data_4B3O
# 
_entry.id   4B3O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4B3O         
PDBE  EBI-53503    
WWPDB D_1290053503 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A30 unspecified 'HIV-1 PROTEASE COMPLEXED WITH A TRIPEPTIDE INHIBITOR' 
PDB 1BV7 unspecified 
;COUNTERACTING HIV-1 PROTEASE DRUG RESISTANCE: STRUCTURAL ANALYSIS OF MUTANT PROTEASES COMPLEXED WITH XV638 AND SD146, CYCLIC UREA AMIDES WITH BROAD SPECIFICITIES
;
PDB 1BV9 unspecified 'HIV-1 PROTEASE (I84V) COMPLEXED WITH XV638 OF DUPONT PHARMACEUTICALS' 
PDB 1BVE unspecified 'HIV-1 PROTEASE-DMP323 COMPLEX IN SOLUTION, NMR, 28 STRUCTURES' 
PDB 1BVG unspecified 'HIV-1 PROTEASE-DMP323 COMPLEX IN SOLUTION, NMR MINIMIZED AVERAGE STRUCTURE' 
PDB 1BWA unspecified 'HIV-1 PROTEASE (V82F/I84V) DOUBLE MUTANT COMPLEXED WITH XV638 OF DUPONT PHARMACEUTICALS' 
PDB 1BWB unspecified 'HIV-1 PROTEASE (V82F/I84V) DOUBLE MUTANT COMPLEXED WITH SD146 OF DUPONT PHARMACEUTICALS' 
PDB 1C0T unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH BM+21.1326' 
PDB 1C0U unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH BM+50.0934' 
PDB 1C1B unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH GCA- 186' 
PDB 1C1C unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH TNK- 6123' 
PDB 1DMP unspecified 'STRUCTURE OF HIV-1 PROTEASE COMPLEX' 
PDB 1DTQ unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH PETT-1 (PETT131A94)' 
PDB 1DTT unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH PETT-2 (PETT130A94)' 
PDB 1E6J unspecified 'CRYSTAL STRUCTURE OF HIV-1 CAPSID PROTEIN (P24) IN COMPLEX WITH FAB13B5' 
PDB 1EP4 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH S-1153' 
PDB 1ESK unspecified 'SOLUTION STRUCTURE OF NCP7 FROM HIV-1' 
PDB 1EX4 unspecified 'HIV-1 INTEGRASE CATALYTIC CORE AND C-TERMINAL DOMAIN' 
PDB 1EXQ unspecified 'CRYSTAL STRUCTURE OF THE HIV-1 INTEGRASE CATALYTIC COREDOMAIN' 
PDB 1FB7 unspecified 
'CRYSTAL STRUCTURE OF AN IN VIVO HIV-1 PROTEASE MUTANT INCOMPLEX WITH SAQUINAVIR: INSIGHTS INTO THE MECHANISMS OFDRUG RESISTANCE' 
PDB 1FK9 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH DMP-266(EFAVIRENZ)' 
PDB 1FKO unspecified 
'CRYSTAL STRUCTURE OF NNRTI RESISTANT K103N MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH DMP-266(EFAVIRENZ)' 
PDB 1FKP unspecified 'CRYSTAL STRUCTURE OF NNRTI RESISTANT K103N MUTANT HIV- 1REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1G6L unspecified '1.9A CRYSTAL STRUCTURE OF TETHERED HIV-1 PROTEASE' 
PDB 1HIV unspecified 'HIV-1 PROTEASE (HIV-1 PR) COMPLEX WITH U75875 (NOA- HIS-CHA-PSI[CH(OH)CH(OH)]VAL-ILE-APY)' 
PDB 1HVH unspecified 'NONPEPTIDE CYCLIC CYANOGUANIDINES AS HIV PROTEASE INHIBITORS' 
PDB 1HVR unspecified 'HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 (HIV-1) PROTEASE COMPLEXED WITH XK263 OF DUPONT MERCK' 
PDB 1HWR unspecified 'MOLECULAR RECOGNITION OF CYCLIC UREA HIV PROTEASE INHIBITORS' 
PDB 1HXB unspecified 'HIV-1 PROTEINASE COMPLEXED WITH RO 31-8959' 
PDB 1JKH unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH DMP-266(EFAVIRENZ)' 
PDB 1JLA unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH TNK-651' 
PDB 1JLB unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1JLC unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH PETT-2' 
PDB 1JLE unspecified 'CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSETRANSCRIPTASE' 
PDB 1JLF unspecified 'CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1JLG unspecified 'CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH UC-781' 
PDB 1JLQ unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH 739W94' 
PDB 1KLM unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH BHAP U- 90152' 
PDB 1LV1 unspecified 'CRYSTAL STRUCTURE ANALYSIS OF THE NON-ACTIVE SITE MUTANT OFTETHERED HIV-1 PROTEASE TO 2.1A RESOLUTION' 
PDB 1LW0 unspecified 'CRYSTAL STRUCTURE OF T215Y MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1LW2 unspecified 'CRYSTAL STRUCTURE OF T215Y MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH 1051U91' 
PDB 1LWC unspecified 'CRYSTAL STRUCTURE OF M184V MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1LWE unspecified 'CRYSTAL STRUCTURE OF M41L/T215Y MUTANT HIV-1 REVERSETRANSCRIPTASE (RTMN) IN COMPLEX WITH NEVIRAPINE' 
PDB 1LWF unspecified 
'CRYSTAL STRUCTURE OF A MUTANT HIV-1 REVERSE TRANSCRIPTASE(RTMQ+M184V: M41L/D67N/K70R/M184V/T215Y) IN COMPLEX WITHNEVIRAPINE' 
PDB 1NCP unspecified . 
PDB 1O1W unspecified 'SOLUTION STRUCTURE OF THE RNASE H DOMAIN OF THE HIV -1REVERSE TRANSCRIPTASE IN THE PRESENCE OF MAGNESIUM' 
PDB 1ODW unspecified 'NATIVE HIV-1 PROTEINASE' 
PDB 1ODY unspecified 'HIV-1 PROTEASE COMPLEXED WITH AN INHIBITOR LP-130' 
PDB 1QBR unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1QBS unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1QBT unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1QBU unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1REV unspecified 'HIV-1 REVERSE TRANSCRIPTASE' 
PDB 1RT1 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH MKC-442' 
PDB 1RT2 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH TNK-651' 
PDB 1RT3 unspecified 'AZT DRUG RESISTANT HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH 1051U91' 
PDB 1RT4 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC781' 
PDB 1RT5 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC10' 
PDB 1RT6 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC38' 
PDB 1RT7 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC84' 
PDB 1RTD unspecified 
'STRUCTURE OF A CATALYTIC COMPLEX OF HIV-1 REVERSE TRANSCRIPTASE: IMPLICATIONS FOR NUCLEOSIDE ANALOG DRUG RESISTANCE' 
PDB 1RTH unspecified . 
PDB 1RTI unspecified . 
PDB 1RTJ unspecified . 
PDB 1S1T unspecified 'CRYSTAL STRUCTURE OF L100I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH UC-781' 
PDB 1S1U unspecified 'CRYSTAL STRUCTURE OF L100I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1S1V unspecified 'CRYSTAL STRUCTURE OF L100I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH TNK-651' 
PDB 1S1W unspecified 'CRYSTAL STRUCTURE OF V106A MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH UC-781' 
PDB 1S1X unspecified 'CRYSTAL STRUCTURE OF V108I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1T05 unspecified 
'HIV-1 REVERSE TRANSCRIPTASE CROSSLINKED TO TEMPLATE- PRIMERWITH TENOFOVIR-DIPHOSPHATE BOUND AS THE INCOMINGNUCLEOTIDE SUBSTRATE' 
PDB 1TAM unspecified 'HUMAN IMMUNODEFICIENCY VIRUS, NMR, MINIMIZED AVERAGE STRUCTURE' 
PDB 1TKT unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW426318' 
PDB 1TKX unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW490745' 
PDB 1TKZ unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW429576' 
PDB 1TL1 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW451211' 
PDB 1TL3 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW450557' 
PDB 1VRT unspecified . 
PDB 1VRU unspecified . 
PDB 2WHH unspecified 'HIV-1 PROTEASE TETHERED DIMER Q-PRODUCT COMPLEX ALONG WITH NUCLEOPHILIC WATER MOLECULE' 
PDB 2WOM unspecified 'CRYSTAL STRUCTURE OF UK-453061 BOUND TO HIV-1 REVERSE TRANSCRIPTASE (K103N).' 
PDB 2WON unspecified 'CRYSTAL STRUCTURE OF UK-453061 BOUND TO HIV-1 REVERSE TRANSCRIPTASE (WILD-TYPE).' 
PDB 3PHV unspecified 'HIV-1 PROTEASE (ISOLATE HXB2)' 
PDB 4B37 unspecified 'STRUCTURES OF HIV-1 RT AND RNA-DNA COMPLEX REVEAL A UNIQUE RT CONFORMATION AND SUBSTRATE INTERFACE' 
PDB 4B3P unspecified 'STRUCTURES OF HIV-1 RT AND RNA-DNA COMPLEX REVEAL A UNIQUE RT CONFORMATION AND SUBSTRATE INTERFACE' 
PDB 4B3Q unspecified 'STRUCTURES OF HIV-1 RT AND RNA-DNA COMPLEX REVEAL A UNIQUE RT CONFORMATION AND SUBSTRATE INTERFACE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4B3O 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-25 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lapkouski, M.'    1 
'Tian, L.'         2 
'Miller, J.T.'     3 
'Le Grice, S.F.J.' 4 
'Yang, W.'         5 
# 
_citation.id                        primary 
_citation.title                     
'Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            20 
_citation.page_first                230 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23314251 
_citation.pdbx_database_id_DOI      10.1038/NSMB.2485 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lapkouski, M.'    1 ? 
primary 'Tian, L.'         2 ? 
primary 'Miller, J.T.'     3 ? 
primary 'Le Grice, S.F.J.' 4 ? 
primary 'Yang, W.'         5 ? 
# 
_cell.entry_id           4B3O 
_cell.length_a           164.598 
_cell.length_b           164.598 
_cell.length_c           129.030 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4B3O 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'REVERSE TRANSCRIPTASE/RIBONUCLEASE H'                                                         64424.840 1 
'2.7.7.49, 2.7.7.7, 3.1.26.13, 3.4.23.16, 3.1.13.2' YES ? ? 
2 polymer     man 'P51 RT'                                                                                       51384.031 1 
'2.7.7.49, 2.7.7.7, 3.1.26.13, 3.4.23.16'           YES ? ? 
3 polymer     syn 
;5'-D(*CP*GP*TP*AP*TP*GP*CP*CP*TP*AP*TP*AP*GP*TP *TP*AP*TP*TP*GP*TP*GP*GP*CP*C)-3'
;
7366.749  1 ?                                                   ?   ? ? 
4 polymer     syn 
;5'-R(*AP*UP*GP*AP*3DRP*GP*GP*CP*CP*AP*CP*AP*AP*UP*AP *AP*CP*UP*AP*UP*AP*GP*GP*CP*AP*UP*A)-3'
;
8539.169  1 ?                                                   ?   ? ? 
5 non-polymer syn '(-)-6-CHLORO-4-CYCLOPROPYLETHYNYL-4-TRIFLUOROMETHYL-1,4-DIHYDRO-2H-3,1-BENZOXAZIN-2-ONE'      315.675   1 ? ?   
? ? 
6 non-polymer syn 'CALCIUM ION'                                                                                  40.078    2 ? ?   
? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'REVERSE TRANSCRIPTASE, EXORIBONUCLEASE H, P66 RT, REVERSE TRANSCRIPTASE P66 SUBUNIT' 
2 'REVERSE TRANSCRIPTASE, REVERSE TRANSCRIPTASE P51 SUBUNIT'                            
3 'PRIMER DNA'                                                                          
4 'TEMPLATE RNA'                                                                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFREL
NKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKIL
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFREL
NKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKIL
;
A ? 
2 'polypeptide(L)'        no no  
;GPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRE
LNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;GPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRE
LNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no no  
;(DC)(DG)(DT)(DA)(DT)(DG)(DC)(DC)(DT)(DA)(DT)(DA)(DG)(DT)(DT)(DA)(DT)(DT)(DG)(DT)
(DG)(DG)(DC)(DC)
;
CGTATGCCTATAGTTATTGTGGCC D ? 
4 polyribonucleotide      no yes 'AUGA(3DR)GGCCACAAUAACUAUAGGCAUA' AUGANGGCCACAAUAACUAUAGGCAUA R ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  GLY n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  LYS n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 ARG n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 GLN n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 CYS n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 VAL n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 SER n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 LYS n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 THR n 
1 469 LEU n 
1 470 THR n 
1 471 ASP n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 HIS n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 GLN n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
1 559 ILE n 
1 560 LEU n 
2 1   GLY n 
2 2   PRO n 
2 3   ILE n 
2 4   SER n 
2 5   PRO n 
2 6   ILE n 
2 7   GLU n 
2 8   THR n 
2 9   VAL n 
2 10  PRO n 
2 11  VAL n 
2 12  LYS n 
2 13  LEU n 
2 14  LYS n 
2 15  PRO n 
2 16  GLY n 
2 17  MET n 
2 18  ASP n 
2 19  GLY n 
2 20  PRO n 
2 21  LYS n 
2 22  VAL n 
2 23  LYS n 
2 24  GLN n 
2 25  TRP n 
2 26  PRO n 
2 27  LEU n 
2 28  THR n 
2 29  GLU n 
2 30  GLU n 
2 31  LYS n 
2 32  ILE n 
2 33  LYS n 
2 34  ALA n 
2 35  LEU n 
2 36  VAL n 
2 37  GLU n 
2 38  ILE n 
2 39  CYS n 
2 40  THR n 
2 41  GLU n 
2 42  MET n 
2 43  GLU n 
2 44  LYS n 
2 45  GLU n 
2 46  GLY n 
2 47  LYS n 
2 48  ILE n 
2 49  SER n 
2 50  LYS n 
2 51  ILE n 
2 52  GLY n 
2 53  PRO n 
2 54  GLU n 
2 55  ASN n 
2 56  PRO n 
2 57  TYR n 
2 58  ASN n 
2 59  THR n 
2 60  PRO n 
2 61  VAL n 
2 62  PHE n 
2 63  ALA n 
2 64  ILE n 
2 65  LYS n 
2 66  LYS n 
2 67  LYS n 
2 68  ASP n 
2 69  GLY n 
2 70  THR n 
2 71  LYS n 
2 72  TRP n 
2 73  ARG n 
2 74  LYS n 
2 75  LEU n 
2 76  VAL n 
2 77  ASP n 
2 78  PHE n 
2 79  ARG n 
2 80  GLU n 
2 81  LEU n 
2 82  ASN n 
2 83  LYS n 
2 84  LYS n 
2 85  THR n 
2 86  GLN n 
2 87  ASP n 
2 88  PHE n 
2 89  TRP n 
2 90  GLU n 
2 91  VAL n 
2 92  GLN n 
2 93  LEU n 
2 94  GLY n 
2 95  ILE n 
2 96  PRO n 
2 97  HIS n 
2 98  PRO n 
2 99  ALA n 
2 100 GLY n 
2 101 LEU n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 LYS n 
2 106 SER n 
2 107 VAL n 
2 108 THR n 
2 109 VAL n 
2 110 LEU n 
2 111 ASP n 
2 112 VAL n 
2 113 GLY n 
2 114 ASP n 
2 115 ALA n 
2 116 TYR n 
2 117 PHE n 
2 118 SER n 
2 119 VAL n 
2 120 PRO n 
2 121 LEU n 
2 122 ASP n 
2 123 GLU n 
2 124 ASP n 
2 125 PHE n 
2 126 ARG n 
2 127 LYS n 
2 128 TYR n 
2 129 THR n 
2 130 ALA n 
2 131 PHE n 
2 132 THR n 
2 133 ILE n 
2 134 PRO n 
2 135 SER n 
2 136 ILE n 
2 137 ASN n 
2 138 ASN n 
2 139 GLU n 
2 140 THR n 
2 141 PRO n 
2 142 GLY n 
2 143 ILE n 
2 144 ARG n 
2 145 TYR n 
2 146 GLN n 
2 147 TYR n 
2 148 ASN n 
2 149 VAL n 
2 150 LEU n 
2 151 PRO n 
2 152 GLN n 
2 153 GLY n 
2 154 TRP n 
2 155 LYS n 
2 156 GLY n 
2 157 SER n 
2 158 PRO n 
2 159 ALA n 
2 160 ILE n 
2 161 PHE n 
2 162 GLN n 
2 163 SER n 
2 164 SER n 
2 165 MET n 
2 166 THR n 
2 167 LYS n 
2 168 ILE n 
2 169 LEU n 
2 170 GLU n 
2 171 PRO n 
2 172 PHE n 
2 173 ARG n 
2 174 LYS n 
2 175 GLN n 
2 176 ASN n 
2 177 PRO n 
2 178 ASP n 
2 179 ILE n 
2 180 VAL n 
2 181 ILE n 
2 182 TYR n 
2 183 GLN n 
2 184 TYR n 
2 185 MET n 
2 186 ASP n 
2 187 ASP n 
2 188 LEU n 
2 189 TYR n 
2 190 VAL n 
2 191 GLY n 
2 192 SER n 
2 193 ASP n 
2 194 LEU n 
2 195 GLU n 
2 196 ILE n 
2 197 GLY n 
2 198 GLN n 
2 199 HIS n 
2 200 ARG n 
2 201 THR n 
2 202 LYS n 
2 203 ILE n 
2 204 GLU n 
2 205 GLU n 
2 206 LEU n 
2 207 ARG n 
2 208 GLN n 
2 209 HIS n 
2 210 LEU n 
2 211 LEU n 
2 212 ARG n 
2 213 TRP n 
2 214 GLY n 
2 215 LEU n 
2 216 THR n 
2 217 THR n 
2 218 PRO n 
2 219 ASP n 
2 220 LYS n 
2 221 LYS n 
2 222 HIS n 
2 223 GLN n 
2 224 LYS n 
2 225 GLU n 
2 226 PRO n 
2 227 PRO n 
2 228 PHE n 
2 229 LEU n 
2 230 TRP n 
2 231 MET n 
2 232 GLY n 
2 233 TYR n 
2 234 GLU n 
2 235 LEU n 
2 236 HIS n 
2 237 PRO n 
2 238 ASP n 
2 239 LYS n 
2 240 TRP n 
2 241 THR n 
2 242 VAL n 
2 243 GLN n 
2 244 PRO n 
2 245 ILE n 
2 246 VAL n 
2 247 LEU n 
2 248 PRO n 
2 249 GLU n 
2 250 LYS n 
2 251 ASP n 
2 252 SER n 
2 253 TRP n 
2 254 THR n 
2 255 VAL n 
2 256 ASN n 
2 257 ASP n 
2 258 ILE n 
2 259 GLN n 
2 260 LYS n 
2 261 LEU n 
2 262 VAL n 
2 263 GLY n 
2 264 LYS n 
2 265 LEU n 
2 266 ASN n 
2 267 TRP n 
2 268 ALA n 
2 269 SER n 
2 270 GLN n 
2 271 ILE n 
2 272 TYR n 
2 273 PRO n 
2 274 GLY n 
2 275 ILE n 
2 276 LYS n 
2 277 VAL n 
2 278 ARG n 
2 279 GLN n 
2 280 LEU n 
2 281 CYS n 
2 282 LYS n 
2 283 LEU n 
2 284 LEU n 
2 285 ARG n 
2 286 GLY n 
2 287 THR n 
2 288 LYS n 
2 289 ALA n 
2 290 LEU n 
2 291 THR n 
2 292 GLU n 
2 293 VAL n 
2 294 ILE n 
2 295 PRO n 
2 296 LEU n 
2 297 THR n 
2 298 GLU n 
2 299 GLU n 
2 300 ALA n 
2 301 GLU n 
2 302 LEU n 
2 303 GLU n 
2 304 LEU n 
2 305 ALA n 
2 306 GLU n 
2 307 ASN n 
2 308 ARG n 
2 309 GLU n 
2 310 ILE n 
2 311 LEU n 
2 312 LYS n 
2 313 GLU n 
2 314 PRO n 
2 315 VAL n 
2 316 HIS n 
2 317 GLY n 
2 318 VAL n 
2 319 TYR n 
2 320 TYR n 
2 321 ASP n 
2 322 PRO n 
2 323 SER n 
2 324 LYS n 
2 325 ASP n 
2 326 LEU n 
2 327 ILE n 
2 328 ALA n 
2 329 GLU n 
2 330 ILE n 
2 331 GLN n 
2 332 LYS n 
2 333 GLN n 
2 334 GLY n 
2 335 GLN n 
2 336 GLY n 
2 337 GLN n 
2 338 TRP n 
2 339 THR n 
2 340 TYR n 
2 341 GLN n 
2 342 ILE n 
2 343 TYR n 
2 344 GLN n 
2 345 GLU n 
2 346 PRO n 
2 347 PHE n 
2 348 LYS n 
2 349 ASN n 
2 350 LEU n 
2 351 LYS n 
2 352 THR n 
2 353 GLY n 
2 354 LYS n 
2 355 TYR n 
2 356 ALA n 
2 357 ARG n 
2 358 MET n 
2 359 ARG n 
2 360 GLY n 
2 361 ALA n 
2 362 HIS n 
2 363 THR n 
2 364 ASN n 
2 365 ASP n 
2 366 VAL n 
2 367 LYS n 
2 368 GLN n 
2 369 LEU n 
2 370 THR n 
2 371 GLU n 
2 372 ALA n 
2 373 VAL n 
2 374 GLN n 
2 375 LYS n 
2 376 ILE n 
2 377 THR n 
2 378 THR n 
2 379 GLU n 
2 380 SER n 
2 381 ILE n 
2 382 VAL n 
2 383 ILE n 
2 384 TRP n 
2 385 GLY n 
2 386 LYS n 
2 387 THR n 
2 388 PRO n 
2 389 LYS n 
2 390 PHE n 
2 391 LYS n 
2 392 LEU n 
2 393 PRO n 
2 394 ILE n 
2 395 GLN n 
2 396 LYS n 
2 397 GLU n 
2 398 THR n 
2 399 TRP n 
2 400 GLU n 
2 401 THR n 
2 402 TRP n 
2 403 TRP n 
2 404 THR n 
2 405 GLU n 
2 406 TYR n 
2 407 TRP n 
2 408 GLN n 
2 409 ALA n 
2 410 THR n 
2 411 TRP n 
2 412 VAL n 
2 413 PRO n 
2 414 GLU n 
2 415 TRP n 
2 416 GLU n 
2 417 PHE n 
2 418 VAL n 
2 419 ASN n 
2 420 THR n 
2 421 PRO n 
2 422 PRO n 
2 423 LEU n 
2 424 VAL n 
2 425 LYS n 
2 426 LEU n 
2 427 TRP n 
2 428 TYR n 
2 429 GLN n 
2 430 LEU n 
2 431 GLU n 
2 432 LYS n 
2 433 GLU n 
2 434 PRO n 
2 435 ILE n 
2 436 VAL n 
2 437 GLY n 
2 438 ALA n 
2 439 GLU n 
2 440 THR n 
2 441 PHE n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
3 5   DT  n 
3 6   DG  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DA  n 
3 11  DT  n 
3 12  DA  n 
3 13  DG  n 
3 14  DT  n 
3 15  DT  n 
3 16  DA  n 
3 17  DT  n 
3 18  DT  n 
3 19  DG  n 
3 20  DT  n 
3 21  DG  n 
3 22  DG  n 
3 23  DC  n 
3 24  DC  n 
4 1   A   n 
4 2   U   n 
4 3   G   n 
4 4   A   n 
4 5   3DR n 
4 6   G   n 
4 7   G   n 
4 8   C   n 
4 9   C   n 
4 10  A   n 
4 11  C   n 
4 12  A   n 
4 13  A   n 
4 14  U   n 
4 15  A   n 
4 16  A   n 
4 17  C   n 
4 18  U   n 
4 19  A   n 
4 20  U   n 
4 21  A   n 
4 22  G   n 
4 23  G   n 
4 24  C   n 
4 25  A   n 
4 26  U   n 
4 27  A   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HIV-1 ? ? ? ? ? ? ? ? 'HUMAN IMMUNODEFICIENCY VIRUS 1' 11676 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 1007065 ? ? ? ? ? 
? M15PDMI.1 ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
2 1 sample ? ? ? HIV-1 ? ? ? ? ? ? ? ? 'HUMAN IMMUNODEFICIENCY VIRUS 1' 11676 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 1007065 ? ? ? ? ? 
? M15PDMI.1 ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
4 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP POL_HV1H2 1 ? ? P04585 ? 
2 UNP POL_HV1H2 2 ? ? P04585 ? 
3 PDB 4B3O      3 ? ? 4B3O   ? 
4 PDB 4B3O      4 ? ? 4B3O   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4B3O A 1 ? 560 ? P04585 588 ? 1147 ? 1 560 
2 2 4B3O B 2 ? 441 ? P04585 588 ? 1027 ? 1 440 
3 3 4B3O D 1 ? 24  ? 4B3O   0   ? 23   ? 0 23  
4 4 4B3O R 1 ? 27  ? 4B3O   1   ? 27   ? 1 27  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4B3O GLY A 68  ? UNP P04585 SER 655  'engineered mutation' 68  1  
1 4B3O LYS A 83  ? UNP P04585 ARG 670  'engineered mutation' 83  2  
1 4B3O VAL A 411 ? UNP P04585 ILE 998  'engineered mutation' 411 3  
1 4B3O SER A 447 ? UNP P04585 ASN 1034 'engineered mutation' 447 4  
1 4B3O LYS A 461 ? UNP P04585 ARG 1048 'engineered mutation' 461 5  
1 4B3O HIS A 483 ? UNP P04585 TYR 1070 'engineered mutation' 483 6  
1 4B3O ILE A 559 ? UNP P04585 VAL 1146 'engineered mutation' 559 7  
2 4B3O GLY B 1   ? UNP P04585 ?   ?    'expression tag'      0   8  
2 4B3O GLY B 69  ? UNP P04585 SER 655  'engineered mutation' 68  9  
2 4B3O LYS B 84  ? UNP P04585 ARG 670  'engineered mutation' 83  10 
2 4B3O VAL B 412 ? UNP P04585 ILE 998  'engineered mutation' 411 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE"                                                  
'ABASIC DIDEOXYRIBOSE' 'C5 H11 O6 P'       198.111 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                                                              ? 
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                                                                   ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                  ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                           ? 'C4 H7 N O4' 
133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                                                               ? 
'C9 H14 N3 O8 P'    323.197 
CA  non-polymer         . 'CALCIUM ION'                                                                             ? 'Ca 2' 
40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                                  ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                      ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                       ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                      ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                              ? 
'C10 H15 N2 O8 P'   322.208 
EFZ non-polymer         . '(-)-6-CHLORO-4-CYCLOPROPYLETHYNYL-4-TRIFLUOROMETHYL-1,4-DIHYDRO-2H-3,1-BENZOXAZIN-2-ONE' 
'DMP-266; Efavirenz'   'C14 H9 Cl F3 N O2' 315.675 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                                                              ? 
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                                                                 ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                           ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                   ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                 ? 
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                   ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                    ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                ? 
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                             ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                   ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                    ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                 ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                  ? 
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                                                                ? 
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                                                                    ? 
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4B3O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.68 
_exptl_crystal.density_percent_sol   70.2 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;RT COMPLEX WAS MIXED WITH RESERVOIR SOLUTION CONTAINING 0.1M SODIUM CITRATE (PH5.2), 0.1M CACL2, 7.5% PEG400 (V/V). VAPOR DIFFUSION 4C.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARRESEARCH MX-300' 
_diffrn_detector.pdbx_collection_date   2010-07-10 
_diffrn_detector.details                'MIRRORS VERTICAL FOCUSING' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL - LIQUID NITROGEN COOLED' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4B3O 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            3.30 
_reflns.number_obs                   30196 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.07 
_reflns.pdbx_netI_over_sigmaI        17.50 
_reflns.B_iso_Wilson_estimate        100.08 
_reflns.pdbx_redundancy              4.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.30 
_reflns_shell.d_res_low              3.39 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.72 
_reflns_shell.meanI_over_sigI_obs    2.30 
_reflns_shell.pdbx_redundancy        4.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4B3O 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30184 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.733 
_refine.ls_d_res_high                            3.300 
_refine.ls_percent_reflns_obs                    98.36 
_refine.ls_R_factor_obs                          0.2758 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2748 
_refine.ls_R_factor_R_free                       0.2954 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1515 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               80.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.27 
_refine.solvent_model_param_bsol                 47.51 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1RTD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.50 
_refine.pdbx_overall_phase_error                 33.35 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7543 
_refine_hist.pdbx_number_atoms_nucleic_acid   947 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8513 
_refine_hist.d_res_high                       3.300 
_refine_hist.d_res_low                        29.733 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 8823  'X-RAY DIFFRACTION' ? 
f_angle_d          0.875  ? ? 12229 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.894 ? ? 3339  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.060  ? ? 1382  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1386  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.3000 3.4064  2621 0.3849 100.00 0.4035 . . 130 . . 
'X-RAY DIFFRACTION' . 3.4064 3.5279  2582 0.3550 100.00 0.4074 . . 159 . . 
'X-RAY DIFFRACTION' . 3.5279 3.6690  2633 0.3454 100.00 0.3855 . . 136 . . 
'X-RAY DIFFRACTION' . 3.6690 3.8356  2587 0.3254 99.00  0.3599 . . 146 . . 
'X-RAY DIFFRACTION' . 3.8356 4.0374  2624 0.3175 99.00  0.2979 . . 124 . . 
'X-RAY DIFFRACTION' . 4.0374 4.2896  2621 0.3003 99.00  0.2775 . . 126 . . 
'X-RAY DIFFRACTION' . 4.2896 4.6197  2577 0.2735 99.00  0.3359 . . 149 . . 
'X-RAY DIFFRACTION' . 4.6197 5.0825  2591 0.2637 98.00  0.3116 . . 142 . . 
'X-RAY DIFFRACTION' . 5.0825 5.8132  2597 0.2664 97.00  0.2860 . . 142 . . 
'X-RAY DIFFRACTION' . 5.8132 7.3060  2598 0.2695 97.00  0.3057 . . 130 . . 
'X-RAY DIFFRACTION' . 7.3060 29.7343 2638 0.2073 95.00  0.2006 . . 131 . . 
# 
_struct.entry_id                  4B3O 
_struct.title                     
'Structures of HIV-1 RT and RNA-DNA Complex Reveal a Unique RT Conformation and Substrate Interface' 
_struct.pdbx_descriptor           
;REVERSE TRANSCRIPTASE/RIBONUCLEASE H (E.C.2.7.7.49, 2.7.7.7, 3.1.26.13, 3.4.23.16, 3.1.13.2), P51 RT (E.C.2.7.7.49, 2.7.7.7, 3.1.26.13, 3.4.23.16)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4B3O 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA/RNA 
_struct_keywords.text            'HYDROLASE-DNA-RNA COMPLEX, RNASE H, SUBUNIT INTERFACE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 30  ? GLY A 45  ? LYS A 30  GLY A 45  1 ? 16 
HELX_P HELX_P2  2  PHE A 77  ? THR A 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  3  ASP A 113 ? VAL A 118 ? ASP A 113 VAL A 118 1 ? 6  
HELX_P HELX_P4  4  PHE A 124 ? ALA A 129 ? PHE A 124 ALA A 129 5 ? 6  
HELX_P HELX_P5  5  GLY A 155 ? ASN A 175 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P6  6  GLU A 194 ? ARG A 211 ? GLU A 194 ARG A 211 1 ? 18 
HELX_P HELX_P7  7  THR A 253 ? SER A 268 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P8  8  VAL A 276 ? LEU A 283 ? VAL A 276 LEU A 283 1 ? 8  
HELX_P HELX_P9  9  THR A 296 ? LEU A 310 ? THR A 296 LEU A 310 1 ? 15 
HELX_P HELX_P10 10 ASP A 364 ? TRP A 383 ? ASP A 364 TRP A 383 1 ? 20 
HELX_P HELX_P11 11 GLN A 394 ? TYR A 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P12 12 THR A 473 ? ASP A 488 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P13 13 SER A 499 ? GLN A 507 ? SER A 499 GLN A 507 1 ? 9  
HELX_P HELX_P14 14 GLU A 516 ? LYS A 528 ? GLU A 516 LYS A 528 1 ? 13 
HELX_P HELX_P15 15 GLY A 544 ? SER A 553 ? GLY A 544 SER A 553 1 ? 10 
HELX_P HELX_P16 16 THR B 28  ? GLU B 45  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P17 17 PHE B 78  ? THR B 85  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P18 18 THR B 85  ? VAL B 91  ? THR B 84  VAL B 90  1 ? 7  
HELX_P HELX_P19 19 GLY B 113 ? TYR B 116 ? GLY B 112 TYR B 115 5 ? 4  
HELX_P HELX_P20 20 ASP B 122 ? ALA B 130 ? ASP B 121 ALA B 129 5 ? 9  
HELX_P HELX_P21 21 SER B 135 ? GLU B 139 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P22 22 LYS B 155 ? THR B 166 ? LYS B 154 THR B 165 1 ? 12 
HELX_P HELX_P23 23 LEU B 169 ? ASN B 176 ? LEU B 168 ASN B 175 1 ? 8  
HELX_P HELX_P24 24 GLU B 195 ? GLY B 214 ? GLU B 194 GLY B 213 1 ? 20 
HELX_P HELX_P25 25 HIS B 236 ? TRP B 240 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P26 26 THR B 254 ? ALA B 268 ? THR B 253 ALA B 267 1 ? 15 
HELX_P HELX_P27 27 VAL B 277 ? LYS B 282 ? VAL B 276 LYS B 281 1 ? 6  
HELX_P HELX_P28 28 THR B 297 ? GLU B 313 ? THR B 296 GLU B 312 1 ? 17 
HELX_P HELX_P29 29 ASN B 364 ? TRP B 384 ? ASN B 363 TRP B 383 1 ? 21 
HELX_P HELX_P30 30 GLN B 395 ? TRP B 403 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P31 31 PRO B 421 ? TYR B 428 ? PRO B 420 TYR B 427 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? D 3DR 5  P     ? ? ? 1_555 D A 4  "O3'" ? ? R 3DR 5  R A 4  1_555 ? ? ? ? ? ? ?            1.610 ? 
covale2  covale both ? D 3DR 5  "O3'" ? ? ? 1_555 D G 6  P     ? ? R 3DR 5  R G 6  1_555 ? ? ? ? ? ? ?            1.619 ? 
hydrog1  hydrog ?    ? C DT  3  N3    ? ? ? 1_555 D A 27 N1    ? ? D DT  2  R A 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DT  3  O4    ? ? ? 1_555 D A 27 N6    ? ? D DT  2  R A 27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DA  4  N1    ? ? ? 1_555 D U 26 N3    ? ? D DA  3  R U 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DA  4  N6    ? ? ? 1_555 D U 26 O4    ? ? D DA  3  R U 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DT  5  N3    ? ? ? 1_555 D A 25 N1    ? ? D DT  4  R A 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DT  5  O4    ? ? ? 1_555 D A 25 N6    ? ? D DT  4  R A 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DG  6  N1    ? ? ? 1_555 D C 24 N3    ? ? D DG  5  R C 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DG  6  N2    ? ? ? 1_555 D C 24 O2    ? ? D DG  5  R C 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DG  6  O6    ? ? ? 1_555 D C 24 N4    ? ? D DG  5  R C 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DC  7  N3    ? ? ? 1_555 D G 23 N1    ? ? D DC  6  R G 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DC  7  N4    ? ? ? 1_555 D G 23 O6    ? ? D DC  6  R G 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DC  7  O2    ? ? ? 1_555 D G 23 N2    ? ? D DC  6  R G 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DC  8  N3    ? ? ? 1_555 D G 22 N1    ? ? D DC  7  R G 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DC  8  N4    ? ? ? 1_555 D G 22 O6    ? ? D DC  7  R G 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DC  8  O2    ? ? ? 1_555 D G 22 N2    ? ? D DC  7  R G 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DT  9  N3    ? ? ? 1_555 D A 21 N1    ? ? D DT  8  R A 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DT  9  O4    ? ? ? 1_555 D A 21 N6    ? ? D DT  8  R A 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DA  10 N1    ? ? ? 1_555 D U 20 N3    ? ? D DA  9  R U 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DA  10 N6    ? ? ? 1_555 D U 20 O4    ? ? D DA  9  R U 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  11 N3    ? ? ? 1_555 D A 19 N1    ? ? D DT  10 R A 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DT  11 O4    ? ? ? 1_555 D A 19 N6    ? ? D DT  10 R A 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DA  12 N1    ? ? ? 1_555 D U 18 N3    ? ? D DA  11 R U 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DA  12 N6    ? ? ? 1_555 D U 18 O4    ? ? D DA  11 R U 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DG  13 N1    ? ? ? 1_555 D C 17 N3    ? ? D DG  12 R C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DG  13 N2    ? ? ? 1_555 D C 17 O2    ? ? D DG  12 R C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DG  13 O6    ? ? ? 1_555 D C 17 N4    ? ? D DG  12 R C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DT  14 N3    ? ? ? 1_555 D A 16 N1    ? ? D DT  13 R A 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DT  14 O4    ? ? ? 1_555 D A 16 N6    ? ? D DT  13 R A 16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DT  15 N3    ? ? ? 1_555 D A 15 N1    ? ? D DT  14 R A 15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DT  15 O4    ? ? ? 1_555 D A 15 N6    ? ? D DT  14 R A 15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DA  16 N1    ? ? ? 1_555 D U 14 N3    ? ? D DA  15 R U 14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? C DA  16 N6    ? ? ? 1_555 D U 14 O4    ? ? D DA  15 R U 14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? C DT  17 N3    ? ? ? 1_555 D A 13 N1    ? ? D DT  16 R A 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? C DT  17 O4    ? ? ? 1_555 D A 13 N6    ? ? D DT  16 R A 13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? C DT  18 N3    ? ? ? 1_555 D A 12 N1    ? ? D DT  17 R A 12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? C DT  18 O4    ? ? ? 1_555 D A 12 N6    ? ? D DT  17 R A 12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? C DG  19 N1    ? ? ? 1_555 D C 11 N3    ? ? D DG  18 R C 11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? C DG  19 N2    ? ? ? 1_555 D C 11 O2    ? ? D DG  18 R C 11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? C DG  19 O6    ? ? ? 1_555 D C 11 N4    ? ? D DG  18 R C 11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? C DT  20 N3    ? ? ? 1_555 D A 10 N1    ? ? D DT  19 R A 10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? C DT  20 O4    ? ? ? 1_555 D A 10 N6    ? ? D DT  19 R A 10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? C DG  21 N1    ? ? ? 1_555 D C 9  N3    ? ? D DG  20 R C 9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? C DG  21 N2    ? ? ? 1_555 D C 9  O2    ? ? D DG  20 R C 9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? C DG  21 O6    ? ? ? 1_555 D C 9  N4    ? ? D DG  20 R C 9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? C DG  22 N1    ? ? ? 1_555 D C 8  N3    ? ? D DG  21 R C 8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? C DG  22 N2    ? ? ? 1_555 D C 8  O2    ? ? D DG  21 R C 8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? C DG  22 O6    ? ? ? 1_555 D C 8  N4    ? ? D DG  21 R C 8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? C DC  23 N3    ? ? ? 1_555 D G 7  N1    ? ? D DC  22 R G 7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? C DC  23 N4    ? ? ? 1_555 D G 7  O6    ? ? D DC  22 R G 7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? C DC  23 O2    ? ? ? 1_555 D G 7  N2    ? ? D DC  22 R G 7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? C DC  24 N3    ? ? ? 1_555 D G 6  N1    ? ? D DC  23 R G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? C DC  24 N4    ? ? ? 1_555 D G 6  O6    ? ? D DC  23 R G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? C DC  24 O2    ? ? ? 1_555 D G 6  N2    ? ? D DC  23 R G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 3 ? 
AC ? 4 ? 
AD ? 5 ? 
AE ? 5 ? 
BA ? 3 ? 
BB ? 2 ? 
BC ? 3 ? 
BD ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? parallel      
AD 4 5 ? parallel      
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? parallel      
AE 4 5 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? parallel      
BD 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 47  ? ILE A 50  ? ILE A 47  ILE A 50  
AA 2 ARG A 143 ? TYR A 146 ? ARG A 143 TYR A 146 
AA 3 PHE A 130 ? THR A 131 ? PHE A 130 THR A 131 
AB 1 SER A 105 ? ASP A 110 ? SER A 105 ASP A 110 
AB 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
AB 3 VAL A 179 ? TYR A 183 ? VAL A 179 TYR A 183 
AC 1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
AC 2 TYR A 232 ? LEU A 234 ? TYR A 232 LEU A 234 
AC 3 LYS A 238 ? VAL A 241 ? LYS A 238 VAL A 241 
AC 4 GLY A 316 ? VAL A 317 ? GLY A 316 VAL A 317 
AD 1 LYS A 347 ? THR A 351 ? LYS A 347 THR A 351 
AD 2 GLN A 336 ? GLU A 344 ? GLN A 336 GLU A 344 
AD 3 ILE A 326 ? GLY A 333 ? ILE A 326 GLY A 333 
AD 4 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
AD 5 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
AE 1 GLN A 464 ? THR A 470 ? GLN A 464 THR A 470 
AE 2 LEU A 452 ? THR A 459 ? LEU A 452 THR A 459 
AE 3 GLU A 438 ? SER A 447 ? GLU A 438 SER A 447 
AE 4 VAL A 493 ? THR A 497 ? VAL A 493 THR A 497 
AE 5 VAL A 531 ? TRP A 535 ? VAL A 531 TRP A 535 
BA 1 ILE B 48  ? LYS B 50  ? ILE B 47  LYS B 49  
BA 2 ILE B 143 ? TYR B 147 ? ILE B 142 TYR B 146 
BA 3 PHE B 131 ? ILE B 133 ? PHE B 130 ILE B 132 
BB 1 VAL B 61  ? LYS B 65  ? VAL B 60  LYS B 64  
BB 2 TRP B 72  ? VAL B 76  ? TRP B 71  VAL B 75  
BC 1 SER B 106 ? ASP B 111 ? SER B 105 ASP B 110 
BC 2 ASP B 187 ? SER B 192 ? ASP B 186 SER B 191 
BC 3 VAL B 180 ? TYR B 184 ? VAL B 179 TYR B 183 
BD 1 LYS B 348 ? TYR B 355 ? LYS B 347 TYR B 354 
BD 2 TRP B 338 ? GLU B 345 ? TRP B 337 GLU B 344 
BD 3 ILE B 327 ? LYS B 332 ? ILE B 326 LYS B 331 
BD 4 LYS B 389 ? LEU B 392 ? LYS B 388 LEU B 391 
BD 5 TRP B 415 ? PHE B 417 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 50  ? N ILE A 50  O ARG A 143 ? O ARG A 143 
AA 2 3 N TYR A 144 ? N TYR A 144 O PHE A 130 ? O PHE A 130 
AB 1 2 N LEU A 109 ? N LEU A 109 O LEU A 187 ? O LEU A 187 
AB 2 3 N GLY A 190 ? N GLY A 190 O VAL A 179 ? O VAL A 179 
AC 1 2 N TRP A 229 ? N TRP A 229 O TYR A 232 ? O TYR A 232 
AC 2 3 N GLU A 233 ? N GLU A 233 O THR A 240 ? O THR A 240 
AC 3 4 N TRP A 239 ? N TRP A 239 O GLY A 316 ? O GLY A 316 
AD 1 2 N LEU A 349 ? N LEU A 349 O ILE A 341 ? O ILE A 341 
AD 2 3 N TYR A 342 ? N TYR A 342 O ILE A 326 ? O ILE A 326 
AD 3 4 N ALA A 327 ? N ALA A 327 O LYS A 388 ? O LYS A 388 
AD 4 5 N LEU A 391 ? N LEU A 391 O GLU A 415 ? O GLU A 415 
AE 1 2 N LEU A 469 ? N LEU A 469 O GLY A 453 ? O GLY A 453 
AE 2 3 N VAL A 458 ? N VAL A 458 O TYR A 441 ? O TYR A 441 
AE 3 4 N PHE A 440 ? N PHE A 440 O ASN A 494 ? O ASN A 494 
AE 4 5 N ILE A 495 ? N ILE A 495 O TYR A 532 ? O TYR A 532 
BA 1 2 N SER B 49  ? N SER B 48  O GLN B 146 ? O GLN B 145 
BA 2 3 N TYR B 145 ? N TYR B 144 O PHE B 131 ? O PHE B 130 
BB 1 2 N ILE B 64  ? N ILE B 63  O ARG B 73  ? O ARG B 72  
BC 1 2 N LEU B 110 ? N LEU B 109 O LEU B 188 ? O LEU B 187 
BC 2 3 N GLY B 191 ? N GLY B 190 O VAL B 180 ? O VAL B 179 
BD 1 2 N TYR B 355 ? N TYR B 354 O TRP B 338 ? O TRP B 337 
BD 2 3 N TYR B 343 ? N TYR B 342 O ILE B 327 ? O ILE B 326 
BD 3 4 N ALA B 328 ? N ALA B 327 O LYS B 389 ? O LYS B 388 
BD 4 5 N LEU B 392 ? N LEU B 391 O GLU B 416 ? O GLU B 415 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    9 
_struct_site.details              'BINDING SITE FOR RESIDUE EFZ A 1557' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 9 LEU A 100 ? LEU A 100 . ? 1_555 ? 
2 AC1 9 LYS A 101 ? LYS A 101 . ? 1_555 ? 
3 AC1 9 VAL A 106 ? VAL A 106 . ? 1_555 ? 
4 AC1 9 VAL A 179 ? VAL A 179 . ? 1_555 ? 
5 AC1 9 TYR A 181 ? TYR A 181 . ? 1_555 ? 
6 AC1 9 TYR A 188 ? TYR A 188 . ? 1_555 ? 
7 AC1 9 GLY A 190 ? GLY A 190 . ? 1_555 ? 
8 AC1 9 PHE A 227 ? PHE A 227 . ? 1_555 ? 
9 AC1 9 TYR A 318 ? TYR A 318 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4B3O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4B3O 
_atom_sites.fract_transf_matrix[1][1]   0.006075 
_atom_sites.fract_transf_matrix[1][2]   0.003508 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007015 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007750 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
F  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 4   ? -62.315  -62.643 -5.519  1.00 100.20 ? 4    PRO A N     1 
ATOM   2    C  CA    . PRO A 1 4   ? -61.373  -61.942 -4.649  1.00 110.90 ? 4    PRO A CA    1 
ATOM   3    C  C     . PRO A 1 4   ? -61.730  -60.460 -4.495  1.00 108.42 ? 4    PRO A C     1 
ATOM   4    O  O     . PRO A 1 4   ? -60.863  -59.592 -4.628  1.00 100.29 ? 4    PRO A O     1 
ATOM   5    C  CB    . PRO A 1 4   ? -60.037  -62.112 -5.380  1.00 108.66 ? 4    PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 4   ? -60.410  -62.247 -6.817  1.00 109.01 ? 4    PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 4   ? -61.735  -62.955 -6.838  1.00 95.73  ? 4    PRO A CD    1 
ATOM   8    N  N     . ILE A 1 5   ? -62.999  -60.187 -4.196  1.00 100.75 ? 5    ILE A N     1 
ATOM   9    C  CA    . ILE A 1 5   ? -63.508  -58.815 -4.117  1.00 92.16  ? 5    ILE A CA    1 
ATOM   10   C  C     . ILE A 1 5   ? -63.325  -58.163 -2.740  1.00 92.60  ? 5    ILE A C     1 
ATOM   11   O  O     . ILE A 1 5   ? -64.049  -57.226 -2.392  1.00 92.16  ? 5    ILE A O     1 
ATOM   12   C  CB    . ILE A 1 5   ? -64.989  -58.744 -4.546  1.00 82.75  ? 5    ILE A CB    1 
ATOM   13   N  N     . GLU A 1 6   ? -62.347  -58.663 -1.981  1.00 90.63  ? 6    GLU A N     1 
ATOM   14   C  CA    . GLU A 1 6   ? -61.918  -58.114 -0.676  1.00 83.49  ? 6    GLU A CA    1 
ATOM   15   C  C     . GLU A 1 6   ? -63.015  -57.535 0.235   1.00 75.03  ? 6    GLU A C     1 
ATOM   16   O  O     . GLU A 1 6   ? -63.459  -56.396 0.059   1.00 81.66  ? 6    GLU A O     1 
ATOM   17   C  CB    . GLU A 1 6   ? -60.739  -57.133 -0.844  1.00 95.13  ? 6    GLU A CB    1 
ATOM   18   C  CG    . GLU A 1 6   ? -60.941  -56.020 -1.868  1.00 100.26 ? 6    GLU A CG    1 
ATOM   19   C  CD    . GLU A 1 6   ? -59.639  -55.396 -2.345  1.00 106.43 ? 6    GLU A CD    1 
ATOM   20   O  OE1   . GLU A 1 6   ? -58.602  -55.552 -1.665  1.00 113.98 ? 6    GLU A OE1   1 
ATOM   21   O  OE2   . GLU A 1 6   ? -59.655  -54.745 -3.411  1.00 102.23 ? 6    GLU A OE2   1 
ATOM   22   N  N     . THR A 1 7   ? -63.430  -58.334 1.217   1.00 73.60  ? 7    THR A N     1 
ATOM   23   C  CA    . THR A 1 7   ? -64.479  -57.945 2.164   1.00 72.69  ? 7    THR A CA    1 
ATOM   24   C  C     . THR A 1 7   ? -64.014  -56.855 3.129   1.00 74.65  ? 7    THR A C     1 
ATOM   25   O  O     . THR A 1 7   ? -62.883  -56.886 3.620   1.00 75.80  ? 7    THR A O     1 
ATOM   26   C  CB    . THR A 1 7   ? -64.992  -59.150 2.981   1.00 69.78  ? 7    THR A CB    1 
ATOM   27   O  OG1   . THR A 1 7   ? -63.886  -59.828 3.590   1.00 79.72  ? 7    THR A OG1   1 
ATOM   28   C  CG2   . THR A 1 7   ? -65.755  -60.124 2.092   1.00 77.13  ? 7    THR A CG2   1 
ATOM   29   N  N     . VAL A 1 8   ? -64.901  -55.898 3.391   1.00 76.21  ? 8    VAL A N     1 
ATOM   30   C  CA    . VAL A 1 8   ? -64.622  -54.795 4.309   1.00 63.26  ? 8    VAL A CA    1 
ATOM   31   C  C     . VAL A 1 8   ? -65.184  -55.115 5.699   1.00 68.07  ? 8    VAL A C     1 
ATOM   32   O  O     . VAL A 1 8   ? -66.381  -55.387 5.832   1.00 66.60  ? 8    VAL A O     1 
ATOM   33   C  CB    . VAL A 1 8   ? -65.195  -53.457 3.780   1.00 58.16  ? 8    VAL A CB    1 
ATOM   34   C  CG1   . VAL A 1 8   ? -65.034  -52.344 4.807   1.00 58.06  ? 8    VAL A CG1   1 
ATOM   35   C  CG2   . VAL A 1 8   ? -64.523  -53.068 2.471   1.00 76.64  ? 8    VAL A CG2   1 
ATOM   36   N  N     . PRO A 1 9   ? -64.318  -55.096 6.734   1.00 68.74  ? 9    PRO A N     1 
ATOM   37   C  CA    . PRO A 1 9   ? -64.735  -55.370 8.114   1.00 59.36  ? 9    PRO A CA    1 
ATOM   38   C  C     . PRO A 1 9   ? -65.705  -54.320 8.662   1.00 60.13  ? 9    PRO A C     1 
ATOM   39   O  O     . PRO A 1 9   ? -65.370  -53.134 8.728   1.00 67.48  ? 9    PRO A O     1 
ATOM   40   C  CB    . PRO A 1 9   ? -63.414  -55.356 8.897   1.00 56.29  ? 9    PRO A CB    1 
ATOM   41   C  CG    . PRO A 1 9   ? -62.464  -54.583 8.047   1.00 48.51  ? 9    PRO A CG    1 
ATOM   42   C  CD    . PRO A 1 9   ? -62.862  -54.881 6.634   1.00 70.27  ? 9    PRO A CD    1 
ATOM   43   N  N     . VAL A 1 10  ? -66.901  -54.768 9.037   1.00 55.97  ? 10   VAL A N     1 
ATOM   44   C  CA    . VAL A 1 10  ? -67.955  -53.883 9.539   1.00 60.77  ? 10   VAL A CA    1 
ATOM   45   C  C     . VAL A 1 10  ? -68.462  -54.367 10.900  1.00 64.31  ? 10   VAL A C     1 
ATOM   46   O  O     . VAL A 1 10  ? -68.772  -55.549 11.073  1.00 70.02  ? 10   VAL A O     1 
ATOM   47   C  CB    . VAL A 1 10  ? -69.135  -53.774 8.538   1.00 65.77  ? 10   VAL A CB    1 
ATOM   48   C  CG1   . VAL A 1 10  ? -70.265  -52.926 9.107   1.00 63.29  ? 10   VAL A CG1   1 
ATOM   49   C  CG2   . VAL A 1 10  ? -68.667  -53.197 7.209   1.00 64.75  ? 10   VAL A CG2   1 
ATOM   50   N  N     . LYS A 1 11  ? -68.533  -53.444 11.857  1.00 59.82  ? 11   LYS A N     1 
ATOM   51   C  CA    . LYS A 1 11  ? -69.060  -53.730 13.191  1.00 62.39  ? 11   LYS A CA    1 
ATOM   52   C  C     . LYS A 1 11  ? -70.329  -52.918 13.467  1.00 66.25  ? 11   LYS A C     1 
ATOM   53   O  O     . LYS A 1 11  ? -70.764  -52.129 12.626  1.00 67.47  ? 11   LYS A O     1 
ATOM   54   C  CB    . LYS A 1 11  ? -67.996  -53.442 14.255  1.00 50.70  ? 11   LYS A CB    1 
ATOM   55   N  N     . LEU A 1 12  ? -70.921  -53.126 14.641  1.00 68.16  ? 12   LEU A N     1 
ATOM   56   C  CA    . LEU A 1 12  ? -72.117  -52.391 15.057  1.00 66.72  ? 12   LEU A CA    1 
ATOM   57   C  C     . LEU A 1 12  ? -71.777  -51.267 16.036  1.00 77.87  ? 12   LEU A C     1 
ATOM   58   O  O     . LEU A 1 12  ? -70.612  -51.072 16.392  1.00 80.70  ? 12   LEU A O     1 
ATOM   59   C  CB    . LEU A 1 12  ? -73.142  -53.341 15.690  1.00 63.62  ? 12   LEU A CB    1 
ATOM   60   C  CG    . LEU A 1 12  ? -73.907  -54.335 14.811  1.00 63.88  ? 12   LEU A CG    1 
ATOM   61   C  CD1   . LEU A 1 12  ? -74.583  -55.377 15.688  1.00 64.72  ? 12   LEU A CD1   1 
ATOM   62   C  CD2   . LEU A 1 12  ? -74.932  -53.640 13.926  1.00 68.09  ? 12   LEU A CD2   1 
ATOM   63   N  N     . LYS A 1 13  ? -72.804  -50.529 16.459  1.00 79.88  ? 13   LYS A N     1 
ATOM   64   C  CA    . LYS A 1 13  ? -72.659  -49.497 17.486  1.00 83.65  ? 13   LYS A CA    1 
ATOM   65   C  C     . LYS A 1 13  ? -72.404  -50.134 18.859  1.00 87.04  ? 13   LYS A C     1 
ATOM   66   O  O     . LYS A 1 13  ? -72.907  -51.227 19.131  1.00 87.15  ? 13   LYS A O     1 
ATOM   67   C  CB    . LYS A 1 13  ? -73.890  -48.583 17.514  1.00 91.57  ? 13   LYS A CB    1 
ATOM   68   C  CG    . LYS A 1 13  ? -73.948  -47.599 16.354  1.00 78.91  ? 13   LYS A CG    1 
ATOM   69   C  CD    . LYS A 1 13  ? -75.019  -46.540 16.567  1.00 82.50  ? 13   LYS A CD    1 
ATOM   70   C  CE    . LYS A 1 13  ? -75.074  -45.555 15.409  1.00 72.34  ? 13   LYS A CE    1 
ATOM   71   N  NZ    . LYS A 1 13  ? -73.884  -44.660 15.360  1.00 81.11  ? 13   LYS A NZ    1 
ATOM   72   N  N     . PRO A 1 14  ? -71.621  -49.451 19.722  1.00 83.57  ? 14   PRO A N     1 
ATOM   73   C  CA    . PRO A 1 14  ? -71.071  -50.008 20.968  1.00 78.64  ? 14   PRO A CA    1 
ATOM   74   C  C     . PRO A 1 14  ? -72.021  -50.826 21.853  1.00 83.86  ? 14   PRO A C     1 
ATOM   75   O  O     . PRO A 1 14  ? -71.655  -51.926 22.274  1.00 96.98  ? 14   PRO A O     1 
ATOM   76   C  CB    . PRO A 1 14  ? -70.594  -48.763 21.721  1.00 80.96  ? 14   PRO A CB    1 
ATOM   77   C  CG    . PRO A 1 14  ? -70.213  -47.816 20.640  1.00 85.92  ? 14   PRO A CG    1 
ATOM   78   C  CD    . PRO A 1 14  ? -71.203  -48.046 19.533  1.00 82.57  ? 14   PRO A CD    1 
ATOM   79   N  N     . GLY A 1 15  ? -73.218  -50.309 22.127  1.00 81.65  ? 15   GLY A N     1 
ATOM   80   C  CA    . GLY A 1 15  ? -74.079  -50.904 23.151  1.00 93.51  ? 15   GLY A CA    1 
ATOM   81   C  C     . GLY A 1 15  ? -75.447  -51.418 22.742  1.00 96.82  ? 15   GLY A C     1 
ATOM   82   O  O     . GLY A 1 15  ? -76.439  -51.136 23.419  1.00 101.30 ? 15   GLY A O     1 
ATOM   83   N  N     . MET A 1 16  ? -75.503  -52.178 21.647  1.00 90.75  ? 16   MET A N     1 
ATOM   84   C  CA    . MET A 1 16  ? -76.742  -52.847 21.217  1.00 92.45  ? 16   MET A CA    1 
ATOM   85   C  C     . MET A 1 16  ? -76.517  -53.953 20.184  1.00 91.21  ? 16   MET A C     1 
ATOM   86   O  O     . MET A 1 16  ? -75.668  -53.828 19.298  1.00 92.71  ? 16   MET A O     1 
ATOM   87   C  CB    . MET A 1 16  ? -77.792  -51.844 20.707  1.00 90.38  ? 16   MET A CB    1 
ATOM   88   C  CG    . MET A 1 16  ? -77.292  -50.824 19.696  1.00 91.47  ? 16   MET A CG    1 
ATOM   89   S  SD    . MET A 1 16  ? -78.588  -49.651 19.252  1.00 109.76 ? 16   MET A SD    1 
ATOM   90   C  CE    . MET A 1 16  ? -77.625  -48.346 18.496  1.00 64.97  ? 16   MET A CE    1 
ATOM   91   N  N     . ASP A 1 17  ? -77.289  -55.030 20.314  1.00 86.57  ? 17   ASP A N     1 
ATOM   92   C  CA    . ASP A 1 17  ? -77.272  -56.138 19.359  1.00 84.96  ? 17   ASP A CA    1 
ATOM   93   C  C     . ASP A 1 17  ? -78.161  -55.841 18.150  1.00 86.52  ? 17   ASP A C     1 
ATOM   94   O  O     . ASP A 1 17  ? -78.769  -54.770 18.064  1.00 85.21  ? 17   ASP A O     1 
ATOM   95   C  CB    . ASP A 1 17  ? -77.714  -57.440 20.039  1.00 88.23  ? 17   ASP A CB    1 
ATOM   96   C  CG    . ASP A 1 17  ? -76.606  -58.080 20.858  1.00 104.49 ? 17   ASP A CG    1 
ATOM   97   O  OD1   . ASP A 1 17  ? -75.516  -58.335 20.301  1.00 106.48 ? 17   ASP A OD1   1 
ATOM   98   O  OD2   . ASP A 1 17  ? -76.831  -58.342 22.058  1.00 113.93 ? 17   ASP A OD2   1 
ATOM   99   N  N     . GLY A 1 18  ? -78.229  -56.793 17.220  1.00 87.72  ? 18   GLY A N     1 
ATOM   100  C  CA    . GLY A 1 18  ? -79.047  -56.657 16.015  1.00 80.62  ? 18   GLY A CA    1 
ATOM   101  C  C     . GLY A 1 18  ? -80.544  -56.662 16.287  1.00 81.09  ? 18   GLY A C     1 
ATOM   102  O  O     . GLY A 1 18  ? -80.973  -57.018 17.388  1.00 85.91  ? 18   GLY A O     1 
ATOM   103  N  N     . PRO A 1 19  ? -81.351  -56.268 15.281  1.00 80.98  ? 19   PRO A N     1 
ATOM   104  C  CA    . PRO A 1 19  ? -82.806  -56.156 15.429  1.00 90.35  ? 19   PRO A CA    1 
ATOM   105  C  C     . PRO A 1 19  ? -83.502  -57.501 15.651  1.00 92.88  ? 19   PRO A C     1 
ATOM   106  O  O     . PRO A 1 19  ? -83.281  -58.451 14.895  1.00 85.81  ? 19   PRO A O     1 
ATOM   107  C  CB    . PRO A 1 19  ? -83.250  -55.533 14.099  1.00 86.91  ? 19   PRO A CB    1 
ATOM   108  C  CG    . PRO A 1 19  ? -82.171  -55.877 13.132  1.00 75.61  ? 19   PRO A CG    1 
ATOM   109  C  CD    . PRO A 1 19  ? -80.903  -55.875 13.932  1.00 76.69  ? 19   PRO A CD    1 
ATOM   110  N  N     . LYS A 1 20  ? -84.328  -57.564 16.692  1.00 96.24  ? 20   LYS A N     1 
ATOM   111  C  CA    . LYS A 1 20  ? -85.115  -58.757 17.001  1.00 98.61  ? 20   LYS A CA    1 
ATOM   112  C  C     . LYS A 1 20  ? -86.601  -58.510 16.729  1.00 101.67 ? 20   LYS A C     1 
ATOM   113  O  O     . LYS A 1 20  ? -87.473  -59.069 17.402  1.00 108.91 ? 20   LYS A O     1 
ATOM   114  C  CB    . LYS A 1 20  ? -84.890  -59.182 18.455  1.00 98.94  ? 20   LYS A CB    1 
ATOM   115  N  N     . VAL A 1 21  ? -86.874  -57.673 15.730  1.00 93.91  ? 21   VAL A N     1 
ATOM   116  C  CA    . VAL A 1 21  ? -88.240  -57.294 15.359  1.00 99.87  ? 21   VAL A CA    1 
ATOM   117  C  C     . VAL A 1 21  ? -88.963  -58.431 14.623  1.00 102.27 ? 21   VAL A C     1 
ATOM   118  O  O     . VAL A 1 21  ? -88.414  -59.039 13.700  1.00 97.43  ? 21   VAL A O     1 
ATOM   119  C  CB    . VAL A 1 21  ? -88.262  -55.963 14.556  1.00 97.38  ? 21   VAL A CB    1 
ATOM   120  C  CG1   . VAL A 1 21  ? -87.357  -56.033 13.330  1.00 92.43  ? 21   VAL A CG1   1 
ATOM   121  C  CG2   . VAL A 1 21  ? -89.682  -55.561 14.175  1.00 100.21 ? 21   VAL A CG2   1 
ATOM   122  N  N     . LYS A 1 22  ? -90.191  -58.711 15.054  1.00 94.57  ? 22   LYS A N     1 
ATOM   123  C  CA    . LYS A 1 22  ? -90.999  -59.796 14.497  1.00 89.57  ? 22   LYS A CA    1 
ATOM   124  C  C     . LYS A 1 22  ? -91.707  -59.398 13.201  1.00 91.39  ? 22   LYS A C     1 
ATOM   125  O  O     . LYS A 1 22  ? -91.857  -58.211 12.900  1.00 92.22  ? 22   LYS A O     1 
ATOM   126  C  CB    . LYS A 1 22  ? -92.020  -60.281 15.530  1.00 77.52  ? 22   LYS A CB    1 
ATOM   127  N  N     . GLN A 1 23  ? -92.139  -60.406 12.444  1.00 90.86  ? 23   GLN A N     1 
ATOM   128  C  CA    . GLN A 1 23  ? -92.821  -60.203 11.165  1.00 93.80  ? 23   GLN A CA    1 
ATOM   129  C  C     . GLN A 1 23  ? -94.270  -59.739 11.313  1.00 101.96 ? 23   GLN A C     1 
ATOM   130  O  O     . GLN A 1 23  ? -94.919  -59.992 12.331  1.00 107.72 ? 23   GLN A O     1 
ATOM   131  C  CB    . GLN A 1 23  ? -92.769  -61.484 10.324  1.00 90.92  ? 23   GLN A CB    1 
ATOM   132  C  CG    . GLN A 1 23  ? -91.667  -61.508 9.274   1.00 93.53  ? 23   GLN A CG    1 
ATOM   133  C  CD    . GLN A 1 23  ? -92.009  -60.711 8.023   1.00 93.76  ? 23   GLN A CD    1 
ATOM   134  O  OE1   . GLN A 1 23  ? -91.122  -60.190 7.349   1.00 90.19  ? 23   GLN A OE1   1 
ATOM   135  N  NE2   . GLN A 1 23  ? -93.298  -60.615 7.707   1.00 93.69  ? 23   GLN A NE2   1 
ATOM   136  N  N     . TRP A 1 24  ? -94.760  -59.058 10.278  1.00 102.73 ? 24   TRP A N     1 
ATOM   137  C  CA    . TRP A 1 24  ? -96.155  -58.632 10.188  1.00 101.80 ? 24   TRP A CA    1 
ATOM   138  C  C     . TRP A 1 24  ? -97.020  -59.777 9.721   1.00 108.59 ? 24   TRP A C     1 
ATOM   139  O  O     . TRP A 1 24  ? -96.497  -60.758 9.184   1.00 110.19 ? 24   TRP A O     1 
ATOM   140  C  CB    . TRP A 1 24  ? -96.272  -57.449 9.231   1.00 99.39  ? 24   TRP A CB    1 
ATOM   141  N  N     . PRO A 1 25  ? -98.355  -59.681 9.924   1.00 122.12 ? 25   PRO A N     1 
ATOM   142  C  CA    . PRO A 1 25  ? -99.288  -60.725 9.479   1.00 117.83 ? 25   PRO A CA    1 
ATOM   143  C  C     . PRO A 1 25  ? -99.106  -61.137 8.015   1.00 109.61 ? 25   PRO A C     1 
ATOM   144  O  O     . PRO A 1 25  ? -98.879  -60.286 7.152   1.00 102.23 ? 25   PRO A O     1 
ATOM   145  C  CB    . PRO A 1 25  ? -100.673 -60.083 9.685   1.00 111.45 ? 25   PRO A CB    1 
ATOM   146  C  CG    . PRO A 1 25  ? -100.423 -58.657 10.065  1.00 104.19 ? 25   PRO A CG    1 
ATOM   147  C  CD    . PRO A 1 25  ? -99.060  -58.632 10.680  1.00 111.12 ? 25   PRO A CD    1 
ATOM   148  N  N     . LEU A 1 26  ? -99.206  -62.441 7.762   1.00 112.45 ? 26   LEU A N     1 
ATOM   149  C  CA    . LEU A 1 26  ? -99.022  -63.018 6.426   1.00 113.66 ? 26   LEU A CA    1 
ATOM   150  C  C     . LEU A 1 26  ? -100.115 -62.598 5.440   1.00 128.29 ? 26   LEU A C     1 
ATOM   151  O  O     . LEU A 1 26  ? -101.241 -62.290 5.840   1.00 130.13 ? 26   LEU A O     1 
ATOM   152  C  CB    . LEU A 1 26  ? -98.919  -64.550 6.498   1.00 114.11 ? 26   LEU A CB    1 
ATOM   153  C  CG    . LEU A 1 26  ? -99.916  -65.345 7.353   1.00 122.75 ? 26   LEU A CG    1 
ATOM   154  C  CD1   . LEU A 1 26  ? -100.290 -66.654 6.675   1.00 118.47 ? 26   LEU A CD1   1 
ATOM   155  C  CD2   . LEU A 1 26  ? -99.375  -65.598 8.755   1.00 102.68 ? 26   LEU A CD2   1 
ATOM   156  N  N     . THR A 1 27  ? -99.770  -62.595 4.153   1.00 120.06 ? 27   THR A N     1 
ATOM   157  C  CA    . THR A 1 27  ? -100.678 -62.143 3.096   1.00 121.45 ? 27   THR A CA    1 
ATOM   158  C  C     . THR A 1 27  ? -101.062 -63.275 2.136   1.00 114.75 ? 27   THR A C     1 
ATOM   159  O  O     . THR A 1 27  ? -102.198 -63.325 1.656   1.00 121.24 ? 27   THR A O     1 
ATOM   160  C  CB    . THR A 1 27  ? -100.066 -60.971 2.293   1.00 126.42 ? 27   THR A CB    1 
ATOM   161  O  OG1   . THR A 1 27  ? -99.388  -60.075 3.182   1.00 118.58 ? 27   THR A OG1   1 
ATOM   162  C  CG2   . THR A 1 27  ? -101.147 -60.203 1.537   1.00 104.58 ? 27   THR A CG2   1 
ATOM   163  N  N     . GLU A 1 28  ? -100.107 -64.167 1.864   1.00 109.10 ? 28   GLU A N     1 
ATOM   164  C  CA    . GLU A 1 28  ? -100.265 -65.300 0.932   1.00 104.93 ? 28   GLU A CA    1 
ATOM   165  C  C     . GLU A 1 28  ? -100.250 -64.881 -0.543  1.00 106.43 ? 28   GLU A C     1 
ATOM   166  O  O     . GLU A 1 28  ? -99.771  -65.629 -1.400  1.00 98.66  ? 28   GLU A O     1 
ATOM   167  C  CB    . GLU A 1 28  ? -101.512 -66.139 1.258   1.00 104.76 ? 28   GLU A CB    1 
ATOM   168  C  CG    . GLU A 1 28  ? -101.499 -67.545 0.671   1.00 99.55  ? 28   GLU A CG    1 
ATOM   169  C  CD    . GLU A 1 28  ? -102.785 -68.310 0.930   1.00 115.66 ? 28   GLU A CD    1 
ATOM   170  O  OE1   . GLU A 1 28  ? -103.879 -67.741 0.721   1.00 113.51 ? 28   GLU A OE1   1 
ATOM   171  O  OE2   . GLU A 1 28  ? -102.702 -69.488 1.334   1.00 116.67 ? 28   GLU A OE2   1 
ATOM   172  N  N     . GLU A 1 29  ? -100.769 -63.688 -0.829  1.00 105.97 ? 29   GLU A N     1 
ATOM   173  C  CA    . GLU A 1 29  ? -100.780 -63.138 -2.185  1.00 110.51 ? 29   GLU A CA    1 
ATOM   174  C  C     . GLU A 1 29  ? -99.388  -62.694 -2.634  1.00 116.79 ? 29   GLU A C     1 
ATOM   175  O  O     . GLU A 1 29  ? -99.083  -62.699 -3.829  1.00 104.61 ? 29   GLU A O     1 
ATOM   176  C  CB    . GLU A 1 29  ? -101.761 -61.967 -2.279  1.00 100.73 ? 29   GLU A CB    1 
ATOM   177  N  N     . LYS A 1 30  ? -98.552  -62.312 -1.669  1.00 116.44 ? 30   LYS A N     1 
ATOM   178  C  CA    . LYS A 1 30  ? -97.192  -61.850 -1.944  1.00 113.72 ? 30   LYS A CA    1 
ATOM   179  C  C     . LYS A 1 30  ? -96.133  -62.908 -1.627  1.00 113.42 ? 30   LYS A C     1 
ATOM   180  O  O     . LYS A 1 30  ? -95.023  -62.856 -2.161  1.00 116.44 ? 30   LYS A O     1 
ATOM   181  C  CB    . LYS A 1 30  ? -96.899  -60.564 -1.166  1.00 94.82  ? 30   LYS A CB    1 
ATOM   182  N  N     . ILE A 1 31  ? -96.484  -63.861 -0.763  1.00 110.84 ? 31   ILE A N     1 
ATOM   183  C  CA    . ILE A 1 31  ? -95.564  -64.923 -0.336  1.00 106.67 ? 31   ILE A CA    1 
ATOM   184  C  C     . ILE A 1 31  ? -95.177  -65.847 -1.496  1.00 107.54 ? 31   ILE A C     1 
ATOM   185  O  O     . ILE A 1 31  ? -94.005  -66.200 -1.648  1.00 102.68 ? 31   ILE A O     1 
ATOM   186  C  CB    . ILE A 1 31  ? -96.140  -65.751 0.841   1.00 102.73 ? 31   ILE A CB    1 
ATOM   187  C  CG1   . ILE A 1 31  ? -96.486  -64.836 2.023   1.00 103.77 ? 31   ILE A CG1   1 
ATOM   188  C  CG2   . ILE A 1 31  ? -95.158  -66.834 1.278   1.00 92.47  ? 31   ILE A CG2   1 
ATOM   189  C  CD1   . ILE A 1 31  ? -97.262  -65.513 3.136   1.00 100.49 ? 31   ILE A CD1   1 
ATOM   190  N  N     . LYS A 1 32  ? -96.163  -66.215 -2.314  1.00 110.21 ? 32   LYS A N     1 
ATOM   191  C  CA    . LYS A 1 32  ? -95.955  -67.106 -3.461  1.00 109.80 ? 32   LYS A CA    1 
ATOM   192  C  C     . LYS A 1 32  ? -94.952  -66.554 -4.476  1.00 111.99 ? 32   LYS A C     1 
ATOM   193  O  O     . LYS A 1 32  ? -94.254  -67.319 -5.147  1.00 101.94 ? 32   LYS A O     1 
ATOM   194  C  CB    . LYS A 1 32  ? -97.287  -67.406 -4.152  1.00 97.27  ? 32   LYS A CB    1 
ATOM   195  N  N     . ALA A 1 33  ? -94.889  -65.228 -4.580  1.00 108.88 ? 33   ALA A N     1 
ATOM   196  C  CA    . ALA A 1 33  ? -93.956  -64.554 -5.482  1.00 111.25 ? 33   ALA A CA    1 
ATOM   197  C  C     . ALA A 1 33  ? -92.560  -64.417 -4.872  1.00 102.78 ? 33   ALA A C     1 
ATOM   198  O  O     . ALA A 1 33  ? -91.559  -64.500 -5.586  1.00 100.59 ? 33   ALA A O     1 
ATOM   199  C  CB    . ALA A 1 33  ? -94.499  -63.191 -5.885  1.00 108.75 ? 33   ALA A CB    1 
ATOM   200  N  N     . LEU A 1 34  ? -92.505  -64.210 -3.556  1.00 98.08  ? 34   LEU A N     1 
ATOM   201  C  CA    . LEU A 1 34  ? -91.242  -64.004 -2.839  1.00 97.76  ? 34   LEU A CA    1 
ATOM   202  C  C     . LEU A 1 34  ? -90.350  -65.245 -2.796  1.00 91.25  ? 34   LEU A C     1 
ATOM   203  O  O     . LEU A 1 34  ? -89.123  -65.128 -2.804  1.00 90.74  ? 34   LEU A O     1 
ATOM   204  C  CB    . LEU A 1 34  ? -91.503  -63.496 -1.415  1.00 90.09  ? 34   LEU A CB    1 
ATOM   205  C  CG    . LEU A 1 34  ? -91.893  -62.025 -1.229  1.00 91.05  ? 34   LEU A CG    1 
ATOM   206  C  CD1   . LEU A 1 34  ? -92.561  -61.817 0.122   1.00 90.61  ? 34   LEU A CD1   1 
ATOM   207  C  CD2   . LEU A 1 34  ? -90.693  -61.100 -1.383  1.00 83.44  ? 34   LEU A CD2   1 
ATOM   208  N  N     . VAL A 1 35  ? -90.971  -66.423 -2.747  1.00 89.91  ? 35   VAL A N     1 
ATOM   209  C  CA    . VAL A 1 35  ? -90.246  -67.698 -2.726  1.00 84.01  ? 35   VAL A CA    1 
ATOM   210  C  C     . VAL A 1 35  ? -89.487  -67.918 -4.039  1.00 87.15  ? 35   VAL A C     1 
ATOM   211  O  O     . VAL A 1 35  ? -88.345  -68.383 -4.032  1.00 83.40  ? 35   VAL A O     1 
ATOM   212  C  CB    . VAL A 1 35  ? -91.189  -68.892 -2.433  1.00 75.65  ? 35   VAL A CB    1 
ATOM   213  C  CG1   . VAL A 1 35  ? -90.428  -70.212 -2.440  1.00 64.97  ? 35   VAL A CG1   1 
ATOM   214  C  CG2   . VAL A 1 35  ? -91.891  -68.706 -1.094  1.00 73.47  ? 35   VAL A CG2   1 
ATOM   215  N  N     . GLU A 1 36  ? -90.124  -67.563 -5.155  1.00 88.12  ? 36   GLU A N     1 
ATOM   216  C  CA    . GLU A 1 36  ? -89.529  -67.700 -6.486  1.00 90.38  ? 36   GLU A CA    1 
ATOM   217  C  C     . GLU A 1 36  ? -88.313  -66.793 -6.690  1.00 97.18  ? 36   GLU A C     1 
ATOM   218  O  O     . GLU A 1 36  ? -87.371  -67.159 -7.396  1.00 92.69  ? 36   GLU A O     1 
ATOM   219  C  CB    . GLU A 1 36  ? -90.575  -67.428 -7.570  1.00 83.65  ? 36   GLU A CB    1 
ATOM   220  N  N     . ILE A 1 37  ? -88.344  -65.614 -6.071  1.00 95.41  ? 37   ILE A N     1 
ATOM   221  C  CA    . ILE A 1 37  ? -87.248  -64.647 -6.163  1.00 94.41  ? 37   ILE A CA    1 
ATOM   222  C  C     . ILE A 1 37  ? -86.081  -65.042 -5.251  1.00 94.27  ? 37   ILE A C     1 
ATOM   223  O  O     . ILE A 1 37  ? -84.918  -64.970 -5.657  1.00 95.01  ? 37   ILE A O     1 
ATOM   224  C  CB    . ILE A 1 37  ? -87.722  -63.203 -5.842  1.00 90.84  ? 37   ILE A CB    1 
ATOM   225  C  CG1   . ILE A 1 37  ? -88.941  -62.807 -6.696  1.00 89.37  ? 37   ILE A CG1   1 
ATOM   226  C  CG2   . ILE A 1 37  ? -86.585  -62.196 -5.997  1.00 89.55  ? 37   ILE A CG2   1 
ATOM   227  C  CD1   . ILE A 1 37  ? -88.720  -62.806 -8.199  1.00 78.93  ? 37   ILE A CD1   1 
ATOM   228  N  N     . CYS A 1 38  ? -86.402  -65.465 -4.028  1.00 88.97  ? 38   CYS A N     1 
ATOM   229  C  CA    . CYS A 1 38  ? -85.395  -65.843 -3.031  1.00 88.69  ? 38   CYS A CA    1 
ATOM   230  C  C     . CYS A 1 38  ? -84.614  -67.106 -3.399  1.00 89.71  ? 38   CYS A C     1 
ATOM   231  O  O     . CYS A 1 38  ? -83.444  -67.241 -3.033  1.00 91.52  ? 38   CYS A O     1 
ATOM   232  C  CB    . CYS A 1 38  ? -86.036  -66.003 -1.649  1.00 92.03  ? 38   CYS A CB    1 
ATOM   233  S  SG    . CYS A 1 38  ? -86.517  -64.447 -0.863  1.00 85.39  ? 38   CYS A SG    1 
ATOM   234  N  N     . THR A 1 39  ? -85.264  -68.022 -4.115  1.00 89.03  ? 39   THR A N     1 
ATOM   235  C  CA    . THR A 1 39  ? -84.622  -69.253 -4.583  1.00 90.17  ? 39   THR A CA    1 
ATOM   236  C  C     . THR A 1 39  ? -83.573  -68.947 -5.656  1.00 87.38  ? 39   THR A C     1 
ATOM   237  O  O     . THR A 1 39  ? -82.512  -69.575 -5.693  1.00 86.24  ? 39   THR A O     1 
ATOM   238  C  CB    . THR A 1 39  ? -85.657  -70.269 -5.120  1.00 86.54  ? 39   THR A CB    1 
ATOM   239  O  OG1   . THR A 1 39  ? -86.722  -70.417 -4.173  1.00 83.22  ? 39   THR A OG1   1 
ATOM   240  C  CG2   . THR A 1 39  ? -85.016  -71.633 -5.360  1.00 88.93  ? 39   THR A CG2   1 
ATOM   241  N  N     . GLU A 1 40  ? -83.878  -67.975 -6.516  1.00 84.85  ? 40   GLU A N     1 
ATOM   242  C  CA    . GLU A 1 40  ? -82.954  -67.522 -7.557  1.00 93.15  ? 40   GLU A CA    1 
ATOM   243  C  C     . GLU A 1 40  ? -81.738  -66.816 -6.952  1.00 97.34  ? 40   GLU A C     1 
ATOM   244  O  O     . GLU A 1 40  ? -80.613  -66.994 -7.425  1.00 95.84  ? 40   GLU A O     1 
ATOM   245  C  CB    . GLU A 1 40  ? -83.676  -66.604 -8.553  1.00 93.98  ? 40   GLU A CB    1 
ATOM   246  C  CG    . GLU A 1 40  ? -82.850  -66.184 -9.765  1.00 90.69  ? 40   GLU A CG    1 
ATOM   247  C  CD    . GLU A 1 40  ? -82.464  -67.346 -10.667 1.00 100.60 ? 40   GLU A CD    1 
ATOM   248  O  OE1   . GLU A 1 40  ? -83.307  -68.239 -10.899 1.00 95.30  ? 40   GLU A OE1   1 
ATOM   249  O  OE2   . GLU A 1 40  ? -81.314  -67.360 -11.154 1.00 102.60 ? 40   GLU A OE2   1 
ATOM   250  N  N     . MET A 1 41  ? -81.976  -66.024 -5.907  1.00 93.69  ? 41   MET A N     1 
ATOM   251  C  CA    . MET A 1 41  ? -80.909  -65.324 -5.189  1.00 84.41  ? 41   MET A CA    1 
ATOM   252  C  C     . MET A 1 41  ? -80.009  -66.293 -4.421  1.00 88.42  ? 41   MET A C     1 
ATOM   253  O  O     . MET A 1 41  ? -78.808  -66.053 -4.280  1.00 89.07  ? 41   MET A O     1 
ATOM   254  C  CB    . MET A 1 41  ? -81.493  -64.276 -4.237  1.00 83.24  ? 41   MET A CB    1 
ATOM   255  C  CG    . MET A 1 41  ? -82.085  -63.057 -4.927  1.00 81.62  ? 41   MET A CG    1 
ATOM   256  S  SD    . MET A 1 41  ? -82.730  -61.845 -3.758  1.00 88.80  ? 41   MET A SD    1 
ATOM   257  C  CE    . MET A 1 41  ? -83.272  -60.553 -4.872  1.00 79.22  ? 41   MET A CE    1 
ATOM   258  N  N     . GLU A 1 42  ? -80.601  -67.381 -3.930  1.00 87.69  ? 42   GLU A N     1 
ATOM   259  C  CA    . GLU A 1 42  ? -79.862  -68.432 -3.230  1.00 86.70  ? 42   GLU A CA    1 
ATOM   260  C  C     . GLU A 1 42  ? -79.029  -69.263 -4.207  1.00 88.46  ? 42   GLU A C     1 
ATOM   261  O  O     . GLU A 1 42  ? -77.913  -69.678 -3.883  1.00 90.03  ? 42   GLU A O     1 
ATOM   262  C  CB    . GLU A 1 42  ? -80.825  -69.333 -2.451  1.00 87.14  ? 42   GLU A CB    1 
ATOM   263  C  CG    . GLU A 1 42  ? -80.152  -70.254 -1.441  1.00 88.34  ? 42   GLU A CG    1 
ATOM   264  C  CD    . GLU A 1 42  ? -81.099  -71.275 -0.834  1.00 100.04 ? 42   GLU A CD    1 
ATOM   265  O  OE1   . GLU A 1 42  ? -82.333  -71.117 -0.966  1.00 98.70  ? 42   GLU A OE1   1 
ATOM   266  O  OE2   . GLU A 1 42  ? -80.606  -72.243 -0.218  1.00 108.95 ? 42   GLU A OE2   1 
ATOM   267  N  N     . LYS A 1 43  ? -79.581  -69.500 -5.397  1.00 82.71  ? 43   LYS A N     1 
ATOM   268  C  CA    . LYS A 1 43  ? -78.902  -70.261 -6.447  1.00 82.68  ? 43   LYS A CA    1 
ATOM   269  C  C     . LYS A 1 43  ? -77.712  -69.498 -7.029  1.00 91.33  ? 43   LYS A C     1 
ATOM   270  O  O     . LYS A 1 43  ? -76.706  -70.102 -7.408  1.00 91.02  ? 43   LYS A O     1 
ATOM   271  C  CB    . LYS A 1 43  ? -79.883  -70.635 -7.560  1.00 83.51  ? 43   LYS A CB    1 
ATOM   272  N  N     . GLU A 1 44  ? -77.839  -68.174 -7.099  1.00 87.90  ? 44   GLU A N     1 
ATOM   273  C  CA    . GLU A 1 44  ? -76.760  -67.305 -7.569  1.00 88.26  ? 44   GLU A CA    1 
ATOM   274  C  C     . GLU A 1 44  ? -75.649  -67.170 -6.527  1.00 86.76  ? 44   GLU A C     1 
ATOM   275  O  O     . GLU A 1 44  ? -74.483  -66.978 -6.876  1.00 81.86  ? 44   GLU A O     1 
ATOM   276  C  CB    . GLU A 1 44  ? -77.303  -65.923 -7.946  1.00 89.03  ? 44   GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 44  ? -78.056  -65.888 -9.269  1.00 88.88  ? 44   GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 44  ? -78.731  -64.554 -9.534  1.00 94.29  ? 44   GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 44  ? -79.416  -64.033 -8.626  1.00 86.63  ? 44   GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 44  ? -78.586  -64.029 -10.658 1.00 96.58  ? 44   GLU A OE2   1 
ATOM   281  N  N     . GLY A 1 45  ? -76.022  -67.272 -5.253  1.00 82.34  ? 45   GLY A N     1 
ATOM   282  C  CA    . GLY A 1 45  ? -75.067  -67.204 -4.148  1.00 85.04  ? 45   GLY A CA    1 
ATOM   283  C  C     . GLY A 1 45  ? -75.125  -65.906 -3.362  1.00 80.50  ? 45   GLY A C     1 
ATOM   284  O  O     . GLY A 1 45  ? -74.167  -65.551 -2.672  1.00 72.29  ? 45   GLY A O     1 
ATOM   285  N  N     . LYS A 1 46  ? -76.250  -65.202 -3.467  1.00 78.56  ? 46   LYS A N     1 
ATOM   286  C  CA    . LYS A 1 46  ? -76.446  -63.934 -2.766  1.00 68.91  ? 46   LYS A CA    1 
ATOM   287  C  C     . LYS A 1 46  ? -76.910  -64.140 -1.325  1.00 73.71  ? 46   LYS A C     1 
ATOM   288  O  O     . LYS A 1 46  ? -76.535  -63.377 -0.432  1.00 75.29  ? 46   LYS A O     1 
ATOM   289  C  CB    . LYS A 1 46  ? -77.442  -63.050 -3.521  1.00 60.28  ? 46   LYS A CB    1 
ATOM   290  N  N     . ILE A 1 47  ? -77.729  -65.169 -1.109  1.00 72.64  ? 47   ILE A N     1 
ATOM   291  C  CA    . ILE A 1 47  ? -78.254  -65.496 0.222   1.00 72.92  ? 47   ILE A CA    1 
ATOM   292  C  C     . ILE A 1 47  ? -78.132  -66.988 0.542   1.00 77.82  ? 47   ILE A C     1 
ATOM   293  O  O     . ILE A 1 47  ? -78.045  -67.820 -0.364  1.00 84.07  ? 47   ILE A O     1 
ATOM   294  C  CB    . ILE A 1 47  ? -79.723  -65.037 0.404   1.00 74.24  ? 47   ILE A CB    1 
ATOM   295  C  CG1   . ILE A 1 47  ? -80.588  -65.475 -0.789  1.00 79.14  ? 47   ILE A CG1   1 
ATOM   296  C  CG2   . ILE A 1 47  ? -79.790  -63.529 0.623   1.00 73.35  ? 47   ILE A CG2   1 
ATOM   297  C  CD1   . ILE A 1 47  ? -82.081  -65.334 -0.569  1.00 84.26  ? 47   ILE A CD1   1 
ATOM   298  N  N     . SER A 1 48  ? -78.123  -67.312 1.834   1.00 72.01  ? 48   SER A N     1 
ATOM   299  C  CA    . SER A 1 48  ? -78.015  -68.697 2.297   1.00 73.63  ? 48   SER A CA    1 
ATOM   300  C  C     . SER A 1 48  ? -79.034  -69.018 3.391   1.00 80.39  ? 48   SER A C     1 
ATOM   301  O  O     . SER A 1 48  ? -79.429  -68.140 4.161   1.00 81.52  ? 48   SER A O     1 
ATOM   302  C  CB    . SER A 1 48  ? -76.596  -68.986 2.794   1.00 77.13  ? 48   SER A CB    1 
ATOM   303  O  OG    . SER A 1 48  ? -75.655  -68.878 1.741   1.00 71.95  ? 48   SER A OG    1 
ATOM   304  N  N     . LYS A 1 49  ? -79.444  -70.284 3.453   1.00 86.02  ? 49   LYS A N     1 
ATOM   305  C  CA    . LYS A 1 49  ? -80.452  -70.741 4.414   1.00 85.32  ? 49   LYS A CA    1 
ATOM   306  C  C     . LYS A 1 49  ? -79.899  -70.906 5.828   1.00 87.58  ? 49   LYS A C     1 
ATOM   307  O  O     . LYS A 1 49  ? -78.761  -71.343 6.017   1.00 93.35  ? 49   LYS A O     1 
ATOM   308  C  CB    . LYS A 1 49  ? -81.087  -72.054 3.948   1.00 87.12  ? 49   LYS A CB    1 
ATOM   309  C  CG    . LYS A 1 49  ? -82.102  -71.898 2.827   1.00 88.20  ? 49   LYS A CG    1 
ATOM   310  C  CD    . LYS A 1 49  ? -82.752  -73.229 2.483   1.00 92.16  ? 49   LYS A CD    1 
ATOM   311  C  CE    . LYS A 1 49  ? -83.817  -73.063 1.412   1.00 92.46  ? 49   LYS A CE    1 
ATOM   312  N  NZ    . LYS A 1 49  ? -84.462  -74.359 1.065   1.00 102.82 ? 49   LYS A NZ    1 
ATOM   313  N  N     . ILE A 1 50  ? -80.725  -70.554 6.811   1.00 84.45  ? 50   ILE A N     1 
ATOM   314  C  CA    . ILE A 1 50  ? -80.382  -70.672 8.232   1.00 85.18  ? 50   ILE A CA    1 
ATOM   315  C  C     . ILE A 1 50  ? -81.564  -71.218 9.038   1.00 87.92  ? 50   ILE A C     1 
ATOM   316  O  O     . ILE A 1 50  ? -82.718  -71.090 8.623   1.00 87.74  ? 50   ILE A O     1 
ATOM   317  C  CB    . ILE A 1 50  ? -79.913  -69.324 8.832   1.00 81.13  ? 50   ILE A CB    1 
ATOM   318  C  CG1   . ILE A 1 50  ? -80.750  -68.161 8.280   1.00 84.42  ? 50   ILE A CG1   1 
ATOM   319  C  CG2   . ILE A 1 50  ? -78.429  -69.110 8.561   1.00 81.25  ? 50   ILE A CG2   1 
ATOM   320  C  CD1   . ILE A 1 50  ? -80.654  -66.877 9.077   1.00 87.95  ? 50   ILE A CD1   1 
ATOM   321  N  N     . GLY A 1 51  ? -81.269  -71.828 10.184  1.00 84.29  ? 51   GLY A N     1 
ATOM   322  C  CA    . GLY A 1 51  ? -82.300  -72.415 11.040  1.00 86.67  ? 51   GLY A CA    1 
ATOM   323  C  C     . GLY A 1 51  ? -82.565  -71.611 12.302  1.00 91.11  ? 51   GLY A C     1 
ATOM   324  O  O     . GLY A 1 51  ? -82.578  -70.378 12.259  1.00 92.60  ? 51   GLY A O     1 
ATOM   325  N  N     . PRO A 1 52  ? -82.782  -72.304 13.439  1.00 94.50  ? 52   PRO A N     1 
ATOM   326  C  CA    . PRO A 1 52  ? -83.001  -71.660 14.740  1.00 88.13  ? 52   PRO A CA    1 
ATOM   327  C  C     . PRO A 1 52  ? -81.728  -71.025 15.309  1.00 84.61  ? 52   PRO A C     1 
ATOM   328  O  O     . PRO A 1 52  ? -81.737  -70.522 16.437  1.00 83.24  ? 52   PRO A O     1 
ATOM   329  C  CB    . PRO A 1 52  ? -83.462  -72.819 15.639  1.00 84.49  ? 52   PRO A CB    1 
ATOM   330  C  CG    . PRO A 1 52  ? -83.823  -73.933 14.712  1.00 81.31  ? 52   PRO A CG    1 
ATOM   331  C  CD    . PRO A 1 52  ? -82.914  -73.767 13.535  1.00 88.46  ? 52   PRO A CD    1 
ATOM   332  N  N     . GLU A 1 53  ? -80.652  -71.055 14.524  1.00 83.99  ? 53   GLU A N     1 
ATOM   333  C  CA    . GLU A 1 53  ? -79.359  -70.481 14.895  1.00 84.95  ? 53   GLU A CA    1 
ATOM   334  C  C     . GLU A 1 53  ? -79.438  -68.976 15.136  1.00 82.57  ? 53   GLU A C     1 
ATOM   335  O  O     . GLU A 1 53  ? -79.012  -68.483 16.183  1.00 76.97  ? 53   GLU A O     1 
ATOM   336  C  CB    . GLU A 1 53  ? -78.329  -70.758 13.795  1.00 92.32  ? 53   GLU A CB    1 
ATOM   337  C  CG    . GLU A 1 53  ? -77.808  -72.184 13.743  1.00 99.55  ? 53   GLU A CG    1 
ATOM   338  C  CD    . GLU A 1 53  ? -76.656  -72.418 14.699  1.00 112.62 ? 53   GLU A CD    1 
ATOM   339  O  OE1   . GLU A 1 53  ? -76.900  -72.512 15.921  1.00 121.99 ? 53   GLU A OE1   1 
ATOM   340  O  OE2   . GLU A 1 53  ? -75.506  -72.522 14.224  1.00 105.01 ? 53   GLU A OE2   1 
ATOM   341  N  N     . ASN A 1 54  ? -79.989  -68.263 14.158  1.00 87.27  ? 54   ASN A N     1 
ATOM   342  C  CA    . ASN A 1 54  ? -80.014  -66.806 14.161  1.00 77.80  ? 54   ASN A CA    1 
ATOM   343  C  C     . ASN A 1 54  ? -81.175  -66.238 14.981  1.00 80.50  ? 54   ASN A C     1 
ATOM   344  O  O     . ASN A 1 54  ? -82.337  -66.552 14.711  1.00 79.00  ? 54   ASN A O     1 
ATOM   345  C  CB    . ASN A 1 54  ? -80.072  -66.286 12.722  1.00 77.15  ? 54   ASN A CB    1 
ATOM   346  C  CG    . ASN A 1 54  ? -79.515  -64.884 12.579  1.00 82.81  ? 54   ASN A CG    1 
ATOM   347  O  OD1   . ASN A 1 54  ? -79.957  -63.950 13.248  1.00 88.42  ? 54   ASN A OD1   1 
ATOM   348  N  ND2   . ASN A 1 54  ? -78.545  -64.727 11.687  1.00 78.19  ? 54   ASN A ND2   1 
ATOM   349  N  N     . PRO A 1 55  ? -80.860  -65.407 15.993  1.00 78.80  ? 55   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 55  ? -81.886  -64.752 16.806  1.00 81.65  ? 55   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 55  ? -82.431  -63.472 16.170  1.00 81.76  ? 55   PRO A C     1 
ATOM   352  O  O     . PRO A 1 55  ? -83.550  -63.059 16.483  1.00 85.84  ? 55   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 55  ? -81.148  -64.414 18.114  1.00 76.73  ? 55   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 55  ? -79.767  -64.981 17.984  1.00 74.69  ? 55   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 55  ? -79.511  -65.141 16.519  1.00 74.72  ? 55   PRO A CD    1 
ATOM   356  N  N     . TYR A 1 56  ? -81.645  -62.858 15.287  1.00 81.36  ? 56   TYR A N     1 
ATOM   357  C  CA    . TYR A 1 56  ? -82.005  -61.581 14.667  1.00 89.40  ? 56   TYR A CA    1 
ATOM   358  C  C     . TYR A 1 56  ? -82.968  -61.762 13.493  1.00 90.97  ? 56   TYR A C     1 
ATOM   359  O  O     . TYR A 1 56  ? -82.909  -62.767 12.781  1.00 86.05  ? 56   TYR A O     1 
ATOM   360  C  CB    . TYR A 1 56  ? -80.749  -60.828 14.209  1.00 80.95  ? 56   TYR A CB    1 
ATOM   361  C  CG    . TYR A 1 56  ? -79.593  -60.874 15.190  1.00 78.98  ? 56   TYR A CG    1 
ATOM   362  C  CD1   . TYR A 1 56  ? -79.644  -60.173 16.396  1.00 84.39  ? 56   TYR A CD1   1 
ATOM   363  C  CD2   . TYR A 1 56  ? -78.445  -61.614 14.908  1.00 72.66  ? 56   TYR A CD2   1 
ATOM   364  C  CE1   . TYR A 1 56  ? -78.587  -60.212 17.293  1.00 82.37  ? 56   TYR A CE1   1 
ATOM   365  C  CE2   . TYR A 1 56  ? -77.383  -61.660 15.799  1.00 70.84  ? 56   TYR A CE2   1 
ATOM   366  C  CZ    . TYR A 1 56  ? -77.459  -60.958 16.988  1.00 76.76  ? 56   TYR A CZ    1 
ATOM   367  O  OH    . TYR A 1 56  ? -76.407  -61.000 17.875  1.00 77.63  ? 56   TYR A OH    1 
ATOM   368  N  N     . ASN A 1 57  ? -83.847  -60.780 13.301  1.00 92.21  ? 57   ASN A N     1 
ATOM   369  C  CA    . ASN A 1 57  ? -84.843  -60.815 12.228  1.00 92.28  ? 57   ASN A CA    1 
ATOM   370  C  C     . ASN A 1 57  ? -85.121  -59.436 11.625  1.00 91.40  ? 57   ASN A C     1 
ATOM   371  O  O     . ASN A 1 57  ? -85.044  -58.417 12.317  1.00 93.39  ? 57   ASN A O     1 
ATOM   372  C  CB    . ASN A 1 57  ? -86.147  -61.452 12.728  1.00 97.70  ? 57   ASN A CB    1 
ATOM   373  C  CG    . ASN A 1 57  ? -87.096  -61.822 11.598  1.00 100.08 ? 57   ASN A CG    1 
ATOM   374  O  OD1   . ASN A 1 57  ? -86.684  -61.998 10.450  1.00 89.63  ? 57   ASN A OD1   1 
ATOM   375  N  ND2   . ASN A 1 57  ? -88.377  -61.947 11.924  1.00 107.15 ? 57   ASN A ND2   1 
ATOM   376  N  N     . THR A 1 58  ? -85.445  -59.421 10.333  1.00 87.81  ? 58   THR A N     1 
ATOM   377  C  CA    . THR A 1 58  ? -85.732  -58.190 9.597   1.00 80.91  ? 58   THR A CA    1 
ATOM   378  C  C     . THR A 1 58  ? -87.013  -58.364 8.769   1.00 85.89  ? 58   THR A C     1 
ATOM   379  O  O     . THR A 1 58  ? -87.164  -59.374 8.076   1.00 85.92  ? 58   THR A O     1 
ATOM   380  C  CB    . THR A 1 58  ? -84.555  -57.807 8.671   1.00 87.88  ? 58   THR A CB    1 
ATOM   381  O  OG1   . THR A 1 58  ? -83.310  -58.082 9.328   1.00 90.29  ? 58   THR A OG1   1 
ATOM   382  C  CG2   . THR A 1 58  ? -84.606  -56.334 8.300   1.00 77.20  ? 58   THR A CG2   1 
ATOM   383  N  N     . PRO A 1 59  ? -87.944  -57.389 8.846   1.00 84.52  ? 59   PRO A N     1 
ATOM   384  C  CA    . PRO A 1 59  ? -89.204  -57.480 8.097   1.00 74.97  ? 59   PRO A CA    1 
ATOM   385  C  C     . PRO A 1 59  ? -89.030  -57.289 6.589   1.00 73.96  ? 59   PRO A C     1 
ATOM   386  O  O     . PRO A 1 59  ? -88.204  -56.483 6.155   1.00 77.06  ? 59   PRO A O     1 
ATOM   387  C  CB    . PRO A 1 59  ? -90.049  -56.345 8.686   1.00 71.49  ? 59   PRO A CB    1 
ATOM   388  C  CG    . PRO A 1 59  ? -89.057  -55.367 9.213   1.00 74.55  ? 59   PRO A CG    1 
ATOM   389  C  CD    . PRO A 1 59  ? -87.905  -56.192 9.708   1.00 77.43  ? 59   PRO A CD    1 
ATOM   390  N  N     . VAL A 1 60  ? -89.812  -58.033 5.809   1.00 71.90  ? 60   VAL A N     1 
ATOM   391  C  CA    . VAL A 1 60  ? -89.751  -57.978 4.346   1.00 78.87  ? 60   VAL A CA    1 
ATOM   392  C  C     . VAL A 1 60  ? -91.052  -57.411 3.779   1.00 89.22  ? 60   VAL A C     1 
ATOM   393  O  O     . VAL A 1 60  ? -92.145  -57.853 4.145   1.00 89.64  ? 60   VAL A O     1 
ATOM   394  C  CB    . VAL A 1 60  ? -89.478  -59.372 3.729   1.00 78.85  ? 60   VAL A CB    1 
ATOM   395  C  CG1   . VAL A 1 60  ? -89.206  -59.262 2.234   1.00 88.61  ? 60   VAL A CG1   1 
ATOM   396  C  CG2   . VAL A 1 60  ? -88.308  -60.053 4.423   1.00 78.64  ? 60   VAL A CG2   1 
ATOM   397  N  N     . PHE A 1 61  ? -90.923  -56.428 2.891   1.00 84.57  ? 61   PHE A N     1 
ATOM   398  C  CA    . PHE A 1 61  ? -92.073  -55.798 2.246   1.00 86.55  ? 61   PHE A CA    1 
ATOM   399  C  C     . PHE A 1 61  ? -92.306  -56.360 0.846   1.00 81.80  ? 61   PHE A C     1 
ATOM   400  O  O     . PHE A 1 61  ? -91.365  -56.546 0.074   1.00 88.23  ? 61   PHE A O     1 
ATOM   401  C  CB    . PHE A 1 61  ? -91.887  -54.280 2.181   1.00 77.63  ? 61   PHE A CB    1 
ATOM   402  N  N     . VAL A 1 75  ? -86.833  -55.540 1.488   1.00 65.50  ? 75   VAL A N     1 
ATOM   403  C  CA    . VAL A 1 75  ? -86.541  -55.725 2.907   1.00 70.83  ? 75   VAL A CA    1 
ATOM   404  C  C     . VAL A 1 75  ? -86.227  -54.375 3.555   1.00 69.07  ? 75   VAL A C     1 
ATOM   405  O  O     . VAL A 1 75  ? -85.347  -53.644 3.093   1.00 62.99  ? 75   VAL A O     1 
ATOM   406  C  CB    . VAL A 1 75  ? -85.371  -56.713 3.131   1.00 70.09  ? 75   VAL A CB    1 
ATOM   407  C  CG1   . VAL A 1 75  ? -85.250  -57.080 4.603   1.00 72.26  ? 75   VAL A CG1   1 
ATOM   408  C  CG2   . VAL A 1 75  ? -85.557  -57.972 2.294   1.00 67.91  ? 75   VAL A CG2   1 
ATOM   409  N  N     . ASP A 1 76  ? -86.957  -54.056 4.621   1.00 82.63  ? 76   ASP A N     1 
ATOM   410  C  CA    . ASP A 1 76  ? -86.804  -52.783 5.323   1.00 89.52  ? 76   ASP A CA    1 
ATOM   411  C  C     . ASP A 1 76  ? -85.788  -52.889 6.461   1.00 81.93  ? 76   ASP A C     1 
ATOM   412  O  O     . ASP A 1 76  ? -86.071  -53.479 7.507   1.00 77.23  ? 76   ASP A O     1 
ATOM   413  C  CB    . ASP A 1 76  ? -88.162  -52.295 5.848   1.00 92.43  ? 76   ASP A CB    1 
ATOM   414  C  CG    . ASP A 1 76  ? -88.098  -50.898 6.446   1.00 96.63  ? 76   ASP A CG    1 
ATOM   415  O  OD1   . ASP A 1 76  ? -87.475  -50.004 5.832   1.00 99.80  ? 76   ASP A OD1   1 
ATOM   416  O  OD2   . ASP A 1 76  ? -88.674  -50.693 7.535   1.00 83.53  ? 76   ASP A OD2   1 
ATOM   417  N  N     . PHE A 1 77  ? -84.609  -52.309 6.245   1.00 78.72  ? 77   PHE A N     1 
ATOM   418  C  CA    . PHE A 1 77  ? -83.524  -52.337 7.229   1.00 80.45  ? 77   PHE A CA    1 
ATOM   419  C  C     . PHE A 1 77  ? -83.503  -51.083 8.108   1.00 81.28  ? 77   PHE A C     1 
ATOM   420  O  O     . PHE A 1 77  ? -82.433  -50.595 8.481   1.00 74.43  ? 77   PHE A O     1 
ATOM   421  C  CB    . PHE A 1 77  ? -82.170  -52.512 6.528   1.00 72.60  ? 77   PHE A CB    1 
ATOM   422  C  CG    . PHE A 1 77  ? -81.999  -53.841 5.848   1.00 72.38  ? 77   PHE A CG    1 
ATOM   423  C  CD1   . PHE A 1 77  ? -81.616  -54.966 6.573   1.00 65.59  ? 77   PHE A CD1   1 
ATOM   424  C  CD2   . PHE A 1 77  ? -82.205  -53.968 4.478   1.00 86.30  ? 77   PHE A CD2   1 
ATOM   425  C  CE1   . PHE A 1 77  ? -81.452  -56.192 5.948   1.00 61.99  ? 77   PHE A CE1   1 
ATOM   426  C  CE2   . PHE A 1 77  ? -82.041  -55.192 3.847   1.00 81.33  ? 77   PHE A CE2   1 
ATOM   427  C  CZ    . PHE A 1 77  ? -81.663  -56.305 4.583   1.00 69.38  ? 77   PHE A CZ    1 
ATOM   428  N  N     . ARG A 1 78  ? -84.689  -50.576 8.444   1.00 77.00  ? 78   ARG A N     1 
ATOM   429  C  CA    . ARG A 1 78  ? -84.831  -49.341 9.219   1.00 75.67  ? 78   ARG A CA    1 
ATOM   430  C  C     . ARG A 1 78  ? -84.273  -49.445 10.640  1.00 76.66  ? 78   ARG A C     1 
ATOM   431  O  O     . ARG A 1 78  ? -83.702  -48.483 11.159  1.00 77.30  ? 78   ARG A O     1 
ATOM   432  C  CB    . ARG A 1 78  ? -86.298  -48.903 9.263   1.00 79.29  ? 78   ARG A CB    1 
ATOM   433  N  N     . GLU A 1 79  ? -84.440  -50.613 11.257  1.00 81.10  ? 79   GLU A N     1 
ATOM   434  C  CA    . GLU A 1 79  ? -83.970  -50.852 12.621  1.00 83.75  ? 79   GLU A CA    1 
ATOM   435  C  C     . GLU A 1 79  ? -82.474  -51.179 12.664  1.00 78.08  ? 79   GLU A C     1 
ATOM   436  O  O     . GLU A 1 79  ? -81.778  -50.790 13.605  1.00 76.72  ? 79   GLU A O     1 
ATOM   437  C  CB    . GLU A 1 79  ? -84.787  -51.971 13.281  1.00 82.50  ? 79   GLU A CB    1 
ATOM   438  C  CG    . GLU A 1 79  ? -84.625  -52.079 14.794  1.00 90.51  ? 79   GLU A CG    1 
ATOM   439  C  CD    . GLU A 1 79  ? -85.199  -50.892 15.551  1.00 95.78  ? 79   GLU A CD    1 
ATOM   440  O  OE1   . GLU A 1 79  ? -86.277  -50.390 15.165  1.00 100.22 ? 79   GLU A OE1   1 
ATOM   441  O  OE2   . GLU A 1 79  ? -84.572  -50.465 16.543  1.00 90.16  ? 79   GLU A OE2   1 
ATOM   442  N  N     . LEU A 1 80  ? -81.992  -51.890 11.645  1.00 73.41  ? 80   LEU A N     1 
ATOM   443  C  CA    . LEU A 1 80  ? -80.581  -52.277 11.557  1.00 69.08  ? 80   LEU A CA    1 
ATOM   444  C  C     . LEU A 1 80  ? -79.663  -51.081 11.296  1.00 71.56  ? 80   LEU A C     1 
ATOM   445  O  O     . LEU A 1 80  ? -78.593  -50.977 11.898  1.00 70.89  ? 80   LEU A O     1 
ATOM   446  C  CB    . LEU A 1 80  ? -80.376  -53.361 10.487  1.00 66.53  ? 80   LEU A CB    1 
ATOM   447  C  CG    . LEU A 1 80  ? -78.958  -53.896 10.229  1.00 64.35  ? 80   LEU A CG    1 
ATOM   448  C  CD1   . LEU A 1 80  ? -78.415  -54.681 11.416  1.00 77.62  ? 80   LEU A CD1   1 
ATOM   449  C  CD2   . LEU A 1 80  ? -78.924  -54.750 8.972   1.00 60.91  ? 80   LEU A CD2   1 
ATOM   450  N  N     . ASN A 1 81  ? -80.091  -50.185 10.405  1.00 73.57  ? 81   ASN A N     1 
ATOM   451  C  CA    . ASN A 1 81  ? -79.314  -48.995 10.040  1.00 74.10  ? 81   ASN A CA    1 
ATOM   452  C  C     . ASN A 1 81  ? -79.010  -48.066 11.216  1.00 71.71  ? 81   ASN A C     1 
ATOM   453  O  O     . ASN A 1 81  ? -77.975  -47.395 11.232  1.00 69.18  ? 81   ASN A O     1 
ATOM   454  C  CB    . ASN A 1 81  ? -80.011  -48.216 8.919   1.00 79.73  ? 81   ASN A CB    1 
ATOM   455  C  CG    . ASN A 1 81  ? -79.972  -48.941 7.585   1.00 76.13  ? 81   ASN A CG    1 
ATOM   456  O  OD1   . ASN A 1 81  ? -78.989  -49.602 7.246   1.00 74.62  ? 81   ASN A OD1   1 
ATOM   457  N  ND2   . ASN A 1 81  ? -81.046  -48.813 6.814   1.00 75.87  ? 81   ASN A ND2   1 
ATOM   458  N  N     . LYS A 1 82  ? -79.916  -48.032 12.191  1.00 70.34  ? 82   LYS A N     1 
ATOM   459  C  CA    . LYS A 1 82  ? -79.721  -47.259 13.416  1.00 73.87  ? 82   LYS A CA    1 
ATOM   460  C  C     . LYS A 1 82  ? -78.717  -47.933 14.352  1.00 73.72  ? 82   LYS A C     1 
ATOM   461  O  O     . LYS A 1 82  ? -78.049  -47.263 15.142  1.00 70.12  ? 82   LYS A O     1 
ATOM   462  C  CB    . LYS A 1 82  ? -81.055  -47.052 14.137  1.00 73.60  ? 82   LYS A CB    1 
ATOM   463  N  N     . LYS A 1 83  ? -78.620  -49.258 14.252  1.00 75.00  ? 83   LYS A N     1 
ATOM   464  C  CA    . LYS A 1 83  ? -77.698  -50.047 15.070  1.00 77.66  ? 83   LYS A CA    1 
ATOM   465  C  C     . LYS A 1 83  ? -76.323  -50.202 14.418  1.00 72.52  ? 83   LYS A C     1 
ATOM   466  O  O     . LYS A 1 83  ? -75.333  -50.466 15.104  1.00 71.66  ? 83   LYS A O     1 
ATOM   467  C  CB    . LYS A 1 83  ? -78.297  -51.424 15.371  1.00 65.39  ? 83   LYS A CB    1 
ATOM   468  N  N     . THR A 1 84  ? -76.274  -50.041 13.096  1.00 70.41  ? 84   THR A N     1 
ATOM   469  C  CA    . THR A 1 84  ? -75.028  -50.135 12.332  1.00 67.87  ? 84   THR A CA    1 
ATOM   470  C  C     . THR A 1 84  ? -74.132  -48.927 12.619  1.00 77.31  ? 84   THR A C     1 
ATOM   471  O  O     . THR A 1 84  ? -74.628  -47.824 12.867  1.00 81.43  ? 84   THR A O     1 
ATOM   472  C  CB    . THR A 1 84  ? -75.301  -50.239 10.813  1.00 70.23  ? 84   THR A CB    1 
ATOM   473  O  OG1   . THR A 1 84  ? -76.387  -51.143 10.576  1.00 74.86  ? 84   THR A OG1   1 
ATOM   474  C  CG2   . THR A 1 84  ? -74.068  -50.741 10.065  1.00 66.44  ? 84   THR A CG2   1 
ATOM   475  N  N     . GLN A 1 85  ? -72.818  -49.149 12.586  1.00 73.97  ? 85   GLN A N     1 
ATOM   476  C  CA    . GLN A 1 85  ? -71.828  -48.101 12.851  1.00 75.46  ? 85   GLN A CA    1 
ATOM   477  C  C     . GLN A 1 85  ? -71.886  -46.960 11.832  1.00 70.63  ? 85   GLN A C     1 
ATOM   478  O  O     . GLN A 1 85  ? -72.397  -47.129 10.721  1.00 67.49  ? 85   GLN A O     1 
ATOM   479  C  CB    . GLN A 1 85  ? -70.411  -48.693 12.903  1.00 74.43  ? 85   GLN A CB    1 
ATOM   480  C  CG    . GLN A 1 85  ? -69.856  -49.156 11.560  1.00 65.77  ? 85   GLN A CG    1 
ATOM   481  C  CD    . GLN A 1 85  ? -68.379  -49.503 11.613  1.00 68.65  ? 85   GLN A CD    1 
ATOM   482  O  OE1   . GLN A 1 85  ? -67.977  -50.602 11.230  1.00 69.51  ? 85   GLN A OE1   1 
ATOM   483  N  NE2   . GLN A 1 85  ? -67.562  -48.567 12.087  1.00 70.50  ? 85   GLN A NE2   1 
ATOM   484  N  N     . ASP A 1 86  ? -71.359  -45.803 12.225  1.00 76.04  ? 86   ASP A N     1 
ATOM   485  C  CA    . ASP A 1 86  ? -71.295  -44.641 11.345  1.00 75.49  ? 86   ASP A CA    1 
ATOM   486  C  C     . ASP A 1 86  ? -70.186  -44.793 10.309  1.00 70.71  ? 86   ASP A C     1 
ATOM   487  O  O     . ASP A 1 86  ? -69.052  -45.146 10.642  1.00 73.24  ? 86   ASP A O     1 
ATOM   488  C  CB    . ASP A 1 86  ? -71.091  -43.357 12.156  1.00 76.03  ? 86   ASP A CB    1 
ATOM   489  C  CG    . ASP A 1 86  ? -72.329  -42.956 12.941  1.00 76.45  ? 86   ASP A CG    1 
ATOM   490  O  OD1   . ASP A 1 86  ? -73.431  -42.914 12.353  1.00 73.36  ? 86   ASP A OD1   1 
ATOM   491  O  OD2   . ASP A 1 86  ? -72.196  -42.669 14.150  1.00 89.19  ? 86   ASP A OD2   1 
ATOM   492  N  N     . PHE A 1 87  ? -70.534  -44.538 9.051   1.00 66.59  ? 87   PHE A N     1 
ATOM   493  C  CA    . PHE A 1 87  ? -69.574  -44.551 7.952   1.00 67.98  ? 87   PHE A CA    1 
ATOM   494  C  C     . PHE A 1 87  ? -69.283  -43.123 7.512   1.00 74.77  ? 87   PHE A C     1 
ATOM   495  O  O     . PHE A 1 87  ? -70.152  -42.251 7.605   1.00 87.81  ? 87   PHE A O     1 
ATOM   496  C  CB    . PHE A 1 87  ? -70.118  -45.360 6.770   1.00 69.02  ? 87   PHE A CB    1 
ATOM   497  C  CG    . PHE A 1 87  ? -70.246  -46.833 7.045   1.00 60.94  ? 87   PHE A CG    1 
ATOM   498  C  CD1   . PHE A 1 87  ? -71.421  -47.357 7.575   1.00 66.50  ? 87   PHE A CD1   1 
ATOM   499  C  CD2   . PHE A 1 87  ? -69.195  -47.700 6.764   1.00 62.14  ? 87   PHE A CD2   1 
ATOM   500  C  CE1   . PHE A 1 87  ? -71.542  -48.715 7.828   1.00 72.37  ? 87   PHE A CE1   1 
ATOM   501  C  CE2   . PHE A 1 87  ? -69.310  -49.060 7.013   1.00 76.01  ? 87   PHE A CE2   1 
ATOM   502  C  CZ    . PHE A 1 87  ? -70.486  -49.567 7.545   1.00 79.19  ? 87   PHE A CZ    1 
ATOM   503  N  N     . TRP A 1 88  ? -68.062  -42.885 7.039   1.00 76.84  ? 88   TRP A N     1 
ATOM   504  C  CA    . TRP A 1 88  ? -67.681  -41.565 6.542   1.00 86.22  ? 88   TRP A CA    1 
ATOM   505  C  C     . TRP A 1 88  ? -68.379  -41.255 5.248   1.00 97.99  ? 88   TRP A C     1 
ATOM   506  O  O     . TRP A 1 88  ? -68.629  -42.153 4.439   1.00 102.99 ? 88   TRP A O     1 
ATOM   507  C  CB    . TRP A 1 88  ? -66.165  -41.443 6.392   1.00 84.05  ? 88   TRP A CB    1 
ATOM   508  C  CG    . TRP A 1 88  ? -65.704  -40.038 6.071   1.00 86.34  ? 88   TRP A CG    1 
ATOM   509  C  CD1   . TRP A 1 88  ? -64.983  -39.614 4.957   1.00 86.49  ? 88   TRP A CD1   1 
ATOM   510  C  CD2   . TRP A 1 88  ? -65.941  -38.815 6.858   1.00 85.29  ? 88   TRP A CD2   1 
ATOM   511  N  NE1   . TRP A 1 88  ? -64.756  -38.261 5.006   1.00 90.29  ? 88   TRP A NE1   1 
ATOM   512  C  CE2   . TRP A 1 88  ? -65.303  -37.721 6.116   1.00 88.92  ? 88   TRP A CE2   1 
ATOM   513  C  CE3   . TRP A 1 88  ? -66.587  -38.530 8.058   1.00 82.79  ? 88   TRP A CE3   1 
ATOM   514  C  CZ2   . TRP A 1 88  ? -65.326  -36.411 6.573   1.00 92.40  ? 88   TRP A CZ2   1 
ATOM   515  C  CZ3   . TRP A 1 88  ? -66.603  -37.204 8.508   1.00 83.58  ? 88   TRP A CZ3   1 
ATOM   516  C  CH2   . TRP A 1 88  ? -65.988  -36.172 7.782   1.00 90.62  ? 88   TRP A CH2   1 
ATOM   517  N  N     . GLU A 1 89  ? -68.701  -39.976 5.056   1.00 103.14 ? 89   GLU A N     1 
ATOM   518  C  CA    . GLU A 1 89  ? -69.469  -39.499 3.901   1.00 103.80 ? 89   GLU A CA    1 
ATOM   519  C  C     . GLU A 1 89  ? -69.024  -40.097 2.563   1.00 104.36 ? 89   GLU A C     1 
ATOM   520  O  O     . GLU A 1 89  ? -67.829  -40.168 2.265   1.00 108.91 ? 89   GLU A O     1 
ATOM   521  C  CB    . GLU A 1 89  ? -69.460  -37.963 3.836   1.00 98.47  ? 89   GLU A CB    1 
ATOM   522  C  CG    . GLU A 1 89  ? -68.075  -37.325 3.822   1.00 94.81  ? 89   GLU A CG    1 
ATOM   523  C  CD    . GLU A 1 89  ? -68.120  -35.808 3.784   1.00 104.12 ? 89   GLU A CD    1 
ATOM   524  O  OE1   . GLU A 1 89  ? -68.841  -35.204 4.607   1.00 101.15 ? 89   GLU A OE1   1 
ATOM   525  O  OE2   . GLU A 1 89  ? -67.422  -35.216 2.934   1.00 105.37 ? 89   GLU A OE2   1 
ATOM   526  N  N     . VAL A 1 90  ? -70.004  -40.536 1.777   1.00 96.32  ? 90   VAL A N     1 
ATOM   527  C  CA    . VAL A 1 90  ? -69.765  -41.052 0.432   1.00 104.58 ? 90   VAL A CA    1 
ATOM   528  C  C     . VAL A 1 90  ? -69.445  -39.876 -0.492  1.00 111.33 ? 90   VAL A C     1 
ATOM   529  O  O     . VAL A 1 90  ? -68.386  -39.840 -1.123  1.00 108.67 ? 90   VAL A O     1 
ATOM   530  C  CB    . VAL A 1 90  ? -70.986  -41.841 -0.100  1.00 96.73  ? 90   VAL A CB    1 
ATOM   531  C  CG1   . VAL A 1 90  ? -70.692  -42.441 -1.467  1.00 88.41  ? 90   VAL A CG1   1 
ATOM   532  C  CG2   . VAL A 1 90  ? -71.390  -42.935 0.879   1.00 78.27  ? 90   VAL A CG2   1 
ATOM   533  N  N     . GLN A 1 91  ? -70.372  -38.921 -0.551  1.00 106.04 ? 91   GLN A N     1 
ATOM   534  C  CA    . GLN A 1 91  ? -70.201  -37.673 -1.291  1.00 110.34 ? 91   GLN A CA    1 
ATOM   535  C  C     . GLN A 1 91  ? -71.160  -36.625 -0.731  1.00 110.83 ? 91   GLN A C     1 
ATOM   536  O  O     . GLN A 1 91  ? -72.355  -36.637 -1.039  1.00 115.50 ? 91   GLN A O     1 
ATOM   537  C  CB    . GLN A 1 91  ? -70.449  -37.884 -2.789  1.00 106.07 ? 91   GLN A CB    1 
ATOM   538  N  N     . LEU A 1 92  ? -70.631  -35.732 0.104   1.00 106.74 ? 92   LEU A N     1 
ATOM   539  C  CA    . LEU A 1 92  ? -71.438  -34.704 0.762   1.00 109.98 ? 92   LEU A CA    1 
ATOM   540  C  C     . LEU A 1 92  ? -71.888  -33.624 -0.219  1.00 116.39 ? 92   LEU A C     1 
ATOM   541  O  O     . LEU A 1 92  ? -73.087  -33.446 -0.448  1.00 114.77 ? 92   LEU A O     1 
ATOM   542  C  CB    . LEU A 1 92  ? -70.672  -34.082 1.934   1.00 100.71 ? 92   LEU A CB    1 
ATOM   543  N  N     . GLY A 1 93  ? -70.923  -32.909 -0.792  1.00 114.56 ? 93   GLY A N     1 
ATOM   544  C  CA    . GLY A 1 93  ? -71.204  -31.882 -1.788  1.00 104.20 ? 93   GLY A CA    1 
ATOM   545  C  C     . GLY A 1 93  ? -71.241  -32.468 -3.184  1.00 101.93 ? 93   GLY A C     1 
ATOM   546  O  O     . GLY A 1 93  ? -70.329  -33.194 -3.584  1.00 93.08  ? 93   GLY A O     1 
ATOM   547  N  N     . ILE A 1 94  ? -72.304  -32.159 -3.922  1.00 89.52  ? 94   ILE A N     1 
ATOM   548  C  CA    . ILE A 1 94  ? -72.461  -32.639 -5.296  1.00 74.42  ? 94   ILE A CA    1 
ATOM   549  C  C     . ILE A 1 94  ? -71.711  -31.749 -6.292  1.00 69.03  ? 94   ILE A C     1 
ATOM   550  O  O     . ILE A 1 94  ? -71.700  -30.525 -6.137  1.00 72.47  ? 94   ILE A O     1 
ATOM   551  C  CB    . ILE A 1 94  ? -73.949  -32.778 -5.706  1.00 78.16  ? 94   ILE A CB    1 
ATOM   552  C  CG1   . ILE A 1 94  ? -74.739  -31.504 -5.370  1.00 81.43  ? 94   ILE A CG1   1 
ATOM   553  C  CG2   . ILE A 1 94  ? -74.568  -34.001 -5.039  1.00 72.95  ? 94   ILE A CG2   1 
ATOM   554  C  CD1   . ILE A 1 94  ? -76.027  -31.342 -6.152  1.00 82.63  ? 94   ILE A CD1   1 
ATOM   555  N  N     . PRO A 1 95  ? -71.066  -32.365 -7.305  1.00 59.34  ? 95   PRO A N     1 
ATOM   556  C  CA    . PRO A 1 95  ? -70.345  -31.614 -8.337  1.00 62.67  ? 95   PRO A CA    1 
ATOM   557  C  C     . PRO A 1 95  ? -71.253  -30.667 -9.116  1.00 61.70  ? 95   PRO A C     1 
ATOM   558  O  O     . PRO A 1 95  ? -72.330  -31.067 -9.563  1.00 68.30  ? 95   PRO A O     1 
ATOM   559  C  CB    . PRO A 1 95  ? -69.817  -32.713 -9.265  1.00 59.87  ? 95   PRO A CB    1 
ATOM   560  C  CG    . PRO A 1 95  ? -69.712  -33.915 -8.395  1.00 59.62  ? 95   PRO A CG    1 
ATOM   561  C  CD    . PRO A 1 95  ? -70.888  -33.820 -7.470  1.00 63.68  ? 95   PRO A CD    1 
ATOM   562  N  N     . HIS A 1 96  ? -70.820  -29.418 -9.262  1.00 56.09  ? 96   HIS A N     1 
ATOM   563  C  CA    . HIS A 1 96  ? -71.560  -28.439 -10.048 1.00 62.28  ? 96   HIS A CA    1 
ATOM   564  C  C     . HIS A 1 96  ? -71.089  -28.470 -11.476 1.00 66.89  ? 96   HIS A C     1 
ATOM   565  O  O     . HIS A 1 96  ? -69.880  -28.476 -11.726 1.00 69.16  ? 96   HIS A O     1 
ATOM   566  C  CB    . HIS A 1 96  ? -71.411  -27.041 -9.458  1.00 61.34  ? 96   HIS A CB    1 
ATOM   567  C  CG    . HIS A 1 96  ? -72.519  -26.095 -9.855  1.00 64.97  ? 96   HIS A CG    1 
ATOM   568  N  ND1   . HIS A 1 96  ? -72.502  -25.405 -11.010 1.00 68.14  ? 96   HIS A ND1   1 
ATOM   569  C  CD2   . HIS A 1 96  ? -73.705  -25.750 -9.208  1.00 67.61  ? 96   HIS A CD2   1 
ATOM   570  C  CE1   . HIS A 1 96  ? -73.616  -24.654 -11.099 1.00 70.45  ? 96   HIS A CE1   1 
ATOM   571  N  NE2   . HIS A 1 96  ? -74.350  -24.865 -9.995  1.00 65.77  ? 96   HIS A NE2   1 
ATOM   572  N  N     . PRO A 1 97  ? -72.037  -28.501 -12.438 1.00 62.74  ? 97   PRO A N     1 
ATOM   573  C  CA    . PRO A 1 97  ? -71.731  -28.578 -13.874 1.00 64.62  ? 97   PRO A CA    1 
ATOM   574  C  C     . PRO A 1 97  ? -70.780  -27.493 -14.387 1.00 67.59  ? 97   PRO A C     1 
ATOM   575  O  O     . PRO A 1 97  ? -70.153  -27.673 -15.433 1.00 80.88  ? 97   PRO A O     1 
ATOM   576  C  CB    . PRO A 1 97  ? -73.104  -28.427 -14.530 1.00 69.95  ? 97   PRO A CB    1 
ATOM   577  C  CG    . PRO A 1 97  ? -74.054  -28.968 -13.521 1.00 69.99  ? 97   PRO A CG    1 
ATOM   578  C  CD    . PRO A 1 97  ? -73.491  -28.553 -12.192 1.00 67.08  ? 97   PRO A CD    1 
ATOM   579  N  N     . ALA A 1 98  ? -70.681  -26.383 -13.657 1.00 60.67  ? 98   ALA A N     1 
ATOM   580  C  CA    . ALA A 1 98  ? -69.772  -25.290 -14.005 1.00 59.46  ? 98   ALA A CA    1 
ATOM   581  C  C     . ALA A 1 98  ? -68.307  -25.657 -13.760 1.00 59.11  ? 98   ALA A C     1 
ATOM   582  O  O     . ALA A 1 98  ? -67.414  -25.155 -14.444 1.00 64.59  ? 98   ALA A O     1 
ATOM   583  C  CB    . ALA A 1 98  ? -70.141  -24.030 -13.236 1.00 61.10  ? 98   ALA A CB    1 
ATOM   584  N  N     . GLY A 1 99  ? -68.073  -26.532 -12.783 1.00 57.19  ? 99   GLY A N     1 
ATOM   585  C  CA    . GLY A 1 99  ? -66.724  -26.971 -12.428 1.00 57.26  ? 99   GLY A CA    1 
ATOM   586  C  C     . GLY A 1 99  ? -66.159  -28.058 -13.323 1.00 58.00  ? 99   GLY A C     1 
ATOM   587  O  O     . GLY A 1 99  ? -64.950  -28.300 -13.324 1.00 55.11  ? 99   GLY A O     1 
ATOM   588  N  N     . LEU A 1 100 ? -67.036  -28.714 -14.081 1.00 64.97  ? 100  LEU A N     1 
ATOM   589  C  CA    . LEU A 1 100 ? -66.633  -29.769 -15.010 1.00 74.42  ? 100  LEU A CA    1 
ATOM   590  C  C     . LEU A 1 100 ? -65.908  -29.198 -16.230 1.00 79.92  ? 100  LEU A C     1 
ATOM   591  O  O     . LEU A 1 100 ? -66.040  -28.013 -16.544 1.00 79.77  ? 100  LEU A O     1 
ATOM   592  C  CB    . LEU A 1 100 ? -67.847  -30.600 -15.447 1.00 68.04  ? 100  LEU A CB    1 
ATOM   593  C  CG    . LEU A 1 100 ? -68.552  -31.479 -14.407 1.00 65.94  ? 100  LEU A CG    1 
ATOM   594  C  CD1   . LEU A 1 100 ? -69.787  -32.131 -15.011 1.00 58.01  ? 100  LEU A CD1   1 
ATOM   595  C  CD2   . LEU A 1 100 ? -67.614  -32.533 -13.834 1.00 66.86  ? 100  LEU A CD2   1 
ATOM   596  N  N     . LYS A 1 101 ? -65.143  -30.051 -16.906 1.00 81.84  ? 101  LYS A N     1 
ATOM   597  C  CA    . LYS A 1 101 ? -64.343  -29.642 -18.060 1.00 78.86  ? 101  LYS A CA    1 
ATOM   598  C  C     . LYS A 1 101 ? -65.018  -30.012 -19.379 1.00 79.17  ? 101  LYS A C     1 
ATOM   599  O  O     . LYS A 1 101 ? -65.745  -31.006 -19.457 1.00 83.09  ? 101  LYS A O     1 
ATOM   600  C  CB    . LYS A 1 101 ? -62.945  -30.264 -17.989 1.00 88.34  ? 101  LYS A CB    1 
ATOM   601  C  CG    . LYS A 1 101 ? -62.129  -29.832 -16.780 1.00 92.45  ? 101  LYS A CG    1 
ATOM   602  C  CD    . LYS A 1 101 ? -60.872  -30.673 -16.628 1.00 93.60  ? 101  LYS A CD    1 
ATOM   603  C  CE    . LYS A 1 101 ? -60.137  -30.336 -15.341 1.00 89.04  ? 101  LYS A CE    1 
ATOM   604  N  NZ    . LYS A 1 101 ? -58.933  -31.191 -15.150 1.00 94.03  ? 101  LYS A NZ    1 
ATOM   605  N  N     . LYS A 1 102 ? -64.771  -29.204 -20.409 1.00 82.82  ? 102  LYS A N     1 
ATOM   606  C  CA    . LYS A 1 102 ? -65.323  -29.438 -21.743 1.00 79.73  ? 102  LYS A CA    1 
ATOM   607  C  C     . LYS A 1 102 ? -64.618  -30.613 -22.419 1.00 78.38  ? 102  LYS A C     1 
ATOM   608  O  O     . LYS A 1 102 ? -63.388  -30.640 -22.514 1.00 79.08  ? 102  LYS A O     1 
ATOM   609  C  CB    . LYS A 1 102 ? -65.205  -28.174 -22.602 1.00 78.69  ? 102  LYS A CB    1 
ATOM   610  C  CG    . LYS A 1 102 ? -65.976  -28.228 -23.915 1.00 78.89  ? 102  LYS A CG    1 
ATOM   611  C  CD    . LYS A 1 102 ? -65.736  -26.990 -24.769 1.00 88.13  ? 102  LYS A CD    1 
ATOM   612  C  CE    . LYS A 1 102 ? -64.408  -27.059 -25.511 1.00 74.24  ? 102  LYS A CE    1 
ATOM   613  N  NZ    . LYS A 1 102 ? -64.177  -25.850 -26.349 1.00 82.94  ? 102  LYS A NZ    1 
ATOM   614  N  N     . LYS A 1 103 ? -65.409  -31.580 -22.879 1.00 72.12  ? 103  LYS A N     1 
ATOM   615  C  CA    . LYS A 1 103 ? -64.877  -32.794 -23.502 1.00 73.33  ? 103  LYS A CA    1 
ATOM   616  C  C     . LYS A 1 103 ? -65.436  -33.012 -24.907 1.00 79.55  ? 103  LYS A C     1 
ATOM   617  O  O     . LYS A 1 103 ? -66.526  -32.535 -25.234 1.00 78.29  ? 103  LYS A O     1 
ATOM   618  C  CB    . LYS A 1 103 ? -65.159  -34.022 -22.623 1.00 64.71  ? 103  LYS A CB    1 
ATOM   619  C  CG    . LYS A 1 103 ? -64.511  -33.992 -21.243 1.00 63.02  ? 103  LYS A CG    1 
ATOM   620  C  CD    . LYS A 1 103 ? -62.997  -34.131 -21.317 1.00 67.12  ? 103  LYS A CD    1 
ATOM   621  C  CE    . LYS A 1 103 ? -62.361  -34.006 -19.943 1.00 73.74  ? 103  LYS A CE    1 
ATOM   622  N  NZ    . LYS A 1 103 ? -60.876  -34.074 -20.015 1.00 72.72  ? 103  LYS A NZ    1 
ATOM   623  N  N     . LYS A 1 104 ? -64.679  -33.736 -25.729 1.00 79.86  ? 104  LYS A N     1 
ATOM   624  C  CA    . LYS A 1 104 ? -65.079  -34.047 -27.101 1.00 81.56  ? 104  LYS A CA    1 
ATOM   625  C  C     . LYS A 1 104 ? -66.151  -35.139 -27.141 1.00 79.15  ? 104  LYS A C     1 
ATOM   626  O  O     . LYS A 1 104 ? -67.158  -35.001 -27.839 1.00 78.39  ? 104  LYS A O     1 
ATOM   627  C  CB    . LYS A 1 104 ? -63.857  -34.456 -27.937 1.00 82.73  ? 104  LYS A CB    1 
ATOM   628  C  CG    . LYS A 1 104 ? -64.133  -34.699 -29.417 1.00 88.81  ? 104  LYS A CG    1 
ATOM   629  C  CD    . LYS A 1 104 ? -64.273  -33.400 -30.197 1.00 93.17  ? 104  LYS A CD    1 
ATOM   630  C  CE    . LYS A 1 104 ? -64.550  -33.670 -31.667 1.00 96.63  ? 104  LYS A CE    1 
ATOM   631  N  NZ    . LYS A 1 104 ? -64.690  -32.410 -32.448 1.00 85.77  ? 104  LYS A NZ    1 
ATOM   632  N  N     . SER A 1 105 ? -65.927  -36.216 -26.390 1.00 74.23  ? 105  SER A N     1 
ATOM   633  C  CA    . SER A 1 105 ? -66.860  -37.341 -26.338 1.00 74.03  ? 105  SER A CA    1 
ATOM   634  C  C     . SER A 1 105 ? -67.104  -37.803 -24.903 1.00 66.43  ? 105  SER A C     1 
ATOM   635  O  O     . SER A 1 105 ? -66.163  -37.943 -24.117 1.00 66.21  ? 105  SER A O     1 
ATOM   636  C  CB    . SER A 1 105 ? -66.348  -38.503 -27.192 1.00 76.59  ? 105  SER A CB    1 
ATOM   637  O  OG    . SER A 1 105 ? -66.215  -38.119 -28.549 1.00 81.27  ? 105  SER A OG    1 
ATOM   638  N  N     . VAL A 1 106 ? -68.374  -38.030 -24.571 1.00 63.86  ? 106  VAL A N     1 
ATOM   639  C  CA    . VAL A 1 106 ? -68.778  -38.445 -23.224 1.00 58.65  ? 106  VAL A CA    1 
ATOM   640  C  C     . VAL A 1 106 ? -69.597  -39.739 -23.277 1.00 58.07  ? 106  VAL A C     1 
ATOM   641  O  O     . VAL A 1 106 ? -70.395  -39.940 -24.197 1.00 65.32  ? 106  VAL A O     1 
ATOM   642  C  CB    . VAL A 1 106 ? -69.595  -37.347 -22.495 1.00 59.08  ? 106  VAL A CB    1 
ATOM   643  C  CG1   . VAL A 1 106 ? -69.715  -37.666 -21.011 1.00 72.38  ? 106  VAL A CG1   1 
ATOM   644  C  CG2   . VAL A 1 106 ? -68.963  -35.973 -22.675 1.00 60.39  ? 106  VAL A CG2   1 
ATOM   645  N  N     . THR A 1 107 ? -69.394  -40.608 -22.286 1.00 57.13  ? 107  THR A N     1 
ATOM   646  C  CA    . THR A 1 107 ? -70.100  -41.889 -22.198 1.00 56.71  ? 107  THR A CA    1 
ATOM   647  C  C     . THR A 1 107 ? -70.504  -42.203 -20.754 1.00 59.37  ? 107  THR A C     1 
ATOM   648  O  O     . THR A 1 107 ? -69.710  -42.025 -19.826 1.00 61.85  ? 107  THR A O     1 
ATOM   649  C  CB    . THR A 1 107 ? -69.242  -43.047 -22.759 1.00 55.85  ? 107  THR A CB    1 
ATOM   650  O  OG1   . THR A 1 107 ? -68.732  -42.691 -24.050 1.00 65.58  ? 107  THR A OG1   1 
ATOM   651  C  CG2   . THR A 1 107 ? -70.060  -44.329 -22.887 1.00 53.13  ? 107  THR A CG2   1 
ATOM   652  N  N     . VAL A 1 108 ? -71.740  -42.667 -20.577 1.00 55.85  ? 108  VAL A N     1 
ATOM   653  C  CA    . VAL A 1 108 ? -72.238  -43.099 -19.268 1.00 57.02  ? 108  VAL A CA    1 
ATOM   654  C  C     . VAL A 1 108 ? -72.396  -44.624 -19.221 1.00 53.63  ? 108  VAL A C     1 
ATOM   655  O  O     . VAL A 1 108 ? -72.721  -45.255 -20.231 1.00 57.60  ? 108  VAL A O     1 
ATOM   656  C  CB    . VAL A 1 108 ? -73.554  -42.371 -18.879 1.00 60.72  ? 108  VAL A CB    1 
ATOM   657  C  CG1   . VAL A 1 108 ? -74.748  -42.916 -19.654 1.00 72.93  ? 108  VAL A CG1   1 
ATOM   658  C  CG2   . VAL A 1 108 ? -73.801  -42.455 -17.379 1.00 62.07  ? 108  VAL A CG2   1 
ATOM   659  N  N     . LEU A 1 109 ? -72.146  -45.207 -18.050 1.00 53.74  ? 109  LEU A N     1 
ATOM   660  C  CA    . LEU A 1 109 ? -72.248  -46.654 -17.863 1.00 56.08  ? 109  LEU A CA    1 
ATOM   661  C  C     . LEU A 1 109 ? -73.079  -47.008 -16.629 1.00 63.27  ? 109  LEU A C     1 
ATOM   662  O  O     . LEU A 1 109 ? -72.693  -46.698 -15.499 1.00 68.56  ? 109  LEU A O     1 
ATOM   663  C  CB    . LEU A 1 109 ? -70.855  -47.296 -17.769 1.00 47.96  ? 109  LEU A CB    1 
ATOM   664  C  CG    . LEU A 1 109 ? -69.983  -47.389 -19.028 1.00 49.04  ? 109  LEU A CG    1 
ATOM   665  C  CD1   . LEU A 1 109 ? -69.149  -46.131 -19.230 1.00 58.34  ? 109  LEU A CD1   1 
ATOM   666  C  CD2   . LEU A 1 109 ? -69.074  -48.605 -18.947 1.00 46.37  ? 109  LEU A CD2   1 
ATOM   667  N  N     . ASP A 1 110 ? -74.221  -47.651 -16.861 1.00 64.76  ? 110  ASP A N     1 
ATOM   668  C  CA    . ASP A 1 110 ? -75.104  -48.094 -15.782 1.00 67.90  ? 110  ASP A CA    1 
ATOM   669  C  C     . ASP A 1 110 ? -74.705  -49.493 -15.318 1.00 73.81  ? 110  ASP A C     1 
ATOM   670  O  O     . ASP A 1 110 ? -74.921  -50.479 -16.027 1.00 82.46  ? 110  ASP A O     1 
ATOM   671  C  CB    . ASP A 1 110 ? -76.570  -48.075 -16.235 1.00 74.93  ? 110  ASP A CB    1 
ATOM   672  C  CG    . ASP A 1 110 ? -77.021  -46.707 -16.727 1.00 93.10  ? 110  ASP A CG    1 
ATOM   673  O  OD1   . ASP A 1 110 ? -76.563  -45.681 -16.178 1.00 99.24  ? 110  ASP A OD1   1 
ATOM   674  O  OD2   . ASP A 1 110 ? -77.847  -46.659 -17.663 1.00 98.00  ? 110  ASP A OD2   1 
ATOM   675  N  N     . VAL A 1 111 ? -74.125  -49.570 -14.123 1.00 68.11  ? 111  VAL A N     1 
ATOM   676  C  CA    . VAL A 1 111 ? -73.566  -50.823 -13.612 1.00 71.28  ? 111  VAL A CA    1 
ATOM   677  C  C     . VAL A 1 111 ? -74.637  -51.770 -13.062 1.00 73.50  ? 111  VAL A C     1 
ATOM   678  O  O     . VAL A 1 111 ? -75.331  -51.453 -12.092 1.00 77.21  ? 111  VAL A O     1 
ATOM   679  C  CB    . VAL A 1 111 ? -72.456  -50.574 -12.560 1.00 71.08  ? 111  VAL A CB    1 
ATOM   680  C  CG1   . VAL A 1 111 ? -71.979  -51.882 -11.944 1.00 68.24  ? 111  VAL A CG1   1 
ATOM   681  C  CG2   . VAL A 1 111 ? -71.283  -49.835 -13.189 1.00 71.63  ? 111  VAL A CG2   1 
ATOM   682  N  N     . GLY A 1 112 ? -74.765  -52.925 -13.712 1.00 75.04  ? 112  GLY A N     1 
ATOM   683  C  CA    . GLY A 1 112 ? -75.585  -54.024 -13.213 1.00 75.62  ? 112  GLY A CA    1 
ATOM   684  C  C     . GLY A 1 112 ? -74.748  -54.915 -12.315 1.00 80.25  ? 112  GLY A C     1 
ATOM   685  O  O     . GLY A 1 112 ? -73.519  -54.941 -12.435 1.00 82.28  ? 112  GLY A O     1 
ATOM   686  N  N     . ASP A 1 113 ? -75.415  -55.647 -11.422 1.00 89.13  ? 113  ASP A N     1 
ATOM   687  C  CA    . ASP A 1 113 ? -74.753  -56.455 -10.388 1.00 94.69  ? 113  ASP A CA    1 
ATOM   688  C  C     . ASP A 1 113 ? -73.824  -55.589 -9.531  1.00 94.05  ? 113  ASP A C     1 
ATOM   689  O  O     . ASP A 1 113 ? -72.663  -55.936 -9.303  1.00 87.73  ? 113  ASP A O     1 
ATOM   690  C  CB    . ASP A 1 113 ? -73.992  -57.644 -11.002 1.00 95.02  ? 113  ASP A CB    1 
ATOM   691  C  CG    . ASP A 1 113 ? -74.893  -58.575 -11.798 1.00 112.60 ? 113  ASP A CG    1 
ATOM   692  O  OD1   . ASP A 1 113 ? -75.594  -58.098 -12.717 1.00 116.41 ? 113  ASP A OD1   1 
ATOM   693  O  OD2   . ASP A 1 113 ? -74.889  -59.791 -11.512 1.00 122.38 ? 113  ASP A OD2   1 
ATOM   694  N  N     . ALA A 1 114 ? -74.352  -54.458 -9.068  1.00 87.35  ? 114  ALA A N     1 
ATOM   695  C  CA    . ALA A 1 114 ? -73.572  -53.479 -8.313  1.00 77.21  ? 114  ALA A CA    1 
ATOM   696  C  C     . ALA A 1 114 ? -73.309  -53.938 -6.879  1.00 80.39  ? 114  ALA A C     1 
ATOM   697  O  O     . ALA A 1 114 ? -72.160  -54.173 -6.499  1.00 81.80  ? 114  ALA A O     1 
ATOM   698  C  CB    . ALA A 1 114 ? -74.265  -52.122 -8.329  1.00 78.47  ? 114  ALA A CB    1 
ATOM   699  N  N     . TYR A 1 115 ? -74.377  -54.071 -6.096  1.00 80.69  ? 115  TYR A N     1 
ATOM   700  C  CA    . TYR A 1 115 ? -74.276  -54.508 -4.705  1.00 72.91  ? 115  TYR A CA    1 
ATOM   701  C  C     . TYR A 1 115 ? -74.190  -56.032 -4.597  1.00 76.18  ? 115  TYR A C     1 
ATOM   702  O  O     . TYR A 1 115 ? -73.844  -56.570 -3.542  1.00 81.68  ? 115  TYR A O     1 
ATOM   703  C  CB    . TYR A 1 115 ? -75.462  -53.982 -3.888  1.00 70.34  ? 115  TYR A CB    1 
ATOM   704  C  CG    . TYR A 1 115 ? -75.617  -52.475 -3.905  1.00 75.19  ? 115  TYR A CG    1 
ATOM   705  C  CD1   . TYR A 1 115 ? -74.856  -51.665 -3.061  1.00 68.37  ? 115  TYR A CD1   1 
ATOM   706  C  CD2   . TYR A 1 115 ? -76.531  -51.859 -4.759  1.00 85.51  ? 115  TYR A CD2   1 
ATOM   707  C  CE1   . TYR A 1 115 ? -74.997  -50.285 -3.073  1.00 65.97  ? 115  TYR A CE1   1 
ATOM   708  C  CE2   . TYR A 1 115 ? -76.680  -50.480 -4.778  1.00 90.51  ? 115  TYR A CE2   1 
ATOM   709  C  CZ    . TYR A 1 115 ? -75.912  -49.699 -3.934  1.00 76.12  ? 115  TYR A CZ    1 
ATOM   710  O  OH    . TYR A 1 115 ? -76.056  -48.330 -3.949  1.00 76.95  ? 115  TYR A OH    1 
ATOM   711  N  N     . PHE A 1 116 ? -74.500  -56.716 -5.697  1.00 85.14  ? 116  PHE A N     1 
ATOM   712  C  CA    . PHE A 1 116 ? -74.503  -58.179 -5.750  1.00 79.17  ? 116  PHE A CA    1 
ATOM   713  C  C     . PHE A 1 116 ? -73.086  -58.743 -5.904  1.00 75.39  ? 116  PHE A C     1 
ATOM   714  O  O     . PHE A 1 116 ? -72.783  -59.823 -5.392  1.00 75.05  ? 116  PHE A O     1 
ATOM   715  C  CB    . PHE A 1 116 ? -75.387  -58.667 -6.899  1.00 84.59  ? 116  PHE A CB    1 
ATOM   716  C  CG    . PHE A 1 116 ? -76.838  -58.309 -6.741  1.00 99.07  ? 116  PHE A CG    1 
ATOM   717  C  CD1   . PHE A 1 116 ? -77.679  -59.090 -5.967  1.00 100.00 ? 116  PHE A CD1   1 
ATOM   718  C  CD2   . PHE A 1 116 ? -77.361  -57.190 -7.368  1.00 103.71 ? 116  PHE A CD2   1 
ATOM   719  C  CE1   . PHE A 1 116 ? -79.012  -58.762 -5.819  1.00 106.27 ? 116  PHE A CE1   1 
ATOM   720  C  CE2   . PHE A 1 116 ? -78.694  -56.859 -7.225  1.00 110.95 ? 116  PHE A CE2   1 
ATOM   721  C  CZ    . PHE A 1 116 ? -79.522  -57.645 -6.449  1.00 116.37 ? 116  PHE A CZ    1 
ATOM   722  N  N     . SER A 1 117 ? -72.225  -58.009 -6.606  1.00 72.04  ? 117  SER A N     1 
ATOM   723  C  CA    . SER A 1 117 ? -70.851  -58.450 -6.865  1.00 69.85  ? 117  SER A CA    1 
ATOM   724  C  C     . SER A 1 117 ? -69.946  -58.359 -5.636  1.00 68.91  ? 117  SER A C     1 
ATOM   725  O  O     . SER A 1 117 ? -69.028  -59.167 -5.478  1.00 71.22  ? 117  SER A O     1 
ATOM   726  C  CB    . SER A 1 117 ? -70.237  -57.659 -8.022  1.00 78.08  ? 117  SER A CB    1 
ATOM   727  O  OG    . SER A 1 117 ? -70.212  -56.271 -7.736  1.00 89.12  ? 117  SER A OG    1 
ATOM   728  N  N     . VAL A 1 118 ? -70.207  -57.375 -4.777  1.00 69.29  ? 118  VAL A N     1 
ATOM   729  C  CA    . VAL A 1 118 ? -69.395  -57.150 -3.580  1.00 66.20  ? 118  VAL A CA    1 
ATOM   730  C  C     . VAL A 1 118 ? -69.978  -57.899 -2.376  1.00 61.21  ? 118  VAL A C     1 
ATOM   731  O  O     . VAL A 1 118 ? -71.101  -57.615 -1.952  1.00 61.21  ? 118  VAL A O     1 
ATOM   732  C  CB    . VAL A 1 118 ? -69.245  -55.644 -3.259  1.00 65.50  ? 118  VAL A CB    1 
ATOM   733  C  CG1   . VAL A 1 118 ? -68.343  -55.435 -2.049  1.00 65.35  ? 118  VAL A CG1   1 
ATOM   734  C  CG2   . VAL A 1 118 ? -68.696  -54.887 -4.461  1.00 63.40  ? 118  VAL A CG2   1 
ATOM   735  N  N     . PRO A 1 119 ? -69.211  -58.862 -1.826  1.00 64.33  ? 119  PRO A N     1 
ATOM   736  C  CA    . PRO A 1 119 ? -69.654  -59.657 -0.678  1.00 64.23  ? 119  PRO A CA    1 
ATOM   737  C  C     . PRO A 1 119 ? -69.586  -58.892 0.644   1.00 64.97  ? 119  PRO A C     1 
ATOM   738  O  O     . PRO A 1 119 ? -68.825  -57.929 0.769   1.00 64.42  ? 119  PRO A O     1 
ATOM   739  C  CB    . PRO A 1 119 ? -68.672  -60.831 -0.666  1.00 67.11  ? 119  PRO A CB    1 
ATOM   740  C  CG    . PRO A 1 119 ? -67.433  -60.290 -1.289  1.00 76.03  ? 119  PRO A CG    1 
ATOM   741  C  CD    . PRO A 1 119 ? -67.882  -59.283 -2.309  1.00 66.99  ? 119  PRO A CD    1 
ATOM   742  N  N     . LEU A 1 120 ? -70.384  -59.333 1.613   1.00 62.75  ? 120  LEU A N     1 
ATOM   743  C  CA    . LEU A 1 120 ? -70.454  -58.706 2.931   1.00 63.05  ? 120  LEU A CA    1 
ATOM   744  C  C     . LEU A 1 120 ? -69.504  -59.393 3.914   1.00 61.08  ? 120  LEU A C     1 
ATOM   745  O  O     . LEU A 1 120 ? -69.122  -60.550 3.712   1.00 58.77  ? 120  LEU A O     1 
ATOM   746  C  CB    . LEU A 1 120 ? -71.897  -58.762 3.455   1.00 57.17  ? 120  LEU A CB    1 
ATOM   747  C  CG    . LEU A 1 120 ? -72.319  -57.911 4.659   1.00 59.43  ? 120  LEU A CG    1 
ATOM   748  C  CD1   . LEU A 1 120 ? -72.446  -56.441 4.286   1.00 66.43  ? 120  LEU A CD1   1 
ATOM   749  C  CD2   . LEU A 1 120 ? -73.628  -58.428 5.235   1.00 58.05  ? 120  LEU A CD2   1 
ATOM   750  N  N     . ASP A 1 121 ? -69.123  -58.669 4.967   1.00 59.71  ? 121  ASP A N     1 
ATOM   751  C  CA    . ASP A 1 121 ? -68.298  -59.211 6.047   1.00 63.74  ? 121  ASP A CA    1 
ATOM   752  C  C     . ASP A 1 121 ? -69.004  -60.396 6.703   1.00 65.21  ? 121  ASP A C     1 
ATOM   753  O  O     . ASP A 1 121 ? -70.150  -60.277 7.143   1.00 68.98  ? 121  ASP A O     1 
ATOM   754  C  CB    . ASP A 1 121 ? -67.990  -58.125 7.085   1.00 65.54  ? 121  ASP A CB    1 
ATOM   755  C  CG    . ASP A 1 121 ? -67.073  -58.614 8.198   1.00 68.63  ? 121  ASP A CG    1 
ATOM   756  O  OD1   . ASP A 1 121 ? -66.092  -59.331 7.906   1.00 78.50  ? 121  ASP A OD1   1 
ATOM   757  O  OD2   . ASP A 1 121 ? -67.337  -58.276 9.372   1.00 71.70  ? 121  ASP A OD2   1 
ATOM   758  N  N     . GLU A 1 122 ? -68.305  -61.529 6.762   1.00 60.74  ? 122  GLU A N     1 
ATOM   759  C  CA    . GLU A 1 122 ? -68.888  -62.807 7.183   1.00 61.13  ? 122  GLU A CA    1 
ATOM   760  C  C     . GLU A 1 122 ? -69.505  -62.767 8.585   1.00 60.60  ? 122  GLU A C     1 
ATOM   761  O  O     . GLU A 1 122 ? -70.562  -63.357 8.818   1.00 59.70  ? 122  GLU A O     1 
ATOM   762  C  CB    . GLU A 1 122 ? -67.843  -63.926 7.093   1.00 58.42  ? 122  GLU A CB    1 
ATOM   763  C  CG    . GLU A 1 122 ? -68.329  -65.198 6.405   1.00 57.78  ? 122  GLU A CG    1 
ATOM   764  C  CD    . GLU A 1 122 ? -69.461  -65.896 7.141   1.00 57.87  ? 122  GLU A CD    1 
ATOM   765  O  OE1   . GLU A 1 122 ? -69.403  -65.998 8.384   1.00 67.48  ? 122  GLU A OE1   1 
ATOM   766  O  OE2   . GLU A 1 122 ? -70.408  -66.355 6.469   1.00 56.75  ? 122  GLU A OE2   1 
ATOM   767  N  N     . ASP A 1 123 ? -68.844  -62.065 9.503   1.00 65.03  ? 123  ASP A N     1 
ATOM   768  C  CA    . ASP A 1 123 ? -69.324  -61.924 10.879  1.00 70.66  ? 123  ASP A CA    1 
ATOM   769  C  C     . ASP A 1 123 ? -70.562  -61.031 10.981  1.00 70.22  ? 123  ASP A C     1 
ATOM   770  O  O     . ASP A 1 123 ? -71.370  -61.183 11.900  1.00 69.36  ? 123  ASP A O     1 
ATOM   771  C  CB    . ASP A 1 123 ? -68.210  -61.386 11.785  1.00 68.65  ? 123  ASP A CB    1 
ATOM   772  C  CG    . ASP A 1 123 ? -67.017  -62.326 11.876  1.00 73.45  ? 123  ASP A CG    1 
ATOM   773  O  OD1   . ASP A 1 123 ? -67.209  -63.560 11.820  1.00 68.75  ? 123  ASP A OD1   1 
ATOM   774  O  OD2   . ASP A 1 123 ? -65.880  -61.827 12.013  1.00 87.60  ? 123  ASP A OD2   1 
ATOM   775  N  N     . PHE A 1 124 ? -70.701  -60.105 10.034  1.00 71.55  ? 124  PHE A N     1 
ATOM   776  C  CA    . PHE A 1 124 ? -71.828  -59.173 10.005  1.00 69.45  ? 124  PHE A CA    1 
ATOM   777  C  C     . PHE A 1 124 ? -73.055  -59.768 9.309   1.00 66.01  ? 124  PHE A C     1 
ATOM   778  O  O     . PHE A 1 124 ? -74.176  -59.288 9.499   1.00 67.03  ? 124  PHE A O     1 
ATOM   779  C  CB    . PHE A 1 124 ? -71.418  -57.858 9.331   1.00 68.56  ? 124  PHE A CB    1 
ATOM   780  C  CG    . PHE A 1 124 ? -72.302  -56.692 9.682   1.00 72.64  ? 124  PHE A CG    1 
ATOM   781  C  CD1   . PHE A 1 124 ? -72.040  -55.919 10.809  1.00 77.64  ? 124  PHE A CD1   1 
ATOM   782  C  CD2   . PHE A 1 124 ? -73.393  -56.360 8.884   1.00 69.26  ? 124  PHE A CD2   1 
ATOM   783  C  CE1   . PHE A 1 124 ? -72.851  -54.843 11.136  1.00 67.12  ? 124  PHE A CE1   1 
ATOM   784  C  CE2   . PHE A 1 124 ? -74.210  -55.288 9.209   1.00 63.12  ? 124  PHE A CE2   1 
ATOM   785  C  CZ    . PHE A 1 124 ? -73.937  -54.526 10.335  1.00 59.88  ? 124  PHE A CZ    1 
ATOM   786  N  N     . ARG A 1 125 ? -72.836  -60.819 8.519   1.00 59.60  ? 125  ARG A N     1 
ATOM   787  C  CA    . ARG A 1 125 ? -73.892  -61.461 7.722   1.00 63.07  ? 125  ARG A CA    1 
ATOM   788  C  C     . ARG A 1 125 ? -75.091  -61.952 8.541   1.00 67.78  ? 125  ARG A C     1 
ATOM   789  O  O     . ARG A 1 125 ? -76.200  -62.067 8.014   1.00 73.81  ? 125  ARG A O     1 
ATOM   790  C  CB    . ARG A 1 125 ? -73.317  -62.619 6.899   1.00 62.12  ? 125  ARG A CB    1 
ATOM   791  C  CG    . ARG A 1 125 ? -72.397  -62.187 5.768   1.00 62.30  ? 125  ARG A CG    1 
ATOM   792  C  CD    . ARG A 1 125 ? -71.868  -63.382 4.992   1.00 58.30  ? 125  ARG A CD    1 
ATOM   793  N  NE    . ARG A 1 125 ? -70.897  -62.979 3.975   1.00 55.65  ? 125  ARG A NE    1 
ATOM   794  C  CZ    . ARG A 1 125 ? -70.265  -63.816 3.156   1.00 58.06  ? 125  ARG A CZ    1 
ATOM   795  N  NH1   . ARG A 1 125 ? -70.490  -65.123 3.219   1.00 60.05  ? 125  ARG A NH1   1 
ATOM   796  N  NH2   . ARG A 1 125 ? -69.401  -63.343 2.268   1.00 65.51  ? 125  ARG A NH2   1 
ATOM   797  N  N     . LYS A 1 126 ? -74.860  -62.234 9.821   1.00 68.22  ? 126  LYS A N     1 
ATOM   798  C  CA    . LYS A 1 126 ? -75.904  -62.753 10.709  1.00 65.26  ? 126  LYS A CA    1 
ATOM   799  C  C     . LYS A 1 126 ? -76.916  -61.696 11.169  1.00 70.47  ? 126  LYS A C     1 
ATOM   800  O  O     . LYS A 1 126 ? -78.008  -62.038 11.630  1.00 75.17  ? 126  LYS A O     1 
ATOM   801  C  CB    . LYS A 1 126 ? -75.286  -63.483 11.912  1.00 64.31  ? 126  LYS A CB    1 
ATOM   802  C  CG    . LYS A 1 126 ? -74.355  -62.645 12.777  1.00 63.37  ? 126  LYS A CG    1 
ATOM   803  C  CD    . LYS A 1 126 ? -73.603  -63.520 13.768  1.00 66.98  ? 126  LYS A CD    1 
ATOM   804  C  CE    . LYS A 1 126 ? -72.721  -62.697 14.695  1.00 62.79  ? 126  LYS A CE    1 
ATOM   805  N  NZ    . LYS A 1 126 ? -73.507  -61.985 15.740  1.00 77.20  ? 126  LYS A NZ    1 
ATOM   806  N  N     . TYR A 1 127 ? -76.553  -60.422 11.037  1.00 69.27  ? 127  TYR A N     1 
ATOM   807  C  CA    . TYR A 1 127 ? -77.435  -59.317 11.421  1.00 67.06  ? 127  TYR A CA    1 
ATOM   808  C  C     . TYR A 1 127 ? -78.419  -58.942 10.310  1.00 72.18  ? 127  TYR A C     1 
ATOM   809  O  O     . TYR A 1 127 ? -79.416  -58.260 10.559  1.00 73.35  ? 127  TYR A O     1 
ATOM   810  C  CB    . TYR A 1 127 ? -76.620  -58.087 11.840  1.00 61.43  ? 127  TYR A CB    1 
ATOM   811  C  CG    . TYR A 1 127 ? -75.597  -58.353 12.926  1.00 63.89  ? 127  TYR A CG    1 
ATOM   812  C  CD1   . TYR A 1 127 ? -75.993  -58.678 14.225  1.00 68.46  ? 127  TYR A CD1   1 
ATOM   813  C  CD2   . TYR A 1 127 ? -74.232  -58.266 12.657  1.00 66.38  ? 127  TYR A CD2   1 
ATOM   814  C  CE1   . TYR A 1 127 ? -75.058  -58.921 15.219  1.00 67.71  ? 127  TYR A CE1   1 
ATOM   815  C  CE2   . TYR A 1 127 ? -73.289  -58.504 13.646  1.00 69.58  ? 127  TYR A CE2   1 
ATOM   816  C  CZ    . TYR A 1 127 ? -73.707  -58.830 14.924  1.00 67.82  ? 127  TYR A CZ    1 
ATOM   817  O  OH    . TYR A 1 127 ? -72.774  -59.067 15.907  1.00 71.62  ? 127  TYR A OH    1 
ATOM   818  N  N     . THR A 1 128 ? -78.134  -59.398 9.091   1.00 72.64  ? 128  THR A N     1 
ATOM   819  C  CA    . THR A 1 128 ? -78.969  -59.104 7.922   1.00 74.20  ? 128  THR A CA    1 
ATOM   820  C  C     . THR A 1 128 ? -80.021  -60.190 7.667   1.00 76.76  ? 128  THR A C     1 
ATOM   821  O  O     . THR A 1 128 ? -80.597  -60.266 6.578   1.00 77.60  ? 128  THR A O     1 
ATOM   822  C  CB    . THR A 1 128 ? -78.112  -58.913 6.650   1.00 73.92  ? 128  THR A CB    1 
ATOM   823  O  OG1   . THR A 1 128 ? -77.286  -60.066 6.446   1.00 68.16  ? 128  THR A OG1   1 
ATOM   824  C  CG2   . THR A 1 128 ? -77.232  -57.673 6.768   1.00 68.45  ? 128  THR A CG2   1 
ATOM   825  N  N     . ALA A 1 129 ? -80.272  -61.016 8.682   1.00 74.93  ? 129  ALA A N     1 
ATOM   826  C  CA    . ALA A 1 129 ? -81.194  -62.145 8.571   1.00 80.75  ? 129  ALA A CA    1 
ATOM   827  C  C     . ALA A 1 129 ? -82.656  -61.709 8.487   1.00 86.36  ? 129  ALA A C     1 
ATOM   828  O  O     . ALA A 1 129 ? -83.103  -60.849 9.249   1.00 84.61  ? 129  ALA A O     1 
ATOM   829  C  CB    . ALA A 1 129 ? -80.992  -63.108 9.732   1.00 76.48  ? 129  ALA A CB    1 
ATOM   830  N  N     . PHE A 1 130 ? -83.389  -62.312 7.552   1.00 88.79  ? 130  PHE A N     1 
ATOM   831  C  CA    . PHE A 1 130 ? -84.818  -62.047 7.384   1.00 89.68  ? 130  PHE A CA    1 
ATOM   832  C  C     . PHE A 1 130 ? -85.629  -63.339 7.271   1.00 92.43  ? 130  PHE A C     1 
ATOM   833  O  O     . PHE A 1 130 ? -85.178  -64.316 6.668   1.00 93.56  ? 130  PHE A O     1 
ATOM   834  C  CB    . PHE A 1 130 ? -85.077  -61.118 6.185   1.00 84.27  ? 130  PHE A CB    1 
ATOM   835  C  CG    . PHE A 1 130 ? -84.638  -61.678 4.856   1.00 78.98  ? 130  PHE A CG    1 
ATOM   836  C  CD1   . PHE A 1 130 ? -83.335  -61.492 4.401   1.00 83.40  ? 130  PHE A CD1   1 
ATOM   837  C  CD2   . PHE A 1 130 ? -85.535  -62.366 4.044   1.00 72.39  ? 130  PHE A CD2   1 
ATOM   838  C  CE1   . PHE A 1 130 ? -82.933  -61.999 3.174   1.00 79.98  ? 130  PHE A CE1   1 
ATOM   839  C  CE2   . PHE A 1 130 ? -85.138  -62.874 2.816   1.00 73.55  ? 130  PHE A CE2   1 
ATOM   840  C  CZ    . PHE A 1 130 ? -83.836  -62.687 2.380   1.00 73.07  ? 130  PHE A CZ    1 
ATOM   841  N  N     . THR A 1 131 ? -86.824  -63.330 7.857   1.00 93.93  ? 131  THR A N     1 
ATOM   842  C  CA    . THR A 1 131 ? -87.696  -64.504 7.882   1.00 96.54  ? 131  THR A CA    1 
ATOM   843  C  C     . THR A 1 131 ? -88.924  -64.298 6.994   1.00 97.71  ? 131  THR A C     1 
ATOM   844  O  O     . THR A 1 131 ? -89.593  -63.264 7.073   1.00 95.94  ? 131  THR A O     1 
ATOM   845  C  CB    . THR A 1 131 ? -88.143  -64.845 9.322   1.00 95.90  ? 131  THR A CB    1 
ATOM   846  O  OG1   . THR A 1 131 ? -87.011  -64.813 10.200  1.00 93.44  ? 131  THR A OG1   1 
ATOM   847  C  CG2   . THR A 1 131 ? -88.787  -66.228 9.386   1.00 101.31 ? 131  THR A CG2   1 
ATOM   848  N  N     . ILE A 1 132 ? -89.205  -65.289 6.149   1.00 104.28 ? 132  ILE A N     1 
ATOM   849  C  CA    . ILE A 1 132 ? -90.374  -65.265 5.271   1.00 108.91 ? 132  ILE A CA    1 
ATOM   850  C  C     . ILE A 1 132 ? -91.642  -65.622 6.063   1.00 110.08 ? 132  ILE A C     1 
ATOM   851  O  O     . ILE A 1 132 ? -91.588  -66.460 6.969   1.00 114.20 ? 132  ILE A O     1 
ATOM   852  C  CB    . ILE A 1 132 ? -90.177  -66.195 4.038   1.00 93.79  ? 132  ILE A CB    1 
ATOM   853  C  CG1   . ILE A 1 132 ? -90.984  -65.706 2.828   1.00 86.78  ? 132  ILE A CG1   1 
ATOM   854  C  CG2   . ILE A 1 132 ? -90.499  -67.650 4.361   1.00 93.08  ? 132  ILE A CG2   1 
ATOM   855  C  CD1   . ILE A 1 132 ? -90.346  -64.554 2.079   1.00 86.82  ? 132  ILE A CD1   1 
ATOM   856  N  N     . PRO A 1 133 ? -92.778  -64.961 5.751   1.00 112.30 ? 133  PRO A N     1 
ATOM   857  C  CA    . PRO A 1 133 ? -94.052  -65.315 6.386   1.00 113.50 ? 133  PRO A CA    1 
ATOM   858  C  C     . PRO A 1 133 ? -94.507  -66.739 6.061   1.00 113.47 ? 133  PRO A C     1 
ATOM   859  O  O     . PRO A 1 133 ? -94.198  -67.265 4.989   1.00 114.68 ? 133  PRO A O     1 
ATOM   860  C  CB    . PRO A 1 133 ? -95.032  -64.297 5.798   1.00 119.97 ? 133  PRO A CB    1 
ATOM   861  C  CG    . PRO A 1 133 ? -94.185  -63.126 5.442   1.00 113.82 ? 133  PRO A CG    1 
ATOM   862  C  CD    . PRO A 1 133 ? -92.889  -63.715 4.968   1.00 107.81 ? 133  PRO A CD    1 
ATOM   863  N  N     . SER A 1 134 ? -95.243  -67.340 6.993   1.00 112.61 ? 134  SER A N     1 
ATOM   864  C  CA    . SER A 1 134 ? -95.666  -68.737 6.899   1.00 113.41 ? 134  SER A CA    1 
ATOM   865  C  C     . SER A 1 134 ? -96.808  -68.960 5.904   1.00 113.52 ? 134  SER A C     1 
ATOM   866  O  O     . SER A 1 134 ? -97.425  -68.005 5.427   1.00 115.80 ? 134  SER A O     1 
ATOM   867  C  CB    . SER A 1 134 ? -96.070  -69.251 8.283   1.00 113.14 ? 134  SER A CB    1 
ATOM   868  O  OG    . SER A 1 134 ? -97.156  -68.508 8.808   1.00 113.63 ? 134  SER A OG    1 
ATOM   869  N  N     . ILE A 1 135 ? -97.078  -70.229 5.603   1.00 111.94 ? 135  ILE A N     1 
ATOM   870  C  CA    . ILE A 1 135 ? -98.162  -70.612 4.697   1.00 114.02 ? 135  ILE A CA    1 
ATOM   871  C  C     . ILE A 1 135 ? -99.478  -70.779 5.463   1.00 114.96 ? 135  ILE A C     1 
ATOM   872  O  O     . ILE A 1 135 ? -100.500 -70.201 5.082   1.00 109.06 ? 135  ILE A O     1 
ATOM   873  C  CB    . ILE A 1 135 ? -97.825  -71.907 3.909   1.00 108.19 ? 135  ILE A CB    1 
ATOM   874  C  CG1   . ILE A 1 135 ? -96.479  -71.781 3.170   1.00 102.29 ? 135  ILE A CG1   1 
ATOM   875  C  CG2   . ILE A 1 135 ? -98.957  -72.290 2.958   1.00 94.73  ? 135  ILE A CG2   1 
ATOM   876  C  CD1   . ILE A 1 135 ? -96.408  -70.694 2.113   1.00 83.43  ? 135  ILE A CD1   1 
ATOM   877  N  N     . ASN A 1 136 ? -99.444  -71.562 6.541   1.00 110.15 ? 136  ASN A N     1 
ATOM   878  C  CA    . ASN A 1 136 ? -100.640 -71.840 7.336   1.00 111.74 ? 136  ASN A CA    1 
ATOM   879  C  C     . ASN A 1 136 ? -100.420 -71.714 8.846   1.00 110.98 ? 136  ASN A C     1 
ATOM   880  O  O     . ASN A 1 136 ? -100.023 -72.676 9.511   1.00 106.94 ? 136  ASN A O     1 
ATOM   881  C  CB    . ASN A 1 136 ? -101.210 -73.219 6.986   1.00 91.85  ? 136  ASN A CB    1 
ATOM   882  N  N     . ASN A 1 137 ? -100.683 -70.515 9.366   1.00 109.99 ? 137  ASN A N     1 
ATOM   883  C  CA    . ASN A 1 137 ? -100.622 -70.209 10.804  1.00 110.27 ? 137  ASN A CA    1 
ATOM   884  C  C     . ASN A 1 137 ? -99.287  -70.515 11.497  1.00 110.95 ? 137  ASN A C     1 
ATOM   885  O  O     . ASN A 1 137 ? -99.138  -71.550 12.155  1.00 109.92 ? 137  ASN A O     1 
ATOM   886  C  CB    . ASN A 1 137 ? -101.794 -70.860 11.555  1.00 100.23 ? 137  ASN A CB    1 
ATOM   887  N  N     . GLU A 1 138 ? -98.330  -69.602 11.332  1.00 108.12 ? 138  GLU A N     1 
ATOM   888  C  CA    . GLU A 1 138 ? -97.031  -69.638 12.023  1.00 113.97 ? 138  GLU A CA    1 
ATOM   889  C  C     . GLU A 1 138 ? -96.252  -70.959 11.910  1.00 123.20 ? 138  GLU A C     1 
ATOM   890  O  O     . GLU A 1 138 ? -95.610  -71.394 12.871  1.00 120.35 ? 138  GLU A O     1 
ATOM   891  C  CB    . GLU A 1 138 ? -97.191  -69.224 13.494  1.00 103.63 ? 138  GLU A CB    1 
ATOM   892  N  N     . THR A 1 139 ? -96.314  -71.587 10.737  1.00 123.62 ? 139  THR A N     1 
ATOM   893  C  CA    . THR A 1 139 ? -95.508  -72.776 10.445  1.00 121.32 ? 139  THR A CA    1 
ATOM   894  C  C     . THR A 1 139 ? -94.027  -72.396 10.329  1.00 128.55 ? 139  THR A C     1 
ATOM   895  O  O     . THR A 1 139 ? -93.716  -71.290 9.880   1.00 120.57 ? 139  THR A O     1 
ATOM   896  C  CB    . THR A 1 139 ? -95.973  -73.493 9.156   1.00 114.74 ? 139  THR A CB    1 
ATOM   897  O  OG1   . THR A 1 139 ? -96.308  -72.527 8.152   1.00 109.84 ? 139  THR A OG1   1 
ATOM   898  C  CG2   . THR A 1 139 ? -97.184  -74.370 9.437   1.00 99.22  ? 139  THR A CG2   1 
ATOM   899  N  N     . PRO A 1 140 ? -93.113  -73.309 10.736  1.00 129.00 ? 140  PRO A N     1 
ATOM   900  C  CA    . PRO A 1 140 ? -91.666  -73.089 10.817  1.00 122.62 ? 140  PRO A CA    1 
ATOM   901  C  C     . PRO A 1 140 ? -91.111  -71.976 9.918   1.00 115.46 ? 140  PRO A C     1 
ATOM   902  O  O     . PRO A 1 140 ? -90.444  -71.066 10.415  1.00 113.65 ? 140  PRO A O     1 
ATOM   903  C  CB    . PRO A 1 140 ? -91.098  -74.452 10.412  1.00 107.19 ? 140  PRO A CB    1 
ATOM   904  C  CG    . PRO A 1 140 ? -92.150  -75.439 10.826  1.00 114.84 ? 140  PRO A CG    1 
ATOM   905  C  CD    . PRO A 1 140 ? -93.435  -74.698 11.109  1.00 120.47 ? 140  PRO A CD    1 
ATOM   906  N  N     . GLY A 1 141 ? -91.385  -72.054 8.617   1.00 112.95 ? 141  GLY A N     1 
ATOM   907  C  CA    . GLY A 1 141 ? -90.970  -71.017 7.672   1.00 106.73 ? 141  GLY A CA    1 
ATOM   908  C  C     . GLY A 1 141 ? -89.532  -71.140 7.204   1.00 109.04 ? 141  GLY A C     1 
ATOM   909  O  O     . GLY A 1 141 ? -88.765  -71.958 7.719   1.00 111.84 ? 141  GLY A O     1 
ATOM   910  N  N     . ILE A 1 142 ? -89.171  -70.317 6.222   1.00 98.77  ? 142  ILE A N     1 
ATOM   911  C  CA    . ILE A 1 142 ? -87.831  -70.333 5.636   1.00 102.55 ? 142  ILE A CA    1 
ATOM   912  C  C     . ILE A 1 142 ? -87.069  -69.062 6.016   1.00 99.94  ? 142  ILE A C     1 
ATOM   913  O  O     . ILE A 1 142 ? -87.617  -67.958 5.960   1.00 95.37  ? 142  ILE A O     1 
ATOM   914  C  CB    . ILE A 1 142 ? -87.873  -70.479 4.091   1.00 96.32  ? 142  ILE A CB    1 
ATOM   915  C  CG1   . ILE A 1 142 ? -88.985  -71.446 3.638   1.00 97.60  ? 142  ILE A CG1   1 
ATOM   916  C  CG2   . ILE A 1 142 ? -86.508  -70.886 3.542   1.00 93.37  ? 142  ILE A CG2   1 
ATOM   917  C  CD1   . ILE A 1 142 ? -88.785  -72.904 4.013   1.00 105.12 ? 142  ILE A CD1   1 
ATOM   918  N  N     . ARG A 1 143 ? -85.807  -69.228 6.405   1.00 95.01  ? 143  ARG A N     1 
ATOM   919  C  CA    . ARG A 1 143 ? -84.962  -68.108 6.818   1.00 90.19  ? 143  ARG A CA    1 
ATOM   920  C  C     . ARG A 1 143 ? -83.766  -67.924 5.886   1.00 91.04  ? 143  ARG A C     1 
ATOM   921  O  O     . ARG A 1 143 ? -83.194  -68.900 5.396   1.00 88.70  ? 143  ARG A O     1 
ATOM   922  C  CB    . ARG A 1 143 ? -84.476  -68.303 8.257   1.00 89.85  ? 143  ARG A CB    1 
ATOM   923  C  CG    . ARG A 1 143 ? -85.570  -68.248 9.312   1.00 98.11  ? 143  ARG A CG    1 
ATOM   924  C  CD    . ARG A 1 143 ? -85.032  -68.587 10.695  1.00 98.81  ? 143  ARG A CD    1 
ATOM   925  N  NE    . ARG A 1 143 ? -84.071  -67.596 11.179  1.00 96.88  ? 143  ARG A NE    1 
ATOM   926  C  CZ    . ARG A 1 143 ? -84.387  -66.522 11.900  1.00 100.50 ? 143  ARG A CZ    1 
ATOM   927  N  NH1   . ARG A 1 143 ? -85.649  -66.281 12.235  1.00 102.80 ? 143  ARG A NH1   1 
ATOM   928  N  NH2   . ARG A 1 143 ? -83.436  -65.684 12.288  1.00 89.11  ? 143  ARG A NH2   1 
ATOM   929  N  N     . TYR A 1 144 ? -83.399  -66.666 5.651   1.00 83.42  ? 144  TYR A N     1 
ATOM   930  C  CA    . TYR A 1 144 ? -82.251  -66.326 4.809   1.00 81.08  ? 144  TYR A CA    1 
ATOM   931  C  C     . TYR A 1 144 ? -81.391  -65.230 5.436   1.00 83.81  ? 144  TYR A C     1 
ATOM   932  O  O     . TYR A 1 144 ? -81.851  -64.490 6.308   1.00 78.63  ? 144  TYR A O     1 
ATOM   933  C  CB    . TYR A 1 144 ? -82.711  -65.871 3.420   1.00 82.67  ? 144  TYR A CB    1 
ATOM   934  C  CG    . TYR A 1 144 ? -83.455  -66.911 2.613   1.00 82.96  ? 144  TYR A CG    1 
ATOM   935  C  CD1   . TYR A 1 144 ? -82.769  -67.929 1.949   1.00 92.83  ? 144  TYR A CD1   1 
ATOM   936  C  CD2   . TYR A 1 144 ? -84.843  -66.866 2.496   1.00 82.36  ? 144  TYR A CD2   1 
ATOM   937  C  CE1   . TYR A 1 144 ? -83.448  -68.879 1.202   1.00 92.41  ? 144  TYR A CE1   1 
ATOM   938  C  CE2   . TYR A 1 144 ? -85.530  -67.811 1.750   1.00 87.02  ? 144  TYR A CE2   1 
ATOM   939  C  CZ    . TYR A 1 144 ? -84.829  -68.815 1.106   1.00 95.30  ? 144  TYR A CZ    1 
ATOM   940  O  OH    . TYR A 1 144 ? -85.507  -69.756 0.365   1.00 100.96 ? 144  TYR A OH    1 
ATOM   941  N  N     . GLN A 1 145 ? -80.143  -65.138 4.981   1.00 81.88  ? 145  GLN A N     1 
ATOM   942  C  CA    . GLN A 1 145 ? -79.233  -64.061 5.379   1.00 76.18  ? 145  GLN A CA    1 
ATOM   943  C  C     . GLN A 1 145 ? -78.364  -63.615 4.201   1.00 73.57  ? 145  GLN A C     1 
ATOM   944  O  O     . GLN A 1 145 ? -77.932  -64.439 3.393   1.00 74.30  ? 145  GLN A O     1 
ATOM   945  C  CB    . GLN A 1 145 ? -78.366  -64.472 6.579   1.00 75.41  ? 145  GLN A CB    1 
ATOM   946  C  CG    . GLN A 1 145 ? -77.531  -65.733 6.383   1.00 81.78  ? 145  GLN A CG    1 
ATOM   947  C  CD    . GLN A 1 145 ? -76.601  -66.017 7.550   1.00 77.91  ? 145  GLN A CD    1 
ATOM   948  O  OE1   . GLN A 1 145 ? -76.952  -65.803 8.712   1.00 76.40  ? 145  GLN A OE1   1 
ATOM   949  N  NE2   . GLN A 1 145 ? -75.407  -66.512 7.244   1.00 77.48  ? 145  GLN A NE2   1 
ATOM   950  N  N     . TYR A 1 146 ? -78.121  -62.309 4.113   1.00 70.30  ? 146  TYR A N     1 
ATOM   951  C  CA    . TYR A 1 146 ? -77.346  -61.728 3.015   1.00 71.65  ? 146  TYR A CA    1 
ATOM   952  C  C     . TYR A 1 146 ? -75.862  -62.077 3.093   1.00 65.95  ? 146  TYR A C     1 
ATOM   953  O  O     . TYR A 1 146 ? -75.222  -61.878 4.127   1.00 69.94  ? 146  TYR A O     1 
ATOM   954  C  CB    . TYR A 1 146 ? -77.522  -60.207 2.971   1.00 71.56  ? 146  TYR A CB    1 
ATOM   955  C  CG    . TYR A 1 146 ? -78.792  -59.745 2.291   1.00 72.11  ? 146  TYR A CG    1 
ATOM   956  C  CD1   . TYR A 1 146 ? -78.836  -59.554 0.910   1.00 67.45  ? 146  TYR A CD1   1 
ATOM   957  C  CD2   . TYR A 1 146 ? -79.947  -59.490 3.028   1.00 73.14  ? 146  TYR A CD2   1 
ATOM   958  C  CE1   . TYR A 1 146 ? -79.996  -59.128 0.282   1.00 71.78  ? 146  TYR A CE1   1 
ATOM   959  C  CE2   . TYR A 1 146 ? -81.112  -59.063 2.409   1.00 68.72  ? 146  TYR A CE2   1 
ATOM   960  C  CZ    . TYR A 1 146 ? -81.132  -58.884 1.037   1.00 70.80  ? 146  TYR A CZ    1 
ATOM   961  O  OH    . TYR A 1 146 ? -82.286  -58.461 0.419   1.00 74.07  ? 146  TYR A OH    1 
ATOM   962  N  N     . ASN A 1 147 ? -75.331  -62.602 1.991   1.00 58.94  ? 147  ASN A N     1 
ATOM   963  C  CA    . ASN A 1 147 ? -73.899  -62.858 1.855   1.00 61.01  ? 147  ASN A CA    1 
ATOM   964  C  C     . ASN A 1 147 ? -73.194  -61.699 1.156   1.00 62.86  ? 147  ASN A C     1 
ATOM   965  O  O     . ASN A 1 147 ? -71.971  -61.562 1.236   1.00 67.18  ? 147  ASN A O     1 
ATOM   966  C  CB    . ASN A 1 147 ? -73.650  -64.167 1.098   1.00 62.79  ? 147  ASN A CB    1 
ATOM   967  C  CG    . ASN A 1 147 ? -74.145  -65.388 1.853   1.00 67.69  ? 147  ASN A CG    1 
ATOM   968  O  OD1   . ASN A 1 147 ? -73.919  -65.527 3.057   1.00 66.59  ? 147  ASN A OD1   1 
ATOM   969  N  ND2   . ASN A 1 147 ? -74.816  -66.287 1.143   1.00 73.55  ? 147  ASN A ND2   1 
ATOM   970  N  N     . VAL A 1 148 ? -73.982  -60.872 0.472   1.00 63.32  ? 148  VAL A N     1 
ATOM   971  C  CA    . VAL A 1 148 ? -73.480  -59.698 -0.244  1.00 63.04  ? 148  VAL A CA    1 
ATOM   972  C  C     . VAL A 1 148 ? -74.125  -58.415 0.296   1.00 61.52  ? 148  VAL A C     1 
ATOM   973  O  O     . VAL A 1 148 ? -74.871  -58.459 1.278   1.00 64.99  ? 148  VAL A O     1 
ATOM   974  C  CB    . VAL A 1 148 ? -73.699  -59.820 -1.774  1.00 54.45  ? 148  VAL A CB    1 
ATOM   975  C  CG1   . VAL A 1 148 ? -72.870  -60.963 -2.344  1.00 59.10  ? 148  VAL A CG1   1 
ATOM   976  C  CG2   . VAL A 1 148 ? -75.176  -60.001 -2.109  1.00 58.24  ? 148  VAL A CG2   1 
ATOM   977  N  N     . LEU A 1 149 ? -73.830  -57.282 -0.340  1.00 54.53  ? 149  LEU A N     1 
ATOM   978  C  CA    . LEU A 1 149 ? -74.406  -55.995 0.053   1.00 52.60  ? 149  LEU A CA    1 
ATOM   979  C  C     . LEU A 1 149 ? -75.898  -55.926 -0.285  1.00 61.41  ? 149  LEU A C     1 
ATOM   980  O  O     . LEU A 1 149 ? -76.281  -56.120 -1.441  1.00 67.39  ? 149  LEU A O     1 
ATOM   981  C  CB    . LEU A 1 149 ? -73.655  -54.830 -0.606  1.00 52.82  ? 149  LEU A CB    1 
ATOM   982  C  CG    . LEU A 1 149 ? -72.198  -54.554 -0.217  1.00 56.20  ? 149  LEU A CG    1 
ATOM   983  C  CD1   . LEU A 1 149 ? -71.593  -53.518 -1.153  1.00 47.36  ? 149  LEU A CD1   1 
ATOM   984  C  CD2   . LEU A 1 149 ? -72.071  -54.099 1.231   1.00 55.02  ? 149  LEU A CD2   1 
ATOM   985  N  N     . PRO A 1 150 ? -76.745  -55.661 0.730   1.00 61.37  ? 150  PRO A N     1 
ATOM   986  C  CA    . PRO A 1 150 ? -78.190  -55.569 0.521   1.00 65.03  ? 150  PRO A CA    1 
ATOM   987  C  C     . PRO A 1 150 ? -78.656  -54.165 0.128   1.00 63.14  ? 150  PRO A C     1 
ATOM   988  O  O     . PRO A 1 150 ? -77.977  -53.178 0.420   1.00 60.83  ? 150  PRO A O     1 
ATOM   989  C  CB    . PRO A 1 150 ? -78.759  -55.956 1.887   1.00 65.75  ? 150  PRO A CB    1 
ATOM   990  C  CG    . PRO A 1 150 ? -77.707  -55.555 2.868   1.00 59.64  ? 150  PRO A CG    1 
ATOM   991  C  CD    . PRO A 1 150 ? -76.383  -55.513 2.153   1.00 58.80  ? 150  PRO A CD    1 
ATOM   992  N  N     . GLN A 1 151 ? -79.810  -54.092 -0.532  1.00 70.83  ? 151  GLN A N     1 
ATOM   993  C  CA    . GLN A 1 151 ? -80.402  -52.818 -0.937  1.00 75.18  ? 151  GLN A CA    1 
ATOM   994  C  C     . GLN A 1 151 ? -81.058  -52.111 0.246   1.00 73.85  ? 151  GLN A C     1 
ATOM   995  O  O     . GLN A 1 151 ? -81.789  -52.729 1.023   1.00 67.58  ? 151  GLN A O     1 
ATOM   996  C  CB    . GLN A 1 151 ? -81.424  -53.026 -2.061  1.00 75.80  ? 151  GLN A CB    1 
ATOM   997  C  CG    . GLN A 1 151 ? -80.817  -53.290 -3.434  1.00 78.91  ? 151  GLN A CG    1 
ATOM   998  C  CD    . GLN A 1 151 ? -80.385  -52.026 -4.162  1.00 97.54  ? 151  GLN A CD    1 
ATOM   999  O  OE1   . GLN A 1 151 ? -80.542  -50.911 -3.661  1.00 101.37 ? 151  GLN A OE1   1 
ATOM   1000 N  NE2   . GLN A 1 151 ? -79.838  -52.199 -5.360  1.00 99.23  ? 151  GLN A NE2   1 
ATOM   1001 N  N     . GLY A 1 152 ? -80.788  -50.814 0.371   1.00 70.76  ? 152  GLY A N     1 
ATOM   1002 C  CA    . GLY A 1 152 ? -81.342  -50.002 1.453   1.00 71.78  ? 152  GLY A CA    1 
ATOM   1003 C  C     . GLY A 1 152 ? -80.575  -50.121 2.758   1.00 74.54  ? 152  GLY A C     1 
ATOM   1004 O  O     . GLY A 1 152 ? -81.144  -49.941 3.837   1.00 77.80  ? 152  GLY A O     1 
ATOM   1005 N  N     . TRP A 1 153 ? -79.282  -50.426 2.657   1.00 70.28  ? 153  TRP A N     1 
ATOM   1006 C  CA    . TRP A 1 153 ? -78.412  -50.539 3.826   1.00 66.27  ? 153  TRP A CA    1 
ATOM   1007 C  C     . TRP A 1 153 ? -77.486  -49.357 3.928   1.00 66.48  ? 153  TRP A C     1 
ATOM   1008 O  O     . TRP A 1 153 ? -77.080  -48.786 2.912   1.00 65.10  ? 153  TRP A O     1 
ATOM   1009 C  CB    . TRP A 1 153 ? -77.632  -51.854 3.793   1.00 67.00  ? 153  TRP A CB    1 
ATOM   1010 C  CG    . TRP A 1 153 ? -76.786  -52.107 5.022   1.00 63.13  ? 153  TRP A CG    1 
ATOM   1011 C  CD1   . TRP A 1 153 ? -77.204  -52.137 6.352   1.00 64.11  ? 153  TRP A CD1   1 
ATOM   1012 C  CD2   . TRP A 1 153 ? -75.342  -52.385 5.073   1.00 65.86  ? 153  TRP A CD2   1 
ATOM   1013 N  NE1   . TRP A 1 153 ? -76.150  -52.398 7.192   1.00 64.34  ? 153  TRP A NE1   1 
ATOM   1014 C  CE2   . TRP A 1 153 ? -75.007  -52.559 6.492   1.00 66.80  ? 153  TRP A CE2   1 
ATOM   1015 C  CE3   . TRP A 1 153 ? -74.333  -52.503 4.124   1.00 64.84  ? 153  TRP A CE3   1 
ATOM   1016 C  CZ2   . TRP A 1 153 ? -73.714  -52.833 6.914   1.00 61.19  ? 153  TRP A CZ2   1 
ATOM   1017 C  CZ3   . TRP A 1 153 ? -73.031  -52.780 4.563   1.00 60.64  ? 153  TRP A CZ3   1 
ATOM   1018 C  CH2   . TRP A 1 153 ? -72.732  -52.942 5.925   1.00 59.52  ? 153  TRP A CH2   1 
ATOM   1019 N  N     . LYS A 1 154 ? -77.154  -48.986 5.164   1.00 63.31  ? 154  LYS A N     1 
ATOM   1020 C  CA    . LYS A 1 154 ? -76.357  -47.793 5.464   1.00 63.74  ? 154  LYS A CA    1 
ATOM   1021 C  C     . LYS A 1 154 ? -74.963  -47.806 4.828   1.00 64.11  ? 154  LYS A C     1 
ATOM   1022 O  O     . LYS A 1 154 ? -74.525  -46.799 4.266   1.00 61.30  ? 154  LYS A O     1 
ATOM   1023 C  CB    . LYS A 1 154 ? -76.245  -47.606 6.982   1.00 64.39  ? 154  LYS A CB    1 
ATOM   1024 C  CG    . LYS A 1 154 ? -75.712  -46.252 7.423   1.00 65.11  ? 154  LYS A CG    1 
ATOM   1025 C  CD    . LYS A 1 154 ? -75.613  -46.171 8.938   1.00 68.25  ? 154  LYS A CD    1 
ATOM   1026 C  CE    . LYS A 1 154 ? -75.066  -44.826 9.387   1.00 77.87  ? 154  LYS A CE    1 
ATOM   1027 N  NZ    . LYS A 1 154 ? -74.973  -44.733 10.870  1.00 77.06  ? 154  LYS A NZ    1 
ATOM   1028 N  N     . GLY A 1 155 ? -74.277  -48.943 4.917   1.00 63.89  ? 155  GLY A N     1 
ATOM   1029 C  CA    . GLY A 1 155 ? -72.905  -49.061 4.426   1.00 64.85  ? 155  GLY A CA    1 
ATOM   1030 C  C     . GLY A 1 155 ? -72.763  -49.596 3.012   1.00 64.24  ? 155  GLY A C     1 
ATOM   1031 O  O     . GLY A 1 155 ? -71.645  -49.792 2.533   1.00 65.19  ? 155  GLY A O     1 
ATOM   1032 N  N     . SER A 1 156 ? -73.892  -49.827 2.344   1.00 62.54  ? 156  SER A N     1 
ATOM   1033 C  CA    . SER A 1 156 ? -73.897  -50.386 0.989   1.00 55.53  ? 156  SER A CA    1 
ATOM   1034 C  C     . SER A 1 156 ? -73.286  -49.466 -0.079  1.00 59.26  ? 156  SER A C     1 
ATOM   1035 O  O     . SER A 1 156 ? -72.465  -49.926 -0.872  1.00 67.64  ? 156  SER A O     1 
ATOM   1036 C  CB    . SER A 1 156 ? -75.303  -50.845 0.579   1.00 58.79  ? 156  SER A CB    1 
ATOM   1037 O  OG    . SER A 1 156 ? -75.617  -52.101 1.154   1.00 61.14  ? 156  SER A OG    1 
ATOM   1038 N  N     . PRO A 1 157 ? -73.679  -48.172 -0.107  1.00 59.12  ? 157  PRO A N     1 
ATOM   1039 C  CA    . PRO A 1 157 ? -73.060  -47.276 -1.091  1.00 54.14  ? 157  PRO A CA    1 
ATOM   1040 C  C     . PRO A 1 157 ? -71.640  -46.841 -0.714  1.00 54.70  ? 157  PRO A C     1 
ATOM   1041 O  O     . PRO A 1 157 ? -70.868  -46.443 -1.590  1.00 55.04  ? 157  PRO A O     1 
ATOM   1042 C  CB    . PRO A 1 157 ? -74.000  -46.068 -1.107  1.00 56.91  ? 157  PRO A CB    1 
ATOM   1043 C  CG    . PRO A 1 157 ? -74.615  -46.053 0.248   1.00 57.72  ? 157  PRO A CG    1 
ATOM   1044 C  CD    . PRO A 1 157 ? -74.748  -47.492 0.655   1.00 55.53  ? 157  PRO A CD    1 
ATOM   1045 N  N     . ALA A 1 158 ? -71.310  -46.918 0.574   1.00 58.27  ? 158  ALA A N     1 
ATOM   1046 C  CA    . ALA A 1 158 ? -69.993  -46.520 1.074   1.00 60.37  ? 158  ALA A CA    1 
ATOM   1047 C  C     . ALA A 1 158 ? -68.911  -47.541 0.723   1.00 63.57  ? 158  ALA A C     1 
ATOM   1048 O  O     . ALA A 1 158 ? -67.819  -47.170 0.287   1.00 72.13  ? 158  ALA A O     1 
ATOM   1049 C  CB    . ALA A 1 158 ? -70.043  -46.286 2.578   1.00 63.60  ? 158  ALA A CB    1 
ATOM   1050 N  N     . ILE A 1 159 ? -69.224  -48.822 0.917   1.00 59.79  ? 159  ILE A N     1 
ATOM   1051 C  CA    . ILE A 1 159 ? -68.304  -49.917 0.600   1.00 59.51  ? 159  ILE A CA    1 
ATOM   1052 C  C     . ILE A 1 159 ? -68.173  -50.100 -0.916  1.00 65.37  ? 159  ILE A C     1 
ATOM   1053 O  O     . ILE A 1 159 ? -67.075  -50.343 -1.424  1.00 66.20  ? 159  ILE A O     1 
ATOM   1054 C  CB    . ILE A 1 159 ? -68.737  -51.240 1.283   1.00 53.51  ? 159  ILE A CB    1 
ATOM   1055 C  CG1   . ILE A 1 159 ? -68.627  -51.112 2.808   1.00 58.03  ? 159  ILE A CG1   1 
ATOM   1056 C  CG2   . ILE A 1 159 ? -67.895  -52.415 0.795   1.00 56.07  ? 159  ILE A CG2   1 
ATOM   1057 C  CD1   . ILE A 1 159 ? -69.417  -52.148 3.584   1.00 54.74  ? 159  ILE A CD1   1 
ATOM   1058 N  N     . PHE A 1 160 ? -69.294  -49.965 -1.625  1.00 66.84  ? 160  PHE A N     1 
ATOM   1059 C  CA    . PHE A 1 160 ? -69.335  -50.115 -3.083  1.00 63.05  ? 160  PHE A CA    1 
ATOM   1060 C  C     . PHE A 1 160 ? -68.437  -49.111 -3.808  1.00 65.26  ? 160  PHE A C     1 
ATOM   1061 O  O     . PHE A 1 160 ? -67.744  -49.471 -4.760  1.00 72.03  ? 160  PHE A O     1 
ATOM   1062 C  CB    . PHE A 1 160 ? -70.779  -50.020 -3.595  1.00 58.28  ? 160  PHE A CB    1 
ATOM   1063 C  CG    . PHE A 1 160 ? -70.904  -50.077 -5.093  1.00 64.22  ? 160  PHE A CG    1 
ATOM   1064 C  CD1   . PHE A 1 160 ? -70.682  -51.266 -5.782  1.00 70.19  ? 160  PHE A CD1   1 
ATOM   1065 C  CD2   . PHE A 1 160 ? -71.256  -48.942 -5.817  1.00 66.05  ? 160  PHE A CD2   1 
ATOM   1066 C  CE1   . PHE A 1 160 ? -70.798  -51.318 -7.163  1.00 66.18  ? 160  PHE A CE1   1 
ATOM   1067 C  CE2   . PHE A 1 160 ? -71.376  -48.990 -7.197  1.00 65.42  ? 160  PHE A CE2   1 
ATOM   1068 C  CZ    . PHE A 1 160 ? -71.148  -50.179 -7.870  1.00 68.75  ? 160  PHE A CZ    1 
ATOM   1069 N  N     . GLN A 1 161 ? -68.459  -47.859 -3.351  1.00 61.27  ? 161  GLN A N     1 
ATOM   1070 C  CA    . GLN A 1 161 ? -67.619  -46.804 -3.918  1.00 66.12  ? 161  GLN A CA    1 
ATOM   1071 C  C     . GLN A 1 161 ? -66.144  -47.027 -3.578  1.00 66.90  ? 161  GLN A C     1 
ATOM   1072 O  O     . GLN A 1 161 ? -65.270  -46.825 -4.424  1.00 67.78  ? 161  GLN A O     1 
ATOM   1073 C  CB    . GLN A 1 161 ? -68.088  -45.424 -3.440  1.00 67.49  ? 161  GLN A CB    1 
ATOM   1074 C  CG    . GLN A 1 161 ? -67.321  -44.252 -4.038  1.00 77.25  ? 161  GLN A CG    1 
ATOM   1075 C  CD    . GLN A 1 161 ? -67.977  -42.914 -3.756  1.00 84.29  ? 161  GLN A CD    1 
ATOM   1076 O  OE1   . GLN A 1 161 ? -67.559  -42.182 -2.859  1.00 89.00  ? 161  GLN A OE1   1 
ATOM   1077 N  NE2   . GLN A 1 161 ? -69.017  -42.592 -4.517  1.00 84.95  ? 161  GLN A NE2   1 
ATOM   1078 N  N     . SER A 1 162 ? -65.882  -47.450 -2.341  1.00 65.34  ? 162  SER A N     1 
ATOM   1079 C  CA    . SER A 1 162 ? -64.525  -47.741 -1.875  1.00 71.66  ? 162  SER A CA    1 
ATOM   1080 C  C     . SER A 1 162 ? -63.906  -48.921 -2.623  1.00 69.40  ? 162  SER A C     1 
ATOM   1081 O  O     . SER A 1 162 ? -62.699  -48.940 -2.874  1.00 72.73  ? 162  SER A O     1 
ATOM   1082 C  CB    . SER A 1 162 ? -64.524  -48.011 -0.369  1.00 73.91  ? 162  SER A CB    1 
ATOM   1083 O  OG    . SER A 1 162 ? -63.205  -48.180 0.122   1.00 82.42  ? 162  SER A OG    1 
ATOM   1084 N  N     . SER A 1 163 ? -64.740  -49.900 -2.970  1.00 65.89  ? 163  SER A N     1 
ATOM   1085 C  CA    . SER A 1 163 ? -64.310  -51.050 -3.761  1.00 63.41  ? 163  SER A CA    1 
ATOM   1086 C  C     . SER A 1 163 ? -64.095  -50.668 -5.224  1.00 62.86  ? 163  SER A C     1 
ATOM   1087 O  O     . SER A 1 163 ? -63.203  -51.203 -5.884  1.00 69.19  ? 163  SER A O     1 
ATOM   1088 C  CB    . SER A 1 163 ? -65.329  -52.188 -3.656  1.00 60.23  ? 163  SER A CB    1 
ATOM   1089 O  OG    . SER A 1 163 ? -65.468  -52.628 -2.316  1.00 64.56  ? 163  SER A OG    1 
ATOM   1090 N  N     . MET A 1 164 ? -64.912  -49.737 -5.718  1.00 58.24  ? 164  MET A N     1 
ATOM   1091 C  CA    . MET A 1 164 ? -64.830  -49.265 -7.102  1.00 59.18  ? 164  MET A CA    1 
ATOM   1092 C  C     . MET A 1 164 ? -63.598  -48.389 -7.341  1.00 61.59  ? 164  MET A C     1 
ATOM   1093 O  O     . MET A 1 164 ? -62.982  -48.457 -8.407  1.00 68.21  ? 164  MET A O     1 
ATOM   1094 C  CB    . MET A 1 164 ? -66.110  -48.511 -7.490  1.00 55.70  ? 164  MET A CB    1 
ATOM   1095 C  CG    . MET A 1 164 ? -66.234  -48.174 -8.971  1.00 55.51  ? 164  MET A CG    1 
ATOM   1096 S  SD    . MET A 1 164 ? -66.405  -49.614 -10.046 1.00 66.09  ? 164  MET A SD    1 
ATOM   1097 C  CE    . MET A 1 164 ? -68.131  -50.027 -9.811  1.00 71.92  ? 164  MET A CE    1 
ATOM   1098 N  N     . THR A 1 165 ? -63.248  -47.574 -6.345  1.00 57.37  ? 165  THR A N     1 
ATOM   1099 C  CA    . THR A 1 165 ? -62.091  -46.676 -6.424  1.00 61.08  ? 165  THR A CA    1 
ATOM   1100 C  C     . THR A 1 165 ? -60.778  -47.457 -6.559  1.00 63.68  ? 165  THR A C     1 
ATOM   1101 O  O     . THR A 1 165 ? -59.857  -47.022 -7.256  1.00 71.80  ? 165  THR A O     1 
ATOM   1102 C  CB    . THR A 1 165 ? -62.021  -45.730 -5.203  1.00 64.37  ? 165  THR A CB    1 
ATOM   1103 O  OG1   . THR A 1 165 ? -63.319  -45.180 -4.942  1.00 65.37  ? 165  THR A OG1   1 
ATOM   1104 C  CG2   . THR A 1 165 ? -61.039  -44.586 -5.448  1.00 53.91  ? 165  THR A CG2   1 
ATOM   1105 N  N     . LYS A 1 166 ? -60.709  -48.611 -5.897  1.00 59.77  ? 166  LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 166 ? -59.538  -49.489 -5.960  1.00 65.91  ? 166  LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 166 ? -59.414  -50.189 -7.316  1.00 68.99  ? 166  LYS A C     1 
ATOM   1108 O  O     . LYS A 1 166 ? -58.306  -50.490 -7.765  1.00 79.13  ? 166  LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 166 ? -59.579  -50.525 -4.832  1.00 65.11  ? 166  LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 166 ? -59.449  -49.935 -3.434  1.00 63.67  ? 166  LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 166 ? -59.520  -51.003 -2.351  1.00 75.38  ? 166  LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 166 ? -58.190  -51.718 -2.168  1.00 85.18  ? 166  LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 166 ? -58.233  -52.695 -1.045  1.00 85.85  ? 166  LYS A NZ    1 
ATOM   1114 N  N     . ILE A 1 167 ? -60.555  -50.443 -7.955  1.00 65.62  ? 167  ILE A N     1 
ATOM   1115 C  CA    . ILE A 1 167 ? -60.600  -51.083 -9.272  1.00 63.77  ? 167  ILE A CA    1 
ATOM   1116 C  C     . ILE A 1 167 ? -60.202  -50.105 -10.383 1.00 62.72  ? 167  ILE A C     1 
ATOM   1117 O  O     . ILE A 1 167 ? -59.495  -50.478 -11.323 1.00 75.55  ? 167  ILE A O     1 
ATOM   1118 C  CB    . ILE A 1 167 ? -61.995  -51.700 -9.556  1.00 59.30  ? 167  ILE A CB    1 
ATOM   1119 C  CG1   . ILE A 1 167 ? -62.268  -52.866 -8.598  1.00 62.63  ? 167  ILE A CG1   1 
ATOM   1120 C  CG2   . ILE A 1 167 ? -62.107  -52.173 -11.002 1.00 61.63  ? 167  ILE A CG2   1 
ATOM   1121 C  CD1   . ILE A 1 167 ? -63.722  -53.287 -8.517  1.00 56.58  ? 167  ILE A CD1   1 
ATOM   1122 N  N     . LEU A 1 168 ? -60.648  -48.857 -10.261 1.00 57.42  ? 168  LEU A N     1 
ATOM   1123 C  CA    . LEU A 1 168 ? -60.395  -47.829 -11.274 1.00 58.96  ? 168  LEU A CA    1 
ATOM   1124 C  C     . LEU A 1 168 ? -58.972  -47.262 -11.244 1.00 68.52  ? 168  LEU A C     1 
ATOM   1125 O  O     . LEU A 1 168 ? -58.512  -46.696 -12.238 1.00 66.53  ? 168  LEU A O     1 
ATOM   1126 C  CB    . LEU A 1 168 ? -61.425  -46.696 -11.163 1.00 59.55  ? 168  LEU A CB    1 
ATOM   1127 C  CG    . LEU A 1 168 ? -62.691  -46.760 -12.030 1.00 60.95  ? 168  LEU A CG    1 
ATOM   1128 C  CD1   . LEU A 1 168 ? -63.547  -47.986 -11.742 1.00 64.78  ? 168  LEU A CD1   1 
ATOM   1129 C  CD2   . LEU A 1 168 ? -63.510  -45.491 -11.850 1.00 67.07  ? 168  LEU A CD2   1 
ATOM   1130 N  N     . GLU A 1 169 ? -58.287  -47.421 -10.111 1.00 70.37  ? 169  GLU A N     1 
ATOM   1131 C  CA    . GLU A 1 169 ? -56.934  -46.877 -9.912  1.00 76.34  ? 169  GLU A CA    1 
ATOM   1132 C  C     . GLU A 1 169 ? -55.921  -47.249 -11.014 1.00 78.70  ? 169  GLU A C     1 
ATOM   1133 O  O     . GLU A 1 169 ? -55.248  -46.359 -11.539 1.00 79.50  ? 169  GLU A O     1 
ATOM   1134 C  CB    . GLU A 1 169 ? -56.390  -47.248 -8.523  1.00 77.83  ? 169  GLU A CB    1 
ATOM   1135 C  CG    . GLU A 1 169 ? -55.070  -46.577 -8.164  1.00 91.73  ? 169  GLU A CG    1 
ATOM   1136 C  CD    . GLU A 1 169 ? -54.263  -47.353 -7.137  1.00 115.89 ? 169  GLU A CD    1 
ATOM   1137 O  OE1   . GLU A 1 169 ? -54.865  -47.989 -6.245  1.00 114.43 ? 169  GLU A OE1   1 
ATOM   1138 O  OE2   . GLU A 1 169 ? -53.016  -47.321 -7.219  1.00 129.22 ? 169  GLU A OE2   1 
ATOM   1139 N  N     . PRO A 1 170 ? -55.802  -48.553 -11.360 1.00 70.30  ? 170  PRO A N     1 
ATOM   1140 C  CA    . PRO A 1 170 ? -54.882  -48.932 -12.441 1.00 68.48  ? 170  PRO A CA    1 
ATOM   1141 C  C     . PRO A 1 170 ? -55.256  -48.337 -13.801 1.00 69.27  ? 170  PRO A C     1 
ATOM   1142 O  O     . PRO A 1 170 ? -54.368  -48.028 -14.597 1.00 72.79  ? 170  PRO A O     1 
ATOM   1143 C  CB    . PRO A 1 170 ? -54.996  -50.460 -12.483 1.00 56.35  ? 170  PRO A CB    1 
ATOM   1144 C  CG    . PRO A 1 170 ? -55.440  -50.841 -11.115 1.00 57.99  ? 170  PRO A CG    1 
ATOM   1145 C  CD    . PRO A 1 170 ? -56.377  -49.745 -10.707 1.00 62.95  ? 170  PRO A CD    1 
ATOM   1146 N  N     . PHE A 1 171 ? -56.554  -48.182 -14.056 1.00 63.13  ? 171  PHE A N     1 
ATOM   1147 C  CA    . PHE A 1 171 ? -57.038  -47.604 -15.310 1.00 66.66  ? 171  PHE A CA    1 
ATOM   1148 C  C     . PHE A 1 171 ? -56.812  -46.093 -15.360 1.00 75.34  ? 171  PHE A C     1 
ATOM   1149 O  O     . PHE A 1 171 ? -56.543  -45.536 -16.427 1.00 77.60  ? 171  PHE A O     1 
ATOM   1150 C  CB    . PHE A 1 171 ? -58.521  -47.931 -15.520 1.00 64.99  ? 171  PHE A CB    1 
ATOM   1151 C  CG    . PHE A 1 171 ? -58.985  -47.763 -16.942 1.00 63.09  ? 171  PHE A CG    1 
ATOM   1152 C  CD1   . PHE A 1 171 ? -58.888  -48.816 -17.847 1.00 65.19  ? 171  PHE A CD1   1 
ATOM   1153 C  CD2   . PHE A 1 171 ? -59.522  -46.556 -17.377 1.00 55.81  ? 171  PHE A CD2   1 
ATOM   1154 C  CE1   . PHE A 1 171 ? -59.314  -48.666 -19.159 1.00 63.35  ? 171  PHE A CE1   1 
ATOM   1155 C  CE2   . PHE A 1 171 ? -59.948  -46.400 -18.687 1.00 58.15  ? 171  PHE A CE2   1 
ATOM   1156 C  CZ    . PHE A 1 171 ? -59.846  -47.456 -19.579 1.00 64.31  ? 171  PHE A CZ    1 
ATOM   1157 N  N     . ARG A 1 172 ? -56.925  -45.441 -14.203 1.00 69.50  ? 172  ARG A N     1 
ATOM   1158 C  CA    . ARG A 1 172 ? -56.708  -43.997 -14.084 1.00 69.65  ? 172  ARG A CA    1 
ATOM   1159 C  C     . ARG A 1 172 ? -55.242  -43.617 -14.297 1.00 81.04  ? 172  ARG A C     1 
ATOM   1160 O  O     . ARG A 1 172 ? -54.945  -42.566 -14.869 1.00 82.60  ? 172  ARG A O     1 
ATOM   1161 C  CB    . ARG A 1 172 ? -57.190  -43.486 -12.722 1.00 63.38  ? 172  ARG A CB    1 
ATOM   1162 C  CG    . ARG A 1 172 ? -58.702  -43.425 -12.568 1.00 54.30  ? 172  ARG A CG    1 
ATOM   1163 C  CD    . ARG A 1 172 ? -59.095  -43.118 -11.132 1.00 55.50  ? 172  ARG A CD    1 
ATOM   1164 N  NE    . ARG A 1 172 ? -60.542  -43.170 -10.930 1.00 51.58  ? 172  ARG A NE    1 
ATOM   1165 C  CZ    . ARG A 1 172 ? -61.357  -42.121 -11.014 1.00 52.22  ? 172  ARG A CZ    1 
ATOM   1166 N  NH1   . ARG A 1 172 ? -60.880  -40.915 -11.298 1.00 62.33  ? 172  ARG A NH1   1 
ATOM   1167 N  NH2   . ARG A 1 172 ? -62.659  -42.277 -10.812 1.00 53.48  ? 172  ARG A NH2   1 
ATOM   1168 N  N     . LYS A 1 173 ? -54.337  -44.478 -13.832 1.00 82.42  ? 173  LYS A N     1 
ATOM   1169 C  CA    . LYS A 1 173 ? -52.898  -44.269 -13.994 1.00 81.45  ? 173  LYS A CA    1 
ATOM   1170 C  C     . LYS A 1 173 ? -52.441  -44.542 -15.427 1.00 79.14  ? 173  LYS A C     1 
ATOM   1171 O  O     . LYS A 1 173 ? -51.586  -43.830 -15.957 1.00 80.60  ? 173  LYS A O     1 
ATOM   1172 C  CB    . LYS A 1 173 ? -52.107  -45.138 -13.012 1.00 83.15  ? 173  LYS A CB    1 
ATOM   1173 C  CG    . LYS A 1 173 ? -52.170  -44.667 -11.567 1.00 105.46 ? 173  LYS A CG    1 
ATOM   1174 C  CD    . LYS A 1 173 ? -51.277  -45.513 -10.673 1.00 112.82 ? 173  LYS A CD    1 
ATOM   1175 C  CE    . LYS A 1 173 ? -51.290  -45.003 -9.241  1.00 102.92 ? 173  LYS A CE    1 
ATOM   1176 N  NZ    . LYS A 1 173 ? -50.397  -45.805 -8.360  1.00 91.31  ? 173  LYS A NZ    1 
ATOM   1177 N  N     . GLN A 1 174 ? -53.015  -45.576 -16.040 1.00 77.11  ? 174  GLN A N     1 
ATOM   1178 C  CA    . GLN A 1 174 ? -52.719  -45.928 -17.430 1.00 77.02  ? 174  GLN A CA    1 
ATOM   1179 C  C     . GLN A 1 174 ? -53.336  -44.930 -18.408 1.00 80.08  ? 174  GLN A C     1 
ATOM   1180 O  O     . GLN A 1 174 ? -52.776  -44.671 -19.475 1.00 88.38  ? 174  GLN A O     1 
ATOM   1181 C  CB    . GLN A 1 174 ? -53.202  -47.346 -17.746 1.00 78.53  ? 174  GLN A CB    1 
ATOM   1182 C  CG    . GLN A 1 174 ? -52.318  -48.449 -17.179 1.00 90.24  ? 174  GLN A CG    1 
ATOM   1183 C  CD    . GLN A 1 174 ? -52.910  -49.836 -17.356 1.00 104.68 ? 174  GLN A CD    1 
ATOM   1184 O  OE1   . GLN A 1 174 ? -53.489  -50.154 -18.396 1.00 110.91 ? 174  GLN A OE1   1 
ATOM   1185 N  NE2   . GLN A 1 174 ? -52.759  -50.674 -16.337 1.00 89.51  ? 174  GLN A NE2   1 
ATOM   1186 N  N     . ASN A 1 175 ? -54.489  -44.376 -18.035 1.00 79.80  ? 175  ASN A N     1 
ATOM   1187 C  CA    . ASN A 1 175 ? -55.167  -43.365 -18.846 1.00 79.28  ? 175  ASN A CA    1 
ATOM   1188 C  C     . ASN A 1 175 ? -55.452  -42.076 -18.062 1.00 85.47  ? 175  ASN A C     1 
ATOM   1189 O  O     . ASN A 1 175 ? -56.578  -41.866 -17.599 1.00 86.46  ? 175  ASN A O     1 
ATOM   1190 C  CB    . ASN A 1 175 ? -56.460  -43.930 -19.451 1.00 76.75  ? 175  ASN A CB    1 
ATOM   1191 C  CG    . ASN A 1 175 ? -56.222  -45.171 -20.291 1.00 82.56  ? 175  ASN A CG    1 
ATOM   1192 O  OD1   . ASN A 1 175 ? -55.902  -46.240 -19.769 1.00 75.39  ? 175  ASN A OD1   1 
ATOM   1193 N  ND2   . ASN A 1 175 ? -56.391  -45.038 -21.601 1.00 84.21  ? 175  ASN A ND2   1 
ATOM   1194 N  N     . PRO A 1 176 ? -54.428  -41.211 -17.901 1.00 84.28  ? 176  PRO A N     1 
ATOM   1195 C  CA    . PRO A 1 176 ? -54.615  -39.932 -17.215 1.00 84.01  ? 176  PRO A CA    1 
ATOM   1196 C  C     . PRO A 1 176 ? -55.223  -38.864 -18.125 1.00 87.61  ? 176  PRO A C     1 
ATOM   1197 O  O     . PRO A 1 176 ? -55.726  -37.850 -17.634 1.00 89.66  ? 176  PRO A O     1 
ATOM   1198 C  CB    . PRO A 1 176 ? -53.186  -39.528 -16.810 1.00 78.84  ? 176  PRO A CB    1 
ATOM   1199 C  CG    . PRO A 1 176 ? -52.295  -40.665 -17.204 1.00 85.04  ? 176  PRO A CG    1 
ATOM   1200 C  CD    . PRO A 1 176 ? -53.020  -41.410 -18.279 1.00 82.78  ? 176  PRO A CD    1 
ATOM   1201 N  N     . ASP A 1 177 ? -55.168  -39.099 -19.435 1.00 92.99  ? 177  ASP A N     1 
ATOM   1202 C  CA    . ASP A 1 177 ? -55.721  -38.179 -20.431 1.00 96.97  ? 177  ASP A CA    1 
ATOM   1203 C  C     . ASP A 1 177 ? -57.249  -38.136 -20.404 1.00 97.59  ? 177  ASP A C     1 
ATOM   1204 O  O     . ASP A 1 177 ? -57.853  -37.122 -20.762 1.00 91.40  ? 177  ASP A O     1 
ATOM   1205 C  CB    . ASP A 1 177 ? -55.219  -38.536 -21.837 1.00 99.11  ? 177  ASP A CB    1 
ATOM   1206 C  CG    . ASP A 1 177 ? -55.514  -39.979 -22.223 1.00 98.16  ? 177  ASP A CG    1 
ATOM   1207 O  OD1   . ASP A 1 177 ? -55.073  -40.900 -21.502 1.00 96.57  ? 177  ASP A OD1   1 
ATOM   1208 O  OD2   . ASP A 1 177 ? -56.190  -40.191 -23.251 1.00 88.63  ? 177  ASP A OD2   1 
ATOM   1209 N  N     . ILE A 1 178 ? -57.863  -39.239 -19.979 1.00 89.72  ? 178  ILE A N     1 
ATOM   1210 C  CA    . ILE A 1 178 ? -59.320  -39.321 -19.850 1.00 85.74  ? 178  ILE A CA    1 
ATOM   1211 C  C     . ILE A 1 178 ? -59.755  -39.057 -18.405 1.00 78.17  ? 178  ILE A C     1 
ATOM   1212 O  O     . ILE A 1 178 ? -58.974  -39.252 -17.468 1.00 72.77  ? 178  ILE A O     1 
ATOM   1213 C  CB    . ILE A 1 178 ? -59.881  -40.675 -20.360 1.00 76.70  ? 178  ILE A CB    1 
ATOM   1214 C  CG1   . ILE A 1 178 ? -59.615  -41.806 -19.357 1.00 76.10  ? 178  ILE A CG1   1 
ATOM   1215 C  CG2   . ILE A 1 178 ? -59.305  -41.019 -21.730 1.00 71.51  ? 178  ILE A CG2   1 
ATOM   1216 C  CD1   . ILE A 1 178 ? -60.591  -42.959 -19.461 1.00 64.08  ? 178  ILE A CD1   1 
ATOM   1217 N  N     . VAL A 1 179 ? -60.995  -38.603 -18.233 1.00 77.73  ? 179  VAL A N     1 
ATOM   1218 C  CA    . VAL A 1 179 ? -61.536  -38.296 -16.907 1.00 70.15  ? 179  VAL A CA    1 
ATOM   1219 C  C     . VAL A 1 179 ? -62.744  -39.182 -16.599 1.00 62.53  ? 179  VAL A C     1 
ATOM   1220 O  O     . VAL A 1 179 ? -63.718  -39.207 -17.357 1.00 67.44  ? 179  VAL A O     1 
ATOM   1221 C  CB    . VAL A 1 179 ? -61.917  -36.800 -16.771 1.00 69.61  ? 179  VAL A CB    1 
ATOM   1222 C  CG1   . VAL A 1 179 ? -62.494  -36.506 -15.392 1.00 76.25  ? 179  VAL A CG1   1 
ATOM   1223 C  CG2   . VAL A 1 179 ? -60.710  -35.909 -17.032 1.00 75.02  ? 179  VAL A CG2   1 
ATOM   1224 N  N     . ILE A 1 180 ? -62.665  -39.910 -15.486 1.00 64.01  ? 180  ILE A N     1 
ATOM   1225 C  CA    . ILE A 1 180 ? -63.752  -40.782 -15.040 1.00 60.77  ? 180  ILE A CA    1 
ATOM   1226 C  C     . ILE A 1 180 ? -64.319  -40.290 -13.707 1.00 61.85  ? 180  ILE A C     1 
ATOM   1227 O  O     . ILE A 1 180 ? -63.579  -40.100 -12.738 1.00 59.66  ? 180  ILE A O     1 
ATOM   1228 C  CB    . ILE A 1 180 ? -63.300  -42.256 -14.901 1.00 57.59  ? 180  ILE A CB    1 
ATOM   1229 C  CG1   . ILE A 1 180 ? -62.495  -42.703 -16.128 1.00 67.64  ? 180  ILE A CG1   1 
ATOM   1230 C  CG2   . ILE A 1 180 ? -64.505  -43.167 -14.689 1.00 52.55  ? 180  ILE A CG2   1 
ATOM   1231 C  CD1   . ILE A 1 180 ? -61.603  -43.902 -15.882 1.00 68.90  ? 180  ILE A CD1   1 
ATOM   1232 N  N     . TYR A 1 181 ? -65.633  -40.082 -13.676 1.00 64.41  ? 181  TYR A N     1 
ATOM   1233 C  CA    . TYR A 1 181 ? -66.339  -39.679 -12.463 1.00 62.45  ? 181  TYR A CA    1 
ATOM   1234 C  C     . TYR A 1 181 ? -67.337  -40.756 -12.039 1.00 63.17  ? 181  TYR A C     1 
ATOM   1235 O  O     . TYR A 1 181 ? -68.093  -41.272 -12.865 1.00 65.49  ? 181  TYR A O     1 
ATOM   1236 C  CB    . TYR A 1 181 ? -67.044  -38.331 -12.670 1.00 66.99  ? 181  TYR A CB    1 
ATOM   1237 C  CG    . TYR A 1 181 ? -68.065  -37.982 -11.606 1.00 78.89  ? 181  TYR A CG    1 
ATOM   1238 C  CD1   . TYR A 1 181 ? -67.682  -37.362 -10.416 1.00 83.27  ? 181  TYR A CD1   1 
ATOM   1239 C  CD2   . TYR A 1 181 ? -69.418  -38.267 -11.792 1.00 78.58  ? 181  TYR A CD2   1 
ATOM   1240 C  CE1   . TYR A 1 181 ? -68.614  -37.043 -9.440  1.00 84.20  ? 181  TYR A CE1   1 
ATOM   1241 C  CE2   . TYR A 1 181 ? -70.357  -37.949 -10.823 1.00 79.30  ? 181  TYR A CE2   1 
ATOM   1242 C  CZ    . TYR A 1 181 ? -69.950  -37.338 -9.650  1.00 79.43  ? 181  TYR A CZ    1 
ATOM   1243 O  OH    . TYR A 1 181 ? -70.882  -37.025 -8.687  1.00 74.52  ? 181  TYR A OH    1 
ATOM   1244 N  N     . GLN A 1 182 ? -67.331  -41.086 -10.749 1.00 64.84  ? 182  GLN A N     1 
ATOM   1245 C  CA    . GLN A 1 182 ? -68.229  -42.106 -10.205 1.00 66.61  ? 182  GLN A CA    1 
ATOM   1246 C  C     . GLN A 1 182 ? -69.335  -41.514 -9.330  1.00 66.91  ? 182  GLN A C     1 
ATOM   1247 O  O     . GLN A 1 182 ? -69.073  -40.708 -8.433  1.00 72.50  ? 182  GLN A O     1 
ATOM   1248 C  CB    . GLN A 1 182 ? -67.448  -43.195 -9.451  1.00 67.31  ? 182  GLN A CB    1 
ATOM   1249 C  CG    . GLN A 1 182 ? -66.477  -42.691 -8.389  1.00 71.56  ? 182  GLN A CG    1 
ATOM   1250 C  CD    . GLN A 1 182 ? -65.764  -43.815 -7.657  1.00 67.66  ? 182  GLN A CD    1 
ATOM   1251 O  OE1   . GLN A 1 182 ? -66.375  -44.817 -7.281  1.00 55.19  ? 182  GLN A OE1   1 
ATOM   1252 N  NE2   . GLN A 1 182 ? -64.464  -43.648 -7.444  1.00 64.47  ? 182  GLN A NE2   1 
ATOM   1253 N  N     . TYR A 1 183 ? -70.572  -41.917 -9.614  1.00 66.05  ? 183  TYR A N     1 
ATOM   1254 C  CA    . TYR A 1 183 ? -71.746  -41.462 -8.872  1.00 68.82  ? 183  TYR A CA    1 
ATOM   1255 C  C     . TYR A 1 183 ? -72.710  -42.624 -8.645  1.00 72.77  ? 183  TYR A C     1 
ATOM   1256 O  O     . TYR A 1 183 ? -73.246  -43.192 -9.601  1.00 80.56  ? 183  TYR A O     1 
ATOM   1257 C  CB    . TYR A 1 183 ? -72.439  -40.311 -9.616  1.00 74.42  ? 183  TYR A CB    1 
ATOM   1258 C  CG    . TYR A 1 183 ? -73.838  -39.987 -9.130  1.00 80.54  ? 183  TYR A CG    1 
ATOM   1259 C  CD1   . TYR A 1 183 ? -74.043  -39.263 -7.955  1.00 77.59  ? 183  TYR A CD1   1 
ATOM   1260 C  CD2   . TYR A 1 183 ? -74.958  -40.397 -9.855  1.00 80.02  ? 183  TYR A CD2   1 
ATOM   1261 C  CE1   . TYR A 1 183 ? -75.323  -38.966 -7.511  1.00 76.71  ? 183  TYR A CE1   1 
ATOM   1262 C  CE2   . TYR A 1 183 ? -76.241  -40.103 -9.420  1.00 78.33  ? 183  TYR A CE2   1 
ATOM   1263 C  CZ    . TYR A 1 183 ? -76.418  -39.388 -8.249  1.00 78.40  ? 183  TYR A CZ    1 
ATOM   1264 O  OH    . TYR A 1 183 ? -77.691  -39.096 -7.817  1.00 83.61  ? 183  TYR A OH    1 
ATOM   1265 N  N     . MET A 1 184 ? -72.924  -42.962 -7.372  1.00 72.15  ? 184  MET A N     1 
ATOM   1266 C  CA    . MET A 1 184 ? -73.767  -44.094 -6.965  1.00 75.34  ? 184  MET A CA    1 
ATOM   1267 C  C     . MET A 1 184 ? -73.388  -45.380 -7.704  1.00 76.07  ? 184  MET A C     1 
ATOM   1268 O  O     . MET A 1 184 ? -72.382  -46.011 -7.378  1.00 85.70  ? 184  MET A O     1 
ATOM   1269 C  CB    . MET A 1 184 ? -75.260  -43.769 -7.133  1.00 72.05  ? 184  MET A CB    1 
ATOM   1270 C  CG    . MET A 1 184 ? -75.795  -42.734 -6.157  1.00 79.43  ? 184  MET A CG    1 
ATOM   1271 S  SD    . MET A 1 184 ? -77.549  -42.396 -6.402  1.00 89.01  ? 184  MET A SD    1 
ATOM   1272 C  CE    . MET A 1 184 ? -77.852  -41.209 -5.096  1.00 65.92  ? 184  MET A CE    1 
ATOM   1273 N  N     . ASP A 1 185 ? -74.192  -45.753 -8.699  1.00 71.16  ? 185  ASP A N     1 
ATOM   1274 C  CA    . ASP A 1 185 ? -73.931  -46.933 -9.522  1.00 70.96  ? 185  ASP A CA    1 
ATOM   1275 C  C     . ASP A 1 185 ? -73.399  -46.547 -10.902 1.00 72.08  ? 185  ASP A C     1 
ATOM   1276 O  O     . ASP A 1 185 ? -72.617  -47.287 -11.500 1.00 74.79  ? 185  ASP A O     1 
ATOM   1277 C  CB    . ASP A 1 185 ? -75.201  -47.779 -9.670  1.00 70.58  ? 185  ASP A CB    1 
ATOM   1278 C  CG    . ASP A 1 185 ? -75.639  -48.426 -8.362  1.00 84.48  ? 185  ASP A CG    1 
ATOM   1279 O  OD1   . ASP A 1 185 ? -75.241  -47.949 -7.278  1.00 82.01  ? 185  ASP A OD1   1 
ATOM   1280 O  OD2   . ASP A 1 185 ? -76.395  -49.419 -8.422  1.00 94.56  ? 185  ASP A OD2   1 
ATOM   1281 N  N     . ASP A 1 186 ? -73.827  -45.385 -11.393 1.00 68.68  ? 186  ASP A N     1 
ATOM   1282 C  CA    . ASP A 1 186 ? -73.456  -44.904 -12.725 1.00 59.75  ? 186  ASP A CA    1 
ATOM   1283 C  C     . ASP A 1 186 ? -72.024  -44.375 -12.783 1.00 58.78  ? 186  ASP A C     1 
ATOM   1284 O  O     . ASP A 1 186 ? -71.505  -43.846 -11.798 1.00 61.80  ? 186  ASP A O     1 
ATOM   1285 C  CB    . ASP A 1 186 ? -74.437  -43.821 -13.193 1.00 62.53  ? 186  ASP A CB    1 
ATOM   1286 C  CG    . ASP A 1 186 ? -75.864  -44.337 -13.343 1.00 68.27  ? 186  ASP A CG    1 
ATOM   1287 O  OD1   . ASP A 1 186 ? -76.151  -45.479 -12.922 1.00 70.40  ? 186  ASP A OD1   1 
ATOM   1288 O  OD2   . ASP A 1 186 ? -76.705  -43.589 -13.885 1.00 70.74  ? 186  ASP A OD2   1 
ATOM   1289 N  N     . LEU A 1 187 ? -71.394  -44.524 -13.947 1.00 60.16  ? 187  LEU A N     1 
ATOM   1290 C  CA    . LEU A 1 187 ? -70.040  -44.020 -14.177 1.00 53.54  ? 187  LEU A CA    1 
ATOM   1291 C  C     . LEU A 1 187 ? -69.989  -43.102 -15.396 1.00 54.31  ? 187  LEU A C     1 
ATOM   1292 O  O     . LEU A 1 187 ? -70.394  -43.490 -16.493 1.00 55.61  ? 187  LEU A O     1 
ATOM   1293 C  CB    . LEU A 1 187 ? -69.043  -45.176 -14.337 1.00 45.05  ? 187  LEU A CB    1 
ATOM   1294 C  CG    . LEU A 1 187 ? -68.381  -45.762 -13.084 1.00 55.42  ? 187  LEU A CG    1 
ATOM   1295 C  CD1   . LEU A 1 187 ? -69.307  -46.708 -12.333 1.00 69.64  ? 187  LEU A CD1   1 
ATOM   1296 C  CD2   . LEU A 1 187 ? -67.093  -46.477 -13.462 1.00 50.89  ? 187  LEU A CD2   1 
ATOM   1297 N  N     . TYR A 1 188 ? -69.490  -41.885 -15.189 1.00 54.12  ? 188  TYR A N     1 
ATOM   1298 C  CA    . TYR A 1 188 ? -69.376  -40.890 -16.254 1.00 52.49  ? 188  TYR A CA    1 
ATOM   1299 C  C     . TYR A 1 188 ? -67.937  -40.786 -16.760 1.00 59.12  ? 188  TYR A C     1 
ATOM   1300 O  O     . TYR A 1 188 ? -67.033  -40.404 -16.013 1.00 60.78  ? 188  TYR A O     1 
ATOM   1301 C  CB    . TYR A 1 188 ? -69.874  -39.523 -15.771 1.00 57.51  ? 188  TYR A CB    1 
ATOM   1302 C  CG    . TYR A 1 188 ? -71.371  -39.443 -15.549 1.00 50.49  ? 188  TYR A CG    1 
ATOM   1303 C  CD1   . TYR A 1 188 ? -71.937  -39.808 -14.327 1.00 51.95  ? 188  TYR A CD1   1 
ATOM   1304 C  CD2   . TYR A 1 188 ? -72.221  -38.993 -16.560 1.00 59.86  ? 188  TYR A CD2   1 
ATOM   1305 C  CE1   . TYR A 1 188 ? -73.307  -39.733 -14.121 1.00 55.75  ? 188  TYR A CE1   1 
ATOM   1306 C  CE2   . TYR A 1 188 ? -73.591  -38.913 -16.362 1.00 59.71  ? 188  TYR A CE2   1 
ATOM   1307 C  CZ    . TYR A 1 188 ? -74.129  -39.285 -15.143 1.00 58.99  ? 188  TYR A CZ    1 
ATOM   1308 O  OH    . TYR A 1 188 ? -75.488  -39.208 -14.943 1.00 60.10  ? 188  TYR A OH    1 
ATOM   1309 N  N     . VAL A 1 189 ? -67.736  -41.134 -18.029 1.00 55.45  ? 189  VAL A N     1 
ATOM   1310 C  CA    . VAL A 1 189 ? -66.410  -41.114 -18.652 1.00 55.49  ? 189  VAL A CA    1 
ATOM   1311 C  C     . VAL A 1 189 ? -66.372  -40.091 -19.790 1.00 53.25  ? 189  VAL A C     1 
ATOM   1312 O  O     . VAL A 1 189 ? -67.251  -40.082 -20.654 1.00 55.38  ? 189  VAL A O     1 
ATOM   1313 C  CB    . VAL A 1 189 ? -66.005  -42.511 -19.189 1.00 48.00  ? 189  VAL A CB    1 
ATOM   1314 C  CG1   . VAL A 1 189 ? -64.561  -42.510 -19.673 1.00 55.50  ? 189  VAL A CG1   1 
ATOM   1315 C  CG2   . VAL A 1 189 ? -66.197  -43.582 -18.124 1.00 57.10  ? 189  VAL A CG2   1 
ATOM   1316 N  N     . GLY A 1 190 ? -65.353  -39.234 -19.779 1.00 56.21  ? 190  GLY A N     1 
ATOM   1317 C  CA    . GLY A 1 190 ? -65.187  -38.204 -20.805 1.00 61.06  ? 190  GLY A CA    1 
ATOM   1318 C  C     . GLY A 1 190 ? -63.739  -37.966 -21.194 1.00 65.99  ? 190  GLY A C     1 
ATOM   1319 O  O     . GLY A 1 190 ? -62.842  -38.027 -20.349 1.00 68.04  ? 190  GLY A O     1 
ATOM   1320 N  N     . SER A 1 191 ? -63.516  -37.692 -22.479 1.00 69.70  ? 191  SER A N     1 
ATOM   1321 C  CA    . SER A 1 191 ? -62.173  -37.439 -23.008 1.00 76.45  ? 191  SER A CA    1 
ATOM   1322 C  C     . SER A 1 191 ? -62.185  -36.450 -24.176 1.00 74.41  ? 191  SER A C     1 
ATOM   1323 O  O     . SER A 1 191 ? -63.239  -36.165 -24.751 1.00 71.37  ? 191  SER A O     1 
ATOM   1324 C  CB    . SER A 1 191 ? -61.509  -38.750 -23.438 1.00 70.35  ? 191  SER A CB    1 
ATOM   1325 O  OG    . SER A 1 191 ? -62.177  -39.327 -24.546 1.00 70.09  ? 191  SER A OG    1 
ATOM   1326 N  N     . ASP A 1 192 ? -61.004  -35.938 -24.518 1.00 71.10  ? 192  ASP A N     1 
ATOM   1327 C  CA    . ASP A 1 192 ? -60.843  -35.010 -25.639 1.00 72.83  ? 192  ASP A CA    1 
ATOM   1328 C  C     . ASP A 1 192 ? -60.406  -35.718 -26.926 1.00 76.70  ? 192  ASP A C     1 
ATOM   1329 O  O     . ASP A 1 192 ? -60.139  -35.069 -27.942 1.00 87.95  ? 192  ASP A O     1 
ATOM   1330 C  CB    . ASP A 1 192 ? -59.852  -33.897 -25.275 1.00 78.18  ? 192  ASP A CB    1 
ATOM   1331 C  CG    . ASP A 1 192 ? -60.403  -32.938 -24.233 1.00 79.72  ? 192  ASP A CG    1 
ATOM   1332 O  OD1   . ASP A 1 192 ? -61.534  -32.435 -24.411 1.00 75.65  ? 192  ASP A OD1   1 
ATOM   1333 O  OD2   . ASP A 1 192 ? -59.697  -32.677 -23.236 1.00 81.71  ? 192  ASP A OD2   1 
ATOM   1334 N  N     . LEU A 1 193 ? -60.345  -37.048 -26.875 1.00 73.20  ? 193  LEU A N     1 
ATOM   1335 C  CA    . LEU A 1 193 ? -59.968  -37.867 -28.028 1.00 77.03  ? 193  LEU A CA    1 
ATOM   1336 C  C     . LEU A 1 193 ? -61.093  -37.938 -29.061 1.00 81.83  ? 193  LEU A C     1 
ATOM   1337 O  O     . LEU A 1 193 ? -62.236  -37.572 -28.772 1.00 81.50  ? 193  LEU A O     1 
ATOM   1338 C  CB    . LEU A 1 193 ? -59.582  -39.282 -27.576 1.00 66.99  ? 193  LEU A CB    1 
ATOM   1339 C  CG    . LEU A 1 193 ? -58.354  -39.469 -26.677 1.00 73.86  ? 193  LEU A CG    1 
ATOM   1340 C  CD1   . LEU A 1 193 ? -58.422  -40.805 -25.953 1.00 61.18  ? 193  LEU A CD1   1 
ATOM   1341 C  CD2   . LEU A 1 193 ? -57.057  -39.351 -27.467 1.00 88.00  ? 193  LEU A CD2   1 
ATOM   1342 N  N     . GLU A 1 194 ? -60.760  -38.408 -30.263 1.00 86.02  ? 194  GLU A N     1 
ATOM   1343 C  CA    . GLU A 1 194 ? -61.744  -38.601 -31.331 1.00 88.40  ? 194  GLU A CA    1 
ATOM   1344 C  C     . GLU A 1 194 ? -62.743  -39.705 -30.982 1.00 76.94  ? 194  GLU A C     1 
ATOM   1345 O  O     . GLU A 1 194 ? -62.467  -40.555 -30.132 1.00 75.11  ? 194  GLU A O     1 
ATOM   1346 C  CB    . GLU A 1 194 ? -61.051  -38.913 -32.664 1.00 89.05  ? 194  GLU A CB    1 
ATOM   1347 C  CG    . GLU A 1 194 ? -60.485  -37.697 -33.385 1.00 93.05  ? 194  GLU A CG    1 
ATOM   1348 C  CD    . GLU A 1 194 ? -59.115  -37.286 -32.876 1.00 118.44 ? 194  GLU A CD    1 
ATOM   1349 O  OE1   . GLU A 1 194 ? -58.162  -38.083 -33.005 1.00 115.70 ? 194  GLU A OE1   1 
ATOM   1350 O  OE2   . GLU A 1 194 ? -58.988  -36.157 -32.357 1.00 141.47 ? 194  GLU A OE2   1 
ATOM   1351 N  N     . ILE A 1 195 ? -63.896  -39.684 -31.650 1.00 74.67  ? 195  ILE A N     1 
ATOM   1352 C  CA    . ILE A 1 195 ? -64.989  -40.631 -31.388 1.00 77.99  ? 195  ILE A CA    1 
ATOM   1353 C  C     . ILE A 1 195 ? -64.584  -42.101 -31.587 1.00 77.67  ? 195  ILE A C     1 
ATOM   1354 O  O     . ILE A 1 195 ? -65.157  -42.998 -30.964 1.00 73.71  ? 195  ILE A O     1 
ATOM   1355 C  CB    . ILE A 1 195 ? -66.264  -40.268 -32.204 1.00 73.85  ? 195  ILE A CB    1 
ATOM   1356 C  CG1   . ILE A 1 195 ? -67.509  -40.978 -31.653 1.00 71.68  ? 195  ILE A CG1   1 
ATOM   1357 C  CG2   . ILE A 1 195 ? -66.077  -40.535 -33.695 1.00 72.46  ? 195  ILE A CG2   1 
ATOM   1358 C  CD1   . ILE A 1 195 ? -68.095  -40.339 -30.410 1.00 67.00  ? 195  ILE A CD1   1 
ATOM   1359 N  N     . GLY A 1 196 ? -63.590  -42.335 -32.442 1.00 79.02  ? 196  GLY A N     1 
ATOM   1360 C  CA    . GLY A 1 196 ? -63.066  -43.678 -32.685 1.00 74.94  ? 196  GLY A CA    1 
ATOM   1361 C  C     . GLY A 1 196 ? -62.181  -44.181 -31.558 1.00 72.17  ? 196  GLY A C     1 
ATOM   1362 O  O     . GLY A 1 196 ? -62.297  -45.334 -31.137 1.00 64.70  ? 196  GLY A O     1 
ATOM   1363 N  N     . GLN A 1 197 ? -61.298  -43.309 -31.075 1.00 80.09  ? 197  GLN A N     1 
ATOM   1364 C  CA    . GLN A 1 197 ? -60.376  -43.638 -29.984 1.00 78.12  ? 197  GLN A CA    1 
ATOM   1365 C  C     . GLN A 1 197 ? -61.090  -43.722 -28.636 1.00 74.22  ? 197  GLN A C     1 
ATOM   1366 O  O     . GLN A 1 197 ? -60.706  -44.513 -27.771 1.00 75.26  ? 197  GLN A O     1 
ATOM   1367 C  CB    . GLN A 1 197 ? -59.242  -42.610 -29.907 1.00 80.63  ? 197  GLN A CB    1 
ATOM   1368 C  CG    . GLN A 1 197 ? -58.333  -42.576 -31.128 1.00 83.08  ? 197  GLN A CG    1 
ATOM   1369 C  CD    . GLN A 1 197 ? -57.235  -41.534 -31.016 1.00 93.85  ? 197  GLN A CD    1 
ATOM   1370 O  OE1   . GLN A 1 197 ? -57.168  -40.600 -31.815 1.00 106.48 ? 197  GLN A OE1   1 
ATOM   1371 N  NE2   . GLN A 1 197 ? -56.367  -41.687 -30.020 1.00 79.93  ? 197  GLN A NE2   1 
ATOM   1372 N  N     . HIS A 1 198 ? -62.126  -42.901 -28.471 1.00 77.00  ? 198  HIS A N     1 
ATOM   1373 C  CA    . HIS A 1 198 ? -62.913  -42.850 -27.238 1.00 71.42  ? 198  HIS A CA    1 
ATOM   1374 C  C     . HIS A 1 198 ? -63.759  -44.080 -27.051 1.00 65.46  ? 198  HIS A C     1 
ATOM   1375 O  O     . HIS A 1 198 ? -63.882  -44.588 -25.935 1.00 60.51  ? 198  HIS A O     1 
ATOM   1376 C  CB    . HIS A 1 198 ? -63.785  -41.595 -27.223 1.00 73.39  ? 198  HIS A CB    1 
ATOM   1377 C  CG    . HIS A 1 198 ? -64.677  -41.481 -26.009 1.00 67.53  ? 198  HIS A CG    1 
ATOM   1378 N  ND1   . HIS A 1 198 ? -64.245  -40.984 -24.837 1.00 72.46  ? 198  HIS A ND1   1 
ATOM   1379 C  CD2   . HIS A 1 198 ? -66.017  -41.817 -25.823 1.00 67.22  ? 198  HIS A CD2   1 
ATOM   1380 C  CE1   . HIS A 1 198 ? -65.252  -41.000 -23.944 1.00 70.89  ? 198  HIS A CE1   1 
ATOM   1381 N  NE2   . HIS A 1 198 ? -66.336  -41.510 -24.549 1.00 66.09  ? 198  HIS A NE2   1 
ATOM   1382 N  N     . ARG A 1 199 ? -64.341  -44.569 -28.145 1.00 71.32  ? 199  ARG A N     1 
ATOM   1383 C  CA    . ARG A 1 199 ? -65.219  -45.740 -28.116 1.00 63.57  ? 199  ARG A CA    1 
ATOM   1384 C  C     . ARG A 1 199 ? -64.456  -47.028 -27.793 1.00 58.73  ? 199  ARG A C     1 
ATOM   1385 O  O     . ARG A 1 199 ? -65.018  -47.960 -27.214 1.00 55.97  ? 199  ARG A O     1 
ATOM   1386 C  CB    . ARG A 1 199 ? -65.954  -45.887 -29.454 1.00 58.71  ? 199  ARG A CB    1 
ATOM   1387 C  CG    . ARG A 1 199 ? -67.279  -46.634 -29.375 1.00 63.15  ? 199  ARG A CG    1 
ATOM   1388 C  CD    . ARG A 1 199 ? -68.438  -45.710 -29.021 1.00 66.02  ? 199  ARG A CD    1 
ATOM   1389 N  NE    . ARG A 1 199 ? -68.829  -44.858 -30.144 1.00 64.48  ? 199  ARG A NE    1 
ATOM   1390 C  CZ    . ARG A 1 199 ? -69.834  -43.985 -30.120 1.00 72.25  ? 199  ARG A CZ    1 
ATOM   1391 N  NH1   . ARG A 1 199 ? -70.570  -43.832 -29.025 1.00 71.65  ? 199  ARG A NH1   1 
ATOM   1392 N  NH2   . ARG A 1 199 ? -70.105  -43.260 -31.196 1.00 68.63  ? 199  ARG A NH2   1 
ATOM   1393 N  N     . THR A 1 200 ? -63.180  -47.066 -28.171 1.00 61.39  ? 200  THR A N     1 
ATOM   1394 C  CA    . THR A 1 200 ? -62.320  -48.227 -27.937 1.00 64.10  ? 200  THR A CA    1 
ATOM   1395 C  C     . THR A 1 200 ? -61.897  -48.329 -26.468 1.00 67.33  ? 200  THR A C     1 
ATOM   1396 O  O     . THR A 1 200 ? -61.804  -49.429 -25.918 1.00 64.83  ? 200  THR A O     1 
ATOM   1397 C  CB    . THR A 1 200 ? -61.066  -48.191 -28.839 1.00 65.13  ? 200  THR A CB    1 
ATOM   1398 O  OG1   . THR A 1 200 ? -61.427  -47.753 -30.155 1.00 69.21  ? 200  THR A OG1   1 
ATOM   1399 C  CG2   . THR A 1 200 ? -60.418  -49.570 -28.931 1.00 57.95  ? 200  THR A CG2   1 
ATOM   1400 N  N     . LYS A 1 201 ? -61.651  -47.178 -25.842 1.00 62.27  ? 201  LYS A N     1 
ATOM   1401 C  CA    . LYS A 1 201 ? -61.187  -47.121 -24.453 1.00 57.09  ? 201  LYS A CA    1 
ATOM   1402 C  C     . LYS A 1 201 ? -62.279  -47.450 -23.433 1.00 60.51  ? 201  LYS A C     1 
ATOM   1403 O  O     . LYS A 1 201 ? -61.979  -47.884 -22.318 1.00 64.29  ? 201  LYS A O     1 
ATOM   1404 C  CB    . LYS A 1 201 ? -60.563  -45.754 -24.143 1.00 55.40  ? 201  LYS A CB    1 
ATOM   1405 C  CG    . LYS A 1 201 ? -59.241  -45.480 -24.851 1.00 66.25  ? 201  LYS A CG    1 
ATOM   1406 C  CD    . LYS A 1 201 ? -58.105  -46.324 -24.288 1.00 71.28  ? 201  LYS A CD    1 
ATOM   1407 C  CE    . LYS A 1 201 ? -56.797  -46.045 -25.010 1.00 77.96  ? 201  LYS A CE    1 
ATOM   1408 N  NZ    . LYS A 1 201 ? -55.681  -46.872 -24.475 1.00 80.96  ? 201  LYS A NZ    1 
ATOM   1409 N  N     . ILE A 1 202 ? -63.537  -47.239 -23.818 1.00 59.04  ? 202  ILE A N     1 
ATOM   1410 C  CA    . ILE A 1 202 ? -64.685  -47.592 -22.977 1.00 52.75  ? 202  ILE A CA    1 
ATOM   1411 C  C     . ILE A 1 202 ? -64.850  -49.112 -22.874 1.00 57.90  ? 202  ILE A C     1 
ATOM   1412 O  O     . ILE A 1 202 ? -65.183  -49.632 -21.806 1.00 61.40  ? 202  ILE A O     1 
ATOM   1413 C  CB    . ILE A 1 202 ? -65.984  -46.881 -23.449 1.00 55.66  ? 202  ILE A CB    1 
ATOM   1414 C  CG1   . ILE A 1 202 ? -66.234  -45.613 -22.624 1.00 53.05  ? 202  ILE A CG1   1 
ATOM   1415 C  CG2   . ILE A 1 202 ? -67.206  -47.782 -23.327 1.00 51.16  ? 202  ILE A CG2   1 
ATOM   1416 C  CD1   . ILE A 1 202 ? -65.319  -44.450 -22.943 1.00 48.93  ? 202  ILE A CD1   1 
ATOM   1417 N  N     . GLU A 1 203 ? -64.594  -49.811 -23.979 1.00 56.45  ? 203  GLU A N     1 
ATOM   1418 C  CA    . GLU A 1 203 ? -64.634  -51.275 -24.013 1.00 60.85  ? 203  GLU A CA    1 
ATOM   1419 C  C     . GLU A 1 203 ? -63.526  -51.881 -23.148 1.00 68.18  ? 203  GLU A C     1 
ATOM   1420 O  O     . GLU A 1 203 ? -63.731  -52.906 -22.494 1.00 66.65  ? 203  GLU A O     1 
ATOM   1421 C  CB    . GLU A 1 203 ? -64.537  -51.783 -25.459 1.00 53.57  ? 203  GLU A CB    1 
ATOM   1422 N  N     . GLU A 1 204 ? -62.361  -51.234 -23.148 1.00 65.26  ? 204  GLU A N     1 
ATOM   1423 C  CA    . GLU A 1 204 ? -61.228  -51.642 -22.313 1.00 66.95  ? 204  GLU A CA    1 
ATOM   1424 C  C     . GLU A 1 204 ? -61.521  -51.438 -20.826 1.00 67.73  ? 204  GLU A C     1 
ATOM   1425 O  O     . GLU A 1 204 ? -61.009  -52.175 -19.979 1.00 65.42  ? 204  GLU A O     1 
ATOM   1426 C  CB    . GLU A 1 204 ? -59.961  -50.880 -22.710 1.00 61.56  ? 204  GLU A CB    1 
ATOM   1427 C  CG    . GLU A 1 204 ? -59.393  -51.272 -24.068 1.00 63.99  ? 204  GLU A CG    1 
ATOM   1428 C  CD    . GLU A 1 204 ? -58.159  -50.474 -24.457 1.00 74.50  ? 204  GLU A CD    1 
ATOM   1429 O  OE1   . GLU A 1 204 ? -57.586  -49.775 -23.594 1.00 74.65  ? 204  GLU A OE1   1 
ATOM   1430 O  OE2   . GLU A 1 204 ? -57.757  -50.550 -25.638 1.00 79.06  ? 204  GLU A OE2   1 
ATOM   1431 N  N     . LEU A 1 205 ? -62.342  -50.434 -20.523 1.00 64.74  ? 205  LEU A N     1 
ATOM   1432 C  CA    . LEU A 1 205 ? -62.803  -50.174 -19.161 1.00 63.04  ? 205  LEU A CA    1 
ATOM   1433 C  C     . LEU A 1 205 ? -63.819  -51.239 -18.742 1.00 67.50  ? 205  LEU A C     1 
ATOM   1434 O  O     . LEU A 1 205 ? -63.810  -51.696 -17.598 1.00 68.20  ? 205  LEU A O     1 
ATOM   1435 C  CB    . LEU A 1 205 ? -63.422  -48.774 -19.065 1.00 59.87  ? 205  LEU A CB    1 
ATOM   1436 C  CG    . LEU A 1 205 ? -63.319  -47.975 -17.758 1.00 62.51  ? 205  LEU A CG    1 
ATOM   1437 C  CD1   . LEU A 1 205 ? -63.530  -46.494 -18.035 1.00 64.52  ? 205  LEU A CD1   1 
ATOM   1438 C  CD2   . LEU A 1 205 ? -64.296  -48.456 -16.695 1.00 66.10  ? 205  LEU A CD2   1 
ATOM   1439 N  N     . ARG A 1 206 ? -64.682  -51.625 -19.682 1.00 67.16  ? 206  ARG A N     1 
ATOM   1440 C  CA    . ARG A 1 206 ? -65.713  -52.642 -19.453 1.00 63.18  ? 206  ARG A CA    1 
ATOM   1441 C  C     . ARG A 1 206 ? -65.122  -54.014 -19.138 1.00 68.07  ? 206  ARG A C     1 
ATOM   1442 O  O     . ARG A 1 206 ? -65.617  -54.719 -18.257 1.00 64.94  ? 206  ARG A O     1 
ATOM   1443 C  CB    . ARG A 1 206 ? -66.639  -52.752 -20.668 1.00 61.66  ? 206  ARG A CB    1 
ATOM   1444 C  CG    . ARG A 1 206 ? -67.614  -51.597 -20.840 1.00 61.27  ? 206  ARG A CG    1 
ATOM   1445 C  CD    . ARG A 1 206 ? -68.521  -51.833 -22.037 1.00 65.32  ? 206  ARG A CD    1 
ATOM   1446 N  NE    . ARG A 1 206 ? -69.457  -52.933 -21.808 1.00 64.42  ? 206  ARG A NE    1 
ATOM   1447 C  CZ    . ARG A 1 206 ? -69.939  -53.728 -22.760 1.00 65.64  ? 206  ARG A CZ    1 
ATOM   1448 N  NH1   . ARG A 1 206 ? -69.570  -53.566 -24.025 1.00 64.10  ? 206  ARG A NH1   1 
ATOM   1449 N  NH2   . ARG A 1 206 ? -70.786  -54.698 -22.445 1.00 66.51  ? 206  ARG A NH2   1 
ATOM   1450 N  N     . GLN A 1 207 ? -64.068  -54.382 -19.867 1.00 68.29  ? 207  GLN A N     1 
ATOM   1451 C  CA    . GLN A 1 207 ? -63.378  -55.661 -19.677 1.00 70.10  ? 207  GLN A CA    1 
ATOM   1452 C  C     . GLN A 1 207 ? -62.672  -55.732 -18.324 1.00 70.28  ? 207  GLN A C     1 
ATOM   1453 O  O     . GLN A 1 207 ? -62.524  -56.813 -17.749 1.00 67.97  ? 207  GLN A O     1 
ATOM   1454 C  CB    . GLN A 1 207 ? -62.373  -55.905 -20.806 1.00 74.70  ? 207  GLN A CB    1 
ATOM   1455 C  CG    . GLN A 1 207 ? -63.006  -56.187 -22.163 1.00 72.16  ? 207  GLN A CG    1 
ATOM   1456 C  CD    . GLN A 1 207 ? -61.990  -56.269 -23.291 1.00 74.54  ? 207  GLN A CD    1 
ATOM   1457 O  OE1   . GLN A 1 207 ? -60.887  -55.728 -23.197 1.00 69.21  ? 207  GLN A OE1   1 
ATOM   1458 N  NE2   . GLN A 1 207 ? -62.365  -56.945 -24.371 1.00 80.61  ? 207  GLN A NE2   1 
ATOM   1459 N  N     . HIS A 1 208 ? -62.238  -54.574 -17.829 1.00 68.83  ? 208  HIS A N     1 
ATOM   1460 C  CA    . HIS A 1 208 ? -61.595  -54.467 -16.522 1.00 71.66  ? 208  HIS A CA    1 
ATOM   1461 C  C     . HIS A 1 208 ? -62.595  -54.592 -15.403 1.00 70.12  ? 208  HIS A C     1 
ATOM   1462 O  O     . HIS A 1 208 ? -62.285  -55.150 -14.348 1.00 74.76  ? 208  HIS A O     1 
ATOM   1463 C  CB    . HIS A 1 208 ? -60.825  -53.154 -16.415 1.00 67.42  ? 208  HIS A CB    1 
ATOM   1464 C  CG    . HIS A 1 208 ? -60.002  -53.026 -15.155 1.00 71.84  ? 208  HIS A CG    1 
ATOM   1465 N  ND1   . HIS A 1 208 ? -58.898  -53.763 -14.933 1.00 78.36  ? 208  HIS A ND1   1 
ATOM   1466 C  CD2   . HIS A 1 208 ? -60.156  -52.204 -14.041 1.00 69.45  ? 208  HIS A CD2   1 
ATOM   1467 C  CE1   . HIS A 1 208 ? -58.374  -53.436 -13.737 1.00 81.24  ? 208  HIS A CE1   1 
ATOM   1468 N  NE2   . HIS A 1 208 ? -59.144  -52.481 -13.193 1.00 72.25  ? 208  HIS A NE2   1 
ATOM   1469 N  N     . LEU A 1 209 ? -63.803  -54.076 -15.627 1.00 62.44  ? 209  LEU A N     1 
ATOM   1470 C  CA    . LEU A 1 209 ? -64.891  -54.186 -14.654 1.00 63.29  ? 209  LEU A CA    1 
ATOM   1471 C  C     . LEU A 1 209 ? -65.515  -55.581 -14.662 1.00 68.91  ? 209  LEU A C     1 
ATOM   1472 O  O     . LEU A 1 209 ? -65.981  -56.063 -13.628 1.00 61.67  ? 209  LEU A O     1 
ATOM   1473 C  CB    . LEU A 1 209 ? -65.973  -53.128 -14.911 1.00 62.83  ? 209  LEU A CB    1 
ATOM   1474 C  CG    . LEU A 1 209 ? -65.638  -51.634 -14.805 1.00 58.33  ? 209  LEU A CG    1 
ATOM   1475 C  CD1   . LEU A 1 209 ? -66.844  -50.803 -15.216 1.00 59.42  ? 209  LEU A CD1   1 
ATOM   1476 C  CD2   . LEU A 1 209 ? -65.169  -51.238 -13.411 1.00 62.06  ? 209  LEU A CD2   1 
ATOM   1477 N  N     . LEU A 1 210 ? -65.517  -56.219 -15.833 1.00 74.32  ? 210  LEU A N     1 
ATOM   1478 C  CA    . LEU A 1 210 ? -66.065  -57.568 -16.000 1.00 73.00  ? 210  LEU A CA    1 
ATOM   1479 C  C     . LEU A 1 210 ? -65.208  -58.624 -15.296 1.00 73.39  ? 210  LEU A C     1 
ATOM   1480 O  O     . LEU A 1 210 ? -65.698  -59.705 -14.960 1.00 74.57  ? 210  LEU A O     1 
ATOM   1481 C  CB    . LEU A 1 210 ? -66.218  -57.905 -17.489 1.00 72.85  ? 210  LEU A CB    1 
ATOM   1482 C  CG    . LEU A 1 210 ? -67.151  -59.051 -17.901 1.00 75.95  ? 210  LEU A CG    1 
ATOM   1483 C  CD1   . LEU A 1 210 ? -68.616  -58.667 -17.743 1.00 58.86  ? 210  LEU A CD1   1 
ATOM   1484 C  CD2   . LEU A 1 210 ? -66.866  -59.474 -19.334 1.00 97.33  ? 210  LEU A CD2   1 
ATOM   1485 N  N     . ARG A 1 211 ? -63.933  -58.300 -15.083 1.00 68.65  ? 211  ARG A N     1 
ATOM   1486 C  CA    . ARG A 1 211 ? -63.013  -59.143 -14.318 1.00 66.60  ? 211  ARG A CA    1 
ATOM   1487 C  C     . ARG A 1 211 ? -63.490  -59.334 -12.879 1.00 60.45  ? 211  ARG A C     1 
ATOM   1488 O  O     . ARG A 1 211 ? -63.355  -60.420 -12.311 1.00 60.49  ? 211  ARG A O     1 
ATOM   1489 C  CB    . ARG A 1 211 ? -61.610  -58.533 -14.309 1.00 69.28  ? 211  ARG A CB    1 
ATOM   1490 C  CG    . ARG A 1 211 ? -60.778  -58.816 -15.550 1.00 76.16  ? 211  ARG A CG    1 
ATOM   1491 C  CD    . ARG A 1 211 ? -59.419  -58.134 -15.468 1.00 86.02  ? 211  ARG A CD    1 
ATOM   1492 N  NE    . ARG A 1 211 ? -58.658  -58.548 -14.288 1.00 107.78 ? 211  ARG A NE    1 
ATOM   1493 C  CZ    . ARG A 1 211 ? -57.531  -57.974 -13.871 1.00 101.64 ? 211  ARG A CZ    1 
ATOM   1494 N  NH1   . ARG A 1 211 ? -57.011  -56.947 -14.531 1.00 88.72  ? 211  ARG A NH1   1 
ATOM   1495 N  NH2   . ARG A 1 211 ? -56.922  -58.431 -12.785 1.00 91.88  ? 211  ARG A NH2   1 
ATOM   1496 N  N     . TRP A 1 212 ? -64.046  -58.270 -12.303 1.00 64.93  ? 212  TRP A N     1 
ATOM   1497 C  CA    . TRP A 1 212 ? -64.543  -58.287 -10.929 1.00 68.90  ? 212  TRP A CA    1 
ATOM   1498 C  C     . TRP A 1 212 ? -65.997  -58.671 -10.853 1.00 68.91  ? 212  TRP A C     1 
ATOM   1499 O  O     . TRP A 1 212 ? -66.537  -58.874 -9.762  1.00 66.69  ? 212  TRP A O     1 
ATOM   1500 C  CB    . TRP A 1 212 ? -64.306  -56.932 -10.267 1.00 63.97  ? 212  TRP A CB    1 
ATOM   1501 C  CG    . TRP A 1 212 ? -62.847  -56.542 -10.216 1.00 62.92  ? 212  TRP A CG    1 
ATOM   1502 C  CD1   . TRP A 1 212 ? -62.134  -55.791 -11.148 1.00 65.16  ? 212  TRP A CD1   1 
ATOM   1503 C  CD2   . TRP A 1 212 ? -61.866  -56.885 -9.176  1.00 60.30  ? 212  TRP A CD2   1 
ATOM   1504 N  NE1   . TRP A 1 212 ? -60.825  -55.646 -10.764 1.00 60.96  ? 212  TRP A NE1   1 
ATOM   1505 C  CE2   . TRP A 1 212 ? -60.596  -56.276 -9.593  1.00 63.95  ? 212  TRP A CE2   1 
ATOM   1506 C  CE3   . TRP A 1 212 ? -61.911  -57.603 -7.985  1.00 67.97  ? 212  TRP A CE3   1 
ATOM   1507 C  CZ2   . TRP A 1 212 ? -59.439  -56.396 -8.836  1.00 72.94  ? 212  TRP A CZ2   1 
ATOM   1508 C  CZ3   . TRP A 1 212 ? -60.736  -57.717 -7.231  1.00 77.28  ? 212  TRP A CZ3   1 
ATOM   1509 C  CH2   . TRP A 1 212 ? -59.531  -57.128 -7.648  1.00 77.39  ? 212  TRP A CH2   1 
ATOM   1510 N  N     . GLY A 1 213 ? -66.640  -58.778 -12.014 1.00 69.06  ? 213  GLY A N     1 
ATOM   1511 C  CA    . GLY A 1 213 ? -68.038  -59.193 -12.101 1.00 66.07  ? 213  GLY A CA    1 
ATOM   1512 C  C     . GLY A 1 213 ? -69.017  -58.035 -12.094 1.00 68.51  ? 213  GLY A C     1 
ATOM   1513 O  O     . GLY A 1 213 ? -70.029  -58.074 -11.392 1.00 76.27  ? 213  GLY A O     1 
ATOM   1514 N  N     . LEU A 1 214 ? -68.713  -57.004 -12.880 1.00 68.00  ? 214  LEU A N     1 
ATOM   1515 C  CA    . LEU A 1 214 ? -69.571  -55.826 -12.987 1.00 66.34  ? 214  LEU A CA    1 
ATOM   1516 C  C     . LEU A 1 214 ? -70.150  -55.704 -14.394 1.00 63.80  ? 214  LEU A C     1 
ATOM   1517 O  O     . LEU A 1 214 ? -69.416  -55.500 -15.366 1.00 65.08  ? 214  LEU A O     1 
ATOM   1518 C  CB    . LEU A 1 214 ? -68.803  -54.556 -12.598 1.00 60.53  ? 214  LEU A CB    1 
ATOM   1519 C  CG    . LEU A 1 214 ? -68.276  -54.456 -11.160 1.00 58.42  ? 214  LEU A CG    1 
ATOM   1520 C  CD1   . LEU A 1 214 ? -67.096  -53.500 -11.081 1.00 53.82  ? 214  LEU A CD1   1 
ATOM   1521 C  CD2   . LEU A 1 214 ? -69.371  -54.045 -10.185 1.00 61.25  ? 214  LEU A CD2   1 
ATOM   1522 N  N     . THR A 1 215 ? -71.471  -55.839 -14.491 1.00 67.11  ? 215  THR A N     1 
ATOM   1523 C  CA    . THR A 1 215 ? -72.174  -55.802 -15.772 1.00 59.93  ? 215  THR A CA    1 
ATOM   1524 C  C     . THR A 1 215 ? -72.348  -54.363 -16.258 1.00 59.52  ? 215  THR A C     1 
ATOM   1525 O  O     . THR A 1 215 ? -72.814  -53.497 -15.515 1.00 66.16  ? 215  THR A O     1 
ATOM   1526 C  CB    . THR A 1 215 ? -73.550  -56.499 -15.684 1.00 67.50  ? 215  THR A CB    1 
ATOM   1527 O  OG1   . THR A 1 215 ? -73.423  -57.732 -14.964 1.00 75.19  ? 215  THR A OG1   1 
ATOM   1528 C  CG2   . THR A 1 215 ? -74.107  -56.787 -17.075 1.00 68.99  ? 215  THR A CG2   1 
ATOM   1529 N  N     . THR A 1 216 ? -71.962  -54.121 -17.509 1.00 60.18  ? 216  THR A N     1 
ATOM   1530 C  CA    . THR A 1 216 ? -72.063  -52.799 -18.129 1.00 61.53  ? 216  THR A CA    1 
ATOM   1531 C  C     . THR A 1 216 ? -72.698  -52.899 -19.519 1.00 60.64  ? 216  THR A C     1 
ATOM   1532 O  O     . THR A 1 216 ? -72.467  -53.881 -20.231 1.00 65.89  ? 216  THR A O     1 
ATOM   1533 C  CB    . THR A 1 216 ? -70.682  -52.117 -18.240 1.00 63.65  ? 216  THR A CB    1 
ATOM   1534 O  OG1   . THR A 1 216 ? -69.718  -53.057 -18.732 1.00 73.53  ? 216  THR A OG1   1 
ATOM   1535 C  CG2   . THR A 1 216 ? -70.227  -51.593 -16.882 1.00 60.68  ? 216  THR A CG2   1 
ATOM   1536 N  N     . PRO A 1 217 ? -73.503  -51.887 -19.910 1.00 57.73  ? 217  PRO A N     1 
ATOM   1537 C  CA    . PRO A 1 217 ? -74.182  -51.902 -21.210 1.00 68.19  ? 217  PRO A CA    1 
ATOM   1538 C  C     . PRO A 1 217 ? -73.215  -51.824 -22.389 1.00 73.35  ? 217  PRO A C     1 
ATOM   1539 O  O     . PRO A 1 217 ? -72.173  -51.168 -22.297 1.00 69.68  ? 217  PRO A O     1 
ATOM   1540 C  CB    . PRO A 1 217 ? -75.061  -50.643 -21.168 1.00 64.41  ? 217  PRO A CB    1 
ATOM   1541 C  CG    . PRO A 1 217 ? -75.177  -50.291 -19.724 1.00 64.48  ? 217  PRO A CG    1 
ATOM   1542 C  CD    . PRO A 1 217 ? -73.861  -50.689 -19.130 1.00 61.59  ? 217  PRO A CD    1 
ATOM   1543 N  N     . ASP A 1 218 ? -73.569  -52.493 -23.484 1.00 75.88  ? 218  ASP A N     1 
ATOM   1544 C  CA    . ASP A 1 218 ? -72.756  -52.494 -24.702 1.00 68.37  ? 218  ASP A CA    1 
ATOM   1545 C  C     . ASP A 1 218 ? -72.943  -51.213 -25.521 1.00 71.57  ? 218  ASP A C     1 
ATOM   1546 O  O     . ASP A 1 218 ? -73.775  -50.368 -25.182 1.00 79.24  ? 218  ASP A O     1 
ATOM   1547 C  CB    . ASP A 1 218 ? -73.048  -53.739 -25.553 1.00 69.46  ? 218  ASP A CB    1 
ATOM   1548 C  CG    . ASP A 1 218 ? -74.530  -53.938 -25.819 1.00 79.90  ? 218  ASP A CG    1 
ATOM   1549 O  OD1   . ASP A 1 218 ? -75.285  -54.187 -24.855 1.00 76.29  ? 218  ASP A OD1   1 
ATOM   1550 O  OD2   . ASP A 1 218 ? -74.938  -53.859 -26.997 1.00 87.52  ? 218  ASP A OD2   1 
ATOM   1551 N  N     . LYS A 1 219 ? -72.163  -51.088 -26.595 1.00 69.00  ? 219  LYS A N     1 
ATOM   1552 C  CA    . LYS A 1 219 ? -72.150  -49.899 -27.456 1.00 62.14  ? 219  LYS A CA    1 
ATOM   1553 C  C     . LYS A 1 219 ? -73.543  -49.459 -27.921 1.00 65.31  ? 219  LYS A C     1 
ATOM   1554 O  O     . LYS A 1 219 ? -73.857  -48.266 -27.913 1.00 63.95  ? 219  LYS A O     1 
ATOM   1555 C  CB    . LYS A 1 219 ? -71.234  -50.134 -28.665 1.00 59.97  ? 219  LYS A CB    1 
ATOM   1556 C  CG    . LYS A 1 219 ? -70.949  -48.894 -29.500 1.00 59.38  ? 219  LYS A CG    1 
ATOM   1557 C  CD    . LYS A 1 219 ? -70.139  -49.238 -30.739 1.00 59.27  ? 219  LYS A CD    1 
ATOM   1558 C  CE    . LYS A 1 219 ? -69.981  -48.031 -31.649 1.00 58.47  ? 219  LYS A CE    1 
ATOM   1559 N  NZ    . LYS A 1 219 ? -69.188  -48.354 -32.867 1.00 70.82  ? 219  LYS A NZ    1 
ATOM   1560 N  N     . LYS A 1 220 ? -74.367  -50.426 -28.320 1.00 76.90  ? 220  LYS A N     1 
ATOM   1561 C  CA    . LYS A 1 220 ? -75.728  -50.155 -28.787 1.00 73.92  ? 220  LYS A CA    1 
ATOM   1562 C  C     . LYS A 1 220 ? -76.685  -49.814 -27.643 1.00 75.70  ? 220  LYS A C     1 
ATOM   1563 O  O     . LYS A 1 220 ? -77.688  -49.127 -27.850 1.00 90.46  ? 220  LYS A O     1 
ATOM   1564 C  CB    . LYS A 1 220 ? -76.265  -51.346 -29.584 1.00 66.12  ? 220  LYS A CB    1 
ATOM   1565 N  N     . HIS A 1 221 ? -76.366  -50.295 -26.443 1.00 69.84  ? 221  HIS A N     1 
ATOM   1566 C  CA    . HIS A 1 221 ? -77.206  -50.092 -25.262 1.00 73.61  ? 221  HIS A CA    1 
ATOM   1567 C  C     . HIS A 1 221 ? -76.816  -48.878 -24.458 1.00 68.85  ? 221  HIS A C     1 
ATOM   1568 O  O     . HIS A 1 221 ? -77.492  -48.526 -23.487 1.00 66.15  ? 221  HIS A O     1 
ATOM   1569 C  CB    . HIS A 1 221 ? -77.191  -51.342 -24.384 1.00 72.90  ? 221  HIS A CB    1 
ATOM   1570 C  CG    . HIS A 1 221 ? -77.986  -52.497 -24.951 1.00 75.17  ? 221  HIS A CG    1 
ATOM   1571 N  ND1   . HIS A 1 221 ? -77.663  -53.102 -26.109 1.00 80.23  ? 221  HIS A ND1   1 
ATOM   1572 C  CD2   . HIS A 1 221 ? -79.114  -53.157 -24.465 1.00 77.62  ? 221  HIS A CD2   1 
ATOM   1573 C  CE1   . HIS A 1 221 ? -78.540  -54.092 -26.358 1.00 80.66  ? 221  HIS A CE1   1 
ATOM   1574 N  NE2   . HIS A 1 221 ? -79.427  -54.125 -25.351 1.00 85.74  ? 221  HIS A NE2   1 
ATOM   1575 N  N     . GLN A 1 222 ? -75.725  -48.227 -24.860 1.00 65.77  ? 222  GLN A N     1 
ATOM   1576 C  CA    . GLN A 1 222 ? -75.241  -47.015 -24.195 1.00 58.65  ? 222  GLN A CA    1 
ATOM   1577 C  C     . GLN A 1 222 ? -76.128  -45.807 -24.487 1.00 64.07  ? 222  GLN A C     1 
ATOM   1578 O  O     . GLN A 1 222 ? -76.665  -45.670 -25.589 1.00 68.15  ? 222  GLN A O     1 
ATOM   1579 C  CB    . GLN A 1 222 ? -73.797  -46.715 -24.606 1.00 58.78  ? 222  GLN A CB    1 
ATOM   1580 C  CG    . GLN A 1 222 ? -72.750  -47.533 -23.863 1.00 58.51  ? 222  GLN A CG    1 
ATOM   1581 C  CD    . GLN A 1 222 ? -71.364  -47.449 -24.483 1.00 49.20  ? 222  GLN A CD    1 
ATOM   1582 O  OE1   . GLN A 1 222 ? -70.485  -48.247 -24.160 1.00 54.28  ? 222  GLN A OE1   1 
ATOM   1583 N  NE2   . GLN A 1 222 ? -71.163  -46.485 -25.378 1.00 58.70  ? 222  GLN A NE2   1 
ATOM   1584 N  N     . LYS A 1 223 ? -76.270  -44.936 -23.490 1.00 64.82  ? 223  LYS A N     1 
ATOM   1585 C  CA    . LYS A 1 223 ? -77.084  -43.727 -23.614 1.00 63.63  ? 223  LYS A CA    1 
ATOM   1586 C  C     . LYS A 1 223 ? -76.365  -42.636 -24.406 1.00 66.86  ? 223  LYS A C     1 
ATOM   1587 O  O     . LYS A 1 223 ? -75.136  -42.530 -24.363 1.00 62.67  ? 223  LYS A O     1 
ATOM   1588 C  CB    . LYS A 1 223 ? -77.482  -43.196 -22.233 1.00 71.12  ? 223  LYS A CB    1 
ATOM   1589 C  CG    . LYS A 1 223 ? -78.463  -44.076 -21.474 1.00 77.17  ? 223  LYS A CG    1 
ATOM   1590 C  CD    . LYS A 1 223 ? -78.789  -43.486 -20.112 1.00 78.34  ? 223  LYS A CD    1 
ATOM   1591 C  CE    . LYS A 1 223 ? -79.765  -44.365 -19.346 1.00 81.80  ? 223  LYS A CE    1 
ATOM   1592 N  NZ    . LYS A 1 223 ? -80.084  -43.802 -18.005 1.00 99.24  ? 223  LYS A NZ    1 
ATOM   1593 N  N     . GLU A 1 224 ? -77.145  -41.832 -25.123 1.00 72.69  ? 224  GLU A N     1 
ATOM   1594 C  CA    . GLU A 1 224 ? -76.620  -40.728 -25.929 1.00 77.86  ? 224  GLU A CA    1 
ATOM   1595 C  C     . GLU A 1 224 ? -76.232  -39.523 -25.055 1.00 77.67  ? 224  GLU A C     1 
ATOM   1596 O  O     . GLU A 1 224 ? -76.667  -39.436 -23.904 1.00 85.30  ? 224  GLU A O     1 
ATOM   1597 C  CB    . GLU A 1 224 ? -77.636  -40.334 -27.009 1.00 86.96  ? 224  GLU A CB    1 
ATOM   1598 C  CG    . GLU A 1 224 ? -77.762  -41.355 -28.134 1.00 90.33  ? 224  GLU A CG    1 
ATOM   1599 C  CD    . GLU A 1 224 ? -78.624  -40.879 -29.293 1.00 104.28 ? 224  GLU A CD    1 
ATOM   1600 O  OE1   . GLU A 1 224 ? -79.146  -39.744 -29.242 1.00 106.91 ? 224  GLU A OE1   1 
ATOM   1601 O  OE2   . GLU A 1 224 ? -78.781  -41.649 -30.264 1.00 102.21 ? 224  GLU A OE2   1 
ATOM   1602 N  N     . PRO A 1 225 ? -75.409  -38.594 -25.598 1.00 76.84  ? 225  PRO A N     1 
ATOM   1603 C  CA    . PRO A 1 225 ? -74.867  -37.431 -24.869 1.00 80.95  ? 225  PRO A CA    1 
ATOM   1604 C  C     . PRO A 1 225 ? -75.826  -36.555 -24.030 1.00 94.51  ? 225  PRO A C     1 
ATOM   1605 O  O     . PRO A 1 225 ? -75.365  -35.941 -23.067 1.00 104.84 ? 225  PRO A O     1 
ATOM   1606 C  CB    . PRO A 1 225 ? -74.198  -36.587 -25.973 1.00 86.21  ? 225  PRO A CB    1 
ATOM   1607 C  CG    . PRO A 1 225 ? -74.519  -37.259 -27.270 1.00 105.66 ? 225  PRO A CG    1 
ATOM   1608 C  CD    . PRO A 1 225 ? -74.814  -38.688 -26.942 1.00 99.84  ? 225  PRO A CD    1 
ATOM   1609 N  N     . PRO A 1 226 ? -77.127  -36.463 -24.390 1.00 96.78  ? 226  PRO A N     1 
ATOM   1610 C  CA    . PRO A 1 226 ? -77.999  -35.742 -23.453 1.00 81.65  ? 226  PRO A CA    1 
ATOM   1611 C  C     . PRO A 1 226 ? -78.270  -36.536 -22.170 1.00 79.87  ? 226  PRO A C     1 
ATOM   1612 O  O     . PRO A 1 226 ? -79.214  -37.330 -22.115 1.00 79.80  ? 226  PRO A O     1 
ATOM   1613 C  CB    . PRO A 1 226 ? -79.293  -35.539 -24.255 1.00 81.27  ? 226  PRO A CB    1 
ATOM   1614 C  CG    . PRO A 1 226 ? -78.888  -35.667 -25.682 1.00 92.68  ? 226  PRO A CG    1 
ATOM   1615 C  CD    . PRO A 1 226 ? -77.807  -36.704 -25.677 1.00 84.20  ? 226  PRO A CD    1 
ATOM   1616 N  N     . PHE A 1 227 ? -77.435  -36.318 -21.154 1.00 74.12  ? 227  PHE A N     1 
ATOM   1617 C  CA    . PHE A 1 227 ? -77.568  -37.012 -19.872 1.00 76.15  ? 227  PHE A CA    1 
ATOM   1618 C  C     . PHE A 1 227 ? -78.420  -36.214 -18.891 1.00 76.75  ? 227  PHE A C     1 
ATOM   1619 O  O     . PHE A 1 227 ? -78.300  -34.991 -18.803 1.00 77.80  ? 227  PHE A O     1 
ATOM   1620 C  CB    . PHE A 1 227 ? -76.195  -37.288 -19.244 1.00 76.91  ? 227  PHE A CB    1 
ATOM   1621 C  CG    . PHE A 1 227 ? -75.204  -37.925 -20.180 1.00 77.72  ? 227  PHE A CG    1 
ATOM   1622 C  CD1   . PHE A 1 227 ? -75.385  -39.229 -20.634 1.00 74.31  ? 227  PHE A CD1   1 
ATOM   1623 C  CD2   . PHE A 1 227 ? -74.074  -37.227 -20.590 1.00 79.90  ? 227  PHE A CD2   1 
ATOM   1624 C  CE1   . PHE A 1 227 ? -74.467  -39.814 -21.494 1.00 68.69  ? 227  PHE A CE1   1 
ATOM   1625 C  CE2   . PHE A 1 227 ? -73.154  -37.807 -21.450 1.00 77.83  ? 227  PHE A CE2   1 
ATOM   1626 C  CZ    . PHE A 1 227 ? -73.349  -39.103 -21.900 1.00 71.76  ? 227  PHE A CZ    1 
ATOM   1627 N  N     . LEU A 1 228 ? -79.275  -36.920 -18.155 1.00 75.64  ? 228  LEU A N     1 
ATOM   1628 C  CA    . LEU A 1 228 ? -80.085  -36.312 -17.102 1.00 76.65  ? 228  LEU A CA    1 
ATOM   1629 C  C     . LEU A 1 228 ? -79.524  -36.690 -15.733 1.00 78.39  ? 228  LEU A C     1 
ATOM   1630 O  O     . LEU A 1 228 ? -79.655  -37.834 -15.289 1.00 86.75  ? 228  LEU A O     1 
ATOM   1631 C  CB    . LEU A 1 228 ? -81.555  -36.735 -17.227 1.00 89.41  ? 228  LEU A CB    1 
ATOM   1632 C  CG    . LEU A 1 228 ? -82.333  -36.308 -18.478 1.00 93.36  ? 228  LEU A CG    1 
ATOM   1633 C  CD1   . LEU A 1 228 ? -83.599  -37.139 -18.628 1.00 88.25  ? 228  LEU A CD1   1 
ATOM   1634 C  CD2   . LEU A 1 228 ? -82.665  -34.822 -18.459 1.00 91.18  ? 228  LEU A CD2   1 
ATOM   1635 N  N     . TRP A 1 229 ? -78.891  -35.719 -15.078 1.00 78.78  ? 229  TRP A N     1 
ATOM   1636 C  CA    . TRP A 1 229 ? -78.210  -35.949 -13.806 1.00 75.49  ? 229  TRP A CA    1 
ATOM   1637 C  C     . TRP A 1 229 ? -78.493  -34.844 -12.827 1.00 80.02  ? 229  TRP A C     1 
ATOM   1638 O  O     . TRP A 1 229 ? -78.205  -33.677 -13.100 1.00 82.83  ? 229  TRP A O     1 
ATOM   1639 C  CB    . TRP A 1 229 ? -76.707  -36.095 -14.037 1.00 69.67  ? 229  TRP A CB    1 
ATOM   1640 C  CG    . TRP A 1 229 ? -75.899  -36.285 -12.776 1.00 72.20  ? 229  TRP A CG    1 
ATOM   1641 C  CD1   . TRP A 1 229 ? -75.679  -37.469 -12.078 1.00 77.62  ? 229  TRP A CD1   1 
ATOM   1642 C  CD2   . TRP A 1 229 ? -75.166  -35.257 -12.021 1.00 69.38  ? 229  TRP A CD2   1 
ATOM   1643 N  NE1   . TRP A 1 229 ? -74.889  -37.251 -10.977 1.00 80.63  ? 229  TRP A NE1   1 
ATOM   1644 C  CE2   . TRP A 1 229 ? -74.546  -35.949 -10.883 1.00 75.95  ? 229  TRP A CE2   1 
ATOM   1645 C  CE3   . TRP A 1 229 ? -74.970  -33.887 -12.165 1.00 67.50  ? 229  TRP A CE3   1 
ATOM   1646 C  CZ2   . TRP A 1 229 ? -73.771  -35.279 -9.948  1.00 77.55  ? 229  TRP A CZ2   1 
ATOM   1647 C  CZ3   . TRP A 1 229 ? -74.185  -33.223 -11.215 1.00 63.55  ? 229  TRP A CZ3   1 
ATOM   1648 C  CH2   . TRP A 1 229 ? -73.601  -33.904 -10.134 1.00 67.43  ? 229  TRP A CH2   1 
ATOM   1649 N  N     . MET A 1 230 ? -79.067  -35.215 -11.681 1.00 81.14  ? 230  MET A N     1 
ATOM   1650 C  CA    . MET A 1 230 ? -79.418  -34.280 -10.598 1.00 80.75  ? 230  MET A CA    1 
ATOM   1651 C  C     . MET A 1 230 ? -80.283  -33.095 -11.047 1.00 76.70  ? 230  MET A C     1 
ATOM   1652 O  O     . MET A 1 230 ? -80.208  -32.005 -10.472 1.00 74.93  ? 230  MET A O     1 
ATOM   1653 C  CB    . MET A 1 230 ? -78.159  -33.794 -9.861  1.00 79.23  ? 230  MET A CB    1 
ATOM   1654 C  CG    . MET A 1 230 ? -77.587  -34.787 -8.861  1.00 74.52  ? 230  MET A CG    1 
ATOM   1655 S  SD    . MET A 1 230 ? -78.597  -34.951 -7.375  1.00 95.04  ? 230  MET A SD    1 
ATOM   1656 C  CE    . MET A 1 230 ? -77.565  -36.022 -6.378  1.00 78.82  ? 230  MET A CE    1 
ATOM   1657 N  N     . GLY A 1 231 ? -81.108  -33.321 -12.068 1.00 79.78  ? 231  GLY A N     1 
ATOM   1658 C  CA    . GLY A 1 231 ? -81.971  -32.278 -12.621 1.00 83.86  ? 231  GLY A CA    1 
ATOM   1659 C  C     . GLY A 1 231 ? -81.345  -31.506 -13.770 1.00 78.80  ? 231  GLY A C     1 
ATOM   1660 O  O     . GLY A 1 231 ? -82.026  -30.729 -14.444 1.00 78.97  ? 231  GLY A O     1 
ATOM   1661 N  N     . TYR A 1 232 ? -80.049  -31.720 -13.992 1.00 76.12  ? 232  TYR A N     1 
ATOM   1662 C  CA    . TYR A 1 232 ? -79.313  -31.038 -15.055 1.00 76.80  ? 232  TYR A CA    1 
ATOM   1663 C  C     . TYR A 1 232 ? -79.291  -31.866 -16.337 1.00 81.27  ? 232  TYR A C     1 
ATOM   1664 O  O     . TYR A 1 232 ? -79.058  -33.077 -16.302 1.00 85.77  ? 232  TYR A O     1 
ATOM   1665 C  CB    . TYR A 1 232 ? -77.872  -30.740 -14.621 1.00 77.50  ? 232  TYR A CB    1 
ATOM   1666 C  CG    . TYR A 1 232 ? -77.736  -29.971 -13.323 1.00 76.90  ? 232  TYR A CG    1 
ATOM   1667 C  CD1   . TYR A 1 232 ? -77.780  -28.577 -13.306 1.00 74.90  ? 232  TYR A CD1   1 
ATOM   1668 C  CD2   . TYR A 1 232 ? -77.545  -30.639 -12.113 1.00 74.83  ? 232  TYR A CD2   1 
ATOM   1669 C  CE1   . TYR A 1 232 ? -77.649  -27.871 -12.120 1.00 75.31  ? 232  TYR A CE1   1 
ATOM   1670 C  CE2   . TYR A 1 232 ? -77.414  -29.942 -10.922 1.00 74.80  ? 232  TYR A CE2   1 
ATOM   1671 C  CZ    . TYR A 1 232 ? -77.465  -28.560 -10.931 1.00 72.42  ? 232  TYR A CZ    1 
ATOM   1672 O  OH    . TYR A 1 232 ? -77.335  -27.868 -9.749  1.00 67.68  ? 232  TYR A OH    1 
ATOM   1673 N  N     . GLU A 1 233 ? -79.539  -31.203 -17.464 1.00 86.03  ? 233  GLU A N     1 
ATOM   1674 C  CA    . GLU A 1 233 ? -79.384  -31.814 -18.780 1.00 77.50  ? 233  GLU A CA    1 
ATOM   1675 C  C     . GLU A 1 233 ? -77.987  -31.483 -19.303 1.00 74.17  ? 233  GLU A C     1 
ATOM   1676 O  O     . GLU A 1 233 ? -77.708  -30.344 -19.690 1.00 77.34  ? 233  GLU A O     1 
ATOM   1677 C  CB    . GLU A 1 233 ? -80.467  -31.315 -19.743 1.00 73.78  ? 233  GLU A CB    1 
ATOM   1678 C  CG    . GLU A 1 233 ? -80.509  -32.044 -21.080 1.00 76.01  ? 233  GLU A CG    1 
ATOM   1679 C  CD    . GLU A 1 233 ? -81.535  -31.467 -22.038 1.00 84.88  ? 233  GLU A CD    1 
ATOM   1680 O  OE1   . GLU A 1 233 ? -82.692  -31.241 -21.621 1.00 83.02  ? 233  GLU A OE1   1 
ATOM   1681 O  OE2   . GLU A 1 233 ? -81.184  -31.238 -23.215 1.00 90.34  ? 233  GLU A OE2   1 
ATOM   1682 N  N     . LEU A 1 234 ? -77.115  -32.488 -19.302 1.00 73.38  ? 234  LEU A N     1 
ATOM   1683 C  CA    . LEU A 1 234 ? -75.700  -32.299 -19.624 1.00 76.58  ? 234  LEU A CA    1 
ATOM   1684 C  C     . LEU A 1 234 ? -75.386  -32.487 -21.107 1.00 79.38  ? 234  LEU A C     1 
ATOM   1685 O  O     . LEU A 1 234 ? -75.982  -33.330 -21.780 1.00 81.58  ? 234  LEU A O     1 
ATOM   1686 C  CB    . LEU A 1 234 ? -74.828  -33.238 -18.781 1.00 77.10  ? 234  LEU A CB    1 
ATOM   1687 C  CG    . LEU A 1 234 ? -74.772  -33.018 -17.264 1.00 75.28  ? 234  LEU A CG    1 
ATOM   1688 C  CD1   . LEU A 1 234 ? -74.316  -34.286 -16.557 1.00 70.55  ? 234  LEU A CD1   1 
ATOM   1689 C  CD2   . LEU A 1 234 ? -73.875  -31.844 -16.897 1.00 74.25  ? 234  LEU A CD2   1 
ATOM   1690 N  N     . HIS A 1 235 ? -74.446  -31.683 -21.598 1.00 74.57  ? 235  HIS A N     1 
ATOM   1691 C  CA    . HIS A 1 235 ? -73.934  -31.782 -22.965 1.00 71.43  ? 235  HIS A CA    1 
ATOM   1692 C  C     . HIS A 1 235 ? -72.429  -31.676 -22.932 1.00 71.70  ? 235  HIS A C     1 
ATOM   1693 O  O     . HIS A 1 235 ? -71.872  -31.176 -21.952 1.00 77.32  ? 235  HIS A O     1 
ATOM   1694 C  CB    . HIS A 1 235 ? -74.524  -30.678 -23.841 1.00 69.37  ? 235  HIS A CB    1 
ATOM   1695 C  CG    . HIS A 1 235 ? -76.032  -30.687 -23.909 1.00 67.14  ? 235  HIS A CG    1 
ATOM   1696 N  ND1   . HIS A 1 235 ? -76.709  -31.343 -24.869 1.00 68.67  ? 235  HIS A ND1   1 
ATOM   1697 C  CD2   . HIS A 1 235 ? -76.990  -30.087 -23.093 1.00 71.93  ? 235  HIS A CD2   1 
ATOM   1698 C  CE1   . HIS A 1 235 ? -78.031  -31.174 -24.680 1.00 69.53  ? 235  HIS A CE1   1 
ATOM   1699 N  NE2   . HIS A 1 235 ? -78.201  -30.405 -23.592 1.00 68.43  ? 235  HIS A NE2   1 
ATOM   1700 N  N     . PRO A 1 236 ? -71.742  -32.158 -23.990 1.00 72.39  ? 236  PRO A N     1 
ATOM   1701 C  CA    . PRO A 1 236 ? -70.274  -32.093 -24.031 1.00 73.79  ? 236  PRO A CA    1 
ATOM   1702 C  C     . PRO A 1 236 ? -69.696  -30.673 -24.038 1.00 78.19  ? 236  PRO A C     1 
ATOM   1703 O  O     . PRO A 1 236 ? -68.595  -30.459 -23.524 1.00 75.75  ? 236  PRO A O     1 
ATOM   1704 C  CB    . PRO A 1 236 ? -69.927  -32.806 -25.344 1.00 73.52  ? 236  PRO A CB    1 
ATOM   1705 C  CG    . PRO A 1 236 ? -71.090  -33.697 -25.610 1.00 67.10  ? 236  PRO A CG    1 
ATOM   1706 C  CD    . PRO A 1 236 ? -72.281  -32.925 -25.128 1.00 69.21  ? 236  PRO A CD    1 
ATOM   1707 N  N     . ASP A 1 237 ? -70.431  -29.720 -24.610 1.00 84.28  ? 237  ASP A N     1 
ATOM   1708 C  CA    . ASP A 1 237 ? -69.951  -28.341 -24.745 1.00 83.27  ? 237  ASP A CA    1 
ATOM   1709 C  C     . ASP A 1 237 ? -70.648  -27.347 -23.811 1.00 78.24  ? 237  ASP A C     1 
ATOM   1710 O  O     . ASP A 1 237 ? -70.045  -26.354 -23.397 1.00 72.38  ? 237  ASP A O     1 
ATOM   1711 C  CB    . ASP A 1 237 ? -70.057  -27.869 -26.202 1.00 89.16  ? 237  ASP A CB    1 
ATOM   1712 C  CG    . ASP A 1 237 ? -71.472  -27.964 -26.754 1.00 88.88  ? 237  ASP A CG    1 
ATOM   1713 O  OD1   . ASP A 1 237 ? -72.057  -29.070 -26.732 1.00 79.05  ? 237  ASP A OD1   1 
ATOM   1714 O  OD2   . ASP A 1 237 ? -71.996  -26.932 -27.223 1.00 94.89  ? 237  ASP A OD2   1 
ATOM   1715 N  N     . LYS A 1 238 ? -71.911  -27.618 -23.488 1.00 78.42  ? 238  LYS A N     1 
ATOM   1716 C  CA    . LYS A 1 238 ? -72.711  -26.735 -22.632 1.00 77.95  ? 238  LYS A CA    1 
ATOM   1717 C  C     . LYS A 1 238 ? -73.531  -27.524 -21.606 1.00 80.08  ? 238  LYS A C     1 
ATOM   1718 O  O     . LYS A 1 238 ? -73.503  -28.754 -21.597 1.00 79.72  ? 238  LYS A O     1 
ATOM   1719 C  CB    . LYS A 1 238 ? -73.621  -25.838 -23.485 1.00 80.68  ? 238  LYS A CB    1 
ATOM   1720 C  CG    . LYS A 1 238 ? -74.591  -26.585 -24.390 1.00 82.14  ? 238  LYS A CG    1 
ATOM   1721 C  CD    . LYS A 1 238 ? -75.439  -25.624 -25.208 1.00 85.45  ? 238  LYS A CD    1 
ATOM   1722 C  CE    . LYS A 1 238 ? -76.400  -26.374 -26.117 1.00 84.95  ? 238  LYS A CE    1 
ATOM   1723 N  NZ    . LYS A 1 238 ? -77.237  -25.447 -26.927 1.00 80.53  ? 238  LYS A NZ    1 
ATOM   1724 N  N     . TRP A 1 239 ? -74.245  -26.811 -20.736 1.00 82.82  ? 239  TRP A N     1 
ATOM   1725 C  CA    . TRP A 1 239 ? -75.154  -27.446 -19.779 1.00 78.51  ? 239  TRP A CA    1 
ATOM   1726 C  C     . TRP A 1 239 ? -76.346  -26.583 -19.477 1.00 81.93  ? 239  TRP A C     1 
ATOM   1727 O  O     . TRP A 1 239 ? -76.229  -25.360 -19.374 1.00 83.57  ? 239  TRP A O     1 
ATOM   1728 C  CB    . TRP A 1 239 ? -74.423  -27.844 -18.494 1.00 73.70  ? 239  TRP A CB    1 
ATOM   1729 C  CG    . TRP A 1 239 ? -73.965  -26.684 -17.640 1.00 75.84  ? 239  TRP A CG    1 
ATOM   1730 C  CD1   . TRP A 1 239 ? -72.741  -26.021 -17.690 1.00 76.92  ? 239  TRP A CD1   1 
ATOM   1731 C  CD2   . TRP A 1 239 ? -74.715  -26.016 -16.564 1.00 72.39  ? 239  TRP A CD2   1 
ATOM   1732 N  NE1   . TRP A 1 239 ? -72.687  -25.020 -16.752 1.00 71.87  ? 239  TRP A NE1   1 
ATOM   1733 C  CE2   . TRP A 1 239 ? -73.836  -24.962 -16.044 1.00 70.65  ? 239  TRP A CE2   1 
ATOM   1734 C  CE3   . TRP A 1 239 ? -75.979  -26.178 -16.003 1.00 74.00  ? 239  TRP A CE3   1 
ATOM   1735 C  CZ2   . TRP A 1 239 ? -74.226  -24.122 -15.010 1.00 71.50  ? 239  TRP A CZ2   1 
ATOM   1736 C  CZ3   . TRP A 1 239 ? -76.360  -25.324 -14.960 1.00 69.96  ? 239  TRP A CZ3   1 
ATOM   1737 C  CH2   . TRP A 1 239 ? -75.504  -24.322 -14.478 1.00 71.50  ? 239  TRP A CH2   1 
ATOM   1738 N  N     . THR A 1 240 ? -77.507  -27.217 -19.335 1.00 84.17  ? 240  THR A N     1 
ATOM   1739 C  CA    . THR A 1 240 ? -78.755  -26.505 -19.050 1.00 84.19  ? 240  THR A CA    1 
ATOM   1740 C  C     . THR A 1 240 ? -79.678  -27.306 -18.128 1.00 86.33  ? 240  THR A C     1 
ATOM   1741 O  O     . THR A 1 240 ? -79.597  -28.533 -18.066 1.00 91.78  ? 240  THR A O     1 
ATOM   1742 C  CB    . THR A 1 240 ? -79.501  -26.103 -20.348 1.00 89.96  ? 240  THR A CB    1 
ATOM   1743 O  OG1   . THR A 1 240 ? -80.703  -25.394 -20.018 1.00 100.18 ? 240  THR A OG1   1 
ATOM   1744 C  CG2   . THR A 1 240 ? -79.849  -27.327 -21.200 1.00 81.61  ? 240  THR A CG2   1 
ATOM   1745 N  N     . VAL A 1 241 ? -80.544  -26.596 -17.409 1.00 90.70  ? 241  VAL A N     1 
ATOM   1746 C  CA    . VAL A 1 241 ? -81.535  -27.226 -16.535 1.00 86.17  ? 241  VAL A CA    1 
ATOM   1747 C  C     . VAL A 1 241 ? -82.825  -27.528 -17.299 1.00 84.57  ? 241  VAL A C     1 
ATOM   1748 O  O     . VAL A 1 241 ? -83.102  -26.909 -18.331 1.00 93.46  ? 241  VAL A O     1 
ATOM   1749 C  CB    . VAL A 1 241 ? -81.846  -26.363 -15.285 1.00 76.86  ? 241  VAL A CB    1 
ATOM   1750 C  CG1   . VAL A 1 241 ? -80.664  -26.363 -14.325 1.00 79.30  ? 241  VAL A CG1   1 
ATOM   1751 C  CG2   . VAL A 1 241 ? -82.231  -24.940 -15.675 1.00 81.71  ? 241  VAL A CG2   1 
ATOM   1752 N  N     . GLN A 1 242 ? -83.600  -28.487 -16.792 1.00 85.72  ? 242  GLN A N     1 
ATOM   1753 C  CA    . GLN A 1 242 ? -84.896  -28.841 -17.374 1.00 93.70  ? 242  GLN A CA    1 
ATOM   1754 C  C     . GLN A 1 242 ? -85.858  -27.651 -17.315 1.00 93.47  ? 242  GLN A C     1 
ATOM   1755 O  O     . GLN A 1 242 ? -85.905  -26.952 -16.299 1.00 94.20  ? 242  GLN A O     1 
ATOM   1756 C  CB    . GLN A 1 242 ? -85.500  -30.051 -16.653 1.00 99.21  ? 242  GLN A CB    1 
ATOM   1757 C  CG    . GLN A 1 242 ? -84.813  -31.375 -16.963 1.00 100.03 ? 242  GLN A CG    1 
ATOM   1758 C  CD    . GLN A 1 242 ? -85.418  -32.548 -16.209 1.00 100.81 ? 242  GLN A CD    1 
ATOM   1759 O  OE1   . GLN A 1 242 ? -85.719  -32.452 -15.018 1.00 97.47  ? 242  GLN A OE1   1 
ATOM   1760 N  NE2   . GLN A 1 242 ? -85.590  -33.668 -16.902 1.00 89.23  ? 242  GLN A NE2   1 
ATOM   1761 N  N     . PRO A 1 243 ? -86.618  -27.411 -18.406 1.00 100.06 ? 243  PRO A N     1 
ATOM   1762 C  CA    . PRO A 1 243 ? -87.525  -26.261 -18.508 1.00 97.60  ? 243  PRO A CA    1 
ATOM   1763 C  C     . PRO A 1 243 ? -88.455  -26.115 -17.303 1.00 99.63  ? 243  PRO A C     1 
ATOM   1764 O  O     . PRO A 1 243 ? -89.166  -27.059 -16.946 1.00 101.11 ? 243  PRO A O     1 
ATOM   1765 C  CB    . PRO A 1 243 ? -88.332  -26.564 -19.772 1.00 98.24  ? 243  PRO A CB    1 
ATOM   1766 C  CG    . PRO A 1 243 ? -87.407  -27.379 -20.607 1.00 98.33  ? 243  PRO A CG    1 
ATOM   1767 C  CD    . PRO A 1 243 ? -86.635  -28.227 -19.637 1.00 100.22 ? 243  PRO A CD    1 
ATOM   1768 N  N     . ILE A 1 244 ? -88.432  -24.936 -16.684 1.00 96.28  ? 244  ILE A N     1 
ATOM   1769 C  CA    . ILE A 1 244 ? -89.232  -24.661 -15.492 1.00 92.13  ? 244  ILE A CA    1 
ATOM   1770 C  C     . ILE A 1 244 ? -90.582  -24.053 -15.876 1.00 100.41 ? 244  ILE A C     1 
ATOM   1771 O  O     . ILE A 1 244 ? -90.650  -22.931 -16.387 1.00 103.97 ? 244  ILE A O     1 
ATOM   1772 C  CB    . ILE A 1 244 ? -88.493  -23.741 -14.485 1.00 89.92  ? 244  ILE A CB    1 
ATOM   1773 C  CG1   . ILE A 1 244 ? -87.139  -24.336 -14.075 1.00 89.37  ? 244  ILE A CG1   1 
ATOM   1774 C  CG2   . ILE A 1 244 ? -89.341  -23.504 -13.242 1.00 92.85  ? 244  ILE A CG2   1 
ATOM   1775 C  CD1   . ILE A 1 244 ? -85.957  -23.811 -14.866 1.00 102.54 ? 244  ILE A CD1   1 
ATOM   1776 N  N     . VAL A 1 245 ? -91.647  -24.814 -15.634 1.00 101.19 ? 245  VAL A N     1 
ATOM   1777 C  CA    . VAL A 1 245 ? -93.016  -24.368 -15.898 1.00 106.81 ? 245  VAL A CA    1 
ATOM   1778 C  C     . VAL A 1 245 ? -93.808  -24.383 -14.590 1.00 95.55  ? 245  VAL A C     1 
ATOM   1779 O  O     . VAL A 1 245 ? -93.868  -25.408 -13.904 1.00 97.15  ? 245  VAL A O     1 
ATOM   1780 C  CB    . VAL A 1 245 ? -93.716  -25.248 -16.962 1.00 110.05 ? 245  VAL A CB    1 
ATOM   1781 C  CG1   . VAL A 1 245 ? -95.135  -24.762 -17.225 1.00 95.29  ? 245  VAL A CG1   1 
ATOM   1782 C  CG2   . VAL A 1 245 ? -92.920  -25.265 -18.261 1.00 103.81 ? 245  VAL A CG2   1 
ATOM   1783 N  N     . LEU A 1 246 ? -94.408  -23.244 -14.251 1.00 95.91  ? 246  LEU A N     1 
ATOM   1784 C  CA    . LEU A 1 246 ? -95.138  -23.094 -12.991 1.00 107.38 ? 246  LEU A CA    1 
ATOM   1785 C  C     . LEU A 1 246 ? -96.617  -22.725 -13.178 1.00 107.59 ? 246  LEU A C     1 
ATOM   1786 O  O     . LEU A 1 246 ? -96.965  -22.041 -14.144 1.00 109.29 ? 246  LEU A O     1 
ATOM   1787 C  CB    . LEU A 1 246 ? -94.434  -22.090 -12.052 1.00 91.40  ? 246  LEU A CB    1 
ATOM   1788 C  CG    . LEU A 1 246 ? -93.817  -20.732 -12.457 1.00 79.36  ? 246  LEU A CG    1 
ATOM   1789 C  CD1   . LEU A 1 246 ? -92.533  -20.890 -13.266 1.00 77.60  ? 246  LEU A CD1   1 
ATOM   1790 C  CD2   . LEU A 1 246 ? -94.792  -19.791 -13.160 1.00 85.35  ? 246  LEU A CD2   1 
ATOM   1791 N  N     . PRO A 1 247 ? -97.491  -23.201 -12.264 1.00 112.32 ? 247  PRO A N     1 
ATOM   1792 C  CA    . PRO A 1 247 ? -98.890  -22.755 -12.202 1.00 117.42 ? 247  PRO A CA    1 
ATOM   1793 C  C     . PRO A 1 247 ? -98.973  -21.251 -11.940 1.00 119.37 ? 247  PRO A C     1 
ATOM   1794 O  O     . PRO A 1 247 ? -98.134  -20.706 -11.217 1.00 109.96 ? 247  PRO A O     1 
ATOM   1795 C  CB    . PRO A 1 247 ? -99.455  -23.539 -11.015 1.00 111.36 ? 247  PRO A CB    1 
ATOM   1796 C  CG    . PRO A 1 247 ? -98.611  -24.764 -10.944 1.00 110.06 ? 247  PRO A CG    1 
ATOM   1797 C  CD    . PRO A 1 247 ? -97.233  -24.310 -11.325 1.00 110.06 ? 247  PRO A CD    1 
ATOM   1798 N  N     . GLU A 1 248 ? -99.980  -20.593 -12.511 1.00 113.34 ? 248  GLU A N     1 
ATOM   1799 C  CA    . GLU A 1 248 ? -99.965  -19.128 -12.624 1.00 101.97 ? 248  GLU A CA    1 
ATOM   1800 C  C     . GLU A 1 248 ? -101.005 -18.325 -11.814 1.00 97.81  ? 248  GLU A C     1 
ATOM   1801 O  O     . GLU A 1 248 ? -100.956 -18.300 -10.582 1.00 98.98  ? 248  GLU A O     1 
ATOM   1802 C  CB    . GLU A 1 248 ? -99.959  -18.702 -14.106 1.00 102.94 ? 248  GLU A CB    1 
ATOM   1803 C  CG    . GLU A 1 248 ? -100.951 -19.441 -14.999 1.00 105.46 ? 248  GLU A CG    1 
ATOM   1804 C  CD    . GLU A 1 248 ? -100.933 -18.956 -16.439 1.00 117.54 ? 248  GLU A CD    1 
ATOM   1805 O  OE1   . GLU A 1 248 ? -100.736 -17.742 -16.668 1.00 113.57 ? 248  GLU A OE1   1 
ATOM   1806 O  OE2   . GLU A 1 248 ? -101.126 -19.791 -17.347 1.00 126.27 ? 248  GLU A OE2   1 
ATOM   1807 N  N     . LYS A 1 249 ? -101.934 -17.687 -12.528 1.00 103.41 ? 249  LYS A N     1 
ATOM   1808 C  CA    . LYS A 1 249 ? -102.730 -16.545 -12.045 1.00 108.76 ? 249  LYS A CA    1 
ATOM   1809 C  C     . LYS A 1 249 ? -103.394 -16.630 -10.663 1.00 103.95 ? 249  LYS A C     1 
ATOM   1810 O  O     . LYS A 1 249 ? -102.961 -15.951 -9.728  1.00 94.23  ? 249  LYS A O     1 
ATOM   1811 C  CB    . LYS A 1 249 ? -103.771 -16.147 -13.102 1.00 101.13 ? 249  LYS A CB    1 
ATOM   1812 N  N     . ASP A 1 250 ? -104.438 -17.453 -10.551 1.00 108.30 ? 250  ASP A N     1 
ATOM   1813 C  CA    . ASP A 1 250 ? -105.339 -17.466 -9.386  1.00 108.75 ? 250  ASP A CA    1 
ATOM   1814 C  C     . ASP A 1 250 ? -104.650 -17.521 -8.020  1.00 111.23 ? 250  ASP A C     1 
ATOM   1815 O  O     . ASP A 1 250 ? -103.587 -18.129 -7.872  1.00 106.76 ? 250  ASP A O     1 
ATOM   1816 C  CB    . ASP A 1 250 ? -106.361 -18.603 -9.512  1.00 112.70 ? 250  ASP A CB    1 
ATOM   1817 C  CG    . ASP A 1 250 ? -107.384 -18.355 -10.611 1.00 111.33 ? 250  ASP A CG    1 
ATOM   1818 O  OD1   . ASP A 1 250 ? -107.005 -17.852 -11.691 1.00 104.49 ? 250  ASP A OD1   1 
ATOM   1819 O  OD2   . ASP A 1 250 ? -108.573 -18.673 -10.395 1.00 115.33 ? 250  ASP A OD2   1 
ATOM   1820 N  N     . SER A 1 251 ? -105.282 -16.880 -7.035  1.00 105.30 ? 251  SER A N     1 
ATOM   1821 C  CA    . SER A 1 251 ? -104.744 -16.748 -5.677  1.00 102.55 ? 251  SER A CA    1 
ATOM   1822 C  C     . SER A 1 251 ? -104.301 -18.081 -5.077  1.00 100.63 ? 251  SER A C     1 
ATOM   1823 O  O     . SER A 1 251 ? -105.128 -18.916 -4.699  1.00 92.78  ? 251  SER A O     1 
ATOM   1824 C  CB    . SER A 1 251 ? -105.762 -16.059 -4.762  1.00 93.00  ? 251  SER A CB    1 
ATOM   1825 N  N     . TRP A 1 252 ? -102.985 -18.267 -5.006  1.00 112.28 ? 252  TRP A N     1 
ATOM   1826 C  CA    . TRP A 1 252 ? -102.386 -19.504 -4.511  1.00 107.22 ? 252  TRP A CA    1 
ATOM   1827 C  C     . TRP A 1 252 ? -102.253 -19.511 -3.013  1.00 102.69 ? 252  TRP A C     1 
ATOM   1828 O  O     . TRP A 1 252 ? -102.372 -18.469 -2.362  1.00 104.41 ? 252  TRP A O     1 
ATOM   1829 C  CB    . TRP A 1 252 ? -101.025 -19.729 -5.163  1.00 104.44 ? 252  TRP A CB    1 
ATOM   1830 N  N     . THR A 1 253 ? -102.003 -20.695 -2.457  1.00 97.83  ? 253  THR A N     1 
ATOM   1831 C  CA    . THR A 1 253 ? -101.868 -20.875 -1.010  1.00 98.33  ? 253  THR A CA    1 
ATOM   1832 C  C     . THR A 1 253 ? -100.420 -20.686 -0.530  1.00 99.11  ? 253  THR A C     1 
ATOM   1833 O  O     . THR A 1 253 ? -99.522  -20.423 -1.333  1.00 98.51  ? 253  THR A O     1 
ATOM   1834 C  CB    . THR A 1 253 ? -102.440 -22.241 -0.552  1.00 93.15  ? 253  THR A CB    1 
ATOM   1835 O  OG1   . THR A 1 253 ? -102.439 -22.311 0.879   1.00 98.55  ? 253  THR A OG1   1 
ATOM   1836 C  CG2   . THR A 1 253 ? -101.629 -23.407 -1.119  1.00 86.43  ? 253  THR A CG2   1 
ATOM   1837 N  N     . VAL A 1 254 ? -100.214 -20.822 0.781   1.00 94.95  ? 254  VAL A N     1 
ATOM   1838 C  CA    . VAL A 1 254 ? -98.921  -20.562 1.429   1.00 96.74  ? 254  VAL A CA    1 
ATOM   1839 C  C     . VAL A 1 254 ? -97.778  -21.473 0.953   1.00 92.23  ? 254  VAL A C     1 
ATOM   1840 O  O     . VAL A 1 254 ? -96.686  -20.988 0.648   1.00 90.02  ? 254  VAL A O     1 
ATOM   1841 C  CB    . VAL A 1 254 ? -99.048  -20.581 2.978   1.00 89.12  ? 254  VAL A CB    1 
ATOM   1842 C  CG1   . VAL A 1 254 ? -99.589  -21.916 3.473   1.00 86.75  ? 254  VAL A CG1   1 
ATOM   1843 C  CG2   . VAL A 1 254 ? -97.719  -20.252 3.649   1.00 84.16  ? 254  VAL A CG2   1 
ATOM   1844 N  N     . ASN A 1 255 ? -98.031  -22.779 0.884   1.00 86.49  ? 255  ASN A N     1 
ATOM   1845 C  CA    . ASN A 1 255 ? -96.997  -23.741 0.499   1.00 92.04  ? 255  ASN A CA    1 
ATOM   1846 C  C     . ASN A 1 255 ? -96.734  -23.766 -1.008  1.00 100.42 ? 255  ASN A C     1 
ATOM   1847 O  O     . ASN A 1 255 ? -95.681  -24.231 -1.451  1.00 97.62  ? 255  ASN A O     1 
ATOM   1848 C  CB    . ASN A 1 255 ? -97.325  -25.144 1.019   1.00 90.58  ? 255  ASN A CB    1 
ATOM   1849 C  CG    . ASN A 1 255 ? -96.086  -26.007 1.196   1.00 84.07  ? 255  ASN A CG    1 
ATOM   1850 O  OD1   . ASN A 1 255 ? -95.078  -25.566 1.754   1.00 79.92  ? 255  ASN A OD1   1 
ATOM   1851 N  ND2   . ASN A 1 255 ? -96.159  -27.248 0.730   1.00 83.58  ? 255  ASN A ND2   1 
ATOM   1852 N  N     . ASP A 1 256 ? -97.694  -23.265 -1.785  1.00 94.93  ? 256  ASP A N     1 
ATOM   1853 C  CA    . ASP A 1 256 ? -97.519  -23.088 -3.227  1.00 91.36  ? 256  ASP A CA    1 
ATOM   1854 C  C     . ASP A 1 256 ? -96.515  -21.975 -3.526  1.00 91.49  ? 256  ASP A C     1 
ATOM   1855 O  O     . ASP A 1 256 ? -95.849  -21.994 -4.563  1.00 93.05  ? 256  ASP A O     1 
ATOM   1856 C  CB    . ASP A 1 256 ? -98.859  -22.800 -3.911  1.00 87.55  ? 256  ASP A CB    1 
ATOM   1857 C  CG    . ASP A 1 256 ? -99.720  -24.046 -4.073  1.00 93.39  ? 256  ASP A CG    1 
ATOM   1858 O  OD1   . ASP A 1 256 ? -99.227  -25.168 -3.826  1.00 96.90  ? 256  ASP A OD1   1 
ATOM   1859 O  OD2   . ASP A 1 256 ? -100.901 -23.900 -4.454  1.00 91.24  ? 256  ASP A OD2   1 
ATOM   1860 N  N     . ILE A 1 257 ? -96.422  -21.009 -2.612  1.00 92.00  ? 257  ILE A N     1 
ATOM   1861 C  CA    . ILE A 1 257 ? -95.390  -19.974 -2.663  1.00 92.41  ? 257  ILE A CA    1 
ATOM   1862 C  C     . ILE A 1 257 ? -94.033  -20.597 -2.323  1.00 92.96  ? 257  ILE A C     1 
ATOM   1863 O  O     . ILE A 1 257 ? -93.024  -20.282 -2.956  1.00 93.75  ? 257  ILE A O     1 
ATOM   1864 C  CB    . ILE A 1 257 ? -95.702  -18.794 -1.703  1.00 84.78  ? 257  ILE A CB    1 
ATOM   1865 C  CG1   . ILE A 1 257 ? -97.095  -18.197 -1.979  1.00 83.81  ? 257  ILE A CG1   1 
ATOM   1866 C  CG2   . ILE A 1 257 ? -94.613  -17.727 -1.760  1.00 81.75  ? 257  ILE A CG2   1 
ATOM   1867 C  CD1   . ILE A 1 257 ? -97.295  -17.603 -3.362  1.00 95.28  ? 257  ILE A CD1   1 
ATOM   1868 N  N     . GLN A 1 258 ? -94.027  -21.491 -1.334  1.00 87.87  ? 258  GLN A N     1 
ATOM   1869 C  CA    . GLN A 1 258 ? -92.822  -22.224 -0.935  1.00 91.27  ? 258  GLN A CA    1 
ATOM   1870 C  C     . GLN A 1 258 ? -92.324  -23.151 -2.045  1.00 91.61  ? 258  GLN A C     1 
ATOM   1871 O  O     . GLN A 1 258 ? -91.119  -23.376 -2.180  1.00 86.64  ? 258  GLN A O     1 
ATOM   1872 C  CB    . GLN A 1 258 ? -93.088  -23.030 0.338   1.00 88.00  ? 258  GLN A CB    1 
ATOM   1873 N  N     . LYS A 1 259 ? -93.260  -23.685 -2.830  1.00 92.17  ? 259  LYS A N     1 
ATOM   1874 C  CA    . LYS A 1 259 ? -92.934  -24.481 -4.013  1.00 88.30  ? 259  LYS A CA    1 
ATOM   1875 C  C     . LYS A 1 259 ? -92.414  -23.594 -5.144  1.00 87.94  ? 259  LYS A C     1 
ATOM   1876 O  O     . LYS A 1 259 ? -91.593  -24.030 -5.954  1.00 88.86  ? 259  LYS A O     1 
ATOM   1877 C  CB    . LYS A 1 259 ? -94.155  -25.272 -4.489  1.00 82.55  ? 259  LYS A CB    1 
ATOM   1878 C  CG    . LYS A 1 259 ? -94.507  -26.474 -3.626  1.00 94.75  ? 259  LYS A CG    1 
ATOM   1879 C  CD    . LYS A 1 259 ? -95.778  -27.149 -4.118  1.00 99.00  ? 259  LYS A CD    1 
ATOM   1880 C  CE    . LYS A 1 259 ? -96.169  -28.326 -3.236  1.00 98.44  ? 259  LYS A CE    1 
ATOM   1881 N  NZ    . LYS A 1 259 ? -95.240  -29.482 -3.376  1.00 83.79  ? 259  LYS A NZ    1 
ATOM   1882 N  N     . LEU A 1 260 ? -92.899  -22.354 -5.188  1.00 87.76  ? 260  LEU A N     1 
ATOM   1883 C  CA    . LEU A 1 260 ? -92.492  -21.384 -6.203  1.00 84.66  ? 260  LEU A CA    1 
ATOM   1884 C  C     . LEU A 1 260 ? -91.099  -20.826 -5.902  1.00 86.84  ? 260  LEU A C     1 
ATOM   1885 O  O     . LEU A 1 260 ? -90.304  -20.606 -6.819  1.00 87.20  ? 260  LEU A O     1 
ATOM   1886 C  CB    . LEU A 1 260 ? -93.517  -20.246 -6.299  1.00 85.56  ? 260  LEU A CB    1 
ATOM   1887 C  CG    . LEU A 1 260 ? -93.905  -19.705 -7.683  1.00 93.37  ? 260  LEU A CG    1 
ATOM   1888 C  CD1   . LEU A 1 260 ? -95.203  -18.915 -7.596  1.00 95.33  ? 260  LEU A CD1   1 
ATOM   1889 C  CD2   . LEU A 1 260 ? -92.806  -18.864 -8.316  1.00 102.67 ? 260  LEU A CD2   1 
ATOM   1890 N  N     . VAL A 1 261 ? -90.815  -20.603 -4.618  1.00 82.87  ? 261  VAL A N     1 
ATOM   1891 C  CA    . VAL A 1 261 ? -89.497  -20.146 -4.164  1.00 81.32  ? 261  VAL A CA    1 
ATOM   1892 C  C     . VAL A 1 261 ? -88.439  -21.223 -4.419  1.00 81.31  ? 261  VAL A C     1 
ATOM   1893 O  O     . VAL A 1 261 ? -87.320  -20.916 -4.840  1.00 78.65  ? 261  VAL A O     1 
ATOM   1894 C  CB    . VAL A 1 261 ? -89.516  -19.735 -2.668  1.00 71.88  ? 261  VAL A CB    1 
ATOM   1895 C  CG1   . VAL A 1 261 ? -88.107  -19.494 -2.139  1.00 65.50  ? 261  VAL A CG1   1 
ATOM   1896 C  CG2   . VAL A 1 261 ? -90.365  -18.489 -2.466  1.00 76.87  ? 261  VAL A CG2   1 
ATOM   1897 N  N     . GLY A 1 262 ? -88.811  -22.480 -4.177  1.00 81.14  ? 262  GLY A N     1 
ATOM   1898 C  CA    . GLY A 1 262 ? -87.934  -23.626 -4.418  1.00 81.99  ? 262  GLY A CA    1 
ATOM   1899 C  C     . GLY A 1 262 ? -87.517  -23.784 -5.870  1.00 82.86  ? 262  GLY A C     1 
ATOM   1900 O  O     . GLY A 1 262 ? -86.417  -24.259 -6.156  1.00 85.00  ? 262  GLY A O     1 
ATOM   1901 N  N     . LYS A 1 263 ? -88.401  -23.386 -6.784  1.00 83.85  ? 263  LYS A N     1 
ATOM   1902 C  CA    . LYS A 1 263 ? -88.118  -23.418 -8.219  1.00 79.96  ? 263  LYS A CA    1 
ATOM   1903 C  C     . LYS A 1 263 ? -87.265  -22.228 -8.657  1.00 77.87  ? 263  LYS A C     1 
ATOM   1904 O  O     . LYS A 1 263 ? -86.410  -22.362 -9.536  1.00 83.70  ? 263  LYS A O     1 
ATOM   1905 C  CB    . LYS A 1 263 ? -89.417  -23.462 -9.028  1.00 68.57  ? 263  LYS A CB    1 
ATOM   1906 C  CG    . LYS A 1 263 ? -90.160  -24.788 -8.953  1.00 69.30  ? 263  LYS A CG    1 
ATOM   1907 C  CD    . LYS A 1 263 ? -91.442  -24.748 -9.768  1.00 71.68  ? 263  LYS A CD    1 
ATOM   1908 C  CE    . LYS A 1 263 ? -92.194  -26.067 -9.679  1.00 75.54  ? 263  LYS A CE    1 
ATOM   1909 N  NZ    . LYS A 1 263 ? -93.455  -26.041 -10.470 1.00 62.82  ? 263  LYS A NZ    1 
ATOM   1910 N  N     . LEU A 1 264 ? -87.504  -21.071 -8.041  1.00 73.87  ? 264  LEU A N     1 
ATOM   1911 C  CA    . LEU A 1 264 ? -86.756  -19.849 -8.345  1.00 79.03  ? 264  LEU A CA    1 
ATOM   1912 C  C     . LEU A 1 264 ? -85.326  -19.895 -7.805  1.00 78.82  ? 264  LEU A C     1 
ATOM   1913 O  O     . LEU A 1 264 ? -84.399  -19.405 -8.453  1.00 81.58  ? 264  LEU A O     1 
ATOM   1914 C  CB    . LEU A 1 264 ? -87.487  -18.612 -7.810  1.00 84.30  ? 264  LEU A CB    1 
ATOM   1915 C  CG    . LEU A 1 264 ? -88.744  -18.123 -8.540  1.00 90.41  ? 264  LEU A CG    1 
ATOM   1916 C  CD1   . LEU A 1 264 ? -89.503  -17.126 -7.677  1.00 94.88  ? 264  LEU A CD1   1 
ATOM   1917 C  CD2   . LEU A 1 264 ? -88.409  -17.512 -9.895  1.00 88.70  ? 264  LEU A CD2   1 
ATOM   1918 N  N     . ASN A 1 265 ? -85.160  -20.480 -6.619  1.00 79.29  ? 265  ASN A N     1 
ATOM   1919 C  CA    . ASN A 1 265 ? -83.840  -20.700 -6.025  1.00 75.62  ? 265  ASN A CA    1 
ATOM   1920 C  C     . ASN A 1 265 ? -83.038  -21.730 -6.819  1.00 76.91  ? 265  ASN A C     1 
ATOM   1921 O  O     . ASN A 1 265 ? -81.810  -21.648 -6.905  1.00 71.96  ? 265  ASN A O     1 
ATOM   1922 C  CB    . ASN A 1 265 ? -83.977  -21.139 -4.561  1.00 73.61  ? 265  ASN A CB    1 
ATOM   1923 C  CG    . ASN A 1 265 ? -82.637  -21.284 -3.858  1.00 73.32  ? 265  ASN A CG    1 
ATOM   1924 O  OD1   . ASN A 1 265 ? -81.702  -20.521 -4.103  1.00 73.69  ? 265  ASN A OD1   1 
ATOM   1925 N  ND2   . ASN A 1 265 ? -82.543  -22.266 -2.969  1.00 75.35  ? 265  ASN A ND2   1 
ATOM   1926 N  N     . TRP A 1 266 ? -83.752  -22.694 -7.396  1.00 77.39  ? 266  TRP A N     1 
ATOM   1927 C  CA    . TRP A 1 266 ? -83.168  -23.719 -8.258  1.00 72.47  ? 266  TRP A CA    1 
ATOM   1928 C  C     . TRP A 1 266 ? -82.732  -23.148 -9.581  1.00 74.97  ? 266  TRP A C     1 
ATOM   1929 O  O     . TRP A 1 266 ? -81.764  -23.620 -10.180 1.00 82.75  ? 266  TRP A O     1 
ATOM   1930 C  CB    . TRP A 1 266 ? -84.170  -24.854 -8.463  1.00 72.20  ? 266  TRP A CB    1 
ATOM   1931 C  CG    . TRP A 1 266 ? -83.711  -25.945 -9.402  1.00 69.67  ? 266  TRP A CG    1 
ATOM   1932 C  CD1   . TRP A 1 266 ? -84.270  -26.300 -10.627 1.00 67.06  ? 266  TRP A CD1   1 
ATOM   1933 C  CD2   . TRP A 1 266 ? -82.577  -26.864 -9.222  1.00 72.16  ? 266  TRP A CD2   1 
ATOM   1934 N  NE1   . TRP A 1 266 ? -83.584  -27.341 -11.197 1.00 69.03  ? 266  TRP A NE1   1 
ATOM   1935 C  CE2   . TRP A 1 266 ? -82.558  -27.728 -10.410 1.00 71.58  ? 266  TRP A CE2   1 
ATOM   1936 C  CE3   . TRP A 1 266 ? -81.613  -27.051 -8.236  1.00 73.23  ? 266  TRP A CE3   1 
ATOM   1937 C  CZ2   . TRP A 1 266 ? -81.607  -28.725 -10.578 1.00 74.67  ? 266  TRP A CZ2   1 
ATOM   1938 C  CZ3   . TRP A 1 266 ? -80.659  -28.061 -8.418  1.00 75.16  ? 266  TRP A CZ3   1 
ATOM   1939 C  CH2   . TRP A 1 266 ? -80.659  -28.876 -9.562  1.00 72.88  ? 266  TRP A CH2   1 
ATOM   1940 N  N     . ALA A 1 267 ? -83.445  -22.120 -10.039 1.00 74.26  ? 267  ALA A N     1 
ATOM   1941 C  CA    . ALA A 1 267 ? -83.143  -21.454 -11.305 1.00 64.48  ? 267  ALA A CA    1 
ATOM   1942 C  C     . ALA A 1 267 ? -82.089  -20.354 -11.153 1.00 64.41  ? 267  ALA A C     1 
ATOM   1943 O  O     . ALA A 1 267 ? -81.539  -19.874 -12.147 1.00 77.18  ? 267  ALA A O     1 
ATOM   1944 C  CB    . ALA A 1 267 ? -84.417  -20.891 -11.919 1.00 59.70  ? 267  ALA A CB    1 
ATOM   1945 N  N     . SER A 1 268 ? -81.806  -19.971 -9.908  1.00 68.43  ? 268  SER A N     1 
ATOM   1946 C  CA    . SER A 1 268 ? -80.869  -18.884 -9.602  1.00 74.64  ? 268  SER A CA    1 
ATOM   1947 C  C     . SER A 1 268 ? -79.415  -19.188 -9.975  1.00 75.54  ? 268  SER A C     1 
ATOM   1948 O  O     . SER A 1 268 ? -78.605  -18.270 -10.127 1.00 77.21  ? 268  SER A O     1 
ATOM   1949 C  CB    . SER A 1 268 ? -80.959  -18.506 -8.120  1.00 77.63  ? 268  SER A CB    1 
ATOM   1950 O  OG    . SER A 1 268 ? -82.230  -17.963 -7.807  1.00 92.34  ? 268  SER A OG    1 
ATOM   1951 N  N     . GLN A 1 269 ? -79.094  -20.473 -10.121 1.00 71.18  ? 269  GLN A N     1 
ATOM   1952 C  CA    . GLN A 1 269 ? -77.739  -20.909 -10.468 1.00 78.70  ? 269  GLN A CA    1 
ATOM   1953 C  C     . GLN A 1 269 ? -77.369  -20.635 -11.931 1.00 76.87  ? 269  GLN A C     1 
ATOM   1954 O  O     . GLN A 1 269 ? -76.186  -20.561 -12.272 1.00 71.21  ? 269  GLN A O     1 
ATOM   1955 C  CB    . GLN A 1 269 ? -77.535  -22.391 -10.125 1.00 78.85  ? 269  GLN A CB    1 
ATOM   1956 C  CG    . GLN A 1 269 ? -78.470  -23.354 -10.846 1.00 69.05  ? 269  GLN A CG    1 
ATOM   1957 C  CD    . GLN A 1 269 ? -78.272  -24.798 -10.423 1.00 63.32  ? 269  GLN A CD    1 
ATOM   1958 O  OE1   . GLN A 1 269 ? -77.151  -25.239 -10.167 1.00 63.93  ? 269  GLN A OE1   1 
ATOM   1959 N  NE2   . GLN A 1 269 ? -79.367  -25.547 -10.353 1.00 63.16  ? 269  GLN A NE2   1 
ATOM   1960 N  N     . ILE A 1 270 ? -78.382  -20.484 -12.783 1.00 78.94  ? 270  ILE A N     1 
ATOM   1961 C  CA    . ILE A 1 270 ? -78.168  -20.211 -14.208 1.00 71.63  ? 270  ILE A CA    1 
ATOM   1962 C  C     . ILE A 1 270 ? -78.810  -18.888 -14.665 1.00 70.55  ? 270  ILE A C     1 
ATOM   1963 O  O     . ILE A 1 270 ? -78.196  -18.127 -15.417 1.00 70.41  ? 270  ILE A O     1 
ATOM   1964 C  CB    . ILE A 1 270 ? -78.577  -21.419 -15.103 1.00 64.71  ? 270  ILE A CB    1 
ATOM   1965 C  CG1   . ILE A 1 270 ? -78.253  -21.160 -16.581 1.00 79.81  ? 270  ILE A CG1   1 
ATOM   1966 C  CG2   . ILE A 1 270 ? -80.041  -21.798 -14.910 1.00 61.85  ? 270  ILE A CG2   1 
ATOM   1967 C  CD1   . ILE A 1 270 ? -76.777  -21.207 -16.913 1.00 84.22  ? 270  ILE A CD1   1 
ATOM   1968 N  N     . TYR A 1 271 ? -80.029  -18.617 -14.199 1.00 69.85  ? 271  TYR A N     1 
ATOM   1969 C  CA    . TYR A 1 271 ? -80.704  -17.350 -14.482 1.00 66.26  ? 271  TYR A CA    1 
ATOM   1970 C  C     . TYR A 1 271 ? -80.179  -16.262 -13.540 1.00 83.35  ? 271  TYR A C     1 
ATOM   1971 O  O     . TYR A 1 271 ? -80.278  -16.403 -12.318 1.00 93.32  ? 271  TYR A O     1 
ATOM   1972 C  CB    . TYR A 1 271 ? -82.226  -17.494 -14.353 1.00 66.06  ? 271  TYR A CB    1 
ATOM   1973 C  CG    . TYR A 1 271 ? -82.860  -18.421 -15.372 1.00 68.98  ? 271  TYR A CG    1 
ATOM   1974 C  CD1   . TYR A 1 271 ? -82.993  -19.785 -15.117 1.00 67.62  ? 271  TYR A CD1   1 
ATOM   1975 C  CD2   . TYR A 1 271 ? -83.339  -17.931 -16.587 1.00 84.07  ? 271  TYR A CD2   1 
ATOM   1976 C  CE1   . TYR A 1 271 ? -83.574  -20.637 -16.044 1.00 73.22  ? 271  TYR A CE1   1 
ATOM   1977 C  CE2   . TYR A 1 271 ? -83.925  -18.774 -17.519 1.00 87.43  ? 271  TYR A CE2   1 
ATOM   1978 C  CZ    . TYR A 1 271 ? -84.039  -20.127 -17.242 1.00 83.82  ? 271  TYR A CZ    1 
ATOM   1979 O  OH    . TYR A 1 271 ? -84.619  -20.967 -18.165 1.00 87.46  ? 271  TYR A OH    1 
ATOM   1980 N  N     . PRO A 1 272 ? -79.614  -15.176 -14.105 1.00 83.45  ? 272  PRO A N     1 
ATOM   1981 C  CA    . PRO A 1 272 ? -78.941  -14.147 -13.303 1.00 90.76  ? 272  PRO A CA    1 
ATOM   1982 C  C     . PRO A 1 272 ? -79.881  -13.236 -12.503 1.00 96.51  ? 272  PRO A C     1 
ATOM   1983 O  O     . PRO A 1 272 ? -79.698  -13.083 -11.293 1.00 98.92  ? 272  PRO A O     1 
ATOM   1984 C  CB    . PRO A 1 272 ? -78.153  -13.344 -14.344 1.00 75.80  ? 272  PRO A CB    1 
ATOM   1985 C  CG    . PRO A 1 272 ? -78.894  -13.537 -15.621 1.00 74.99  ? 272  PRO A CG    1 
ATOM   1986 C  CD    . PRO A 1 272 ? -79.541  -14.891 -15.552 1.00 72.77  ? 272  PRO A CD    1 
ATOM   1987 N  N     . GLY A 1 273 ? -80.872  -12.645 -13.169 1.00 91.65  ? 273  GLY A N     1 
ATOM   1988 C  CA    . GLY A 1 273 ? -81.771  -11.682 -12.536 1.00 95.07  ? 273  GLY A CA    1 
ATOM   1989 C  C     . GLY A 1 273 ? -82.989  -12.314 -11.890 1.00 98.36  ? 273  GLY A C     1 
ATOM   1990 O  O     . GLY A 1 273 ? -84.068  -12.346 -12.485 1.00 98.64  ? 273  GLY A O     1 
ATOM   1991 N  N     . ILE A 1 274 ? -82.811  -12.814 -10.669 1.00 102.25 ? 274  ILE A N     1 
ATOM   1992 C  CA    . ILE A 1 274 ? -83.895  -13.446 -9.914  1.00 102.55 ? 274  ILE A CA    1 
ATOM   1993 C  C     . ILE A 1 274 ? -84.107  -12.737 -8.574  1.00 104.93 ? 274  ILE A C     1 
ATOM   1994 O  O     . ILE A 1 274 ? -83.181  -12.622 -7.767  1.00 101.40 ? 274  ILE A O     1 
ATOM   1995 C  CB    . ILE A 1 274 ? -83.638  -14.962 -9.689  1.00 94.05  ? 274  ILE A CB    1 
ATOM   1996 C  CG1   . ILE A 1 274 ? -83.418  -15.701 -11.023 1.00 90.15  ? 274  ILE A CG1   1 
ATOM   1997 C  CG2   . ILE A 1 274 ? -84.762  -15.600 -8.877  1.00 92.62  ? 274  ILE A CG2   1 
ATOM   1998 C  CD1   . ILE A 1 274 ? -84.599  -15.697 -11.978 1.00 91.61  ? 274  ILE A CD1   1 
ATOM   1999 N  N     . LYS A 1 275 ? -85.332  -12.260 -8.354  1.00 105.37 ? 275  LYS A N     1 
ATOM   2000 C  CA    . LYS A 1 275 ? -85.710  -11.596 -7.107  1.00 107.52 ? 275  LYS A CA    1 
ATOM   2001 C  C     . LYS A 1 275 ? -86.768  -12.417 -6.371  1.00 105.54 ? 275  LYS A C     1 
ATOM   2002 O  O     . LYS A 1 275 ? -87.850  -12.673 -6.906  1.00 105.47 ? 275  LYS A O     1 
ATOM   2003 C  CB    . LYS A 1 275 ? -86.223  -10.178 -7.382  1.00 108.79 ? 275  LYS A CB    1 
ATOM   2004 C  CG    . LYS A 1 275 ? -85.162  -9.217  -7.905  1.00 102.59 ? 275  LYS A CG    1 
ATOM   2005 C  CD    . LYS A 1 275 ? -85.765  -7.914  -8.411  1.00 102.40 ? 275  LYS A CD    1 
ATOM   2006 C  CE    . LYS A 1 275 ? -86.091  -6.952  -7.278  1.00 106.63 ? 275  LYS A CE    1 
ATOM   2007 N  NZ    . LYS A 1 275 ? -86.651  -5.668  -7.783  1.00 101.39 ? 275  LYS A NZ    1 
ATOM   2008 N  N     . VAL A 1 276 ? -86.448  -12.827 -5.145  1.00 103.77 ? 276  VAL A N     1 
ATOM   2009 C  CA    . VAL A 1 276 ? -87.313  -13.724 -4.367  1.00 102.74 ? 276  VAL A CA    1 
ATOM   2010 C  C     . VAL A 1 276 ? -87.698  -13.174 -2.989  1.00 101.40 ? 276  VAL A C     1 
ATOM   2011 O  O     . VAL A 1 276 ? -88.402  -13.841 -2.225  1.00 102.31 ? 276  VAL A O     1 
ATOM   2012 C  CB    . VAL A 1 276 ? -86.676  -15.127 -4.191  1.00 100.40 ? 276  VAL A CB    1 
ATOM   2013 C  CG1   . VAL A 1 276 ? -86.616  -15.866 -5.519  1.00 101.39 ? 276  VAL A CG1   1 
ATOM   2014 C  CG2   . VAL A 1 276 ? -85.291  -15.030 -3.561  1.00 82.00  ? 276  VAL A CG2   1 
ATOM   2015 N  N     . ARG A 1 277 ? -87.244  -11.960 -2.686  1.00 105.89 ? 277  ARG A N     1 
ATOM   2016 C  CA    . ARG A 1 277 ? -87.405  -11.367 -1.354  1.00 101.89 ? 277  ARG A CA    1 
ATOM   2017 C  C     . ARG A 1 277 ? -88.849  -11.070 -0.946  1.00 97.80  ? 277  ARG A C     1 
ATOM   2018 O  O     . ARG A 1 277 ? -89.207  -11.240 0.221   1.00 95.37  ? 277  ARG A O     1 
ATOM   2019 C  CB    . ARG A 1 277 ? -86.550  -10.104 -1.217  1.00 104.02 ? 277  ARG A CB    1 
ATOM   2020 C  CG    . ARG A 1 277 ? -85.082  -10.371 -0.911  1.00 107.62 ? 277  ARG A CG    1 
ATOM   2021 C  CD    . ARG A 1 277 ? -84.853  -10.753 0.546   1.00 115.71 ? 277  ARG A CD    1 
ATOM   2022 N  NE    . ARG A 1 277 ? -85.136  -9.647  1.462   1.00 120.99 ? 277  ARG A NE    1 
ATOM   2023 C  CZ    . ARG A 1 277 ? -84.240  -8.748  1.863   1.00 118.01 ? 277  ARG A CZ    1 
ATOM   2024 N  NH1   . ARG A 1 277 ? -82.985  -8.807  1.436   1.00 110.59 ? 277  ARG A NH1   1 
ATOM   2025 N  NH2   . ARG A 1 277 ? -84.603  -7.783  2.698   1.00 114.86 ? 277  ARG A NH2   1 
ATOM   2026 N  N     . GLN A 1 278 ? -89.667  -10.631 -1.900  1.00 97.31  ? 278  GLN A N     1 
ATOM   2027 C  CA    . GLN A 1 278 ? -91.069  -10.301 -1.623  1.00 100.38 ? 278  GLN A CA    1 
ATOM   2028 C  C     . GLN A 1 278 ? -91.908  -11.542 -1.317  1.00 101.01 ? 278  GLN A C     1 
ATOM   2029 O  O     . GLN A 1 278 ? -92.872  -11.471 -0.553  1.00 101.69 ? 278  GLN A O     1 
ATOM   2030 C  CB    . GLN A 1 278 ? -91.688  -9.508  -2.778  1.00 99.17  ? 278  GLN A CB    1 
ATOM   2031 C  CG    . GLN A 1 278 ? -91.088  -8.122  -2.999  1.00 100.12 ? 278  GLN A CG    1 
ATOM   2032 C  CD    . GLN A 1 278 ? -91.282  -7.180  -1.822  1.00 109.23 ? 278  GLN A CD    1 
ATOM   2033 O  OE1   . GLN A 1 278 ? -90.345  -6.504  -1.398  1.00 109.80 ? 278  GLN A OE1   1 
ATOM   2034 N  NE2   . GLN A 1 278 ? -92.499  -7.131  -1.288  1.00 104.86 ? 278  GLN A NE2   1 
ATOM   2035 N  N     . LEU A 1 279 ? -91.533  -12.670 -1.918  1.00 98.97  ? 279  LEU A N     1 
ATOM   2036 C  CA    . LEU A 1 279 ? -92.161  -13.959 -1.627  1.00 101.62 ? 279  LEU A CA    1 
ATOM   2037 C  C     . LEU A 1 279 ? -91.720  -14.483 -0.261  1.00 102.36 ? 279  LEU A C     1 
ATOM   2038 O  O     . LEU A 1 279 ? -92.478  -15.179 0.418   1.00 95.56  ? 279  LEU A O     1 
ATOM   2039 C  CB    . LEU A 1 279 ? -91.837  -14.985 -2.719  1.00 98.44  ? 279  LEU A CB    1 
ATOM   2040 C  CG    . LEU A 1 279 ? -92.598  -14.916 -4.049  1.00 96.22  ? 279  LEU A CG    1 
ATOM   2041 C  CD1   . LEU A 1 279 ? -92.006  -13.875 -4.989  1.00 85.67  ? 279  LEU A CD1   1 
ATOM   2042 C  CD2   . LEU A 1 279 ? -92.605  -16.281 -4.719  1.00 106.94 ? 279  LEU A CD2   1 
ATOM   2043 N  N     . CYS A 1 280 ? -90.492  -14.141 0.129   1.00 102.14 ? 280  CYS A N     1 
ATOM   2044 C  CA    . CYS A 1 280 ? -89.952  -14.496 1.441   1.00 100.40 ? 280  CYS A CA    1 
ATOM   2045 C  C     . CYS A 1 280 ? -90.584  -13.659 2.553   1.00 105.76 ? 280  CYS A C     1 
ATOM   2046 O  O     . CYS A 1 280 ? -90.684  -14.110 3.697   1.00 106.30 ? 280  CYS A O     1 
ATOM   2047 C  CB    . CYS A 1 280 ? -88.432  -14.325 1.456   1.00 95.65  ? 280  CYS A CB    1 
ATOM   2048 S  SG    . CYS A 1 280 ? -87.544  -15.443 0.349   1.00 99.82  ? 280  CYS A SG    1 
ATOM   2049 N  N     . LYS A 1 281 ? -91.001  -12.441 2.208   1.00 106.86 ? 281  LYS A N     1 
ATOM   2050 C  CA    . LYS A 1 281 ? -91.701  -11.553 3.137   1.00 105.76 ? 281  LYS A CA    1 
ATOM   2051 C  C     . LYS A 1 281 ? -93.127  -12.030 3.408   1.00 104.34 ? 281  LYS A C     1 
ATOM   2052 O  O     . LYS A 1 281 ? -93.676  -11.786 4.485   1.00 107.08 ? 281  LYS A O     1 
ATOM   2053 C  CB    . LYS A 1 281 ? -91.720  -10.116 2.606   1.00 97.77  ? 281  LYS A CB    1 
ATOM   2054 C  CG    . LYS A 1 281 ? -90.392  -9.384  2.727   1.00 92.90  ? 281  LYS A CG    1 
ATOM   2055 C  CD    . LYS A 1 281 ? -90.467  -8.000  2.103   1.00 98.46  ? 281  LYS A CD    1 
ATOM   2056 C  CE    . LYS A 1 281 ? -89.128  -7.285  2.183   1.00 99.26  ? 281  LYS A CE    1 
ATOM   2057 N  NZ    . LYS A 1 281 ? -89.181  -5.936  1.555   1.00 103.61 ? 281  LYS A NZ    1 
ATOM   2058 N  N     . LEU A 1 282 ? -93.720  -12.701 2.422   1.00 100.72 ? 282  LEU A N     1 
ATOM   2059 C  CA    . LEU A 1 282 ? -95.054  -13.285 2.562   1.00 100.78 ? 282  LEU A CA    1 
ATOM   2060 C  C     . LEU A 1 282 ? -95.014  -14.573 3.383   1.00 102.19 ? 282  LEU A C     1 
ATOM   2061 O  O     . LEU A 1 282 ? -95.992  -14.926 4.045   1.00 101.81 ? 282  LEU A O     1 
ATOM   2062 C  CB    . LEU A 1 282 ? -95.678  -13.555 1.188   1.00 92.75  ? 282  LEU A CB    1 
ATOM   2063 C  CG    . LEU A 1 282 ? -96.038  -12.362 0.295   1.00 99.20  ? 282  LEU A CG    1 
ATOM   2064 C  CD1   . LEU A 1 282 ? -96.244  -12.815 -1.143  1.00 101.50 ? 282  LEU A CD1   1 
ATOM   2065 C  CD2   . LEU A 1 282 ? -97.265  -11.618 0.806   1.00 104.37 ? 282  LEU A CD2   1 
ATOM   2066 N  N     . LEU A 1 283 ? -93.877  -15.267 3.331   1.00 104.42 ? 283  LEU A N     1 
ATOM   2067 C  CA    . LEU A 1 283 ? -93.673  -16.502 4.090   1.00 101.73 ? 283  LEU A CA    1 
ATOM   2068 C  C     . LEU A 1 283 ? -93.174  -16.238 5.513   1.00 104.04 ? 283  LEU A C     1 
ATOM   2069 O  O     . LEU A 1 283 ? -92.916  -17.176 6.273   1.00 104.29 ? 283  LEU A O     1 
ATOM   2070 C  CB    . LEU A 1 283 ? -92.708  -17.439 3.351   1.00 102.64 ? 283  LEU A CB    1 
ATOM   2071 C  CG    . LEU A 1 283 ? -93.179  -18.103 2.051   1.00 96.31  ? 283  LEU A CG    1 
ATOM   2072 C  CD1   . LEU A 1 283 ? -91.998  -18.702 1.302   1.00 90.39  ? 283  LEU A CD1   1 
ATOM   2073 C  CD2   . LEU A 1 283 ? -94.245  -19.160 2.308   1.00 86.54  ? 283  LEU A CD2   1 
ATOM   2074 N  N     . ARG A 1 284 ? -93.048  -14.959 5.867   1.00 98.49  ? 284  ARG A N     1 
ATOM   2075 C  CA    . ARG A 1 284 ? -92.635  -14.553 7.209   1.00 100.45 ? 284  ARG A CA    1 
ATOM   2076 C  C     . ARG A 1 284 ? -93.761  -14.788 8.218   1.00 105.51 ? 284  ARG A C     1 
ATOM   2077 O  O     . ARG A 1 284 ? -93.519  -14.867 9.425   1.00 104.41 ? 284  ARG A O     1 
ATOM   2078 C  CB    . ARG A 1 284 ? -92.196  -13.084 7.216   1.00 97.85  ? 284  ARG A CB    1 
ATOM   2079 C  CG    . ARG A 1 284 ? -90.938  -12.803 8.028   1.00 95.16  ? 284  ARG A CG    1 
ATOM   2080 C  CD    . ARG A 1 284 ? -89.686  -13.274 7.299   1.00 97.35  ? 284  ARG A CD    1 
ATOM   2081 N  NE    . ARG A 1 284 ? -88.459  -12.946 8.023   1.00 109.16 ? 284  ARG A NE    1 
ATOM   2082 C  CZ    . ARG A 1 284 ? -87.689  -11.890 7.771   1.00 107.79 ? 284  ARG A CZ    1 
ATOM   2083 N  NH1   . ARG A 1 284 ? -88.007  -11.037 6.804   1.00 90.86  ? 284  ARG A NH1   1 
ATOM   2084 N  NH2   . ARG A 1 284 ? -86.594  -11.685 8.489   1.00 100.57 ? 284  ARG A NH2   1 
ATOM   2085 N  N     . GLY A 1 285 ? -94.989  -14.897 7.709   1.00 113.18 ? 285  GLY A N     1 
ATOM   2086 C  CA    . GLY A 1 285 ? -96.142  -15.312 8.506   1.00 106.55 ? 285  GLY A CA    1 
ATOM   2087 C  C     . GLY A 1 285 ? -96.059  -16.790 8.844   1.00 105.56 ? 285  GLY A C     1 
ATOM   2088 O  O     . GLY A 1 285 ? -95.316  -17.539 8.204   1.00 113.28 ? 285  GLY A O     1 
ATOM   2089 N  N     . THR A 1 286 ? -96.831  -17.215 9.841   1.00 101.39 ? 286  THR A N     1 
ATOM   2090 C  CA    . THR A 1 286 ? -96.697  -18.565 10.391  1.00 106.91 ? 286  THR A CA    1 
ATOM   2091 C  C     . THR A 1 286 ? -98.012  -19.358 10.380  1.00 105.13 ? 286  THR A C     1 
ATOM   2092 O  O     . THR A 1 286 ? -99.098  -18.775 10.321  1.00 99.81  ? 286  THR A O     1 
ATOM   2093 C  CB    . THR A 1 286 ? -96.134  -18.519 11.832  1.00 105.38 ? 286  THR A CB    1 
ATOM   2094 O  OG1   . THR A 1 286 ? -95.274  -17.382 11.983  1.00 102.38 ? 286  THR A OG1   1 
ATOM   2095 C  CG2   . THR A 1 286 ? -95.347  -19.787 12.155  1.00 101.70 ? 286  THR A CG2   1 
ATOM   2096 N  N     . LYS A 1 287 ? -97.880  -20.688 10.407  1.00 110.37 ? 287  LYS A N     1 
ATOM   2097 C  CA    . LYS A 1 287 ? -98.973  -21.649 10.666  1.00 112.11 ? 287  LYS A CA    1 
ATOM   2098 C  C     . LYS A 1 287 ? -99.657  -22.263 9.431   1.00 103.94 ? 287  LYS A C     1 
ATOM   2099 O  O     . LYS A 1 287 ? -99.011  -22.966 8.651   1.00 105.71 ? 287  LYS A O     1 
ATOM   2100 C  CB    . LYS A 1 287 ? -100.006 -21.094 11.665  1.00 109.86 ? 287  LYS A CB    1 
ATOM   2101 N  N     . ALA A 1 288 ? -100.955 -21.987 9.282   1.00 102.75 ? 288  ALA A N     1 
ATOM   2102 C  CA    . ALA A 1 288 ? -101.872 -22.694 8.367   1.00 104.49 ? 288  ALA A CA    1 
ATOM   2103 C  C     . ALA A 1 288 ? -101.299 -23.201 7.039   1.00 91.29  ? 288  ALA A C     1 
ATOM   2104 O  O     . ALA A 1 288 ? -100.562 -22.488 6.358   1.00 87.30  ? 288  ALA A O     1 
ATOM   2105 C  CB    . ALA A 1 288 ? -103.115 -21.849 8.115   1.00 105.30 ? 288  ALA A CB    1 
ATOM   2106 N  N     . LEU A 1 289 ? -101.662 -24.433 6.684   1.00 87.96  ? 289  LEU A N     1 
ATOM   2107 C  CA    . LEU A 1 289 ? -101.277 -25.037 5.405   1.00 94.60  ? 289  LEU A CA    1 
ATOM   2108 C  C     . LEU A 1 289 ? -102.100 -24.480 4.243   1.00 95.30  ? 289  LEU A C     1 
ATOM   2109 O  O     . LEU A 1 289 ? -101.658 -24.507 3.092   1.00 84.52  ? 289  LEU A O     1 
ATOM   2110 C  CB    . LEU A 1 289 ? -101.415 -26.563 5.463   1.00 97.90  ? 289  LEU A CB    1 
ATOM   2111 C  CG    . LEU A 1 289 ? -100.397 -27.361 6.286   1.00 102.55 ? 289  LEU A CG    1 
ATOM   2112 C  CD1   . LEU A 1 289 ? -100.953 -28.732 6.640   1.00 92.83  ? 289  LEU A CD1   1 
ATOM   2113 C  CD2   . LEU A 1 289 ? -99.065  -27.493 5.557   1.00 70.22  ? 289  LEU A CD2   1 
ATOM   2114 N  N     . THR A 1 290 ? -103.300 -23.989 4.553   1.00 102.99 ? 290  THR A N     1 
ATOM   2115 C  CA    . THR A 1 290 ? -104.171 -23.353 3.563   1.00 102.21 ? 290  THR A CA    1 
ATOM   2116 C  C     . THR A 1 290 ? -104.616 -21.967 4.036   1.00 103.44 ? 290  THR A C     1 
ATOM   2117 O  O     . THR A 1 290 ? -105.807 -21.716 4.247   1.00 111.21 ? 290  THR A O     1 
ATOM   2118 C  CB    . THR A 1 290 ? -105.399 -24.227 3.218   1.00 100.82 ? 290  THR A CB    1 
ATOM   2119 O  OG1   . THR A 1 290 ? -106.015 -24.695 4.424   1.00 111.86 ? 290  THR A OG1   1 
ATOM   2120 C  CG2   . THR A 1 290 ? -104.995 -25.421 2.360   1.00 81.81  ? 290  THR A CG2   1 
ATOM   2121 N  N     . GLU A 1 291 ? -103.642 -21.075 4.204   1.00 94.78  ? 291  GLU A N     1 
ATOM   2122 C  CA    . GLU A 1 291 ? -103.898 -19.698 4.625   1.00 102.10 ? 291  GLU A CA    1 
ATOM   2123 C  C     . GLU A 1 291 ? -104.432 -18.855 3.465   1.00 100.23 ? 291  GLU A C     1 
ATOM   2124 O  O     . GLU A 1 291 ? -105.193 -17.907 3.680   1.00 89.38  ? 291  GLU A O     1 
ATOM   2125 C  CB    . GLU A 1 291 ? -102.620 -19.075 5.205   1.00 99.59  ? 291  GLU A CB    1 
ATOM   2126 C  CG    . GLU A 1 291 ? -102.783 -17.684 5.813   1.00 105.22 ? 291  GLU A CG    1 
ATOM   2127 C  CD    . GLU A 1 291 ? -103.618 -17.673 7.082   1.00 113.59 ? 291  GLU A CD    1 
ATOM   2128 O  OE1   . GLU A 1 291 ? -103.355 -18.495 7.986   1.00 103.38 ? 291  GLU A OE1   1 
ATOM   2129 O  OE2   . GLU A 1 291 ? -104.533 -16.828 7.181   1.00 126.79 ? 291  GLU A OE2   1 
ATOM   2130 N  N     . VAL A 1 292 ? -104.038 -19.226 2.245   1.00 99.29  ? 292  VAL A N     1 
ATOM   2131 C  CA    . VAL A 1 292 ? -104.362 -18.484 1.016   1.00 97.95  ? 292  VAL A CA    1 
ATOM   2132 C  C     . VAL A 1 292 ? -103.912 -17.024 1.150   1.00 99.72  ? 292  VAL A C     1 
ATOM   2133 O  O     . VAL A 1 292 ? -104.729 -16.111 1.301   1.00 99.85  ? 292  VAL A O     1 
ATOM   2134 C  CB    . VAL A 1 292 ? -105.858 -18.599 0.612   1.00 88.77  ? 292  VAL A CB    1 
ATOM   2135 C  CG1   . VAL A 1 292 ? -106.075 -18.085 -0.806  1.00 72.93  ? 292  VAL A CG1   1 
ATOM   2136 C  CG2   . VAL A 1 292 ? -106.341 -20.039 0.716   1.00 81.00  ? 292  VAL A CG2   1 
ATOM   2137 N  N     . ILE A 1 293 ? -102.596 -16.828 1.114   1.00 101.43 ? 293  ILE A N     1 
ATOM   2138 C  CA    . ILE A 1 293 ? -101.997 -15.503 1.269   1.00 106.40 ? 293  ILE A CA    1 
ATOM   2139 C  C     . ILE A 1 293 ? -102.073 -14.726 -0.048  1.00 106.58 ? 293  ILE A C     1 
ATOM   2140 O  O     . ILE A 1 293 ? -101.554 -15.183 -1.069  1.00 109.62 ? 293  ILE A O     1 
ATOM   2141 C  CB    . ILE A 1 293 ? -100.535 -15.588 1.772   1.00 113.97 ? 293  ILE A CB    1 
ATOM   2142 C  CG1   . ILE A 1 293 ? -100.477 -16.297 3.131   1.00 105.79 ? 293  ILE A CG1   1 
ATOM   2143 C  CG2   . ILE A 1 293 ? -99.914  -14.198 1.869   1.00 97.42  ? 293  ILE A CG2   1 
ATOM   2144 C  CD1   . ILE A 1 293 ? -99.089  -16.732 3.555   1.00 99.65  ? 293  ILE A CD1   1 
ATOM   2145 N  N     . PRO A 1 294 ? -102.733 -13.550 -0.025  1.00 106.64 ? 294  PRO A N     1 
ATOM   2146 C  CA    . PRO A 1 294 ? -102.845 -12.701 -1.213  1.00 100.79 ? 294  PRO A CA    1 
ATOM   2147 C  C     . PRO A 1 294 ? -101.531 -11.997 -1.549  1.00 103.09 ? 294  PRO A C     1 
ATOM   2148 O  O     . PRO A 1 294 ? -100.630 -11.926 -0.710  1.00 113.39 ? 294  PRO A O     1 
ATOM   2149 C  CB    . PRO A 1 294 ? -103.911 -11.678 -0.811  1.00 91.54  ? 294  PRO A CB    1 
ATOM   2150 C  CG    . PRO A 1 294 ? -103.804 -11.590 0.671   1.00 89.87  ? 294  PRO A CG    1 
ATOM   2151 C  CD    . PRO A 1 294 ? -103.442 -12.972 1.133   1.00 98.64  ? 294  PRO A CD    1 
ATOM   2152 N  N     . LEU A 1 295 ? -101.437 -11.481 -2.772  1.00 93.89  ? 295  LEU A N     1 
ATOM   2153 C  CA    . LEU A 1 295 ? -100.235 -10.794 -3.237  1.00 96.74  ? 295  LEU A CA    1 
ATOM   2154 C  C     . LEU A 1 295 ? -100.317 -9.279  -3.054  1.00 100.09 ? 295  LEU A C     1 
ATOM   2155 O  O     . LEU A 1 295 ? -101.402 -8.692  -3.110  1.00 102.48 ? 295  LEU A O     1 
ATOM   2156 C  CB    . LEU A 1 295 ? -99.917  -11.156 -4.703  1.00 103.75 ? 295  LEU A CB    1 
ATOM   2157 C  CG    . LEU A 1 295 ? -100.884 -11.041 -5.904  1.00 106.98 ? 295  LEU A CG    1 
ATOM   2158 C  CD1   . LEU A 1 295 ? -102.087 -11.975 -5.795  1.00 99.95  ? 295  LEU A CD1   1 
ATOM   2159 C  CD2   . LEU A 1 295 ? -101.333 -9.613  -6.201  1.00 99.42  ? 295  LEU A CD2   1 
ATOM   2160 N  N     . THR A 1 296 ? -99.165  -8.660  -2.812  1.00 100.34 ? 296  THR A N     1 
ATOM   2161 C  CA    . THR A 1 296 ? -99.047  -7.204  -2.841  1.00 105.71 ? 296  THR A CA    1 
ATOM   2162 C  C     . THR A 1 296 ? -98.553  -6.790  -4.224  1.00 108.99 ? 296  THR A C     1 
ATOM   2163 O  O     . THR A 1 296 ? -97.963  -7.602  -4.943  1.00 107.95 ? 296  THR A O     1 
ATOM   2164 C  CB    . THR A 1 296 ? -98.094  -6.667  -1.750  1.00 95.03  ? 296  THR A CB    1 
ATOM   2165 O  OG1   . THR A 1 296 ? -96.832  -7.340  -1.828  1.00 91.92  ? 296  THR A OG1   1 
ATOM   2166 C  CG2   . THR A 1 296 ? -98.690  -6.870  -0.361  1.00 81.52  ? 296  THR A CG2   1 
ATOM   2167 N  N     . GLU A 1 297 ? -98.800  -5.535  -4.595  1.00 109.24 ? 297  GLU A N     1 
ATOM   2168 C  CA    . GLU A 1 297 ? -98.436  -5.026  -5.921  1.00 109.98 ? 297  GLU A CA    1 
ATOM   2169 C  C     . GLU A 1 297 ? -96.936  -5.152  -6.204  1.00 113.70 ? 297  GLU A C     1 
ATOM   2170 O  O     . GLU A 1 297 ? -96.536  -5.434  -7.333  1.00 118.20 ? 297  GLU A O     1 
ATOM   2171 C  CB    . GLU A 1 297 ? -98.904  -3.578  -6.098  1.00 103.86 ? 297  GLU A CB    1 
ATOM   2172 C  CG    . GLU A 1 297 ? -98.973  -3.119  -7.549  1.00 104.26 ? 297  GLU A CG    1 
ATOM   2173 C  CD    . GLU A 1 297 ? -99.658  -1.774  -7.726  1.00 121.60 ? 297  GLU A CD    1 
ATOM   2174 O  OE1   . GLU A 1 297 ? -99.861  -1.055  -6.723  1.00 129.07 ? 297  GLU A OE1   1 
ATOM   2175 O  OE2   . GLU A 1 297 ? -99.996  -1.432  -8.879  1.00 120.58 ? 297  GLU A OE2   1 
ATOM   2176 N  N     . GLU A 1 298 ? -96.120  -4.947  -5.170  1.00 115.61 ? 298  GLU A N     1 
ATOM   2177 C  CA    . GLU A 1 298 ? -94.665  -5.075  -5.278  1.00 112.21 ? 298  GLU A CA    1 
ATOM   2178 C  C     . GLU A 1 298 ? -94.197  -6.533  -5.330  1.00 112.01 ? 298  GLU A C     1 
ATOM   2179 O  O     . GLU A 1 298 ? -93.134  -6.827  -5.884  1.00 114.76 ? 298  GLU A O     1 
ATOM   2180 C  CB    . GLU A 1 298 ? -93.963  -4.317  -4.142  1.00 105.89 ? 298  GLU A CB    1 
ATOM   2181 C  CG    . GLU A 1 298 ? -94.444  -4.668  -2.739  1.00 109.00 ? 298  GLU A CG    1 
ATOM   2182 C  CD    . GLU A 1 298 ? -93.783  -3.831  -1.657  1.00 119.11 ? 298  GLU A CD    1 
ATOM   2183 O  OE1   . GLU A 1 298 ? -92.555  -3.608  -1.729  1.00 110.85 ? 298  GLU A OE1   1 
ATOM   2184 O  OE2   . GLU A 1 298 ? -94.496  -3.394  -0.729  1.00 123.68 ? 298  GLU A OE2   1 
ATOM   2185 N  N     . ALA A 1 299 ? -94.990  -7.435  -4.753  1.00 108.26 ? 299  ALA A N     1 
ATOM   2186 C  CA    . ALA A 1 299 ? -94.680  -8.866  -4.759  1.00 107.58 ? 299  ALA A CA    1 
ATOM   2187 C  C     . ALA A 1 299 ? -94.959  -9.500  -6.119  1.00 112.10 ? 299  ALA A C     1 
ATOM   2188 O  O     . ALA A 1 299 ? -94.173  -10.318 -6.601  1.00 120.03 ? 299  ALA A O     1 
ATOM   2189 C  CB    . ALA A 1 299 ? -95.449  -9.590  -3.664  1.00 102.86 ? 299  ALA A CB    1 
ATOM   2190 N  N     . GLU A 1 300 ? -96.080  -9.115  -6.727  1.00 104.16 ? 300  GLU A N     1 
ATOM   2191 C  CA    . GLU A 1 300 ? -96.456  -9.599  -8.053  1.00 107.09 ? 300  GLU A CA    1 
ATOM   2192 C  C     . GLU A 1 300 ? -95.624  -8.920  -9.144  1.00 109.09 ? 300  GLU A C     1 
ATOM   2193 O  O     . GLU A 1 300 ? -95.481  -9.456  -10.244 1.00 97.83  ? 300  GLU A O     1 
ATOM   2194 C  CB    . GLU A 1 300 ? -97.953  -9.381  -8.299  1.00 100.55 ? 300  GLU A CB    1 
ATOM   2195 C  CG    . GLU A 1 300 ? -98.549  -10.270 -9.384  1.00 96.72  ? 300  GLU A CG    1 
ATOM   2196 C  CD    . GLU A 1 300 ? -100.047 -10.087 -9.553  1.00 113.63 ? 300  GLU A CD    1 
ATOM   2197 O  OE1   . GLU A 1 300 ? -100.523 -8.931  -9.530  1.00 117.16 ? 300  GLU A OE1   1 
ATOM   2198 O  OE2   . GLU A 1 300 ? -100.752 -11.104 -9.719  1.00 107.17 ? 300  GLU A OE2   1 
ATOM   2199 N  N     . LEU A 1 301 ? -95.077  -7.747  -8.825  1.00 108.57 ? 301  LEU A N     1 
ATOM   2200 C  CA    . LEU A 1 301 ? -94.229  -6.990  -9.748  1.00 115.06 ? 301  LEU A CA    1 
ATOM   2201 C  C     . LEU A 1 301 ? -92.919  -7.729  -10.021 1.00 111.43 ? 301  LEU A C     1 
ATOM   2202 O  O     . LEU A 1 301 ? -92.515  -7.875  -11.177 1.00 106.26 ? 301  LEU A O     1 
ATOM   2203 C  CB    . LEU A 1 301 ? -93.942  -5.587  -9.191  1.00 109.84 ? 301  LEU A CB    1 
ATOM   2204 C  CG    . LEU A 1 301 ? -93.785  -4.355  -10.102 1.00 112.70 ? 301  LEU A CG    1 
ATOM   2205 C  CD1   . LEU A 1 301 ? -92.617  -4.470  -11.076 1.00 93.19  ? 301  LEU A CD1   1 
ATOM   2206 C  CD2   . LEU A 1 301 ? -95.076  -4.016  -10.842 1.00 100.60 ? 301  LEU A CD2   1 
ATOM   2207 N  N     . GLU A 1 302 ? -92.265  -8.193  -8.957  1.00 105.72 ? 302  GLU A N     1 
ATOM   2208 C  CA    . GLU A 1 302 ? -91.024  -8.960  -9.090  1.00 105.62 ? 302  GLU A CA    1 
ATOM   2209 C  C     . GLU A 1 302 ? -91.285  -10.402 -9.534  1.00 104.91 ? 302  GLU A C     1 
ATOM   2210 O  O     . GLU A 1 302 ? -90.387  -11.070 -10.048 1.00 105.69 ? 302  GLU A O     1 
ATOM   2211 C  CB    . GLU A 1 302 ? -90.191  -8.917  -7.800  1.00 103.96 ? 302  GLU A CB    1 
ATOM   2212 C  CG    . GLU A 1 302 ? -90.744  -9.728  -6.635  1.00 110.36 ? 302  GLU A CG    1 
ATOM   2213 C  CD    . GLU A 1 302 ? -89.683  -10.080 -5.606  1.00 109.77 ? 302  GLU A CD    1 
ATOM   2214 O  OE1   . GLU A 1 302 ? -88.797  -9.240  -5.335  1.00 111.20 ? 302  GLU A OE1   1 
ATOM   2215 O  OE2   . GLU A 1 302 ? -89.736  -11.203 -5.062  1.00 100.76 ? 302  GLU A OE2   1 
ATOM   2216 N  N     . LEU A 1 303 ? -92.516  -10.868 -9.332  1.00 99.28  ? 303  LEU A N     1 
ATOM   2217 C  CA    . LEU A 1 303 ? -92.934  -12.196 -9.774  1.00 93.68  ? 303  LEU A CA    1 
ATOM   2218 C  C     . LEU A 1 303 ? -93.195  -12.214 -11.280 1.00 101.62 ? 303  LEU A C     1 
ATOM   2219 O  O     . LEU A 1 303 ? -92.859  -13.185 -11.960 1.00 104.14 ? 303  LEU A O     1 
ATOM   2220 C  CB    . LEU A 1 303 ? -94.183  -12.652 -9.007  1.00 91.65  ? 303  LEU A CB    1 
ATOM   2221 C  CG    . LEU A 1 303 ? -94.702  -14.083 -9.198  1.00 100.77 ? 303  LEU A CG    1 
ATOM   2222 C  CD1   . LEU A 1 303 ? -93.790  -15.105 -8.533  1.00 110.71 ? 303  LEU A CD1   1 
ATOM   2223 C  CD2   . LEU A 1 303 ? -96.119  -14.206 -8.658  1.00 100.88 ? 303  LEU A CD2   1 
ATOM   2224 N  N     . ALA A 1 304 ? -93.790  -11.135 -11.788 1.00 105.76 ? 304  ALA A N     1 
ATOM   2225 C  CA    . ALA A 1 304 ? -94.105  -11.005 -13.212 1.00 107.15 ? 304  ALA A CA    1 
ATOM   2226 C  C     . ALA A 1 304 ? -92.853  -10.844 -14.074 1.00 108.07 ? 304  ALA A C     1 
ATOM   2227 O  O     . ALA A 1 304 ? -92.800  -11.353 -15.196 1.00 104.71 ? 304  ALA A O     1 
ATOM   2228 C  CB    . ALA A 1 304 ? -95.065  -9.847  -13.447 1.00 104.00 ? 304  ALA A CB    1 
ATOM   2229 N  N     . GLU A 1 305 ? -91.856  -10.134 -13.548 1.00 100.87 ? 305  GLU A N     1 
ATOM   2230 C  CA    . GLU A 1 305 ? -90.591  -9.937  -14.259 1.00 100.53 ? 305  GLU A CA    1 
ATOM   2231 C  C     . GLU A 1 305 ? -89.710  -11.190 -14.225 1.00 102.96 ? 305  GLU A C     1 
ATOM   2232 O  O     . GLU A 1 305 ? -88.893  -11.400 -15.122 1.00 101.25 ? 305  GLU A O     1 
ATOM   2233 C  CB    . GLU A 1 305 ? -89.836  -8.704  -13.738 1.00 102.58 ? 305  GLU A CB    1 
ATOM   2234 C  CG    . GLU A 1 305 ? -89.304  -8.811  -12.314 1.00 101.95 ? 305  GLU A CG    1 
ATOM   2235 C  CD    . GLU A 1 305 ? -88.616  -7.545  -11.832 1.00 104.59 ? 305  GLU A CD    1 
ATOM   2236 O  OE1   . GLU A 1 305 ? -88.349  -6.642  -12.655 1.00 105.60 ? 305  GLU A OE1   1 
ATOM   2237 O  OE2   . GLU A 1 305 ? -88.335  -7.452  -10.618 1.00 102.35 ? 305  GLU A OE2   1 
ATOM   2238 N  N     . ASN A 1 306 ? -89.887  -12.014 -13.192 1.00 103.05 ? 306  ASN A N     1 
ATOM   2239 C  CA    . ASN A 1 306 ? -89.199  -13.302 -13.091 1.00 105.87 ? 306  ASN A CA    1 
ATOM   2240 C  C     . ASN A 1 306 ? -89.751  -14.336 -14.070 1.00 103.89 ? 306  ASN A C     1 
ATOM   2241 O  O     . ASN A 1 306 ? -89.044  -15.267 -14.462 1.00 103.26 ? 306  ASN A O     1 
ATOM   2242 C  CB    . ASN A 1 306 ? -89.252  -13.844 -11.659 1.00 100.07 ? 306  ASN A CB    1 
ATOM   2243 C  CG    . ASN A 1 306 ? -88.188  -13.238 -10.761 1.00 99.53  ? 306  ASN A CG    1 
ATOM   2244 O  OD1   . ASN A 1 306 ? -87.076  -12.938 -11.201 1.00 100.12 ? 306  ASN A OD1   1 
ATOM   2245 N  ND2   . ASN A 1 306 ? -88.523  -13.065 -9.489  1.00 98.59  ? 306  ASN A ND2   1 
ATOM   2246 N  N     . ARG A 1 307 ? -91.016  -14.165 -14.454 1.00 98.04  ? 307  ARG A N     1 
ATOM   2247 C  CA    . ARG A 1 307 ? -91.638  -14.976 -15.500 1.00 97.83  ? 307  ARG A CA    1 
ATOM   2248 C  C     . ARG A 1 307 ? -90.997  -14.678 -16.854 1.00 100.96 ? 307  ARG A C     1 
ATOM   2249 O  O     . ARG A 1 307 ? -90.850  -15.572 -17.688 1.00 94.26  ? 307  ARG A O     1 
ATOM   2250 C  CB    . ARG A 1 307 ? -93.146  -14.711 -15.573 1.00 92.52  ? 307  ARG A CB    1 
ATOM   2251 C  CG    . ARG A 1 307 ? -93.947  -15.209 -14.380 1.00 90.11  ? 307  ARG A CG    1 
ATOM   2252 C  CD    . ARG A 1 307 ? -95.405  -14.791 -14.496 1.00 94.02  ? 307  ARG A CD    1 
ATOM   2253 N  NE    . ARG A 1 307 ? -96.181  -15.147 -13.309 1.00 98.41  ? 307  ARG A NE    1 
ATOM   2254 C  CZ    . ARG A 1 307 ? -97.473  -14.871 -13.139 1.00 106.50 ? 307  ARG A CZ    1 
ATOM   2255 N  NH1   . ARG A 1 307 ? -98.157  -14.229 -14.079 1.00 111.20 ? 307  ARG A NH1   1 
ATOM   2256 N  NH2   . ARG A 1 307 ? -98.085  -15.238 -12.021 1.00 106.13 ? 307  ARG A NH2   1 
ATOM   2257 N  N     . GLU A 1 308 ? -90.617  -13.416 -17.054 1.00 99.46  ? 308  GLU A N     1 
ATOM   2258 C  CA    . GLU A 1 308 ? -89.978  -12.962 -18.291 1.00 101.45 ? 308  GLU A CA    1 
ATOM   2259 C  C     . GLU A 1 308 ? -88.546  -13.480 -18.430 1.00 99.07  ? 308  GLU A C     1 
ATOM   2260 O  O     . GLU A 1 308 ? -88.076  -13.725 -19.543 1.00 102.70 ? 308  GLU A O     1 
ATOM   2261 C  CB    . GLU A 1 308 ? -89.989  -11.430 -18.373 1.00 114.99 ? 308  GLU A CB    1 
ATOM   2262 C  CG    . GLU A 1 308 ? -91.376  -10.800 -18.430 1.00 114.26 ? 308  GLU A CG    1 
ATOM   2263 C  CD    . GLU A 1 308 ? -92.105  -11.059 -19.738 1.00 119.82 ? 308  GLU A CD    1 
ATOM   2264 O  OE1   . GLU A 1 308 ? -91.452  -11.067 -20.805 1.00 115.88 ? 308  GLU A OE1   1 
ATOM   2265 O  OE2   . GLU A 1 308 ? -93.338  -11.256 -19.699 1.00 124.68 ? 308  GLU A OE2   1 
ATOM   2266 N  N     . ILE A 1 309 ? -87.862  -13.637 -17.296 1.00 92.65  ? 309  ILE A N     1 
ATOM   2267 C  CA    . ILE A 1 309 ? -86.494  -14.162 -17.264 1.00 96.41  ? 309  ILE A CA    1 
ATOM   2268 C  C     . ILE A 1 309 ? -86.473  -15.645 -17.651 1.00 96.71  ? 309  ILE A C     1 
ATOM   2269 O  O     . ILE A 1 309 ? -85.586  -16.091 -18.383 1.00 101.21 ? 309  ILE A O     1 
ATOM   2270 C  CB    . ILE A 1 309 ? -85.831  -13.952 -15.874 1.00 90.76  ? 309  ILE A CB    1 
ATOM   2271 C  CG1   . ILE A 1 309 ? -85.834  -12.467 -15.467 1.00 91.88  ? 309  ILE A CG1   1 
ATOM   2272 C  CG2   . ILE A 1 309 ? -84.420  -14.534 -15.832 1.00 83.57  ? 309  ILE A CG2   1 
ATOM   2273 C  CD1   . ILE A 1 309 ? -85.074  -11.530 -16.389 1.00 89.51  ? 309  ILE A CD1   1 
ATOM   2274 N  N     . LEU A 1 310 ? -87.469  -16.391 -17.175 1.00 94.45  ? 310  LEU A N     1 
ATOM   2275 C  CA    . LEU A 1 310 ? -87.567  -17.831 -17.423 1.00 97.93  ? 310  LEU A CA    1 
ATOM   2276 C  C     . LEU A 1 310 ? -88.104  -18.180 -18.818 1.00 98.13  ? 310  LEU A C     1 
ATOM   2277 O  O     . LEU A 1 310 ? -88.170  -19.357 -19.183 1.00 92.92  ? 310  LEU A O     1 
ATOM   2278 C  CB    . LEU A 1 310 ? -88.425  -18.504 -16.342 1.00 108.25 ? 310  LEU A CB    1 
ATOM   2279 C  CG    . LEU A 1 310 ? -87.940  -18.476 -14.886 1.00 101.50 ? 310  LEU A CG    1 
ATOM   2280 C  CD1   . LEU A 1 310 ? -89.088  -18.787 -13.936 1.00 86.13  ? 310  LEU A CD1   1 
ATOM   2281 C  CD2   . LEU A 1 310 ? -86.778  -19.432 -14.656 1.00 89.60  ? 310  LEU A CD2   1 
ATOM   2282 N  N     . LYS A 1 311 ? -88.479  -17.159 -19.589 1.00 98.92  ? 311  LYS A N     1 
ATOM   2283 C  CA    . LYS A 1 311 ? -89.015  -17.350 -20.940 1.00 99.60  ? 311  LYS A CA    1 
ATOM   2284 C  C     . LYS A 1 311 ? -87.952  -17.818 -21.936 1.00 96.87  ? 311  LYS A C     1 
ATOM   2285 O  O     . LYS A 1 311 ? -88.073  -18.899 -22.517 1.00 92.76  ? 311  LYS A O     1 
ATOM   2286 C  CB    . LYS A 1 311 ? -89.697  -16.074 -21.446 1.00 93.60  ? 311  LYS A CB    1 
ATOM   2287 C  CG    . LYS A 1 311 ? -91.117  -15.880 -20.940 1.00 96.38  ? 311  LYS A CG    1 
ATOM   2288 C  CD    . LYS A 1 311 ? -91.745  -14.624 -21.520 1.00 97.93  ? 311  LYS A CD    1 
ATOM   2289 C  CE    . LYS A 1 311 ? -93.172  -14.444 -21.030 1.00 106.93 ? 311  LYS A CE    1 
ATOM   2290 N  NZ    . LYS A 1 311 ? -93.816  -13.240 -21.624 1.00 106.33 ? 311  LYS A NZ    1 
ATOM   2291 N  N     . GLU A 1 312 ? -86.918  -17.000 -22.126 1.00 91.99  ? 312  GLU A N     1 
ATOM   2292 C  CA    . GLU A 1 312 ? -85.842  -17.308 -23.068 1.00 99.24  ? 312  GLU A CA    1 
ATOM   2293 C  C     . GLU A 1 312 ? -84.868  -18.335 -22.485 1.00 96.86  ? 312  GLU A C     1 
ATOM   2294 O  O     . GLU A 1 312 ? -84.380  -18.160 -21.366 1.00 94.05  ? 312  GLU A O     1 
ATOM   2295 C  CB    . GLU A 1 312 ? -85.098  -16.034 -23.483 1.00 103.35 ? 312  GLU A CB    1 
ATOM   2296 C  CG    . GLU A 1 312 ? -85.910  -15.095 -24.364 1.00 101.25 ? 312  GLU A CG    1 
ATOM   2297 C  CD    . GLU A 1 312 ? -85.113  -13.896 -24.849 1.00 99.62  ? 312  GLU A CD    1 
ATOM   2298 O  OE1   . GLU A 1 312 ? -83.975  -14.083 -25.333 1.00 99.26  ? 312  GLU A OE1   1 
ATOM   2299 O  OE2   . GLU A 1 312 ? -85.632  -12.764 -24.757 1.00 101.51 ? 312  GLU A OE2   1 
ATOM   2300 N  N     . PRO A 1 313 ? -84.591  -19.416 -23.244 1.00 105.19 ? 313  PRO A N     1 
ATOM   2301 C  CA    . PRO A 1 313 ? -83.706  -20.495 -22.794 1.00 99.25  ? 313  PRO A CA    1 
ATOM   2302 C  C     . PRO A 1 313 ? -82.245  -20.059 -22.691 1.00 92.92  ? 313  PRO A C     1 
ATOM   2303 O  O     . PRO A 1 313 ? -81.731  -19.389 -23.590 1.00 88.77  ? 313  PRO A O     1 
ATOM   2304 C  CB    . PRO A 1 313 ? -83.863  -21.565 -23.887 1.00 103.73 ? 313  PRO A CB    1 
ATOM   2305 C  CG    . PRO A 1 313 ? -85.102  -21.197 -24.634 1.00 98.50  ? 313  PRO A CG    1 
ATOM   2306 C  CD    . PRO A 1 313 ? -85.159  -19.703 -24.572 1.00 98.88  ? 313  PRO A CD    1 
ATOM   2307 N  N     . VAL A 1 314 ? -81.596  -20.439 -21.592 1.00 87.70  ? 314  VAL A N     1 
ATOM   2308 C  CA    . VAL A 1 314 ? -80.183  -20.120 -21.360 1.00 87.12  ? 314  VAL A CA    1 
ATOM   2309 C  C     . VAL A 1 314 ? -79.355  -21.373 -21.066 1.00 76.71  ? 314  VAL A C     1 
ATOM   2310 O  O     . VAL A 1 314 ? -79.899  -22.415 -20.691 1.00 77.86  ? 314  VAL A O     1 
ATOM   2311 C  CB    . VAL A 1 314 ? -79.989  -19.083 -20.225 1.00 91.40  ? 314  VAL A CB    1 
ATOM   2312 C  CG1   . VAL A 1 314 ? -80.433  -17.698 -20.676 1.00 97.34  ? 314  VAL A CG1   1 
ATOM   2313 C  CG2   . VAL A 1 314 ? -80.720  -19.505 -18.957 1.00 78.39  ? 314  VAL A CG2   1 
ATOM   2314 N  N     . HIS A 1 315 ? -78.039  -21.258 -21.238 1.00 75.45  ? 315  HIS A N     1 
ATOM   2315 C  CA    . HIS A 1 315 ? -77.118  -22.376 -21.032 1.00 80.20  ? 315  HIS A CA    1 
ATOM   2316 C  C     . HIS A 1 315 ? -75.860  -21.950 -20.325 1.00 79.16  ? 315  HIS A C     1 
ATOM   2317 O  O     . HIS A 1 315 ? -75.467  -20.782 -20.383 1.00 80.90  ? 315  HIS A O     1 
ATOM   2318 C  CB    . HIS A 1 315 ? -76.774  -23.031 -22.367 1.00 76.95  ? 315  HIS A CB    1 
ATOM   2319 C  CG    . HIS A 1 315 ? -76.045  -22.119 -23.324 1.00 75.03  ? 315  HIS A CG    1 
ATOM   2320 N  ND1   . HIS A 1 315 ? -76.685  -21.233 -24.109 1.00 79.97  ? 315  HIS A ND1   1 
ATOM   2321 C  CD2   . HIS A 1 315 ? -74.686  -21.979 -23.600 1.00 70.32  ? 315  HIS A CD2   1 
ATOM   2322 C  CE1   . HIS A 1 315 ? -75.785  -20.560 -24.851 1.00 89.96  ? 315  HIS A CE1   1 
ATOM   2323 N  NE2   . HIS A 1 315 ? -74.562  -21.018 -24.538 1.00 86.58  ? 315  HIS A NE2   1 
ATOM   2324 N  N     . GLY A 1 316 ? -75.220  -22.904 -19.651 1.00 73.30  ? 316  GLY A N     1 
ATOM   2325 C  CA    . GLY A 1 316 ? -73.970  -22.657 -18.935 1.00 66.22  ? 316  GLY A CA    1 
ATOM   2326 C  C     . GLY A 1 316 ? -72.748  -23.157 -19.683 1.00 67.62  ? 316  GLY A C     1 
ATOM   2327 O  O     . GLY A 1 316 ? -72.850  -24.029 -20.548 1.00 77.41  ? 316  GLY A O     1 
ATOM   2328 N  N     . VAL A 1 317 ? -71.589  -22.599 -19.340 1.00 67.66  ? 317  VAL A N     1 
ATOM   2329 C  CA    . VAL A 1 317 ? -70.323  -22.943 -19.990 1.00 69.49  ? 317  VAL A CA    1 
ATOM   2330 C  C     . VAL A 1 317 ? -69.406  -23.682 -19.011 1.00 71.46  ? 317  VAL A C     1 
ATOM   2331 O  O     . VAL A 1 317 ? -69.435  -23.422 -17.805 1.00 72.52  ? 317  VAL A O     1 
ATOM   2332 C  CB    . VAL A 1 317 ? -69.609  -21.686 -20.547 1.00 70.85  ? 317  VAL A CB    1 
ATOM   2333 C  CG1   . VAL A 1 317 ? -68.441  -22.071 -21.446 1.00 73.13  ? 317  VAL A CG1   1 
ATOM   2334 C  CG2   . VAL A 1 317 ? -70.585  -20.809 -21.320 1.00 73.73  ? 317  VAL A CG2   1 
ATOM   2335 N  N     . TYR A 1 318 ? -68.605  -24.606 -19.537 1.00 71.47  ? 318  TYR A N     1 
ATOM   2336 C  CA    . TYR A 1 318 ? -67.664  -25.383 -18.729 1.00 67.26  ? 318  TYR A CA    1 
ATOM   2337 C  C     . TYR A 1 318 ? -66.375  -24.616 -18.424 1.00 69.20  ? 318  TYR A C     1 
ATOM   2338 O  O     . TYR A 1 318 ? -66.061  -23.620 -19.081 1.00 71.80  ? 318  TYR A O     1 
ATOM   2339 C  CB    . TYR A 1 318 ? -67.346  -26.719 -19.409 1.00 74.64  ? 318  TYR A CB    1 
ATOM   2340 C  CG    . TYR A 1 318 ? -68.503  -27.693 -19.407 1.00 76.15  ? 318  TYR A CG    1 
ATOM   2341 C  CD1   . TYR A 1 318 ? -68.760  -28.498 -18.298 1.00 73.29  ? 318  TYR A CD1   1 
ATOM   2342 C  CD2   . TYR A 1 318 ? -69.341  -27.810 -20.514 1.00 83.30  ? 318  TYR A CD2   1 
ATOM   2343 C  CE1   . TYR A 1 318 ? -69.820  -29.391 -18.290 1.00 71.62  ? 318  TYR A CE1   1 
ATOM   2344 C  CE2   . TYR A 1 318 ? -70.402  -28.702 -20.516 1.00 78.31  ? 318  TYR A CE2   1 
ATOM   2345 C  CZ    . TYR A 1 318 ? -70.637  -29.489 -19.403 1.00 69.76  ? 318  TYR A CZ    1 
ATOM   2346 O  OH    . TYR A 1 318 ? -71.690  -30.375 -19.399 1.00 69.46  ? 318  TYR A OH    1 
ATOM   2347 N  N     . TYR A 1 319 ? -65.639  -25.097 -17.424 1.00 70.87  ? 319  TYR A N     1 
ATOM   2348 C  CA    . TYR A 1 319 ? -64.423  -24.441 -16.946 1.00 72.47  ? 319  TYR A CA    1 
ATOM   2349 C  C     . TYR A 1 319 ? -63.194  -24.786 -17.786 1.00 71.35  ? 319  TYR A C     1 
ATOM   2350 O  O     . TYR A 1 319 ? -62.988  -25.942 -18.163 1.00 72.86  ? 319  TYR A O     1 
ATOM   2351 C  CB    . TYR A 1 319 ? -64.184  -24.792 -15.472 1.00 63.89  ? 319  TYR A CB    1 
ATOM   2352 C  CG    . TYR A 1 319 ? -62.842  -24.360 -14.913 1.00 59.95  ? 319  TYR A CG    1 
ATOM   2353 C  CD1   . TYR A 1 319 ? -62.557  -23.012 -14.683 1.00 56.38  ? 319  TYR A CD1   1 
ATOM   2354 C  CD2   . TYR A 1 319 ? -61.862  -25.302 -14.600 1.00 63.96  ? 319  TYR A CD2   1 
ATOM   2355 C  CE1   . TYR A 1 319 ? -61.332  -22.618 -14.166 1.00 57.57  ? 319  TYR A CE1   1 
ATOM   2356 C  CE2   . TYR A 1 319 ? -60.635  -24.916 -14.083 1.00 65.00  ? 319  TYR A CE2   1 
ATOM   2357 C  CZ    . TYR A 1 319 ? -60.375  -23.575 -13.869 1.00 62.96  ? 319  TYR A CZ    1 
ATOM   2358 O  OH    . TYR A 1 319 ? -59.157  -23.192 -13.357 1.00 66.08  ? 319  TYR A OH    1 
ATOM   2359 N  N     . ASP A 1 320 ? -62.387  -23.765 -18.070 1.00 67.09  ? 320  ASP A N     1 
ATOM   2360 C  CA    . ASP A 1 320 ? -61.116  -23.932 -18.766 1.00 66.17  ? 320  ASP A CA    1 
ATOM   2361 C  C     . ASP A 1 320 ? -59.980  -23.477 -17.844 1.00 66.60  ? 320  ASP A C     1 
ATOM   2362 O  O     . ASP A 1 320 ? -59.944  -22.313 -17.437 1.00 75.20  ? 320  ASP A O     1 
ATOM   2363 C  CB    . ASP A 1 320 ? -61.110  -23.132 -20.074 1.00 74.36  ? 320  ASP A CB    1 
ATOM   2364 C  CG    . ASP A 1 320 ? -60.107  -23.664 -21.088 1.00 83.36  ? 320  ASP A CG    1 
ATOM   2365 O  OD1   . ASP A 1 320 ? -58.923  -23.853 -20.735 1.00 85.78  ? 320  ASP A OD1   1 
ATOM   2366 O  OD2   . ASP A 1 320 ? -60.505  -23.881 -22.252 1.00 89.31  ? 320  ASP A OD2   1 
ATOM   2367 N  N     . PRO A 1 321 ? -59.054  -24.398 -17.507 1.00 64.68  ? 321  PRO A N     1 
ATOM   2368 C  CA    . PRO A 1 321 ? -57.955  -24.129 -16.567 1.00 72.92  ? 321  PRO A CA    1 
ATOM   2369 C  C     . PRO A 1 321 ? -56.970  -23.050 -17.024 1.00 78.32  ? 321  PRO A C     1 
ATOM   2370 O  O     . PRO A 1 321 ? -56.239  -22.500 -16.197 1.00 78.46  ? 321  PRO A O     1 
ATOM   2371 C  CB    . PRO A 1 321 ? -57.237  -25.482 -16.468 1.00 73.15  ? 321  PRO A CB    1 
ATOM   2372 C  CG    . PRO A 1 321 ? -58.251  -26.489 -16.891 1.00 73.15  ? 321  PRO A CG    1 
ATOM   2373 C  CD    . PRO A 1 321 ? -59.047  -25.801 -17.958 1.00 69.79  ? 321  PRO A CD    1 
ATOM   2374 N  N     . SER A 1 322 ? -56.955  -22.753 -18.322 1.00 76.84  ? 322  SER A N     1 
ATOM   2375 C  CA    . SER A 1 322 ? -56.043  -21.755 -18.884 1.00 81.15  ? 322  SER A CA    1 
ATOM   2376 C  C     . SER A 1 322 ? -56.501  -20.318 -18.622 1.00 89.52  ? 322  SER A C     1 
ATOM   2377 O  O     . SER A 1 322 ? -55.697  -19.469 -18.232 1.00 99.46  ? 322  SER A O     1 
ATOM   2378 C  CB    . SER A 1 322 ? -55.845  -21.988 -20.385 1.00 86.87  ? 322  SER A CB    1 
ATOM   2379 O  OG    . SER A 1 322 ? -57.077  -21.924 -21.082 1.00 95.79  ? 322  SER A OG    1 
ATOM   2380 N  N     . LYS A 1 323 ? -57.790  -20.055 -18.836 1.00 88.66  ? 323  LYS A N     1 
ATOM   2381 C  CA    . LYS A 1 323 ? -58.356  -18.715 -18.663 1.00 86.60  ? 323  LYS A CA    1 
ATOM   2382 C  C     . LYS A 1 323 ? -58.668  -18.389 -17.202 1.00 87.22  ? 323  LYS A C     1 
ATOM   2383 O  O     . LYS A 1 323 ? -58.982  -19.280 -16.409 1.00 84.75  ? 323  LYS A O     1 
ATOM   2384 C  CB    . LYS A 1 323 ? -59.615  -18.541 -19.523 1.00 82.22  ? 323  LYS A CB    1 
ATOM   2385 C  CG    . LYS A 1 323 ? -59.353  -18.111 -20.963 1.00 89.18  ? 323  LYS A CG    1 
ATOM   2386 C  CD    . LYS A 1 323 ? -59.014  -19.278 -21.884 1.00 94.43  ? 323  LYS A CD    1 
ATOM   2387 C  CE    . LYS A 1 323 ? -60.246  -20.079 -22.285 1.00 93.00  ? 323  LYS A CE    1 
ATOM   2388 N  NZ    . LYS A 1 323 ? -61.154  -19.320 -23.190 1.00 90.38  ? 323  LYS A NZ    1 
ATOM   2389 N  N     . ASP A 1 324 ? -58.580  -17.104 -16.864 1.00 88.75  ? 324  ASP A N     1 
ATOM   2390 C  CA    . ASP A 1 324 ? -58.859  -16.621 -15.511 1.00 82.66  ? 324  ASP A CA    1 
ATOM   2391 C  C     . ASP A 1 324 ? -60.361  -16.494 -15.257 1.00 78.84  ? 324  ASP A C     1 
ATOM   2392 O  O     . ASP A 1 324 ? -61.143  -16.292 -16.189 1.00 82.80  ? 324  ASP A O     1 
ATOM   2393 C  CB    . ASP A 1 324 ? -58.175  -15.269 -15.271 1.00 82.73  ? 324  ASP A CB    1 
ATOM   2394 C  CG    . ASP A 1 324 ? -56.658  -15.349 -15.371 1.00 94.56  ? 324  ASP A CG    1 
ATOM   2395 O  OD1   . ASP A 1 324 ? -56.065  -16.313 -14.841 1.00 101.29 ? 324  ASP A OD1   1 
ATOM   2396 O  OD2   . ASP A 1 324 ? -56.058  -14.435 -15.975 1.00 99.54  ? 324  ASP A OD2   1 
ATOM   2397 N  N     . LEU A 1 325 ? -60.751  -16.612 -13.989 1.00 75.11  ? 325  LEU A N     1 
ATOM   2398 C  CA    . LEU A 1 325 ? -62.151  -16.479 -13.586 1.00 72.16  ? 325  LEU A CA    1 
ATOM   2399 C  C     . LEU A 1 325 ? -62.489  -15.027 -13.257 1.00 69.97  ? 325  LEU A C     1 
ATOM   2400 O  O     . LEU A 1 325 ? -61.752  -14.361 -12.525 1.00 68.35  ? 325  LEU A O     1 
ATOM   2401 C  CB    . LEU A 1 325 ? -62.458  -17.375 -12.381 1.00 64.21  ? 325  LEU A CB    1 
ATOM   2402 C  CG    . LEU A 1 325 ? -62.283  -18.894 -12.501 1.00 60.80  ? 325  LEU A CG    1 
ATOM   2403 C  CD1   . LEU A 1 325 ? -62.256  -19.527 -11.118 1.00 60.83  ? 325  LEU A CD1   1 
ATOM   2404 C  CD2   . LEU A 1 325 ? -63.370  -19.524 -13.360 1.00 56.16  ? 325  LEU A CD2   1 
ATOM   2405 N  N     . ILE A 1 326 ? -63.602  -14.544 -13.806 1.00 68.13  ? 326  ILE A N     1 
ATOM   2406 C  CA    . ILE A 1 326 ? -64.052  -13.168 -13.581 1.00 67.30  ? 326  ILE A CA    1 
ATOM   2407 C  C     . ILE A 1 326 ? -65.476  -13.147 -13.018 1.00 70.47  ? 326  ILE A C     1 
ATOM   2408 O  O     . ILE A 1 326 ? -66.392  -13.732 -13.600 1.00 71.87  ? 326  ILE A O     1 
ATOM   2409 C  CB    . ILE A 1 326 ? -63.976  -12.312 -14.872 1.00 70.25  ? 326  ILE A CB    1 
ATOM   2410 C  CG1   . ILE A 1 326 ? -62.568  -12.367 -15.481 1.00 69.70  ? 326  ILE A CG1   1 
ATOM   2411 C  CG2   . ILE A 1 326 ? -64.374  -10.866 -14.588 1.00 71.12  ? 326  ILE A CG2   1 
ATOM   2412 C  CD1   . ILE A 1 326 ? -62.505  -12.001 -16.950 1.00 80.04  ? 326  ILE A CD1   1 
ATOM   2413 N  N     . ALA A 1 327 ? -65.644  -12.474 -11.881 1.00 70.02  ? 327  ALA A N     1 
ATOM   2414 C  CA    . ALA A 1 327 ? -66.950  -12.324 -11.240 1.00 61.35  ? 327  ALA A CA    1 
ATOM   2415 C  C     . ALA A 1 327 ? -67.374  -10.857 -11.188 1.00 62.86  ? 327  ALA A C     1 
ATOM   2416 O  O     . ALA A 1 327 ? -66.547  -9.972  -10.955 1.00 64.35  ? 327  ALA A O     1 
ATOM   2417 C  CB    . ALA A 1 327 ? -66.928  -12.924 -9.843  1.00 53.99  ? 327  ALA A CB    1 
ATOM   2418 N  N     . GLU A 1 328 ? -68.665  -10.611 -11.403 1.00 60.81  ? 328  GLU A N     1 
ATOM   2419 C  CA    . GLU A 1 328 ? -69.210  -9.253  -11.416 1.00 73.66  ? 328  GLU A CA    1 
ATOM   2420 C  C     . GLU A 1 328 ? -70.387  -9.112  -10.450 1.00 77.11  ? 328  GLU A C     1 
ATOM   2421 O  O     . GLU A 1 328 ? -71.256  -9.982  -10.388 1.00 76.47  ? 328  GLU A O     1 
ATOM   2422 C  CB    . GLU A 1 328 ? -69.631  -8.862  -12.837 1.00 92.48  ? 328  GLU A CB    1 
ATOM   2423 C  CG    . GLU A 1 328 ? -69.764  -7.362  -13.065 1.00 88.56  ? 328  GLU A CG    1 
ATOM   2424 C  CD    . GLU A 1 328 ? -70.129  -7.007  -14.496 1.00 91.83  ? 328  GLU A CD    1 
ATOM   2425 O  OE1   . GLU A 1 328 ? -69.663  -7.695  -15.431 1.00 85.05  ? 328  GLU A OE1   1 
ATOM   2426 O  OE2   . GLU A 1 328 ? -70.886  -6.032  -14.688 1.00 99.23  ? 328  GLU A OE2   1 
ATOM   2427 N  N     . ILE A 1 329 ? -70.405  -8.006  -9.709  1.00 73.90  ? 329  ILE A N     1 
ATOM   2428 C  CA    . ILE A 1 329 ? -71.426  -7.747  -8.690  1.00 72.93  ? 329  ILE A CA    1 
ATOM   2429 C  C     . ILE A 1 329 ? -72.345  -6.597  -9.109  1.00 79.25  ? 329  ILE A C     1 
ATOM   2430 O  O     . ILE A 1 329 ? -71.878  -5.572  -9.612  1.00 86.97  ? 329  ILE A O     1 
ATOM   2431 C  CB    . ILE A 1 329 ? -70.777  -7.423  -7.317  1.00 80.21  ? 329  ILE A CB    1 
ATOM   2432 C  CG1   . ILE A 1 329 ? -69.826  -8.546  -6.866  1.00 62.36  ? 329  ILE A CG1   1 
ATOM   2433 C  CG2   . ILE A 1 329 ? -71.827  -7.098  -6.255  1.00 82.87  ? 329  ILE A CG2   1 
ATOM   2434 C  CD1   . ILE A 1 329 ? -70.482  -9.884  -6.594  1.00 55.57  ? 329  ILE A CD1   1 
ATOM   2435 N  N     . GLN A 1 330 ? -73.649  -6.781  -8.907  1.00 76.88  ? 330  GLN A N     1 
ATOM   2436 C  CA    . GLN A 1 330 ? -74.637  -5.726  -9.147  1.00 79.97  ? 330  GLN A CA    1 
ATOM   2437 C  C     . GLN A 1 330 ? -75.610  -5.613  -7.976  1.00 77.59  ? 330  GLN A C     1 
ATOM   2438 O  O     . GLN A 1 330 ? -76.109  -6.624  -7.474  1.00 81.15  ? 330  GLN A O     1 
ATOM   2439 C  CB    . GLN A 1 330 ? -75.426  -5.974  -10.441 1.00 82.49  ? 330  GLN A CB    1 
ATOM   2440 C  CG    . GLN A 1 330 ? -74.592  -6.131  -11.706 1.00 80.30  ? 330  GLN A CG    1 
ATOM   2441 C  CD    . GLN A 1 330 ? -74.200  -7.572  -11.982 1.00 82.63  ? 330  GLN A CD    1 
ATOM   2442 O  OE1   . GLN A 1 330 ? -73.053  -7.858  -12.325 1.00 82.65  ? 330  GLN A OE1   1 
ATOM   2443 N  NE2   . GLN A 1 330 ? -75.153  -8.488  -11.832 1.00 71.53  ? 330  GLN A NE2   1 
ATOM   2444 N  N     . LYS A 1 331 ? -75.872  -4.381  -7.546  1.00 71.31  ? 331  LYS A N     1 
ATOM   2445 C  CA    . LYS A 1 331 ? -76.879  -4.113  -6.523  1.00 74.08  ? 331  LYS A CA    1 
ATOM   2446 C  C     . LYS A 1 331 ? -78.239  -3.923  -7.191  1.00 81.20  ? 331  LYS A C     1 
ATOM   2447 O  O     . LYS A 1 331 ? -78.480  -2.908  -7.849  1.00 86.15  ? 331  LYS A O     1 
ATOM   2448 C  CB    . LYS A 1 331 ? -76.502  -2.879  -5.695  1.00 78.13  ? 331  LYS A CB    1 
ATOM   2449 C  CG    . LYS A 1 331 ? -77.452  -2.579  -4.545  1.00 84.08  ? 331  LYS A CG    1 
ATOM   2450 C  CD    . LYS A 1 331 ? -77.091  -1.275  -3.849  1.00 79.04  ? 331  LYS A CD    1 
ATOM   2451 C  CE    . LYS A 1 331 ? -78.150  -0.869  -2.835  1.00 80.86  ? 331  LYS A CE    1 
ATOM   2452 N  NZ    . LYS A 1 331 ? -78.210  -1.786  -1.662  1.00 92.95  ? 331  LYS A NZ    1 
ATOM   2453 N  N     . GLN A 1 332 ? -79.121  -4.905  -7.024  1.00 79.00  ? 332  GLN A N     1 
ATOM   2454 C  CA    . GLN A 1 332 ? -80.438  -4.878  -7.668  1.00 87.56  ? 332  GLN A CA    1 
ATOM   2455 C  C     . GLN A 1 332 ? -81.523  -4.187  -6.833  1.00 94.06  ? 332  GLN A C     1 
ATOM   2456 O  O     . GLN A 1 332 ? -82.517  -3.707  -7.384  1.00 120.09 ? 332  GLN A O     1 
ATOM   2457 C  CB    . GLN A 1 332 ? -80.882  -6.287  -8.087  1.00 86.32  ? 332  GLN A CB    1 
ATOM   2458 C  CG    . GLN A 1 332 ? -80.864  -7.329  -6.977  1.00 90.90  ? 332  GLN A CG    1 
ATOM   2459 C  CD    . GLN A 1 332 ? -81.499  -8.652  -7.377  1.00 96.98  ? 332  GLN A CD    1 
ATOM   2460 O  OE1   . GLN A 1 332 ? -81.697  -9.531  -6.539  1.00 98.76  ? 332  GLN A OE1   1 
ATOM   2461 N  NE2   . GLN A 1 332 ? -81.820  -8.800  -8.659  1.00 101.02 ? 332  GLN A NE2   1 
ATOM   2462 N  N     . GLY A 1 333 ? -81.330  -4.138  -5.517  1.00 82.66  ? 333  GLY A N     1 
ATOM   2463 C  CA    . GLY A 1 333 ? -82.293  -3.493  -4.625  1.00 94.16  ? 333  GLY A CA    1 
ATOM   2464 C  C     . GLY A 1 333 ? -81.914  -3.506  -3.157  1.00 94.33  ? 333  GLY A C     1 
ATOM   2465 O  O     . GLY A 1 333 ? -80.732  -3.569  -2.808  1.00 89.27  ? 333  GLY A O     1 
ATOM   2466 N  N     . GLN A 1 334 ? -82.932  -3.441  -2.300  1.00 93.18  ? 334  GLN A N     1 
ATOM   2467 C  CA    . GLN A 1 334 ? -82.746  -3.413  -0.848  1.00 88.22  ? 334  GLN A CA    1 
ATOM   2468 C  C     . GLN A 1 334 ? -82.354  -4.781  -0.287  1.00 90.70  ? 334  GLN A C     1 
ATOM   2469 O  O     . GLN A 1 334 ? -83.178  -5.697  -0.207  1.00 88.22  ? 334  GLN A O     1 
ATOM   2470 C  CB    . GLN A 1 334 ? -83.993  -2.855  -0.142  1.00 92.32  ? 334  GLN A CB    1 
ATOM   2471 C  CG    . GLN A 1 334 ? -85.322  -3.441  -0.609  1.00 94.75  ? 334  GLN A CG    1 
ATOM   2472 C  CD    . GLN A 1 334 ? -86.520  -2.853  0.116   1.00 108.13 ? 334  GLN A CD    1 
ATOM   2473 O  OE1   . GLN A 1 334 ? -87.295  -3.577  0.741   1.00 107.71 ? 334  GLN A OE1   1 
ATOM   2474 N  NE2   . GLN A 1 334 ? -86.678  -1.535  0.036   1.00 111.28 ? 334  GLN A NE2   1 
ATOM   2475 N  N     . GLY A 1 335 ? -81.083  -4.908  0.087   1.00 92.20  ? 335  GLY A N     1 
ATOM   2476 C  CA    . GLY A 1 335 ? -80.540  -6.158  0.617   1.00 92.73  ? 335  GLY A CA    1 
ATOM   2477 C  C     . GLY A 1 335 ? -80.497  -7.281  -0.402  1.00 98.81  ? 335  GLY A C     1 
ATOM   2478 O  O     . GLY A 1 335 ? -80.631  -8.453  -0.046  1.00 99.30  ? 335  GLY A O     1 
ATOM   2479 N  N     . GLN A 1 336 ? -80.312  -6.918  -1.669  1.00 94.71  ? 336  GLN A N     1 
ATOM   2480 C  CA    . GLN A 1 336 ? -80.264  -7.883  -2.765  1.00 85.77  ? 336  GLN A CA    1 
ATOM   2481 C  C     . GLN A 1 336 ? -79.080  -7.634  -3.694  1.00 84.17  ? 336  GLN A C     1 
ATOM   2482 O  O     . GLN A 1 336 ? -78.833  -6.501  -4.114  1.00 88.13  ? 336  GLN A O     1 
ATOM   2483 C  CB    . GLN A 1 336 ? -81.568  -7.859  -3.564  1.00 92.79  ? 336  GLN A CB    1 
ATOM   2484 C  CG    . GLN A 1 336 ? -82.656  -8.765  -3.014  1.00 94.48  ? 336  GLN A CG    1 
ATOM   2485 C  CD    . GLN A 1 336 ? -83.790  -8.989  -3.999  1.00 109.41 ? 336  GLN A CD    1 
ATOM   2486 O  OE1   . GLN A 1 336 ? -84.021  -10.112 -4.448  1.00 108.44 ? 336  GLN A OE1   1 
ATOM   2487 N  NE2   . GLN A 1 336 ? -84.501  -7.920  -4.342  1.00 102.68 ? 336  GLN A NE2   1 
ATOM   2488 N  N     . TRP A 1 337 ? -78.353  -8.705  -4.003  1.00 81.16  ? 337  TRP A N     1 
ATOM   2489 C  CA    . TRP A 1 337 ? -77.184  -8.643  -4.879  1.00 77.97  ? 337  TRP A CA    1 
ATOM   2490 C  C     . TRP A 1 337 ? -77.203  -9.789  -5.850  1.00 78.95  ? 337  TRP A C     1 
ATOM   2491 O  O     . TRP A 1 337 ? -77.663  -10.883 -5.522  1.00 81.51  ? 337  TRP A O     1 
ATOM   2492 C  CB    . TRP A 1 337 ? -75.894  -8.676  -4.062  1.00 70.14  ? 337  TRP A CB    1 
ATOM   2493 C  CG    . TRP A 1 337 ? -75.821  -7.635  -2.966  1.00 75.50  ? 337  TRP A CG    1 
ATOM   2494 C  CD1   . TRP A 1 337 ? -76.381  -7.703  -1.692  1.00 80.88  ? 337  TRP A CD1   1 
ATOM   2495 C  CD2   . TRP A 1 337 ? -75.136  -6.333  -3.009  1.00 82.03  ? 337  TRP A CD2   1 
ATOM   2496 N  NE1   . TRP A 1 337 ? -76.104  -6.569  -0.974  1.00 81.26  ? 337  TRP A NE1   1 
ATOM   2497 C  CE2   . TRP A 1 337 ? -75.362  -5.708  -1.699  1.00 78.27  ? 337  TRP A CE2   1 
ATOM   2498 C  CE3   . TRP A 1 337 ? -74.389  -5.649  -3.963  1.00 82.06  ? 337  TRP A CE3   1 
ATOM   2499 C  CZ2   . TRP A 1 337 ? -74.854  -4.456  -1.384  1.00 69.40  ? 337  TRP A CZ2   1 
ATOM   2500 C  CZ3   . TRP A 1 337 ? -73.882  -4.386  -3.632  1.00 78.57  ? 337  TRP A CZ3   1 
ATOM   2501 C  CH2   . TRP A 1 337 ? -74.110  -3.806  -2.373  1.00 72.79  ? 337  TRP A CH2   1 
ATOM   2502 N  N     . THR A 1 338 ? -76.707  -9.547  -7.061  1.00 75.42  ? 338  THR A N     1 
ATOM   2503 C  CA    . THR A 1 338 ? -76.629  -10.590 -8.086  1.00 69.74  ? 338  THR A CA    1 
ATOM   2504 C  C     . THR A 1 338 ? -75.233  -10.684 -8.692  1.00 67.84  ? 338  THR A C     1 
ATOM   2505 O  O     . THR A 1 338 ? -74.602  -9.664  -8.979  1.00 74.25  ? 338  THR A O     1 
ATOM   2506 C  CB    . THR A 1 338 ? -77.661  -10.379 -9.214  1.00 74.01  ? 338  THR A CB    1 
ATOM   2507 O  OG1   . THR A 1 338 ? -77.726  -8.989  -9.560  1.00 78.71  ? 338  THR A OG1   1 
ATOM   2508 C  CG2   . THR A 1 338 ? -79.038  -10.856 -8.778  1.00 78.97  ? 338  THR A CG2   1 
ATOM   2509 N  N     . TYR A 1 339 ? -74.760  -11.914 -8.880  1.00 67.21  ? 339  TYR A N     1 
ATOM   2510 C  CA    . TYR A 1 339 ? -73.443  -12.148 -9.466  1.00 71.15  ? 339  TYR A CA    1 
ATOM   2511 C  C     . TYR A 1 339 ? -73.458  -13.185 -10.584 1.00 74.77  ? 339  TYR A C     1 
ATOM   2512 O  O     . TYR A 1 339 ? -74.211  -14.159 -10.532 1.00 79.64  ? 339  TYR A O     1 
ATOM   2513 C  CB    . TYR A 1 339 ? -72.416  -12.526 -8.387  1.00 71.64  ? 339  TYR A CB    1 
ATOM   2514 C  CG    . TYR A 1 339 ? -72.651  -13.857 -7.698  1.00 74.56  ? 339  TYR A CG    1 
ATOM   2515 C  CD1   . TYR A 1 339 ? -73.441  -13.942 -6.551  1.00 70.60  ? 339  TYR A CD1   1 
ATOM   2516 C  CD2   . TYR A 1 339 ? -72.057  -15.027 -8.176  1.00 74.88  ? 339  TYR A CD2   1 
ATOM   2517 C  CE1   . TYR A 1 339 ? -73.647  -15.155 -5.911  1.00 74.69  ? 339  TYR A CE1   1 
ATOM   2518 C  CE2   . TYR A 1 339 ? -72.260  -16.245 -7.544  1.00 72.48  ? 339  TYR A CE2   1 
ATOM   2519 C  CZ    . TYR A 1 339 ? -73.054  -16.303 -6.413  1.00 75.08  ? 339  TYR A CZ    1 
ATOM   2520 O  OH    . TYR A 1 339 ? -73.258  -17.509 -5.783  1.00 70.86  ? 339  TYR A OH    1 
ATOM   2521 N  N     . GLN A 1 340 ? -72.624  -12.954 -11.595 1.00 72.31  ? 340  GLN A N     1 
ATOM   2522 C  CA    . GLN A 1 340 ? -72.417  -13.911 -12.681 1.00 72.14  ? 340  GLN A CA    1 
ATOM   2523 C  C     . GLN A 1 340 ? -70.925  -14.134 -12.929 1.00 66.06  ? 340  GLN A C     1 
ATOM   2524 O  O     . GLN A 1 340 ? -70.169  -13.182 -13.142 1.00 68.88  ? 340  GLN A O     1 
ATOM   2525 C  CB    . GLN A 1 340 ? -73.137  -13.480 -13.970 1.00 82.01  ? 340  GLN A CB    1 
ATOM   2526 C  CG    . GLN A 1 340 ? -72.955  -12.023 -14.382 1.00 85.73  ? 340  GLN A CG    1 
ATOM   2527 C  CD    . GLN A 1 340 ? -74.046  -11.104 -13.854 1.00 83.35  ? 340  GLN A CD    1 
ATOM   2528 O  OE1   . GLN A 1 340 ? -74.806  -11.464 -12.954 1.00 76.10  ? 340  GLN A OE1   1 
ATOM   2529 N  NE2   . GLN A 1 340 ? -74.126  -9.906  -14.420 1.00 88.66  ? 340  GLN A NE2   1 
ATOM   2530 N  N     . ILE A 1 341 ? -70.512  -15.398 -12.886 1.00 64.32  ? 341  ILE A N     1 
ATOM   2531 C  CA    . ILE A 1 341 ? -69.105  -15.766 -13.043 1.00 67.67  ? 341  ILE A CA    1 
ATOM   2532 C  C     . ILE A 1 341 ? -68.845  -16.269 -14.462 1.00 72.24  ? 341  ILE A C     1 
ATOM   2533 O  O     . ILE A 1 341 ? -69.509  -17.195 -14.934 1.00 75.25  ? 341  ILE A O     1 
ATOM   2534 C  CB    . ILE A 1 341 ? -68.672  -16.822 -11.998 1.00 66.20  ? 341  ILE A CB    1 
ATOM   2535 C  CG1   . ILE A 1 341 ? -69.060  -16.363 -10.586 1.00 65.49  ? 341  ILE A CG1   1 
ATOM   2536 C  CG2   . ILE A 1 341 ? -67.172  -17.082 -12.082 1.00 66.18  ? 341  ILE A CG2   1 
ATOM   2537 C  CD1   . ILE A 1 341 ? -69.278  -17.489 -9.596  1.00 71.80  ? 341  ILE A CD1   1 
ATOM   2538 N  N     . TYR A 1 342 ? -67.880  -15.645 -15.133 1.00 73.49  ? 342  TYR A N     1 
ATOM   2539 C  CA    . TYR A 1 342 ? -67.555  -15.969 -16.522 1.00 67.34  ? 342  TYR A CA    1 
ATOM   2540 C  C     . TYR A 1 342 ? -66.056  -15.893 -16.809 1.00 65.96  ? 342  TYR A C     1 
ATOM   2541 O  O     . TYR A 1 342 ? -65.334  -15.111 -16.187 1.00 63.89  ? 342  TYR A O     1 
ATOM   2542 C  CB    . TYR A 1 342 ? -68.327  -15.056 -17.488 1.00 72.15  ? 342  TYR A CB    1 
ATOM   2543 C  CG    . TYR A 1 342 ? -68.146  -13.569 -17.243 1.00 75.99  ? 342  TYR A CG    1 
ATOM   2544 C  CD1   . TYR A 1 342 ? -67.108  -12.861 -17.851 1.00 78.04  ? 342  TYR A CD1   1 
ATOM   2545 C  CD2   . TYR A 1 342 ? -69.022  -12.867 -16.414 1.00 76.48  ? 342  TYR A CD2   1 
ATOM   2546 C  CE1   . TYR A 1 342 ? -66.941  -11.502 -17.632 1.00 77.89  ? 342  TYR A CE1   1 
ATOM   2547 C  CE2   . TYR A 1 342 ? -68.864  -11.508 -16.189 1.00 82.69  ? 342  TYR A CE2   1 
ATOM   2548 C  CZ    . TYR A 1 342 ? -67.823  -10.831 -16.800 1.00 86.70  ? 342  TYR A CZ    1 
ATOM   2549 O  OH    . TYR A 1 342 ? -67.664  -9.482  -16.580 1.00 103.94 ? 342  TYR A OH    1 
ATOM   2550 N  N     . GLN A 1 343 ? -65.601  -16.717 -17.750 1.00 71.05  ? 343  GLN A N     1 
ATOM   2551 C  CA    . GLN A 1 343 ? -64.226  -16.656 -18.246 1.00 73.98  ? 343  GLN A CA    1 
ATOM   2552 C  C     . GLN A 1 343 ? -64.179  -15.869 -19.552 1.00 74.45  ? 343  GLN A C     1 
ATOM   2553 O  O     . GLN A 1 343 ? -63.213  -15.153 -19.825 1.00 68.06  ? 343  GLN A O     1 
ATOM   2554 C  CB    . GLN A 1 343 ? -63.655  -18.062 -18.447 1.00 66.69  ? 343  GLN A CB    1 
ATOM   2555 C  CG    . GLN A 1 343 ? -63.389  -18.815 -17.152 1.00 66.07  ? 343  GLN A CG    1 
ATOM   2556 C  CD    . GLN A 1 343 ? -62.674  -20.135 -17.370 1.00 68.45  ? 343  GLN A CD    1 
ATOM   2557 O  OE1   . GLN A 1 343 ? -63.085  -20.954 -18.195 1.00 75.66  ? 343  GLN A OE1   1 
ATOM   2558 N  NE2   . GLN A 1 343 ? -61.601  -20.353 -16.620 1.00 66.37  ? 343  GLN A NE2   1 
ATOM   2559 N  N     . GLU A 1 344 ? -65.234  -16.016 -20.351 1.00 77.43  ? 344  GLU A N     1 
ATOM   2560 C  CA    . GLU A 1 344 ? -65.417  -15.252 -21.581 1.00 78.77  ? 344  GLU A CA    1 
ATOM   2561 C  C     . GLU A 1 344 ? -66.686  -14.406 -21.462 1.00 79.22  ? 344  GLU A C     1 
ATOM   2562 O  O     . GLU A 1 344 ? -67.668  -14.855 -20.864 1.00 82.06  ? 344  GLU A O     1 
ATOM   2563 C  CB    . GLU A 1 344 ? -65.517  -16.191 -22.789 1.00 83.38  ? 344  GLU A CB    1 
ATOM   2564 C  CG    . GLU A 1 344 ? -64.254  -16.993 -23.087 1.00 89.33  ? 344  GLU A CG    1 
ATOM   2565 C  CD    . GLU A 1 344 ? -63.124  -16.153 -23.659 1.00 95.64  ? 344  GLU A CD    1 
ATOM   2566 O  OE1   . GLU A 1 344 ? -63.401  -15.171 -24.382 1.00 102.51 ? 344  GLU A OE1   1 
ATOM   2567 O  OE2   . GLU A 1 344 ? -61.949  -16.483 -23.391 1.00 96.78  ? 344  GLU A OE2   1 
ATOM   2568 N  N     . PRO A 1 345 ? -66.671  -13.177 -22.023 1.00 83.20  ? 345  PRO A N     1 
ATOM   2569 C  CA    . PRO A 1 345 ? -67.830  -12.277 -21.950 1.00 82.86  ? 345  PRO A CA    1 
ATOM   2570 C  C     . PRO A 1 345 ? -69.097  -12.885 -22.554 1.00 83.29  ? 345  PRO A C     1 
ATOM   2571 O  O     . PRO A 1 345 ? -69.027  -13.569 -23.579 1.00 86.84  ? 345  PRO A O     1 
ATOM   2572 C  CB    . PRO A 1 345 ? -67.384  -11.052 -22.762 1.00 83.60  ? 345  PRO A CB    1 
ATOM   2573 C  CG    . PRO A 1 345 ? -66.231  -11.519 -23.585 1.00 83.52  ? 345  PRO A CG    1 
ATOM   2574 C  CD    . PRO A 1 345 ? -65.548  -12.552 -22.743 1.00 81.76  ? 345  PRO A CD    1 
ATOM   2575 N  N     . PHE A 1 346 ? -70.234  -12.637 -21.900 1.00 81.52  ? 346  PHE A N     1 
ATOM   2576 C  CA    . PHE A 1 346 ? -71.549  -13.175 -22.294 1.00 86.87  ? 346  PHE A CA    1 
ATOM   2577 C  C     . PHE A 1 346 ? -71.672  -14.700 -22.170 1.00 86.82  ? 346  PHE A C     1 
ATOM   2578 O  O     . PHE A 1 346 ? -72.760  -15.256 -22.347 1.00 87.14  ? 346  PHE A O     1 
ATOM   2579 C  CB    . PHE A 1 346 ? -71.951  -12.706 -23.703 1.00 94.25  ? 346  PHE A CB    1 
ATOM   2580 C  CG    . PHE A 1 346 ? -72.282  -11.242 -23.786 1.00 102.04 ? 346  PHE A CG    1 
ATOM   2581 C  CD1   . PHE A 1 346 ? -73.582  -10.796 -23.564 1.00 107.10 ? 346  PHE A CD1   1 
ATOM   2582 C  CD2   . PHE A 1 346 ? -71.298  -10.307 -24.091 1.00 103.26 ? 346  PHE A CD2   1 
ATOM   2583 C  CE1   . PHE A 1 346 ? -73.892  -9.447  -23.641 1.00 106.89 ? 346  PHE A CE1   1 
ATOM   2584 C  CE2   . PHE A 1 346 ? -71.602  -8.956  -24.169 1.00 110.69 ? 346  PHE A CE2   1 
ATOM   2585 C  CZ    . PHE A 1 346 ? -72.901  -8.525  -23.945 1.00 107.19 ? 346  PHE A CZ    1 
ATOM   2586 N  N     . LYS A 1 347 ? -70.560  -15.364 -21.860 1.00 88.26  ? 347  LYS A N     1 
ATOM   2587 C  CA    . LYS A 1 347 ? -70.533  -16.813 -21.678 1.00 86.66  ? 347  LYS A CA    1 
ATOM   2588 C  C     . LYS A 1 347 ? -70.418  -17.162 -20.194 1.00 77.22  ? 347  LYS A C     1 
ATOM   2589 O  O     . LYS A 1 347 ? -69.322  -17.414 -19.684 1.00 71.77  ? 347  LYS A O     1 
ATOM   2590 C  CB    . LYS A 1 347 ? -69.384  -17.438 -22.478 1.00 88.67  ? 347  LYS A CB    1 
ATOM   2591 C  CG    . LYS A 1 347 ? -69.558  -17.371 -23.988 1.00 87.07  ? 347  LYS A CG    1 
ATOM   2592 C  CD    . LYS A 1 347 ? -68.364  -17.978 -24.707 1.00 89.83  ? 347  LYS A CD    1 
ATOM   2593 C  CE    . LYS A 1 347 ? -68.526  -17.892 -26.216 1.00 77.22  ? 347  LYS A CE    1 
ATOM   2594 N  NZ    . LYS A 1 347 ? -67.358  -18.474 -26.934 1.00 79.80  ? 347  LYS A NZ    1 
ATOM   2595 N  N     . ASN A 1 348 ? -71.560  -17.169 -19.511 1.00 77.98  ? 348  ASN A N     1 
ATOM   2596 C  CA    . ASN A 1 348 ? -71.610  -17.406 -18.069 1.00 74.07  ? 348  ASN A CA    1 
ATOM   2597 C  C     . ASN A 1 348 ? -71.416  -18.865 -17.677 1.00 73.15  ? 348  ASN A C     1 
ATOM   2598 O  O     . ASN A 1 348 ? -71.946  -19.771 -18.325 1.00 80.17  ? 348  ASN A O     1 
ATOM   2599 C  CB    . ASN A 1 348 ? -72.922  -16.875 -17.481 1.00 65.40  ? 348  ASN A CB    1 
ATOM   2600 C  CG    . ASN A 1 348 ? -72.983  -15.358 -17.456 1.00 74.63  ? 348  ASN A CG    1 
ATOM   2601 O  OD1   . ASN A 1 348 ? -72.009  -14.687 -17.112 1.00 74.93  ? 348  ASN A OD1   1 
ATOM   2602 N  ND2   . ASN A 1 348 ? -74.139  -14.810 -17.814 1.00 71.47  ? 348  ASN A ND2   1 
ATOM   2603 N  N     . LEU A 1 349 ? -70.650  -19.077 -16.610 1.00 67.81  ? 349  LEU A N     1 
ATOM   2604 C  CA    . LEU A 1 349 ? -70.410  -20.410 -16.065 1.00 61.31  ? 349  LEU A CA    1 
ATOM   2605 C  C     . LEU A 1 349 ? -71.445  -20.731 -14.990 1.00 66.90  ? 349  LEU A C     1 
ATOM   2606 O  O     . LEU A 1 349 ? -72.058  -21.799 -15.010 1.00 64.13  ? 349  LEU A O     1 
ATOM   2607 C  CB    . LEU A 1 349 ? -68.993  -20.516 -15.483 1.00 59.36  ? 349  LEU A CB    1 
ATOM   2608 C  CG    . LEU A 1 349 ? -67.801  -19.940 -16.260 1.00 75.17  ? 349  LEU A CG    1 
ATOM   2609 C  CD1   . LEU A 1 349 ? -66.612  -19.750 -15.331 1.00 71.97  ? 349  LEU A CD1   1 
ATOM   2610 C  CD2   . LEU A 1 349 ? -67.418  -20.802 -17.455 1.00 83.58  ? 349  LEU A CD2   1 
ATOM   2611 N  N     . LYS A 1 350 ? -71.632  -19.795 -14.059 1.00 68.29  ? 350  LYS A N     1 
ATOM   2612 C  CA    . LYS A 1 350 ? -72.587  -19.941 -12.959 1.00 63.99  ? 350  LYS A CA    1 
ATOM   2613 C  C     . LYS A 1 350 ? -73.027  -18.571 -12.438 1.00 67.33  ? 350  LYS A C     1 
ATOM   2614 O  O     . LYS A 1 350 ? -72.211  -17.652 -12.323 1.00 65.64  ? 350  LYS A O     1 
ATOM   2615 C  CB    . LYS A 1 350 ? -71.972  -20.762 -11.819 1.00 70.31  ? 350  LYS A CB    1 
ATOM   2616 C  CG    . LYS A 1 350 ? -72.948  -21.146 -10.716 1.00 79.91  ? 350  LYS A CG    1 
ATOM   2617 C  CD    . LYS A 1 350 ? -72.225  -21.734 -9.514  1.00 65.95  ? 350  LYS A CD    1 
ATOM   2618 C  CE    . LYS A 1 350 ? -73.189  -22.041 -8.377  1.00 69.46  ? 350  LYS A CE    1 
ATOM   2619 N  NZ    . LYS A 1 350 ? -73.742  -20.810 -7.744  1.00 75.90  ? 350  LYS A NZ    1 
ATOM   2620 N  N     . THR A 1 351 ? -74.316  -18.446 -12.127 1.00 70.70  ? 351  THR A N     1 
ATOM   2621 C  CA    . THR A 1 351 ? -74.861  -17.220 -11.540 1.00 77.05  ? 351  THR A CA    1 
ATOM   2622 C  C     . THR A 1 351 ? -75.341  -17.455 -10.105 1.00 81.65  ? 351  THR A C     1 
ATOM   2623 O  O     . THR A 1 351 ? -75.399  -18.597 -9.640  1.00 76.33  ? 351  THR A O     1 
ATOM   2624 C  CB    . THR A 1 351 ? -76.017  -16.631 -12.383 1.00 74.16  ? 351  THR A CB    1 
ATOM   2625 O  OG1   . THR A 1 351 ? -77.130  -17.531 -12.379 1.00 77.02  ? 351  THR A OG1   1 
ATOM   2626 C  CG2   . THR A 1 351 ? -75.574  -16.372 -13.821 1.00 76.65  ? 351  THR A CG2   1 
ATOM   2627 N  N     . GLY A 1 352 ? -75.678  -16.370 -9.410  1.00 79.85  ? 352  GLY A N     1 
ATOM   2628 C  CA    . GLY A 1 352 ? -76.185  -16.443 -8.040  1.00 79.14  ? 352  GLY A CA    1 
ATOM   2629 C  C     . GLY A 1 352 ? -77.209  -15.368 -7.729  1.00 84.55  ? 352  GLY A C     1 
ATOM   2630 O  O     . GLY A 1 352 ? -77.608  -14.605 -8.613  1.00 85.82  ? 352  GLY A O     1 
ATOM   2631 N  N     . LYS A 1 353 ? -77.633  -15.304 -6.468  1.00 90.63  ? 353  LYS A N     1 
ATOM   2632 C  CA    . LYS A 1 353 ? -78.672  -14.360 -6.049  1.00 93.52  ? 353  LYS A CA    1 
ATOM   2633 C  C     . LYS A 1 353 ? -78.473  -13.805 -4.629  1.00 90.37  ? 353  LYS A C     1 
ATOM   2634 O  O     . LYS A 1 353 ? -79.409  -13.254 -4.040  1.00 102.85 ? 353  LYS A O     1 
ATOM   2635 C  CB    . LYS A 1 353 ? -80.072  -14.989 -6.220  1.00 95.05  ? 353  LYS A CB    1 
ATOM   2636 C  CG    . LYS A 1 353 ? -80.606  -15.800 -5.039  1.00 87.42  ? 353  LYS A CG    1 
ATOM   2637 C  CD    . LYS A 1 353 ? -79.850  -17.100 -4.805  1.00 93.07  ? 353  LYS A CD    1 
ATOM   2638 C  CE    . LYS A 1 353 ? -80.152  -17.658 -3.424  1.00 87.31  ? 353  LYS A CE    1 
ATOM   2639 N  NZ    . LYS A 1 353 ? -79.413  -18.924 -3.162  1.00 76.56  ? 353  LYS A NZ    1 
ATOM   2640 N  N     . TYR A 1 354 ? -77.252  -13.930 -4.101  1.00 80.77  ? 354  TYR A N     1 
ATOM   2641 C  CA    . TYR A 1 354 ? -76.935  -13.527 -2.721  1.00 83.75  ? 354  TYR A CA    1 
ATOM   2642 C  C     . TYR A 1 354 ? -77.761  -12.339 -2.233  1.00 85.20  ? 354  TYR A C     1 
ATOM   2643 O  O     . TYR A 1 354 ? -77.646  -11.228 -2.754  1.00 88.51  ? 354  TYR A O     1 
ATOM   2644 C  CB    . TYR A 1 354 ? -75.435  -13.235 -2.550  1.00 72.15  ? 354  TYR A CB    1 
ATOM   2645 C  CG    . TYR A 1 354 ? -75.074  -12.677 -1.184  1.00 71.79  ? 354  TYR A CG    1 
ATOM   2646 C  CD1   . TYR A 1 354 ? -74.839  -13.525 -0.102  1.00 82.23  ? 354  TYR A CD1   1 
ATOM   2647 C  CD2   . TYR A 1 354 ? -74.980  -11.300 -0.972  1.00 74.92  ? 354  TYR A CD2   1 
ATOM   2648 C  CE1   . TYR A 1 354 ? -74.515  -13.019 1.149   1.00 81.70  ? 354  TYR A CE1   1 
ATOM   2649 C  CE2   . TYR A 1 354 ? -74.658  -10.786 0.275   1.00 75.46  ? 354  TYR A CE2   1 
ATOM   2650 C  CZ    . TYR A 1 354 ? -74.425  -11.651 1.331   1.00 74.52  ? 354  TYR A CZ    1 
ATOM   2651 O  OH    . TYR A 1 354 ? -74.105  -11.146 2.570   1.00 67.53  ? 354  TYR A OH    1 
ATOM   2652 N  N     . ALA A 1 355 ? -78.594  -12.589 -1.230  1.00 88.53  ? 355  ALA A N     1 
ATOM   2653 C  CA    . ALA A 1 355 ? -79.435  -11.555 -0.642  1.00 96.68  ? 355  ALA A CA    1 
ATOM   2654 C  C     . ALA A 1 355 ? -79.547  -11.765 0.865   1.00 104.44 ? 355  ALA A C     1 
ATOM   2655 O  O     . ALA A 1 355 ? -80.600  -11.521 1.462   1.00 108.78 ? 355  ALA A O     1 
ATOM   2656 C  CB    . ALA A 1 355 ? -80.812  -11.566 -1.294  1.00 100.75 ? 355  ALA A CB    1 
ATOM   2657 N  N     . ARG A 1 356 ? -78.451  -12.205 1.478   1.00 91.85  ? 356  ARG A N     1 
ATOM   2658 C  CA    . ARG A 1 356 ? -78.483  -12.609 2.880   1.00 99.19  ? 356  ARG A CA    1 
ATOM   2659 C  C     . ARG A 1 356 ? -78.213  -11.482 3.874   1.00 98.67  ? 356  ARG A C     1 
ATOM   2660 O  O     . ARG A 1 356 ? -77.189  -11.461 4.565   1.00 103.92 ? 356  ARG A O     1 
ATOM   2661 C  CB    . ARG A 1 356 ? -77.578  -13.825 3.137   1.00 108.41 ? 356  ARG A CB    1 
ATOM   2662 C  CG    . ARG A 1 356 ? -77.948  -14.589 4.400   1.00 109.89 ? 356  ARG A CG    1 
ATOM   2663 C  CD    . ARG A 1 356 ? -77.424  -16.014 4.395   1.00 120.73 ? 356  ARG A CD    1 
ATOM   2664 N  NE    . ARG A 1 356 ? -78.006  -16.792 5.488   1.00 110.29 ? 356  ARG A NE    1 
ATOM   2665 C  CZ    . ARG A 1 356 ? -77.808  -18.093 5.684   1.00 108.28 ? 356  ARG A CZ    1 
ATOM   2666 N  NH1   . ARG A 1 356 ? -77.035  -18.792 4.861   1.00 116.26 ? 356  ARG A NH1   1 
ATOM   2667 N  NH2   . ARG A 1 356 ? -78.388  -18.701 6.710   1.00 93.83  ? 356  ARG A NH2   1 
ATOM   2668 N  N     . MET A 1 357 ? -79.142  -10.530 3.912   1.00 95.73  ? 357  MET A N     1 
ATOM   2669 C  CA    . MET A 1 357 ? -79.299  -9.654  5.059   1.00 99.78  ? 357  MET A CA    1 
ATOM   2670 C  C     . MET A 1 357 ? -80.110  -10.500 6.036   1.00 102.64 ? 357  MET A C     1 
ATOM   2671 O  O     . MET A 1 357 ? -81.328  -10.638 5.886   1.00 103.95 ? 357  MET A O     1 
ATOM   2672 C  CB    . MET A 1 357 ? -80.049  -8.376  4.672   1.00 103.56 ? 357  MET A CB    1 
ATOM   2673 C  CG    . MET A 1 357 ? -80.091  -7.316  5.763   1.00 108.36 ? 357  MET A CG    1 
ATOM   2674 S  SD    . MET A 1 357 ? -81.177  -5.927  5.376   1.00 130.22 ? 357  MET A SD    1 
ATOM   2675 C  CE    . MET A 1 357 ? -80.221  -5.062  4.132   1.00 91.96  ? 357  MET A CE    1 
ATOM   2676 N  N     . ARG A 1 358 ? -79.422  -11.081 7.016   1.00 98.49  ? 358  ARG A N     1 
ATOM   2677 C  CA    . ARG A 1 358 ? -79.999  -12.105 7.897   1.00 104.82 ? 358  ARG A CA    1 
ATOM   2678 C  C     . ARG A 1 358 ? -81.056  -11.579 8.881   1.00 104.53 ? 358  ARG A C     1 
ATOM   2679 O  O     . ARG A 1 358 ? -80.995  -11.844 10.085  1.00 102.49 ? 358  ARG A O     1 
ATOM   2680 C  CB    . ARG A 1 358 ? -78.886  -12.871 8.633   1.00 105.79 ? 358  ARG A CB    1 
ATOM   2681 C  CG    . ARG A 1 358 ? -77.905  -11.999 9.410   1.00 91.10  ? 358  ARG A CG    1 
ATOM   2682 C  CD    . ARG A 1 358 ? -76.954  -12.833 10.257  1.00 88.53  ? 358  ARG A CD    1 
ATOM   2683 N  NE    . ARG A 1 358 ? -77.658  -13.650 11.247  1.00 102.73 ? 358  ARG A NE    1 
ATOM   2684 C  CZ    . ARG A 1 358 ? -77.975  -13.250 12.476  1.00 109.15 ? 358  ARG A CZ    1 
ATOM   2685 N  NH1   . ARG A 1 358 ? -77.657  -12.031 12.895  1.00 109.83 ? 358  ARG A NH1   1 
ATOM   2686 N  NH2   . ARG A 1 358 ? -78.616  -14.076 13.293  1.00 99.26  ? 358  ARG A NH2   1 
ATOM   2687 N  N     . GLY A 1 359 ? -82.034  -10.847 8.352   1.00 97.50  ? 359  GLY A N     1 
ATOM   2688 C  CA    . GLY A 1 359 ? -83.061  -10.203 9.169   1.00 95.21  ? 359  GLY A CA    1 
ATOM   2689 C  C     . GLY A 1 359 ? -82.546  -8.958  9.869   1.00 103.71 ? 359  GLY A C     1 
ATOM   2690 O  O     . GLY A 1 359 ? -83.285  -8.302  10.607  1.00 99.72  ? 359  GLY A O     1 
ATOM   2691 N  N     . ALA A 1 360 ? -81.276  -8.637  9.630   1.00 107.61 ? 360  ALA A N     1 
ATOM   2692 C  CA    . ALA A 1 360 ? -80.620  -7.486  10.244  1.00 96.89  ? 360  ALA A CA    1 
ATOM   2693 C  C     . ALA A 1 360 ? -80.766  -6.236  9.373   1.00 100.16 ? 360  ALA A C     1 
ATOM   2694 O  O     . ALA A 1 360 ? -81.779  -6.064  8.691   1.00 101.05 ? 360  ALA A O     1 
ATOM   2695 C  CB    . ALA A 1 360 ? -79.153  -7.799  10.514  1.00 83.89  ? 360  ALA A CB    1 
ATOM   2696 N  N     . HIS A 1 361 ? -79.757  -5.366  9.403   1.00 98.20  ? 361  HIS A N     1 
ATOM   2697 C  CA    . HIS A 1 361 ? -79.801  -4.102  8.669   1.00 102.08 ? 361  HIS A CA    1 
ATOM   2698 C  C     . HIS A 1 361 ? -78.553  -3.853  7.864   1.00 98.33  ? 361  HIS A C     1 
ATOM   2699 O  O     . HIS A 1 361 ? -78.635  -3.584  6.664   1.00 102.92 ? 361  HIS A O     1 
ATOM   2700 C  CB    . HIS A 1 361 ? -80.082  -2.939  9.620   1.00 100.45 ? 361  HIS A CB    1 
ATOM   2701 C  CG    . HIS A 1 361 ? -81.298  -3.147  10.495  1.00 106.46 ? 361  HIS A CG    1 
ATOM   2702 N  ND1   . HIS A 1 361 ? -82.554  -3.006  10.035  1.00 110.23 ? 361  HIS A ND1   1 
ATOM   2703 C  CD2   . HIS A 1 361 ? -81.409  -3.504  11.839  1.00 109.87 ? 361  HIS A CD2   1 
ATOM   2704 C  CE1   . HIS A 1 361 ? -83.427  -3.257  11.030  1.00 109.26 ? 361  HIS A CE1   1 
ATOM   2705 N  NE2   . HIS A 1 361 ? -82.725  -3.560  12.133  1.00 116.54 ? 361  HIS A NE2   1 
ATOM   2706 N  N     . THR A 1 362 ? -77.393  -3.946  8.519   1.00 90.26  ? 362  THR A N     1 
ATOM   2707 C  CA    . THR A 1 362 ? -76.069  -3.752  7.890   1.00 81.43  ? 362  THR A CA    1 
ATOM   2708 C  C     . THR A 1 362 ? -75.951  -2.467  7.048   1.00 81.25  ? 362  THR A C     1 
ATOM   2709 O  O     . THR A 1 362 ? -76.626  -1.475  7.327   1.00 93.28  ? 362  THR A O     1 
ATOM   2710 C  CB    . THR A 1 362 ? -75.616  -4.991  7.076   1.00 79.58  ? 362  THR A CB    1 
ATOM   2711 O  OG1   . THR A 1 362 ? -76.617  -5.333  6.111   1.00 100.78 ? 362  THR A OG1   1 
ATOM   2712 C  CG2   . THR A 1 362 ? -75.368  -6.183  7.994   1.00 70.99  ? 362  THR A CG2   1 
ATOM   2713 N  N     . ASN A 1 363 ? -75.086  -2.493  6.033   1.00 78.03  ? 363  ASN A N     1 
ATOM   2714 C  CA    . ASN A 1 363 ? -74.863  -1.335  5.163   1.00 86.62  ? 363  ASN A CA    1 
ATOM   2715 C  C     . ASN A 1 363 ? -74.769  -1.699  3.673   1.00 95.92  ? 363  ASN A C     1 
ATOM   2716 O  O     . ASN A 1 363 ? -75.445  -2.623  3.216   1.00 88.68  ? 363  ASN A O     1 
ATOM   2717 C  CB    . ASN A 1 363 ? -73.638  -0.532  5.633   1.00 74.62  ? 363  ASN A CB    1 
ATOM   2718 C  CG    . ASN A 1 363 ? -72.363  -1.354  5.657   1.00 86.99  ? 363  ASN A CG    1 
ATOM   2719 O  OD1   . ASN A 1 363 ? -71.829  -1.723  4.611   1.00 80.65  ? 363  ASN A OD1   1 
ATOM   2720 N  ND2   . ASN A 1 363 ? -71.859  -1.628  6.854   1.00 112.19 ? 363  ASN A ND2   1 
ATOM   2721 N  N     . ASP A 1 364 ? -73.943  -0.966  2.927   1.00 89.31  ? 364  ASP A N     1 
ATOM   2722 C  CA    . ASP A 1 364 ? -73.744  -1.212  1.497   1.00 74.09  ? 364  ASP A CA    1 
ATOM   2723 C  C     . ASP A 1 364 ? -72.360  -1.771  1.165   1.00 72.46  ? 364  ASP A C     1 
ATOM   2724 O  O     . ASP A 1 364 ? -72.238  -2.693  0.357   1.00 73.30  ? 364  ASP A O     1 
ATOM   2725 C  CB    . ASP A 1 364 ? -74.003  0.062   0.685   1.00 74.29  ? 364  ASP A CB    1 
ATOM   2726 C  CG    . ASP A 1 364 ? -75.421  0.141   0.146   1.00 84.59  ? 364  ASP A CG    1 
ATOM   2727 O  OD1   . ASP A 1 364 ? -76.006  -0.917  -0.174  1.00 79.15  ? 364  ASP A OD1   1 
ATOM   2728 O  OD2   . ASP A 1 364 ? -75.944  1.268   0.024   1.00 103.90 ? 364  ASP A OD2   1 
ATOM   2729 N  N     . VAL A 1 365 ? -71.327  -1.206  1.789   1.00 68.20  ? 365  VAL A N     1 
ATOM   2730 C  CA    . VAL A 1 365 ? -69.936  -1.575  1.503   1.00 60.82  ? 365  VAL A CA    1 
ATOM   2731 C  C     . VAL A 1 365 ? -69.570  -2.930  2.117   1.00 64.10  ? 365  VAL A C     1 
ATOM   2732 O  O     . VAL A 1 365 ? -69.002  -3.790  1.438   1.00 66.46  ? 365  VAL A O     1 
ATOM   2733 C  CB    . VAL A 1 365 ? -68.941  -0.487  1.977   1.00 54.56  ? 365  VAL A CB    1 
ATOM   2734 C  CG1   . VAL A 1 365 ? -67.542  -0.767  1.446   1.00 56.94  ? 365  VAL A CG1   1 
ATOM   2735 C  CG2   . VAL A 1 365 ? -69.399  0.896   1.533   1.00 53.78  ? 365  VAL A CG2   1 
ATOM   2736 N  N     . LYS A 1 366 ? -69.899  -3.108  3.396   1.00 67.81  ? 366  LYS A N     1 
ATOM   2737 C  CA    . LYS A 1 366 ? -69.644  -4.357  4.117   1.00 65.71  ? 366  LYS A CA    1 
ATOM   2738 C  C     . LYS A 1 366 ? -70.496  -5.505  3.570   1.00 63.47  ? 366  LYS A C     1 
ATOM   2739 O  O     . LYS A 1 366 ? -70.028  -6.642  3.479   1.00 62.39  ? 366  LYS A O     1 
ATOM   2740 C  CB    . LYS A 1 366 ? -69.896  -4.165  5.618   1.00 71.51  ? 366  LYS A CB    1 
ATOM   2741 C  CG    . LYS A 1 366 ? -69.525  -5.352  6.494   1.00 78.38  ? 366  LYS A CG    1 
ATOM   2742 C  CD    . LYS A 1 366 ? -69.960  -5.123  7.933   1.00 72.22  ? 366  LYS A CD    1 
ATOM   2743 C  CE    . LYS A 1 366 ? -69.783  -6.377  8.772   1.00 72.69  ? 366  LYS A CE    1 
ATOM   2744 N  NZ    . LYS A 1 366 ? -70.208  -6.165  10.183  1.00 71.01  ? 366  LYS A NZ    1 
ATOM   2745 N  N     . GLN A 1 367 ? -71.740  -5.193  3.206   1.00 59.10  ? 367  GLN A N     1 
ATOM   2746 C  CA    . GLN A 1 367 ? -72.664  -6.173  2.630   1.00 63.09  ? 367  GLN A CA    1 
ATOM   2747 C  C     . GLN A 1 367 ? -72.198  -6.644  1.249   1.00 65.36  ? 367  GLN A C     1 
ATOM   2748 O  O     . GLN A 1 367 ? -72.437  -7.792  0.865   1.00 61.11  ? 367  GLN A O     1 
ATOM   2749 C  CB    . GLN A 1 367 ? -74.083  -5.596  2.566   1.00 56.33  ? 367  GLN A CB    1 
ATOM   2750 C  CG    . GLN A 1 367 ? -75.174  -6.615  2.271   1.00 66.27  ? 367  GLN A CG    1 
ATOM   2751 C  CD    . GLN A 1 367 ? -76.559  -6.109  2.627   1.00 77.57  ? 367  GLN A CD    1 
ATOM   2752 O  OE1   . GLN A 1 367 ? -77.007  -6.245  3.764   1.00 94.54  ? 367  GLN A OE1   1 
ATOM   2753 N  NE2   . GLN A 1 367 ? -77.250  -5.533  1.651   1.00 70.86  ? 367  GLN A NE2   1 
ATOM   2754 N  N     . LEU A 1 368 ? -71.533  -5.752  0.514   1.00 64.51  ? 368  LEU A N     1 
ATOM   2755 C  CA    . LEU A 1 368 ? -70.900  -6.098  -0.759  1.00 60.03  ? 368  LEU A CA    1 
ATOM   2756 C  C     . LEU A 1 368 ? -69.704  -7.018  -0.521  1.00 58.39  ? 368  LEU A C     1 
ATOM   2757 O  O     . LEU A 1 368 ? -69.478  -7.960  -1.281  1.00 54.42  ? 368  LEU A O     1 
ATOM   2758 C  CB    . LEU A 1 368 ? -70.463  -4.830  -1.507  1.00 57.63  ? 368  LEU A CB    1 
ATOM   2759 C  CG    . LEU A 1 368 ? -69.988  -4.926  -2.965  1.00 59.45  ? 368  LEU A CG    1 
ATOM   2760 C  CD1   . LEU A 1 368 ? -70.267  -3.628  -3.704  1.00 61.90  ? 368  LEU A CD1   1 
ATOM   2761 C  CD2   . LEU A 1 368 ? -68.512  -5.285  -3.071  1.00 47.77  ? 368  LEU A CD2   1 
ATOM   2762 N  N     . THR A 1 369 ? -68.947  -6.735  0.538   1.00 59.77  ? 369  THR A N     1 
ATOM   2763 C  CA    . THR A 1 369 ? -67.775  -7.529  0.910   1.00 55.79  ? 369  THR A CA    1 
ATOM   2764 C  C     . THR A 1 369 ? -68.184  -8.915  1.416   1.00 58.73  ? 369  THR A C     1 
ATOM   2765 O  O     . THR A 1 369 ? -67.462  -9.895  1.212   1.00 56.93  ? 369  THR A O     1 
ATOM   2766 C  CB    . THR A 1 369 ? -66.920  -6.804  1.972   1.00 57.35  ? 369  THR A CB    1 
ATOM   2767 O  OG1   . THR A 1 369 ? -66.818  -5.414  1.640   1.00 52.83  ? 369  THR A OG1   1 
ATOM   2768 C  CG2   . THR A 1 369 ? -65.517  -7.402  2.048   1.00 48.95  ? 369  THR A CG2   1 
ATOM   2769 N  N     . GLU A 1 370 ? -69.344  -8.986  2.068   1.00 58.99  ? 370  GLU A N     1 
ATOM   2770 C  CA    . GLU A 1 370 ? -69.922  -10.258 2.506   1.00 61.92  ? 370  GLU A CA    1 
ATOM   2771 C  C     . GLU A 1 370 ? -70.392  -11.098 1.317   1.00 60.57  ? 370  GLU A C     1 
ATOM   2772 O  O     . GLU A 1 370 ? -70.415  -12.329 1.391   1.00 67.21  ? 370  GLU A O     1 
ATOM   2773 C  CB    . GLU A 1 370 ? -71.080  -10.023 3.480   1.00 70.67  ? 370  GLU A CB    1 
ATOM   2774 C  CG    . GLU A 1 370 ? -70.650  -9.611  4.882   1.00 73.11  ? 370  GLU A CG    1 
ATOM   2775 C  CD    . GLU A 1 370 ? -71.820  -9.378  5.823   1.00 81.15  ? 370  GLU A CD    1 
ATOM   2776 O  OE1   . GLU A 1 370 ? -72.907  -8.973  5.354   1.00 79.45  ? 370  GLU A OE1   1 
ATOM   2777 O  OE2   . GLU A 1 370 ? -71.650  -9.593  7.041   1.00 82.69  ? 370  GLU A OE2   1 
ATOM   2778 N  N     . ALA A 1 371 ? -70.766  -10.422 0.231   1.00 60.17  ? 371  ALA A N     1 
ATOM   2779 C  CA    . ALA A 1 371 ? -71.124  -11.082 -1.024  1.00 57.04  ? 371  ALA A CA    1 
ATOM   2780 C  C     . ALA A 1 371 ? -69.884  -11.652 -1.707  1.00 54.84  ? 371  ALA A C     1 
ATOM   2781 O  O     . ALA A 1 371 ? -69.902  -12.786 -2.189  1.00 58.46  ? 371  ALA A O     1 
ATOM   2782 C  CB    . ALA A 1 371 ? -71.841  -10.112 -1.951  1.00 56.18  ? 371  ALA A CB    1 
ATOM   2783 N  N     . VAL A 1 372 ? -68.815  -10.856 -1.735  1.00 53.02  ? 372  VAL A N     1 
ATOM   2784 C  CA    . VAL A 1 372 ? -67.532  -11.251 -2.324  1.00 51.17  ? 372  VAL A CA    1 
ATOM   2785 C  C     . VAL A 1 372 ? -66.950  -12.476 -1.614  1.00 55.68  ? 372  VAL A C     1 
ATOM   2786 O  O     . VAL A 1 372 ? -66.444  -13.396 -2.263  1.00 56.61  ? 372  VAL A O     1 
ATOM   2787 C  CB    . VAL A 1 372 ? -66.518  -10.078 -2.301  1.00 45.33  ? 372  VAL A CB    1 
ATOM   2788 C  CG1   . VAL A 1 372 ? -65.129  -10.530 -2.735  1.00 42.50  ? 372  VAL A CG1   1 
ATOM   2789 C  CG2   . VAL A 1 372 ? -66.997  -8.939  -3.188  1.00 55.05  ? 372  VAL A CG2   1 
ATOM   2790 N  N     . GLN A 1 373 ? -67.048  -12.486 -0.285  1.00 58.17  ? 373  GLN A N     1 
ATOM   2791 C  CA    . GLN A 1 373 ? -66.501  -13.561 0.543   1.00 63.42  ? 373  GLN A CA    1 
ATOM   2792 C  C     . GLN A 1 373 ? -67.194  -14.908 0.317   1.00 60.48  ? 373  GLN A C     1 
ATOM   2793 O  O     . GLN A 1 373 ? -66.559  -15.961 0.423   1.00 57.46  ? 373  GLN A O     1 
ATOM   2794 C  CB    . GLN A 1 373 ? -66.556  -13.172 2.025   1.00 69.56  ? 373  GLN A CB    1 
ATOM   2795 C  CG    . GLN A 1 373 ? -65.618  -13.966 2.928   1.00 77.33  ? 373  GLN A CG    1 
ATOM   2796 C  CD    . GLN A 1 373 ? -64.155  -13.839 2.534   1.00 90.82  ? 373  GLN A CD    1 
ATOM   2797 O  OE1   . GLN A 1 373 ? -63.456  -14.841 2.385   1.00 92.38  ? 373  GLN A OE1   1 
ATOM   2798 N  NE2   . GLN A 1 373 ? -63.687  -12.607 2.362   1.00 79.82  ? 373  GLN A NE2   1 
ATOM   2799 N  N     . LYS A 1 374 ? -68.489  -14.868 0.006   1.00 56.23  ? 374  LYS A N     1 
ATOM   2800 C  CA    . LYS A 1 374 ? -69.261  -16.082 -0.264  1.00 54.50  ? 374  LYS A CA    1 
ATOM   2801 C  C     . LYS A 1 374 ? -68.875  -16.710 -1.605  1.00 61.08  ? 374  LYS A C     1 
ATOM   2802 O  O     . LYS A 1 374 ? -68.789  -17.934 -1.718  1.00 65.27  ? 374  LYS A O     1 
ATOM   2803 C  CB    . LYS A 1 374 ? -70.766  -15.794 -0.216  1.00 56.73  ? 374  LYS A CB    1 
ATOM   2804 C  CG    . LYS A 1 374 ? -71.635  -17.039 -0.116  1.00 81.84  ? 374  LYS A CG    1 
ATOM   2805 C  CD    . LYS A 1 374 ? -73.113  -16.689 -0.099  1.00 91.27  ? 374  LYS A CD    1 
ATOM   2806 C  CE    . LYS A 1 374 ? -73.976  -17.937 -0.002  1.00 94.81  ? 374  LYS A CE    1 
ATOM   2807 N  NZ    . LYS A 1 374 ? -75.428  -17.609 0.015   1.00 89.77  ? 374  LYS A NZ    1 
ATOM   2808 N  N     . ILE A 1 375 ? -68.643  -15.865 -2.610  1.00 60.96  ? 375  ILE A N     1 
ATOM   2809 C  CA    . ILE A 1 375 ? -68.243  -16.316 -3.947  1.00 57.03  ? 375  ILE A CA    1 
ATOM   2810 C  C     . ILE A 1 375 ? -66.798  -16.821 -3.947  1.00 55.66  ? 375  ILE A C     1 
ATOM   2811 O  O     . ILE A 1 375 ? -66.471  -17.784 -4.648  1.00 58.62  ? 375  ILE A O     1 
ATOM   2812 C  CB    . ILE A 1 375 ? -68.416  -15.201 -5.005  1.00 56.17  ? 375  ILE A CB    1 
ATOM   2813 C  CG1   . ILE A 1 375 ? -69.838  -14.634 -4.958  1.00 51.82  ? 375  ILE A CG1   1 
ATOM   2814 C  CG2   . ILE A 1 375 ? -68.108  -15.724 -6.404  1.00 59.59  ? 375  ILE A CG2   1 
ATOM   2815 C  CD1   . ILE A 1 375 ? -69.955  -13.228 -5.503  1.00 52.07  ? 375  ILE A CD1   1 
ATOM   2816 N  N     . THR A 1 376 ? -65.945  -16.169 -3.158  1.00 44.45  ? 376  THR A N     1 
ATOM   2817 C  CA    . THR A 1 376 ? -64.545  -16.572 -3.004  1.00 51.88  ? 376  THR A CA    1 
ATOM   2818 C  C     . THR A 1 376 ? -64.452  -17.999 -2.458  1.00 53.04  ? 376  THR A C     1 
ATOM   2819 O  O     . THR A 1 376 ? -63.671  -18.809 -2.958  1.00 58.98  ? 376  THR A O     1 
ATOM   2820 C  CB    . THR A 1 376 ? -63.767  -15.598 -2.089  1.00 44.47  ? 376  THR A CB    1 
ATOM   2821 O  OG1   . THR A 1 376 ? -63.980  -14.251 -2.528  1.00 56.04  ? 376  THR A OG1   1 
ATOM   2822 C  CG2   . THR A 1 376 ? -62.271  -15.897 -2.116  1.00 58.96  ? 376  THR A CG2   1 
ATOM   2823 N  N     . THR A 1 377 ? -65.264  -18.296 -1.443  1.00 54.78  ? 377  THR A N     1 
ATOM   2824 C  CA    . THR A 1 377 ? -65.338  -19.633 -0.853  1.00 54.15  ? 377  THR A CA    1 
ATOM   2825 C  C     . THR A 1 377 ? -65.998  -20.622 -1.820  1.00 60.31  ? 377  THR A C     1 
ATOM   2826 O  O     . THR A 1 377 ? -65.624  -21.795 -1.868  1.00 64.12  ? 377  THR A O     1 
ATOM   2827 C  CB    . THR A 1 377 ? -66.110  -19.618 0.485   1.00 56.37  ? 377  THR A CB    1 
ATOM   2828 O  OG1   . THR A 1 377 ? -65.739  -18.461 1.244   1.00 60.92  ? 377  THR A OG1   1 
ATOM   2829 C  CG2   . THR A 1 377 ? -65.809  -20.871 1.304   1.00 58.40  ? 377  THR A CG2   1 
ATOM   2830 N  N     . GLU A 1 378 ? -66.972  -20.131 -2.586  1.00 62.90  ? 378  GLU A N     1 
ATOM   2831 C  CA    . GLU A 1 378 ? -67.682  -20.930 -3.587  1.00 62.10  ? 378  GLU A CA    1 
ATOM   2832 C  C     . GLU A 1 378 ? -66.754  -21.368 -4.723  1.00 59.60  ? 378  GLU A C     1 
ATOM   2833 O  O     . GLU A 1 378 ? -66.870  -22.486 -5.231  1.00 61.83  ? 378  GLU A O     1 
ATOM   2834 C  CB    . GLU A 1 378 ? -68.871  -20.139 -4.144  1.00 63.14  ? 378  GLU A CB    1 
ATOM   2835 C  CG    . GLU A 1 378 ? -69.834  -20.943 -5.005  1.00 65.72  ? 378  GLU A CG    1 
ATOM   2836 C  CD    . GLU A 1 378 ? -70.944  -20.092 -5.594  1.00 72.81  ? 378  GLU A CD    1 
ATOM   2837 O  OE1   . GLU A 1 378 ? -71.749  -19.535 -4.817  1.00 79.79  ? 378  GLU A OE1   1 
ATOM   2838 O  OE2   . GLU A 1 378 ? -71.007  -19.975 -6.835  1.00 72.26  ? 378  GLU A OE2   1 
ATOM   2839 N  N     . SER A 1 379 ? -65.836  -20.483 -5.108  1.00 55.82  ? 379  SER A N     1 
ATOM   2840 C  CA    . SER A 1 379 ? -64.886  -20.752 -6.188  1.00 59.00  ? 379  SER A CA    1 
ATOM   2841 C  C     . SER A 1 379 ? -63.808  -21.764 -5.793  1.00 58.50  ? 379  SER A C     1 
ATOM   2842 O  O     . SER A 1 379 ? -63.281  -22.479 -6.648  1.00 64.57  ? 379  SER A O     1 
ATOM   2843 C  CB    . SER A 1 379 ? -64.238  -19.451 -6.666  1.00 57.36  ? 379  SER A CB    1 
ATOM   2844 O  OG    . SER A 1 379 ? -65.209  -18.562 -7.190  1.00 61.98  ? 379  SER A OG    1 
ATOM   2845 N  N     . ILE A 1 380 ? -63.486  -21.811 -4.500  1.00 52.38  ? 380  ILE A N     1 
ATOM   2846 C  CA    . ILE A 1 380 ? -62.522  -22.774 -3.961  1.00 52.91  ? 380  ILE A CA    1 
ATOM   2847 C  C     . ILE A 1 380 ? -63.082  -24.197 -4.040  1.00 59.38  ? 380  ILE A C     1 
ATOM   2848 O  O     . ILE A 1 380 ? -62.359  -25.140 -4.374  1.00 58.56  ? 380  ILE A O     1 
ATOM   2849 C  CB    . ILE A 1 380 ? -62.117  -22.427 -2.502  1.00 51.22  ? 380  ILE A CB    1 
ATOM   2850 C  CG1   . ILE A 1 380 ? -61.497  -21.021 -2.409  1.00 59.74  ? 380  ILE A CG1   1 
ATOM   2851 C  CG2   . ILE A 1 380 ? -61.180  -23.478 -1.914  1.00 56.37  ? 380  ILE A CG2   1 
ATOM   2852 C  CD1   . ILE A 1 380 ? -60.309  -20.764 -3.318  1.00 57.97  ? 380  ILE A CD1   1 
ATOM   2853 N  N     . VAL A 1 381 ? -64.374  -24.336 -3.743  1.00 58.32  ? 381  VAL A N     1 
ATOM   2854 C  CA    . VAL A 1 381 ? -65.063  -25.626 -3.801  1.00 57.03  ? 381  VAL A CA    1 
ATOM   2855 C  C     . VAL A 1 381 ? -65.218  -26.101 -5.247  1.00 57.95  ? 381  VAL A C     1 
ATOM   2856 O  O     . VAL A 1 381 ? -64.894  -27.247 -5.567  1.00 62.91  ? 381  VAL A O     1 
ATOM   2857 C  CB    . VAL A 1 381 ? -66.453  -25.568 -3.117  1.00 55.30  ? 381  VAL A CB    1 
ATOM   2858 C  CG1   . VAL A 1 381 ? -67.123  -26.936 -3.125  1.00 64.20  ? 381  VAL A CG1   1 
ATOM   2859 C  CG2   . VAL A 1 381 ? -66.336  -25.054 -1.690  1.00 60.81  ? 381  VAL A CG2   1 
ATOM   2860 N  N     . ILE A 1 382 ? -65.695  -25.210 -6.115  1.00 55.40  ? 382  ILE A N     1 
ATOM   2861 C  CA    . ILE A 1 382 ? -66.040  -25.566 -7.493  1.00 51.69  ? 382  ILE A CA    1 
ATOM   2862 C  C     . ILE A 1 382 ? -64.822  -25.647 -8.423  1.00 52.57  ? 382  ILE A C     1 
ATOM   2863 O  O     . ILE A 1 382 ? -64.570  -26.690 -9.030  1.00 56.96  ? 382  ILE A O     1 
ATOM   2864 C  CB    . ILE A 1 382 ? -67.125  -24.622 -8.074  1.00 49.02  ? 382  ILE A CB    1 
ATOM   2865 C  CG1   . ILE A 1 382 ? -68.409  -24.709 -7.240  1.00 48.68  ? 382  ILE A CG1   1 
ATOM   2866 C  CG2   . ILE A 1 382 ? -67.421  -24.966 -9.528  1.00 53.78  ? 382  ILE A CG2   1 
ATOM   2867 C  CD1   . ILE A 1 382 ? -69.437  -23.640 -7.552  1.00 57.64  ? 382  ILE A CD1   1 
ATOM   2868 N  N     . TRP A 1 383 ? -64.072  -24.552 -8.527  1.00 53.14  ? 383  TRP A N     1 
ATOM   2869 C  CA    . TRP A 1 383 ? -62.980  -24.456 -9.501  1.00 50.73  ? 383  TRP A CA    1 
ATOM   2870 C  C     . TRP A 1 383 ? -61.608  -24.656 -8.916  1.00 56.97  ? 383  TRP A C     1 
ATOM   2871 O  O     . TRP A 1 383 ? -60.700  -25.129 -9.604  1.00 73.21  ? 383  TRP A O     1 
ATOM   2872 C  CB    . TRP A 1 383 ? -63.060  -23.139 -10.267 1.00 51.28  ? 383  TRP A CB    1 
ATOM   2873 C  CG    . TRP A 1 383 ? -64.355  -22.978 -11.030 1.00 49.37  ? 383  TRP A CG    1 
ATOM   2874 C  CD1   . TRP A 1 383 ? -64.769  -23.683 -12.158 1.00 54.66  ? 383  TRP A CD1   1 
ATOM   2875 C  CD2   . TRP A 1 383 ? -65.457  -22.049 -10.740 1.00 53.42  ? 383  TRP A CD2   1 
ATOM   2876 N  NE1   . TRP A 1 383 ? -66.008  -23.265 -12.573 1.00 52.77  ? 383  TRP A NE1   1 
ATOM   2877 C  CE2   . TRP A 1 383 ? -66.478  -22.289 -11.769 1.00 50.73  ? 383  TRP A CE2   1 
ATOM   2878 C  CE3   . TRP A 1 383 ? -65.692  -21.079 -9.771  1.00 51.07  ? 383  TRP A CE3   1 
ATOM   2879 C  CZ2   . TRP A 1 383 ? -67.669  -21.578 -11.803 1.00 57.27  ? 383  TRP A CZ2   1 
ATOM   2880 C  CZ3   . TRP A 1 383 ? -66.898  -20.369 -9.817  1.00 54.98  ? 383  TRP A CZ3   1 
ATOM   2881 C  CH2   . TRP A 1 383 ? -67.861  -20.614 -10.810 1.00 56.09  ? 383  TRP A CH2   1 
ATOM   2882 N  N     . GLY A 1 384 ? -61.444  -24.297 -7.645  1.00 52.84  ? 384  GLY A N     1 
ATOM   2883 C  CA    . GLY A 1 384 ? -60.183  -24.506 -6.935  1.00 58.89  ? 384  GLY A CA    1 
ATOM   2884 C  C     . GLY A 1 384 ? -59.223  -23.331 -6.970  1.00 56.23  ? 384  GLY A C     1 
ATOM   2885 O  O     . GLY A 1 384 ? -58.056  -23.471 -6.598  1.00 55.26  ? 384  GLY A O     1 
ATOM   2886 N  N     . LYS A 1 385 ? -59.707  -22.176 -7.422  1.00 58.72  ? 385  LYS A N     1 
ATOM   2887 C  CA    . LYS A 1 385 ? -58.909  -20.947 -7.430  1.00 62.24  ? 385  LYS A CA    1 
ATOM   2888 C  C     . LYS A 1 385 ? -59.775  -19.697 -7.257  1.00 64.80  ? 385  LYS A C     1 
ATOM   2889 O  O     . LYS A 1 385 ? -60.964  -19.701 -7.588  1.00 63.24  ? 385  LYS A O     1 
ATOM   2890 C  CB    . LYS A 1 385 ? -58.042  -20.847 -8.696  1.00 66.61  ? 385  LYS A CB    1 
ATOM   2891 C  CG    . LYS A 1 385 ? -58.807  -20.678 -10.001 1.00 64.18  ? 385  LYS A CG    1 
ATOM   2892 C  CD    . LYS A 1 385 ? -57.857  -20.395 -11.154 1.00 76.97  ? 385  LYS A CD    1 
ATOM   2893 C  CE    . LYS A 1 385 ? -58.613  -20.000 -12.411 1.00 72.07  ? 385  LYS A CE    1 
ATOM   2894 N  NZ    . LYS A 1 385 ? -57.691  -19.711 -13.544 1.00 67.15  ? 385  LYS A NZ    1 
ATOM   2895 N  N     . THR A 1 386 ? -59.164  -18.635 -6.737  1.00 68.47  ? 386  THR A N     1 
ATOM   2896 C  CA    . THR A 1 386 ? -59.863  -17.377 -6.475  1.00 68.06  ? 386  THR A CA    1 
ATOM   2897 C  C     . THR A 1 386 ? -60.078  -16.562 -7.754  1.00 70.75  ? 386  THR A C     1 
ATOM   2898 O  O     . THR A 1 386 ? -59.152  -16.414 -8.556  1.00 75.84  ? 386  THR A O     1 
ATOM   2899 C  CB    . THR A 1 386 ? -59.120  -16.517 -5.432  1.00 69.96  ? 386  THR A CB    1 
ATOM   2900 O  OG1   . THR A 1 386 ? -57.748  -16.367 -5.817  1.00 82.74  ? 386  THR A OG1   1 
ATOM   2901 C  CG2   . THR A 1 386 ? -59.191  -17.167 -4.058  1.00 70.91  ? 386  THR A CG2   1 
ATOM   2902 N  N     . PRO A 1 387 ? -61.303  -16.035 -7.946  1.00 59.33  ? 387  PRO A N     1 
ATOM   2903 C  CA    . PRO A 1 387 ? -61.630  -15.260 -9.141  1.00 60.73  ? 387  PRO A CA    1 
ATOM   2904 C  C     . PRO A 1 387 ? -61.289  -13.775 -9.016  1.00 57.53  ? 387  PRO A C     1 
ATOM   2905 O  O     . PRO A 1 387 ? -61.212  -13.243 -7.906  1.00 55.62  ? 387  PRO A O     1 
ATOM   2906 C  CB    . PRO A 1 387 ? -63.144  -15.443 -9.263  1.00 58.67  ? 387  PRO A CB    1 
ATOM   2907 C  CG    . PRO A 1 387 ? -63.616  -15.630 -7.860  1.00 57.28  ? 387  PRO A CG    1 
ATOM   2908 C  CD    . PRO A 1 387 ? -62.472  -16.191 -7.057  1.00 55.36  ? 387  PRO A CD    1 
ATOM   2909 N  N     . LYS A 1 388 ? -61.083  -13.124 -10.159 1.00 65.45  ? 388  LYS A N     1 
ATOM   2910 C  CA    . LYS A 1 388 ? -60.876  -11.679 -10.209 1.00 63.27  ? 388  LYS A CA    1 
ATOM   2911 C  C     . LYS A 1 388 ? -62.228  -10.974 -10.217 1.00 59.20  ? 388  LYS A C     1 
ATOM   2912 O  O     . LYS A 1 388 ? -63.088  -11.272 -11.048 1.00 58.44  ? 388  LYS A O     1 
ATOM   2913 C  CB    . LYS A 1 388 ? -60.062  -11.287 -11.446 1.00 70.51  ? 388  LYS A CB    1 
ATOM   2914 C  CG    . LYS A 1 388 ? -58.609  -11.736 -11.411 1.00 76.88  ? 388  LYS A CG    1 
ATOM   2915 C  CD    . LYS A 1 388 ? -57.873  -11.316 -12.672 1.00 79.06  ? 388  LYS A CD    1 
ATOM   2916 C  CE    . LYS A 1 388 ? -56.422  -11.768 -12.642 1.00 83.18  ? 388  LYS A CE    1 
ATOM   2917 N  NZ    . LYS A 1 388 ? -55.689  -11.363 -13.873 1.00 89.11  ? 388  LYS A NZ    1 
ATOM   2918 N  N     . PHE A 1 389 ? -62.409  -10.041 -9.286  1.00 61.90  ? 389  PHE A N     1 
ATOM   2919 C  CA    . PHE A 1 389 ? -63.690  -9.361  -9.116  1.00 60.52  ? 389  PHE A CA    1 
ATOM   2920 C  C     . PHE A 1 389 ? -63.752  -8.019  -9.841  1.00 66.80  ? 389  PHE A C     1 
ATOM   2921 O  O     . PHE A 1 389 ? -62.742  -7.328  -9.982  1.00 69.81  ? 389  PHE A O     1 
ATOM   2922 C  CB    . PHE A 1 389 ? -64.007  -9.178  -7.627  1.00 53.45  ? 389  PHE A CB    1 
ATOM   2923 C  CG    . PHE A 1 389 ? -64.250  -10.469 -6.893  1.00 46.41  ? 389  PHE A CG    1 
ATOM   2924 C  CD1   . PHE A 1 389 ? -65.519  -11.040 -6.864  1.00 45.03  ? 389  PHE A CD1   1 
ATOM   2925 C  CD2   . PHE A 1 389 ? -63.210  -11.116 -6.232  1.00 58.83  ? 389  PHE A CD2   1 
ATOM   2926 C  CE1   . PHE A 1 389 ? -65.746  -12.231 -6.190  1.00 41.00  ? 389  PHE A CE1   1 
ATOM   2927 C  CE2   . PHE A 1 389 ? -63.431  -12.307 -5.557  1.00 43.24  ? 389  PHE A CE2   1 
ATOM   2928 C  CZ    . PHE A 1 389 ? -64.700  -12.866 -5.536  1.00 45.53  ? 389  PHE A CZ    1 
ATOM   2929 N  N     . LYS A 1 390 ? -64.948  -7.673  -10.311 1.00 67.57  ? 390  LYS A N     1 
ATOM   2930 C  CA    . LYS A 1 390 ? -65.212  -6.366  -10.905 1.00 71.76  ? 390  LYS A CA    1 
ATOM   2931 C  C     . LYS A 1 390 ? -66.408  -5.731  -10.199 1.00 73.41  ? 390  LYS A C     1 
ATOM   2932 O  O     . LYS A 1 390 ? -67.565  -5.989  -10.543 1.00 71.98  ? 390  LYS A O     1 
ATOM   2933 C  CB    . LYS A 1 390 ? -65.442  -6.485  -12.415 1.00 82.07  ? 390  LYS A CB    1 
ATOM   2934 C  CG    . LYS A 1 390 ? -64.162  -6.645  -13.221 1.00 88.18  ? 390  LYS A CG    1 
ATOM   2935 C  CD    . LYS A 1 390 ? -64.439  -6.668  -14.716 1.00 93.71  ? 390  LYS A CD    1 
ATOM   2936 C  CE    . LYS A 1 390 ? -63.154  -6.591  -15.527 1.00 89.69  ? 390  LYS A CE    1 
ATOM   2937 N  NZ    . LYS A 1 390 ? -62.318  -7.818  -15.405 1.00 74.12  ? 390  LYS A NZ    1 
ATOM   2938 N  N     . LEU A 1 391 ? -66.106  -4.902  -9.203  1.00 78.49  ? 391  LEU A N     1 
ATOM   2939 C  CA    . LEU A 1 391 ? -67.109  -4.380  -8.275  1.00 71.12  ? 391  LEU A CA    1 
ATOM   2940 C  C     . LEU A 1 391 ? -67.654  -3.011  -8.692  1.00 70.62  ? 391  LEU A C     1 
ATOM   2941 O  O     . LEU A 1 391 ? -66.943  -2.230  -9.330  1.00 79.26  ? 391  LEU A O     1 
ATOM   2942 C  CB    . LEU A 1 391 ? -66.527  -4.307  -6.855  1.00 68.68  ? 391  LEU A CB    1 
ATOM   2943 C  CG    . LEU A 1 391 ? -65.782  -5.523  -6.282  1.00 62.99  ? 391  LEU A CG    1 
ATOM   2944 C  CD1   . LEU A 1 391 ? -65.228  -5.212  -4.900  1.00 72.99  ? 391  LEU A CD1   1 
ATOM   2945 C  CD2   . LEU A 1 391 ? -66.664  -6.762  -6.232  1.00 57.90  ? 391  LEU A CD2   1 
ATOM   2946 N  N     . PRO A 1 392 ? -68.922  -2.715  -8.331  1.00 64.11  ? 392  PRO A N     1 
ATOM   2947 C  CA    . PRO A 1 392 ? -69.518  -1.407  -8.609  1.00 70.31  ? 392  PRO A CA    1 
ATOM   2948 C  C     . PRO A 1 392 ? -69.175  -0.364  -7.538  1.00 66.46  ? 392  PRO A C     1 
ATOM   2949 O  O     . PRO A 1 392 ? -70.034  0.429   -7.140  1.00 70.64  ? 392  PRO A O     1 
ATOM   2950 C  CB    . PRO A 1 392 ? -71.017  -1.710  -8.614  1.00 72.18  ? 392  PRO A CB    1 
ATOM   2951 C  CG    . PRO A 1 392 ? -71.169  -2.842  -7.658  1.00 68.55  ? 392  PRO A CG    1 
ATOM   2952 C  CD    . PRO A 1 392 ? -69.894  -3.640  -7.713  1.00 67.30  ? 392  PRO A CD    1 
ATOM   2953 N  N     . ILE A 1 393 ? -67.921  -0.370  -7.090  1.00 66.60  ? 393  ILE A N     1 
ATOM   2954 C  CA    . ILE A 1 393 ? -67.443  0.554   -6.061  1.00 74.08  ? 393  ILE A CA    1 
ATOM   2955 C  C     . ILE A 1 393 ? -66.047  1.082   -6.412  1.00 76.50  ? 393  ILE A C     1 
ATOM   2956 O  O     . ILE A 1 393 ? -65.199  0.340   -6.913  1.00 77.56  ? 393  ILE A O     1 
ATOM   2957 C  CB    . ILE A 1 393 ? -67.475  -0.096  -4.647  1.00 78.34  ? 393  ILE A CB    1 
ATOM   2958 C  CG1   . ILE A 1 393 ? -67.156  0.925   -3.546  1.00 80.37  ? 393  ILE A CG1   1 
ATOM   2959 C  CG2   . ILE A 1 393 ? -66.552  -1.308  -4.556  1.00 70.63  ? 393  ILE A CG2   1 
ATOM   2960 C  CD1   . ILE A 1 393 ? -68.341  1.761   -3.112  1.00 78.38  ? 393  ILE A CD1   1 
ATOM   2961 N  N     . GLN A 1 394 ? -65.829  2.371   -6.160  1.00 70.48  ? 394  GLN A N     1 
ATOM   2962 C  CA    . GLN A 1 394 ? -64.545  3.014   -6.433  1.00 77.08  ? 394  GLN A CA    1 
ATOM   2963 C  C     . GLN A 1 394 ? -63.517  2.681   -5.353  1.00 72.74  ? 394  GLN A C     1 
ATOM   2964 O  O     . GLN A 1 394 ? -63.879  2.340   -4.224  1.00 81.34  ? 394  GLN A O     1 
ATOM   2965 C  CB    . GLN A 1 394 ? -64.716  4.533   -6.550  1.00 86.35  ? 394  GLN A CB    1 
ATOM   2966 C  CG    . GLN A 1 394 ? -65.643  4.977   -7.674  1.00 87.26  ? 394  GLN A CG    1 
ATOM   2967 C  CD    . GLN A 1 394 ? -65.674  6.482   -7.858  1.00 97.74  ? 394  GLN A CD    1 
ATOM   2968 O  OE1   . GLN A 1 394 ? -64.632  7.133   -7.946  1.00 116.54 ? 394  GLN A OE1   1 
ATOM   2969 N  NE2   . GLN A 1 394 ? -66.876  7.044   -7.929  1.00 91.36  ? 394  GLN A NE2   1 
ATOM   2970 N  N     . LYS A 1 395 ? -62.237  2.783   -5.710  1.00 71.41  ? 395  LYS A N     1 
ATOM   2971 C  CA    . LYS A 1 395 ? -61.138  2.531   -4.774  1.00 77.67  ? 395  LYS A CA    1 
ATOM   2972 C  C     . LYS A 1 395 ? -61.007  3.636   -3.724  1.00 83.98  ? 395  LYS A C     1 
ATOM   2973 O  O     . LYS A 1 395 ? -60.414  3.426   -2.664  1.00 81.90  ? 395  LYS A O     1 
ATOM   2974 C  CB    . LYS A 1 395 ? -59.813  2.350   -5.525  1.00 75.51  ? 395  LYS A CB    1 
ATOM   2975 C  CG    . LYS A 1 395 ? -59.701  1.036   -6.283  1.00 86.32  ? 395  LYS A CG    1 
ATOM   2976 C  CD    . LYS A 1 395 ? -58.292  0.809   -6.805  1.00 92.10  ? 395  LYS A CD    1 
ATOM   2977 C  CE    . LYS A 1 395 ? -58.166  -0.553  -7.471  1.00 94.31  ? 395  LYS A CE    1 
ATOM   2978 N  NZ    . LYS A 1 395 ? -56.786  -0.802  -7.970  1.00 100.56 ? 395  LYS A NZ    1 
ATOM   2979 N  N     . GLU A 1 396 ? -61.565  4.806   -4.031  1.00 90.88  ? 396  GLU A N     1 
ATOM   2980 C  CA    . GLU A 1 396 ? -61.591  5.939   -3.107  1.00 95.23  ? 396  GLU A CA    1 
ATOM   2981 C  C     . GLU A 1 396 ? -62.513  5.666   -1.919  1.00 83.35  ? 396  GLU A C     1 
ATOM   2982 O  O     . GLU A 1 396 ? -62.187  6.008   -0.782  1.00 86.69  ? 396  GLU A O     1 
ATOM   2983 C  CB    . GLU A 1 396 ? -62.036  7.214   -3.831  1.00 105.94 ? 396  GLU A CB    1 
ATOM   2984 C  CG    . GLU A 1 396 ? -61.071  7.706   -4.901  1.00 117.39 ? 396  GLU A CG    1 
ATOM   2985 C  CD    . GLU A 1 396 ? -61.624  8.864   -5.715  1.00 113.15 ? 396  GLU A CD    1 
ATOM   2986 O  OE1   . GLU A 1 396 ? -62.359  9.706   -5.153  1.00 106.35 ? 396  GLU A OE1   1 
ATOM   2987 O  OE2   . GLU A 1 396 ? -61.316  8.938   -6.923  1.00 116.28 ? 396  GLU A OE2   1 
ATOM   2988 N  N     . THR A 1 397 ? -63.658  5.045   -2.197  1.00 78.59  ? 397  THR A N     1 
ATOM   2989 C  CA    . THR A 1 397 ? -64.657  4.733   -1.175  1.00 76.69  ? 397  THR A CA    1 
ATOM   2990 C  C     . THR A 1 397 ? -64.254  3.510   -0.345  1.00 78.98  ? 397  THR A C     1 
ATOM   2991 O  O     . THR A 1 397 ? -64.472  3.479   0.869   1.00 80.25  ? 397  THR A O     1 
ATOM   2992 C  CB    . THR A 1 397 ? -66.049  4.504   -1.806  1.00 60.23  ? 397  THR A CB    1 
ATOM   2993 O  OG1   . THR A 1 397 ? -66.325  5.539   -2.758  1.00 63.35  ? 397  THR A OG1   1 
ATOM   2994 C  CG2   . THR A 1 397 ? -67.138  4.502   -0.741  1.00 58.95  ? 397  THR A CG2   1 
ATOM   2995 N  N     . TRP A 1 398 ? -63.666  2.516   -1.009  1.00 79.49  ? 398  TRP A N     1 
ATOM   2996 C  CA    . TRP A 1 398 ? -63.230  1.272   -0.367  1.00 74.89  ? 398  TRP A CA    1 
ATOM   2997 C  C     . TRP A 1 398 ? -62.173  1.506   0.679   1.00 74.45  ? 398  TRP A C     1 
ATOM   2998 O  O     . TRP A 1 398 ? -62.197  0.882   1.742   1.00 80.03  ? 398  TRP A O     1 
ATOM   2999 C  CB    . TRP A 1 398 ? -62.729  0.283   -1.418  1.00 78.36  ? 398  TRP A CB    1 
ATOM   3000 C  CG    . TRP A 1 398 ? -62.305  -1.062  -0.867  1.00 74.88  ? 398  TRP A CG    1 
ATOM   3001 C  CD1   . TRP A 1 398 ? -61.061  -1.413  -0.346  1.00 72.36  ? 398  TRP A CD1   1 
ATOM   3002 C  CD2   . TRP A 1 398 ? -63.111  -2.290  -0.780  1.00 62.90  ? 398  TRP A CD2   1 
ATOM   3003 N  NE1   . TRP A 1 398 ? -61.046  -2.726  0.051   1.00 63.14  ? 398  TRP A NE1   1 
ATOM   3004 C  CE2   . TRP A 1 398 ? -62.240  -3.310  -0.180  1.00 60.74  ? 398  TRP A CE2   1 
ATOM   3005 C  CE3   . TRP A 1 398 ? -64.416  -2.633  -1.121  1.00 58.25  ? 398  TRP A CE3   1 
ATOM   3006 C  CZ2   . TRP A 1 398 ? -62.680  -4.606  0.056   1.00 57.41  ? 398  TRP A CZ2   1 
ATOM   3007 C  CZ3   . TRP A 1 398 ? -64.847  -3.944  -0.877  1.00 56.85  ? 398  TRP A CZ3   1 
ATOM   3008 C  CH2   . TRP A 1 398 ? -63.998  -4.904  -0.303  1.00 55.91  ? 398  TRP A CH2   1 
ATOM   3009 N  N     . GLU A 1 399 ? -61.238  2.408   0.384   1.00 80.16  ? 399  GLU A N     1 
ATOM   3010 C  CA    . GLU A 1 399 ? -60.149  2.738   1.304   1.00 82.50  ? 399  GLU A CA    1 
ATOM   3011 C  C     . GLU A 1 399 ? -60.619  3.571   2.496   1.00 79.55  ? 399  GLU A C     1 
ATOM   3012 O  O     . GLU A 1 399 ? -60.090  3.431   3.598   1.00 73.69  ? 399  GLU A O     1 
ATOM   3013 C  CB    . GLU A 1 399 ? -59.018  3.465   0.567   1.00 92.07  ? 399  GLU A CB    1 
ATOM   3014 C  CG    . GLU A 1 399 ? -58.149  2.566   -0.305  1.00 98.50  ? 399  GLU A CG    1 
ATOM   3015 C  CD    . GLU A 1 399 ? -57.270  1.618   0.494   1.00 108.44 ? 399  GLU A CD    1 
ATOM   3016 O  OE1   . GLU A 1 399 ? -56.746  2.025   1.555   1.00 102.07 ? 399  GLU A OE1   1 
ATOM   3017 O  OE2   . GLU A 1 399 ? -57.094  0.462   0.055   1.00 113.53 ? 399  GLU A OE2   1 
ATOM   3018 N  N     . THR A 1 400 ? -61.610  4.430   2.266   1.00 78.45  ? 400  THR A N     1 
ATOM   3019 C  CA    . THR A 1 400 ? -62.146  5.309   3.308   1.00 85.67  ? 400  THR A CA    1 
ATOM   3020 C  C     . THR A 1 400 ? -62.931  4.527   4.366   1.00 80.50  ? 400  THR A C     1 
ATOM   3021 O  O     . THR A 1 400 ? -62.874  4.852   5.554   1.00 83.09  ? 400  THR A O     1 
ATOM   3022 C  CB    . THR A 1 400 ? -63.032  6.425   2.707   1.00 88.13  ? 400  THR A CB    1 
ATOM   3023 O  OG1   . THR A 1 400 ? -62.377  7.002   1.571   1.00 94.87  ? 400  THR A OG1   1 
ATOM   3024 C  CG2   . THR A 1 400 ? -63.299  7.521   3.729   1.00 90.45  ? 400  THR A CG2   1 
ATOM   3025 N  N     . TRP A 1 401 ? -63.649  3.495   3.926   1.00 77.92  ? 401  TRP A N     1 
ATOM   3026 C  CA    . TRP A 1 401 ? -64.475  2.677   4.816   1.00 70.87  ? 401  TRP A CA    1 
ATOM   3027 C  C     . TRP A 1 401 ? -63.672  1.738   5.675   1.00 73.91  ? 401  TRP A C     1 
ATOM   3028 O  O     . TRP A 1 401 ? -63.890  1.665   6.885   1.00 86.06  ? 401  TRP A O     1 
ATOM   3029 C  CB    . TRP A 1 401 ? -65.527  1.907   4.015   1.00 64.45  ? 401  TRP A CB    1 
ATOM   3030 C  CG    . TRP A 1 401 ? -66.240  0.831   4.804   1.00 64.20  ? 401  TRP A CG    1 
ATOM   3031 C  CD1   . TRP A 1 401 ? -66.041  -0.546  4.734   1.00 69.67  ? 401  TRP A CD1   1 
ATOM   3032 C  CD2   . TRP A 1 401 ? -67.291  1.010   5.819   1.00 73.19  ? 401  TRP A CD2   1 
ATOM   3033 N  NE1   . TRP A 1 401 ? -66.871  -1.209  5.602   1.00 72.10  ? 401  TRP A NE1   1 
ATOM   3034 C  CE2   . TRP A 1 401 ? -67.645  -0.338  6.284   1.00 76.06  ? 401  TRP A CE2   1 
ATOM   3035 C  CE3   . TRP A 1 401 ? -67.949  2.107   6.366   1.00 81.11  ? 401  TRP A CE3   1 
ATOM   3036 C  CZ2   . TRP A 1 401 ? -68.617  -0.551  7.252   1.00 77.09  ? 401  TRP A CZ2   1 
ATOM   3037 C  CZ3   . TRP A 1 401 ? -68.928  1.878   7.343   1.00 83.90  ? 401  TRP A CZ3   1 
ATOM   3038 C  CH2   . TRP A 1 401 ? -69.251  0.581   7.773   1.00 75.14  ? 401  TRP A CH2   1 
ATOM   3039 N  N     . TRP A 1 402 ? -62.734  1.017   5.063   1.00 66.52  ? 402  TRP A N     1 
ATOM   3040 C  CA    . TRP A 1 402 ? -61.999  -0.046  5.756   1.00 64.31  ? 402  TRP A CA    1 
ATOM   3041 C  C     . TRP A 1 402 ? -60.872  0.418   6.643   1.00 70.36  ? 402  TRP A C     1 
ATOM   3042 O  O     . TRP A 1 402 ? -60.313  -0.374  7.406   1.00 77.85  ? 402  TRP A O     1 
ATOM   3043 C  CB    . TRP A 1 402 ? -61.520  -1.106  4.765   1.00 56.39  ? 402  TRP A CB    1 
ATOM   3044 C  CG    . TRP A 1 402 ? -62.647  -1.948  4.214   1.00 59.19  ? 402  TRP A CG    1 
ATOM   3045 C  CD1   . TRP A 1 402 ? -63.120  -1.986  2.904   1.00 66.94  ? 402  TRP A CD1   1 
ATOM   3046 C  CD2   . TRP A 1 402 ? -63.499  -2.896  4.951   1.00 62.30  ? 402  TRP A CD2   1 
ATOM   3047 N  NE1   . TRP A 1 402 ? -64.164  -2.868  2.784   1.00 64.61  ? 402  TRP A NE1   1 
ATOM   3048 C  CE2   . TRP A 1 402 ? -64.443  -3.447  3.971   1.00 62.25  ? 402  TRP A CE2   1 
ATOM   3049 C  CE3   . TRP A 1 402 ? -63.568  -3.329  6.273   1.00 68.74  ? 402  TRP A CE3   1 
ATOM   3050 C  CZ2   . TRP A 1 402 ? -65.404  -4.385  4.323   1.00 67.81  ? 402  TRP A CZ2   1 
ATOM   3051 C  CZ3   . TRP A 1 402 ? -64.542  -4.277  6.614   1.00 66.57  ? 402  TRP A CZ3   1 
ATOM   3052 C  CH2   . TRP A 1 402 ? -65.436  -4.791  5.661   1.00 66.76  ? 402  TRP A CH2   1 
ATOM   3053 N  N     . THR A 1 403 ? -60.532  1.703   6.558   1.00 69.20  ? 403  THR A N     1 
ATOM   3054 C  CA    . THR A 1 403 ? -59.537  2.300   7.451   1.00 73.48  ? 403  THR A CA    1 
ATOM   3055 C  C     . THR A 1 403 ? -60.166  2.774   8.761   1.00 75.99  ? 403  THR A C     1 
ATOM   3056 O  O     . THR A 1 403 ? -59.529  2.719   9.816   1.00 79.10  ? 403  THR A O     1 
ATOM   3057 C  CB    . THR A 1 403 ? -58.782  3.475   6.792   1.00 71.87  ? 403  THR A CB    1 
ATOM   3058 O  OG1   . THR A 1 403 ? -59.708  4.316   6.092   1.00 77.76  ? 403  THR A OG1   1 
ATOM   3059 C  CG2   . THR A 1 403 ? -57.725  2.961   5.822   1.00 59.26  ? 403  THR A CG2   1 
ATOM   3060 N  N     . GLU A 1 404 ? -61.413  3.236   8.686   1.00 72.81  ? 404  GLU A N     1 
ATOM   3061 C  CA    . GLU A 1 404 ? -62.142  3.711   9.865   1.00 86.54  ? 404  GLU A CA    1 
ATOM   3062 C  C     . GLU A 1 404 ? -62.909  2.592   10.575  1.00 85.49  ? 404  GLU A C     1 
ATOM   3063 O  O     . GLU A 1 404 ? -63.330  2.752   11.723  1.00 86.54  ? 404  GLU A O     1 
ATOM   3064 C  CB    . GLU A 1 404 ? -63.086  4.868   9.500   1.00 100.11 ? 404  GLU A CB    1 
ATOM   3065 C  CG    . GLU A 1 404 ? -64.265  4.488   8.612   1.00 91.98  ? 404  GLU A CG    1 
ATOM   3066 C  CD    . GLU A 1 404 ? -65.231  5.636   8.377   1.00 93.00  ? 404  GLU A CD    1 
ATOM   3067 O  OE1   . GLU A 1 404 ? -64.772  6.770   8.117   1.00 101.44 ? 404  GLU A OE1   1 
ATOM   3068 O  OE2   . GLU A 1 404 ? -66.456  5.404   8.452   1.00 81.94  ? 404  GLU A OE2   1 
ATOM   3069 N  N     . TYR A 1 405 ? -63.081  1.464   9.887   1.00 78.84  ? 405  TYR A N     1 
ATOM   3070 C  CA    . TYR A 1 405 ? -63.825  0.327   10.425  1.00 74.58  ? 405  TYR A CA    1 
ATOM   3071 C  C     . TYR A 1 405 ? -62.920  -0.623  11.207  1.00 67.69  ? 405  TYR A C     1 
ATOM   3072 O  O     . TYR A 1 405 ? -61.756  -0.824  10.851  1.00 70.64  ? 405  TYR A O     1 
ATOM   3073 C  CB    . TYR A 1 405 ? -64.551  -0.421  9.302   1.00 70.68  ? 405  TYR A CB    1 
ATOM   3074 C  CG    . TYR A 1 405 ? -65.763  -1.210  9.752   1.00 69.44  ? 405  TYR A CG    1 
ATOM   3075 C  CD1   . TYR A 1 405 ? -66.852  -0.574  10.354  1.00 78.84  ? 405  TYR A CD1   1 
ATOM   3076 C  CD2   . TYR A 1 405 ? -65.832  -2.588  9.559   1.00 61.09  ? 405  TYR A CD2   1 
ATOM   3077 C  CE1   . TYR A 1 405 ? -67.965  -1.292  10.762  1.00 72.59  ? 405  TYR A CE1   1 
ATOM   3078 C  CE2   . TYR A 1 405 ? -66.944  -3.314  9.962   1.00 66.81  ? 405  TYR A CE2   1 
ATOM   3079 C  CZ    . TYR A 1 405 ? -68.005  -2.662  10.563  1.00 71.81  ? 405  TYR A CZ    1 
ATOM   3080 O  OH    . TYR A 1 405 ? -69.108  -3.380  10.965  1.00 78.07  ? 405  TYR A OH    1 
ATOM   3081 N  N     . TRP A 1 406 ? -63.473  -1.203  12.270  1.00 64.47  ? 406  TRP A N     1 
ATOM   3082 C  CA    . TRP A 1 406 ? -62.725  -2.071  13.181  1.00 60.72  ? 406  TRP A CA    1 
ATOM   3083 C  C     . TRP A 1 406 ? -62.448  -3.441  12.622  1.00 62.25  ? 406  TRP A C     1 
ATOM   3084 O  O     . TRP A 1 406 ? -61.411  -4.037  12.922  1.00 60.67  ? 406  TRP A O     1 
ATOM   3085 C  CB    . TRP A 1 406 ? -63.452  -2.189  14.521  1.00 63.12  ? 406  TRP A CB    1 
ATOM   3086 C  CG    . TRP A 1 406 ? -64.867  -2.708  14.401  1.00 59.96  ? 406  TRP A CG    1 
ATOM   3087 C  CD1   . TRP A 1 406 ? -66.030  -1.967  14.205  1.00 62.22  ? 406  TRP A CD1   1 
ATOM   3088 C  CD2   . TRP A 1 406 ? -65.315  -4.108  14.459  1.00 57.81  ? 406  TRP A CD2   1 
ATOM   3089 N  NE1   . TRP A 1 406 ? -67.130  -2.785  14.142  1.00 59.53  ? 406  TRP A NE1   1 
ATOM   3090 C  CE2   . TRP A 1 406 ? -66.774  -4.079  14.286  1.00 57.88  ? 406  TRP A CE2   1 
ATOM   3091 C  CE3   . TRP A 1 406 ? -64.681  -5.335  14.631  1.00 60.06  ? 406  TRP A CE3   1 
ATOM   3092 C  CZ2   . TRP A 1 406 ? -67.538  -5.238  14.289  1.00 59.58  ? 406  TRP A CZ2   1 
ATOM   3093 C  CZ3   . TRP A 1 406 ? -65.464  -6.497  14.631  1.00 63.77  ? 406  TRP A CZ3   1 
ATOM   3094 C  CH2   . TRP A 1 406 ? -66.857  -6.447  14.463  1.00 62.90  ? 406  TRP A CH2   1 
ATOM   3095 N  N     . GLN A 1 407 ? -63.369  -3.952  11.806  1.00 65.98  ? 407  GLN A N     1 
ATOM   3096 C  CA    . GLN A 1 407 ? -63.265  -5.312  11.280  1.00 55.59  ? 407  GLN A CA    1 
ATOM   3097 C  C     . GLN A 1 407 ? -62.295  -5.401  10.105  1.00 55.35  ? 407  GLN A C     1 
ATOM   3098 O  O     . GLN A 1 407 ? -62.329  -4.574  9.190   1.00 62.79  ? 407  GLN A O     1 
ATOM   3099 C  CB    . GLN A 1 407 ? -64.644  -5.847  10.883  1.00 55.52  ? 407  GLN A CB    1 
ATOM   3100 C  CG    . GLN A 1 407 ? -64.739  -7.366  10.838  1.00 56.88  ? 407  GLN A CG    1 
ATOM   3101 C  CD    . GLN A 1 407 ? -66.130  -7.859  10.487  1.00 65.71  ? 407  GLN A CD    1 
ATOM   3102 O  OE1   . GLN A 1 407 ? -66.685  -7.507  9.445   1.00 63.98  ? 407  GLN A OE1   1 
ATOM   3103 N  NE2   . GLN A 1 407 ? -66.698  -8.690  11.354  1.00 58.72  ? 407  GLN A NE2   1 
ATOM   3104 N  N     . ALA A 1 408 ? -61.434  -6.415  10.147  1.00 51.77  ? 408  ALA A N     1 
ATOM   3105 C  CA    . ALA A 1 408 ? -60.425  -6.635  9.116   1.00 52.48  ? 408  ALA A CA    1 
ATOM   3106 C  C     . ALA A 1 408 ? -60.950  -7.518  7.989   1.00 55.39  ? 408  ALA A C     1 
ATOM   3107 O  O     . ALA A 1 408 ? -61.750  -8.427  8.222   1.00 58.20  ? 408  ALA A O     1 
ATOM   3108 C  CB    . ALA A 1 408 ? -59.174  -7.246  9.729   1.00 50.85  ? 408  ALA A CB    1 
ATOM   3109 N  N     . THR A 1 409 ? -60.496  -7.235  6.770   1.00 57.90  ? 409  THR A N     1 
ATOM   3110 C  CA    . THR A 1 409 ? -60.836  -8.029  5.586   1.00 59.71  ? 409  THR A CA    1 
ATOM   3111 C  C     . THR A 1 409 ? -59.778  -7.851  4.495   1.00 60.26  ? 409  THR A C     1 
ATOM   3112 O  O     . THR A 1 409 ? -58.973  -6.916  4.550   1.00 60.96  ? 409  THR A O     1 
ATOM   3113 C  CB    . THR A 1 409 ? -62.238  -7.679  5.030   1.00 59.81  ? 409  THR A CB    1 
ATOM   3114 O  OG1   . THR A 1 409 ? -62.614  -8.635  4.031   1.00 64.77  ? 409  THR A OG1   1 
ATOM   3115 C  CG2   . THR A 1 409 ? -62.260  -6.278  4.423   1.00 49.72  ? 409  THR A CG2   1 
ATOM   3116 N  N     . TRP A 1 410 ? -59.781  -8.750  3.511   1.00 61.40  ? 410  TRP A N     1 
ATOM   3117 C  CA    . TRP A 1 410 ? -58.849  -8.663  2.388   1.00 71.96  ? 410  TRP A CA    1 
ATOM   3118 C  C     . TRP A 1 410 ? -59.403  -9.235  1.114   1.00 73.99  ? 410  TRP A C     1 
ATOM   3119 O  O     . TRP A 1 410 ? -59.781  -10.409 1.057   1.00 70.86  ? 410  TRP A O     1 
ATOM   3120 C  CB    . TRP A 1 410 ? -57.511  -9.318  2.736   1.00 71.37  ? 410  TRP A CB    1 
ATOM   3121 C  CG    . TRP A 1 410 ? -56.463  -9.196  1.652   1.00 81.51  ? 410  TRP A CG    1 
ATOM   3122 C  CD1   . TRP A 1 410 ? -56.060  -8.042  0.982   1.00 87.97  ? 410  TRP A CD1   1 
ATOM   3123 C  CD2   . TRP A 1 410 ? -55.634  -10.272 1.086   1.00 87.36  ? 410  TRP A CD2   1 
ATOM   3124 N  NE1   . TRP A 1 410 ? -55.079  -8.324  0.065   1.00 94.80  ? 410  TRP A NE1   1 
ATOM   3125 C  CE2   . TRP A 1 410 ? -54.775  -9.639  0.076   1.00 100.53 ? 410  TRP A CE2   1 
ATOM   3126 C  CE3   . TRP A 1 410 ? -55.523  -11.642 1.303   1.00 85.72  ? 410  TRP A CE3   1 
ATOM   3127 C  CZ2   . TRP A 1 410 ? -53.856  -10.366 -0.668  1.00 106.06 ? 410  TRP A CZ2   1 
ATOM   3128 C  CZ3   . TRP A 1 410 ? -54.592  -12.364 0.545   1.00 91.99  ? 410  TRP A CZ3   1 
ATOM   3129 C  CH2   . TRP A 1 410 ? -53.780  -11.739 -0.416  1.00 102.40 ? 410  TRP A CH2   1 
ATOM   3130 N  N     . VAL A 1 411 ? -59.478  -8.460  0.083   1.00 79.87  ? 411  VAL A N     1 
ATOM   3131 C  CA    . VAL A 1 411 ? -59.817  -8.889  -1.271  1.00 81.75  ? 411  VAL A CA    1 
ATOM   3132 C  C     . VAL A 1 411 ? -58.589  -8.638  -2.151  1.00 94.06  ? 411  VAL A C     1 
ATOM   3133 O  O     . VAL A 1 411 ? -58.264  -7.485  -2.449  1.00 100.14 ? 411  VAL A O     1 
ATOM   3134 C  CB    . VAL A 1 411 ? -61.037  -8.141  -1.838  1.00 68.47  ? 411  VAL A CB    1 
ATOM   3135 C  CG1   . VAL A 1 411 ? -61.249  -8.499  -3.301  1.00 73.61  ? 411  VAL A CG1   1 
ATOM   3136 C  CG2   . VAL A 1 411 ? -62.281  -8.453  -1.020  1.00 50.91  ? 411  VAL A CG2   1 
ATOM   3137 N  N     . PRO A 1 412 ? -57.876  -9.655  -2.552  1.00 96.10  ? 412  PRO A N     1 
ATOM   3138 C  CA    . PRO A 1 412 ? -56.601  -9.573  -3.275  1.00 99.18  ? 412  PRO A CA    1 
ATOM   3139 C  C     . PRO A 1 412 ? -56.698  -8.880  -4.635  1.00 95.19  ? 412  PRO A C     1 
ATOM   3140 O  O     . PRO A 1 412 ? -55.935  -7.949  -4.904  1.00 99.92  ? 412  PRO A O     1 
ATOM   3141 C  CB    . PRO A 1 412 ? -56.198  -11.044 -3.453  1.00 100.76 ? 412  PRO A CB    1 
ATOM   3142 C  CG    . PRO A 1 412 ? -56.953  -11.779 -2.400  1.00 93.81  ? 412  PRO A CG    1 
ATOM   3143 C  CD    . PRO A 1 412 ? -58.260  -11.055 -2.295  1.00 88.84  ? 412  PRO A CD    1 
ATOM   3144 N  N     . GLU A 1 413 ? -57.627  -9.331  -5.476  1.00 86.79  ? 413  GLU A N     1 
ATOM   3145 C  CA    . GLU A 1 413 ? -57.765  -8.802  -6.833  1.00 83.50  ? 413  GLU A CA    1 
ATOM   3146 C  C     . GLU A 1 413 ? -59.190  -8.339  -7.128  1.00 76.83  ? 413  GLU A C     1 
ATOM   3147 O  O     . GLU A 1 413 ? -60.119  -9.152  -7.180  1.00 75.48  ? 413  GLU A O     1 
ATOM   3148 C  CB    . GLU A 1 413 ? -57.321  -9.845  -7.867  1.00 83.14  ? 413  GLU A CB    1 
ATOM   3149 C  CG    . GLU A 1 413 ? -55.825  -10.126 -7.880  1.00 90.63  ? 413  GLU A CG    1 
ATOM   3150 C  CD    . GLU A 1 413 ? -55.439  -11.242 -8.835  1.00 107.85 ? 413  GLU A CD    1 
ATOM   3151 O  OE1   . GLU A 1 413 ? -56.095  -12.307 -8.818  1.00 106.41 ? 413  GLU A OE1   1 
ATOM   3152 O  OE2   . GLU A 1 413 ? -54.469  -11.058 -9.600  1.00 107.59 ? 413  GLU A OE2   1 
ATOM   3153 N  N     . TRP A 1 414 ? -59.352  -7.030  -7.313  1.00 70.82  ? 414  TRP A N     1 
ATOM   3154 C  CA    . TRP A 1 414 ? -60.642  -6.446  -7.691  1.00 71.43  ? 414  TRP A CA    1 
ATOM   3155 C  C     . TRP A 1 414 ? -60.487  -5.174  -8.481  1.00 78.51  ? 414  TRP A C     1 
ATOM   3156 O  O     . TRP A 1 414 ? -59.550  -4.402  -8.260  1.00 79.27  ? 414  TRP A O     1 
ATOM   3157 C  CB    . TRP A 1 414 ? -61.531  -6.227  -6.466  1.00 73.67  ? 414  TRP A CB    1 
ATOM   3158 C  CG    . TRP A 1 414 ? -61.098  -5.094  -5.565  1.00 86.18  ? 414  TRP A CG    1 
ATOM   3159 C  CD1   . TRP A 1 414 ? -60.082  -5.102  -4.613  1.00 88.31  ? 414  TRP A CD1   1 
ATOM   3160 C  CD2   . TRP A 1 414 ? -61.672  -3.742  -5.497  1.00 80.84  ? 414  TRP A CD2   1 
ATOM   3161 N  NE1   . TRP A 1 414 ? -59.988  -3.886  -3.985  1.00 81.70  ? 414  TRP A NE1   1 
ATOM   3162 C  CE2   . TRP A 1 414 ? -60.911  -3.025  -4.466  1.00 80.52  ? 414  TRP A CE2   1 
ATOM   3163 C  CE3   . TRP A 1 414 ? -62.697  -3.077  -6.163  1.00 76.75  ? 414  TRP A CE3   1 
ATOM   3164 C  CZ2   . TRP A 1 414 ? -61.183  -1.705  -4.136  1.00 80.52  ? 414  TRP A CZ2   1 
ATOM   3165 C  CZ3   . TRP A 1 414 ? -62.963  -1.747  -5.819  1.00 79.44  ? 414  TRP A CZ3   1 
ATOM   3166 C  CH2   . TRP A 1 414 ? -62.224  -1.079  -4.829  1.00 82.54  ? 414  TRP A CH2   1 
ATOM   3167 N  N     . GLU A 1 415 ? -61.411  -4.953  -9.414  1.00 81.24  ? 415  GLU A N     1 
ATOM   3168 C  CA    . GLU A 1 415 ? -61.390  -3.777  -10.285 1.00 75.10  ? 415  GLU A CA    1 
ATOM   3169 C  C     . GLU A 1 415 ? -62.703  -2.994  -10.219 1.00 75.95  ? 415  GLU A C     1 
ATOM   3170 O  O     . GLU A 1 415 ? -63.702  -3.483  -9.686  1.00 80.75  ? 415  GLU A O     1 
ATOM   3171 C  CB    . GLU A 1 415 ? -61.090  -4.191  -11.729 1.00 76.59  ? 415  GLU A CB    1 
ATOM   3172 N  N     . PHE A 1 416 ? -62.690  -1.779  -10.765 1.00 73.89  ? 416  PHE A N     1 
ATOM   3173 C  CA    . PHE A 1 416 ? -63.859  -0.899  -10.753 1.00 77.86  ? 416  PHE A CA    1 
ATOM   3174 C  C     . PHE A 1 416 ? -64.620  -0.916  -12.080 1.00 82.91  ? 416  PHE A C     1 
ATOM   3175 O  O     . PHE A 1 416 ? -64.026  -0.765  -13.150 1.00 93.22  ? 416  PHE A O     1 
ATOM   3176 C  CB    . PHE A 1 416 ? -63.450  0.534   -10.378 1.00 83.91  ? 416  PHE A CB    1 
ATOM   3177 C  CG    . PHE A 1 416 ? -64.507  1.570   -10.663 1.00 87.68  ? 416  PHE A CG    1 
ATOM   3178 C  CD1   . PHE A 1 416 ? -65.678  1.621   -9.911  1.00 88.68  ? 416  PHE A CD1   1 
ATOM   3179 C  CD2   . PHE A 1 416 ? -64.325  2.502   -11.680 1.00 88.53  ? 416  PHE A CD2   1 
ATOM   3180 C  CE1   . PHE A 1 416 ? -66.650  2.574   -10.176 1.00 83.48  ? 416  PHE A CE1   1 
ATOM   3181 C  CE2   . PHE A 1 416 ? -65.293  3.459   -11.947 1.00 91.32  ? 416  PHE A CE2   1 
ATOM   3182 C  CZ    . PHE A 1 416 ? -66.457  3.495   -11.193 1.00 89.09  ? 416  PHE A CZ    1 
ATOM   3183 N  N     . VAL A 1 417 ? -65.936  -1.104  -11.988 1.00 73.68  ? 417  VAL A N     1 
ATOM   3184 C  CA    . VAL A 1 417 ? -66.831  -1.068  -13.147 1.00 74.61  ? 417  VAL A CA    1 
ATOM   3185 C  C     . VAL A 1 417 ? -68.048  -0.195  -12.832 1.00 76.55  ? 417  VAL A C     1 
ATOM   3186 O  O     . VAL A 1 417 ? -68.724  -0.397  -11.820 1.00 81.20  ? 417  VAL A O     1 
ATOM   3187 C  CB    . VAL A 1 417 ? -67.277  -2.489  -13.578 1.00 65.79  ? 417  VAL A CB    1 
ATOM   3188 C  CG1   . VAL A 1 417 ? -68.431  -2.432  -14.572 1.00 64.52  ? 417  VAL A CG1   1 
ATOM   3189 C  CG2   . VAL A 1 417 ? -66.111  -3.261  -14.178 1.00 71.22  ? 417  VAL A CG2   1 
ATOM   3190 N  N     . ASN A 1 418 ? -68.311  0.777   -13.704 1.00 81.56  ? 418  ASN A N     1 
ATOM   3191 C  CA    . ASN A 1 418 ? -69.445  1.686   -13.545 1.00 85.65  ? 418  ASN A CA    1 
ATOM   3192 C  C     . ASN A 1 418 ? -70.759  1.053   -14.004 1.00 82.24  ? 418  ASN A C     1 
ATOM   3193 O  O     . ASN A 1 418 ? -70.965  0.812   -15.196 1.00 82.31  ? 418  ASN A O     1 
ATOM   3194 C  CB    . ASN A 1 418 ? -69.183  3.005   -14.287 1.00 76.71  ? 418  ASN A CB    1 
ATOM   3195 C  CG    . ASN A 1 418 ? -70.234  4.067   -14.000 1.00 81.49  ? 418  ASN A CG    1 
ATOM   3196 O  OD1   . ASN A 1 418 ? -70.974  3.988   -13.018 1.00 85.47  ? 418  ASN A OD1   1 
ATOM   3197 N  ND2   . ASN A 1 418 ? -70.298  5.076   -14.861 1.00 96.08  ? 418  ASN A ND2   1 
ATOM   3198 N  N     . THR A 1 419 ? -71.636  0.781   -13.040 1.00 83.24  ? 419  THR A N     1 
ATOM   3199 C  CA    . THR A 1 419 ? -72.963  0.227   -13.310 1.00 87.73  ? 419  THR A CA    1 
ATOM   3200 C  C     . THR A 1 419 ? -74.041  1.246   -12.933 1.00 94.69  ? 419  THR A C     1 
ATOM   3201 O  O     . THR A 1 419 ? -73.822  2.063   -12.035 1.00 88.25  ? 419  THR A O     1 
ATOM   3202 C  CB    . THR A 1 419 ? -73.203  -1.086  -12.532 1.00 88.14  ? 419  THR A CB    1 
ATOM   3203 O  OG1   . THR A 1 419 ? -72.996  -0.863  -11.131 1.00 91.54  ? 419  THR A OG1   1 
ATOM   3204 C  CG2   . THR A 1 419 ? -72.264  -2.186  -13.016 1.00 79.98  ? 419  THR A CG2   1 
ATOM   3205 N  N     . PRO A 1 420 ? -75.204  1.211   -13.621 1.00 113.23 ? 420  PRO A N     1 
ATOM   3206 C  CA    . PRO A 1 420 ? -76.318  2.117   -13.309 1.00 113.14 ? 420  PRO A CA    1 
ATOM   3207 C  C     . PRO A 1 420 ? -76.675  2.233   -11.813 1.00 107.90 ? 420  PRO A C     1 
ATOM   3208 O  O     . PRO A 1 420 ? -76.899  3.351   -11.341 1.00 110.35 ? 420  PRO A O     1 
ATOM   3209 C  CB    . PRO A 1 420 ? -77.480  1.533   -14.118 1.00 115.62 ? 420  PRO A CB    1 
ATOM   3210 C  CG    . PRO A 1 420 ? -76.817  0.917   -15.300 1.00 114.71 ? 420  PRO A CG    1 
ATOM   3211 C  CD    . PRO A 1 420 ? -75.481  0.407   -14.829 1.00 112.35 ? 420  PRO A CD    1 
ATOM   3212 N  N     . PRO A 1 421 ? -76.732  1.104   -11.069 1.00 98.74  ? 421  PRO A N     1 
ATOM   3213 C  CA    . PRO A 1 421 ? -76.905  1.266   -9.631  1.00 93.42  ? 421  PRO A CA    1 
ATOM   3214 C  C     . PRO A 1 421 ? -75.574  1.171   -8.878  1.00 88.31  ? 421  PRO A C     1 
ATOM   3215 O  O     . PRO A 1 421 ? -75.210  0.100   -8.382  1.00 85.00  ? 421  PRO A O     1 
ATOM   3216 C  CB    . PRO A 1 421 ? -77.837  0.104   -9.258  1.00 86.07  ? 421  PRO A CB    1 
ATOM   3217 C  CG    . PRO A 1 421 ? -77.756  -0.874  -10.395 1.00 94.71  ? 421  PRO A CG    1 
ATOM   3218 C  CD    . PRO A 1 421 ? -76.847  -0.314  -11.452 1.00 88.50  ? 421  PRO A CD    1 
ATOM   3219 N  N     . LEU A 1 422 ? -74.858  2.292   -8.808  1.00 89.80  ? 422  LEU A N     1 
ATOM   3220 C  CA    . LEU A 1 422 ? -73.580  2.364   -8.097  1.00 81.23  ? 422  LEU A CA    1 
ATOM   3221 C  C     . LEU A 1 422 ? -73.763  2.319   -6.585  1.00 77.94  ? 422  LEU A C     1 
ATOM   3222 O  O     . LEU A 1 422 ? -74.777  2.783   -6.057  1.00 90.85  ? 422  LEU A O     1 
ATOM   3223 C  CB    . LEU A 1 422 ? -72.815  3.637   -8.475  1.00 79.53  ? 422  LEU A CB    1 
ATOM   3224 C  CG    . LEU A 1 422 ? -71.973  3.685   -9.753  1.00 86.23  ? 422  LEU A CG    1 
ATOM   3225 C  CD1   . LEU A 1 422 ? -71.461  5.100   -9.971  1.00 83.31  ? 422  LEU A CD1   1 
ATOM   3226 C  CD2   . LEU A 1 422 ? -70.813  2.699   -9.709  1.00 72.18  ? 422  LEU A CD2   1 
ATOM   3227 N  N     . VAL A 1 423 ? -72.772  1.758   -5.899  1.00 74.55  ? 423  VAL A N     1 
ATOM   3228 C  CA    . VAL A 1 423 ? -72.740  1.753   -4.440  1.00 80.26  ? 423  VAL A CA    1 
ATOM   3229 C  C     . VAL A 1 423 ? -72.151  3.082   -3.971  1.00 79.84  ? 423  VAL A C     1 
ATOM   3230 O  O     . VAL A 1 423 ? -71.007  3.412   -4.293  1.00 79.56  ? 423  VAL A O     1 
ATOM   3231 C  CB    . VAL A 1 423 ? -71.926  0.561   -3.890  1.00 82.04  ? 423  VAL A CB    1 
ATOM   3232 C  CG1   . VAL A 1 423 ? -71.901  0.579   -2.368  1.00 74.86  ? 423  VAL A CG1   1 
ATOM   3233 C  CG2   . VAL A 1 423 ? -72.505  -0.755  -4.391  1.00 80.74  ? 423  VAL A CG2   1 
ATOM   3234 N  N     . LYS A 1 424 ? -72.945  3.844   -3.223  1.00 83.46  ? 424  LYS A N     1 
ATOM   3235 C  CA    . LYS A 1 424 ? -72.558  5.194   -2.823  1.00 87.52  ? 424  LYS A CA    1 
ATOM   3236 C  C     . LYS A 1 424 ? -72.540  5.393   -1.311  1.00 89.34  ? 424  LYS A C     1 
ATOM   3237 O  O     . LYS A 1 424 ? -73.524  5.109   -0.622  1.00 93.82  ? 424  LYS A O     1 
ATOM   3238 C  CB    . LYS A 1 424 ? -73.479  6.228   -3.479  1.00 84.44  ? 424  LYS A CB    1 
ATOM   3239 N  N     . LEU A 1 425 ? -71.406  5.876   -0.808  1.00 87.05  ? 425  LEU A N     1 
ATOM   3240 C  CA    . LEU A 1 425 ? -71.282  6.294   0.582   1.00 85.06  ? 425  LEU A CA    1 
ATOM   3241 C  C     . LEU A 1 425 ? -71.849  7.707   0.692   1.00 90.16  ? 425  LEU A C     1 
ATOM   3242 O  O     . LEU A 1 425 ? -71.354  8.635   0.045   1.00 97.72  ? 425  LEU A O     1 
ATOM   3243 C  CB    . LEU A 1 425 ? -69.816  6.266   1.025   1.00 82.24  ? 425  LEU A CB    1 
ATOM   3244 C  CG    . LEU A 1 425 ? -69.497  6.247   2.523   1.00 82.39  ? 425  LEU A CG    1 
ATOM   3245 C  CD1   . LEU A 1 425 ? -69.641  4.844   3.097   1.00 58.37  ? 425  LEU A CD1   1 
ATOM   3246 C  CD2   . LEU A 1 425 ? -68.093  6.777   2.769   1.00 83.55  ? 425  LEU A CD2   1 
ATOM   3247 N  N     . TRP A 1 426 ? -72.891  7.858   1.506   1.00 84.65  ? 426  TRP A N     1 
ATOM   3248 C  CA    . TRP A 1 426 ? -73.664  9.100   1.556   1.00 90.16  ? 426  TRP A CA    1 
ATOM   3249 C  C     . TRP A 1 426 ? -72.953  10.240  2.233   1.00 97.20  ? 426  TRP A C     1 
ATOM   3250 O  O     . TRP A 1 426 ? -72.771  11.301  1.632   1.00 104.17 ? 426  TRP A O     1 
ATOM   3251 C  CB    . TRP A 1 426 ? -75.028  8.866   2.203   1.00 87.55  ? 426  TRP A CB    1 
ATOM   3252 C  CG    . TRP A 1 426 ? -75.848  7.781   1.542   1.00 88.98  ? 426  TRP A CG    1 
ATOM   3253 C  CD1   . TRP A 1 426 ? -76.295  7.733   0.223   1.00 95.03  ? 426  TRP A CD1   1 
ATOM   3254 C  CD2   . TRP A 1 426 ? -76.363  6.551   2.162   1.00 95.11  ? 426  TRP A CD2   1 
ATOM   3255 N  NE1   . TRP A 1 426 ? -77.019  6.591   -0.009  1.00 97.00  ? 426  TRP A NE1   1 
ATOM   3256 C  CE2   . TRP A 1 426 ? -77.100  5.839   1.109   1.00 93.83  ? 426  TRP A CE2   1 
ATOM   3257 C  CE3   . TRP A 1 426 ? -76.288  5.987   3.432   1.00 91.55  ? 426  TRP A CE3   1 
ATOM   3258 C  CZ2   . TRP A 1 426 ? -77.723  4.622   1.343   1.00 84.80  ? 426  TRP A CZ2   1 
ATOM   3259 C  CZ3   . TRP A 1 426 ? -76.922  4.759   3.654   1.00 87.96  ? 426  TRP A CZ3   1 
ATOM   3260 C  CH2   . TRP A 1 426 ? -77.621  4.095   2.634   1.00 82.81  ? 426  TRP A CH2   1 
ATOM   3261 N  N     . TYR A 1 427 ? -72.543  10.034  3.483   1.00 80.85  ? 427  TYR A N     1 
ATOM   3262 C  CA    . TYR A 1 427 ? -71.969  11.111  4.290   1.00 73.59  ? 427  TYR A CA    1 
ATOM   3263 C  C     . TYR A 1 427 ? -70.762  10.683  5.124   1.00 69.81  ? 427  TYR A C     1 
ATOM   3264 O  O     . TYR A 1 427 ? -70.573  9.497   5.405   1.00 73.96  ? 427  TYR A O     1 
ATOM   3265 C  CB    . TYR A 1 427 ? -73.044  11.731  5.197   1.00 70.33  ? 427  TYR A CB    1 
ATOM   3266 C  CG    . TYR A 1 427 ? -73.652  10.772  6.204   1.00 74.02  ? 427  TYR A CG    1 
ATOM   3267 C  CD1   . TYR A 1 427 ? -73.079  10.594  7.464   1.00 65.57  ? 427  TYR A CD1   1 
ATOM   3268 C  CD2   . TYR A 1 427 ? -74.807  10.050  5.899   1.00 75.95  ? 427  TYR A CD2   1 
ATOM   3269 C  CE1   . TYR A 1 427 ? -73.631  9.719   8.387   1.00 65.73  ? 427  TYR A CE1   1 
ATOM   3270 C  CE2   . TYR A 1 427 ? -75.367  9.175   6.816   1.00 65.92  ? 427  TYR A CE2   1 
ATOM   3271 C  CZ    . TYR A 1 427 ? -74.774  9.012   8.058   1.00 67.59  ? 427  TYR A CZ    1 
ATOM   3272 O  OH    . TYR A 1 427 ? -75.328  8.145   8.972   1.00 72.61  ? 427  TYR A OH    1 
ATOM   3273 N  N     . GLN A 1 428 ? -69.952  11.667  5.511   1.00 61.36  ? 428  GLN A N     1 
ATOM   3274 C  CA    . GLN A 1 428 ? -68.853  11.462  6.450   1.00 71.33  ? 428  GLN A CA    1 
ATOM   3275 C  C     . GLN A 1 428 ? -68.862  12.520  7.548   1.00 72.69  ? 428  GLN A C     1 
ATOM   3276 O  O     . GLN A 1 428 ? -68.963  13.718  7.270   1.00 79.28  ? 428  GLN A O     1 
ATOM   3277 C  CB    . GLN A 1 428 ? -67.502  11.462  5.731   1.00 76.68  ? 428  GLN A CB    1 
ATOM   3278 C  CG    . GLN A 1 428 ? -67.006  10.078  5.345   1.00 92.32  ? 428  GLN A CG    1 
ATOM   3279 C  CD    . GLN A 1 428 ? -65.492  9.991   5.316   1.00 108.44 ? 428  GLN A CD    1 
ATOM   3280 O  OE1   . GLN A 1 428 ? -64.834  10.629  4.494   1.00 119.34 ? 428  GLN A OE1   1 
ATOM   3281 N  NE2   . GLN A 1 428 ? -64.931  9.192   6.217   1.00 92.30  ? 428  GLN A NE2   1 
ATOM   3282 N  N     . LEU A 1 429 ? -68.760  12.063  8.793   1.00 70.45  ? 429  LEU A N     1 
ATOM   3283 C  CA    . LEU A 1 429 ? -68.724  12.952  9.953   1.00 63.49  ? 429  LEU A CA    1 
ATOM   3284 C  C     . LEU A 1 429 ? -67.350  13.601  10.103  1.00 67.37  ? 429  LEU A C     1 
ATOM   3285 O  O     . LEU A 1 429 ? -66.336  13.029  9.693   1.00 67.54  ? 429  LEU A O     1 
ATOM   3286 C  CB    . LEU A 1 429 ? -69.093  12.188  11.230  1.00 63.24  ? 429  LEU A CB    1 
ATOM   3287 C  CG    . LEU A 1 429 ? -70.517  11.634  11.365  1.00 67.21  ? 429  LEU A CG    1 
ATOM   3288 C  CD1   . LEU A 1 429 ? -70.563  10.532  12.414  1.00 61.77  ? 429  LEU A CD1   1 
ATOM   3289 C  CD2   . LEU A 1 429 ? -71.521  12.731  11.692  1.00 67.61  ? 429  LEU A CD2   1 
ATOM   3290 N  N     . GLU A 1 430 ? -67.330  14.795  10.692  1.00 66.17  ? 430  GLU A N     1 
ATOM   3291 C  CA    . GLU A 1 430 ? -66.091  15.544  10.903  1.00 64.27  ? 430  GLU A CA    1 
ATOM   3292 C  C     . GLU A 1 430 ? -65.221  14.908  11.984  1.00 64.59  ? 430  GLU A C     1 
ATOM   3293 O  O     . GLU A 1 430 ? -65.732  14.368  12.968  1.00 69.45  ? 430  GLU A O     1 
ATOM   3294 C  CB    . GLU A 1 430 ? -66.396  17.003  11.261  1.00 64.70  ? 430  GLU A CB    1 
ATOM   3295 C  CG    . GLU A 1 430 ? -66.991  17.827  10.125  1.00 67.85  ? 430  GLU A CG    1 
ATOM   3296 C  CD    . GLU A 1 430 ? -65.999  18.114  9.011   1.00 75.50  ? 430  GLU A CD    1 
ATOM   3297 O  OE1   . GLU A 1 430 ? -64.884  18.598  9.306   1.00 75.60  ? 430  GLU A OE1   1 
ATOM   3298 O  OE2   . GLU A 1 430 ? -66.339  17.865  7.836   1.00 80.49  ? 430  GLU A OE2   1 
ATOM   3299 N  N     . LYS A 1 431 ? -63.906  14.975  11.786  1.00 63.92  ? 431  LYS A N     1 
ATOM   3300 C  CA    . LYS A 1 431 ? -62.941  14.435  12.743  1.00 75.12  ? 431  LYS A CA    1 
ATOM   3301 C  C     . LYS A 1 431 ? -62.715  15.396  13.909  1.00 77.09  ? 431  LYS A C     1 
ATOM   3302 O  O     . LYS A 1 431 ? -62.473  14.967  15.040  1.00 72.49  ? 431  LYS A O     1 
ATOM   3303 C  CB    . LYS A 1 431 ? -61.609  14.126  12.052  1.00 77.46  ? 431  LYS A CB    1 
ATOM   3304 C  CG    . LYS A 1 431 ? -61.673  12.994  11.037  1.00 83.71  ? 431  LYS A CG    1 
ATOM   3305 C  CD    . LYS A 1 431 ? -60.330  12.787  10.356  1.00 86.21  ? 431  LYS A CD    1 
ATOM   3306 C  CE    . LYS A 1 431 ? -60.401  11.679  9.318   1.00 89.98  ? 431  LYS A CE    1 
ATOM   3307 N  NZ    . LYS A 1 431 ? -59.092  11.468  8.640   1.00 84.48  ? 431  LYS A NZ    1 
ATOM   3308 N  N     . GLU A 1 432 ? -62.796  16.694  13.620  1.00 77.85  ? 432  GLU A N     1 
ATOM   3309 C  CA    . GLU A 1 432 ? -62.584  17.742  14.617  1.00 73.69  ? 432  GLU A CA    1 
ATOM   3310 C  C     . GLU A 1 432 ? -63.816  18.647  14.741  1.00 74.52  ? 432  GLU A C     1 
ATOM   3311 O  O     . GLU A 1 432 ? -64.573  18.789  13.777  1.00 75.82  ? 432  GLU A O     1 
ATOM   3312 C  CB    . GLU A 1 432 ? -61.344  18.573  14.262  1.00 72.33  ? 432  GLU A CB    1 
ATOM   3313 C  CG    . GLU A 1 432 ? -60.023  17.815  14.342  1.00 75.36  ? 432  GLU A CG    1 
ATOM   3314 C  CD    . GLU A 1 432 ? -59.659  17.382  15.753  1.00 87.65  ? 432  GLU A CD    1 
ATOM   3315 O  OE1   . GLU A 1 432 ? -59.839  18.182  16.697  1.00 91.35  ? 432  GLU A OE1   1 
ATOM   3316 O  OE2   . GLU A 1 432 ? -59.192  16.235  15.918  1.00 93.39  ? 432  GLU A OE2   1 
ATOM   3317 N  N     . PRO A 1 433 ? -64.024  19.256  15.929  1.00 70.80  ? 433  PRO A N     1 
ATOM   3318 C  CA    . PRO A 1 433 ? -65.163  20.156  16.156  1.00 68.69  ? 433  PRO A CA    1 
ATOM   3319 C  C     . PRO A 1 433 ? -65.147  21.385  15.246  1.00 72.19  ? 433  PRO A C     1 
ATOM   3320 O  O     . PRO A 1 433 ? -64.075  21.877  14.885  1.00 74.81  ? 433  PRO A O     1 
ATOM   3321 C  CB    . PRO A 1 433 ? -64.999  20.577  17.622  1.00 69.90  ? 433  PRO A CB    1 
ATOM   3322 C  CG    . PRO A 1 433 ? -63.570  20.307  17.951  1.00 73.27  ? 433  PRO A CG    1 
ATOM   3323 C  CD    . PRO A 1 433 ? -63.218  19.090  17.152  1.00 76.60  ? 433  PRO A CD    1 
ATOM   3324 N  N     . ILE A 1 434 ? -66.336  21.868  14.893  1.00 70.10  ? 434  ILE A N     1 
ATOM   3325 C  CA    . ILE A 1 434 ? -66.487  22.978  13.951  1.00 78.17  ? 434  ILE A CA    1 
ATOM   3326 C  C     . ILE A 1 434 ? -66.582  24.318  14.683  1.00 79.90  ? 434  ILE A C     1 
ATOM   3327 O  O     . ILE A 1 434 ? -67.343  24.459  15.644  1.00 81.00  ? 434  ILE A O     1 
ATOM   3328 C  CB    . ILE A 1 434 ? -67.723  22.784  13.040  1.00 79.61  ? 434  ILE A CB    1 
ATOM   3329 C  CG1   . ILE A 1 434 ? -67.763  21.356  12.482  1.00 79.84  ? 434  ILE A CG1   1 
ATOM   3330 C  CG2   . ILE A 1 434 ? -67.725  23.803  11.905  1.00 91.40  ? 434  ILE A CG2   1 
ATOM   3331 C  CD1   . ILE A 1 434 ? -69.147  20.875  12.099  1.00 73.49  ? 434  ILE A CD1   1 
ATOM   3332 N  N     . VAL A 1 435 ? -65.799  25.290  14.220  1.00 87.36  ? 435  VAL A N     1 
ATOM   3333 C  CA    . VAL A 1 435 ? -65.803  26.643  14.783  1.00 85.35  ? 435  VAL A CA    1 
ATOM   3334 C  C     . VAL A 1 435 ? -66.999  27.460  14.290  1.00 85.27  ? 435  VAL A C     1 
ATOM   3335 O  O     . VAL A 1 435 ? -67.385  27.371  13.122  1.00 96.80  ? 435  VAL A O     1 
ATOM   3336 C  CB    . VAL A 1 435 ? -64.485  27.405  14.492  1.00 82.21  ? 435  VAL A CB    1 
ATOM   3337 C  CG1   . VAL A 1 435 ? -63.348  26.852  15.339  1.00 70.85  ? 435  VAL A CG1   1 
ATOM   3338 C  CG2   . VAL A 1 435 ? -64.126  27.357  13.011  1.00 83.80  ? 435  VAL A CG2   1 
ATOM   3339 N  N     . GLY A 1 436 ? -67.584  28.244  15.193  1.00 78.41  ? 436  GLY A N     1 
ATOM   3340 C  CA    . GLY A 1 436 ? -68.736  29.088  14.868  1.00 81.10  ? 436  GLY A CA    1 
ATOM   3341 C  C     . GLY A 1 436 ? -70.059  28.344  14.802  1.00 81.17  ? 436  GLY A C     1 
ATOM   3342 O  O     . GLY A 1 436 ? -71.123  28.965  14.740  1.00 81.02  ? 436  GLY A O     1 
ATOM   3343 N  N     . ALA A 1 437 ? -69.988  27.014  14.813  1.00 83.24  ? 437  ALA A N     1 
ATOM   3344 C  CA    . ALA A 1 437 ? -71.170  26.160  14.750  1.00 86.29  ? 437  ALA A CA    1 
ATOM   3345 C  C     . ALA A 1 437 ? -71.904  26.125  16.087  1.00 84.40  ? 437  ALA A C     1 
ATOM   3346 O  O     . ALA A 1 437 ? -71.280  26.199  17.149  1.00 86.74  ? 437  ALA A O     1 
ATOM   3347 C  CB    . ALA A 1 437 ? -70.778  24.753  14.324  1.00 81.53  ? 437  ALA A CB    1 
ATOM   3348 N  N     . GLU A 1 438 ? -73.229  26.013  16.024  1.00 76.97  ? 438  GLU A N     1 
ATOM   3349 C  CA    . GLU A 1 438 ? -74.062  25.950  17.222  1.00 74.93  ? 438  GLU A CA    1 
ATOM   3350 C  C     . GLU A 1 438 ? -73.945  24.580  17.887  1.00 74.05  ? 438  GLU A C     1 
ATOM   3351 O  O     . GLU A 1 438 ? -74.144  23.545  17.245  1.00 81.70  ? 438  GLU A O     1 
ATOM   3352 C  CB    . GLU A 1 438 ? -75.522  26.268  16.883  1.00 71.88  ? 438  GLU A CB    1 
ATOM   3353 C  CG    . GLU A 1 438 ? -76.389  26.592  18.093  1.00 72.57  ? 438  GLU A CG    1 
ATOM   3354 C  CD    . GLU A 1 438 ? -77.807  26.997  17.725  1.00 77.08  ? 438  GLU A CD    1 
ATOM   3355 O  OE1   . GLU A 1 438 ? -78.283  26.626  16.630  1.00 77.05  ? 438  GLU A OE1   1 
ATOM   3356 O  OE2   . GLU A 1 438 ? -78.453  27.687  18.541  1.00 77.93  ? 438  GLU A OE2   1 
ATOM   3357 N  N     . THR A 1 439 ? -73.611  24.590  19.175  1.00 75.73  ? 439  THR A N     1 
ATOM   3358 C  CA    . THR A 1 439 ? -73.434  23.366  19.952  1.00 71.21  ? 439  THR A CA    1 
ATOM   3359 C  C     . THR A 1 439 ? -74.780  22.840  20.447  1.00 71.94  ? 439  THR A C     1 
ATOM   3360 O  O     . THR A 1 439 ? -75.570  23.582  21.033  1.00 75.14  ? 439  THR A O     1 
ATOM   3361 C  CB    . THR A 1 439 ? -72.471  23.596  21.138  1.00 74.28  ? 439  THR A CB    1 
ATOM   3362 O  OG1   . THR A 1 439 ? -71.205  24.046  20.642  1.00 77.57  ? 439  THR A OG1   1 
ATOM   3363 C  CG2   . THR A 1 439 ? -72.266  22.316  21.941  1.00 63.81  ? 439  THR A CG2   1 
ATOM   3364 N  N     . PHE A 1 440 ? -75.030  21.557  20.197  1.00 69.07  ? 440  PHE A N     1 
ATOM   3365 C  CA    . PHE A 1 440 ? -76.276  20.905  20.589  1.00 63.40  ? 440  PHE A CA    1 
ATOM   3366 C  C     . PHE A 1 440 ? -76.024  19.740  21.545  1.00 61.31  ? 440  PHE A C     1 
ATOM   3367 O  O     . PHE A 1 440 ? -75.588  18.664  21.126  1.00 63.72  ? 440  PHE A O     1 
ATOM   3368 C  CB    . PHE A 1 440 ? -77.035  20.410  19.351  1.00 62.53  ? 440  PHE A CB    1 
ATOM   3369 C  CG    . PHE A 1 440 ? -77.811  21.482  18.636  1.00 67.36  ? 440  PHE A CG    1 
ATOM   3370 C  CD1   . PHE A 1 440 ? -77.170  22.386  17.794  1.00 72.38  ? 440  PHE A CD1   1 
ATOM   3371 C  CD2   . PHE A 1 440 ? -79.190  21.576  18.788  1.00 66.28  ? 440  PHE A CD2   1 
ATOM   3372 C  CE1   . PHE A 1 440 ? -77.887  23.370  17.131  1.00 73.37  ? 440  PHE A CE1   1 
ATOM   3373 C  CE2   . PHE A 1 440 ? -79.914  22.556  18.125  1.00 67.83  ? 440  PHE A CE2   1 
ATOM   3374 C  CZ    . PHE A 1 440 ? -79.261  23.456  17.297  1.00 73.10  ? 440  PHE A CZ    1 
ATOM   3375 N  N     . TYR A 1 441 ? -76.289  19.965  22.830  1.00 57.83  ? 441  TYR A N     1 
ATOM   3376 C  CA    . TYR A 1 441 ? -76.273  18.891  23.820  1.00 53.38  ? 441  TYR A CA    1 
ATOM   3377 C  C     . TYR A 1 441 ? -77.606  18.158  23.759  1.00 57.71  ? 441  TYR A C     1 
ATOM   3378 O  O     . TYR A 1 441 ? -78.665  18.778  23.870  1.00 61.89  ? 441  TYR A O     1 
ATOM   3379 C  CB    . TYR A 1 441 ? -76.027  19.443  25.226  1.00 51.42  ? 441  TYR A CB    1 
ATOM   3380 C  CG    . TYR A 1 441 ? -74.611  19.915  25.467  1.00 55.97  ? 441  TYR A CG    1 
ATOM   3381 C  CD1   . TYR A 1 441 ? -73.614  19.020  25.856  1.00 52.35  ? 441  TYR A CD1   1 
ATOM   3382 C  CD2   . TYR A 1 441 ? -74.268  21.257  25.311  1.00 51.51  ? 441  TYR A CD2   1 
ATOM   3383 C  CE1   . TYR A 1 441 ? -72.314  19.448  26.080  1.00 56.85  ? 441  TYR A CE1   1 
ATOM   3384 C  CE2   . TYR A 1 441 ? -72.972  21.695  25.535  1.00 59.26  ? 441  TYR A CE2   1 
ATOM   3385 C  CZ    . TYR A 1 441 ? -71.999  20.785  25.918  1.00 58.74  ? 441  TYR A CZ    1 
ATOM   3386 O  OH    . TYR A 1 441 ? -70.710  21.214  26.140  1.00 65.83  ? 441  TYR A OH    1 
ATOM   3387 N  N     . VAL A 1 442 ? -77.553  16.840  23.578  1.00 58.42  ? 442  VAL A N     1 
ATOM   3388 C  CA    . VAL A 1 442 ? -78.761  16.063  23.314  1.00 58.41  ? 442  VAL A CA    1 
ATOM   3389 C  C     . VAL A 1 442 ? -78.884  14.831  24.221  1.00 59.58  ? 442  VAL A C     1 
ATOM   3390 O  O     . VAL A 1 442 ? -77.879  14.203  24.573  1.00 62.07  ? 442  VAL A O     1 
ATOM   3391 C  CB    . VAL A 1 442 ? -78.866  15.705  21.808  1.00 62.18  ? 442  VAL A CB    1 
ATOM   3392 C  CG1   . VAL A 1 442 ? -78.579  14.231  21.542  1.00 56.44  ? 442  VAL A CG1   1 
ATOM   3393 C  CG2   . VAL A 1 442 ? -80.230  16.096  21.269  1.00 68.58  ? 442  VAL A CG2   1 
ATOM   3394 N  N     . ASP A 1 443 ? -80.120  14.511  24.605  1.00 57.94  ? 443  ASP A N     1 
ATOM   3395 C  CA    . ASP A 1 443 ? -80.413  13.365  25.473  1.00 60.51  ? 443  ASP A CA    1 
ATOM   3396 C  C     . ASP A 1 443 ? -81.870  12.913  25.349  1.00 60.55  ? 443  ASP A C     1 
ATOM   3397 O  O     . ASP A 1 443 ? -82.761  13.722  25.076  1.00 65.83  ? 443  ASP A O     1 
ATOM   3398 C  CB    . ASP A 1 443 ? -80.088  13.697  26.937  1.00 65.17  ? 443  ASP A CB    1 
ATOM   3399 C  CG    . ASP A 1 443 ? -80.167  12.482  27.851  1.00 71.31  ? 443  ASP A CG    1 
ATOM   3400 O  OD1   . ASP A 1 443 ? -79.760  11.377  27.429  1.00 75.09  ? 443  ASP A OD1   1 
ATOM   3401 O  OD2   . ASP A 1 443 ? -80.639  12.633  28.997  1.00 75.78  ? 443  ASP A OD2   1 
ATOM   3402 N  N     . GLY A 1 444 ? -82.098  11.616  25.551  1.00 59.48  ? 444  GLY A N     1 
ATOM   3403 C  CA    . GLY A 1 444 ? -83.440  11.037  25.532  1.00 61.38  ? 444  GLY A CA    1 
ATOM   3404 C  C     . GLY A 1 444 ? -83.640  10.012  26.634  1.00 64.78  ? 444  GLY A C     1 
ATOM   3405 O  O     . GLY A 1 444 ? -82.745  9.214   26.920  1.00 66.84  ? 444  GLY A O     1 
ATOM   3406 N  N     . ALA A 1 445 ? -84.819  10.037  27.252  1.00 67.34  ? 445  ALA A N     1 
ATOM   3407 C  CA    . ALA A 1 445 ? -85.152  9.116   28.339  1.00 71.93  ? 445  ALA A CA    1 
ATOM   3408 C  C     . ALA A 1 445 ? -86.561  8.550   28.187  1.00 67.36  ? 445  ALA A C     1 
ATOM   3409 O  O     . ALA A 1 445 ? -87.478  9.256   27.762  1.00 64.87  ? 445  ALA A O     1 
ATOM   3410 C  CB    . ALA A 1 445 ? -84.997  9.806   29.686  1.00 70.63  ? 445  ALA A CB    1 
ATOM   3411 N  N     . ALA A 1 446 ? -86.721  7.274   28.538  1.00 69.40  ? 446  ALA A N     1 
ATOM   3412 C  CA    . ALA A 1 446 ? -88.009  6.585   28.441  1.00 70.14  ? 446  ALA A CA    1 
ATOM   3413 C  C     . ALA A 1 446 ? -88.157  5.491   29.498  1.00 75.38  ? 446  ALA A C     1 
ATOM   3414 O  O     . ALA A 1 446 ? -87.164  4.946   29.986  1.00 79.28  ? 446  ALA A O     1 
ATOM   3415 C  CB    . ALA A 1 446 ? -88.195  6.003   27.046  1.00 72.41  ? 446  ALA A CB    1 
ATOM   3416 N  N     . SER A 1 447 ? -89.405  5.182   29.845  1.00 75.33  ? 447  SER A N     1 
ATOM   3417 C  CA    . SER A 1 447 ? -89.718  4.101   30.776  1.00 80.02  ? 447  SER A CA    1 
ATOM   3418 C  C     . SER A 1 447 ? -90.577  3.045   30.085  1.00 85.68  ? 447  SER A C     1 
ATOM   3419 O  O     . SER A 1 447 ? -91.481  3.381   29.317  1.00 86.19  ? 447  SER A O     1 
ATOM   3420 C  CB    . SER A 1 447 ? -90.438  4.646   32.011  1.00 86.35  ? 447  SER A CB    1 
ATOM   3421 O  OG    . SER A 1 447 ? -90.654  3.626   32.972  1.00 96.13  ? 447  SER A OG    1 
ATOM   3422 N  N     . ARG A 1 448 ? -90.292  1.774   30.362  1.00 90.59  ? 448  ARG A N     1 
ATOM   3423 C  CA    . ARG A 1 448 ? -91.022  0.661   29.742  1.00 96.53  ? 448  ARG A CA    1 
ATOM   3424 C  C     . ARG A 1 448 ? -92.443  0.464   30.289  1.00 99.37  ? 448  ARG A C     1 
ATOM   3425 O  O     . ARG A 1 448 ? -93.229  -0.301  29.723  1.00 97.94  ? 448  ARG A O     1 
ATOM   3426 C  CB    . ARG A 1 448 ? -90.208  -0.646  29.775  1.00 91.98  ? 448  ARG A CB    1 
ATOM   3427 C  CG    . ARG A 1 448 ? -89.391  -0.899  31.036  1.00 97.40  ? 448  ARG A CG    1 
ATOM   3428 C  CD    . ARG A 1 448 ? -90.148  -1.736  32.055  1.00 108.54 ? 448  ARG A CD    1 
ATOM   3429 N  NE    . ARG A 1 448 ? -89.242  -2.555  32.861  1.00 119.61 ? 448  ARG A NE    1 
ATOM   3430 C  CZ    . ARG A 1 448 ? -88.659  -2.160  33.991  1.00 115.07 ? 448  ARG A CZ    1 
ATOM   3431 N  NH1   . ARG A 1 448 ? -88.876  -0.944  34.476  1.00 111.19 ? 448  ARG A NH1   1 
ATOM   3432 N  NH2   . ARG A 1 448 ? -87.852  -2.989  34.640  1.00 105.75 ? 448  ARG A NH2   1 
ATOM   3433 N  N     . GLU A 1 449 ? -92.763  1.154   31.382  1.00 95.91  ? 449  GLU A N     1 
ATOM   3434 C  CA    . GLU A 1 449 ? -94.132  1.207   31.893  1.00 93.56  ? 449  GLU A CA    1 
ATOM   3435 C  C     . GLU A 1 449 ? -94.912  2.269   31.122  1.00 102.39 ? 449  GLU A C     1 
ATOM   3436 O  O     . GLU A 1 449 ? -94.480  3.423   31.039  1.00 97.99  ? 449  GLU A O     1 
ATOM   3437 C  CB    . GLU A 1 449 ? -94.152  1.515   33.394  1.00 91.76  ? 449  GLU A CB    1 
ATOM   3438 C  CG    . GLU A 1 449 ? -93.679  0.376   34.290  1.00 100.73 ? 449  GLU A CG    1 
ATOM   3439 C  CD    . GLU A 1 449 ? -92.171  0.343   34.491  1.00 104.08 ? 449  GLU A CD    1 
ATOM   3440 O  OE1   . GLU A 1 449 ? -91.454  1.186   33.909  1.00 104.95 ? 449  GLU A OE1   1 
ATOM   3441 O  OE2   . GLU A 1 449 ? -91.698  -0.534  35.244  1.00 100.71 ? 449  GLU A OE2   1 
ATOM   3442 N  N     . THR A 1 450 ? -96.049  1.865   30.552  1.00 106.65 ? 450  THR A N     1 
ATOM   3443 C  CA    . THR A 1 450 ? -96.894  2.723   29.697  1.00 113.44 ? 450  THR A CA    1 
ATOM   3444 C  C     . THR A 1 450 ? -96.210  3.088   28.367  1.00 98.70  ? 450  THR A C     1 
ATOM   3445 O  O     . THR A 1 450 ? -96.877  3.489   27.408  1.00 100.10 ? 450  THR A O     1 
ATOM   3446 C  CB    . THR A 1 450 ? -97.388  3.997   30.434  1.00 111.64 ? 450  THR A CB    1 
ATOM   3447 O  OG1   . THR A 1 450 ? -97.675  3.686   31.803  1.00 124.69 ? 450  THR A OG1   1 
ATOM   3448 C  CG2   . THR A 1 450 ? -98.646  4.560   29.778  1.00 104.62 ? 450  THR A CG2   1 
ATOM   3449 N  N     . LYS A 1 451 ? -94.886  2.927   28.322  1.00 90.03  ? 451  LYS A N     1 
ATOM   3450 C  CA    . LYS A 1 451 ? -94.054  3.243   27.151  1.00 91.52  ? 451  LYS A CA    1 
ATOM   3451 C  C     . LYS A 1 451 ? -94.132  4.720   26.742  1.00 97.33  ? 451  LYS A C     1 
ATOM   3452 O  O     . LYS A 1 451 ? -94.551  5.055   25.630  1.00 98.52  ? 451  LYS A O     1 
ATOM   3453 C  CB    . LYS A 1 451 ? -94.355  2.305   25.971  1.00 100.43 ? 451  LYS A CB    1 
ATOM   3454 C  CG    . LYS A 1 451 ? -93.895  0.871   26.185  1.00 94.41  ? 451  LYS A CG    1 
ATOM   3455 C  CD    . LYS A 1 451 ? -94.184  0.007   24.969  1.00 91.47  ? 451  LYS A CD    1 
ATOM   3456 C  CE    . LYS A 1 451 ? -93.707  -1.421  25.179  1.00 86.57  ? 451  LYS A CE    1 
ATOM   3457 N  NZ    . LYS A 1 451 ? -93.977  -2.276  23.990  1.00 78.32  ? 451  LYS A NZ    1 
ATOM   3458 N  N     . LEU A 1 452 ? -93.725  5.591   27.663  1.00 91.87  ? 452  LEU A N     1 
ATOM   3459 C  CA    . LEU A 1 452 ? -93.680  7.032   27.424  1.00 85.13  ? 452  LEU A CA    1 
ATOM   3460 C  C     . LEU A 1 452 ? -92.246  7.545   27.507  1.00 80.26  ? 452  LEU A C     1 
ATOM   3461 O  O     . LEU A 1 452 ? -91.484  7.141   28.389  1.00 82.08  ? 452  LEU A O     1 
ATOM   3462 C  CB    . LEU A 1 452 ? -94.566  7.778   28.428  1.00 84.06  ? 452  LEU A CB    1 
ATOM   3463 C  CG    . LEU A 1 452 ? -96.087  7.603   28.335  1.00 89.80  ? 452  LEU A CG    1 
ATOM   3464 C  CD1   . LEU A 1 452 ? -96.750  7.986   29.649  1.00 91.67  ? 452  LEU A CD1   1 
ATOM   3465 C  CD2   . LEU A 1 452 ? -96.675  8.405   27.181  1.00 84.38  ? 452  LEU A CD2   1 
ATOM   3466 N  N     . GLY A 1 453 ? -91.886  8.436   26.586  1.00 77.46  ? 453  GLY A N     1 
ATOM   3467 C  CA    . GLY A 1 453 ? -90.530  8.974   26.520  1.00 71.01  ? 453  GLY A CA    1 
ATOM   3468 C  C     . GLY A 1 453 ? -90.449  10.431  26.109  1.00 69.67  ? 453  GLY A C     1 
ATOM   3469 O  O     . GLY A 1 453 ? -91.379  10.972  25.505  1.00 73.72  ? 453  GLY A O     1 
ATOM   3470 N  N     . LYS A 1 454 ? -89.324  11.063  26.441  1.00 67.98  ? 454  LYS A N     1 
ATOM   3471 C  CA    . LYS A 1 454 ? -89.084  12.468  26.113  1.00 67.48  ? 454  LYS A CA    1 
ATOM   3472 C  C     . LYS A 1 454 ? -87.740  12.666  25.416  1.00 66.66  ? 454  LYS A C     1 
ATOM   3473 O  O     . LYS A 1 454 ? -86.750  12.014  25.756  1.00 70.94  ? 454  LYS A O     1 
ATOM   3474 C  CB    . LYS A 1 454 ? -89.152  13.340  27.371  1.00 70.64  ? 454  LYS A CB    1 
ATOM   3475 C  CG    . LYS A 1 454 ? -90.547  13.507  27.954  1.00 71.11  ? 454  LYS A CG    1 
ATOM   3476 C  CD    . LYS A 1 454 ? -90.519  14.370  29.205  1.00 69.04  ? 454  LYS A CD    1 
ATOM   3477 C  CE    . LYS A 1 454 ? -91.908  14.518  29.806  1.00 82.28  ? 454  LYS A CE    1 
ATOM   3478 N  NZ    . LYS A 1 454 ? -91.894  15.356  31.037  1.00 85.07  ? 454  LYS A NZ    1 
ATOM   3479 N  N     . ALA A 1 455 ? -87.721  13.574  24.443  1.00 63.50  ? 455  ALA A N     1 
ATOM   3480 C  CA    . ALA A 1 455 ? -86.506  13.917  23.708  1.00 63.66  ? 455  ALA A CA    1 
ATOM   3481 C  C     . ALA A 1 455 ? -86.323  15.431  23.655  1.00 71.13  ? 455  ALA A C     1 
ATOM   3482 O  O     . ALA A 1 455 ? -87.272  16.168  23.376  1.00 77.94  ? 455  ALA A O     1 
ATOM   3483 C  CB    . ALA A 1 455 ? -86.553  13.335  22.303  1.00 70.56  ? 455  ALA A CB    1 
ATOM   3484 N  N     . GLY A 1 456 ? -85.101  15.888  23.924  1.00 67.08  ? 456  GLY A N     1 
ATOM   3485 C  CA    . GLY A 1 456 ? -84.807  17.319  23.957  1.00 71.26  ? 456  GLY A CA    1 
ATOM   3486 C  C     . GLY A 1 456 ? -83.361  17.687  23.684  1.00 70.15  ? 456  GLY A C     1 
ATOM   3487 O  O     . GLY A 1 456 ? -82.482  16.823  23.651  1.00 65.13  ? 456  GLY A O     1 
ATOM   3488 N  N     . TYR A 1 457 ? -83.125  18.983  23.486  1.00 69.68  ? 457  TYR A N     1 
ATOM   3489 C  CA    . TYR A 1 457 ? -81.783  19.519  23.254  1.00 65.49  ? 457  TYR A CA    1 
ATOM   3490 C  C     . TYR A 1 457 ? -81.586  20.868  23.946  1.00 67.07  ? 457  TYR A C     1 
ATOM   3491 O  O     . TYR A 1 457 ? -82.536  21.638  24.101  1.00 73.55  ? 457  TYR A O     1 
ATOM   3492 C  CB    . TYR A 1 457 ? -81.491  19.641  21.750  1.00 69.04  ? 457  TYR A CB    1 
ATOM   3493 C  CG    . TYR A 1 457 ? -82.412  20.580  20.993  1.00 78.04  ? 457  TYR A CG    1 
ATOM   3494 C  CD1   . TYR A 1 457 ? -82.116  21.940  20.879  1.00 75.69  ? 457  TYR A CD1   1 
ATOM   3495 C  CD2   . TYR A 1 457 ? -83.570  20.106  20.377  1.00 77.57  ? 457  TYR A CD2   1 
ATOM   3496 C  CE1   . TYR A 1 457 ? -82.953  22.801  20.186  1.00 72.50  ? 457  TYR A CE1   1 
ATOM   3497 C  CE2   . TYR A 1 457 ? -84.412  20.960  19.680  1.00 76.10  ? 457  TYR A CE2   1 
ATOM   3498 C  CZ    . TYR A 1 457 ? -84.099  22.305  19.589  1.00 76.08  ? 457  TYR A CZ    1 
ATOM   3499 O  OH    . TYR A 1 457 ? -84.932  23.156  18.899  1.00 80.97  ? 457  TYR A OH    1 
ATOM   3500 N  N     . VAL A 1 458 ? -80.351  21.141  24.365  1.00 66.03  ? 458  VAL A N     1 
ATOM   3501 C  CA    . VAL A 1 458 ? -79.988  22.431  24.961  1.00 67.63  ? 458  VAL A CA    1 
ATOM   3502 C  C     . VAL A 1 458 ? -78.747  22.993  24.266  1.00 65.64  ? 458  VAL A C     1 
ATOM   3503 O  O     . VAL A 1 458 ? -77.716  22.322  24.174  1.00 69.16  ? 458  VAL A O     1 
ATOM   3504 C  CB    . VAL A 1 458 ? -79.761  22.325  26.491  1.00 61.50  ? 458  VAL A CB    1 
ATOM   3505 C  CG1   . VAL A 1 458 ? -79.172  23.613  27.052  1.00 70.14  ? 458  VAL A CG1   1 
ATOM   3506 C  CG2   . VAL A 1 458 ? -81.062  21.992  27.208  1.00 56.34  ? 458  VAL A CG2   1 
ATOM   3507 N  N     . THR A 1 459 ? -78.863  24.226  23.777  1.00 68.13  ? 459  THR A N     1 
ATOM   3508 C  CA    . THR A 1 459 ? -77.782  24.888  23.046  1.00 69.41  ? 459  THR A CA    1 
ATOM   3509 C  C     . THR A 1 459 ? -76.993  25.851  23.930  1.00 70.20  ? 459  THR A C     1 
ATOM   3510 O  O     . THR A 1 459 ? -77.467  26.266  24.990  1.00 75.23  ? 459  THR A O     1 
ATOM   3511 C  CB    . THR A 1 459 ? -78.317  25.673  21.830  1.00 73.94  ? 459  THR A CB    1 
ATOM   3512 O  OG1   . THR A 1 459 ? -79.251  26.665  22.274  1.00 80.40  ? 459  THR A OG1   1 
ATOM   3513 C  CG2   . THR A 1 459 ? -78.999  24.743  20.838  1.00 71.14  ? 459  THR A CG2   1 
ATOM   3514 N  N     . ASN A 1 460 ? -75.791  26.205  23.477  1.00 69.93  ? 460  ASN A N     1 
ATOM   3515 C  CA    . ASN A 1 460 ? -74.965  27.210  24.146  1.00 76.80  ? 460  ASN A CA    1 
ATOM   3516 C  C     . ASN A 1 460 ? -75.486  28.633  23.932  1.00 75.86  ? 460  ASN A C     1 
ATOM   3517 O  O     . ASN A 1 460 ? -75.128  29.551  24.675  1.00 81.18  ? 460  ASN A O     1 
ATOM   3518 C  CB    . ASN A 1 460 ? -73.500  27.096  23.702  1.00 69.03  ? 460  ASN A CB    1 
ATOM   3519 C  CG    . ASN A 1 460 ? -73.316  27.304  22.206  1.00 65.43  ? 460  ASN A CG    1 
ATOM   3520 O  OD1   . ASN A 1 460 ? -74.054  26.748  21.390  1.00 68.51  ? 460  ASN A OD1   1 
ATOM   3521 N  ND2   . ASN A 1 460 ? -72.318  28.100  21.841  1.00 71.65  ? 460  ASN A ND2   1 
ATOM   3522 N  N     . LYS A 1 461 ? -76.332  28.803  22.917  1.00 71.76  ? 461  LYS A N     1 
ATOM   3523 C  CA    . LYS A 1 461 ? -76.947  30.095  22.612  1.00 73.44  ? 461  LYS A CA    1 
ATOM   3524 C  C     . LYS A 1 461 ? -78.174  30.376  23.483  1.00 79.52  ? 461  LYS A C     1 
ATOM   3525 O  O     . LYS A 1 461 ? -78.506  31.536  23.733  1.00 83.19  ? 461  LYS A O     1 
ATOM   3526 C  CB    . LYS A 1 461 ? -77.305  30.189  21.125  1.00 73.17  ? 461  LYS A CB    1 
ATOM   3527 C  CG    . LYS A 1 461 ? -76.101  30.351  20.208  1.00 71.43  ? 461  LYS A CG    1 
ATOM   3528 C  CD    . LYS A 1 461 ? -76.518  30.483  18.752  1.00 75.85  ? 461  LYS A CD    1 
ATOM   3529 C  CE    . LYS A 1 461 ? -75.317  30.697  17.842  1.00 72.16  ? 461  LYS A CE    1 
ATOM   3530 N  NZ    . LYS A 1 461 ? -74.444  29.493  17.745  1.00 57.13  ? 461  LYS A NZ    1 
ATOM   3531 N  N     . GLY A 1 462 ? -78.840  29.315  23.937  1.00 73.82  ? 462  GLY A N     1 
ATOM   3532 C  CA    . GLY A 1 462 ? -79.961  29.447  24.870  1.00 71.92  ? 462  GLY A CA    1 
ATOM   3533 C  C     . GLY A 1 462 ? -81.242  28.723  24.492  1.00 78.92  ? 462  GLY A C     1 
ATOM   3534 O  O     . GLY A 1 462 ? -82.051  28.397  25.364  1.00 84.34  ? 462  GLY A O     1 
ATOM   3535 N  N     . ARG A 1 463 ? -81.430  28.474  23.197  1.00 86.30  ? 463  ARG A N     1 
ATOM   3536 C  CA    . ARG A 1 463 ? -82.660  27.857  22.687  1.00 88.55  ? 463  ARG A CA    1 
ATOM   3537 C  C     . ARG A 1 463 ? -82.780  26.367  23.026  1.00 82.04  ? 463  ARG A C     1 
ATOM   3538 O  O     . ARG A 1 463 ? -81.781  25.644  23.060  1.00 76.95  ? 463  ARG A O     1 
ATOM   3539 C  CB    . ARG A 1 463 ? -82.807  28.088  21.175  1.00 76.66  ? 463  ARG A CB    1 
ATOM   3540 C  CG    . ARG A 1 463 ? -81.646  27.584  20.327  1.00 70.98  ? 463  ARG A CG    1 
ATOM   3541 C  CD    . ARG A 1 463 ? -81.821  27.935  18.857  1.00 79.14  ? 463  ARG A CD    1 
ATOM   3542 N  NE    . ARG A 1 463 ? -82.917  27.194  18.235  1.00 82.95  ? 463  ARG A NE    1 
ATOM   3543 C  CZ    . ARG A 1 463 ? -83.211  27.225  16.937  1.00 91.33  ? 463  ARG A CZ    1 
ATOM   3544 N  NH1   . ARG A 1 463 ? -82.491  27.961  16.099  1.00 102.55 ? 463  ARG A NH1   1 
ATOM   3545 N  NH2   . ARG A 1 463 ? -84.230  26.516  16.475  1.00 82.71  ? 463  ARG A NH2   1 
ATOM   3546 N  N     . GLN A 1 464 ? -84.014  25.928  23.277  1.00 83.87  ? 464  GLN A N     1 
ATOM   3547 C  CA    . GLN A 1 464 ? -84.304  24.542  23.661  1.00 81.51  ? 464  GLN A CA    1 
ATOM   3548 C  C     . GLN A 1 464 ? -85.717  24.106  23.256  1.00 86.94  ? 464  GLN A C     1 
ATOM   3549 O  O     . GLN A 1 464 ? -86.607  24.942  23.082  1.00 95.13  ? 464  GLN A O     1 
ATOM   3550 C  CB    . GLN A 1 464 ? -84.098  24.342  25.170  1.00 78.14  ? 464  GLN A CB    1 
ATOM   3551 C  CG    . GLN A 1 464 ? -84.969  25.221  26.061  1.00 85.03  ? 464  GLN A CG    1 
ATOM   3552 C  CD    . GLN A 1 464 ? -84.781  24.936  27.540  1.00 79.40  ? 464  GLN A CD    1 
ATOM   3553 O  OE1   . GLN A 1 464 ? -85.739  24.624  28.247  1.00 68.96  ? 464  GLN A OE1   1 
ATOM   3554 N  NE2   . GLN A 1 464 ? -83.544  25.040  28.015  1.00 77.42  ? 464  GLN A NE2   1 
ATOM   3555 N  N     . LYS A 1 465 ? -85.909  22.794  23.112  1.00 75.59  ? 465  LYS A N     1 
ATOM   3556 C  CA    . LYS A 1 465 ? -87.211  22.216  22.763  1.00 81.61  ? 465  LYS A CA    1 
ATOM   3557 C  C     . LYS A 1 465 ? -87.341  20.784  23.287  1.00 73.49  ? 465  LYS A C     1 
ATOM   3558 O  O     . LYS A 1 465 ? -86.450  19.958  23.078  1.00 72.73  ? 465  LYS A O     1 
ATOM   3559 C  CB    . LYS A 1 465 ? -87.427  22.247  21.245  1.00 86.79  ? 465  LYS A CB    1 
ATOM   3560 C  CG    . LYS A 1 465 ? -88.830  21.859  20.795  1.00 86.99  ? 465  LYS A CG    1 
ATOM   3561 C  CD    . LYS A 1 465 ? -88.924  21.710  19.283  1.00 86.28  ? 465  LYS A CD    1 
ATOM   3562 C  CE    . LYS A 1 465 ? -89.044  23.055  18.582  1.00 87.19  ? 465  LYS A CE    1 
ATOM   3563 N  NZ    . LYS A 1 465 ? -89.138  22.905  17.104  1.00 81.54  ? 465  LYS A NZ    1 
ATOM   3564 N  N     . VAL A 1 466 ? -88.454  20.503  23.964  1.00 69.85  ? 466  VAL A N     1 
ATOM   3565 C  CA    . VAL A 1 466 ? -88.736  19.173  24.516  1.00 70.91  ? 466  VAL A CA    1 
ATOM   3566 C  C     . VAL A 1 466 ? -90.090  18.667  24.009  1.00 75.83  ? 466  VAL A C     1 
ATOM   3567 O  O     . VAL A 1 466 ? -91.071  19.413  23.995  1.00 89.73  ? 466  VAL A O     1 
ATOM   3568 C  CB    . VAL A 1 466 ? -88.724  19.178  26.067  1.00 79.50  ? 466  VAL A CB    1 
ATOM   3569 C  CG1   . VAL A 1 466 ? -88.900  17.770  26.621  1.00 74.05  ? 466  VAL A CG1   1 
ATOM   3570 C  CG2   . VAL A 1 466 ? -87.435  19.788  26.603  1.00 73.48  ? 466  VAL A CG2   1 
ATOM   3571 N  N     . VAL A 1 467 ? -90.133  17.403  23.585  1.00 70.28  ? 467  VAL A N     1 
ATOM   3572 C  CA    . VAL A 1 467 ? -91.371  16.774  23.101  1.00 78.37  ? 467  VAL A CA    1 
ATOM   3573 C  C     . VAL A 1 467 ? -91.674  15.453  23.816  1.00 75.27  ? 467  VAL A C     1 
ATOM   3574 O  O     . VAL A 1 467 ? -90.789  14.853  24.431  1.00 78.74  ? 467  VAL A O     1 
ATOM   3575 C  CB    . VAL A 1 467 ? -91.355  16.543  21.567  1.00 82.44  ? 467  VAL A CB    1 
ATOM   3576 C  CG1   . VAL A 1 467 ? -91.364  17.867  20.813  1.00 90.66  ? 467  VAL A CG1   1 
ATOM   3577 C  CG2   . VAL A 1 467 ? -90.170  15.679  21.149  1.00 77.22  ? 467  VAL A CG2   1 
ATOM   3578 N  N     . THR A 1 468 ? -92.929  15.011  23.728  1.00 74.52  ? 468  THR A N     1 
ATOM   3579 C  CA    . THR A 1 468 ? -93.364  13.741  24.318  1.00 77.69  ? 468  THR A CA    1 
ATOM   3580 C  C     . THR A 1 468 ? -93.769  12.736  23.239  1.00 84.92  ? 468  THR A C     1 
ATOM   3581 O  O     . THR A 1 468 ? -94.285  13.120  22.186  1.00 86.47  ? 468  THR A O     1 
ATOM   3582 C  CB    . THR A 1 468 ? -94.539  13.935  25.300  1.00 73.37  ? 468  THR A CB    1 
ATOM   3583 O  OG1   . THR A 1 468 ? -95.581  14.687  24.665  1.00 85.15  ? 468  THR A OG1   1 
ATOM   3584 C  CG2   . THR A 1 468 ? -94.080  14.668  26.556  1.00 70.60  ? 468  THR A CG2   1 
ATOM   3585 N  N     . LEU A 1 469 ? -93.535  11.453  23.509  1.00 80.58  ? 469  LEU A N     1 
ATOM   3586 C  CA    . LEU A 1 469 ? -93.811  10.385  22.543  1.00 83.59  ? 469  LEU A CA    1 
ATOM   3587 C  C     . LEU A 1 469 ? -94.611  9.230   23.149  1.00 90.41  ? 469  LEU A C     1 
ATOM   3588 O  O     . LEU A 1 469 ? -94.621  9.039   24.367  1.00 88.25  ? 469  LEU A O     1 
ATOM   3589 C  CB    . LEU A 1 469 ? -92.504  9.855   21.941  1.00 78.82  ? 469  LEU A CB    1 
ATOM   3590 C  CG    . LEU A 1 469 ? -91.637  10.798  21.099  1.00 76.37  ? 469  LEU A CG    1 
ATOM   3591 C  CD1   . LEU A 1 469 ? -90.208  10.282  21.031  1.00 69.92  ? 469  LEU A CD1   1 
ATOM   3592 C  CD2   . LEU A 1 469 ? -92.209  11.000  19.702  1.00 88.46  ? 469  LEU A CD2   1 
ATOM   3593 N  N     . THR A 1 470 ? -95.276  8.467   22.282  1.00 91.35  ? 470  THR A N     1 
ATOM   3594 C  CA    . THR A 1 470 ? -96.050  7.293   22.690  1.00 91.78  ? 470  THR A CA    1 
ATOM   3595 C  C     . THR A 1 470 ? -95.491  6.020   22.055  1.00 97.96  ? 470  THR A C     1 
ATOM   3596 O  O     . THR A 1 470 ? -95.049  6.039   20.903  1.00 94.45  ? 470  THR A O     1 
ATOM   3597 C  CB    . THR A 1 470 ? -97.542  7.430   22.320  1.00 91.02  ? 470  THR A CB    1 
ATOM   3598 O  OG1   . THR A 1 470 ? -97.667  7.770   20.933  1.00 94.50  ? 470  THR A OG1   1 
ATOM   3599 C  CG2   . THR A 1 470 ? -98.215  8.505   23.167  1.00 80.44  ? 470  THR A CG2   1 
ATOM   3600 N  N     . ASP A 1 471 ? -95.526  4.923   22.816  1.00 101.49 ? 471  ASP A N     1 
ATOM   3601 C  CA    . ASP A 1 471 ? -94.988  3.621   22.396  1.00 104.59 ? 471  ASP A CA    1 
ATOM   3602 C  C     . ASP A 1 471 ? -93.528  3.739   21.941  1.00 95.30  ? 471  ASP A C     1 
ATOM   3603 O  O     . ASP A 1 471 ? -93.219  3.624   20.751  1.00 89.52  ? 471  ASP A O     1 
ATOM   3604 C  CB    . ASP A 1 471 ? -95.870  2.981   21.310  1.00 106.16 ? 471  ASP A CB    1 
ATOM   3605 C  CG    . ASP A 1 471 ? -95.553  1.512   21.082  1.00 107.96 ? 471  ASP A CG    1 
ATOM   3606 O  OD1   . ASP A 1 471 ? -95.666  0.715   22.038  1.00 104.69 ? 471  ASP A OD1   1 
ATOM   3607 O  OD2   . ASP A 1 471 ? -95.188  1.154   19.942  1.00 112.38 ? 471  ASP A OD2   1 
ATOM   3608 N  N     . THR A 1 472 ? -92.641  3.980   22.904  1.00 87.51  ? 472  THR A N     1 
ATOM   3609 C  CA    . THR A 1 472 ? -91.227  4.230   22.619  1.00 86.12  ? 472  THR A CA    1 
ATOM   3610 C  C     . THR A 1 472 ? -90.290  3.668   23.695  1.00 84.06  ? 472  THR A C     1 
ATOM   3611 O  O     . THR A 1 472 ? -90.695  3.461   24.842  1.00 86.38  ? 472  THR A O     1 
ATOM   3612 C  CB    . THR A 1 472 ? -90.950  5.740   22.401  1.00 89.14  ? 472  THR A CB    1 
ATOM   3613 O  OG1   . THR A 1 472 ? -89.559  5.943   22.120  1.00 77.27  ? 472  THR A OG1   1 
ATOM   3614 C  CG2   . THR A 1 472 ? -91.346  6.565   23.628  1.00 85.54  ? 472  THR A CG2   1 
ATOM   3615 N  N     . THR A 1 473 ? -89.041  3.424   23.303  1.00 78.08  ? 473  THR A N     1 
ATOM   3616 C  CA    . THR A 1 473 ? -88.005  2.935   24.214  1.00 74.17  ? 473  THR A CA    1 
ATOM   3617 C  C     . THR A 1 473 ? -86.876  3.959   24.355  1.00 73.35  ? 473  THR A C     1 
ATOM   3618 O  O     . THR A 1 473 ? -86.889  5.000   23.691  1.00 75.18  ? 473  THR A O     1 
ATOM   3619 C  CB    . THR A 1 473 ? -87.425  1.582   23.746  1.00 77.25  ? 473  THR A CB    1 
ATOM   3620 O  OG1   . THR A 1 473 ? -87.014  1.680   22.376  1.00 70.74  ? 473  THR A OG1   1 
ATOM   3621 C  CG2   . THR A 1 473 ? -88.460  0.471   23.886  1.00 78.50  ? 473  THR A CG2   1 
ATOM   3622 N  N     . ASN A 1 474 ? -85.909  3.660   25.222  1.00 75.38  ? 474  ASN A N     1 
ATOM   3623 C  CA    . ASN A 1 474 ? -84.755  4.534   25.457  1.00 69.27  ? 474  ASN A CA    1 
ATOM   3624 C  C     . ASN A 1 474 ? -83.868  4.701   24.223  1.00 69.36  ? 474  ASN A C     1 
ATOM   3625 O  O     . ASN A 1 474 ? -83.251  5.751   24.030  1.00 69.81  ? 474  ASN A O     1 
ATOM   3626 C  CB    . ASN A 1 474 ? -83.918  4.021   26.634  1.00 75.16  ? 474  ASN A CB    1 
ATOM   3627 C  CG    . ASN A 1 474 ? -84.711  3.937   27.926  1.00 78.59  ? 474  ASN A CG    1 
ATOM   3628 O  OD1   . ASN A 1 474 ? -85.736  3.256   27.998  1.00 84.32  ? 474  ASN A OD1   1 
ATOM   3629 N  ND2   . ASN A 1 474 ? -84.232  4.619   28.959  1.00 74.87  ? 474  ASN A ND2   1 
ATOM   3630 N  N     . GLN A 1 475 ? -83.812  3.656   23.400  1.00 71.35  ? 475  GLN A N     1 
ATOM   3631 C  CA    . GLN A 1 475 ? -83.048  3.667   22.154  1.00 71.49  ? 475  GLN A CA    1 
ATOM   3632 C  C     . GLN A 1 475 ? -83.702  4.543   21.084  1.00 72.97  ? 475  GLN A C     1 
ATOM   3633 O  O     . GLN A 1 475 ? -83.010  5.140   20.256  1.00 72.00  ? 475  GLN A O     1 
ATOM   3634 C  CB    . GLN A 1 475 ? -82.865  2.239   21.629  1.00 75.16  ? 475  GLN A CB    1 
ATOM   3635 C  CG    . GLN A 1 475 ? -81.679  1.485   22.223  1.00 73.92  ? 475  GLN A CG    1 
ATOM   3636 C  CD    . GLN A 1 475 ? -81.871  1.097   23.680  1.00 76.98  ? 475  GLN A CD    1 
ATOM   3637 O  OE1   . GLN A 1 475 ? -82.982  0.799   24.120  1.00 82.30  ? 475  GLN A OE1   1 
ATOM   3638 N  NE2   . GLN A 1 475 ? -80.778  1.090   24.435  1.00 70.94  ? 475  GLN A NE2   1 
ATOM   3639 N  N     . LYS A 1 476 ? -85.031  4.614   21.111  1.00 70.76  ? 476  LYS A N     1 
ATOM   3640 C  CA    . LYS A 1 476 ? -85.797  5.405   20.146  1.00 70.20  ? 476  LYS A CA    1 
ATOM   3641 C  C     . LYS A 1 476 ? -85.828  6.892   20.502  1.00 74.13  ? 476  LYS A C     1 
ATOM   3642 O  O     . LYS A 1 476 ? -85.750  7.746   19.616  1.00 74.22  ? 476  LYS A O     1 
ATOM   3643 C  CB    . LYS A 1 476 ? -87.226  4.868   20.015  1.00 75.31  ? 476  LYS A CB    1 
ATOM   3644 C  CG    . LYS A 1 476 ? -87.336  3.510   19.339  1.00 85.36  ? 476  LYS A CG    1 
ATOM   3645 C  CD    . LYS A 1 476 ? -88.786  3.062   19.245  1.00 84.17  ? 476  LYS A CD    1 
ATOM   3646 C  CE    . LYS A 1 476 ? -88.907  1.708   18.566  1.00 75.67  ? 476  LYS A CE    1 
ATOM   3647 N  NZ    . LYS A 1 476 ? -90.324  1.263   18.465  1.00 90.80  ? 476  LYS A NZ    1 
ATOM   3648 N  N     . THR A 1 477 ? -85.944  7.190   21.797  1.00 72.73  ? 477  THR A N     1 
ATOM   3649 C  CA    . THR A 1 477 ? -86.016  8.571   22.288  1.00 68.81  ? 477  THR A CA    1 
ATOM   3650 C  C     . THR A 1 477 ? -84.704  9.332   22.103  1.00 71.49  ? 477  THR A C     1 
ATOM   3651 O  O     . THR A 1 477 ? -84.712  10.530  21.810  1.00 76.19  ? 477  THR A O     1 
ATOM   3652 C  CB    . THR A 1 477 ? -86.427  8.637   23.774  1.00 67.97  ? 477  THR A CB    1 
ATOM   3653 O  OG1   . THR A 1 477 ? -85.621  7.732   24.540  1.00 66.69  ? 477  THR A OG1   1 
ATOM   3654 C  CG2   . THR A 1 477 ? -87.894  8.275   23.943  1.00 77.07  ? 477  THR A CG2   1 
ATOM   3655 N  N     . GLU A 1 478 ? -83.586  8.630   22.280  1.00 64.98  ? 478  GLU A N     1 
ATOM   3656 C  CA    . GLU A 1 478 ? -82.258  9.201   22.068  1.00 65.23  ? 478  GLU A CA    1 
ATOM   3657 C  C     . GLU A 1 478 ? -82.020  9.465   20.581  1.00 67.46  ? 478  GLU A C     1 
ATOM   3658 O  O     . GLU A 1 478 ? -81.332  10.420  20.212  1.00 70.05  ? 478  GLU A O     1 
ATOM   3659 C  CB    . GLU A 1 478 ? -81.182  8.261   22.617  1.00 69.07  ? 478  GLU A CB    1 
ATOM   3660 C  CG    . GLU A 1 478 ? -79.822  8.911   22.831  1.00 75.78  ? 478  GLU A CG    1 
ATOM   3661 C  CD    . GLU A 1 478 ? -79.702  9.640   24.158  1.00 71.84  ? 478  GLU A CD    1 
ATOM   3662 O  OE1   . GLU A 1 478 ? -80.381  9.249   25.132  1.00 60.90  ? 478  GLU A OE1   1 
ATOM   3663 O  OE2   . GLU A 1 478 ? -78.912  10.605  24.230  1.00 70.63  ? 478  GLU A OE2   1 
ATOM   3664 N  N     . LEU A 1 479 ? -82.598  8.609   19.741  1.00 72.41  ? 479  LEU A N     1 
ATOM   3665 C  CA    . LEU A 1 479 ? -82.511  8.742   18.289  1.00 70.39  ? 479  LEU A CA    1 
ATOM   3666 C  C     . LEU A 1 479 ? -83.408  9.873   17.784  1.00 70.65  ? 479  LEU A C     1 
ATOM   3667 O  O     . LEU A 1 479 ? -83.076  10.545  16.805  1.00 65.04  ? 479  LEU A O     1 
ATOM   3668 C  CB    . LEU A 1 479 ? -82.883  7.416   17.615  1.00 67.01  ? 479  LEU A CB    1 
ATOM   3669 C  CG    . LEU A 1 479 ? -82.386  7.134   16.193  1.00 68.11  ? 479  LEU A CG    1 
ATOM   3670 C  CD1   . LEU A 1 479 ? -80.874  6.952   16.151  1.00 57.76  ? 479  LEU A CD1   1 
ATOM   3671 C  CD2   . LEU A 1 479 ? -83.080  5.904   15.629  1.00 69.67  ? 479  LEU A CD2   1 
ATOM   3672 N  N     . GLN A 1 480 ? -84.540  10.074  18.460  1.00 73.67  ? 480  GLN A N     1 
ATOM   3673 C  CA    . GLN A 1 480 ? -85.465  11.170  18.156  1.00 74.06  ? 480  GLN A CA    1 
ATOM   3674 C  C     . GLN A 1 480 ? -84.883  12.531  18.529  1.00 73.68  ? 480  GLN A C     1 
ATOM   3675 O  O     . GLN A 1 480 ? -85.194  13.541  17.895  1.00 75.24  ? 480  GLN A O     1 
ATOM   3676 C  CB    . GLN A 1 480 ? -86.798  10.973  18.886  1.00 72.94  ? 480  GLN A CB    1 
ATOM   3677 C  CG    . GLN A 1 480 ? -87.787  10.056  18.181  1.00 75.03  ? 480  GLN A CG    1 
ATOM   3678 C  CD    . GLN A 1 480 ? -88.488  10.709  16.999  1.00 80.01  ? 480  GLN A CD    1 
ATOM   3679 O  OE1   . GLN A 1 480 ? -88.479  11.932  16.846  1.00 77.80  ? 480  GLN A OE1   1 
ATOM   3680 N  NE2   . GLN A 1 480 ? -89.110  9.890   16.159  1.00 83.37  ? 480  GLN A NE2   1 
ATOM   3681 N  N     . ALA A 1 481 ? -84.046  12.544  19.565  1.00 71.02  ? 481  ALA A N     1 
ATOM   3682 C  CA    . ALA A 1 481 ? -83.416  13.765  20.061  1.00 70.92  ? 481  ALA A CA    1 
ATOM   3683 C  C     . ALA A 1 481 ? -82.443  14.366  19.044  1.00 68.90  ? 481  ALA A C     1 
ATOM   3684 O  O     . ALA A 1 481 ? -82.416  15.584  18.851  1.00 70.80  ? 481  ALA A O     1 
ATOM   3685 C  CB    . ALA A 1 481 ? -82.717  13.495  21.385  1.00 69.87  ? 481  ALA A CB    1 
ATOM   3686 N  N     . ILE A 1 482 ? -81.660  13.504  18.396  1.00 68.33  ? 482  ILE A N     1 
ATOM   3687 C  CA    . ILE A 1 482 ? -80.700  13.923  17.368  1.00 71.74  ? 482  ILE A CA    1 
ATOM   3688 C  C     . ILE A 1 482 ? -81.425  14.416  16.112  1.00 77.95  ? 482  ILE A C     1 
ATOM   3689 O  O     . ILE A 1 482 ? -80.940  15.315  15.420  1.00 76.45  ? 482  ILE A O     1 
ATOM   3690 C  CB    . ILE A 1 482 ? -79.712  12.787  17.010  1.00 65.51  ? 482  ILE A CB    1 
ATOM   3691 C  CG1   . ILE A 1 482 ? -79.107  12.182  18.283  1.00 63.24  ? 482  ILE A CG1   1 
ATOM   3692 C  CG2   . ILE A 1 482 ? -78.606  13.297  16.091  1.00 57.98  ? 482  ILE A CG2   1 
ATOM   3693 C  CD1   . ILE A 1 482 ? -78.502  10.808  18.095  1.00 67.24  ? 482  ILE A CD1   1 
ATOM   3694 N  N     . HIS A 1 483 ? -82.588  13.827  15.835  1.00 75.93  ? 483  HIS A N     1 
ATOM   3695 C  CA    . HIS A 1 483 ? -83.444  14.255  14.727  1.00 75.24  ? 483  HIS A CA    1 
ATOM   3696 C  C     . HIS A 1 483 ? -83.933  15.665  14.923  1.00 75.01  ? 483  HIS A C     1 
ATOM   3697 O  O     . HIS A 1 483 ? -84.012  16.436  13.966  1.00 75.16  ? 483  HIS A O     1 
ATOM   3698 C  CB    . HIS A 1 483 ? -84.621  13.297  14.555  1.00 73.73  ? 483  HIS A CB    1 
ATOM   3699 C  CG    . HIS A 1 483 ? -85.553  13.670  13.427  1.00 68.94  ? 483  HIS A CG    1 
ATOM   3700 N  ND1   . HIS A 1 483 ? -85.269  13.411  12.138  1.00 73.44  ? 483  HIS A ND1   1 
ATOM   3701 C  CD2   . HIS A 1 483 ? -86.795  14.303  13.436  1.00 72.85  ? 483  HIS A CD2   1 
ATOM   3702 C  CE1   . HIS A 1 483 ? -86.274  13.855  11.360  1.00 84.05  ? 483  HIS A CE1   1 
ATOM   3703 N  NE2   . HIS A 1 483 ? -87.208  14.400  12.156  1.00 89.58  ? 483  HIS A NE2   1 
ATOM   3704 N  N     . LEU A 1 484 ? -84.260  16.007  16.169  1.00 71.71  ? 484  LEU A N     1 
ATOM   3705 C  CA    . LEU A 1 484 ? -84.656  17.367  16.538  1.00 70.94  ? 484  LEU A CA    1 
ATOM   3706 C  C     . LEU A 1 484 ? -83.461  18.317  16.515  1.00 72.79  ? 484  LEU A C     1 
ATOM   3707 O  O     . LEU A 1 484 ? -83.610  19.509  16.235  1.00 87.02  ? 484  LEU A O     1 
ATOM   3708 C  CB    . LEU A 1 484 ? -85.303  17.383  17.926  1.00 67.03  ? 484  LEU A CB    1 
ATOM   3709 C  CG    . LEU A 1 484 ? -86.634  16.651  18.130  1.00 76.10  ? 484  LEU A CG    1 
ATOM   3710 C  CD1   . LEU A 1 484 ? -86.813  16.290  19.596  1.00 80.15  ? 484  LEU A CD1   1 
ATOM   3711 C  CD2   . LEU A 1 484 ? -87.812  17.473  17.625  1.00 72.02  ? 484  LEU A CD2   1 
ATOM   3712 N  N     . ALA A 1 485 ? -82.280  17.777  16.814  1.00 73.48  ? 485  ALA A N     1 
ATOM   3713 C  CA    . ALA A 1 485 ? -81.033  18.542  16.801  1.00 77.35  ? 485  ALA A CA    1 
ATOM   3714 C  C     . ALA A 1 485 ? -80.571  18.864  15.380  1.00 75.98  ? 485  ALA A C     1 
ATOM   3715 O  O     . ALA A 1 485 ? -79.789  19.793  15.174  1.00 76.48  ? 485  ALA A O     1 
ATOM   3716 C  CB    . ALA A 1 485 ? -79.946  17.795  17.561  1.00 78.32  ? 485  ALA A CB    1 
ATOM   3717 N  N     . LEU A 1 486 ? -81.053  18.090  14.410  1.00 74.49  ? 486  LEU A N     1 
ATOM   3718 C  CA    . LEU A 1 486 ? -80.759  18.324  12.996  1.00 69.31  ? 486  LEU A CA    1 
ATOM   3719 C  C     . LEU A 1 486 ? -81.888  19.089  12.302  1.00 72.47  ? 486  LEU A C     1 
ATOM   3720 O  O     . LEU A 1 486 ? -81.678  19.702  11.253  1.00 72.26  ? 486  LEU A O     1 
ATOM   3721 C  CB    . LEU A 1 486 ? -80.496  16.998  12.271  1.00 62.01  ? 486  LEU A CB    1 
ATOM   3722 C  CG    . LEU A 1 486 ? -79.201  16.240  12.589  1.00 51.55  ? 486  LEU A CG    1 
ATOM   3723 C  CD1   . LEU A 1 486 ? -79.333  14.775  12.203  1.00 56.69  ? 486  LEU A CD1   1 
ATOM   3724 C  CD2   . LEU A 1 486 ? -77.997  16.871  11.904  1.00 48.60  ? 486  LEU A CD2   1 
ATOM   3725 N  N     . GLN A 1 487 ? -83.078  19.046  12.899  1.00 73.90  ? 487  GLN A N     1 
ATOM   3726 C  CA    . GLN A 1 487 ? -84.262  19.714  12.357  1.00 73.63  ? 487  GLN A CA    1 
ATOM   3727 C  C     . GLN A 1 487 ? -84.209  21.228  12.561  1.00 77.98  ? 487  GLN A C     1 
ATOM   3728 O  O     . GLN A 1 487 ? -84.596  21.993  11.674  1.00 85.95  ? 487  GLN A O     1 
ATOM   3729 C  CB    . GLN A 1 487 ? -85.532  19.143  13.002  1.00 72.88  ? 487  GLN A CB    1 
ATOM   3730 C  CG    . GLN A 1 487 ? -86.836  19.521  12.310  1.00 78.23  ? 487  GLN A CG    1 
ATOM   3731 C  CD    . GLN A 1 487 ? -87.090  18.736  11.033  1.00 96.41  ? 487  GLN A CD    1 
ATOM   3732 O  OE1   . GLN A 1 487 ? -86.641  17.598  10.884  1.00 90.41  ? 487  GLN A OE1   1 
ATOM   3733 N  NE2   . GLN A 1 487 ? -87.822  19.343  10.106  1.00 110.10 ? 487  GLN A NE2   1 
ATOM   3734 N  N     . ASP A 1 488 ? -83.725  21.649  13.728  1.00 77.44  ? 488  ASP A N     1 
ATOM   3735 C  CA    . ASP A 1 488 ? -83.735  23.060  14.117  1.00 78.84  ? 488  ASP A CA    1 
ATOM   3736 C  C     . ASP A 1 488 ? -82.389  23.768  13.920  1.00 76.91  ? 488  ASP A C     1 
ATOM   3737 O  O     . ASP A 1 488 ? -82.296  24.988  14.081  1.00 90.07  ? 488  ASP A O     1 
ATOM   3738 C  CB    . ASP A 1 488 ? -84.200  23.203  15.572  1.00 75.09  ? 488  ASP A CB    1 
ATOM   3739 C  CG    . ASP A 1 488 ? -85.645  22.768  15.774  1.00 77.93  ? 488  ASP A CG    1 
ATOM   3740 O  OD1   . ASP A 1 488 ? -86.019  21.672  15.303  1.00 74.43  ? 488  ASP A OD1   1 
ATOM   3741 O  OD2   . ASP A 1 488 ? -86.405  23.522  16.417  1.00 86.23  ? 488  ASP A OD2   1 
ATOM   3742 N  N     . SER A 1 489 ? -81.359  23.003  13.565  1.00 70.87  ? 489  SER A N     1 
ATOM   3743 C  CA    . SER A 1 489 ? -80.010  23.545  13.389  1.00 74.53  ? 489  SER A CA    1 
ATOM   3744 C  C     . SER A 1 489 ? -79.763  24.085  11.980  1.00 80.22  ? 489  SER A C     1 
ATOM   3745 O  O     . SER A 1 489 ? -80.582  23.894  11.077  1.00 76.66  ? 489  SER A O     1 
ATOM   3746 C  CB    . SER A 1 489 ? -78.961  22.486  13.736  1.00 77.43  ? 489  SER A CB    1 
ATOM   3747 O  OG    . SER A 1 489 ? -79.093  21.342  12.910  1.00 82.01  ? 489  SER A OG    1 
ATOM   3748 N  N     . GLY A 1 490 ? -78.627  24.759  11.805  1.00 83.18  ? 490  GLY A N     1 
ATOM   3749 C  CA    . GLY A 1 490 ? -78.233  25.316  10.514  1.00 88.39  ? 490  GLY A CA    1 
ATOM   3750 C  C     . GLY A 1 490 ? -77.532  24.302  9.630   1.00 81.03  ? 490  GLY A C     1 
ATOM   3751 O  O     . GLY A 1 490 ? -78.042  23.202  9.412   1.00 81.01  ? 490  GLY A O     1 
ATOM   3752 N  N     . LEU A 1 491 ? -76.360  24.677  9.122   1.00 81.35  ? 491  LEU A N     1 
ATOM   3753 C  CA    . LEU A 1 491 ? -75.581  23.815  8.231   1.00 81.27  ? 491  LEU A CA    1 
ATOM   3754 C  C     . LEU A 1 491 ? -74.401  23.170  8.961   1.00 79.50  ? 491  LEU A C     1 
ATOM   3755 O  O     . LEU A 1 491 ? -74.252  21.946  8.945   1.00 86.33  ? 491  LEU A O     1 
ATOM   3756 C  CB    . LEU A 1 491 ? -75.108  24.589  6.992   1.00 91.37  ? 491  LEU A CB    1 
ATOM   3757 C  CG    . LEU A 1 491 ? -76.133  24.887  5.887   1.00 84.37  ? 491  LEU A CG    1 
ATOM   3758 C  CD1   . LEU A 1 491 ? -77.046  26.053  6.245   1.00 69.35  ? 491  LEU A CD1   1 
ATOM   3759 C  CD2   . LEU A 1 491 ? -75.426  25.166  4.570   1.00 86.97  ? 491  LEU A CD2   1 
ATOM   3760 N  N     . GLU A 1 492 ? -73.570  23.997  9.593   1.00 79.79  ? 492  GLU A N     1 
ATOM   3761 C  CA    . GLU A 1 492 ? -72.489  23.510  10.449  1.00 89.76  ? 492  GLU A CA    1 
ATOM   3762 C  C     . GLU A 1 492 ? -73.034  23.270  11.854  1.00 89.36  ? 492  GLU A C     1 
ATOM   3763 O  O     . GLU A 1 492 ? -73.520  24.198  12.506  1.00 91.36  ? 492  GLU A O     1 
ATOM   3764 C  CB    . GLU A 1 492 ? -71.323  24.505  10.483  1.00 89.98  ? 492  GLU A CB    1 
ATOM   3765 C  CG    . GLU A 1 492 ? -70.440  24.498  9.240   1.00 80.88  ? 492  GLU A CG    1 
ATOM   3766 C  CD    . GLU A 1 492 ? -70.961  25.374  8.111   1.00 88.10  ? 492  GLU A CD    1 
ATOM   3767 O  OE1   . GLU A 1 492 ? -72.063  25.952  8.237   1.00 98.29  ? 492  GLU A OE1   1 
ATOM   3768 O  OE2   . GLU A 1 492 ? -70.258  25.487  7.085   1.00 90.70  ? 492  GLU A OE2   1 
ATOM   3769 N  N     . VAL A 1 493 ? -72.967  22.019  12.306  1.00 82.27  ? 493  VAL A N     1 
ATOM   3770 C  CA    . VAL A 1 493 ? -73.569  21.618  13.581  1.00 71.85  ? 493  VAL A CA    1 
ATOM   3771 C  C     . VAL A 1 493 ? -72.612  20.778  14.431  1.00 70.77  ? 493  VAL A C     1 
ATOM   3772 O  O     . VAL A 1 493 ? -71.913  19.902  13.915  1.00 69.00  ? 493  VAL A O     1 
ATOM   3773 C  CB    . VAL A 1 493 ? -74.882  20.819  13.377  1.00 67.79  ? 493  VAL A CB    1 
ATOM   3774 C  CG1   . VAL A 1 493 ? -75.709  20.805  14.656  1.00 67.54  ? 493  VAL A CG1   1 
ATOM   3775 C  CG2   . VAL A 1 493 ? -75.710  21.387  12.231  1.00 74.89  ? 493  VAL A CG2   1 
ATOM   3776 N  N     . ASN A 1 494 ? -72.591  21.060  15.732  1.00 69.25  ? 494  ASN A N     1 
ATOM   3777 C  CA    . ASN A 1 494 ? -71.876  20.240  16.708  1.00 66.98  ? 494  ASN A CA    1 
ATOM   3778 C  C     . ASN A 1 494 ? -72.863  19.569  17.661  1.00 64.01  ? 494  ASN A C     1 
ATOM   3779 O  O     . ASN A 1 494 ? -73.539  20.244  18.439  1.00 67.19  ? 494  ASN A O     1 
ATOM   3780 C  CB    . ASN A 1 494 ? -70.864  21.083  17.492  1.00 67.39  ? 494  ASN A CB    1 
ATOM   3781 C  CG    . ASN A 1 494 ? -69.717  21.582  16.630  1.00 71.01  ? 494  ASN A CG    1 
ATOM   3782 O  OD1   . ASN A 1 494 ? -69.203  20.862  15.772  1.00 72.89  ? 494  ASN A OD1   1 
ATOM   3783 N  ND2   . ASN A 1 494 ? -69.301  22.821  16.865  1.00 77.42  ? 494  ASN A ND2   1 
ATOM   3784 N  N     . ILE A 1 495 ? -72.946  18.242  17.588  1.00 64.99  ? 495  ILE A N     1 
ATOM   3785 C  CA    . ILE A 1 495 ? -73.911  17.477  18.385  1.00 61.69  ? 495  ILE A CA    1 
ATOM   3786 C  C     . ILE A 1 495 ? -73.206  16.594  19.418  1.00 57.56  ? 495  ILE A C     1 
ATOM   3787 O  O     . ILE A 1 495 ? -72.281  15.850  19.085  1.00 61.80  ? 495  ILE A O     1 
ATOM   3788 C  CB    . ILE A 1 495 ? -74.839  16.614  17.493  1.00 60.03  ? 495  ILE A CB    1 
ATOM   3789 C  CG1   . ILE A 1 495 ? -75.452  17.458  16.368  1.00 58.68  ? 495  ILE A CG1   1 
ATOM   3790 C  CG2   . ILE A 1 495 ? -75.936  15.959  18.326  1.00 58.20  ? 495  ILE A CG2   1 
ATOM   3791 C  CD1   . ILE A 1 495 ? -75.949  16.656  15.182  1.00 60.09  ? 495  ILE A CD1   1 
ATOM   3792 N  N     . VAL A 1 496 ? -73.653  16.693  20.669  1.00 52.26  ? 496  VAL A N     1 
ATOM   3793 C  CA    . VAL A 1 496 ? -73.110  15.891  21.767  1.00 57.78  ? 496  VAL A CA    1 
ATOM   3794 C  C     . VAL A 1 496 ? -74.206  15.003  22.361  1.00 54.87  ? 496  VAL A C     1 
ATOM   3795 O  O     . VAL A 1 496 ? -75.264  15.494  22.764  1.00 55.71  ? 496  VAL A O     1 
ATOM   3796 C  CB    . VAL A 1 496 ? -72.486  16.776  22.875  1.00 54.71  ? 496  VAL A CB    1 
ATOM   3797 C  CG1   . VAL A 1 496 ? -71.797  15.919  23.929  1.00 51.99  ? 496  VAL A CG1   1 
ATOM   3798 C  CG2   . VAL A 1 496 ? -71.496  17.773  22.286  1.00 58.73  ? 496  VAL A CG2   1 
ATOM   3799 N  N     . THR A 1 497 ? -73.945  13.698  22.402  1.00 51.62  ? 497  THR A N     1 
ATOM   3800 C  CA    . THR A 1 497 ? -74.889  12.722  22.957  1.00 55.89  ? 497  THR A CA    1 
ATOM   3801 C  C     . THR A 1 497 ? -74.211  11.797  23.974  1.00 56.95  ? 497  THR A C     1 
ATOM   3802 O  O     . THR A 1 497 ? -72.988  11.641  23.962  1.00 59.48  ? 497  THR A O     1 
ATOM   3803 C  CB    . THR A 1 497 ? -75.583  11.895  21.846  1.00 56.29  ? 497  THR A CB    1 
ATOM   3804 O  OG1   . THR A 1 497 ? -76.521  10.984  22.434  1.00 56.47  ? 497  THR A OG1   1 
ATOM   3805 C  CG2   . THR A 1 497 ? -74.567  11.111  21.011  1.00 56.31  ? 497  THR A CG2   1 
ATOM   3806 N  N     . ASP A 1 498 ? -75.011  11.191  24.850  1.00 60.39  ? 498  ASP A N     1 
ATOM   3807 C  CA    . ASP A 1 498 ? -74.487  10.292  25.882  1.00 60.06  ? 498  ASP A CA    1 
ATOM   3808 C  C     . ASP A 1 498 ? -74.712  8.802   25.603  1.00 57.87  ? 498  ASP A C     1 
ATOM   3809 O  O     . ASP A 1 498 ? -74.439  7.955   26.459  1.00 60.17  ? 498  ASP A O     1 
ATOM   3810 C  CB    . ASP A 1 498 ? -75.106  10.650  27.235  1.00 56.46  ? 498  ASP A CB    1 
ATOM   3811 C  CG    . ASP A 1 498 ? -76.615  10.503  27.242  1.00 62.94  ? 498  ASP A CG    1 
ATOM   3812 O  OD1   . ASP A 1 498 ? -77.273  10.200  26.224  1.00 73.59  ? 498  ASP A OD1   1 
ATOM   3813 O  OD2   . ASP A 1 498 ? -77.227  10.694  28.313  1.00 55.89  ? 498  ASP A OD2   1 
ATOM   3814 N  N     . SER A 1 499 ? -75.198  8.490   24.404  1.00 58.33  ? 499  SER A N     1 
ATOM   3815 C  CA    . SER A 1 499 ? -75.496  7.110   24.027  1.00 64.79  ? 499  SER A CA    1 
ATOM   3816 C  C     . SER A 1 499 ? -74.447  6.524   23.086  1.00 66.26  ? 499  SER A C     1 
ATOM   3817 O  O     . SER A 1 499 ? -74.045  7.160   22.109  1.00 63.10  ? 499  SER A O     1 
ATOM   3818 C  CB    . SER A 1 499 ? -76.884  7.015   23.391  1.00 64.15  ? 499  SER A CB    1 
ATOM   3819 O  OG    . SER A 1 499 ? -77.238  5.668   23.127  1.00 77.69  ? 499  SER A OG    1 
ATOM   3820 N  N     . GLN A 1 500 ? -74.013  5.305   23.399  1.00 68.53  ? 500  GLN A N     1 
ATOM   3821 C  CA    . GLN A 1 500 ? -73.089  4.554   22.554  1.00 65.84  ? 500  GLN A CA    1 
ATOM   3822 C  C     . GLN A 1 500 ? -73.850  3.901   21.400  1.00 67.06  ? 500  GLN A C     1 
ATOM   3823 O  O     . GLN A 1 500 ? -73.279  3.625   20.342  1.00 71.83  ? 500  GLN A O     1 
ATOM   3824 C  CB    . GLN A 1 500 ? -72.368  3.485   23.381  1.00 70.41  ? 500  GLN A CB    1 
ATOM   3825 C  CG    . GLN A 1 500 ? -71.025  3.040   22.818  1.00 77.51  ? 500  GLN A CG    1 
ATOM   3826 C  CD    . GLN A 1 500 ? -69.895  4.000   23.148  1.00 83.21  ? 500  GLN A CD    1 
ATOM   3827 O  OE1   . GLN A 1 500 ? -69.736  4.427   24.293  1.00 86.62  ? 500  GLN A OE1   1 
ATOM   3828 N  NE2   . GLN A 1 500 ? -69.094  4.336   22.143  1.00 86.97  ? 500  GLN A NE2   1 
ATOM   3829 N  N     . TYR A 1 501 ? -75.142  3.662   21.623  1.00 63.93  ? 501  TYR A N     1 
ATOM   3830 C  CA    . TYR A 1 501 ? -76.043  3.091   20.624  1.00 68.87  ? 501  TYR A CA    1 
ATOM   3831 C  C     . TYR A 1 501 ? -76.318  4.077   19.488  1.00 70.73  ? 501  TYR A C     1 
ATOM   3832 O  O     . TYR A 1 501 ? -76.213  3.722   18.311  1.00 71.64  ? 501  TYR A O     1 
ATOM   3833 C  CB    . TYR A 1 501 ? -77.355  2.658   21.295  1.00 64.53  ? 501  TYR A CB    1 
ATOM   3834 C  CG    . TYR A 1 501 ? -78.482  2.301   20.345  1.00 69.39  ? 501  TYR A CG    1 
ATOM   3835 C  CD1   . TYR A 1 501 ? -78.627  1.002   19.862  1.00 73.56  ? 501  TYR A CD1   1 
ATOM   3836 C  CD2   . TYR A 1 501 ? -79.413  3.261   19.945  1.00 70.20  ? 501  TYR A CD2   1 
ATOM   3837 C  CE1   . TYR A 1 501 ? -79.660  0.670   18.998  1.00 83.92  ? 501  TYR A CE1   1 
ATOM   3838 C  CE2   . TYR A 1 501 ? -80.447  2.940   19.079  1.00 71.81  ? 501  TYR A CE2   1 
ATOM   3839 C  CZ    . TYR A 1 501 ? -80.569  1.644   18.613  1.00 78.97  ? 501  TYR A CZ    1 
ATOM   3840 O  OH    . TYR A 1 501 ? -81.594  1.320   17.754  1.00 83.41  ? 501  TYR A OH    1 
ATOM   3841 N  N     . ALA A 1 502 ? -76.674  5.307   19.854  1.00 71.27  ? 502  ALA A N     1 
ATOM   3842 C  CA    . ALA A 1 502 ? -76.994  6.361   18.891  1.00 67.42  ? 502  ALA A CA    1 
ATOM   3843 C  C     . ALA A 1 502 ? -75.766  6.801   18.096  1.00 65.18  ? 502  ALA A C     1 
ATOM   3844 O  O     . ALA A 1 502 ? -75.871  7.136   16.915  1.00 65.64  ? 502  ALA A O     1 
ATOM   3845 C  CB    . ALA A 1 502 ? -77.625  7.548   19.602  1.00 70.36  ? 502  ALA A CB    1 
ATOM   3846 N  N     . LEU A 1 503 ? -74.609  6.797   18.756  1.00 66.51  ? 503  LEU A N     1 
ATOM   3847 C  CA    . LEU A 1 503 ? -73.334  7.127   18.122  1.00 62.89  ? 503  LEU A CA    1 
ATOM   3848 C  C     . LEU A 1 503 ? -72.908  6.037   17.138  1.00 68.60  ? 503  LEU A C     1 
ATOM   3849 O  O     . LEU A 1 503 ? -72.396  6.335   16.059  1.00 68.25  ? 503  LEU A O     1 
ATOM   3850 C  CB    . LEU A 1 503 ? -72.249  7.330   19.187  1.00 65.54  ? 503  LEU A CB    1 
ATOM   3851 C  CG    . LEU A 1 503 ? -70.850  7.781   18.747  1.00 63.75  ? 503  LEU A CG    1 
ATOM   3852 C  CD1   . LEU A 1 503 ? -70.771  9.295   18.627  1.00 55.43  ? 503  LEU A CD1   1 
ATOM   3853 C  CD2   . LEU A 1 503 ? -69.801  7.274   19.724  1.00 75.88  ? 503  LEU A CD2   1 
ATOM   3854 N  N     . GLY A 1 504 ? -73.132  4.781   17.522  1.00 74.95  ? 504  GLY A N     1 
ATOM   3855 C  CA    . GLY A 1 504 ? -72.718  3.621   16.730  1.00 78.27  ? 504  GLY A CA    1 
ATOM   3856 C  C     . GLY A 1 504 ? -73.439  3.450   15.405  1.00 68.22  ? 504  GLY A C     1 
ATOM   3857 O  O     . GLY A 1 504 ? -72.848  2.979   14.431  1.00 69.18  ? 504  GLY A O     1 
ATOM   3858 N  N     . ILE A 1 505 ? -74.715  3.830   15.369  1.00 64.64  ? 505  ILE A N     1 
ATOM   3859 C  CA    . ILE A 1 505 ? -75.534  3.711   14.159  1.00 62.34  ? 505  ILE A CA    1 
ATOM   3860 C  C     . ILE A 1 505 ? -75.173  4.780   13.123  1.00 60.92  ? 505  ILE A C     1 
ATOM   3861 O  O     . ILE A 1 505 ? -74.972  4.467   11.946  1.00 67.44  ? 505  ILE A O     1 
ATOM   3862 C  CB    . ILE A 1 505 ? -77.048  3.744   14.485  1.00 54.75  ? 505  ILE A CB    1 
ATOM   3863 C  CG1   . ILE A 1 505 ? -77.452  2.476   15.247  1.00 58.03  ? 505  ILE A CG1   1 
ATOM   3864 C  CG2   . ILE A 1 505 ? -77.882  3.889   13.216  1.00 55.47  ? 505  ILE A CG2   1 
ATOM   3865 C  CD1   . ILE A 1 505 ? -78.878  2.478   15.756  1.00 55.74  ? 505  ILE A CD1   1 
ATOM   3866 N  N     . ILE A 1 506 ? -75.083  6.031   13.572  1.00 60.07  ? 506  ILE A N     1 
ATOM   3867 C  CA    . ILE A 1 506 ? -74.757  7.169   12.703  1.00 62.35  ? 506  ILE A CA    1 
ATOM   3868 C  C     . ILE A 1 506 ? -73.328  7.073   12.154  1.00 64.06  ? 506  ILE A C     1 
ATOM   3869 O  O     . ILE A 1 506 ? -73.057  7.510   11.033  1.00 71.15  ? 506  ILE A O     1 
ATOM   3870 C  CB    . ILE A 1 506 ? -74.980  8.522   13.425  1.00 62.69  ? 506  ILE A CB    1 
ATOM   3871 C  CG1   . ILE A 1 506 ? -76.429  8.631   13.920  1.00 61.22  ? 506  ILE A CG1   1 
ATOM   3872 C  CG2   . ILE A 1 506 ? -74.648  9.696   12.510  1.00 64.73  ? 506  ILE A CG2   1 
ATOM   3873 C  CD1   . ILE A 1 506 ? -76.675  9.754   14.908  1.00 71.34  ? 506  ILE A CD1   1 
ATOM   3874 N  N     . GLN A 1 507 ? -72.428  6.488   12.945  1.00 59.76  ? 507  GLN A N     1 
ATOM   3875 C  CA    . GLN A 1 507 ? -71.040  6.274   12.529  1.00 62.76  ? 507  GLN A CA    1 
ATOM   3876 C  C     . GLN A 1 507 ? -70.947  5.219   11.420  1.00 70.08  ? 507  GLN A C     1 
ATOM   3877 O  O     . GLN A 1 507 ? -69.976  5.191   10.660  1.00 81.12  ? 507  GLN A O     1 
ATOM   3878 C  CB    . GLN A 1 507 ? -70.176  5.882   13.730  1.00 64.66  ? 507  GLN A CB    1 
ATOM   3879 C  CG    . GLN A 1 507 ? -68.745  6.395   13.664  1.00 71.31  ? 507  GLN A CG    1 
ATOM   3880 C  CD    . GLN A 1 507 ? -68.124  6.590   15.037  1.00 78.10  ? 507  GLN A CD    1 
ATOM   3881 O  OE1   . GLN A 1 507 ? -68.269  5.751   15.928  1.00 85.97  ? 507  GLN A OE1   1 
ATOM   3882 N  NE2   . GLN A 1 507 ? -67.419  7.702   15.211  1.00 72.41  ? 507  GLN A NE2   1 
ATOM   3883 N  N     . ALA A 1 508 ? -71.962  4.360   11.344  1.00 69.47  ? 508  ALA A N     1 
ATOM   3884 C  CA    . ALA A 1 508 ? -72.124  3.416   10.240  1.00 73.84  ? 508  ALA A CA    1 
ATOM   3885 C  C     . ALA A 1 508 ? -73.080  3.997   9.194   1.00 79.24  ? 508  ALA A C     1 
ATOM   3886 O  O     . ALA A 1 508 ? -73.599  5.102   9.370   1.00 93.79  ? 508  ALA A O     1 
ATOM   3887 C  CB    . ALA A 1 508 ? -72.634  2.078   10.757  1.00 57.37  ? 508  ALA A CB    1 
ATOM   3888 N  N     . GLN A 1 509 ? -73.310  3.258   8.109   1.00 71.08  ? 509  GLN A N     1 
ATOM   3889 C  CA    . GLN A 1 509 ? -74.179  3.724   7.024   1.00 75.06  ? 509  GLN A CA    1 
ATOM   3890 C  C     . GLN A 1 509 ? -75.320  2.737   6.734   1.00 75.27  ? 509  GLN A C     1 
ATOM   3891 O  O     . GLN A 1 509 ? -75.281  2.029   5.725   1.00 87.20  ? 509  GLN A O     1 
ATOM   3892 C  CB    . GLN A 1 509 ? -73.361  3.981   5.749   1.00 83.95  ? 509  GLN A CB    1 
ATOM   3893 C  CG    . GLN A 1 509 ? -72.204  4.961   5.904   1.00 74.31  ? 509  GLN A CG    1 
ATOM   3894 C  CD    . GLN A 1 509 ? -72.654  6.403   6.058   1.00 71.83  ? 509  GLN A CD    1 
ATOM   3895 O  OE1   . GLN A 1 509 ? -73.567  6.862   5.370   1.00 79.79  ? 509  GLN A OE1   1 
ATOM   3896 N  NE2   . GLN A 1 509 ? -72.002  7.129   6.959   1.00 69.45  ? 509  GLN A NE2   1 
ATOM   3897 N  N     . PRO A 1 510 ? -76.350  2.703   7.605   1.00 67.48  ? 510  PRO A N     1 
ATOM   3898 C  CA    . PRO A 1 510 ? -77.419  1.702   7.492   1.00 73.66  ? 510  PRO A CA    1 
ATOM   3899 C  C     . PRO A 1 510 ? -78.236  1.809   6.201   1.00 76.82  ? 510  PRO A C     1 
ATOM   3900 O  O     . PRO A 1 510 ? -79.052  2.724   6.053   1.00 73.67  ? 510  PRO A O     1 
ATOM   3901 C  CB    . PRO A 1 510 ? -78.305  1.985   8.717   1.00 75.91  ? 510  PRO A CB    1 
ATOM   3902 C  CG    . PRO A 1 510 ? -77.462  2.803   9.636   1.00 67.93  ? 510  PRO A CG    1 
ATOM   3903 C  CD    . PRO A 1 510 ? -76.593  3.620   8.732   1.00 71.98  ? 510  PRO A CD    1 
ATOM   3904 N  N     . ASP A 1 511 ? -78.001  0.878   5.278   1.00 79.99  ? 511  ASP A N     1 
ATOM   3905 C  CA    . ASP A 1 511 ? -78.773  0.792   4.040   1.00 89.97  ? 511  ASP A CA    1 
ATOM   3906 C  C     . ASP A 1 511 ? -79.827  -0.308  4.150   1.00 91.20  ? 511  ASP A C     1 
ATOM   3907 O  O     . ASP A 1 511 ? -79.667  -1.403  3.601   1.00 100.21 ? 511  ASP A O     1 
ATOM   3908 C  CB    . ASP A 1 511 ? -77.860  0.548   2.832   1.00 93.21  ? 511  ASP A CB    1 
ATOM   3909 C  CG    . ASP A 1 511 ? -78.618  0.565   1.512   1.00 96.43  ? 511  ASP A CG    1 
ATOM   3910 O  OD1   . ASP A 1 511 ? -79.138  1.634   1.128   1.00 103.95 ? 511  ASP A OD1   1 
ATOM   3911 O  OD2   . ASP A 1 511 ? -78.690  -0.495  0.856   1.00 92.07  ? 511  ASP A OD2   1 
ATOM   3912 N  N     . GLN A 1 512 ? -80.899  -0.002  4.876   1.00 86.89  ? 512  GLN A N     1 
ATOM   3913 C  CA    . GLN A 1 512 ? -82.008  -0.929  5.082   1.00 93.23  ? 512  GLN A CA    1 
ATOM   3914 C  C     . GLN A 1 512 ? -83.225  -0.191  5.627   1.00 89.02  ? 512  GLN A C     1 
ATOM   3915 O  O     . GLN A 1 512 ? -83.173  1.017   5.875   1.00 81.06  ? 512  GLN A O     1 
ATOM   3916 C  CB    . GLN A 1 512 ? -81.604  -2.048  6.049   1.00 95.17  ? 512  GLN A CB    1 
ATOM   3917 N  N     . SER A 1 513 ? -84.319  -0.925  5.807   1.00 92.00  ? 513  SER A N     1 
ATOM   3918 C  CA    . SER A 1 513 ? -85.511  -0.387  6.446   1.00 94.44  ? 513  SER A CA    1 
ATOM   3919 C  C     . SER A 1 513 ? -85.390  -0.512  7.966   1.00 105.73 ? 513  SER A C     1 
ATOM   3920 O  O     . SER A 1 513 ? -86.180  -1.208  8.610   1.00 97.90  ? 513  SER A O     1 
ATOM   3921 C  CB    . SER A 1 513 ? -86.768  -1.097  5.930   1.00 83.65  ? 513  SER A CB    1 
ATOM   3922 O  OG    . SER A 1 513 ? -86.712  -2.490  6.183   1.00 92.98  ? 513  SER A OG    1 
ATOM   3923 N  N     . GLU A 1 514 ? -84.390  0.167   8.531   1.00 100.93 ? 514  GLU A N     1 
ATOM   3924 C  CA    . GLU A 1 514 ? -84.178  0.183   9.980   1.00 103.22 ? 514  GLU A CA    1 
ATOM   3925 C  C     . GLU A 1 514 ? -85.175  1.129   10.661  1.00 107.24 ? 514  GLU A C     1 
ATOM   3926 O  O     . GLU A 1 514 ? -84.841  1.835   11.617  1.00 104.38 ? 514  GLU A O     1 
ATOM   3927 C  CB    . GLU A 1 514 ? -82.725  0.544   10.323  1.00 101.81 ? 514  GLU A CB    1 
ATOM   3928 C  CG    . GLU A 1 514 ? -82.276  0.076   11.704  1.00 104.75 ? 514  GLU A CG    1 
ATOM   3929 C  CD    . GLU A 1 514 ? -80.817  0.374   12.000  1.00 103.18 ? 514  GLU A CD    1 
ATOM   3930 O  OE1   . GLU A 1 514 ? -79.968  0.204   11.097  1.00 107.24 ? 514  GLU A OE1   1 
ATOM   3931 O  OE2   . GLU A 1 514 ? -80.514  0.768   13.146  1.00 92.57  ? 514  GLU A OE2   1 
ATOM   3932 N  N     . SER A 1 515 ? -86.401  1.127   10.138  1.00 97.00  ? 515  SER A N     1 
ATOM   3933 C  CA    . SER A 1 515 ? -87.552  1.844   10.697  1.00 89.95  ? 515  SER A CA    1 
ATOM   3934 C  C     . SER A 1 515 ? -87.463  3.373   10.683  1.00 89.60  ? 515  SER A C     1 
ATOM   3935 O  O     . SER A 1 515 ? -86.800  3.976   11.530  1.00 91.98  ? 515  SER A O     1 
ATOM   3936 C  CB    . SER A 1 515 ? -87.896  1.331   12.105  1.00 86.84  ? 515  SER A CB    1 
ATOM   3937 N  N     . GLU A 1 516 ? -88.126  3.971   9.692   1.00 82.88  ? 516  GLU A N     1 
ATOM   3938 C  CA    . GLU A 1 516 ? -88.549  5.379   9.707   1.00 80.23  ? 516  GLU A CA    1 
ATOM   3939 C  C     . GLU A 1 516 ? -87.489  6.406   10.134  1.00 79.82  ? 516  GLU A C     1 
ATOM   3940 O  O     . GLU A 1 516 ? -86.981  7.166   9.307   1.00 77.69  ? 516  GLU A O     1 
ATOM   3941 C  CB    . GLU A 1 516 ? -89.802  5.511   10.586  1.00 91.78  ? 516  GLU A CB    1 
ATOM   3942 C  CG    . GLU A 1 516 ? -90.732  6.662   10.239  1.00 102.96 ? 516  GLU A CG    1 
ATOM   3943 C  CD    . GLU A 1 516 ? -92.060  6.575   10.972  1.00 121.09 ? 516  GLU A CD    1 
ATOM   3944 O  OE1   . GLU A 1 516 ? -92.671  5.484   10.986  1.00 126.43 ? 516  GLU A OE1   1 
ATOM   3945 O  OE2   . GLU A 1 516 ? -92.499  7.603   11.529  1.00 120.67 ? 516  GLU A OE2   1 
ATOM   3946 N  N     . LEU A 1 517 ? -87.176  6.409   11.429  1.00 80.62  ? 517  LEU A N     1 
ATOM   3947 C  CA    . LEU A 1 517 ? -86.309  7.399   12.068  1.00 73.24  ? 517  LEU A CA    1 
ATOM   3948 C  C     . LEU A 1 517 ? -84.892  7.445   11.490  1.00 72.90  ? 517  LEU A C     1 
ATOM   3949 O  O     . LEU A 1 517 ? -84.358  8.527   11.236  1.00 72.73  ? 517  LEU A O     1 
ATOM   3950 C  CB    . LEU A 1 517 ? -86.237  7.110   13.571  1.00 64.84  ? 517  LEU A CB    1 
ATOM   3951 C  CG    . LEU A 1 517 ? -86.375  8.235   14.601  1.00 67.14  ? 517  LEU A CG    1 
ATOM   3952 C  CD1   . LEU A 1 517 ? -86.452  7.621   15.989  1.00 73.80  ? 517  LEU A CD1   1 
ATOM   3953 C  CD2   . LEU A 1 517 ? -85.243  9.249   14.527  1.00 68.11  ? 517  LEU A CD2   1 
ATOM   3954 N  N     . VAL A 1 518 ? -84.297  6.269   11.293  1.00 70.28  ? 518  VAL A N     1 
ATOM   3955 C  CA    . VAL A 1 518 ? -82.914  6.144   10.816  1.00 70.87  ? 518  VAL A CA    1 
ATOM   3956 C  C     . VAL A 1 518 ? -82.746  6.726   9.408   1.00 74.76  ? 518  VAL A C     1 
ATOM   3957 O  O     . VAL A 1 518 ? -81.780  7.446   9.141   1.00 73.94  ? 518  VAL A O     1 
ATOM   3958 C  CB    . VAL A 1 518 ? -82.422  4.676   10.866  1.00 75.87  ? 518  VAL A CB    1 
ATOM   3959 C  CG1   . VAL A 1 518 ? -80.991  4.555   10.359  1.00 72.38  ? 518  VAL A CG1   1 
ATOM   3960 C  CG2   . VAL A 1 518 ? -82.517  4.129   12.283  1.00 74.96  ? 518  VAL A CG2   1 
ATOM   3961 N  N     . ASN A 1 519 ? -83.696  6.423   8.525   1.00 77.46  ? 519  ASN A N     1 
ATOM   3962 C  CA    . ASN A 1 519 ? -83.689  6.934   7.153   1.00 75.95  ? 519  ASN A CA    1 
ATOM   3963 C  C     . ASN A 1 519 ? -83.860  8.452   7.069   1.00 77.30  ? 519  ASN A C     1 
ATOM   3964 O  O     . ASN A 1 519 ? -83.409  9.079   6.109   1.00 81.50  ? 519  ASN A O     1 
ATOM   3965 C  CB    . ASN A 1 519 ? -84.761  6.234   6.311   1.00 76.84  ? 519  ASN A CB    1 
ATOM   3966 C  CG    . ASN A 1 519 ? -84.461  4.762   6.084   1.00 77.41  ? 519  ASN A CG    1 
ATOM   3967 O  OD1   . ASN A 1 519 ? -83.319  4.375   5.830   1.00 73.58  ? 519  ASN A OD1   1 
ATOM   3968 N  ND2   . ASN A 1 519 ? -85.494  3.932   6.167   1.00 84.27  ? 519  ASN A ND2   1 
ATOM   3969 N  N     . GLN A 1 520 ? -84.512  9.029   8.077   1.00 73.23  ? 520  GLN A N     1 
ATOM   3970 C  CA    . GLN A 1 520 ? -84.704  10.477  8.162   1.00 74.56  ? 520  GLN A CA    1 
ATOM   3971 C  C     . GLN A 1 520 ? -83.422  11.198  8.578   1.00 75.15  ? 520  GLN A C     1 
ATOM   3972 O  O     . GLN A 1 520 ? -83.112  12.268  8.050   1.00 77.24  ? 520  GLN A O     1 
ATOM   3973 C  CB    . GLN A 1 520 ? -85.846  10.820  9.125   1.00 66.68  ? 520  GLN A CB    1 
ATOM   3974 C  CG    . GLN A 1 520 ? -87.232  10.469  8.602   1.00 68.98  ? 520  GLN A CG    1 
ATOM   3975 C  CD    . GLN A 1 520 ? -88.336  10.770  9.599   1.00 73.32  ? 520  GLN A CD    1 
ATOM   3976 O  OE1   . GLN A 1 520 ? -88.443  11.884  10.114  1.00 73.59  ? 520  GLN A OE1   1 
ATOM   3977 N  NE2   . GLN A 1 520 ? -89.174  9.775   9.868   1.00 75.87  ? 520  GLN A NE2   1 
ATOM   3978 N  N     . ILE A 1 521 ? -82.686  10.607  9.520   1.00 71.33  ? 521  ILE A N     1 
ATOM   3979 C  CA    . ILE A 1 521 ? -81.418  11.167  10.001  1.00 72.26  ? 521  ILE A CA    1 
ATOM   3980 C  C     . ILE A 1 521 ? -80.346  11.125  8.907   1.00 76.66  ? 521  ILE A C     1 
ATOM   3981 O  O     . ILE A 1 521 ? -79.620  12.103  8.707   1.00 74.64  ? 521  ILE A O     1 
ATOM   3982 C  CB    . ILE A 1 521 ? -80.919  10.453  11.282  1.00 70.71  ? 521  ILE A CB    1 
ATOM   3983 C  CG1   . ILE A 1 521 ? -81.937  10.618  12.417  1.00 71.64  ? 521  ILE A CG1   1 
ATOM   3984 C  CG2   . ILE A 1 521 ? -79.558  10.991  11.713  1.00 71.91  ? 521  ILE A CG2   1 
ATOM   3985 C  CD1   . ILE A 1 521 ? -81.643  9.784   13.647  1.00 66.05  ? 521  ILE A CD1   1 
ATOM   3986 N  N     . ILE A 1 522 ? -80.264  9.996   8.203   1.00 72.51  ? 522  ILE A N     1 
ATOM   3987 C  CA    . ILE A 1 522 ? -79.344  9.833   7.073   1.00 73.76  ? 522  ILE A CA    1 
ATOM   3988 C  C     . ILE A 1 522 ? -79.629  10.876  5.986   1.00 83.83  ? 522  ILE A C     1 
ATOM   3989 O  O     . ILE A 1 522 ? -78.704  11.486  5.447   1.00 83.63  ? 522  ILE A O     1 
ATOM   3990 C  CB    . ILE A 1 522 ? -79.401  8.399   6.489   1.00 71.31  ? 522  ILE A CB    1 
ATOM   3991 C  CG1   . ILE A 1 522 ? -78.880  7.383   7.514   1.00 67.98  ? 522  ILE A CG1   1 
ATOM   3992 C  CG2   . ILE A 1 522 ? -78.599  8.300   5.196   1.00 75.51  ? 522  ILE A CG2   1 
ATOM   3993 C  CD1   . ILE A 1 522 ? -79.280  5.949   7.234   1.00 65.97  ? 522  ILE A CD1   1 
ATOM   3994 N  N     . GLU A 1 523 ? -80.913  11.084  5.693   1.00 83.24  ? 523  GLU A N     1 
ATOM   3995 C  CA    . GLU A 1 523 ? -81.349  12.066  4.700   1.00 83.53  ? 523  GLU A CA    1 
ATOM   3996 C  C     . GLU A 1 523 ? -81.049  13.502  5.140   1.00 86.97  ? 523  GLU A C     1 
ATOM   3997 O  O     . GLU A 1 523 ? -80.767  14.364  4.304   1.00 94.48  ? 523  GLU A O     1 
ATOM   3998 C  CB    . GLU A 1 523 ? -82.845  11.903  4.408   1.00 78.60  ? 523  GLU A CB    1 
ATOM   3999 C  CG    . GLU A 1 523 ? -83.294  12.445  3.056   1.00 87.30  ? 523  GLU A CG    1 
ATOM   4000 C  CD    . GLU A 1 523 ? -82.851  11.579  1.888   1.00 100.84 ? 523  GLU A CD    1 
ATOM   4001 O  OE1   . GLU A 1 523 ? -82.925  10.335  1.993   1.00 94.06  ? 523  GLU A OE1   1 
ATOM   4002 O  OE2   . GLU A 1 523 ? -82.435  12.147  0.855   1.00 111.12 ? 523  GLU A OE2   1 
ATOM   4003 N  N     . GLN A 1 524 ? -81.115  13.747  6.448   1.00 79.60  ? 524  GLN A N     1 
ATOM   4004 C  CA    . GLN A 1 524 ? -80.798  15.057  7.020   1.00 75.60  ? 524  GLN A CA    1 
ATOM   4005 C  C     . GLN A 1 524 ? -79.309  15.387  6.920   1.00 74.80  ? 524  GLN A C     1 
ATOM   4006 O  O     . GLN A 1 524 ? -78.941  16.527  6.631   1.00 80.20  ? 524  GLN A O     1 
ATOM   4007 C  CB    . GLN A 1 524 ? -81.254  15.139  8.481   1.00 68.72  ? 524  GLN A CB    1 
ATOM   4008 C  CG    . GLN A 1 524 ? -82.726  15.476  8.666   1.00 80.46  ? 524  GLN A CG    1 
ATOM   4009 C  CD    . GLN A 1 524 ? -83.140  15.540  10.127  1.00 74.96  ? 524  GLN A CD    1 
ATOM   4010 O  OE1   . GLN A 1 524 ? -82.743  14.703  10.939  1.00 71.31  ? 524  GLN A OE1   1 
ATOM   4011 N  NE2   . GLN A 1 524 ? -83.953  16.535  10.465  1.00 76.74  ? 524  GLN A NE2   1 
ATOM   4012 N  N     . LEU A 1 525 ? -78.465  14.382  7.153   1.00 70.19  ? 525  LEU A N     1 
ATOM   4013 C  CA    . LEU A 1 525 ? -77.008  14.553  7.156   1.00 77.06  ? 525  LEU A CA    1 
ATOM   4014 C  C     . LEU A 1 525 ? -76.417  14.815  5.769   1.00 81.95  ? 525  LEU A C     1 
ATOM   4015 O  O     . LEU A 1 525 ? -75.342  15.409  5.652   1.00 79.34  ? 525  LEU A O     1 
ATOM   4016 C  CB    . LEU A 1 525 ? -76.328  13.342  7.807   1.00 72.26  ? 525  LEU A CB    1 
ATOM   4017 C  CG    . LEU A 1 525 ? -76.440  13.218  9.331   1.00 61.12  ? 525  LEU A CG    1 
ATOM   4018 C  CD1   . LEU A 1 525 ? -76.370  11.761  9.761   1.00 59.93  ? 525  LEU A CD1   1 
ATOM   4019 C  CD2   . LEU A 1 525 ? -75.373  14.040  10.039  1.00 54.67  ? 525  LEU A CD2   1 
ATOM   4020 N  N     . ILE A 1 526 ? -77.119  14.367  4.728   1.00 80.43  ? 526  ILE A N     1 
ATOM   4021 C  CA    . ILE A 1 526 ? -76.720  14.626  3.341   1.00 85.90  ? 526  ILE A CA    1 
ATOM   4022 C  C     . ILE A 1 526 ? -76.921  16.105  2.996   1.00 85.05  ? 526  ILE A C     1 
ATOM   4023 O  O     . ILE A 1 526 ? -76.111  16.701  2.280   1.00 85.47  ? 526  ILE A O     1 
ATOM   4024 C  CB    . ILE A 1 526 ? -77.490  13.722  2.344   1.00 85.49  ? 526  ILE A CB    1 
ATOM   4025 C  CG1   . ILE A 1 526 ? -77.197  12.242  2.624   1.00 82.34  ? 526  ILE A CG1   1 
ATOM   4026 C  CG2   . ILE A 1 526 ? -77.127  14.063  0.902   1.00 98.86  ? 526  ILE A CG2   1 
ATOM   4027 C  CD1   . ILE A 1 526 ? -78.218  11.281  2.051   1.00 90.33  ? 526  ILE A CD1   1 
ATOM   4028 N  N     . LYS A 1 527 ? -77.996  16.689  3.526   1.00 81.26  ? 527  LYS A N     1 
ATOM   4029 C  CA    . LYS A 1 527 ? -78.334  18.095  3.291   1.00 80.68  ? 527  LYS A CA    1 
ATOM   4030 C  C     . LYS A 1 527 ? -77.343  19.059  3.947   1.00 81.72  ? 527  LYS A C     1 
ATOM   4031 O  O     . LYS A 1 527 ? -77.093  20.148  3.427   1.00 88.05  ? 527  LYS A O     1 
ATOM   4032 C  CB    . LYS A 1 527 ? -79.757  18.398  3.782   1.00 75.31  ? 527  LYS A CB    1 
ATOM   4033 C  CG    . LYS A 1 527 ? -80.856  17.560  3.140   1.00 77.98  ? 527  LYS A CG    1 
ATOM   4034 C  CD    . LYS A 1 527 ? -81.181  18.021  1.726   1.00 95.77  ? 527  LYS A CD    1 
ATOM   4035 C  CE    . LYS A 1 527 ? -82.252  17.150  1.085   1.00 102.83 ? 527  LYS A CE    1 
ATOM   4036 N  NZ    . LYS A 1 527 ? -83.593  17.335  1.708   1.00 82.41  ? 527  LYS A NZ    1 
ATOM   4037 N  N     . LYS A 1 528 ? -76.786  18.649  5.086   1.00 73.81  ? 528  LYS A N     1 
ATOM   4038 C  CA    . LYS A 1 528 ? -75.839  19.472  5.841   1.00 69.31  ? 528  LYS A CA    1 
ATOM   4039 C  C     . LYS A 1 528 ? -74.454  19.476  5.194   1.00 75.74  ? 528  LYS A C     1 
ATOM   4040 O  O     . LYS A 1 528 ? -74.087  18.534  4.487   1.00 87.35  ? 528  LYS A O     1 
ATOM   4041 C  CB    . LYS A 1 528 ? -75.729  18.986  7.293   1.00 69.53  ? 528  LYS A CB    1 
ATOM   4042 C  CG    . LYS A 1 528 ? -77.053  18.774  8.019   1.00 62.12  ? 528  LYS A CG    1 
ATOM   4043 C  CD    . LYS A 1 528 ? -77.767  20.080  8.328   1.00 69.01  ? 528  LYS A CD    1 
ATOM   4044 C  CE    . LYS A 1 528 ? -79.107  19.825  8.999   1.00 63.82  ? 528  LYS A CE    1 
ATOM   4045 N  NZ    . LYS A 1 528 ? -79.848  21.087  9.272   1.00 71.34  ? 528  LYS A NZ    1 
ATOM   4046 N  N     . GLU A 1 529 ? -73.693  20.540  5.444   1.00 73.18  ? 529  GLU A N     1 
ATOM   4047 C  CA    . GLU A 1 529 ? -72.330  20.663  4.928   1.00 78.87  ? 529  GLU A CA    1 
ATOM   4048 C  C     . GLU A 1 529 ? -71.332  19.890  5.790   1.00 80.49  ? 529  GLU A C     1 
ATOM   4049 O  O     . GLU A 1 529 ? -70.692  18.949  5.314   1.00 86.25  ? 529  GLU A O     1 
ATOM   4050 C  CB    . GLU A 1 529 ? -71.916  22.135  4.819   1.00 86.06  ? 529  GLU A CB    1 
ATOM   4051 C  CG    . GLU A 1 529 ? -72.538  22.880  3.646   1.00 92.98  ? 529  GLU A CG    1 
ATOM   4052 C  CD    . GLU A 1 529 ? -72.064  24.320  3.529   1.00 101.18 ? 529  GLU A CD    1 
ATOM   4053 O  OE1   . GLU A 1 529 ? -71.195  24.744  4.323   1.00 90.34  ? 529  GLU A OE1   1 
ATOM   4054 O  OE2   . GLU A 1 529 ? -72.564  25.035  2.635   1.00 118.29 ? 529  GLU A OE2   1 
ATOM   4055 N  N     . LYS A 1 530 ? -71.208  20.292  7.054   1.00 83.48  ? 530  LYS A N     1 
ATOM   4056 C  CA    . LYS A 1 530 ? -70.283  19.659  7.995   1.00 91.15  ? 530  LYS A CA    1 
ATOM   4057 C  C     . LYS A 1 530 ? -70.971  19.365  9.326   1.00 81.14  ? 530  LYS A C     1 
ATOM   4058 O  O     . LYS A 1 530 ? -71.639  20.233  9.893   1.00 77.17  ? 530  LYS A O     1 
ATOM   4059 C  CB    . LYS A 1 530 ? -69.052  20.543  8.224   1.00 79.89  ? 530  LYS A CB    1 
ATOM   4060 C  CG    . LYS A 1 530 ? -68.122  20.659  7.025   1.00 80.88  ? 530  LYS A CG    1 
ATOM   4061 C  CD    . LYS A 1 530 ? -66.963  21.600  7.313   1.00 82.44  ? 530  LYS A CD    1 
ATOM   4062 C  CE    . LYS A 1 530 ? -66.056  21.745  6.102   1.00 84.37  ? 530  LYS A CE    1 
ATOM   4063 N  NZ    . LYS A 1 530 ? -64.921  22.671  6.366   1.00 98.36  ? 530  LYS A NZ    1 
ATOM   4064 N  N     . VAL A 1 531 ? -70.808  18.135  9.813   1.00 77.27  ? 531  VAL A N     1 
ATOM   4065 C  CA    . VAL A 1 531 ? -71.396  17.707  11.085  1.00 65.73  ? 531  VAL A CA    1 
ATOM   4066 C  C     . VAL A 1 531 ? -70.360  16.978  11.943  1.00 64.68  ? 531  VAL A C     1 
ATOM   4067 O  O     . VAL A 1 531 ? -69.725  16.023  11.488  1.00 69.26  ? 531  VAL A O     1 
ATOM   4068 C  CB    . VAL A 1 531 ? -72.636  16.799  10.876  1.00 57.09  ? 531  VAL A CB    1 
ATOM   4069 C  CG1   . VAL A 1 531 ? -73.175  16.293  12.208  1.00 49.38  ? 531  VAL A CG1   1 
ATOM   4070 C  CG2   . VAL A 1 531 ? -73.733  17.537  10.121  1.00 60.07  ? 531  VAL A CG2   1 
ATOM   4071 N  N     . TYR A 1 532 ? -70.194  17.443  13.179  1.00 64.79  ? 532  TYR A N     1 
ATOM   4072 C  CA    . TYR A 1 532 ? -69.333  16.780  14.156  1.00 68.84  ? 532  TYR A CA    1 
ATOM   4073 C  C     . TYR A 1 532 ? -70.172  16.156  15.270  1.00 73.18  ? 532  TYR A C     1 
ATOM   4074 O  O     . TYR A 1 532 ? -71.058  16.805  15.831  1.00 73.07  ? 532  TYR A O     1 
ATOM   4075 C  CB    . TYR A 1 532 ? -68.305  17.761  14.734  1.00 71.10  ? 532  TYR A CB    1 
ATOM   4076 C  CG    . TYR A 1 532 ? -67.411  17.174  15.809  1.00 75.01  ? 532  TYR A CG    1 
ATOM   4077 C  CD1   . TYR A 1 532 ? -66.352  16.328  15.480  1.00 74.50  ? 532  TYR A CD1   1 
ATOM   4078 C  CD2   . TYR A 1 532 ? -67.621  17.472  17.156  1.00 76.40  ? 532  TYR A CD2   1 
ATOM   4079 C  CE1   . TYR A 1 532 ? -65.532  15.789  16.461  1.00 75.27  ? 532  TYR A CE1   1 
ATOM   4080 C  CE2   . TYR A 1 532 ? -66.806  16.938  18.144  1.00 74.27  ? 532  TYR A CE2   1 
ATOM   4081 C  CZ    . TYR A 1 532 ? -65.764  16.099  17.791  1.00 74.06  ? 532  TYR A CZ    1 
ATOM   4082 O  OH    . TYR A 1 532 ? -64.953  15.569  18.768  1.00 71.31  ? 532  TYR A OH    1 
ATOM   4083 N  N     . LEU A 1 533 ? -69.882  14.894  15.580  1.00 73.91  ? 533  LEU A N     1 
ATOM   4084 C  CA    . LEU A 1 533 ? -70.611  14.152  16.605  1.00 65.45  ? 533  LEU A CA    1 
ATOM   4085 C  C     . LEU A 1 533 ? -69.654  13.567  17.644  1.00 70.39  ? 533  LEU A C     1 
ATOM   4086 O  O     . LEU A 1 533 ? -68.690  12.880  17.296  1.00 70.27  ? 533  LEU A O     1 
ATOM   4087 C  CB    . LEU A 1 533 ? -71.462  13.049  15.961  1.00 61.19  ? 533  LEU A CB    1 
ATOM   4088 C  CG    . LEU A 1 533 ? -72.421  12.214  16.820  1.00 69.43  ? 533  LEU A CG    1 
ATOM   4089 C  CD1   . LEU A 1 533 ? -73.562  13.051  17.381  1.00 73.41  ? 533  LEU A CD1   1 
ATOM   4090 C  CD2   . LEU A 1 533 ? -72.969  11.050  16.010  1.00 67.23  ? 533  LEU A CD2   1 
ATOM   4091 N  N     . ALA A 1 534 ? -69.930  13.851  18.915  1.00 65.79  ? 534  ALA A N     1 
ATOM   4092 C  CA    . ALA A 1 534 ? -69.089  13.396  20.023  1.00 62.08  ? 534  ALA A CA    1 
ATOM   4093 C  C     . ALA A 1 534 ? -69.901  12.683  21.105  1.00 57.43  ? 534  ALA A C     1 
ATOM   4094 O  O     . ALA A 1 534 ? -71.116  12.873  21.210  1.00 58.95  ? 534  ALA A O     1 
ATOM   4095 C  CB    . ALA A 1 534 ? -68.319  14.567  20.616  1.00 62.33  ? 534  ALA A CB    1 
ATOM   4096 N  N     . TRP A 1 535 ? -69.217  11.867  21.906  1.00 53.79  ? 535  TRP A N     1 
ATOM   4097 C  CA    . TRP A 1 535 ? -69.856  11.097  22.973  1.00 56.75  ? 535  TRP A CA    1 
ATOM   4098 C  C     . TRP A 1 535 ? -69.323  11.455  24.333  1.00 57.35  ? 535  TRP A C     1 
ATOM   4099 O  O     . TRP A 1 535 ? -68.117  11.650  24.509  1.00 57.29  ? 535  TRP A O     1 
ATOM   4100 C  CB    . TRP A 1 535 ? -69.700  9.600   22.716  1.00 56.23  ? 535  TRP A CB    1 
ATOM   4101 C  CG    . TRP A 1 535 ? -70.279  8.721   23.802  1.00 57.78  ? 535  TRP A CG    1 
ATOM   4102 C  CD1   . TRP A 1 535 ? -71.589  8.262   23.917  1.00 58.46  ? 535  TRP A CD1   1 
ATOM   4103 C  CD2   . TRP A 1 535 ? -69.579  8.166   24.971  1.00 55.03  ? 535  TRP A CD2   1 
ATOM   4104 N  NE1   . TRP A 1 535 ? -71.741  7.487   25.040  1.00 55.61  ? 535  TRP A NE1   1 
ATOM   4105 C  CE2   . TRP A 1 535 ? -70.577  7.389   25.716  1.00 58.69  ? 535  TRP A CE2   1 
ATOM   4106 C  CE3   . TRP A 1 535 ? -68.276  8.233   25.456  1.00 50.78  ? 535  TRP A CE3   1 
ATOM   4107 C  CZ2   . TRP A 1 535 ? -70.261  6.718   26.890  1.00 71.31  ? 535  TRP A CZ2   1 
ATOM   4108 C  CZ3   . TRP A 1 535 ? -67.970  7.552   26.641  1.00 54.38  ? 535  TRP A CZ3   1 
ATOM   4109 C  CH2   . TRP A 1 535 ? -68.939  6.813   27.339  1.00 59.84  ? 535  TRP A CH2   1 
ATOM   4110 N  N     . VAL A 1 536 ? -70.229  11.541  25.305  1.00 57.70  ? 536  VAL A N     1 
ATOM   4111 C  CA    . VAL A 1 536 ? -69.877  11.811  26.703  1.00 55.79  ? 536  VAL A CA    1 
ATOM   4112 C  C     . VAL A 1 536 ? -70.486  10.758  27.639  1.00 55.89  ? 536  VAL A C     1 
ATOM   4113 O  O     . VAL A 1 536 ? -71.551  10.212  27.340  1.00 57.40  ? 536  VAL A O     1 
ATOM   4114 C  CB    . VAL A 1 536 ? -70.311  13.230  27.154  1.00 52.26  ? 536  VAL A CB    1 
ATOM   4115 C  CG1   . VAL A 1 536 ? -69.418  14.292  26.528  1.00 56.58  ? 536  VAL A CG1   1 
ATOM   4116 C  CG2   . VAL A 1 536 ? -71.779  13.493  26.836  1.00 51.09  ? 536  VAL A CG2   1 
ATOM   4117 N  N     . PRO A 1 537 ? -69.806  10.456  28.765  1.00 51.73  ? 537  PRO A N     1 
ATOM   4118 C  CA    . PRO A 1 537 ? -70.380  9.532   29.749  1.00 59.03  ? 537  PRO A CA    1 
ATOM   4119 C  C     . PRO A 1 537 ? -71.584  10.129  30.482  1.00 60.36  ? 537  PRO A C     1 
ATOM   4120 O  O     . PRO A 1 537 ? -71.549  11.293  30.890  1.00 64.13  ? 537  PRO A O     1 
ATOM   4121 C  CB    . PRO A 1 537 ? -69.222  9.283   30.724  1.00 60.41  ? 537  PRO A CB    1 
ATOM   4122 C  CG    . PRO A 1 537 ? -68.310  10.448  30.551  1.00 55.15  ? 537  PRO A CG    1 
ATOM   4123 C  CD    . PRO A 1 537 ? -68.422  10.832  29.107  1.00 52.62  ? 537  PRO A CD    1 
ATOM   4124 N  N     . ALA A 1 538 ? -72.636  9.328   30.636  1.00 57.95  ? 538  ALA A N     1 
ATOM   4125 C  CA    . ALA A 1 538 ? -73.870  9.769   31.285  1.00 60.51  ? 538  ALA A CA    1 
ATOM   4126 C  C     . ALA A 1 538 ? -73.756  9.745   32.808  1.00 63.96  ? 538  ALA A C     1 
ATOM   4127 O  O     . ALA A 1 538 ? -73.017  8.931   33.370  1.00 62.91  ? 538  ALA A O     1 
ATOM   4128 C  CB    . ALA A 1 538 ? -75.044  8.917   30.824  1.00 63.51  ? 538  ALA A CB    1 
ATOM   4129 N  N     . HIS A 1 539 ? -74.498  10.644  33.458  1.00 63.47  ? 539  HIS A N     1 
ATOM   4130 C  CA    . HIS A 1 539 ? -74.542  10.771  34.925  1.00 66.66  ? 539  HIS A CA    1 
ATOM   4131 C  C     . HIS A 1 539 ? -73.187  11.006  35.542  1.00 67.60  ? 539  HIS A C     1 
ATOM   4132 O  O     . HIS A 1 539 ? -72.824  10.372  36.538  1.00 75.09  ? 539  HIS A O     1 
ATOM   4133 C  CB    . HIS A 1 539 ? -75.232  9.562   35.564  1.00 64.53  ? 539  HIS A CB    1 
ATOM   4134 C  CG    . HIS A 1 539 ? -76.598  9.264   34.994  1.00 76.39  ? 539  HIS A CG    1 
ATOM   4135 N  ND1   . HIS A 1 539 ? -77.709  9.897   35.410  1.00 88.95  ? 539  HIS A ND1   1 
ATOM   4136 C  CD2   . HIS A 1 539 ? -77.003  8.362   34.012  1.00 87.64  ? 539  HIS A CD2   1 
ATOM   4137 C  CE1   . HIS A 1 539 ? -78.773  9.428   34.730  1.00 94.95  ? 539  HIS A CE1   1 
ATOM   4138 N  NE2   . HIS A 1 539 ? -78.339  8.489   33.875  1.00 97.42  ? 539  HIS A NE2   1 
ATOM   4139 N  N     . LYS A 1 540 ? -72.430  11.928  34.952  1.00 64.16  ? 540  LYS A N     1 
ATOM   4140 C  CA    . LYS A 1 540 ? -71.086  12.252  35.428  1.00 70.89  ? 540  LYS A CA    1 
ATOM   4141 C  C     . LYS A 1 540 ? -70.972  13.719  35.856  1.00 76.56  ? 540  LYS A C     1 
ATOM   4142 O  O     . LYS A 1 540 ? -69.948  14.142  36.398  1.00 77.43  ? 540  LYS A O     1 
ATOM   4143 C  CB    . LYS A 1 540 ? -70.044  11.902  34.355  1.00 66.42  ? 540  LYS A CB    1 
ATOM   4144 C  CG    . LYS A 1 540 ? -68.630  11.648  34.875  1.00 71.35  ? 540  LYS A CG    1 
ATOM   4145 C  CD    . LYS A 1 540 ? -68.569  10.583  35.966  1.00 74.95  ? 540  LYS A CD    1 
ATOM   4146 C  CE    . LYS A 1 540 ? -68.851  9.187   35.430  1.00 73.48  ? 540  LYS A CE    1 
ATOM   4147 N  NZ    . LYS A 1 540 ? -68.794  8.159   36.507  1.00 78.11  ? 540  LYS A NZ    1 
ATOM   4148 N  N     . GLY A 1 541 ? -72.037  14.482  35.620  1.00 72.52  ? 541  GLY A N     1 
ATOM   4149 C  CA    . GLY A 1 541 ? -72.089  15.892  36.001  1.00 67.45  ? 541  GLY A CA    1 
ATOM   4150 C  C     . GLY A 1 541 ? -71.373  16.807  35.026  1.00 65.67  ? 541  GLY A C     1 
ATOM   4151 O  O     . GLY A 1 541 ? -70.795  17.819  35.426  1.00 59.57  ? 541  GLY A O     1 
ATOM   4152 N  N     . ILE A 1 542 ? -71.414  16.447  33.745  1.00 70.85  ? 542  ILE A N     1 
ATOM   4153 C  CA    . ILE A 1 542 ? -70.804  17.250  32.688  1.00 63.97  ? 542  ILE A CA    1 
ATOM   4154 C  C     . ILE A 1 542 ? -71.762  18.366  32.277  1.00 60.72  ? 542  ILE A C     1 
ATOM   4155 O  O     . ILE A 1 542 ? -72.952  18.124  32.054  1.00 59.19  ? 542  ILE A O     1 
ATOM   4156 C  CB    . ILE A 1 542 ? -70.420  16.391  31.459  1.00 56.66  ? 542  ILE A CB    1 
ATOM   4157 C  CG1   . ILE A 1 542 ? -69.583  15.179  31.889  1.00 61.18  ? 542  ILE A CG1   1 
ATOM   4158 C  CG2   . ILE A 1 542 ? -69.665  17.226  30.430  1.00 57.38  ? 542  ILE A CG2   1 
ATOM   4159 C  CD1   . ILE A 1 542 ? -69.529  14.061  30.868  1.00 57.84  ? 542  ILE A CD1   1 
ATOM   4160 N  N     . GLY A 1 543 ? -71.234  19.586  32.191  1.00 61.78  ? 543  GLY A N     1 
ATOM   4161 C  CA    . GLY A 1 543 ? -72.013  20.758  31.796  1.00 62.90  ? 543  GLY A CA    1 
ATOM   4162 C  C     . GLY A 1 543 ? -72.573  20.641  30.392  1.00 59.71  ? 543  GLY A C     1 
ATOM   4163 O  O     . GLY A 1 543 ? -71.856  20.281  29.455  1.00 59.14  ? 543  GLY A O     1 
ATOM   4164 N  N     . GLY A 1 544 ? -73.859  20.949  30.252  1.00 54.24  ? 544  GLY A N     1 
ATOM   4165 C  CA    . GLY A 1 544 ? -74.561  20.800  28.981  1.00 58.60  ? 544  GLY A CA    1 
ATOM   4166 C  C     . GLY A 1 544 ? -75.419  19.552  28.976  1.00 57.34  ? 544  GLY A C     1 
ATOM   4167 O  O     . GLY A 1 544 ? -76.630  19.625  28.764  1.00 57.46  ? 544  GLY A O     1 
ATOM   4168 N  N     . ASN A 1 545 ? -74.783  18.407  29.218  1.00 57.24  ? 545  ASN A N     1 
ATOM   4169 C  CA    . ASN A 1 545 ? -75.468  17.116  29.290  1.00 61.15  ? 545  ASN A CA    1 
ATOM   4170 C  C     . ASN A 1 545 ? -76.358  16.992  30.528  1.00 61.30  ? 545  ASN A C     1 
ATOM   4171 O  O     . ASN A 1 545 ? -77.376  16.297  30.504  1.00 61.38  ? 545  ASN A O     1 
ATOM   4172 C  CB    . ASN A 1 545 ? -74.448  15.972  29.254  1.00 58.09  ? 545  ASN A CB    1 
ATOM   4173 C  CG    . ASN A 1 545 ? -75.094  14.610  29.063  1.00 63.25  ? 545  ASN A CG    1 
ATOM   4174 O  OD1   . ASN A 1 545 ? -74.962  13.727  29.911  1.00 67.37  ? 545  ASN A OD1   1 
ATOM   4175 N  ND2   . ASN A 1 545 ? -75.796  14.435  27.948  1.00 64.15  ? 545  ASN A ND2   1 
ATOM   4176 N  N     . GLU A 1 546 ? -75.960  17.673  31.602  1.00 62.36  ? 546  GLU A N     1 
ATOM   4177 C  CA    . GLU A 1 546 ? -76.704  17.681  32.862  1.00 68.51  ? 546  GLU A CA    1 
ATOM   4178 C  C     . GLU A 1 546 ? -78.036  18.427  32.731  1.00 71.24  ? 546  GLU A C     1 
ATOM   4179 O  O     . GLU A 1 546 ? -79.039  18.027  33.326  1.00 74.11  ? 546  GLU A O     1 
ATOM   4180 C  CB    . GLU A 1 546 ? -75.851  18.306  33.972  1.00 68.46  ? 546  GLU A CB    1 
ATOM   4181 C  CG    . GLU A 1 546 ? -76.406  18.134  35.381  1.00 71.11  ? 546  GLU A CG    1 
ATOM   4182 C  CD    . GLU A 1 546 ? -75.598  18.873  36.436  1.00 84.45  ? 546  GLU A CD    1 
ATOM   4183 O  OE1   . GLU A 1 546 ? -74.838  19.801  36.084  1.00 64.67  ? 546  GLU A OE1   1 
ATOM   4184 O  OE2   . GLU A 1 546 ? -75.727  18.524  37.628  1.00 97.51  ? 546  GLU A OE2   1 
ATOM   4185 N  N     . GLN A 1 547 ? -78.032  19.502  31.945  1.00 66.74  ? 547  GLN A N     1 
ATOM   4186 C  CA    . GLN A 1 547 ? -79.214  20.346  31.753  1.00 64.98  ? 547  GLN A CA    1 
ATOM   4187 C  C     . GLN A 1 547 ? -80.304  19.674  30.914  1.00 70.13  ? 547  GLN A C     1 
ATOM   4188 O  O     . GLN A 1 547 ? -81.495  19.895  31.151  1.00 76.90  ? 547  GLN A O     1 
ATOM   4189 C  CB    . GLN A 1 547 ? -78.823  21.692  31.131  1.00 61.82  ? 547  GLN A CB    1 
ATOM   4190 C  CG    . GLN A 1 547 ? -78.254  22.709  32.115  1.00 62.07  ? 547  GLN A CG    1 
ATOM   4191 C  CD    . GLN A 1 547 ? -76.818  22.424  32.530  1.00 61.84  ? 547  GLN A CD    1 
ATOM   4192 O  OE1   . GLN A 1 547 ? -76.090  21.695  31.855  1.00 64.01  ? 547  GLN A OE1   1 
ATOM   4193 N  NE2   . GLN A 1 547 ? -76.404  23.009  33.648  1.00 59.78  ? 547  GLN A NE2   1 
ATOM   4194 N  N     . VAL A 1 548 ? -79.894  18.863  29.941  1.00 64.17  ? 548  VAL A N     1 
ATOM   4195 C  CA    . VAL A 1 548 ? -80.834  18.152  29.068  1.00 63.45  ? 548  VAL A CA    1 
ATOM   4196 C  C     . VAL A 1 548 ? -81.478  16.976  29.803  1.00 67.22  ? 548  VAL A C     1 
ATOM   4197 O  O     . VAL A 1 548 ? -82.678  16.730  29.658  1.00 68.68  ? 548  VAL A O     1 
ATOM   4198 C  CB    . VAL A 1 548 ? -80.162  17.637  27.773  1.00 59.04  ? 548  VAL A CB    1 
ATOM   4199 C  CG1   . VAL A 1 548 ? -81.213  17.250  26.743  1.00 59.18  ? 548  VAL A CG1   1 
ATOM   4200 C  CG2   . VAL A 1 548 ? -79.232  18.686  27.186  1.00 61.88  ? 548  VAL A CG2   1 
ATOM   4201 N  N     . ASP A 1 549 ? -80.672  16.265  30.592  1.00 70.01  ? 549  ASP A N     1 
ATOM   4202 C  CA    . ASP A 1 549 ? -81.118  15.078  31.326  1.00 73.84  ? 549  ASP A CA    1 
ATOM   4203 C  C     . ASP A 1 549 ? -82.220  15.384  32.341  1.00 78.70  ? 549  ASP A C     1 
ATOM   4204 O  O     . ASP A 1 549 ? -83.117  14.566  32.555  1.00 75.08  ? 549  ASP A O     1 
ATOM   4205 C  CB    . ASP A 1 549 ? -79.929  14.398  32.018  1.00 72.31  ? 549  ASP A CB    1 
ATOM   4206 C  CG    . ASP A 1 549 ? -80.279  13.030  32.588  1.00 88.82  ? 549  ASP A CG    1 
ATOM   4207 O  OD1   . ASP A 1 549 ? -81.075  12.295  31.962  1.00 84.52  ? 549  ASP A OD1   1 
ATOM   4208 O  OD2   . ASP A 1 549 ? -79.747  12.685  33.664  1.00 98.88  ? 549  ASP A OD2   1 
ATOM   4209 N  N     . LYS A 1 550 ? -82.147  16.564  32.956  1.00 76.97  ? 550  LYS A N     1 
ATOM   4210 C  CA    . LYS A 1 550 ? -83.147  17.011  33.927  1.00 73.63  ? 550  LYS A CA    1 
ATOM   4211 C  C     . LYS A 1 550 ? -84.492  17.332  33.271  1.00 75.95  ? 550  LYS A C     1 
ATOM   4212 O  O     . LYS A 1 550 ? -85.541  17.228  33.911  1.00 80.46  ? 550  LYS A O     1 
ATOM   4213 C  CB    . LYS A 1 550 ? -82.640  18.232  34.701  1.00 78.69  ? 550  LYS A CB    1 
ATOM   4214 C  CG    . LYS A 1 550 ? -81.507  17.936  35.671  1.00 95.80  ? 550  LYS A CG    1 
ATOM   4215 C  CD    . LYS A 1 550 ? -81.020  19.204  36.353  1.00 87.95  ? 550  LYS A CD    1 
ATOM   4216 C  CE    . LYS A 1 550 ? -79.869  18.914  37.303  1.00 74.75  ? 550  LYS A CE    1 
ATOM   4217 N  NZ    . LYS A 1 550 ? -79.376  20.151  37.971  1.00 68.59  ? 550  LYS A NZ    1 
ATOM   4218 N  N     . LEU A 1 551 ? -84.450  17.719  31.997  1.00 71.17  ? 551  LEU A N     1 
ATOM   4219 C  CA    . LEU A 1 551 ? -85.653  18.078  31.246  1.00 68.16  ? 551  LEU A CA    1 
ATOM   4220 C  C     . LEU A 1 551 ? -86.389  16.858  30.689  1.00 68.05  ? 551  LEU A C     1 
ATOM   4221 O  O     . LEU A 1 551 ? -87.619  16.798  30.736  1.00 73.77  ? 551  LEU A O     1 
ATOM   4222 C  CB    . LEU A 1 551 ? -85.315  19.057  30.114  1.00 61.30  ? 551  LEU A CB    1 
ATOM   4223 C  CG    . LEU A 1 551 ? -84.855  20.472  30.486  1.00 71.93  ? 551  LEU A CG    1 
ATOM   4224 C  CD1   . LEU A 1 551 ? -84.164  21.135  29.304  1.00 66.92  ? 551  LEU A CD1   1 
ATOM   4225 C  CD2   . LEU A 1 551 ? -86.011  21.331  30.982  1.00 87.28  ? 551  LEU A CD2   1 
ATOM   4226 N  N     . VAL A 1 552 ? -85.634  15.892  30.165  1.00 69.03  ? 552  VAL A N     1 
ATOM   4227 C  CA    . VAL A 1 552 ? -86.219  14.689  29.559  1.00 68.84  ? 552  VAL A CA    1 
ATOM   4228 C  C     . VAL A 1 552 ? -86.705  13.668  30.593  1.00 79.00  ? 552  VAL A C     1 
ATOM   4229 O  O     . VAL A 1 552 ? -87.631  12.900  30.322  1.00 81.60  ? 552  VAL A O     1 
ATOM   4230 C  CB    . VAL A 1 552 ? -85.270  14.012  28.535  1.00 62.25  ? 552  VAL A CB    1 
ATOM   4231 C  CG1   . VAL A 1 552 ? -85.074  14.903  27.315  1.00 63.89  ? 552  VAL A CG1   1 
ATOM   4232 C  CG2   . VAL A 1 552 ? -83.931  13.647  29.165  1.00 66.10  ? 552  VAL A CG2   1 
ATOM   4233 N  N     . SER A 1 553 ? -86.080  13.663  31.769  1.00 75.47  ? 553  SER A N     1 
ATOM   4234 C  CA    . SER A 1 553 ? -86.466  12.752  32.846  1.00 81.94  ? 553  SER A CA    1 
ATOM   4235 C  C     . SER A 1 553 ? -87.218  13.483  33.962  1.00 85.21  ? 553  SER A C     1 
ATOM   4236 O  O     . SER A 1 553 ? -87.062  13.167  35.146  1.00 95.94  ? 553  SER A O     1 
ATOM   4237 C  CB    . SER A 1 553 ? -85.239  12.016  33.399  1.00 86.35  ? 553  SER A CB    1 
ATOM   4238 O  OG    . SER A 1 553 ? -84.379  12.897  34.101  1.00 92.13  ? 553  SER A OG    1 
ATOM   4239 N  N     . ALA A 1 554 ? -88.037  14.458  33.570  1.00 79.78  ? 554  ALA A N     1 
ATOM   4240 C  CA    . ALA A 1 554 ? -88.821  15.254  34.513  1.00 83.34  ? 554  ALA A CA    1 
ATOM   4241 C  C     . ALA A 1 554 ? -90.002  14.467  35.080  1.00 91.30  ? 554  ALA A C     1 
ATOM   4242 O  O     . ALA A 1 554 ? -90.251  14.495  36.287  1.00 95.76  ? 554  ALA A O     1 
ATOM   4243 C  CB    . ALA A 1 554 ? -89.299  16.541  33.855  1.00 75.09  ? 554  ALA A CB    1 
ATOM   4244 N  N     . GLY A 1 555 ? -90.722  13.771  34.202  1.00 84.37  ? 555  GLY A N     1 
ATOM   4245 C  CA    . GLY A 1 555 ? -91.856  12.941  34.605  1.00 85.83  ? 555  GLY A CA    1 
ATOM   4246 C  C     . GLY A 1 555 ? -91.545  11.455  34.584  1.00 85.82  ? 555  GLY A C     1 
ATOM   4247 O  O     . GLY A 1 555 ? -92.436  10.626  34.782  1.00 85.54  ? 555  GLY A O     1 
ATOM   4248 N  N     . ILE A 1 556 ? -90.278  11.123  34.342  1.00 90.40  ? 556  ILE A N     1 
ATOM   4249 C  CA    . ILE A 1 556 ? -89.825  9.734   34.281  1.00 87.62  ? 556  ILE A CA    1 
ATOM   4250 C  C     . ILE A 1 556 ? -88.848  9.437   35.418  1.00 78.69  ? 556  ILE A C     1 
ATOM   4251 O  O     . ILE A 1 556 ? -87.953  10.232  35.708  1.00 82.50  ? 556  ILE A O     1 
ATOM   4252 C  CB    . ILE A 1 556 ? -89.168  9.405   32.920  1.00 85.99  ? 556  ILE A CB    1 
ATOM   4253 C  CG1   . ILE A 1 556 ? -90.133  9.712   31.767  1.00 81.62  ? 556  ILE A CG1   1 
ATOM   4254 C  CG2   . ILE A 1 556 ? -88.725  7.946   32.874  1.00 89.46  ? 556  ILE A CG2   1 
ATOM   4255 C  CD1   . ILE A 1 556 ? -89.460  9.948   30.431  1.00 76.55  ? 556  ILE A CD1   1 
ATOM   4256 N  N     . THR B 2 8   ? -43.538  -49.058 22.300  1.00 81.25  ? 7    THR B N     1 
ATOM   4257 C  CA    . THR B 2 8   ? -45.005  -48.812 22.152  1.00 92.04  ? 7    THR B CA    1 
ATOM   4258 C  C     . THR B 2 8   ? -45.688  -48.593 23.507  1.00 100.90 ? 7    THR B C     1 
ATOM   4259 O  O     . THR B 2 8   ? -45.230  -49.100 24.534  1.00 101.72 ? 7    THR B O     1 
ATOM   4260 C  CB    . THR B 2 8   ? -45.704  -49.945 21.361  1.00 100.76 ? 7    THR B CB    1 
ATOM   4261 O  OG1   . THR B 2 8   ? -47.103  -49.657 21.236  1.00 89.63  ? 7    THR B OG1   1 
ATOM   4262 C  CG2   . THR B 2 8   ? -45.522  -51.302 22.044  1.00 94.79  ? 7    THR B CG2   1 
ATOM   4263 N  N     . VAL B 2 9   ? -46.782  -47.833 23.491  1.00 97.37  ? 8    VAL B N     1 
ATOM   4264 C  CA    . VAL B 2 9   ? -47.536  -47.505 24.705  1.00 97.62  ? 8    VAL B CA    1 
ATOM   4265 C  C     . VAL B 2 9   ? -49.033  -47.333 24.392  1.00 96.32  ? 8    VAL B C     1 
ATOM   4266 O  O     . VAL B 2 9   ? -49.391  -46.618 23.451  1.00 97.13  ? 8    VAL B O     1 
ATOM   4267 C  CB    . VAL B 2 9   ? -46.945  -46.259 25.426  1.00 88.52  ? 8    VAL B CB    1 
ATOM   4268 C  CG1   . VAL B 2 9   ? -46.901  -45.047 24.504  1.00 83.79  ? 8    VAL B CG1   1 
ATOM   4269 C  CG2   . VAL B 2 9   ? -47.703  -45.940 26.711  1.00 83.24  ? 8    VAL B CG2   1 
ATOM   4270 N  N     . PRO B 2 10  ? -49.907  -48.012 25.165  1.00 103.49 ? 9    PRO B N     1 
ATOM   4271 C  CA    . PRO B 2 10  ? -51.359  -47.903 24.981  1.00 96.40  ? 9    PRO B CA    1 
ATOM   4272 C  C     . PRO B 2 10  ? -51.909  -46.513 25.315  1.00 91.83  ? 9    PRO B C     1 
ATOM   4273 O  O     . PRO B 2 10  ? -51.526  -45.918 26.326  1.00 86.11  ? 9    PRO B O     1 
ATOM   4274 C  CB    . PRO B 2 10  ? -51.921  -48.949 25.954  1.00 89.54  ? 9    PRO B CB    1 
ATOM   4275 C  CG    . PRO B 2 10  ? -50.838  -49.172 26.954  1.00 88.96  ? 9    PRO B CG    1 
ATOM   4276 C  CD    . PRO B 2 10  ? -49.561  -49.020 26.185  1.00 98.51  ? 9    PRO B CD    1 
ATOM   4277 N  N     . VAL B 2 11  ? -52.794  -46.011 24.455  1.00 90.78  ? 10   VAL B N     1 
ATOM   4278 C  CA    . VAL B 2 11  ? -53.410  -44.692 24.627  1.00 87.81  ? 10   VAL B CA    1 
ATOM   4279 C  C     . VAL B 2 11  ? -54.935  -44.815 24.593  1.00 85.17  ? 10   VAL B C     1 
ATOM   4280 O  O     . VAL B 2 11  ? -55.494  -45.458 23.700  1.00 87.99  ? 10   VAL B O     1 
ATOM   4281 C  CB    . VAL B 2 11  ? -52.936  -43.690 23.543  1.00 83.54  ? 10   VAL B CB    1 
ATOM   4282 C  CG1   . VAL B 2 11  ? -53.543  -42.311 23.769  1.00 83.00  ? 10   VAL B CG1   1 
ATOM   4283 C  CG2   . VAL B 2 11  ? -51.416  -43.590 23.516  1.00 87.77  ? 10   VAL B CG2   1 
ATOM   4284 N  N     . LYS B 2 12  ? -55.597  -44.198 25.571  1.00 83.65  ? 11   LYS B N     1 
ATOM   4285 C  CA    . LYS B 2 12  ? -57.058  -44.215 25.661  1.00 84.06  ? 11   LYS B CA    1 
ATOM   4286 C  C     . LYS B 2 12  ? -57.648  -42.806 25.726  1.00 84.54  ? 11   LYS B C     1 
ATOM   4287 O  O     . LYS B 2 12  ? -57.004  -41.873 26.212  1.00 83.73  ? 11   LYS B O     1 
ATOM   4288 C  CB    . LYS B 2 12  ? -57.515  -45.032 26.874  1.00 92.38  ? 11   LYS B CB    1 
ATOM   4289 C  CG    . LYS B 2 12  ? -57.334  -46.535 26.723  1.00 96.01  ? 11   LYS B CG    1 
ATOM   4290 C  CD    . LYS B 2 12  ? -57.847  -47.277 27.946  1.00 97.70  ? 11   LYS B CD    1 
ATOM   4291 C  CE    . LYS B 2 12  ? -57.684  -48.780 27.788  1.00 95.01  ? 11   LYS B CE    1 
ATOM   4292 N  NZ    . LYS B 2 12  ? -58.188  -49.521 28.977  1.00 91.17  ? 11   LYS B NZ    1 
ATOM   4293 N  N     . LEU B 2 13  ? -58.878  -42.668 25.234  1.00 85.22  ? 12   LEU B N     1 
ATOM   4294 C  CA    . LEU B 2 13  ? -59.597  -41.393 25.247  1.00 82.68  ? 12   LEU B CA    1 
ATOM   4295 C  C     . LEU B 2 13  ? -60.166  -41.084 26.632  1.00 91.82  ? 12   LEU B C     1 
ATOM   4296 O  O     . LEU B 2 13  ? -60.145  -41.934 27.526  1.00 97.48  ? 12   LEU B O     1 
ATOM   4297 C  CB    . LEU B 2 13  ? -60.738  -41.411 24.221  1.00 82.02  ? 12   LEU B CB    1 
ATOM   4298 C  CG    . LEU B 2 13  ? -60.444  -41.599 22.730  1.00 77.00  ? 12   LEU B CG    1 
ATOM   4299 C  CD1   . LEU B 2 13  ? -61.712  -42.027 22.009  1.00 75.11  ? 12   LEU B CD1   1 
ATOM   4300 C  CD2   . LEU B 2 13  ? -59.870  -40.337 22.102  1.00 71.88  ? 12   LEU B CD2   1 
ATOM   4301 N  N     . LYS B 2 14  ? -60.670  -39.862 26.798  1.00 93.96  ? 13   LYS B N     1 
ATOM   4302 C  CA    . LYS B 2 14  ? -61.375  -39.468 28.015  1.00 92.96  ? 13   LYS B CA    1 
ATOM   4303 C  C     . LYS B 2 14  ? -62.745  -40.155 28.041  1.00 93.83  ? 13   LYS B C     1 
ATOM   4304 O  O     . LYS B 2 14  ? -63.500  -40.056 27.070  1.00 94.21  ? 13   LYS B O     1 
ATOM   4305 C  CB    . LYS B 2 14  ? -61.525  -37.944 28.077  1.00 98.87  ? 13   LYS B CB    1 
ATOM   4306 C  CG    . LYS B 2 14  ? -61.825  -37.393 29.463  1.00 104.03 ? 13   LYS B CG    1 
ATOM   4307 C  CD    . LYS B 2 14  ? -61.779  -35.874 29.478  1.00 110.16 ? 13   LYS B CD    1 
ATOM   4308 C  CE    . LYS B 2 14  ? -62.086  -35.324 30.862  1.00 114.28 ? 13   LYS B CE    1 
ATOM   4309 N  NZ    . LYS B 2 14  ? -62.045  -33.836 30.890  1.00 106.40 ? 13   LYS B NZ    1 
ATOM   4310 N  N     . PRO B 2 15  ? -63.061  -40.864 29.146  1.00 93.83  ? 14   PRO B N     1 
ATOM   4311 C  CA    . PRO B 2 15  ? -64.301  -41.641 29.262  1.00 94.68  ? 14   PRO B CA    1 
ATOM   4312 C  C     . PRO B 2 15  ? -65.563  -40.809 29.028  1.00 92.15  ? 14   PRO B C     1 
ATOM   4313 O  O     . PRO B 2 15  ? -65.756  -39.773 29.670  1.00 94.90  ? 14   PRO B O     1 
ATOM   4314 C  CB    . PRO B 2 15  ? -64.261  -42.169 30.705  1.00 92.90  ? 14   PRO B CB    1 
ATOM   4315 C  CG    . PRO B 2 15  ? -63.253  -41.325 31.411  1.00 99.61  ? 14   PRO B CG    1 
ATOM   4316 C  CD    . PRO B 2 15  ? -62.241  -40.972 30.365  1.00 96.76  ? 14   PRO B CD    1 
ATOM   4317 N  N     . GLY B 2 16  ? -66.402  -41.269 28.102  1.00 91.34  ? 15   GLY B N     1 
ATOM   4318 C  CA    . GLY B 2 16  ? -67.633  -40.569 27.745  1.00 93.09  ? 15   GLY B CA    1 
ATOM   4319 C  C     . GLY B 2 16  ? -67.596  -39.977 26.348  1.00 94.63  ? 15   GLY B C     1 
ATOM   4320 O  O     . GLY B 2 16  ? -68.564  -40.092 25.593  1.00 94.15  ? 15   GLY B O     1 
ATOM   4321 N  N     . MET B 2 17  ? -66.475  -39.343 26.007  1.00 92.91  ? 16   MET B N     1 
ATOM   4322 C  CA    . MET B 2 17  ? -66.315  -38.685 24.710  1.00 99.35  ? 16   MET B CA    1 
ATOM   4323 C  C     . MET B 2 17  ? -65.806  -39.631 23.624  1.00 97.11  ? 16   MET B C     1 
ATOM   4324 O  O     . MET B 2 17  ? -64.963  -40.494 23.879  1.00 92.01  ? 16   MET B O     1 
ATOM   4325 C  CB    . MET B 2 17  ? -65.388  -37.470 24.825  1.00 97.48  ? 16   MET B CB    1 
ATOM   4326 C  CG    . MET B 2 17  ? -66.015  -36.269 25.518  1.00 100.29 ? 16   MET B CG    1 
ATOM   4327 S  SD    . MET B 2 17  ? -65.093  -34.736 25.279  1.00 103.93 ? 16   MET B SD    1 
ATOM   4328 C  CE    . MET B 2 17  ? -63.664  -35.011 26.323  1.00 81.14  ? 16   MET B CE    1 
ATOM   4329 N  N     . ASP B 2 18  ? -66.332  -39.450 22.415  1.00 89.97  ? 17   ASP B N     1 
ATOM   4330 C  CA    . ASP B 2 18  ? -65.932  -40.234 21.248  1.00 81.18  ? 17   ASP B CA    1 
ATOM   4331 C  C     . ASP B 2 18  ? -64.756  -39.556 20.536  1.00 78.05  ? 17   ASP B C     1 
ATOM   4332 O  O     . ASP B 2 18  ? -64.242  -38.541 21.009  1.00 81.92  ? 17   ASP B O     1 
ATOM   4333 C  CB    . ASP B 2 18  ? -67.127  -40.400 20.298  1.00 85.38  ? 17   ASP B CB    1 
ATOM   4334 C  CG    . ASP B 2 18  ? -66.987  -41.601 19.373  1.00 83.19  ? 17   ASP B CG    1 
ATOM   4335 O  OD1   . ASP B 2 18  ? -66.412  -42.628 19.791  1.00 88.19  ? 17   ASP B OD1   1 
ATOM   4336 O  OD2   . ASP B 2 18  ? -67.466  -41.517 18.222  1.00 73.71  ? 17   ASP B OD2   1 
ATOM   4337 N  N     . GLY B 2 19  ? -64.329  -40.125 19.409  1.00 72.84  ? 18   GLY B N     1 
ATOM   4338 C  CA    . GLY B 2 19  ? -63.229  -39.570 18.620  1.00 71.75  ? 18   GLY B CA    1 
ATOM   4339 C  C     . GLY B 2 19  ? -63.606  -38.320 17.839  1.00 70.57  ? 18   GLY B C     1 
ATOM   4340 O  O     . GLY B 2 19  ? -64.781  -37.946 17.797  1.00 69.88  ? 18   GLY B O     1 
ATOM   4341 N  N     . PRO B 2 20  ? -62.610  -37.670 17.204  1.00 71.48  ? 19   PRO B N     1 
ATOM   4342 C  CA    . PRO B 2 20  ? -62.834  -36.404 16.501  1.00 71.20  ? 19   PRO B CA    1 
ATOM   4343 C  C     . PRO B 2 20  ? -63.556  -36.571 15.161  1.00 63.19  ? 19   PRO B C     1 
ATOM   4344 O  O     . PRO B 2 20  ? -63.104  -37.326 14.297  1.00 63.11  ? 19   PRO B O     1 
ATOM   4345 C  CB    . PRO B 2 20  ? -61.417  -35.861 16.295  1.00 69.33  ? 19   PRO B CB    1 
ATOM   4346 C  CG    . PRO B 2 20  ? -60.546  -37.069 16.261  1.00 66.35  ? 19   PRO B CG    1 
ATOM   4347 C  CD    . PRO B 2 20  ? -61.208  -38.121 17.107  1.00 67.91  ? 19   PRO B CD    1 
ATOM   4348 N  N     . LYS B 2 21  ? -64.676  -35.867 15.008  1.00 63.71  ? 20   LYS B N     1 
ATOM   4349 C  CA    . LYS B 2 21  ? -65.461  -35.892 13.774  1.00 56.70  ? 20   LYS B CA    1 
ATOM   4350 C  C     . LYS B 2 21  ? -65.680  -34.469 13.258  1.00 56.39  ? 20   LYS B C     1 
ATOM   4351 O  O     . LYS B 2 21  ? -66.714  -33.848 13.525  1.00 54.51  ? 20   LYS B O     1 
ATOM   4352 C  CB    . LYS B 2 21  ? -66.801  -36.606 13.995  1.00 54.44  ? 20   LYS B CB    1 
ATOM   4353 C  CG    . LYS B 2 21  ? -66.683  -38.096 14.290  1.00 60.42  ? 20   LYS B CG    1 
ATOM   4354 C  CD    . LYS B 2 21  ? -68.031  -38.723 14.618  1.00 66.83  ? 20   LYS B CD    1 
ATOM   4355 C  CE    . LYS B 2 21  ? -68.833  -39.038 13.363  1.00 78.64  ? 20   LYS B CE    1 
ATOM   4356 N  NZ    . LYS B 2 21  ? -70.141  -39.673 13.686  1.00 70.87  ? 20   LYS B NZ    1 
ATOM   4357 N  N     . VAL B 2 22  ? -64.692  -33.959 12.525  1.00 57.46  ? 21   VAL B N     1 
ATOM   4358 C  CA    . VAL B 2 22  ? -64.710  -32.578 12.035  1.00 59.83  ? 21   VAL B CA    1 
ATOM   4359 C  C     . VAL B 2 22  ? -64.764  -32.535 10.507  1.00 61.92  ? 21   VAL B C     1 
ATOM   4360 O  O     . VAL B 2 22  ? -64.144  -33.360 9.831   1.00 63.43  ? 21   VAL B O     1 
ATOM   4361 C  CB    . VAL B 2 22  ? -63.482  -31.774 12.529  1.00 52.85  ? 21   VAL B CB    1 
ATOM   4362 C  CG1   . VAL B 2 22  ? -63.744  -30.277 12.432  1.00 63.75  ? 21   VAL B CG1   1 
ATOM   4363 C  CG2   . VAL B 2 22  ? -63.124  -32.143 13.962  1.00 56.48  ? 21   VAL B CG2   1 
ATOM   4364 N  N     . LYS B 2 23  ? -65.511  -31.567 9.977   1.00 58.86  ? 22   LYS B N     1 
ATOM   4365 C  CA    . LYS B 2 23  ? -65.637  -31.366 8.533   1.00 59.04  ? 22   LYS B CA    1 
ATOM   4366 C  C     . LYS B 2 23  ? -64.376  -30.737 7.943   1.00 55.76  ? 22   LYS B C     1 
ATOM   4367 O  O     . LYS B 2 23  ? -63.759  -29.863 8.557   1.00 49.59  ? 22   LYS B O     1 
ATOM   4368 C  CB    . LYS B 2 23  ? -66.851  -30.487 8.215   1.00 61.47  ? 22   LYS B CB    1 
ATOM   4369 C  CG    . LYS B 2 23  ? -68.194  -31.115 8.555   1.00 58.38  ? 22   LYS B CG    1 
ATOM   4370 C  CD    . LYS B 2 23  ? -69.335  -30.148 8.281   1.00 76.56  ? 22   LYS B CD    1 
ATOM   4371 C  CE    . LYS B 2 23  ? -70.676  -30.754 8.660   1.00 85.44  ? 22   LYS B CE    1 
ATOM   4372 N  NZ    . LYS B 2 23  ? -71.801  -29.810 8.411   1.00 75.58  ? 22   LYS B NZ    1 
ATOM   4373 N  N     . GLN B 2 24  ? -64.005  -31.190 6.747   1.00 59.48  ? 23   GLN B N     1 
ATOM   4374 C  CA    . GLN B 2 24  ? -62.830  -30.681 6.044   1.00 62.15  ? 23   GLN B CA    1 
ATOM   4375 C  C     . GLN B 2 24  ? -63.154  -29.387 5.297   1.00 65.87  ? 23   GLN B C     1 
ATOM   4376 O  O     . GLN B 2 24  ? -64.133  -29.319 4.549   1.00 72.32  ? 23   GLN B O     1 
ATOM   4377 C  CB    . GLN B 2 24  ? -62.284  -31.742 5.077   1.00 63.49  ? 23   GLN B CB    1 
ATOM   4378 C  CG    . GLN B 2 24  ? -61.070  -31.314 4.259   1.00 66.06  ? 23   GLN B CG    1 
ATOM   4379 C  CD    . GLN B 2 24  ? -59.812  -31.138 5.092   1.00 71.30  ? 23   GLN B CD    1 
ATOM   4380 O  OE1   . GLN B 2 24  ? -59.470  -31.990 5.914   1.00 71.01  ? 23   GLN B OE1   1 
ATOM   4381 N  NE2   . GLN B 2 24  ? -59.111  -30.032 4.874   1.00 64.23  ? 23   GLN B NE2   1 
ATOM   4382 N  N     . TRP B 2 25  ? -62.326  -28.367 5.513   1.00 63.60  ? 24   TRP B N     1 
ATOM   4383 C  CA    . TRP B 2 25  ? -62.469  -27.085 4.828   1.00 66.15  ? 24   TRP B CA    1 
ATOM   4384 C  C     . TRP B 2 25  ? -61.872  -27.164 3.447   1.00 69.24  ? 24   TRP B C     1 
ATOM   4385 O  O     . TRP B 2 25  ? -60.763  -27.682 3.285   1.00 69.70  ? 24   TRP B O     1 
ATOM   4386 C  CB    . TRP B 2 25  ? -61.806  -25.971 5.634   1.00 74.68  ? 24   TRP B CB    1 
ATOM   4387 C  CG    . TRP B 2 25  ? -62.293  -24.587 5.270   1.00 89.11  ? 24   TRP B CG    1 
ATOM   4388 C  CD1   . TRP B 2 25  ? -61.812  -23.755 4.261   1.00 83.07  ? 24   TRP B CD1   1 
ATOM   4389 C  CD2   . TRP B 2 25  ? -63.381  -23.827 5.903   1.00 89.85  ? 24   TRP B CD2   1 
ATOM   4390 N  NE1   . TRP B 2 25  ? -62.506  -22.571 4.230   1.00 82.45  ? 24   TRP B NE1   1 
ATOM   4391 C  CE2   . TRP B 2 25  ? -63.460  -22.548 5.185   1.00 88.67  ? 24   TRP B CE2   1 
ATOM   4392 C  CE3   . TRP B 2 25  ? -64.264  -24.067 6.952   1.00 85.40  ? 24   TRP B CE3   1 
ATOM   4393 C  CZ2   . TRP B 2 25  ? -64.388  -21.571 5.521   1.00 86.37  ? 24   TRP B CZ2   1 
ATOM   4394 C  CZ3   . TRP B 2 25  ? -65.196  -23.073 7.281   1.00 87.80  ? 24   TRP B CZ3   1 
ATOM   4395 C  CH2   . TRP B 2 25  ? -65.254  -21.856 6.582   1.00 73.14  ? 24   TRP B CH2   1 
ATOM   4396 N  N     . PRO B 2 26  ? -62.602  -26.661 2.428   1.00 63.43  ? 25   PRO B N     1 
ATOM   4397 C  CA    . PRO B 2 26  ? -62.147  -26.691 1.032   1.00 61.88  ? 25   PRO B CA    1 
ATOM   4398 C  C     . PRO B 2 26  ? -60.789  -26.022 0.816   1.00 61.40  ? 25   PRO B C     1 
ATOM   4399 O  O     . PRO B 2 26  ? -60.497  -24.992 1.428   1.00 63.00  ? 25   PRO B O     1 
ATOM   4400 C  CB    . PRO B 2 26  ? -63.244  -25.920 0.281   1.00 63.52  ? 25   PRO B CB    1 
ATOM   4401 C  CG    . PRO B 2 26  ? -64.016  -25.192 1.332   1.00 63.05  ? 25   PRO B CG    1 
ATOM   4402 C  CD    . PRO B 2 26  ? -63.949  -26.076 2.537   1.00 65.89  ? 25   PRO B CD    1 
ATOM   4403 N  N     . LEU B 2 27  ? -59.977  -26.619 -0.054  1.00 56.72  ? 26   LEU B N     1 
ATOM   4404 C  CA    . LEU B 2 27  ? -58.636  -26.118 -0.355  1.00 56.54  ? 26   LEU B CA    1 
ATOM   4405 C  C     . LEU B 2 27  ? -58.475  -25.828 -1.847  1.00 65.15  ? 26   LEU B C     1 
ATOM   4406 O  O     . LEU B 2 27  ? -59.258  -26.311 -2.669  1.00 69.66  ? 26   LEU B O     1 
ATOM   4407 C  CB    . LEU B 2 27  ? -57.573  -27.119 0.112   1.00 58.66  ? 26   LEU B CB    1 
ATOM   4408 C  CG    . LEU B 2 27  ? -57.458  -27.403 1.615   1.00 65.41  ? 26   LEU B CG    1 
ATOM   4409 C  CD1   . LEU B 2 27  ? -56.818  -28.761 1.858   1.00 67.98  ? 26   LEU B CD1   1 
ATOM   4410 C  CD2   . LEU B 2 27  ? -56.686  -26.308 2.339   1.00 83.22  ? 26   LEU B CD2   1 
ATOM   4411 N  N     . THR B 2 28  ? -57.458  -25.037 -2.185  1.00 63.45  ? 27   THR B N     1 
ATOM   4412 C  CA    . THR B 2 28  ? -57.194  -24.650 -3.574  1.00 63.99  ? 27   THR B CA    1 
ATOM   4413 C  C     . THR B 2 28  ? -56.627  -25.810 -4.396  1.00 66.59  ? 27   THR B C     1 
ATOM   4414 O  O     . THR B 2 28  ? -56.137  -26.796 -3.841  1.00 67.81  ? 27   THR B O     1 
ATOM   4415 C  CB    . THR B 2 28  ? -56.239  -23.438 -3.667  1.00 62.92  ? 27   THR B CB    1 
ATOM   4416 O  OG1   . THR B 2 28  ? -54.991  -23.754 -3.039  1.00 61.51  ? 27   THR B OG1   1 
ATOM   4417 C  CG2   . THR B 2 28  ? -56.846  -22.211 -2.996  1.00 65.38  ? 27   THR B CG2   1 
ATOM   4418 N  N     . GLU B 2 29  ? -56.696  -25.671 -5.720  1.00 64.96  ? 28   GLU B N     1 
ATOM   4419 C  CA    . GLU B 2 29  ? -56.225  -26.689 -6.663  1.00 66.05  ? 28   GLU B CA    1 
ATOM   4420 C  C     . GLU B 2 29  ? -54.720  -26.941 -6.538  1.00 63.84  ? 28   GLU B C     1 
ATOM   4421 O  O     . GLU B 2 29  ? -54.248  -28.054 -6.779  1.00 65.80  ? 28   GLU B O     1 
ATOM   4422 C  CB    . GLU B 2 29  ? -56.579  -26.273 -8.095  1.00 68.82  ? 28   GLU B CB    1 
ATOM   4423 C  CG    . GLU B 2 29  ? -56.867  -27.427 -9.048  1.00 75.71  ? 28   GLU B CG    1 
ATOM   4424 C  CD    . GLU B 2 29  ? -55.622  -28.008 -9.698  1.00 87.10  ? 28   GLU B CD    1 
ATOM   4425 O  OE1   . GLU B 2 29  ? -54.570  -27.332 -9.720  1.00 87.44  ? 28   GLU B OE1   1 
ATOM   4426 O  OE2   . GLU B 2 29  ? -55.702  -29.148 -10.201 1.00 87.00  ? 28   GLU B OE2   1 
ATOM   4427 N  N     . GLU B 2 30  ? -53.980  -25.900 -6.159  1.00 63.14  ? 29   GLU B N     1 
ATOM   4428 C  CA    . GLU B 2 30  ? -52.533  -25.987 -5.968  1.00 64.24  ? 29   GLU B CA    1 
ATOM   4429 C  C     . GLU B 2 30  ? -52.173  -26.676 -4.648  1.00 64.19  ? 29   GLU B C     1 
ATOM   4430 O  O     . GLU B 2 30  ? -51.233  -27.473 -4.596  1.00 67.60  ? 29   GLU B O     1 
ATOM   4431 C  CB    . GLU B 2 30  ? -51.904  -24.590 -6.030  1.00 72.02  ? 29   GLU B CB    1 
ATOM   4432 C  CG    . GLU B 2 30  ? -50.383  -24.579 -6.113  1.00 93.66  ? 29   GLU B CG    1 
ATOM   4433 C  CD    . GLU B 2 30  ? -49.792  -23.180 -6.073  1.00 102.03 ? 29   GLU B CD    1 
ATOM   4434 O  OE1   . GLU B 2 30  ? -50.400  -22.280 -5.453  1.00 78.14  ? 29   GLU B OE1   1 
ATOM   4435 O  OE2   . GLU B 2 30  ? -48.707  -22.981 -6.658  1.00 109.09 ? 29   GLU B OE2   1 
ATOM   4436 N  N     . LYS B 2 31  ? -52.924  -26.362 -3.592  1.00 67.05  ? 30   LYS B N     1 
ATOM   4437 C  CA    . LYS B 2 31  ? -52.680  -26.917 -2.257  1.00 68.88  ? 30   LYS B CA    1 
ATOM   4438 C  C     . LYS B 2 31  ? -52.975  -28.413 -2.169  1.00 67.12  ? 30   LYS B C     1 
ATOM   4439 O  O     . LYS B 2 31  ? -52.238  -29.152 -1.513  1.00 65.47  ? 30   LYS B O     1 
ATOM   4440 C  CB    . LYS B 2 31  ? -53.484  -26.160 -1.195  1.00 66.09  ? 30   LYS B CB    1 
ATOM   4441 C  CG    . LYS B 2 31  ? -52.896  -24.815 -0.801  1.00 70.45  ? 30   LYS B CG    1 
ATOM   4442 C  CD    . LYS B 2 31  ? -53.779  -24.108 0.216   1.00 74.75  ? 30   LYS B CD    1 
ATOM   4443 C  CE    . LYS B 2 31  ? -53.253  -22.722 0.555   1.00 86.75  ? 30   LYS B CE    1 
ATOM   4444 N  NZ    . LYS B 2 31  ? -51.989  -22.761 1.344   1.00 77.45  ? 30   LYS B NZ    1 
ATOM   4445 N  N     . ILE B 2 32  ? -54.048  -28.849 -2.829  1.00 62.86  ? 31   ILE B N     1 
ATOM   4446 C  CA    . ILE B 2 32  ? -54.444  -30.261 -2.843  1.00 60.52  ? 31   ILE B CA    1 
ATOM   4447 C  C     . ILE B 2 32  ? -53.386  -31.127 -3.533  1.00 66.18  ? 31   ILE B C     1 
ATOM   4448 O  O     . ILE B 2 32  ? -52.975  -32.157 -2.993  1.00 67.86  ? 31   ILE B O     1 
ATOM   4449 C  CB    . ILE B 2 32  ? -55.837  -30.463 -3.492  1.00 54.45  ? 31   ILE B CB    1 
ATOM   4450 C  CG1   . ILE B 2 32  ? -56.922  -29.786 -2.644  1.00 60.72  ? 31   ILE B CG1   1 
ATOM   4451 C  CG2   . ILE B 2 32  ? -56.152  -31.946 -3.661  1.00 53.69  ? 31   ILE B CG2   1 
ATOM   4452 C  CD1   . ILE B 2 32  ? -58.216  -29.511 -3.383  1.00 58.73  ? 31   ILE B CD1   1 
ATOM   4453 N  N     . LYS B 2 33  ? -52.939  -30.692 -4.712  1.00 64.28  ? 32   LYS B N     1 
ATOM   4454 C  CA    . LYS B 2 33  ? -51.895  -31.390 -5.470  1.00 59.66  ? 32   LYS B CA    1 
ATOM   4455 C  C     . LYS B 2 33  ? -50.569  -31.474 -4.714  1.00 66.17  ? 32   LYS B C     1 
ATOM   4456 O  O     . LYS B 2 33  ? -49.808  -32.428 -4.889  1.00 67.05  ? 32   LYS B O     1 
ATOM   4457 C  CB    . LYS B 2 33  ? -51.678  -30.726 -6.832  1.00 61.33  ? 32   LYS B CB    1 
ATOM   4458 C  CG    . LYS B 2 33  ? -52.676  -31.145 -7.899  1.00 73.22  ? 32   LYS B CG    1 
ATOM   4459 C  CD    . LYS B 2 33  ? -52.283  -30.597 -9.261  1.00 76.54  ? 32   LYS B CD    1 
ATOM   4460 C  CE    . LYS B 2 33  ? -53.102  -31.234 -10.371 1.00 82.22  ? 32   LYS B CE    1 
ATOM   4461 N  NZ    . LYS B 2 33  ? -52.741  -30.691 -11.709 1.00 92.90  ? 32   LYS B NZ    1 
ATOM   4462 N  N     . ALA B 2 34  ? -50.303  -30.470 -3.880  1.00 65.76  ? 33   ALA B N     1 
ATOM   4463 C  CA    . ALA B 2 34  ? -49.109  -30.444 -3.038  1.00 63.37  ? 33   ALA B CA    1 
ATOM   4464 C  C     . ALA B 2 34  ? -49.203  -31.458 -1.898  1.00 69.07  ? 33   ALA B C     1 
ATOM   4465 O  O     . ALA B 2 34  ? -48.205  -32.085 -1.539  1.00 79.18  ? 33   ALA B O     1 
ATOM   4466 C  CB    . ALA B 2 34  ? -48.875  -29.044 -2.491  1.00 57.78  ? 33   ALA B CB    1 
ATOM   4467 N  N     . LEU B 2 35  ? -50.404  -31.615 -1.342  1.00 67.65  ? 34   LEU B N     1 
ATOM   4468 C  CA    . LEU B 2 35  ? -50.646  -32.555 -0.245  1.00 75.85  ? 34   LEU B CA    1 
ATOM   4469 C  C     . LEU B 2 35  ? -50.605  -34.011 -0.705  1.00 76.95  ? 34   LEU B C     1 
ATOM   4470 O  O     . LEU B 2 35  ? -50.155  -34.884 0.039   1.00 80.08  ? 34   LEU B O     1 
ATOM   4471 C  CB    . LEU B 2 35  ? -51.983  -32.260 0.447   1.00 76.70  ? 34   LEU B CB    1 
ATOM   4472 C  CG    . LEU B 2 35  ? -52.134  -30.960 1.248   1.00 69.41  ? 34   LEU B CG    1 
ATOM   4473 C  CD1   . LEU B 2 35  ? -53.592  -30.735 1.615   1.00 65.37  ? 34   LEU B CD1   1 
ATOM   4474 C  CD2   . LEU B 2 35  ? -51.260  -30.947 2.494   1.00 63.91  ? 34   LEU B CD2   1 
ATOM   4475 N  N     . VAL B 2 36  ? -51.076  -34.262 -1.927  1.00 74.78  ? 35   VAL B N     1 
ATOM   4476 C  CA    . VAL B 2 36  ? -51.053  -35.601 -2.525  1.00 75.65  ? 35   VAL B CA    1 
ATOM   4477 C  C     . VAL B 2 36  ? -49.611  -36.090 -2.698  1.00 83.45  ? 35   VAL B C     1 
ATOM   4478 O  O     . VAL B 2 36  ? -49.308  -37.253 -2.422  1.00 84.13  ? 35   VAL B O     1 
ATOM   4479 C  CB    . VAL B 2 36  ? -51.812  -35.641 -3.877  1.00 71.38  ? 35   VAL B CB    1 
ATOM   4480 C  CG1   . VAL B 2 36  ? -51.658  -36.994 -4.559  1.00 71.39  ? 35   VAL B CG1   1 
ATOM   4481 C  CG2   . VAL B 2 36  ? -53.287  -35.329 -3.673  1.00 67.60  ? 35   VAL B CG2   1 
ATOM   4482 N  N     . GLU B 2 37  ? -48.733  -35.188 -3.134  1.00 83.12  ? 36   GLU B N     1 
ATOM   4483 C  CA    . GLU B 2 37  ? -47.313  -35.488 -3.326  1.00 82.53  ? 36   GLU B CA    1 
ATOM   4484 C  C     . GLU B 2 37  ? -46.620  -35.870 -2.014  1.00 88.19  ? 36   GLU B C     1 
ATOM   4485 O  O     . GLU B 2 37  ? -45.799  -36.789 -1.987  1.00 88.56  ? 36   GLU B O     1 
ATOM   4486 C  CB    . GLU B 2 37  ? -46.601  -34.297 -3.978  1.00 75.14  ? 36   GLU B CB    1 
ATOM   4487 C  CG    . GLU B 2 37  ? -45.211  -34.606 -4.517  1.00 82.50  ? 36   GLU B CG    1 
ATOM   4488 C  CD    . GLU B 2 37  ? -44.487  -33.376 -5.037  1.00 81.31  ? 36   GLU B CD    1 
ATOM   4489 O  OE1   . GLU B 2 37  ? -45.129  -32.524 -5.688  1.00 77.21  ? 36   GLU B OE1   1 
ATOM   4490 O  OE2   . GLU B 2 37  ? -43.265  -33.266 -4.802  1.00 77.48  ? 36   GLU B OE2   1 
ATOM   4491 N  N     . ILE B 2 38  ? -46.960  -35.163 -0.937  1.00 82.17  ? 37   ILE B N     1 
ATOM   4492 C  CA    . ILE B 2 38  ? -46.384  -35.417 0.388   1.00 85.85  ? 37   ILE B CA    1 
ATOM   4493 C  C     . ILE B 2 38  ? -46.934  -36.711 0.999   1.00 82.70  ? 37   ILE B C     1 
ATOM   4494 O  O     . ILE B 2 38  ? -46.177  -37.504 1.564   1.00 83.93  ? 37   ILE B O     1 
ATOM   4495 C  CB    . ILE B 2 38  ? -46.603  -34.221 1.349   1.00 80.92  ? 37   ILE B CB    1 
ATOM   4496 C  CG1   . ILE B 2 38  ? -45.978  -32.945 0.771   1.00 83.31  ? 37   ILE B CG1   1 
ATOM   4497 C  CG2   . ILE B 2 38  ? -46.017  -34.512 2.727   1.00 79.50  ? 37   ILE B CG2   1 
ATOM   4498 C  CD1   . ILE B 2 38  ? -46.489  -31.659 1.389   1.00 73.49  ? 37   ILE B CD1   1 
ATOM   4499 N  N     . CYS B 2 39  ? -48.244  -36.920 0.868   1.00 81.71  ? 38   CYS B N     1 
ATOM   4500 C  CA    . CYS B 2 39  ? -48.910  -38.108 1.412   1.00 82.62  ? 38   CYS B CA    1 
ATOM   4501 C  C     . CYS B 2 39  ? -48.485  -39.409 0.729   1.00 89.95  ? 38   CYS B C     1 
ATOM   4502 O  O     . CYS B 2 39  ? -48.489  -40.470 1.358   1.00 89.15  ? 38   CYS B O     1 
ATOM   4503 C  CB    . CYS B 2 39  ? -50.432  -37.952 1.354   1.00 83.01  ? 38   CYS B CB    1 
ATOM   4504 S  SG    . CYS B 2 39  ? -51.111  -36.802 2.573   1.00 77.94  ? 38   CYS B SG    1 
ATOM   4505 N  N     . THR B 2 40  ? -48.125  -39.323 -0.551  1.00 90.08  ? 39   THR B N     1 
ATOM   4506 C  CA    . THR B 2 40  ? -47.621  -40.475 -1.303  1.00 84.44  ? 39   THR B CA    1 
ATOM   4507 C  C     . THR B 2 40  ? -46.213  -40.853 -0.831  1.00 84.34  ? 39   THR B C     1 
ATOM   4508 O  O     . THR B 2 40  ? -45.871  -42.037 -0.763  1.00 92.15  ? 39   THR B O     1 
ATOM   4509 C  CB    . THR B 2 40  ? -47.623  -40.211 -2.826  1.00 81.93  ? 39   THR B CB    1 
ATOM   4510 O  OG1   . THR B 2 40  ? -48.896  -39.687 -3.224  1.00 83.38  ? 39   THR B OG1   1 
ATOM   4511 C  CG2   . THR B 2 40  ? -47.353  -41.496 -3.607  1.00 84.60  ? 39   THR B CG2   1 
ATOM   4512 N  N     . GLU B 2 41  ? -45.412  -39.840 -0.504  1.00 78.45  ? 40   GLU B N     1 
ATOM   4513 C  CA    . GLU B 2 41  ? -44.063  -40.039 0.030   1.00 79.23  ? 40   GLU B CA    1 
ATOM   4514 C  C     . GLU B 2 41  ? -44.096  -40.691 1.411   1.00 84.02  ? 40   GLU B C     1 
ATOM   4515 O  O     . GLU B 2 41  ? -43.304  -41.591 1.698   1.00 88.26  ? 40   GLU B O     1 
ATOM   4516 C  CB    . GLU B 2 41  ? -43.308  -38.708 0.104   1.00 86.57  ? 40   GLU B CB    1 
ATOM   4517 C  CG    . GLU B 2 41  ? -42.843  -38.164 -1.239  1.00 94.93  ? 40   GLU B CG    1 
ATOM   4518 C  CD    . GLU B 2 41  ? -42.215  -36.785 -1.135  1.00 95.99  ? 40   GLU B CD    1 
ATOM   4519 O  OE1   . GLU B 2 41  ? -41.475  -36.528 -0.160  1.00 85.01  ? 40   GLU B OE1   1 
ATOM   4520 O  OE2   . GLU B 2 41  ? -42.455  -35.955 -2.037  1.00 94.07  ? 40   GLU B OE2   1 
ATOM   4521 N  N     . MET B 2 42  ? -45.021  -40.233 2.253   1.00 85.69  ? 41   MET B N     1 
ATOM   4522 C  CA    . MET B 2 42  ? -45.165  -40.732 3.621   1.00 82.20  ? 41   MET B CA    1 
ATOM   4523 C  C     . MET B 2 42  ? -45.781  -42.131 3.676   1.00 80.88  ? 41   MET B C     1 
ATOM   4524 O  O     . MET B 2 42  ? -45.566  -42.870 4.639   1.00 84.41  ? 41   MET B O     1 
ATOM   4525 C  CB    . MET B 2 42  ? -45.994  -39.756 4.463   1.00 78.68  ? 41   MET B CB    1 
ATOM   4526 C  CG    . MET B 2 42  ? -45.318  -38.418 4.725   1.00 82.29  ? 41   MET B CG    1 
ATOM   4527 S  SD    . MET B 2 42  ? -46.385  -37.221 5.553   1.00 81.37  ? 41   MET B SD    1 
ATOM   4528 C  CE    . MET B 2 42  ? -46.483  -37.911 7.204   1.00 77.32  ? 41   MET B CE    1 
ATOM   4529 N  N     . GLU B 2 43  ? -46.545  -42.483 2.642   1.00 79.37  ? 42   GLU B N     1 
ATOM   4530 C  CA    . GLU B 2 43  ? -47.163  -43.805 2.535   1.00 81.32  ? 42   GLU B CA    1 
ATOM   4531 C  C     . GLU B 2 43  ? -46.120  -44.885 2.238   1.00 83.61  ? 42   GLU B C     1 
ATOM   4532 O  O     . GLU B 2 43  ? -46.193  -45.992 2.776   1.00 80.23  ? 42   GLU B O     1 
ATOM   4533 C  CB    . GLU B 2 43  ? -48.253  -43.802 1.457   1.00 80.30  ? 42   GLU B CB    1 
ATOM   4534 C  CG    . GLU B 2 43  ? -49.168  -45.020 1.478   1.00 79.88  ? 42   GLU B CG    1 
ATOM   4535 C  CD    . GLU B 2 43  ? -50.209  -45.009 0.371   1.00 79.14  ? 42   GLU B CD    1 
ATOM   4536 O  OE1   . GLU B 2 43  ? -50.124  -44.156 -0.541  1.00 71.08  ? 42   GLU B OE1   1 
ATOM   4537 O  OE2   . GLU B 2 43  ? -51.121  -45.862 0.410   1.00 81.69  ? 42   GLU B OE2   1 
ATOM   4538 N  N     . LYS B 2 44  ? -45.156  -44.549 1.382   1.00 85.60  ? 43   LYS B N     1 
ATOM   4539 C  CA    . LYS B 2 44  ? -44.073  -45.463 1.017   1.00 91.93  ? 43   LYS B CA    1 
ATOM   4540 C  C     . LYS B 2 44  ? -43.048  -45.611 2.142   1.00 94.14  ? 43   LYS B C     1 
ATOM   4541 O  O     . LYS B 2 44  ? -42.427  -46.666 2.289   1.00 107.98 ? 43   LYS B O     1 
ATOM   4542 C  CB    . LYS B 2 44  ? -43.381  -44.995 -0.266  1.00 86.19  ? 43   LYS B CB    1 
ATOM   4543 C  CG    . LYS B 2 44  ? -44.240  -45.101 -1.517  1.00 92.45  ? 43   LYS B CG    1 
ATOM   4544 C  CD    . LYS B 2 44  ? -43.497  -44.592 -2.742  1.00 97.37  ? 43   LYS B CD    1 
ATOM   4545 C  CE    . LYS B 2 44  ? -44.361  -44.684 -3.989  1.00 100.96 ? 43   LYS B CE    1 
ATOM   4546 N  NZ    . LYS B 2 44  ? -43.648  -44.184 -5.196  1.00 95.40  ? 43   LYS B NZ    1 
ATOM   4547 N  N     . GLU B 2 45  ? -42.880  -44.548 2.926   1.00 85.70  ? 44   GLU B N     1 
ATOM   4548 C  CA    . GLU B 2 45  ? -41.958  -44.544 4.064   1.00 88.90  ? 44   GLU B CA    1 
ATOM   4549 C  C     . GLU B 2 45  ? -42.496  -45.345 5.251   1.00 89.65  ? 44   GLU B C     1 
ATOM   4550 O  O     . GLU B 2 45  ? -41.725  -45.810 6.093   1.00 92.64  ? 44   GLU B O     1 
ATOM   4551 C  CB    . GLU B 2 45  ? -41.644  -43.107 4.495   1.00 83.64  ? 44   GLU B CB    1 
ATOM   4552 C  CG    . GLU B 2 45  ? -40.679  -42.374 3.573   1.00 91.05  ? 44   GLU B CG    1 
ATOM   4553 C  CD    . GLU B 2 45  ? -40.623  -40.880 3.841   1.00 100.44 ? 44   GLU B CD    1 
ATOM   4554 O  OE1   . GLU B 2 45  ? -41.692  -40.233 3.878   1.00 95.61  ? 44   GLU B OE1   1 
ATOM   4555 O  OE2   . GLU B 2 45  ? -39.504  -40.349 4.003   1.00 106.36 ? 44   GLU B OE2   1 
ATOM   4556 N  N     . GLY B 2 46  ? -43.817  -45.500 5.308   1.00 87.46  ? 45   GLY B N     1 
ATOM   4557 C  CA    . GLY B 2 46  ? -44.473  -46.249 6.378   1.00 92.79  ? 45   GLY B CA    1 
ATOM   4558 C  C     . GLY B 2 46  ? -44.973  -45.367 7.506   1.00 81.44  ? 45   GLY B C     1 
ATOM   4559 O  O     . GLY B 2 46  ? -45.125  -45.826 8.641   1.00 77.05  ? 45   GLY B O     1 
ATOM   4560 N  N     . LYS B 2 47  ? -45.229  -44.099 7.190   1.00 83.69  ? 46   LYS B N     1 
ATOM   4561 C  CA    . LYS B 2 47  ? -45.717  -43.129 8.169   1.00 85.14  ? 46   LYS B CA    1 
ATOM   4562 C  C     . LYS B 2 47  ? -47.242  -43.139 8.245   1.00 85.96  ? 46   LYS B C     1 
ATOM   4563 O  O     . LYS B 2 47  ? -47.816  -43.078 9.334   1.00 79.47  ? 46   LYS B O     1 
ATOM   4564 C  CB    . LYS B 2 47  ? -45.208  -41.722 7.833   1.00 78.56  ? 46   LYS B CB    1 
ATOM   4565 C  CG    . LYS B 2 47  ? -43.694  -41.577 7.881   1.00 83.53  ? 46   LYS B CG    1 
ATOM   4566 C  CD    . LYS B 2 47  ? -43.249  -40.240 7.311   1.00 88.99  ? 46   LYS B CD    1 
ATOM   4567 C  CE    . LYS B 2 47  ? -41.733  -40.130 7.281   1.00 85.84  ? 46   LYS B CE    1 
ATOM   4568 N  NZ    . LYS B 2 47  ? -41.283  -38.815 6.746   1.00 88.79  ? 46   LYS B NZ    1 
ATOM   4569 N  N     . ILE B 2 48  ? -47.887  -43.213 7.081   1.00 85.91  ? 47   ILE B N     1 
ATOM   4570 C  CA    . ILE B 2 48  ? -49.350  -43.256 6.987   1.00 77.95  ? 47   ILE B CA    1 
ATOM   4571 C  C     . ILE B 2 48  ? -49.827  -44.368 6.049   1.00 75.50  ? 47   ILE B C     1 
ATOM   4572 O  O     . ILE B 2 48  ? -49.092  -44.797 5.156   1.00 83.18  ? 47   ILE B O     1 
ATOM   4573 C  CB    . ILE B 2 48  ? -49.952  -41.899 6.541   1.00 71.59  ? 47   ILE B CB    1 
ATOM   4574 C  CG1   . ILE B 2 48  ? -49.236  -41.366 5.290   1.00 72.08  ? 47   ILE B CG1   1 
ATOM   4575 C  CG2   . ILE B 2 48  ? -49.910  -40.892 7.686   1.00 68.11  ? 47   ILE B CG2   1 
ATOM   4576 C  CD1   . ILE B 2 48  ? -49.945  -40.220 4.595   1.00 74.69  ? 47   ILE B CD1   1 
ATOM   4577 N  N     . SER B 2 49  ? -51.059  -44.827 6.262   1.00 69.64  ? 48   SER B N     1 
ATOM   4578 C  CA    . SER B 2 49  ? -51.655  -45.881 5.440   1.00 79.67  ? 48   SER B CA    1 
ATOM   4579 C  C     . SER B 2 49  ? -53.101  -45.560 5.062   1.00 75.34  ? 48   SER B C     1 
ATOM   4580 O  O     . SER B 2 49  ? -53.812  -44.884 5.810   1.00 72.65  ? 48   SER B O     1 
ATOM   4581 C  CB    . SER B 2 49  ? -51.587  -47.228 6.163   1.00 70.55  ? 48   SER B CB    1 
ATOM   4582 O  OG    . SER B 2 49  ? -50.243  -47.635 6.359   1.00 78.41  ? 48   SER B OG    1 
ATOM   4583 N  N     . LYS B 2 50  ? -53.523  -46.053 3.899   1.00 75.40  ? 49   LYS B N     1 
ATOM   4584 C  CA    . LYS B 2 50  ? -54.886  -45.851 3.406   1.00 73.01  ? 49   LYS B CA    1 
ATOM   4585 C  C     . LYS B 2 50  ? -55.902  -46.687 4.180   1.00 73.12  ? 49   LYS B C     1 
ATOM   4586 O  O     . LYS B 2 50  ? -55.660  -47.860 4.476   1.00 78.31  ? 49   LYS B O     1 
ATOM   4587 C  CB    . LYS B 2 50  ? -54.977  -46.178 1.912   1.00 74.43  ? 49   LYS B CB    1 
ATOM   4588 C  CG    . LYS B 2 50  ? -54.446  -45.089 0.994   1.00 72.88  ? 49   LYS B CG    1 
ATOM   4589 C  CD    . LYS B 2 50  ? -54.677  -45.440 -0.468  1.00 76.56  ? 49   LYS B CD    1 
ATOM   4590 C  CE    . LYS B 2 50  ? -54.291  -44.294 -1.392  1.00 70.17  ? 49   LYS B CE    1 
ATOM   4591 N  NZ    . LYS B 2 50  ? -52.819  -44.073 -1.451  1.00 77.46  ? 49   LYS B NZ    1 
ATOM   4592 N  N     . ILE B 2 51  ? -57.036  -46.070 4.504   1.00 65.90  ? 50   ILE B N     1 
ATOM   4593 C  CA    . ILE B 2 51  ? -58.130  -46.750 5.204   1.00 70.88  ? 50   ILE B CA    1 
ATOM   4594 C  C     . ILE B 2 51  ? -59.481  -46.522 4.525   1.00 67.35  ? 50   ILE B C     1 
ATOM   4595 O  O     . ILE B 2 51  ? -59.693  -45.501 3.866   1.00 66.58  ? 50   ILE B O     1 
ATOM   4596 C  CB    . ILE B 2 51  ? -58.204  -46.366 6.704   1.00 73.20  ? 50   ILE B CB    1 
ATOM   4597 C  CG1   . ILE B 2 51  ? -57.911  -44.875 6.925   1.00 66.18  ? 50   ILE B CG1   1 
ATOM   4598 C  CG2   . ILE B 2 51  ? -57.245  -47.222 7.518   1.00 77.64  ? 50   ILE B CG2   1 
ATOM   4599 C  CD1   . ILE B 2 51  ? -59.138  -43.985 6.916   1.00 66.14  ? 50   ILE B CD1   1 
ATOM   4600 N  N     . GLY B 2 52  ? -60.388  -47.482 4.697   1.00 70.17  ? 51   GLY B N     1 
ATOM   4601 C  CA    . GLY B 2 52  ? -61.698  -47.451 4.049   1.00 74.87  ? 51   GLY B CA    1 
ATOM   4602 C  C     . GLY B 2 52  ? -62.707  -46.503 4.678   1.00 77.27  ? 51   GLY B C     1 
ATOM   4603 O  O     . GLY B 2 52  ? -62.345  -45.673 5.516   1.00 84.21  ? 51   GLY B O     1 
ATOM   4604 N  N     . PRO B 2 53  ? -63.988  -46.624 4.275   1.00 72.64  ? 52   PRO B N     1 
ATOM   4605 C  CA    . PRO B 2 53  ? -65.061  -45.745 4.744   1.00 78.68  ? 52   PRO B CA    1 
ATOM   4606 C  C     . PRO B 2 53  ? -65.659  -46.161 6.092   1.00 78.41  ? 52   PRO B C     1 
ATOM   4607 O  O     . PRO B 2 53  ? -66.537  -45.468 6.614   1.00 79.61  ? 52   PRO B O     1 
ATOM   4608 C  CB    . PRO B 2 53  ? -66.109  -45.869 3.638   1.00 83.69  ? 52   PRO B CB    1 
ATOM   4609 C  CG    . PRO B 2 53  ? -65.928  -47.252 3.111   1.00 75.30  ? 52   PRO B CG    1 
ATOM   4610 C  CD    . PRO B 2 53  ? -64.482  -47.624 3.308   1.00 70.06  ? 52   PRO B CD    1 
ATOM   4611 N  N     . GLU B 2 54  ? -65.182  -47.276 6.645   1.00 74.64  ? 53   GLU B N     1 
ATOM   4612 C  CA    . GLU B 2 54  ? -65.659  -47.784 7.935   1.00 74.96  ? 53   GLU B CA    1 
ATOM   4613 C  C     . GLU B 2 54  ? -65.199  -46.924 9.117   1.00 77.93  ? 53   GLU B C     1 
ATOM   4614 O  O     . GLU B 2 54  ? -65.696  -47.075 10.235  1.00 80.31  ? 53   GLU B O     1 
ATOM   4615 C  CB    . GLU B 2 54  ? -65.249  -49.253 8.134   1.00 70.23  ? 53   GLU B CB    1 
ATOM   4616 C  CG    . GLU B 2 54  ? -63.756  -49.501 8.336   1.00 78.51  ? 53   GLU B CG    1 
ATOM   4617 C  CD    . GLU B 2 54  ? -62.950  -49.472 7.046   1.00 72.61  ? 53   GLU B CD    1 
ATOM   4618 O  OE1   . GLU B 2 54  ? -63.546  -49.573 5.951   1.00 70.66  ? 53   GLU B OE1   1 
ATOM   4619 O  OE2   . GLU B 2 54  ? -61.710  -49.352 7.128   1.00 72.45  ? 53   GLU B OE2   1 
ATOM   4620 N  N     . ASN B 2 55  ? -64.249  -46.028 8.851   1.00 69.79  ? 54   ASN B N     1 
ATOM   4621 C  CA    . ASN B 2 55  ? -63.754  -45.077 9.839   1.00 67.32  ? 54   ASN B CA    1 
ATOM   4622 C  C     . ASN B 2 55  ? -64.551  -43.769 9.773   1.00 72.94  ? 54   ASN B C     1 
ATOM   4623 O  O     . ASN B 2 55  ? -64.455  -43.037 8.785   1.00 72.04  ? 54   ASN B O     1 
ATOM   4624 C  CB    . ASN B 2 55  ? -62.260  -44.813 9.608   1.00 61.64  ? 54   ASN B CB    1 
ATOM   4625 C  CG    . ASN B 2 55  ? -61.584  -44.140 10.792  1.00 69.03  ? 54   ASN B CG    1 
ATOM   4626 O  OD1   . ASN B 2 55  ? -62.146  -43.250 11.432  1.00 72.15  ? 54   ASN B OD1   1 
ATOM   4627 N  ND2   . ASN B 2 55  ? -60.357  -44.558 11.077  1.00 73.31  ? 54   ASN B ND2   1 
ATOM   4628 N  N     . PRO B 2 56  ? -65.346  -43.477 10.821  1.00 76.12  ? 55   PRO B N     1 
ATOM   4629 C  CA    . PRO B 2 56  ? -66.166  -42.263 10.836  1.00 75.98  ? 55   PRO B CA    1 
ATOM   4630 C  C     . PRO B 2 56  ? -65.411  -41.013 11.298  1.00 73.35  ? 55   PRO B C     1 
ATOM   4631 O  O     . PRO B 2 56  ? -65.887  -39.895 11.086  1.00 76.64  ? 55   PRO B O     1 
ATOM   4632 C  CB    . PRO B 2 56  ? -67.273  -42.608 11.832  1.00 72.77  ? 55   PRO B CB    1 
ATOM   4633 C  CG    . PRO B 2 56  ? -66.644  -43.576 12.776  1.00 70.05  ? 55   PRO B CG    1 
ATOM   4634 C  CD    . PRO B 2 56  ? -65.554  -44.299 12.030  1.00 67.99  ? 55   PRO B CD    1 
ATOM   4635 N  N     . TYR B 2 57  ? -64.249  -41.209 11.918  1.00 68.10  ? 56   TYR B N     1 
ATOM   4636 C  CA    . TYR B 2 57  ? -63.473  -40.109 12.489  1.00 58.72  ? 56   TYR B CA    1 
ATOM   4637 C  C     . TYR B 2 57  ? -62.686  -39.350 11.423  1.00 56.58  ? 56   TYR B C     1 
ATOM   4638 O  O     . TYR B 2 57  ? -62.124  -39.953 10.506  1.00 67.86  ? 56   TYR B O     1 
ATOM   4639 C  CB    . TYR B 2 57  ? -62.531  -40.624 13.584  1.00 62.93  ? 56   TYR B CB    1 
ATOM   4640 C  CG    . TYR B 2 57  ? -63.179  -41.582 14.565  1.00 67.00  ? 56   TYR B CG    1 
ATOM   4641 C  CD1   . TYR B 2 57  ? -64.153  -41.143 15.463  1.00 74.15  ? 56   TYR B CD1   1 
ATOM   4642 C  CD2   . TYR B 2 57  ? -62.813  -42.928 14.598  1.00 67.13  ? 56   TYR B CD2   1 
ATOM   4643 C  CE1   . TYR B 2 57  ? -64.747  -42.018 16.361  1.00 75.45  ? 56   TYR B CE1   1 
ATOM   4644 C  CE2   . TYR B 2 57  ? -63.401  -43.810 15.493  1.00 72.37  ? 56   TYR B CE2   1 
ATOM   4645 C  CZ    . TYR B 2 57  ? -64.365  -43.350 16.371  1.00 70.67  ? 56   TYR B CZ    1 
ATOM   4646 O  OH    . TYR B 2 57  ? -64.951  -44.221 17.261  1.00 74.97  ? 56   TYR B OH    1 
ATOM   4647 N  N     . ASN B 2 58  ? -62.653  -38.025 11.556  1.00 58.50  ? 57   ASN B N     1 
ATOM   4648 C  CA    . ASN B 2 58  ? -61.955  -37.159 10.605  1.00 62.59  ? 57   ASN B CA    1 
ATOM   4649 C  C     . ASN B 2 58  ? -61.240  -35.986 11.275  1.00 62.84  ? 57   ASN B C     1 
ATOM   4650 O  O     . ASN B 2 58  ? -61.677  -35.490 12.316  1.00 61.06  ? 57   ASN B O     1 
ATOM   4651 C  CB    . ASN B 2 58  ? -62.925  -36.647 9.534   1.00 61.02  ? 57   ASN B CB    1 
ATOM   4652 C  CG    . ASN B 2 58  ? -62.214  -36.003 8.355   1.00 66.12  ? 57   ASN B CG    1 
ATOM   4653 O  OD1   . ASN B 2 58  ? -61.238  -36.541 7.830   1.00 71.56  ? 57   ASN B OD1   1 
ATOM   4654 N  ND2   . ASN B 2 58  ? -62.706  -34.844 7.932   1.00 68.32  ? 57   ASN B ND2   1 
ATOM   4655 N  N     . THR B 2 59  ? -60.140  -35.554 10.662  1.00 59.66  ? 58   THR B N     1 
ATOM   4656 C  CA    . THR B 2 59  ? -59.334  -34.442 11.162  1.00 56.14  ? 58   THR B CA    1 
ATOM   4657 C  C     . THR B 2 59  ? -59.009  -33.485 10.007  1.00 65.98  ? 58   THR B C     1 
ATOM   4658 O  O     . THR B 2 59  ? -58.623  -33.936 8.926   1.00 76.28  ? 58   THR B O     1 
ATOM   4659 C  CB    . THR B 2 59  ? -58.025  -34.950 11.808  1.00 63.88  ? 58   THR B CB    1 
ATOM   4660 O  OG1   . THR B 2 59  ? -58.268  -36.186 12.492  1.00 70.67  ? 58   THR B OG1   1 
ATOM   4661 C  CG2   . THR B 2 59  ? -57.474  -33.938 12.797  1.00 59.34  ? 58   THR B CG2   1 
ATOM   4662 N  N     . PRO B 2 60  ? -59.184  -32.163 10.222  1.00 56.86  ? 59   PRO B N     1 
ATOM   4663 C  CA    . PRO B 2 60  ? -58.883  -31.171 9.180   1.00 55.80  ? 59   PRO B CA    1 
ATOM   4664 C  C     . PRO B 2 60  ? -57.403  -31.122 8.799   1.00 60.40  ? 59   PRO B C     1 
ATOM   4665 O  O     . PRO B 2 60  ? -56.533  -31.243 9.666   1.00 67.72  ? 59   PRO B O     1 
ATOM   4666 C  CB    . PRO B 2 60  ? -59.303  -29.844 9.824   1.00 54.76  ? 59   PRO B CB    1 
ATOM   4667 C  CG    . PRO B 2 60  ? -60.291  -30.223 10.872  1.00 55.35  ? 59   PRO B CG    1 
ATOM   4668 C  CD    . PRO B 2 60  ? -59.805  -31.537 11.403  1.00 57.11  ? 59   PRO B CD    1 
ATOM   4669 N  N     . VAL B 2 61  ? -57.134  -30.946 7.506   1.00 58.22  ? 60   VAL B N     1 
ATOM   4670 C  CA    . VAL B 2 61  ? -55.766  -30.850 6.992   1.00 63.06  ? 60   VAL B CA    1 
ATOM   4671 C  C     . VAL B 2 61  ? -55.588  -29.596 6.124   1.00 65.74  ? 60   VAL B C     1 
ATOM   4672 O  O     . VAL B 2 61  ? -56.433  -29.285 5.280   1.00 66.60  ? 60   VAL B O     1 
ATOM   4673 C  CB    . VAL B 2 61  ? -55.334  -32.147 6.248   1.00 66.94  ? 60   VAL B CB    1 
ATOM   4674 C  CG1   . VAL B 2 61  ? -56.180  -32.393 5.002   1.00 62.26  ? 60   VAL B CG1   1 
ATOM   4675 C  CG2   . VAL B 2 61  ? -53.849  -32.120 5.907   1.00 69.73  ? 60   VAL B CG2   1 
ATOM   4676 N  N     . PHE B 2 62  ? -54.491  -28.878 6.355   1.00 64.45  ? 61   PHE B N     1 
ATOM   4677 C  CA    . PHE B 2 62  ? -54.193  -27.640 5.635   1.00 67.43  ? 61   PHE B CA    1 
ATOM   4678 C  C     . PHE B 2 62  ? -52.765  -27.638 5.093   1.00 68.71  ? 61   PHE B C     1 
ATOM   4679 O  O     . PHE B 2 62  ? -51.896  -28.351 5.603   1.00 69.50  ? 61   PHE B O     1 
ATOM   4680 C  CB    . PHE B 2 62  ? -54.408  -26.423 6.543   1.00 73.63  ? 61   PHE B CB    1 
ATOM   4681 C  CG    . PHE B 2 62  ? -55.813  -26.290 7.065   1.00 64.99  ? 61   PHE B CG    1 
ATOM   4682 C  CD1   . PHE B 2 62  ? -56.799  -25.668 6.304   1.00 68.01  ? 61   PHE B CD1   1 
ATOM   4683 C  CD2   . PHE B 2 62  ? -56.151  -26.779 8.324   1.00 61.53  ? 61   PHE B CD2   1 
ATOM   4684 C  CE1   . PHE B 2 62  ? -58.094  -25.543 6.785   1.00 73.90  ? 61   PHE B CE1   1 
ATOM   4685 C  CE2   . PHE B 2 62  ? -57.444  -26.657 8.810   1.00 67.59  ? 61   PHE B CE2   1 
ATOM   4686 C  CZ    . PHE B 2 62  ? -58.417  -26.037 8.040   1.00 75.31  ? 61   PHE B CZ    1 
ATOM   4687 N  N     . ALA B 2 63  ? -52.532  -26.833 4.059   1.00 68.66  ? 62   ALA B N     1 
ATOM   4688 C  CA    . ALA B 2 63  ? -51.210  -26.714 3.447   1.00 70.53  ? 62   ALA B CA    1 
ATOM   4689 C  C     . ALA B 2 63  ? -50.561  -25.369 3.768   1.00 76.94  ? 62   ALA B C     1 
ATOM   4690 O  O     . ALA B 2 63  ? -51.141  -24.310 3.515   1.00 82.69  ? 62   ALA B O     1 
ATOM   4691 C  CB    . ALA B 2 63  ? -51.298  -26.924 1.942   1.00 71.15  ? 62   ALA B CB    1 
ATOM   4692 N  N     . ILE B 2 64  ? -49.357  -25.427 4.333   1.00 73.84  ? 63   ILE B N     1 
ATOM   4693 C  CA    . ILE B 2 64  ? -48.581  -24.230 4.673   1.00 82.33  ? 63   ILE B CA    1 
ATOM   4694 C  C     . ILE B 2 64  ? -47.241  -24.210 3.933   1.00 87.40  ? 63   ILE B C     1 
ATOM   4695 O  O     . ILE B 2 64  ? -46.849  -25.207 3.324   1.00 87.42  ? 63   ILE B O     1 
ATOM   4696 C  CB    . ILE B 2 64  ? -48.346  -24.099 6.199   1.00 77.78  ? 63   ILE B CB    1 
ATOM   4697 C  CG1   . ILE B 2 64  ? -47.742  -25.387 6.777   1.00 80.65  ? 63   ILE B CG1   1 
ATOM   4698 C  CG2   . ILE B 2 64  ? -49.642  -23.717 6.907   1.00 68.11  ? 63   ILE B CG2   1 
ATOM   4699 C  CD1   . ILE B 2 64  ? -47.013  -25.202 8.093   1.00 78.38  ? 63   ILE B CD1   1 
ATOM   4700 N  N     . LYS B 2 65  ? -46.550  -23.073 3.985   1.00 87.40  ? 64   LYS B N     1 
ATOM   4701 C  CA    . LYS B 2 65  ? -45.241  -22.929 3.342   1.00 93.26  ? 64   LYS B CA    1 
ATOM   4702 C  C     . LYS B 2 65  ? -44.151  -22.484 4.319   1.00 107.83 ? 64   LYS B C     1 
ATOM   4703 O  O     . LYS B 2 65  ? -44.407  -21.700 5.237   1.00 104.47 ? 64   LYS B O     1 
ATOM   4704 C  CB    . LYS B 2 65  ? -45.316  -21.983 2.134   1.00 91.81  ? 64   LYS B CB    1 
ATOM   4705 C  CG    . LYS B 2 65  ? -45.908  -20.607 2.419   1.00 85.97  ? 64   LYS B CG    1 
ATOM   4706 C  CD    . LYS B 2 65  ? -45.912  -19.724 1.178   1.00 86.18  ? 64   LYS B CD    1 
ATOM   4707 C  CE    . LYS B 2 65  ? -47.029  -20.096 0.213   1.00 83.79  ? 64   LYS B CE    1 
ATOM   4708 N  NZ    . LYS B 2 65  ? -47.010  -19.251 -1.013  1.00 78.34  ? 64   LYS B NZ    1 
ATOM   4709 N  N     . LYS B 2 66  ? -42.940  -22.995 4.109   1.00 114.13 ? 65   LYS B N     1 
ATOM   4710 C  CA    . LYS B 2 66  ? -41.792  -22.682 4.961   1.00 116.98 ? 65   LYS B CA    1 
ATOM   4711 C  C     . LYS B 2 66  ? -40.825  -21.712 4.280   1.00 125.32 ? 65   LYS B C     1 
ATOM   4712 O  O     . LYS B 2 66  ? -40.948  -21.436 3.084   1.00 115.42 ? 65   LYS B O     1 
ATOM   4713 C  CB    . LYS B 2 66  ? -41.063  -23.968 5.362   1.00 105.13 ? 65   LYS B CB    1 
ATOM   4714 N  N     . LYS B 2 67  ? -39.867  -21.199 5.051   1.00 115.90 ? 66   LYS B N     1 
ATOM   4715 C  CA    . LYS B 2 67  ? -38.877  -20.248 4.545   1.00 113.06 ? 66   LYS B CA    1 
ATOM   4716 C  C     . LYS B 2 67  ? -37.540  -20.918 4.224   1.00 123.90 ? 66   LYS B C     1 
ATOM   4717 O  O     . LYS B 2 67  ? -36.962  -20.679 3.161   1.00 121.50 ? 66   LYS B O     1 
ATOM   4718 C  CB    . LYS B 2 67  ? -38.673  -19.104 5.542   1.00 101.77 ? 66   LYS B CB    1 
ATOM   4719 N  N     . ASP B 2 68  ? -37.058  -21.751 5.146   1.00 125.05 ? 67   ASP B N     1 
ATOM   4720 C  CA    . ASP B 2 68  ? -35.787  -22.457 4.980   1.00 114.00 ? 67   ASP B CA    1 
ATOM   4721 C  C     . ASP B 2 68  ? -35.898  -23.597 3.967   1.00 121.21 ? 67   ASP B C     1 
ATOM   4722 O  O     . ASP B 2 68  ? -35.026  -23.760 3.110   1.00 125.28 ? 67   ASP B O     1 
ATOM   4723 C  CB    . ASP B 2 68  ? -35.287  -22.989 6.326   1.00 92.44  ? 67   ASP B CB    1 
ATOM   4724 N  N     . GLY B 2 69  ? -36.972  -24.376 4.075   1.00 120.21 ? 68   GLY B N     1 
ATOM   4725 C  CA    . GLY B 2 69  ? -37.242  -25.473 3.147   1.00 115.55 ? 68   GLY B CA    1 
ATOM   4726 C  C     . GLY B 2 69  ? -37.824  -24.959 1.831   1.00 121.66 ? 68   GLY B C     1 
ATOM   4727 O  O     . GLY B 2 69  ? -37.682  -25.606 0.790   1.00 120.36 ? 68   GLY B O     1 
ATOM   4728 N  N     . THR B 2 70  ? -38.485  -23.800 1.898   1.00 121.95 ? 69   THR B N     1 
ATOM   4729 C  CA    . THR B 2 70  ? -39.092  -23.121 0.738   1.00 127.75 ? 69   THR B CA    1 
ATOM   4730 C  C     . THR B 2 70  ? -40.230  -23.895 0.057   1.00 123.23 ? 69   THR B C     1 
ATOM   4731 O  O     . THR B 2 70  ? -40.901  -23.366 -0.834  1.00 115.90 ? 69   THR B O     1 
ATOM   4732 C  CB    . THR B 2 70  ? -38.002  -22.809 -0.304  1.00 128.64 ? 69   THR B CB    1 
ATOM   4733 O  OG1   . THR B 2 70  ? -36.983  -22.001 0.294   1.00 123.72 ? 69   THR B OG1   1 
ATOM   4734 C  CG2   . THR B 2 70  ? -38.555  -21.917 -1.405  1.00 115.54 ? 69   THR B CG2   1 
ATOM   4735 N  N     . LYS B 2 71  ? -40.446  -25.136 0.488   1.00 118.17 ? 70   LYS B N     1 
ATOM   4736 C  CA    . LYS B 2 71  ? -41.482  -25.998 -0.078  1.00 105.96 ? 70   LYS B CA    1 
ATOM   4737 C  C     . LYS B 2 71  ? -42.717  -26.071 0.822   1.00 109.65 ? 70   LYS B C     1 
ATOM   4738 O  O     . LYS B 2 71  ? -42.742  -25.484 1.907   1.00 107.84 ? 70   LYS B O     1 
ATOM   4739 C  CB    . LYS B 2 71  ? -40.922  -27.401 -0.334  1.00 92.34  ? 70   LYS B CB    1 
ATOM   4740 N  N     . TRP B 2 72  ? -43.737  -26.793 0.359   1.00 92.35  ? 71   TRP B N     1 
ATOM   4741 C  CA    . TRP B 2 72  ? -44.990  -26.953 1.098   1.00 84.03  ? 71   TRP B CA    1 
ATOM   4742 C  C     . TRP B 2 72  ? -44.850  -27.886 2.267   1.00 81.16  ? 71   TRP B C     1 
ATOM   4743 O  O     . TRP B 2 72  ? -44.107  -28.869 2.207   1.00 81.17  ? 71   TRP B O     1 
ATOM   4744 C  CB    . TRP B 2 72  ? -46.098  -27.445 0.173   1.00 78.76  ? 71   TRP B CB    1 
ATOM   4745 C  CG    . TRP B 2 72  ? -46.467  -26.467 -0.917  1.00 87.45  ? 71   TRP B CG    1 
ATOM   4746 C  CD1   . TRP B 2 72  ? -45.956  -26.406 -2.212  1.00 96.94  ? 71   TRP B CD1   1 
ATOM   4747 C  CD2   . TRP B 2 72  ? -47.447  -25.371 -0.844  1.00 90.50  ? 71   TRP B CD2   1 
ATOM   4748 N  NE1   . TRP B 2 72  ? -46.533  -25.382 -2.920  1.00 100.53 ? 71   TRP B NE1   1 
ATOM   4749 C  CE2   . TRP B 2 72  ? -47.434  -24.722 -2.161  1.00 96.19  ? 71   TRP B CE2   1 
ATOM   4750 C  CE3   . TRP B 2 72  ? -48.299  -24.882 0.142   1.00 88.86  ? 71   TRP B CE3   1 
ATOM   4751 C  CZ2   . TRP B 2 72  ? -48.247  -23.635 -2.453  1.00 87.97  ? 71   TRP B CZ2   1 
ATOM   4752 C  CZ3   . TRP B 2 72  ? -49.114  -23.785 -0.166  1.00 88.47  ? 71   TRP B CZ3   1 
ATOM   4753 C  CH2   . TRP B 2 72  ? -49.087  -23.178 -1.433  1.00 89.80  ? 71   TRP B CH2   1 
ATOM   4754 N  N     . ARG B 2 73  ? -45.571  -27.577 3.343   1.00 75.33  ? 72   ARG B N     1 
ATOM   4755 C  CA    . ARG B 2 73  ? -45.594  -28.408 4.544   1.00 65.74  ? 72   ARG B CA    1 
ATOM   4756 C  C     . ARG B 2 73  ? -47.023  -28.817 4.889   1.00 71.45  ? 72   ARG B C     1 
ATOM   4757 O  O     . ARG B 2 73  ? -47.965  -28.047 4.682   1.00 74.31  ? 72   ARG B O     1 
ATOM   4758 N  N     . LYS B 2 74  ? -47.175  -30.030 5.414   1.00 67.59  ? 73   LYS B N     1 
ATOM   4759 C  CA    . LYS B 2 74  ? -48.486  -30.563 5.774   1.00 67.07  ? 73   LYS B CA    1 
ATOM   4760 C  C     . LYS B 2 74  ? -48.834  -30.240 7.226   1.00 71.64  ? 73   LYS B C     1 
ATOM   4761 O  O     . LYS B 2 74  ? -48.080  -30.570 8.145   1.00 73.91  ? 73   LYS B O     1 
ATOM   4762 C  CB    . LYS B 2 74  ? -48.538  -32.075 5.524   1.00 72.61  ? 73   LYS B CB    1 
ATOM   4763 C  CG    . LYS B 2 74  ? -49.938  -32.675 5.568   1.00 70.95  ? 73   LYS B CG    1 
ATOM   4764 C  CD    . LYS B 2 74  ? -49.969  -34.088 5.001   1.00 70.48  ? 73   LYS B CD    1 
ATOM   4765 C  CE    . LYS B 2 74  ? -49.504  -35.129 6.010   1.00 77.87  ? 73   LYS B CE    1 
ATOM   4766 N  NZ    . LYS B 2 74  ? -50.494  -35.344 7.101   1.00 77.83  ? 73   LYS B NZ    1 
ATOM   4767 N  N     . LEU B 2 75  ? -49.980  -29.589 7.415   1.00 74.46  ? 74   LEU B N     1 
ATOM   4768 C  CA    . LEU B 2 75  ? -50.461  -29.216 8.742   1.00 73.03  ? 74   LEU B CA    1 
ATOM   4769 C  C     . LEU B 2 75  ? -51.813  -29.867 9.026   1.00 66.05  ? 74   LEU B C     1 
ATOM   4770 O  O     . LEU B 2 75  ? -52.767  -29.691 8.266   1.00 69.71  ? 74   LEU B O     1 
ATOM   4771 C  CB    . LEU B 2 75  ? -50.558  -27.690 8.870   1.00 78.61  ? 74   LEU B CB    1 
ATOM   4772 C  CG    . LEU B 2 75  ? -51.025  -27.074 10.195  1.00 72.47  ? 74   LEU B CG    1 
ATOM   4773 C  CD1   . LEU B 2 75  ? -49.988  -27.252 11.294  1.00 66.97  ? 74   LEU B CD1   1 
ATOM   4774 C  CD2   . LEU B 2 75  ? -51.352  -25.600 10.007  1.00 75.37  ? 74   LEU B CD2   1 
ATOM   4775 N  N     . VAL B 2 76  ? -51.880  -30.622 10.120  1.00 59.33  ? 75   VAL B N     1 
ATOM   4776 C  CA    . VAL B 2 76  ? -53.114  -31.292 10.528  1.00 67.32  ? 75   VAL B CA    1 
ATOM   4777 C  C     . VAL B 2 76  ? -53.647  -30.656 11.813  1.00 67.87  ? 75   VAL B C     1 
ATOM   4778 O  O     . VAL B 2 76  ? -52.933  -30.566 12.816  1.00 69.34  ? 75   VAL B O     1 
ATOM   4779 C  CB    . VAL B 2 76  ? -52.915  -32.814 10.718  1.00 64.28  ? 75   VAL B CB    1 
ATOM   4780 C  CG1   . VAL B 2 76  ? -54.256  -33.517 10.864  1.00 63.62  ? 75   VAL B CG1   1 
ATOM   4781 C  CG2   . VAL B 2 76  ? -52.141  -33.412 9.551   1.00 67.45  ? 75   VAL B CG2   1 
ATOM   4782 N  N     . ASP B 2 77  ? -54.902  -30.215 11.767  1.00 67.38  ? 76   ASP B N     1 
ATOM   4783 C  CA    . ASP B 2 77  ? -55.528  -29.501 12.879  1.00 71.58  ? 76   ASP B CA    1 
ATOM   4784 C  C     . ASP B 2 77  ? -56.093  -30.456 13.933  1.00 74.65  ? 76   ASP B C     1 
ATOM   4785 O  O     . ASP B 2 77  ? -57.235  -30.910 13.826  1.00 74.23  ? 76   ASP B O     1 
ATOM   4786 C  CB    . ASP B 2 77  ? -56.620  -28.558 12.353  1.00 72.43  ? 76   ASP B CB    1 
ATOM   4787 C  CG    . ASP B 2 77  ? -57.211  -27.674 13.439  1.00 83.28  ? 76   ASP B CG    1 
ATOM   4788 O  OD1   . ASP B 2 77  ? -56.473  -27.282 14.368  1.00 88.37  ? 76   ASP B OD1   1 
ATOM   4789 O  OD2   . ASP B 2 77  ? -58.418  -27.362 13.358  1.00 83.59  ? 76   ASP B OD2   1 
ATOM   4790 N  N     . PHE B 2 78  ? -55.286  -30.744 14.953  1.00 72.80  ? 77   PHE B N     1 
ATOM   4791 C  CA    . PHE B 2 78  ? -55.667  -31.678 16.016  1.00 71.18  ? 77   PHE B CA    1 
ATOM   4792 C  C     . PHE B 2 78  ? -56.353  -31.012 17.214  1.00 73.49  ? 77   PHE B C     1 
ATOM   4793 O  O     . PHE B 2 78  ? -56.494  -31.631 18.271  1.00 75.65  ? 77   PHE B O     1 
ATOM   4794 C  CB    . PHE B 2 78  ? -54.446  -32.476 16.495  1.00 73.20  ? 77   PHE B CB    1 
ATOM   4795 C  CG    . PHE B 2 78  ? -53.978  -33.526 15.525  1.00 73.03  ? 77   PHE B CG    1 
ATOM   4796 C  CD1   . PHE B 2 78  ? -54.738  -34.670 15.291  1.00 61.14  ? 77   PHE B CD1   1 
ATOM   4797 C  CD2   . PHE B 2 78  ? -52.765  -33.385 14.861  1.00 80.55  ? 77   PHE B CD2   1 
ATOM   4798 C  CE1   . PHE B 2 78  ? -54.304  -35.642 14.402  1.00 58.00  ? 77   PHE B CE1   1 
ATOM   4799 C  CE2   . PHE B 2 78  ? -52.324  -34.355 13.973  1.00 79.49  ? 77   PHE B CE2   1 
ATOM   4800 C  CZ    . PHE B 2 78  ? -53.095  -35.485 13.743  1.00 66.24  ? 77   PHE B CZ    1 
ATOM   4801 N  N     . ARG B 2 79  ? -56.786  -29.763 17.039  1.00 73.52  ? 78   ARG B N     1 
ATOM   4802 C  CA    . ARG B 2 79  ? -57.423  -28.981 18.108  1.00 73.96  ? 78   ARG B CA    1 
ATOM   4803 C  C     . ARG B 2 79  ? -58.594  -29.692 18.784  1.00 72.28  ? 78   ARG B C     1 
ATOM   4804 O  O     . ARG B 2 79  ? -58.742  -29.625 20.007  1.00 80.56  ? 78   ARG B O     1 
ATOM   4805 C  CB    . ARG B 2 79  ? -57.891  -27.622 17.581  1.00 80.80  ? 78   ARG B CB    1 
ATOM   4806 C  CG    . ARG B 2 79  ? -56.812  -26.551 17.538  1.00 72.03  ? 78   ARG B CG    1 
ATOM   4807 C  CD    . ARG B 2 79  ? -57.381  -25.219 17.072  1.00 74.64  ? 78   ARG B CD    1 
ATOM   4808 N  NE    . ARG B 2 79  ? -57.874  -25.279 15.696  1.00 79.73  ? 78   ARG B NE    1 
ATOM   4809 C  CZ    . ARG B 2 79  ? -58.487  -24.279 15.066  1.00 78.23  ? 78   ARG B CZ    1 
ATOM   4810 N  NH1   . ARG B 2 79  ? -58.695  -23.120 15.679  1.00 71.46  ? 78   ARG B NH1   1 
ATOM   4811 N  NH2   . ARG B 2 79  ? -58.895  -24.440 13.814  1.00 84.81  ? 78   ARG B NH2   1 
ATOM   4812 N  N     . GLU B 2 80  ? -59.418  -30.365 17.984  1.00 73.35  ? 79   GLU B N     1 
ATOM   4813 C  CA    . GLU B 2 80  ? -60.579  -31.090 18.492  1.00 77.17  ? 79   GLU B CA    1 
ATOM   4814 C  C     . GLU B 2 80  ? -60.165  -32.341 19.268  1.00 84.38  ? 79   GLU B C     1 
ATOM   4815 O  O     . GLU B 2 80  ? -60.673  -32.586 20.362  1.00 87.27  ? 79   GLU B O     1 
ATOM   4816 C  CB    . GLU B 2 80  ? -61.532  -31.454 17.347  1.00 76.07  ? 79   GLU B CB    1 
ATOM   4817 C  CG    . GLU B 2 80  ? -62.938  -31.845 17.790  1.00 78.80  ? 79   GLU B CG    1 
ATOM   4818 C  CD    . GLU B 2 80  ? -63.743  -30.676 18.336  1.00 83.32  ? 79   GLU B CD    1 
ATOM   4819 O  OE1   . GLU B 2 80  ? -63.703  -29.580 17.736  1.00 80.42  ? 79   GLU B OE1   1 
ATOM   4820 O  OE2   . GLU B 2 80  ? -64.426  -30.859 19.366  1.00 92.94  ? 79   GLU B OE2   1 
ATOM   4821 N  N     . LEU B 2 81  ? -59.238  -33.113 18.701  1.00 82.95  ? 80   LEU B N     1 
ATOM   4822 C  CA    . LEU B 2 81  ? -58.753  -34.355 19.314  1.00 80.54  ? 80   LEU B CA    1 
ATOM   4823 C  C     . LEU B 2 81  ? -57.963  -34.116 20.605  1.00 76.74  ? 80   LEU B C     1 
ATOM   4824 O  O     . LEU B 2 81  ? -58.037  -34.918 21.539  1.00 75.44  ? 80   LEU B O     1 
ATOM   4825 C  CB    . LEU B 2 81  ? -57.915  -35.161 18.307  1.00 68.77  ? 80   LEU B CB    1 
ATOM   4826 C  CG    . LEU B 2 81  ? -57.209  -36.458 18.735  1.00 63.71  ? 80   LEU B CG    1 
ATOM   4827 C  CD1   . LEU B 2 81  ? -58.184  -37.509 19.249  1.00 63.48  ? 80   LEU B CD1   1 
ATOM   4828 C  CD2   . LEU B 2 81  ? -56.381  -37.018 17.589  1.00 58.76  ? 80   LEU B CD2   1 
ATOM   4829 N  N     . ASN B 2 82  ? -57.218  -33.012 20.647  1.00 72.13  ? 81   ASN B N     1 
ATOM   4830 C  CA    . ASN B 2 82  ? -56.413  -32.648 21.817  1.00 76.63  ? 81   ASN B CA    1 
ATOM   4831 C  C     . ASN B 2 82  ? -57.240  -32.355 23.072  1.00 84.36  ? 81   ASN B C     1 
ATOM   4832 O  O     . ASN B 2 82  ? -56.757  -32.525 24.193  1.00 82.64  ? 81   ASN B O     1 
ATOM   4833 C  CB    . ASN B 2 82  ? -55.496  -31.463 21.494  1.00 78.07  ? 81   ASN B CB    1 
ATOM   4834 C  CG    . ASN B 2 82  ? -54.347  -31.843 20.574  1.00 70.23  ? 81   ASN B CG    1 
ATOM   4835 O  OD1   . ASN B 2 82  ? -53.851  -32.971 20.602  1.00 68.35  ? 81   ASN B OD1   1 
ATOM   4836 N  ND2   . ASN B 2 82  ? -53.912  -30.893 19.754  1.00 66.81  ? 81   ASN B ND2   1 
ATOM   4837 N  N     . LYS B 2 83  ? -58.482  -31.917 22.873  1.00 82.20  ? 82   LYS B N     1 
ATOM   4838 C  CA    . LYS B 2 83  ? -59.412  -31.672 23.977  1.00 85.45  ? 82   LYS B CA    1 
ATOM   4839 C  C     . LYS B 2 83  ? -59.978  -32.977 24.541  1.00 92.31  ? 82   LYS B C     1 
ATOM   4840 O  O     . LYS B 2 83  ? -60.405  -33.028 25.697  1.00 97.08  ? 82   LYS B O     1 
ATOM   4841 C  CB    . LYS B 2 83  ? -60.556  -30.757 23.529  1.00 82.27  ? 82   LYS B CB    1 
ATOM   4842 C  CG    . LYS B 2 83  ? -60.142  -29.319 23.246  1.00 82.67  ? 82   LYS B CG    1 
ATOM   4843 C  CD    . LYS B 2 83  ? -61.345  -28.428 22.958  1.00 88.53  ? 82   LYS B CD    1 
ATOM   4844 C  CE    . LYS B 2 83  ? -61.863  -28.592 21.535  1.00 83.41  ? 82   LYS B CE    1 
ATOM   4845 N  NZ    . LYS B 2 83  ? -60.948  -27.997 20.521  1.00 88.16  ? 82   LYS B NZ    1 
ATOM   4846 N  N     . LYS B 2 84  ? -59.975  -34.022 23.717  1.00 89.94  ? 83   LYS B N     1 
ATOM   4847 C  CA    . LYS B 2 84  ? -60.532  -35.324 24.088  1.00 95.26  ? 83   LYS B CA    1 
ATOM   4848 C  C     . LYS B 2 84  ? -59.455  -36.251 24.654  1.00 94.67  ? 83   LYS B C     1 
ATOM   4849 O  O     . LYS B 2 84  ? -59.764  -37.295 25.235  1.00 96.62  ? 83   LYS B O     1 
ATOM   4850 C  CB    . LYS B 2 84  ? -61.206  -35.979 22.882  1.00 89.35  ? 83   LYS B CB    1 
ATOM   4851 C  CG    . LYS B 2 84  ? -62.452  -35.255 22.396  1.00 89.56  ? 83   LYS B CG    1 
ATOM   4852 C  CD    . LYS B 2 84  ? -62.799  -35.647 20.970  1.00 80.11  ? 83   LYS B CD    1 
ATOM   4853 C  CE    . LYS B 2 84  ? -64.057  -34.942 20.492  1.00 85.72  ? 83   LYS B CE    1 
ATOM   4854 N  NZ    . LYS B 2 84  ? -64.395  -35.299 19.087  1.00 88.77  ? 83   LYS B NZ    1 
ATOM   4855 N  N     . THR B 2 85  ? -58.194  -35.857 24.481  1.00 92.66  ? 84   THR B N     1 
ATOM   4856 C  CA    . THR B 2 85  ? -57.048  -36.627 24.969  1.00 92.29  ? 84   THR B CA    1 
ATOM   4857 C  C     . THR B 2 85  ? -56.190  -35.800 25.932  1.00 97.95  ? 84   THR B C     1 
ATOM   4858 O  O     . THR B 2 85  ? -54.974  -35.996 26.023  1.00 91.45  ? 84   THR B O     1 
ATOM   4859 C  CB    . THR B 2 85  ? -56.167  -37.132 23.804  1.00 83.66  ? 84   THR B CB    1 
ATOM   4860 O  OG1   . THR B 2 85  ? -55.771  -36.025 22.983  1.00 84.07  ? 84   THR B OG1   1 
ATOM   4861 C  CG2   . THR B 2 85  ? -56.920  -38.143 22.955  1.00 83.54  ? 84   THR B CG2   1 
ATOM   4862 N  N     . GLN B 2 86  ? -56.834  -34.886 26.655  1.00 107.74 ? 85   GLN B N     1 
ATOM   4863 C  CA    . GLN B 2 86  ? -56.131  -33.953 27.540  1.00 107.47 ? 85   GLN B CA    1 
ATOM   4864 C  C     . GLN B 2 86  ? -55.621  -34.584 28.839  1.00 112.99 ? 85   GLN B C     1 
ATOM   4865 O  O     . GLN B 2 86  ? -54.687  -34.069 29.455  1.00 111.56 ? 85   GLN B O     1 
ATOM   4866 C  CB    . GLN B 2 86  ? -56.995  -32.717 27.839  1.00 107.12 ? 85   GLN B CB    1 
ATOM   4867 C  CG    . GLN B 2 86  ? -58.268  -32.988 28.632  1.00 119.71 ? 85   GLN B CG    1 
ATOM   4868 C  CD    . GLN B 2 86  ? -58.967  -31.715 29.077  1.00 125.03 ? 85   GLN B CD    1 
ATOM   4869 O  OE1   . GLN B 2 86  ? -59.182  -30.797 28.285  1.00 118.10 ? 85   GLN B OE1   1 
ATOM   4870 N  NE2   . GLN B 2 86  ? -59.333  -31.660 30.353  1.00 116.68 ? 85   GLN B NE2   1 
ATOM   4871 N  N     . ASP B 2 87  ? -56.234  -35.695 29.245  1.00 116.05 ? 86   ASP B N     1 
ATOM   4872 C  CA    . ASP B 2 87  ? -55.835  -36.406 30.462  1.00 114.10 ? 86   ASP B CA    1 
ATOM   4873 C  C     . ASP B 2 87  ? -54.532  -37.190 30.292  1.00 113.37 ? 86   ASP B C     1 
ATOM   4874 O  O     . ASP B 2 87  ? -53.857  -37.503 31.275  1.00 106.67 ? 86   ASP B O     1 
ATOM   4875 C  CB    . ASP B 2 87  ? -56.955  -37.341 30.933  1.00 103.77 ? 86   ASP B CB    1 
ATOM   4876 C  CG    . ASP B 2 87  ? -58.093  -36.599 31.618  1.00 106.06 ? 86   ASP B CG    1 
ATOM   4877 O  OD1   . ASP B 2 87  ? -58.537  -35.554 31.096  1.00 107.04 ? 86   ASP B OD1   1 
ATOM   4878 O  OD2   . ASP B 2 87  ? -58.550  -37.071 32.681  1.00 94.20  ? 86   ASP B OD2   1 
ATOM   4879 N  N     . PHE B 2 88  ? -54.186  -37.500 29.044  1.00 116.19 ? 87   PHE B N     1 
ATOM   4880 C  CA    . PHE B 2 88  ? -52.986  -38.275 28.734  1.00 116.34 ? 87   PHE B CA    1 
ATOM   4881 C  C     . PHE B 2 88  ? -51.707  -37.438 28.795  1.00 121.69 ? 87   PHE B C     1 
ATOM   4882 O  O     . PHE B 2 88  ? -50.709  -37.867 29.376  1.00 115.18 ? 87   PHE B O     1 
ATOM   4883 C  CB    . PHE B 2 88  ? -53.125  -38.949 27.361  1.00 107.06 ? 87   PHE B CB    1 
ATOM   4884 C  CG    . PHE B 2 88  ? -51.895  -39.697 26.918  1.00 110.45 ? 87   PHE B CG    1 
ATOM   4885 C  CD1   . PHE B 2 88  ? -51.599  -40.952 27.441  1.00 110.14 ? 87   PHE B CD1   1 
ATOM   4886 C  CD2   . PHE B 2 88  ? -51.037  -39.149 25.968  1.00 99.39  ? 87   PHE B CD2   1 
ATOM   4887 C  CE1   . PHE B 2 88  ? -50.467  -41.641 27.033  1.00 110.71 ? 87   PHE B CE1   1 
ATOM   4888 C  CE2   . PHE B 2 88  ? -49.904  -39.835 25.556  1.00 101.33 ? 87   PHE B CE2   1 
ATOM   4889 C  CZ    . PHE B 2 88  ? -49.620  -41.082 26.089  1.00 112.38 ? 87   PHE B CZ    1 
ATOM   4890 N  N     . TRP B 2 89  ? -51.745  -36.249 28.195  1.00 116.85 ? 88   TRP B N     1 
ATOM   4891 C  CA    . TRP B 2 89  ? -50.549  -35.418 28.043  1.00 112.95 ? 88   TRP B CA    1 
ATOM   4892 C  C     . TRP B 2 89  ? -50.407  -34.331 29.079  1.00 125.55 ? 88   TRP B C     1 
ATOM   4893 O  O     . TRP B 2 89  ? -49.459  -33.542 29.028  1.00 123.33 ? 88   TRP B O     1 
ATOM   4894 C  CB    . TRP B 2 89  ? -50.499  -34.821 26.640  1.00 96.73  ? 88   TRP B CB    1 
ATOM   4895 N  N     . GLU B 2 90  ? -51.337  -34.282 30.031  1.00 118.22 ? 89   GLU B N     1 
ATOM   4896 C  CA    . GLU B 2 90  ? -51.295  -33.276 31.094  1.00 131.76 ? 89   GLU B CA    1 
ATOM   4897 C  C     . GLU B 2 90  ? -51.303  -33.886 32.495  1.00 128.93 ? 89   GLU B C     1 
ATOM   4898 O  O     . GLU B 2 90  ? -50.607  -33.402 33.390  1.00 131.33 ? 89   GLU B O     1 
ATOM   4899 C  CB    . GLU B 2 90  ? -52.446  -32.277 30.944  1.00 116.01 ? 89   GLU B CB    1 
ATOM   4900 N  N     . VAL B 2 91  ? -52.090  -34.945 32.676  1.00 127.77 ? 90   VAL B N     1 
ATOM   4901 C  CA    . VAL B 2 91  ? -52.212  -35.614 33.974  1.00 118.37 ? 90   VAL B CA    1 
ATOM   4902 C  C     . VAL B 2 91  ? -51.335  -36.868 34.036  1.00 112.62 ? 90   VAL B C     1 
ATOM   4903 O  O     . VAL B 2 91  ? -50.550  -37.034 34.973  1.00 98.06  ? 90   VAL B O     1 
ATOM   4904 C  CB    . VAL B 2 91  ? -53.684  -35.966 34.307  1.00 108.93 ? 90   VAL B CB    1 
ATOM   4905 C  CG1   . VAL B 2 91  ? -53.799  -36.548 35.709  1.00 87.10  ? 90   VAL B CG1   1 
ATOM   4906 C  CG2   . VAL B 2 91  ? -54.576  -34.739 34.174  1.00 99.16  ? 90   VAL B CG2   1 
ATOM   4907 N  N     . GLN B 2 92  ? -51.473  -37.737 33.036  1.00 120.50 ? 91   GLN B N     1 
ATOM   4908 C  CA    . GLN B 2 92  ? -50.724  -38.995 32.980  1.00 118.38 ? 91   GLN B CA    1 
ATOM   4909 C  C     . GLN B 2 92  ? -49.251  -38.776 32.629  1.00 116.01 ? 91   GLN B C     1 
ATOM   4910 O  O     . GLN B 2 92  ? -48.363  -39.284 33.317  1.00 117.55 ? 91   GLN B O     1 
ATOM   4911 C  CB    . GLN B 2 92  ? -51.373  -39.972 31.992  1.00 112.19 ? 91   GLN B CB    1 
ATOM   4912 C  CG    . GLN B 2 92  ? -52.722  -40.517 32.444  1.00 118.39 ? 91   GLN B CG    1 
ATOM   4913 C  CD    . GLN B 2 92  ? -53.359  -41.461 31.437  1.00 136.27 ? 91   GLN B CD    1 
ATOM   4914 O  OE1   . GLN B 2 92  ? -52.759  -41.809 30.418  1.00 131.96 ? 91   GLN B OE1   1 
ATOM   4915 N  NE2   . GLN B 2 92  ? -54.586  -41.882 31.722  1.00 129.38 ? 91   GLN B NE2   1 
ATOM   4916 N  N     . LEU B 2 93  ? -49.004  -38.022 31.560  1.00 114.63 ? 92   LEU B N     1 
ATOM   4917 C  CA    . LEU B 2 93  ? -47.646  -37.689 31.130  1.00 112.22 ? 92   LEU B CA    1 
ATOM   4918 C  C     . LEU B 2 93  ? -47.525  -36.197 30.822  1.00 115.44 ? 92   LEU B C     1 
ATOM   4919 O  O     . LEU B 2 93  ? -47.537  -35.784 29.659  1.00 112.56 ? 92   LEU B O     1 
ATOM   4920 C  CB    . LEU B 2 93  ? -47.234  -38.535 29.916  1.00 117.36 ? 92   LEU B CB    1 
ATOM   4921 C  CG    . LEU B 2 93  ? -46.954  -40.029 30.119  1.00 104.63 ? 92   LEU B CG    1 
ATOM   4922 C  CD1   . LEU B 2 93  ? -47.029  -40.771 28.792  1.00 94.32  ? 92   LEU B CD1   1 
ATOM   4923 C  CD2   . LEU B 2 93  ? -45.607  -40.263 30.790  1.00 91.58  ? 92   LEU B CD2   1 
ATOM   4924 N  N     . GLY B 2 94  ? -47.412  -35.395 31.878  1.00 119.41 ? 93   GLY B N     1 
ATOM   4925 C  CA    . GLY B 2 94  ? -47.328  -33.942 31.752  1.00 118.44 ? 93   GLY B CA    1 
ATOM   4926 C  C     . GLY B 2 94  ? -45.907  -33.426 31.632  1.00 117.68 ? 93   GLY B C     1 
ATOM   4927 O  O     . GLY B 2 94  ? -44.982  -33.977 32.235  1.00 121.76 ? 93   GLY B O     1 
ATOM   4928 N  N     . ILE B 2 95  ? -45.740  -32.363 30.849  1.00 115.50 ? 94   ILE B N     1 
ATOM   4929 C  CA    . ILE B 2 95  ? -44.437  -31.730 30.653  1.00 119.34 ? 94   ILE B CA    1 
ATOM   4930 C  C     . ILE B 2 95  ? -44.238  -30.616 31.686  1.00 115.48 ? 94   ILE B C     1 
ATOM   4931 O  O     . ILE B 2 95  ? -45.036  -29.676 31.744  1.00 110.94 ? 94   ILE B O     1 
ATOM   4932 C  CB    . ILE B 2 95  ? -44.277  -31.171 29.218  1.00 118.88 ? 94   ILE B CB    1 
ATOM   4933 C  CG1   . ILE B 2 95  ? -44.570  -32.262 28.179  1.00 104.25 ? 94   ILE B CG1   1 
ATOM   4934 C  CG2   . ILE B 2 95  ? -42.880  -30.595 29.016  1.00 94.00  ? 94   ILE B CG2   1 
ATOM   4935 C  CD1   . ILE B 2 95  ? -44.927  -31.738 26.803  1.00 89.25  ? 94   ILE B CD1   1 
ATOM   4936 N  N     . PRO B 2 96  ? -43.177  -30.727 32.513  1.00 119.07 ? 95   PRO B N     1 
ATOM   4937 C  CA    . PRO B 2 96  ? -42.868  -29.725 33.539  1.00 113.95 ? 95   PRO B CA    1 
ATOM   4938 C  C     . PRO B 2 96  ? -42.463  -28.380 32.941  1.00 117.13 ? 95   PRO B C     1 
ATOM   4939 O  O     . PRO B 2 96  ? -41.783  -28.336 31.913  1.00 119.51 ? 95   PRO B O     1 
ATOM   4940 C  CB    . PRO B 2 96  ? -41.684  -30.344 34.295  1.00 99.40  ? 95   PRO B CB    1 
ATOM   4941 C  CG    . PRO B 2 96  ? -41.732  -31.800 33.977  1.00 102.09 ? 95   PRO B CG    1 
ATOM   4942 C  CD    . PRO B 2 96  ? -42.244  -31.865 32.571  1.00 116.10 ? 95   PRO B CD    1 
ATOM   4943 N  N     . HIS B 2 97  ? -42.886  -27.297 33.590  1.00 115.11 ? 96   HIS B N     1 
ATOM   4944 C  CA    . HIS B 2 97  ? -42.601  -25.942 33.121  1.00 111.98 ? 96   HIS B CA    1 
ATOM   4945 C  C     . HIS B 2 97  ? -41.894  -25.126 34.172  1.00 110.66 ? 96   HIS B C     1 
ATOM   4946 O  O     . HIS B 2 97  ? -42.379  -25.016 35.302  1.00 109.99 ? 96   HIS B O     1 
ATOM   4947 C  CB    . HIS B 2 97  ? -43.888  -25.252 32.676  1.00 108.39 ? 96   HIS B CB    1 
ATOM   4948 C  CG    . HIS B 2 97  ? -43.695  -23.818 32.240  1.00 107.00 ? 96   HIS B CG    1 
ATOM   4949 N  ND1   . HIS B 2 97  ? -43.265  -23.487 31.010  1.00 102.70 ? 96   HIS B ND1   1 
ATOM   4950 C  CD2   . HIS B 2 97  ? -43.891  -22.620 32.924  1.00 100.93 ? 96   HIS B CD2   1 
ATOM   4951 C  CE1   . HIS B 2 97  ? -43.187  -22.147 30.908  1.00 98.42  ? 96   HIS B CE1   1 
ATOM   4952 N  NE2   . HIS B 2 97  ? -43.571  -21.617 32.080  1.00 99.31  ? 96   HIS B NE2   1 
ATOM   4953 N  N     . PRO B 2 98  ? -40.730  -24.546 33.817  1.00 110.77 ? 97   PRO B N     1 
ATOM   4954 C  CA    . PRO B 2 98  ? -39.974  -23.690 34.730  1.00 109.00 ? 97   PRO B CA    1 
ATOM   4955 C  C     . PRO B 2 98  ? -40.382  -22.216 34.649  1.00 111.53 ? 97   PRO B C     1 
ATOM   4956 O  O     . PRO B 2 98  ? -40.917  -21.773 33.630  1.00 107.20 ? 97   PRO B O     1 
ATOM   4957 C  CB    . PRO B 2 98  ? -38.532  -23.870 34.253  1.00 108.81 ? 97   PRO B CB    1 
ATOM   4958 C  CG    . PRO B 2 98  ? -38.648  -24.176 32.797  1.00 92.49  ? 97   PRO B CG    1 
ATOM   4959 C  CD    . PRO B 2 98  ? -40.013  -24.761 32.545  1.00 101.14 ? 97   PRO B CD    1 
ATOM   4960 N  N     . ALA B 2 99  ? -40.120  -21.473 35.721  1.00 110.75 ? 98   ALA B N     1 
ATOM   4961 C  CA    . ALA B 2 99  ? -40.458  -20.051 35.790  1.00 107.21 ? 98   ALA B CA    1 
ATOM   4962 C  C     . ALA B 2 99  ? -39.244  -19.148 35.545  1.00 99.46  ? 98   ALA B C     1 
ATOM   4963 O  O     . ALA B 2 99  ? -39.278  -17.951 35.845  1.00 107.12 ? 98   ALA B O     1 
ATOM   4964 C  CB    . ALA B 2 99  ? -41.109  -19.730 37.129  1.00 92.21  ? 98   ALA B CB    1 
ATOM   4965 N  N     . GLY B 2 100 ? -38.180  -19.727 34.990  1.00 95.44  ? 99   GLY B N     1 
ATOM   4966 C  CA    . GLY B 2 100 ? -36.940  -18.996 34.729  1.00 94.38  ? 99   GLY B CA    1 
ATOM   4967 C  C     . GLY B 2 100 ? -36.604  -18.813 33.259  1.00 90.63  ? 99   GLY B C     1 
ATOM   4968 O  O     . GLY B 2 100 ? -35.571  -18.229 32.924  1.00 86.49  ? 99   GLY B O     1 
ATOM   4969 N  N     . LEU B 2 101 ? -37.476  -19.310 32.383  1.00 93.95  ? 100  LEU B N     1 
ATOM   4970 C  CA    . LEU B 2 101 ? -37.282  -19.203 30.936  1.00 92.23  ? 100  LEU B CA    1 
ATOM   4971 C  C     . LEU B 2 101 ? -37.609  -17.800 30.421  1.00 95.11  ? 100  LEU B C     1 
ATOM   4972 O  O     . LEU B 2 101 ? -37.025  -17.341 29.436  1.00 90.12  ? 100  LEU B O     1 
ATOM   4973 C  CB    . LEU B 2 101 ? -38.130  -20.251 30.203  1.00 98.29  ? 100  LEU B CB    1 
ATOM   4974 C  CG    . LEU B 2 101 ? -37.897  -20.478 28.704  1.00 95.49  ? 100  LEU B CG    1 
ATOM   4975 C  CD1   . LEU B 2 101 ? -36.626  -21.279 28.451  1.00 100.58 ? 100  LEU B CD1   1 
ATOM   4976 C  CD2   . LEU B 2 101 ? -39.097  -21.173 28.081  1.00 92.72  ? 100  LEU B CD2   1 
ATOM   4977 N  N     . LYS B 2 102 ? -38.540  -17.129 31.097  1.00 97.96  ? 101  LYS B N     1 
ATOM   4978 C  CA    . LYS B 2 102 ? -38.994  -15.788 30.710  1.00 92.80  ? 101  LYS B CA    1 
ATOM   4979 C  C     . LYS B 2 102 ? -37.937  -14.696 30.913  1.00 97.33  ? 101  LYS B C     1 
ATOM   4980 O  O     . LYS B 2 102 ? -38.066  -13.595 30.372  1.00 90.52  ? 101  LYS B O     1 
ATOM   4981 C  CB    . LYS B 2 102 ? -40.294  -15.423 31.442  1.00 86.74  ? 101  LYS B CB    1 
ATOM   4982 C  CG    . LYS B 2 102 ? -40.218  -15.494 32.961  1.00 87.51  ? 101  LYS B CG    1 
ATOM   4983 C  CD    . LYS B 2 102 ? -41.561  -15.169 33.597  1.00 85.38  ? 101  LYS B CD    1 
ATOM   4984 C  CE    . LYS B 2 102 ? -41.520  -15.324 35.110  1.00 93.34  ? 101  LYS B CE    1 
ATOM   4985 N  NZ    . LYS B 2 102 ? -40.689  -14.279 35.772  1.00 101.60 ? 101  LYS B NZ    1 
ATOM   4986 N  N     . LYS B 2 103 ? -36.900  -15.006 31.689  1.00 100.15 ? 102  LYS B N     1 
ATOM   4987 C  CA    . LYS B 2 103 ? -35.807  -14.068 31.941  1.00 97.10  ? 102  LYS B CA    1 
ATOM   4988 C  C     . LYS B 2 103 ? -34.508  -14.535 31.281  1.00 97.01  ? 102  LYS B C     1 
ATOM   4989 O  O     . LYS B 2 103 ? -33.788  -15.378 31.824  1.00 97.73  ? 102  LYS B O     1 
ATOM   4990 C  CB    . LYS B 2 103 ? -35.607  -13.857 33.447  1.00 91.58  ? 102  LYS B CB    1 
ATOM   4991 C  CG    . LYS B 2 103 ? -36.749  -13.125 34.134  1.00 91.41  ? 102  LYS B CG    1 
ATOM   4992 C  CD    . LYS B 2 103 ? -36.496  -12.983 35.626  1.00 101.30 ? 102  LYS B CD    1 
ATOM   4993 C  CE    . LYS B 2 103 ? -37.647  -12.268 36.316  1.00 105.50 ? 102  LYS B CE    1 
ATOM   4994 N  NZ    . LYS B 2 103 ? -37.414  -12.122 37.779  1.00 100.01 ? 102  LYS B NZ    1 
ATOM   4995 N  N     . LYS B 2 104 ? -34.227  -13.982 30.102  1.00 96.02  ? 103  LYS B N     1 
ATOM   4996 C  CA    . LYS B 2 104 ? -33.024  -14.315 29.337  1.00 97.51  ? 103  LYS B CA    1 
ATOM   4997 C  C     . LYS B 2 104 ? -32.606  -13.161 28.425  1.00 97.51  ? 103  LYS B C     1 
ATOM   4998 O  O     . LYS B 2 104 ? -33.378  -12.226 28.198  1.00 94.61  ? 103  LYS B O     1 
ATOM   4999 C  CB    . LYS B 2 104 ? -33.245  -15.587 28.511  1.00 89.41  ? 103  LYS B CB    1 
ATOM   5000 N  N     . LYS B 2 105 ? -31.380  -13.232 27.909  1.00 105.86 ? 104  LYS B N     1 
ATOM   5001 C  CA    . LYS B 2 105 ? -30.859  -12.216 26.995  1.00 112.90 ? 104  LYS B CA    1 
ATOM   5002 C  C     . LYS B 2 105 ? -31.199  -12.532 25.538  1.00 102.99 ? 104  LYS B C     1 
ATOM   5003 O  O     . LYS B 2 105 ? -31.591  -11.642 24.780  1.00 101.41 ? 104  LYS B O     1 
ATOM   5004 C  CB    . LYS B 2 105 ? -29.346  -12.049 27.169  1.00 104.74 ? 104  LYS B CB    1 
ATOM   5005 C  CG    . LYS B 2 105 ? -28.938  -11.364 28.465  1.00 101.23 ? 104  LYS B CG    1 
ATOM   5006 C  CD    . LYS B 2 105 ? -27.434  -11.154 28.531  1.00 106.01 ? 104  LYS B CD    1 
ATOM   5007 C  CE    . LYS B 2 105 ? -27.029  -10.465 29.824  1.00 96.14  ? 104  LYS B CE    1 
ATOM   5008 N  NZ    . LYS B 2 105 ? -25.558  -10.251 29.902  1.00 99.88  ? 104  LYS B NZ    1 
ATOM   5009 N  N     . SER B 2 106 ? -31.044  -13.800 25.157  1.00 102.91 ? 105  SER B N     1 
ATOM   5010 C  CA    . SER B 2 106 ? -31.345  -14.258 23.800  1.00 112.91 ? 105  SER B CA    1 
ATOM   5011 C  C     . SER B 2 106 ? -31.950  -15.661 23.800  1.00 102.83 ? 105  SER B C     1 
ATOM   5012 O  O     . SER B 2 106 ? -31.445  -16.565 24.471  1.00 99.91  ? 105  SER B O     1 
ATOM   5013 C  CB    . SER B 2 106 ? -30.087  -14.226 22.927  1.00 108.37 ? 105  SER B CB    1 
ATOM   5014 O  OG    . SER B 2 106 ? -29.600  -12.903 22.777  1.00 106.60 ? 105  SER B OG    1 
ATOM   5015 N  N     . VAL B 2 107 ? -33.035  -15.830 23.046  1.00 101.83 ? 106  VAL B N     1 
ATOM   5016 C  CA    . VAL B 2 107 ? -33.731  -17.116 22.937  1.00 101.74 ? 106  VAL B CA    1 
ATOM   5017 C  C     . VAL B 2 107 ? -33.859  -17.537 21.470  1.00 104.45 ? 106  VAL B C     1 
ATOM   5018 O  O     . VAL B 2 107 ? -34.326  -16.761 20.632  1.00 103.82 ? 106  VAL B O     1 
ATOM   5019 C  CB    . VAL B 2 107 ? -35.125  -17.075 23.615  1.00 97.12  ? 106  VAL B CB    1 
ATOM   5020 C  CG1   . VAL B 2 107 ? -35.903  -18.359 23.358  1.00 93.86  ? 106  VAL B CG1   1 
ATOM   5021 C  CG2   . VAL B 2 107 ? -34.990  -16.838 25.113  1.00 92.43  ? 106  VAL B CG2   1 
ATOM   5022 N  N     . THR B 2 108 ? -33.437  -18.765 21.174  1.00 106.88 ? 107  THR B N     1 
ATOM   5023 C  CA    . THR B 2 108 ? -33.499  -19.313 19.818  1.00 102.88 ? 107  THR B CA    1 
ATOM   5024 C  C     . THR B 2 108 ? -34.466  -20.499 19.753  1.00 98.34  ? 107  THR B C     1 
ATOM   5025 O  O     . THR B 2 108 ? -34.447  -21.375 20.621  1.00 93.62  ? 107  THR B O     1 
ATOM   5026 C  CB    . THR B 2 108 ? -32.102  -19.746 19.319  1.00 109.06 ? 107  THR B CB    1 
ATOM   5027 O  OG1   . THR B 2 108 ? -31.128  -18.761 19.688  1.00 113.71 ? 107  THR B OG1   1 
ATOM   5028 C  CG2   . THR B 2 108 ? -32.091  -19.916 17.802  1.00 99.92  ? 107  THR B CG2   1 
ATOM   5029 N  N     . VAL B 2 109 ? -35.306  -20.512 18.719  1.00 101.65 ? 108  VAL B N     1 
ATOM   5030 C  CA    . VAL B 2 109 ? -36.313  -21.560 18.533  1.00 101.70 ? 108  VAL B CA    1 
ATOM   5031 C  C     . VAL B 2 109 ? -35.942  -22.465 17.356  1.00 101.59 ? 108  VAL B C     1 
ATOM   5032 O  O     . VAL B 2 109 ? -35.578  -21.981 16.280  1.00 98.06  ? 108  VAL B O     1 
ATOM   5033 C  CB    . VAL B 2 109 ? -37.725  -20.965 18.308  1.00 102.37 ? 108  VAL B CB    1 
ATOM   5034 C  CG1   . VAL B 2 109 ? -38.793  -22.046 18.413  1.00 105.55 ? 108  VAL B CG1   1 
ATOM   5035 C  CG2   . VAL B 2 109 ? -38.012  -19.850 19.305  1.00 109.88 ? 108  VAL B CG2   1 
ATOM   5036 N  N     . LEU B 2 110 ? -36.035  -23.776 17.572  1.00 100.25 ? 109  LEU B N     1 
ATOM   5037 C  CA    . LEU B 2 110 ? -35.741  -24.767 16.535  1.00 100.63 ? 109  LEU B CA    1 
ATOM   5038 C  C     . LEU B 2 110 ? -36.882  -25.771 16.370  1.00 107.40 ? 109  LEU B C     1 
ATOM   5039 O  O     . LEU B 2 110 ? -37.566  -26.110 17.339  1.00 108.85 ? 109  LEU B O     1 
ATOM   5040 C  CB    . LEU B 2 110 ? -34.435  -25.507 16.846  1.00 106.59 ? 109  LEU B CB    1 
ATOM   5041 C  CG    . LEU B 2 110 ? -33.111  -24.737 16.757  1.00 111.95 ? 109  LEU B CG    1 
ATOM   5042 C  CD1   . LEU B 2 110 ? -32.016  -25.483 17.504  1.00 111.61 ? 109  LEU B CD1   1 
ATOM   5043 C  CD2   . LEU B 2 110 ? -32.701  -24.486 15.311  1.00 105.32 ? 109  LEU B CD2   1 
ATOM   5044 N  N     . ASP B 2 111 ? -37.073  -26.241 15.139  1.00 109.22 ? 110  ASP B N     1 
ATOM   5045 C  CA    . ASP B 2 111 ? -38.117  -27.214 14.827  1.00 109.92 ? 110  ASP B CA    1 
ATOM   5046 C  C     . ASP B 2 111 ? -37.563  -28.638 14.825  1.00 103.78 ? 110  ASP B C     1 
ATOM   5047 O  O     . ASP B 2 111 ? -36.607  -28.943 14.107  1.00 112.69 ? 110  ASP B O     1 
ATOM   5048 C  CB    . ASP B 2 111 ? -38.772  -26.889 13.478  1.00 103.76 ? 110  ASP B CB    1 
ATOM   5049 C  CG    . ASP B 2 111 ? -39.969  -27.779 13.172  1.00 106.59 ? 110  ASP B CG    1 
ATOM   5050 O  OD1   . ASP B 2 111 ? -40.785  -28.034 14.085  1.00 109.44 ? 110  ASP B OD1   1 
ATOM   5051 O  OD2   . ASP B 2 111 ? -40.093  -28.224 12.011  1.00 109.11 ? 110  ASP B OD2   1 
ATOM   5052 N  N     . VAL B 2 112 ? -38.169  -29.498 15.641  1.00 96.23  ? 111  VAL B N     1 
ATOM   5053 C  CA    . VAL B 2 112 ? -37.773  -30.907 15.740  1.00 92.85  ? 111  VAL B CA    1 
ATOM   5054 C  C     . VAL B 2 112 ? -38.959  -31.844 15.476  1.00 97.71  ? 111  VAL B C     1 
ATOM   5055 O  O     . VAL B 2 112 ? -39.102  -32.889 16.118  1.00 93.46  ? 111  VAL B O     1 
ATOM   5056 C  CB    . VAL B 2 112 ? -37.105  -31.232 17.103  1.00 82.69  ? 111  VAL B CB    1 
ATOM   5057 C  CG1   . VAL B 2 112 ? -35.677  -30.706 17.140  1.00 85.35  ? 111  VAL B CG1   1 
ATOM   5058 C  CG2   . VAL B 2 112 ? -37.920  -30.680 18.269  1.00 83.24  ? 111  VAL B CG2   1 
ATOM   5059 N  N     . GLY B 2 113 ? -39.796  -31.462 14.513  1.00 100.79 ? 112  GLY B N     1 
ATOM   5060 C  CA    . GLY B 2 113 ? -41.016  -32.201 14.185  1.00 98.14  ? 112  GLY B CA    1 
ATOM   5061 C  C     . GLY B 2 113 ? -40.804  -33.544 13.509  1.00 101.04 ? 112  GLY B C     1 
ATOM   5062 O  O     . GLY B 2 113 ? -41.682  -34.409 13.551  1.00 101.44 ? 112  GLY B O     1 
ATOM   5063 N  N     . ASP B 2 114 ? -39.639  -33.721 12.886  1.00 102.45 ? 113  ASP B N     1 
ATOM   5064 C  CA    . ASP B 2 114 ? -39.304  -34.963 12.186  1.00 102.73 ? 113  ASP B CA    1 
ATOM   5065 C  C     . ASP B 2 114 ? -38.882  -36.090 13.135  1.00 101.44 ? 113  ASP B C     1 
ATOM   5066 O  O     . ASP B 2 114 ? -38.706  -37.235 12.708  1.00 101.75 ? 113  ASP B O     1 
ATOM   5067 C  CB    . ASP B 2 114 ? -38.212  -34.710 11.139  1.00 101.11 ? 113  ASP B CB    1 
ATOM   5068 C  CG    . ASP B 2 114 ? -38.690  -33.841 9.986   1.00 107.87 ? 113  ASP B CG    1 
ATOM   5069 O  OD1   . ASP B 2 114 ? -39.351  -32.810 10.237  1.00 109.74 ? 113  ASP B OD1   1 
ATOM   5070 O  OD2   . ASP B 2 114 ? -38.404  -34.193 8.822   1.00 104.25 ? 113  ASP B OD2   1 
ATOM   5071 N  N     . ALA B 2 115 ? -38.729  -35.760 14.416  1.00 91.98  ? 114  ALA B N     1 
ATOM   5072 C  CA    . ALA B 2 115 ? -38.321  -36.725 15.439  1.00 92.25  ? 114  ALA B CA    1 
ATOM   5073 C  C     . ALA B 2 115 ? -39.435  -37.704 15.811  1.00 94.40  ? 114  ALA B C     1 
ATOM   5074 O  O     . ALA B 2 115 ? -39.165  -38.845 16.191  1.00 96.29  ? 114  ALA B O     1 
ATOM   5075 C  CB    . ALA B 2 115 ? -37.816  -36.001 16.678  1.00 94.08  ? 114  ALA B CB    1 
ATOM   5076 N  N     . TYR B 2 116 ? -40.671  -37.225 15.675  1.00 98.47  ? 115  TYR B N     1 
ATOM   5077 C  CA    . TYR B 2 116 ? -41.841  -38.030 16.028  1.00 101.49 ? 115  TYR B CA    1 
ATOM   5078 C  C     . TYR B 2 116 ? -42.260  -38.969 14.894  1.00 108.79 ? 115  TYR B C     1 
ATOM   5079 O  O     . TYR B 2 116 ? -43.126  -39.828 15.074  1.00 96.34  ? 115  TYR B O     1 
ATOM   5080 C  CB    . TYR B 2 116 ? -43.012  -37.124 16.411  1.00 94.74  ? 115  TYR B CB    1 
ATOM   5081 C  CG    . TYR B 2 116 ? -42.699  -36.155 17.529  1.00 99.15  ? 115  TYR B CG    1 
ATOM   5082 C  CD1   . TYR B 2 116 ? -41.441  -36.125 18.113  1.00 100.66 ? 115  TYR B CD1   1 
ATOM   5083 C  CD2   . TYR B 2 116 ? -43.664  -35.271 17.997  1.00 94.78  ? 115  TYR B CD2   1 
ATOM   5084 C  CE1   . TYR B 2 116 ? -41.149  -35.240 19.136  1.00 101.24 ? 115  TYR B CE1   1 
ATOM   5085 C  CE2   . TYR B 2 116 ? -43.381  -34.384 19.018  1.00 92.93  ? 115  TYR B CE2   1 
ATOM   5086 C  CZ    . TYR B 2 116 ? -42.123  -34.373 19.584  1.00 97.31  ? 115  TYR B CZ    1 
ATOM   5087 O  OH    . TYR B 2 116 ? -41.839  -33.489 20.600  1.00 98.48  ? 115  TYR B OH    1 
ATOM   5088 N  N     . PHE B 2 117 ? -41.633  -38.829 13.756  1.00 110.07 ? 116  PHE B N     1 
ATOM   5089 C  CA    . PHE B 2 117 ? -41.947  -39.605 12.556  1.00 103.98 ? 116  PHE B CA    1 
ATOM   5090 C  C     . PHE B 2 117 ? -41.279  -40.987 12.546  1.00 95.24  ? 116  PHE B C     1 
ATOM   5091 O  O     . PHE B 2 117 ? -41.263  -41.669 11.517  1.00 91.83  ? 116  PHE B O     1 
ATOM   5092 C  CB    . PHE B 2 117 ? -41.534  -38.825 11.307  1.00 99.88  ? 116  PHE B CB    1 
ATOM   5093 C  CG    . PHE B 2 117 ? -42.554  -37.818 10.855  1.00 109.44 ? 116  PHE B CG    1 
ATOM   5094 C  CD1   . PHE B 2 117 ? -43.844  -37.845 11.358  1.00 107.24 ? 116  PHE B CD1   1 
ATOM   5095 C  CD2   . PHE B 2 117 ? -42.221  -36.845 9.928   1.00 101.27 ? 116  PHE B CD2   1 
ATOM   5096 C  CE1   . PHE B 2 117 ? -44.782  -36.918 10.946  1.00 104.54 ? 116  PHE B CE1   1 
ATOM   5097 C  CE2   . PHE B 2 117 ? -43.157  -35.918 9.511   1.00 101.29 ? 116  PHE B CE2   1 
ATOM   5098 C  CZ    . PHE B 2 117 ? -44.439  -35.953 10.021  1.00 106.08 ? 116  PHE B CZ    1 
ATOM   5099 N  N     . SER B 2 118 ? -40.742  -41.395 13.695  1.00 93.31  ? 117  SER B N     1 
ATOM   5100 C  CA    . SER B 2 118 ? -40.053  -42.679 13.829  1.00 94.19  ? 117  SER B CA    1 
ATOM   5101 C  C     . SER B 2 118 ? -40.707  -43.597 14.865  1.00 88.26  ? 117  SER B C     1 
ATOM   5102 O  O     . SER B 2 118 ? -40.800  -44.809 14.654  1.00 91.52  ? 117  SER B O     1 
ATOM   5103 C  CB    . SER B 2 118 ? -38.576  -42.463 14.173  1.00 89.33  ? 117  SER B CB    1 
ATOM   5104 O  OG    . SER B 2 118 ? -38.431  -41.750 15.389  1.00 93.05  ? 117  SER B OG    1 
ATOM   5105 N  N     . VAL B 2 119 ? -41.152  -43.014 15.977  1.00 80.08  ? 118  VAL B N     1 
ATOM   5106 C  CA    . VAL B 2 119 ? -41.771  -43.768 17.071  1.00 82.21  ? 118  VAL B CA    1 
ATOM   5107 C  C     . VAL B 2 119 ? -43.198  -44.189 16.699  1.00 81.57  ? 118  VAL B C     1 
ATOM   5108 O  O     . VAL B 2 119 ? -44.039  -43.333 16.410  1.00 84.01  ? 118  VAL B O     1 
ATOM   5109 C  CB    . VAL B 2 119 ? -41.771  -42.962 18.393  1.00 87.53  ? 118  VAL B CB    1 
ATOM   5110 C  CG1   . VAL B 2 119 ? -42.369  -43.778 19.532  1.00 73.07  ? 118  VAL B CG1   1 
ATOM   5111 C  CG2   . VAL B 2 119 ? -40.360  -42.515 18.752  1.00 101.31 ? 118  VAL B CG2   1 
ATOM   5112 N  N     . PRO B 2 120 ? -43.471  -45.511 16.702  1.00 81.03  ? 119  PRO B N     1 
ATOM   5113 C  CA    . PRO B 2 120 ? -44.778  -46.058 16.314  1.00 80.54  ? 119  PRO B CA    1 
ATOM   5114 C  C     . PRO B 2 120 ? -45.916  -45.671 17.261  1.00 76.14  ? 119  PRO B C     1 
ATOM   5115 O  O     . PRO B 2 120 ? -45.691  -45.459 18.455  1.00 70.93  ? 119  PRO B O     1 
ATOM   5116 C  CB    . PRO B 2 120 ? -44.552  -47.574 16.352  1.00 81.93  ? 119  PRO B CB    1 
ATOM   5117 C  CG    . PRO B 2 120 ? -43.400  -47.767 17.278  1.00 84.77  ? 119  PRO B CG    1 
ATOM   5118 C  CD    . PRO B 2 120 ? -42.514  -46.580 17.045  1.00 81.71  ? 119  PRO B CD    1 
ATOM   5119 N  N     . LEU B 2 121 ? -47.126  -45.588 16.711  1.00 76.09  ? 120  LEU B N     1 
ATOM   5120 C  CA    . LEU B 2 121 ? -48.326  -45.244 17.471  1.00 73.35  ? 120  LEU B CA    1 
ATOM   5121 C  C     . LEU B 2 121 ? -49.092  -46.508 17.873  1.00 72.67  ? 120  LEU B C     1 
ATOM   5122 O  O     . LEU B 2 121 ? -48.923  -47.565 17.258  1.00 78.84  ? 120  LEU B O     1 
ATOM   5123 C  CB    . LEU B 2 121 ? -49.221  -44.310 16.642  1.00 75.44  ? 120  LEU B CB    1 
ATOM   5124 C  CG    . LEU B 2 121 ? -50.419  -43.596 17.283  1.00 77.76  ? 120  LEU B CG    1 
ATOM   5125 C  CD1   . LEU B 2 121 ? -49.975  -42.495 18.235  1.00 69.71  ? 120  LEU B CD1   1 
ATOM   5126 C  CD2   . LEU B 2 121 ? -51.333  -43.031 16.207  1.00 73.14  ? 120  LEU B CD2   1 
ATOM   5127 N  N     . ASP B 2 122 ? -49.924  -46.388 18.907  1.00 70.43  ? 121  ASP B N     1 
ATOM   5128 C  CA    . ASP B 2 122 ? -50.757  -47.491 19.391  1.00 74.97  ? 121  ASP B CA    1 
ATOM   5129 C  C     . ASP B 2 122 ? -51.765  -47.937 18.332  1.00 77.08  ? 121  ASP B C     1 
ATOM   5130 O  O     . ASP B 2 122 ? -52.416  -47.105 17.696  1.00 80.68  ? 121  ASP B O     1 
ATOM   5131 C  CB    . ASP B 2 122 ? -51.481  -47.087 20.681  1.00 77.82  ? 121  ASP B CB    1 
ATOM   5132 C  CG    . ASP B 2 122 ? -52.232  -48.243 21.325  1.00 87.31  ? 121  ASP B CG    1 
ATOM   5133 O  OD1   . ASP B 2 122 ? -51.663  -49.352 21.431  1.00 100.05 ? 121  ASP B OD1   1 
ATOM   5134 O  OD2   . ASP B 2 122 ? -53.394  -48.038 21.735  1.00 87.31  ? 121  ASP B OD2   1 
ATOM   5135 N  N     . GLU B 2 123 ? -51.884  -49.254 18.162  1.00 81.99  ? 122  GLU B N     1 
ATOM   5136 C  CA    . GLU B 2 123 ? -52.721  -49.865 17.121  1.00 88.64  ? 122  GLU B CA    1 
ATOM   5137 C  C     . GLU B 2 123 ? -54.191  -49.439 17.184  1.00 87.04  ? 122  GLU B C     1 
ATOM   5138 O  O     . GLU B 2 123 ? -54.783  -49.087 16.161  1.00 85.53  ? 122  GLU B O     1 
ATOM   5139 C  CB    . GLU B 2 123 ? -52.600  -51.395 17.179  1.00 94.48  ? 122  GLU B CB    1 
ATOM   5140 C  CG    . GLU B 2 123 ? -53.368  -52.152 16.100  1.00 95.00  ? 122  GLU B CG    1 
ATOM   5141 C  CD    . GLU B 2 123 ? -52.721  -52.065 14.729  1.00 104.68 ? 122  GLU B CD    1 
ATOM   5142 O  OE1   . GLU B 2 123 ? -51.508  -52.345 14.615  1.00 107.73 ? 122  GLU B OE1   1 
ATOM   5143 O  OE2   . GLU B 2 123 ? -53.431  -51.726 13.759  1.00 103.17 ? 122  GLU B OE2   1 
ATOM   5144 N  N     . ASP B 2 124 ? -54.766  -49.472 18.385  1.00 81.63  ? 123  ASP B N     1 
ATOM   5145 C  CA    . ASP B 2 124 ? -56.177  -49.138 18.589  1.00 83.20  ? 123  ASP B CA    1 
ATOM   5146 C  C     . ASP B 2 124 ? -56.455  -47.638 18.471  1.00 83.81  ? 123  ASP B C     1 
ATOM   5147 O  O     . ASP B 2 124 ? -57.595  -47.230 18.234  1.00 82.70  ? 123  ASP B O     1 
ATOM   5148 C  CB    . ASP B 2 124 ? -56.656  -49.655 19.950  1.00 83.59  ? 123  ASP B CB    1 
ATOM   5149 C  CG    . ASP B 2 124 ? -56.551  -51.167 20.076  1.00 95.18  ? 123  ASP B CG    1 
ATOM   5150 O  OD1   . ASP B 2 124 ? -57.075  -51.885 19.196  1.00 86.99  ? 123  ASP B OD1   1 
ATOM   5151 O  OD2   . ASP B 2 124 ? -55.939  -51.637 21.058  1.00 100.17 ? 123  ASP B OD2   1 
ATOM   5152 N  N     . PHE B 2 125 ? -55.410  -46.830 18.631  1.00 87.86  ? 124  PHE B N     1 
ATOM   5153 C  CA    . PHE B 2 125 ? -55.531  -45.374 18.590  1.00 81.91  ? 124  PHE B CA    1 
ATOM   5154 C  C     . PHE B 2 125 ? -55.254  -44.799 17.196  1.00 79.06  ? 124  PHE B C     1 
ATOM   5155 O  O     . PHE B 2 125 ? -55.468  -43.608 16.956  1.00 74.89  ? 124  PHE B O     1 
ATOM   5156 C  CB    . PHE B 2 125 ? -54.603  -44.739 19.634  1.00 84.05  ? 124  PHE B CB    1 
ATOM   5157 C  CG    . PHE B 2 125 ? -55.024  -43.362 20.065  1.00 81.41  ? 124  PHE B CG    1 
ATOM   5158 C  CD1   . PHE B 2 125 ? -56.039  -43.192 21.003  1.00 81.95  ? 124  PHE B CD1   1 
ATOM   5159 C  CD2   . PHE B 2 125 ? -54.402  -42.235 19.540  1.00 78.95  ? 124  PHE B CD2   1 
ATOM   5160 C  CE1   . PHE B 2 125 ? -56.429  -41.923 21.402  1.00 80.42  ? 124  PHE B CE1   1 
ATOM   5161 C  CE2   . PHE B 2 125 ? -54.789  -40.964 19.934  1.00 74.10  ? 124  PHE B CE2   1 
ATOM   5162 C  CZ    . PHE B 2 125 ? -55.802  -40.808 20.867  1.00 76.44  ? 124  PHE B CZ    1 
ATOM   5163 N  N     . ARG B 2 126 ? -54.795  -45.654 16.282  1.00 76.92  ? 125  ARG B N     1 
ATOM   5164 C  CA    . ARG B 2 126 ? -54.462  -45.249 14.910  1.00 70.34  ? 125  ARG B CA    1 
ATOM   5165 C  C     . ARG B 2 126 ? -55.657  -44.714 14.114  1.00 68.74  ? 125  ARG B C     1 
ATOM   5166 O  O     . ARG B 2 126 ? -55.486  -43.904 13.200  1.00 64.24  ? 125  ARG B O     1 
ATOM   5167 C  CB    . ARG B 2 126 ? -53.805  -46.406 14.148  1.00 76.37  ? 125  ARG B CB    1 
ATOM   5168 C  CG    . ARG B 2 126 ? -52.342  -46.637 14.492  1.00 80.46  ? 125  ARG B CG    1 
ATOM   5169 C  CD    . ARG B 2 126 ? -51.698  -47.636 13.543  1.00 83.44  ? 125  ARG B CD    1 
ATOM   5170 N  NE    . ARG B 2 126 ? -50.252  -47.729 13.745  1.00 77.48  ? 125  ARG B NE    1 
ATOM   5171 C  CZ    . ARG B 2 126 ? -49.625  -48.763 14.300  1.00 81.74  ? 125  ARG B CZ    1 
ATOM   5172 N  NH1   . ARG B 2 126 ? -50.304  -49.825 14.714  1.00 82.62  ? 125  ARG B NH1   1 
ATOM   5173 N  NH2   . ARG B 2 126 ? -48.306  -48.739 14.434  1.00 84.06  ? 125  ARG B NH2   1 
ATOM   5174 N  N     . LYS B 2 127 ? -56.857  -45.171 14.469  1.00 67.02  ? 126  LYS B N     1 
ATOM   5175 C  CA    . LYS B 2 127 ? -58.085  -44.807 13.755  1.00 64.40  ? 126  LYS B CA    1 
ATOM   5176 C  C     . LYS B 2 127 ? -58.565  -43.375 14.019  1.00 67.08  ? 126  LYS B C     1 
ATOM   5177 O  O     . LYS B 2 127 ? -59.302  -42.806 13.209  1.00 71.98  ? 126  LYS B O     1 
ATOM   5178 C  CB    . LYS B 2 127 ? -59.205  -45.816 14.055  1.00 66.52  ? 126  LYS B CB    1 
ATOM   5179 C  CG    . LYS B 2 127 ? -59.566  -45.965 15.526  1.00 59.49  ? 126  LYS B CG    1 
ATOM   5180 C  CD    . LYS B 2 127 ? -60.680  -46.982 15.717  1.00 61.03  ? 126  LYS B CD    1 
ATOM   5181 C  CE    . LYS B 2 127 ? -61.021  -47.162 17.187  1.00 62.75  ? 126  LYS B CE    1 
ATOM   5182 N  NZ    . LYS B 2 127 ? -62.121  -48.145 17.386  1.00 63.08  ? 126  LYS B NZ    1 
ATOM   5183 N  N     . TYR B 2 128 ? -58.145  -42.801 15.144  1.00 65.41  ? 127  TYR B N     1 
ATOM   5184 C  CA    . TYR B 2 128 ? -58.570  -41.455 15.540  1.00 61.89  ? 127  TYR B CA    1 
ATOM   5185 C  C     . TYR B 2 128 ? -57.768  -40.344 14.858  1.00 59.89  ? 127  TYR B C     1 
ATOM   5186 O  O     . TYR B 2 128 ? -58.166  -39.176 14.886  1.00 60.46  ? 127  TYR B O     1 
ATOM   5187 C  CB    . TYR B 2 128 ? -58.511  -41.297 17.064  1.00 61.27  ? 127  TYR B CB    1 
ATOM   5188 C  CG    . TYR B 2 128 ? -59.346  -42.307 17.821  1.00 64.07  ? 127  TYR B CG    1 
ATOM   5189 C  CD1   . TYR B 2 128 ? -60.738  -42.209 17.851  1.00 64.05  ? 127  TYR B CD1   1 
ATOM   5190 C  CD2   . TYR B 2 128 ? -58.745  -43.359 18.511  1.00 66.81  ? 127  TYR B CD2   1 
ATOM   5191 C  CE1   . TYR B 2 128 ? -61.506  -43.134 18.541  1.00 60.03  ? 127  TYR B CE1   1 
ATOM   5192 C  CE2   . TYR B 2 128 ? -59.505  -44.287 19.206  1.00 67.73  ? 127  TYR B CE2   1 
ATOM   5193 C  CZ    . TYR B 2 128 ? -60.883  -44.170 19.218  1.00 60.07  ? 127  TYR B CZ    1 
ATOM   5194 O  OH    . TYR B 2 128 ? -61.641  -45.089 19.907  1.00 58.24  ? 127  TYR B OH    1 
ATOM   5195 N  N     . THR B 2 129 ? -56.646  -40.715 14.244  1.00 58.01  ? 128  THR B N     1 
ATOM   5196 C  CA    . THR B 2 129 ? -55.781  -39.763 13.544  1.00 59.42  ? 128  THR B CA    1 
ATOM   5197 C  C     . THR B 2 129 ? -56.083  -39.704 12.041  1.00 61.41  ? 128  THR B C     1 
ATOM   5198 O  O     . THR B 2 129 ? -55.243  -39.276 11.244  1.00 63.82  ? 128  THR B O     1 
ATOM   5199 C  CB    . THR B 2 129 ? -54.286  -40.087 13.764  1.00 62.87  ? 128  THR B CB    1 
ATOM   5200 O  OG1   . THR B 2 129 ? -54.039  -41.463 13.450  1.00 62.52  ? 128  THR B OG1   1 
ATOM   5201 C  CG2   . THR B 2 129 ? -53.880  -39.816 15.208  1.00 68.63  ? 128  THR B CG2   1 
ATOM   5202 N  N     . ALA B 2 130 ? -57.291  -40.126 11.669  1.00 61.93  ? 129  ALA B N     1 
ATOM   5203 C  CA    . ALA B 2 130 ? -57.712  -40.169 10.269  1.00 62.67  ? 129  ALA B CA    1 
ATOM   5204 C  C     . ALA B 2 130 ? -58.025  -38.781 9.714   1.00 60.41  ? 129  ALA B C     1 
ATOM   5205 O  O     . ALA B 2 130 ? -58.663  -37.965 10.383  1.00 68.16  ? 129  ALA B O     1 
ATOM   5206 C  CB    . ALA B 2 130 ? -58.910  -41.093 10.104  1.00 60.52  ? 129  ALA B CB    1 
ATOM   5207 N  N     . PHE B 2 131 ? -57.568  -38.526 8.490   1.00 62.56  ? 130  PHE B N     1 
ATOM   5208 C  CA    . PHE B 2 131 ? -57.804  -37.249 7.812   1.00 64.74  ? 130  PHE B CA    1 
ATOM   5209 C  C     . PHE B 2 131 ? -58.123  -37.434 6.328   1.00 65.04  ? 130  PHE B C     1 
ATOM   5210 O  O     . PHE B 2 131 ? -57.644  -38.378 5.694   1.00 66.13  ? 130  PHE B O     1 
ATOM   5211 C  CB    . PHE B 2 131 ? -56.618  -36.290 8.010   1.00 63.29  ? 130  PHE B CB    1 
ATOM   5212 C  CG    . PHE B 2 131 ? -55.322  -36.773 7.414   1.00 64.87  ? 130  PHE B CG    1 
ATOM   5213 C  CD1   . PHE B 2 131 ? -54.480  -37.618 8.131   1.00 66.69  ? 130  PHE B CD1   1 
ATOM   5214 C  CD2   . PHE B 2 131 ? -54.930  -36.361 6.143   1.00 62.88  ? 130  PHE B CD2   1 
ATOM   5215 C  CE1   . PHE B 2 131 ? -53.282  -38.057 7.586   1.00 66.76  ? 130  PHE B CE1   1 
ATOM   5216 C  CE2   . PHE B 2 131 ? -53.733  -36.797 5.594   1.00 67.92  ? 130  PHE B CE2   1 
ATOM   5217 C  CZ    . PHE B 2 131 ? -52.908  -37.645 6.317   1.00 70.07  ? 130  PHE B CZ    1 
ATOM   5218 N  N     . THR B 2 132 ? -58.931  -36.525 5.785   1.00 63.71  ? 131  THR B N     1 
ATOM   5219 C  CA    . THR B 2 132 ? -59.385  -36.611 4.397   1.00 57.68  ? 131  THR B CA    1 
ATOM   5220 C  C     . THR B 2 132 ? -58.833  -35.466 3.548   1.00 53.33  ? 131  THR B C     1 
ATOM   5221 O  O     . THR B 2 132 ? -58.873  -34.302 3.955   1.00 59.44  ? 131  THR B O     1 
ATOM   5222 C  CB    . THR B 2 132 ? -60.928  -36.611 4.305   1.00 61.21  ? 131  THR B CB    1 
ATOM   5223 O  OG1   . THR B 2 132 ? -61.478  -37.429 5.345   1.00 70.09  ? 131  THR B OG1   1 
ATOM   5224 C  CG2   . THR B 2 132 ? -61.397  -37.139 2.951   1.00 71.07  ? 131  THR B CG2   1 
ATOM   5225 N  N     . ILE B 2 133 ? -58.314  -35.812 2.372   1.00 52.57  ? 132  ILE B N     1 
ATOM   5226 C  CA    . ILE B 2 133 ? -57.875  -34.824 1.389   1.00 57.13  ? 132  ILE B CA    1 
ATOM   5227 C  C     . ILE B 2 133 ? -59.047  -34.513 0.455   1.00 59.22  ? 132  ILE B C     1 
ATOM   5228 O  O     . ILE B 2 133 ? -59.537  -35.406 -0.243  1.00 62.29  ? 132  ILE B O     1 
ATOM   5229 C  CB    . ILE B 2 133 ? -56.653  -35.314 0.577   1.00 50.29  ? 132  ILE B CB    1 
ATOM   5230 C  CG1   . ILE B 2 133 ? -55.522  -35.759 1.515   1.00 51.42  ? 132  ILE B CG1   1 
ATOM   5231 C  CG2   . ILE B 2 133 ? -56.168  -34.224 -0.373  1.00 47.97  ? 132  ILE B CG2   1 
ATOM   5232 C  CD1   . ILE B 2 133 ? -54.509  -36.687 0.877   1.00 54.43  ? 132  ILE B CD1   1 
ATOM   5233 N  N     . PRO B 2 134 ? -59.507  -33.246 0.449   1.00 59.16  ? 133  PRO B N     1 
ATOM   5234 C  CA    . PRO B 2 134 ? -60.664  -32.848 -0.356  1.00 60.96  ? 133  PRO B CA    1 
ATOM   5235 C  C     . PRO B 2 134 ? -60.353  -32.777 -1.850  1.00 59.08  ? 133  PRO B C     1 
ATOM   5236 O  O     . PRO B 2 134 ? -59.192  -32.620 -2.238  1.00 66.15  ? 133  PRO B O     1 
ATOM   5237 C  CB    . PRO B 2 134 ? -61.006  -31.458 0.184   1.00 74.26  ? 133  PRO B CB    1 
ATOM   5238 C  CG    . PRO B 2 134 ? -59.711  -30.926 0.691   1.00 70.65  ? 133  PRO B CG    1 
ATOM   5239 C  CD    . PRO B 2 134 ? -58.952  -32.113 1.214   1.00 65.20  ? 133  PRO B CD    1 
ATOM   5240 N  N     . SER B 2 135 ? -61.393  -32.892 -2.671  1.00 58.51  ? 134  SER B N     1 
ATOM   5241 C  CA    . SER B 2 135 ? -61.254  -32.848 -4.123  1.00 58.48  ? 134  SER B CA    1 
ATOM   5242 C  C     . SER B 2 135 ? -61.960  -31.634 -4.721  1.00 56.42  ? 134  SER B C     1 
ATOM   5243 O  O     . SER B 2 135 ? -62.963  -31.158 -4.181  1.00 62.98  ? 134  SER B O     1 
ATOM   5244 C  CB    . SER B 2 135 ? -61.791  -34.136 -4.751  1.00 61.23  ? 134  SER B CB    1 
ATOM   5245 O  OG    . SER B 2 135 ? -63.090  -34.437 -4.271  1.00 67.64  ? 134  SER B OG    1 
ATOM   5246 N  N     . ILE B 2 136 ? -61.424  -31.143 -5.836  1.00 47.49  ? 135  ILE B N     1 
ATOM   5247 C  CA    . ILE B 2 136 ? -61.982  -29.988 -6.541  1.00 51.55  ? 135  ILE B CA    1 
ATOM   5248 C  C     . ILE B 2 136 ? -63.303  -30.375 -7.205  1.00 56.42  ? 135  ILE B C     1 
ATOM   5249 O  O     . ILE B 2 136 ? -63.338  -31.269 -8.054  1.00 64.75  ? 135  ILE B O     1 
ATOM   5250 C  CB    . ILE B 2 136 ? -60.999  -29.421 -7.597  1.00 64.53  ? 135  ILE B CB    1 
ATOM   5251 C  CG1   . ILE B 2 136 ? -59.626  -29.120 -6.982  1.00 65.25  ? 135  ILE B CG1   1 
ATOM   5252 C  CG2   . ILE B 2 136 ? -61.564  -28.164 -8.245  1.00 55.63  ? 135  ILE B CG2   1 
ATOM   5253 C  CD1   . ILE B 2 136 ? -58.609  -30.233 -7.146  1.00 64.46  ? 135  ILE B CD1   1 
ATOM   5254 N  N     . ASN B 2 137 ? -64.378  -29.696 -6.800  1.00 50.80  ? 136  ASN B N     1 
ATOM   5255 C  CA    . ASN B 2 137 ? -65.748  -29.978 -7.258  1.00 53.38  ? 136  ASN B CA    1 
ATOM   5256 C  C     . ASN B 2 137 ? -66.198  -31.422 -6.993  1.00 55.76  ? 136  ASN B C     1 
ATOM   5257 O  O     . ASN B 2 137 ? -67.037  -31.964 -7.714  1.00 63.43  ? 136  ASN B O     1 
ATOM   5258 C  CB    . ASN B 2 137 ? -65.928  -29.599 -8.738  1.00 55.97  ? 136  ASN B CB    1 
ATOM   5259 C  CG    . ASN B 2 137 ? -67.376  -29.310 -9.101  1.00 58.55  ? 136  ASN B CG    1 
ATOM   5260 O  OD1   . ASN B 2 137 ? -68.111  -28.678 -8.339  1.00 55.91  ? 136  ASN B OD1   1 
ATOM   5261 N  ND2   . ASN B 2 137 ? -67.790  -29.766 -10.277 1.00 62.93  ? 136  ASN B ND2   1 
ATOM   5262 N  N     . ASN B 2 138 ? -65.631  -32.026 -5.948  1.00 55.30  ? 137  ASN B N     1 
ATOM   5263 C  CA    . ASN B 2 138 ? -65.946  -33.399 -5.532  1.00 57.84  ? 137  ASN B CA    1 
ATOM   5264 C  C     . ASN B 2 138 ? -65.995  -34.421 -6.676  1.00 65.99  ? 137  ASN B C     1 
ATOM   5265 O  O     . ASN B 2 138 ? -66.947  -35.198 -6.792  1.00 66.75  ? 137  ASN B O     1 
ATOM   5266 C  CB    . ASN B 2 138 ? -67.239  -33.431 -4.703  1.00 57.49  ? 137  ASN B CB    1 
ATOM   5267 C  CG    . ASN B 2 138 ? -67.113  -32.680 -3.389  1.00 63.95  ? 137  ASN B CG    1 
ATOM   5268 O  OD1   . ASN B 2 138 ? -66.242  -32.975 -2.569  1.00 74.59  ? 137  ASN B OD1   1 
ATOM   5269 N  ND2   . ASN B 2 138 ? -67.992  -31.707 -3.180  1.00 63.86  ? 137  ASN B ND2   1 
ATOM   5270 N  N     . GLU B 2 139 ? -64.960  -34.408 -7.515  1.00 69.50  ? 138  GLU B N     1 
ATOM   5271 C  CA    . GLU B 2 139 ? -64.848  -35.348 -8.632  1.00 70.60  ? 138  GLU B CA    1 
ATOM   5272 C  C     . GLU B 2 139 ? -64.448  -36.735 -8.129  1.00 73.53  ? 138  GLU B C     1 
ATOM   5273 O  O     . GLU B 2 139 ? -65.095  -37.732 -8.454  1.00 76.09  ? 138  GLU B O     1 
ATOM   5274 C  CB    . GLU B 2 139 ? -63.846  -34.846 -9.680  1.00 75.48  ? 138  GLU B CB    1 
ATOM   5275 C  CG    . GLU B 2 139 ? -64.183  -33.496 -10.304 1.00 72.08  ? 138  GLU B CG    1 
ATOM   5276 C  CD    . GLU B 2 139 ? -65.468  -33.505 -11.116 1.00 85.49  ? 138  GLU B CD    1 
ATOM   5277 O  OE1   . GLU B 2 139 ? -65.698  -34.469 -11.877 1.00 99.26  ? 138  GLU B OE1   1 
ATOM   5278 O  OE2   . GLU B 2 139 ? -66.248  -32.535 -10.997 1.00 82.04  ? 138  GLU B OE2   1 
ATOM   5279 N  N     . THR B 2 140 ? -63.379  -36.786 -7.337  1.00 71.52  ? 139  THR B N     1 
ATOM   5280 C  CA    . THR B 2 140 ? -62.951  -38.019 -6.679  1.00 72.62  ? 139  THR B CA    1 
ATOM   5281 C  C     . THR B 2 140 ? -63.523  -38.072 -5.260  1.00 68.43  ? 139  THR B C     1 
ATOM   5282 O  O     . THR B 2 140 ? -63.672  -37.029 -4.619  1.00 71.08  ? 139  THR B O     1 
ATOM   5283 C  CB    . THR B 2 140 ? -61.412  -38.148 -6.635  1.00 79.53  ? 139  THR B CB    1 
ATOM   5284 O  OG1   . THR B 2 140 ? -60.839  -36.956 -6.084  1.00 75.45  ? 139  THR B OG1   1 
ATOM   5285 C  CG2   . THR B 2 140 ? -60.847  -38.380 -8.033  1.00 66.83  ? 139  THR B CG2   1 
ATOM   5286 N  N     . PRO B 2 141 ? -63.853  -39.286 -4.766  1.00 67.52  ? 140  PRO B N     1 
ATOM   5287 C  CA    . PRO B 2 141 ? -64.457  -39.475 -3.438  1.00 76.00  ? 140  PRO B CA    1 
ATOM   5288 C  C     . PRO B 2 141 ? -63.677  -38.846 -2.279  1.00 77.53  ? 140  PRO B C     1 
ATOM   5289 O  O     . PRO B 2 141 ? -64.271  -38.512 -1.252  1.00 79.82  ? 140  PRO B O     1 
ATOM   5290 C  CB    . PRO B 2 141 ? -64.476  -40.997 -3.280  1.00 72.70  ? 140  PRO B CB    1 
ATOM   5291 C  CG    . PRO B 2 141 ? -64.572  -41.508 -4.674  1.00 76.43  ? 140  PRO B CG    1 
ATOM   5292 C  CD    . PRO B 2 141 ? -63.738  -40.566 -5.493  1.00 69.89  ? 140  PRO B CD    1 
ATOM   5293 N  N     . GLY B 2 142 ? -62.366  -38.689 -2.449  1.00 66.59  ? 141  GLY B N     1 
ATOM   5294 C  CA    . GLY B 2 142 ? -61.511  -38.114 -1.414  1.00 58.19  ? 141  GLY B CA    1 
ATOM   5295 C  C     . GLY B 2 142 ? -60.582  -39.154 -0.824  1.00 61.81  ? 141  GLY B C     1 
ATOM   5296 O  O     . GLY B 2 142 ? -61.028  -40.217 -0.384  1.00 62.75  ? 141  GLY B O     1 
ATOM   5297 N  N     . ILE B 2 143 ? -59.289  -38.844 -0.813  1.00 58.60  ? 142  ILE B N     1 
ATOM   5298 C  CA    . ILE B 2 143 ? -58.267  -39.779 -0.341  1.00 56.40  ? 142  ILE B CA    1 
ATOM   5299 C  C     . ILE B 2 143 ? -58.209  -39.801 1.187   1.00 58.18  ? 142  ILE B C     1 
ATOM   5300 O  O     . ILE B 2 143 ? -58.197  -38.750 1.834   1.00 59.91  ? 142  ILE B O     1 
ATOM   5301 C  CB    . ILE B 2 143 ? -56.871  -39.458 -0.923  1.00 57.70  ? 142  ILE B CB    1 
ATOM   5302 C  CG1   . ILE B 2 143 ? -56.989  -38.880 -2.340  1.00 52.87  ? 142  ILE B CG1   1 
ATOM   5303 C  CG2   . ILE B 2 143 ? -56.000  -40.708 -0.924  1.00 63.88  ? 142  ILE B CG2   1 
ATOM   5304 C  CD1   . ILE B 2 143 ? -55.770  -38.111 -2.807  1.00 52.09  ? 142  ILE B CD1   1 
ATOM   5305 N  N     . ARG B 2 144 ? -58.176  -41.007 1.749   1.00 57.25  ? 143  ARG B N     1 
ATOM   5306 C  CA    . ARG B 2 144 ? -58.192  -41.204 3.198   1.00 55.59  ? 143  ARG B CA    1 
ATOM   5307 C  C     . ARG B 2 144 ? -56.876  -41.788 3.711   1.00 64.06  ? 143  ARG B C     1 
ATOM   5308 O  O     . ARG B 2 144 ? -56.312  -42.701 3.103   1.00 79.11  ? 143  ARG B O     1 
ATOM   5309 C  CB    . ARG B 2 144 ? -59.357  -42.117 3.599   1.00 59.62  ? 143  ARG B CB    1 
ATOM   5310 C  CG    . ARG B 2 144 ? -60.746  -41.538 3.350   1.00 65.22  ? 143  ARG B CG    1 
ATOM   5311 C  CD    . ARG B 2 144 ? -61.215  -40.653 4.496   1.00 58.80  ? 143  ARG B CD    1 
ATOM   5312 N  NE    . ARG B 2 144 ? -61.508  -41.420 5.706   1.00 61.69  ? 143  ARG B NE    1 
ATOM   5313 C  CZ    . ARG B 2 144 ? -61.950  -40.898 6.848   1.00 65.19  ? 143  ARG B CZ    1 
ATOM   5314 N  NH1   . ARG B 2 144 ? -62.159  -39.591 6.958   1.00 67.93  ? 143  ARG B NH1   1 
ATOM   5315 N  NH2   . ARG B 2 144 ? -62.184  -41.687 7.887   1.00 63.17  ? 143  ARG B NH2   1 
ATOM   5316 N  N     . TYR B 2 145 ? -56.399  -41.250 4.832   1.00 63.05  ? 144  TYR B N     1 
ATOM   5317 C  CA    . TYR B 2 145 ? -55.177  -41.728 5.481   1.00 66.42  ? 144  TYR B CA    1 
ATOM   5318 C  C     . TYR B 2 145 ? -55.305  -41.709 7.002   1.00 64.41  ? 144  TYR B C     1 
ATOM   5319 O  O     . TYR B 2 145 ? -56.123  -40.971 7.554   1.00 63.15  ? 144  TYR B O     1 
ATOM   5320 C  CB    . TYR B 2 145 ? -53.974  -40.870 5.076   1.00 65.85  ? 144  TYR B CB    1 
ATOM   5321 C  CG    . TYR B 2 145 ? -53.509  -41.043 3.648   1.00 69.64  ? 144  TYR B CG    1 
ATOM   5322 C  CD1   . TYR B 2 145 ? -52.768  -42.161 3.263   1.00 73.14  ? 144  TYR B CD1   1 
ATOM   5323 C  CD2   . TYR B 2 145 ? -53.788  -40.075 2.685   1.00 68.46  ? 144  TYR B CD2   1 
ATOM   5324 C  CE1   . TYR B 2 145 ? -52.331  -42.316 1.957   1.00 78.52  ? 144  TYR B CE1   1 
ATOM   5325 C  CE2   . TYR B 2 145 ? -53.355  -40.221 1.377   1.00 70.60  ? 144  TYR B CE2   1 
ATOM   5326 C  CZ    . TYR B 2 145 ? -52.630  -41.343 1.017   1.00 78.47  ? 144  TYR B CZ    1 
ATOM   5327 O  OH    . TYR B 2 145 ? -52.200  -41.491 -0.281  1.00 83.97  ? 144  TYR B OH    1 
ATOM   5328 N  N     . GLN B 2 146 ? -54.490  -42.524 7.668   1.00 62.99  ? 145  GLN B N     1 
ATOM   5329 C  CA    . GLN B 2 146 ? -54.364  -42.494 9.127   1.00 60.76  ? 145  GLN B CA    1 
ATOM   5330 C  C     . GLN B 2 146 ? -52.903  -42.657 9.550   1.00 68.61  ? 145  GLN B C     1 
ATOM   5331 O  O     . GLN B 2 146 ? -52.125  -43.337 8.875   1.00 76.02  ? 145  GLN B O     1 
ATOM   5332 C  CB    . GLN B 2 146 ? -55.254  -43.554 9.793   1.00 57.17  ? 145  GLN B CB    1 
ATOM   5333 C  CG    . GLN B 2 146 ? -54.872  -45.002 9.510   1.00 59.51  ? 145  GLN B CG    1 
ATOM   5334 C  CD    . GLN B 2 146 ? -55.578  -45.990 10.423  1.00 63.02  ? 145  GLN B CD    1 
ATOM   5335 O  OE1   . GLN B 2 146 ? -56.761  -45.838 10.732  1.00 59.04  ? 145  GLN B OE1   1 
ATOM   5336 N  NE2   . GLN B 2 146 ? -54.853  -47.017 10.852  1.00 56.30  ? 145  GLN B NE2   1 
ATOM   5337 N  N     . TYR B 2 147 ? -52.538  -42.028 10.665  1.00 68.93  ? 146  TYR B N     1 
ATOM   5338 C  CA    . TYR B 2 147 ? -51.162  -42.057 11.160  1.00 70.67  ? 146  TYR B CA    1 
ATOM   5339 C  C     . TYR B 2 147 ? -50.789  -43.390 11.800  1.00 73.97  ? 146  TYR B C     1 
ATOM   5340 O  O     . TYR B 2 147 ? -51.537  -43.932 12.617  1.00 69.31  ? 146  TYR B O     1 
ATOM   5341 C  CB    . TYR B 2 147 ? -50.915  -40.915 12.150  1.00 71.87  ? 146  TYR B CB    1 
ATOM   5342 C  CG    . TYR B 2 147 ? -50.613  -39.583 11.500  1.00 69.63  ? 146  TYR B CG    1 
ATOM   5343 C  CD1   . TYR B 2 147 ? -49.315  -39.257 11.108  1.00 72.53  ? 146  TYR B CD1   1 
ATOM   5344 C  CD2   . TYR B 2 147 ? -51.623  -38.648 11.279  1.00 71.97  ? 146  TYR B CD2   1 
ATOM   5345 C  CE1   . TYR B 2 147 ? -49.031  -38.037 10.514  1.00 72.51  ? 146  TYR B CE1   1 
ATOM   5346 C  CE2   . TYR B 2 147 ? -51.349  -37.425 10.685  1.00 72.33  ? 146  TYR B CE2   1 
ATOM   5347 C  CZ    . TYR B 2 147 ? -50.050  -37.126 10.305  1.00 67.15  ? 146  TYR B CZ    1 
ATOM   5348 O  OH    . TYR B 2 147 ? -49.772  -35.914 9.715   1.00 66.58  ? 146  TYR B OH    1 
ATOM   5349 N  N     . ASN B 2 148 ? -49.625  -43.908 11.413  1.00 73.95  ? 147  ASN B N     1 
ATOM   5350 C  CA    . ASN B 2 148 ? -49.066  -45.121 12.006  1.00 73.24  ? 147  ASN B CA    1 
ATOM   5351 C  C     . ASN B 2 148 ? -48.021  -44.797 13.073  1.00 80.27  ? 147  ASN B C     1 
ATOM   5352 O  O     . ASN B 2 148 ? -47.702  -45.636 13.919  1.00 75.57  ? 147  ASN B O     1 
ATOM   5353 C  CB    . ASN B 2 148 ? -48.460  -46.022 10.925  1.00 69.05  ? 147  ASN B CB    1 
ATOM   5354 C  CG    . ASN B 2 148 ? -49.498  -46.554 9.953   1.00 68.90  ? 147  ASN B CG    1 
ATOM   5355 O  OD1   . ASN B 2 148 ? -50.556  -47.041 10.355  1.00 64.56  ? 147  ASN B OD1   1 
ATOM   5356 N  ND2   . ASN B 2 148 ? -49.193  -46.472 8.663   1.00 68.62  ? 147  ASN B ND2   1 
ATOM   5357 N  N     . VAL B 2 149 ? -47.498  -43.574 13.017  1.00 83.05  ? 148  VAL B N     1 
ATOM   5358 C  CA    . VAL B 2 149 ? -46.514  -43.082 13.983  1.00 81.61  ? 148  VAL B CA    1 
ATOM   5359 C  C     . VAL B 2 149 ? -47.058  -41.865 14.740  1.00 82.42  ? 148  VAL B C     1 
ATOM   5360 O  O     . VAL B 2 149 ? -48.237  -41.524 14.607  1.00 83.81  ? 148  VAL B O     1 
ATOM   5361 C  CB    . VAL B 2 149 ? -45.162  -42.738 13.306  1.00 84.22  ? 148  VAL B CB    1 
ATOM   5362 C  CG1   . VAL B 2 149 ? -44.445  -44.004 12.859  1.00 85.83  ? 148  VAL B CG1   1 
ATOM   5363 C  CG2   . VAL B 2 149 ? -45.357  -41.778 12.136  1.00 83.87  ? 148  VAL B CG2   1 
ATOM   5364 N  N     . LEU B 2 150 ? -46.202  -41.223 15.535  1.00 81.69  ? 149  LEU B N     1 
ATOM   5365 C  CA    . LEU B 2 150 ? -46.581  -40.016 16.270  1.00 76.29  ? 149  LEU B CA    1 
ATOM   5366 C  C     . LEU B 2 150 ? -46.694  -38.816 15.325  1.00 79.25  ? 149  LEU B C     1 
ATOM   5367 O  O     . LEU B 2 150 ? -45.719  -38.457 14.660  1.00 91.64  ? 149  LEU B O     1 
ATOM   5368 C  CB    . LEU B 2 150 ? -45.583  -39.719 17.397  1.00 79.85  ? 149  LEU B CB    1 
ATOM   5369 C  CG    . LEU B 2 150 ? -45.420  -40.719 18.547  1.00 86.04  ? 149  LEU B CG    1 
ATOM   5370 C  CD1   . LEU B 2 150 ? -44.265  -40.303 19.445  1.00 80.96  ? 149  LEU B CD1   1 
ATOM   5371 C  CD2   . LEU B 2 150 ? -46.700  -40.857 19.356  1.00 74.54  ? 149  LEU B CD2   1 
ATOM   5372 N  N     . PRO B 2 151 ? -47.889  -38.197 15.261  1.00 74.32  ? 150  PRO B N     1 
ATOM   5373 C  CA    . PRO B 2 151 ? -48.129  -37.083 14.346  1.00 80.72  ? 150  PRO B CA    1 
ATOM   5374 C  C     . PRO B 2 151 ? -47.760  -35.718 14.926  1.00 81.20  ? 150  PRO B C     1 
ATOM   5375 O  O     . PRO B 2 151 ? -47.792  -35.527 16.144  1.00 74.98  ? 150  PRO B O     1 
ATOM   5376 C  CB    . PRO B 2 151 ? -49.640  -37.157 14.089  1.00 75.54  ? 150  PRO B CB    1 
ATOM   5377 C  CG    . PRO B 2 151 ? -50.211  -38.000 15.187  1.00 69.11  ? 150  PRO B CG    1 
ATOM   5378 C  CD    . PRO B 2 151 ? -49.094  -38.531 16.039  1.00 66.40  ? 150  PRO B CD    1 
ATOM   5379 N  N     . GLN B 2 152 ? -47.412  -34.784 14.043  1.00 84.03  ? 151  GLN B N     1 
ATOM   5380 C  CA    . GLN B 2 152 ? -47.130  -33.404 14.432  1.00 88.26  ? 151  GLN B CA    1 
ATOM   5381 C  C     . GLN B 2 152 ? -48.432  -32.652 14.689  1.00 95.25  ? 151  GLN B C     1 
ATOM   5382 O  O     . GLN B 2 152 ? -49.359  -32.704 13.877  1.00 92.51  ? 151  GLN B O     1 
ATOM   5383 C  CB    . GLN B 2 152 ? -46.315  -32.688 13.350  1.00 94.45  ? 151  GLN B CB    1 
ATOM   5384 C  CG    . GLN B 2 152 ? -44.859  -33.121 13.261  1.00 97.35  ? 151  GLN B CG    1 
ATOM   5385 C  CD    . GLN B 2 152 ? -44.064  -32.311 12.252  1.00 102.71 ? 151  GLN B CD    1 
ATOM   5386 O  OE1   . GLN B 2 152 ? -44.120  -31.080 12.239  1.00 104.34 ? 151  GLN B OE1   1 
ATOM   5387 N  NE2   . GLN B 2 152 ? -43.309  -33.001 11.406  1.00 97.08  ? 151  GLN B NE2   1 
ATOM   5388 N  N     . GLY B 2 153 ? -48.493  -31.957 15.822  1.00 88.44  ? 152  GLY B N     1 
ATOM   5389 C  CA    . GLY B 2 153 ? -49.692  -31.219 16.215  1.00 85.15  ? 152  GLY B CA    1 
ATOM   5390 C  C     . GLY B 2 153 ? -50.493  -31.912 17.302  1.00 79.64  ? 152  GLY B C     1 
ATOM   5391 O  O     . GLY B 2 153 ? -51.406  -31.319 17.880  1.00 82.22  ? 152  GLY B O     1 
ATOM   5392 N  N     . TRP B 2 154 ? -50.156  -33.172 17.571  1.00 72.81  ? 153  TRP B N     1 
ATOM   5393 C  CA    . TRP B 2 154 ? -50.794  -33.940 18.637  1.00 77.47  ? 153  TRP B CA    1 
ATOM   5394 C  C     . TRP B 2 154 ? -50.021  -33.794 19.918  1.00 85.79  ? 153  TRP B C     1 
ATOM   5395 O  O     . TRP B 2 154 ? -48.791  -33.893 19.926  1.00 85.06  ? 153  TRP B O     1 
ATOM   5396 C  CB    . TRP B 2 154 ? -50.926  -35.409 18.238  1.00 73.65  ? 153  TRP B CB    1 
ATOM   5397 C  CG    . TRP B 2 154 ? -51.660  -36.263 19.249  1.00 73.40  ? 153  TRP B CG    1 
ATOM   5398 C  CD1   . TRP B 2 154 ? -52.915  -36.029 19.810  1.00 76.08  ? 153  TRP B CD1   1 
ATOM   5399 C  CD2   . TRP B 2 154 ? -51.212  -37.534 19.840  1.00 73.31  ? 153  TRP B CD2   1 
ATOM   5400 N  NE1   . TRP B 2 154 ? -53.255  -37.029 20.686  1.00 77.18  ? 153  TRP B NE1   1 
ATOM   5401 C  CE2   . TRP B 2 154 ? -52.283  -37.962 20.751  1.00 74.18  ? 153  TRP B CE2   1 
ATOM   5402 C  CE3   . TRP B 2 154 ? -50.076  -38.328 19.715  1.00 67.57  ? 153  TRP B CE3   1 
ATOM   5403 C  CZ2   . TRP B 2 154 ? -52.194  -39.133 21.491  1.00 69.06  ? 153  TRP B CZ2   1 
ATOM   5404 C  CZ3   . TRP B 2 154 ? -49.999  -39.507 20.467  1.00 66.18  ? 153  TRP B CZ3   1 
ATOM   5405 C  CH2   . TRP B 2 154 ? -51.034  -39.898 21.332  1.00 71.15  ? 153  TRP B CH2   1 
ATOM   5406 N  N     . LYS B 2 155 ? -50.743  -33.555 21.011  1.00 85.87  ? 154  LYS B N     1 
ATOM   5407 C  CA    . LYS B 2 155 ? -50.131  -33.280 22.315  1.00 90.60  ? 154  LYS B CA    1 
ATOM   5408 C  C     . LYS B 2 155 ? -49.529  -34.514 22.992  1.00 85.95  ? 154  LYS B C     1 
ATOM   5409 O  O     . LYS B 2 155 ? -48.696  -34.390 23.892  1.00 94.46  ? 154  LYS B O     1 
ATOM   5410 C  CB    . LYS B 2 155 ? -51.129  -32.577 23.249  1.00 87.71  ? 154  LYS B CB    1 
ATOM   5411 C  CG    . LYS B 2 155 ? -52.347  -33.406 23.642  1.00 82.94  ? 154  LYS B CG    1 
ATOM   5412 C  CD    . LYS B 2 155 ? -53.403  -32.565 24.347  1.00 88.66  ? 154  LYS B CD    1 
ATOM   5413 C  CE    . LYS B 2 155 ? -53.014  -32.217 25.776  1.00 96.99  ? 154  LYS B CE    1 
ATOM   5414 N  NZ    . LYS B 2 155 ? -54.029  -31.346 26.431  1.00 94.66  ? 154  LYS B NZ    1 
ATOM   5415 N  N     . GLY B 2 156 ? -49.953  -35.697 22.551  1.00 79.05  ? 155  GLY B N     1 
ATOM   5416 C  CA    . GLY B 2 156 ? -49.451  -36.958 23.093  1.00 81.07  ? 155  GLY B CA    1 
ATOM   5417 C  C     . GLY B 2 156 ? -48.086  -37.356 22.561  1.00 83.35  ? 155  GLY B C     1 
ATOM   5418 O  O     . GLY B 2 156 ? -47.400  -38.184 23.164  1.00 90.33  ? 155  GLY B O     1 
ATOM   5419 N  N     . SER B 2 157 ? -47.694  -36.766 21.432  1.00 82.02  ? 156  SER B N     1 
ATOM   5420 C  CA    . SER B 2 157 ? -46.406  -37.057 20.793  1.00 87.16  ? 156  SER B CA    1 
ATOM   5421 C  C     . SER B 2 157 ? -45.191  -36.637 21.636  1.00 91.77  ? 156  SER B C     1 
ATOM   5422 O  O     . SER B 2 157 ? -44.265  -37.433 21.802  1.00 96.29  ? 156  SER B O     1 
ATOM   5423 C  CB    . SER B 2 157 ? -46.336  -36.447 19.387  1.00 78.16  ? 156  SER B CB    1 
ATOM   5424 O  OG    . SER B 2 157 ? -47.330  -36.994 18.540  1.00 80.64  ? 156  SER B OG    1 
ATOM   5425 N  N     . PRO B 2 158 ? -45.184  -35.392 22.168  1.00 92.01  ? 157  PRO B N     1 
ATOM   5426 C  CA    . PRO B 2 158 ? -44.081  -35.000 23.054  1.00 90.44  ? 157  PRO B CA    1 
ATOM   5427 C  C     . PRO B 2 158 ? -44.155  -35.657 24.432  1.00 85.86  ? 157  PRO B C     1 
ATOM   5428 O  O     . PRO B 2 158 ? -43.148  -35.711 25.137  1.00 87.28  ? 157  PRO B O     1 
ATOM   5429 C  CB    . PRO B 2 158 ? -44.254  -33.480 23.191  1.00 82.43  ? 157  PRO B CB    1 
ATOM   5430 C  CG    . PRO B 2 158 ? -45.169  -33.077 22.086  1.00 81.00  ? 157  PRO B CG    1 
ATOM   5431 C  CD    . PRO B 2 158 ? -46.074  -34.251 21.892  1.00 86.02  ? 157  PRO B CD    1 
ATOM   5432 N  N     . ALA B 2 159 ? -45.339  -36.142 24.805  1.00 83.38  ? 158  ALA B N     1 
ATOM   5433 C  CA    . ALA B 2 159 ? -45.549  -36.805 26.093  1.00 93.91  ? 158  ALA B CA    1 
ATOM   5434 C  C     . ALA B 2 159 ? -44.931  -38.203 26.132  1.00 96.65  ? 158  ALA B C     1 
ATOM   5435 O  O     . ALA B 2 159 ? -44.379  -38.616 27.154  1.00 101.75 ? 158  ALA B O     1 
ATOM   5436 C  CB    . ALA B 2 159 ? -47.034  -36.868 26.421  1.00 97.51  ? 158  ALA B CB    1 
ATOM   5437 N  N     . ILE B 2 160 ? -45.033  -38.923 25.016  1.00 96.17  ? 159  ILE B N     1 
ATOM   5438 C  CA    . ILE B 2 160 ? -44.450  -40.259 24.884  1.00 97.27  ? 159  ILE B CA    1 
ATOM   5439 C  C     . ILE B 2 160 ? -42.941  -40.163 24.648  1.00 93.34  ? 159  ILE B C     1 
ATOM   5440 O  O     . ILE B 2 160 ? -42.163  -40.925 25.228  1.00 90.35  ? 159  ILE B O     1 
ATOM   5441 C  CB    . ILE B 2 160 ? -45.135  -41.066 23.754  1.00 89.17  ? 159  ILE B CB    1 
ATOM   5442 C  CG1   . ILE B 2 160 ? -46.611  -41.303 24.096  1.00 92.33  ? 159  ILE B CG1   1 
ATOM   5443 C  CG2   . ILE B 2 160 ? -44.425  -42.396 23.520  1.00 88.64  ? 159  ILE B CG2   1 
ATOM   5444 C  CD1   . ILE B 2 160 ? -47.494  -41.623 22.908  1.00 84.48  ? 159  ILE B CD1   1 
ATOM   5445 N  N     . PHE B 2 161 ? -42.541  -39.210 23.808  1.00 87.94  ? 160  PHE B N     1 
ATOM   5446 C  CA    . PHE B 2 161 ? -41.133  -38.986 23.481  1.00 90.02  ? 160  PHE B CA    1 
ATOM   5447 C  C     . PHE B 2 161 ? -40.362  -38.352 24.642  1.00 96.65  ? 160  PHE B C     1 
ATOM   5448 O  O     . PHE B 2 161 ? -39.132  -38.373 24.655  1.00 100.73 ? 160  PHE B O     1 
ATOM   5449 C  CB    . PHE B 2 161 ? -41.014  -38.122 22.219  1.00 86.00  ? 160  PHE B CB    1 
ATOM   5450 C  CG    . PHE B 2 161 ? -39.694  -38.255 21.508  1.00 90.52  ? 160  PHE B CG    1 
ATOM   5451 C  CD1   . PHE B 2 161 ? -39.443  -39.343 20.676  1.00 95.36  ? 160  PHE B CD1   1 
ATOM   5452 C  CD2   . PHE B 2 161 ? -38.707  -37.287 21.657  1.00 87.16  ? 160  PHE B CD2   1 
ATOM   5453 C  CE1   . PHE B 2 161 ? -38.229  -39.467 20.016  1.00 95.31  ? 160  PHE B CE1   1 
ATOM   5454 C  CE2   . PHE B 2 161 ? -37.491  -37.406 21.000  1.00 92.70  ? 160  PHE B CE2   1 
ATOM   5455 C  CZ    . PHE B 2 161 ? -37.252  -38.497 20.178  1.00 99.43  ? 160  PHE B CZ    1 
ATOM   5456 N  N     . GLN B 2 162 ? -41.096  -37.807 25.615  1.00 95.69  ? 161  GLN B N     1 
ATOM   5457 C  CA    . GLN B 2 162 ? -40.521  -37.152 26.799  1.00 99.04  ? 161  GLN B CA    1 
ATOM   5458 C  C     . GLN B 2 162 ? -39.506  -38.025 27.542  1.00 102.09 ? 161  GLN B C     1 
ATOM   5459 O  O     . GLN B 2 162 ? -38.453  -37.538 27.963  1.00 107.52 ? 161  GLN B O     1 
ATOM   5460 C  CB    . GLN B 2 162 ? -41.638  -36.720 27.758  1.00 105.53 ? 161  GLN B CB    1 
ATOM   5461 C  CG    . GLN B 2 162 ? -41.182  -35.845 28.919  1.00 108.74 ? 161  GLN B CG    1 
ATOM   5462 C  CD    . GLN B 2 162 ? -42.282  -35.581 29.932  1.00 116.22 ? 161  GLN B CD    1 
ATOM   5463 O  OE1   . GLN B 2 162 ? -42.447  -34.456 30.401  1.00 113.82 ? 161  GLN B OE1   1 
ATOM   5464 N  NE2   . GLN B 2 162 ? -43.038  -36.619 30.279  1.00 109.39 ? 161  GLN B NE2   1 
ATOM   5465 N  N     . SER B 2 163 ? -39.833  -39.307 27.695  1.00 104.95 ? 162  SER B N     1 
ATOM   5466 C  CA    . SER B 2 163 ? -38.959  -40.271 28.368  1.00 99.58  ? 162  SER B CA    1 
ATOM   5467 C  C     . SER B 2 163 ? -37.663  -40.515 27.591  1.00 103.38 ? 162  SER B C     1 
ATOM   5468 O  O     . SER B 2 163 ? -36.641  -40.881 28.177  1.00 107.45 ? 162  SER B O     1 
ATOM   5469 C  CB    . SER B 2 163 ? -39.698  -41.593 28.593  1.00 84.83  ? 162  SER B CB    1 
ATOM   5470 O  OG    . SER B 2 163 ? -38.917  -42.493 29.361  1.00 82.91  ? 162  SER B OG    1 
ATOM   5471 N  N     . SER B 2 164 ? -37.718  -40.308 26.277  1.00 100.84 ? 163  SER B N     1 
ATOM   5472 C  CA    . SER B 2 164 ? -36.552  -40.451 25.406  1.00 101.26 ? 163  SER B CA    1 
ATOM   5473 C  C     . SER B 2 164 ? -35.937  -39.094 25.044  1.00 96.59  ? 163  SER B C     1 
ATOM   5474 O  O     . SER B 2 164 ? -34.871  -39.035 24.426  1.00 98.69  ? 163  SER B O     1 
ATOM   5475 C  CB    . SER B 2 164 ? -36.928  -41.223 24.138  1.00 98.20  ? 163  SER B CB    1 
ATOM   5476 O  OG    . SER B 2 164 ? -35.789  -41.475 23.333  1.00 111.93 ? 163  SER B OG    1 
ATOM   5477 N  N     . MET B 2 165 ? -36.614  -38.014 25.433  1.00 94.54  ? 164  MET B N     1 
ATOM   5478 C  CA    . MET B 2 165 ? -36.149  -36.651 25.166  1.00 99.03  ? 164  MET B CA    1 
ATOM   5479 C  C     . MET B 2 165 ? -35.281  -36.123 26.308  1.00 99.83  ? 164  MET B C     1 
ATOM   5480 O  O     . MET B 2 165 ? -34.338  -35.364 26.079  1.00 103.13 ? 164  MET B O     1 
ATOM   5481 C  CB    . MET B 2 165 ? -37.338  -35.713 24.921  1.00 88.35  ? 164  MET B CB    1 
ATOM   5482 C  CG    . MET B 2 165 ? -36.977  -34.339 24.371  1.00 83.79  ? 164  MET B CG    1 
ATOM   5483 S  SD    . MET B 2 165 ? -36.326  -34.380 22.689  1.00 94.12  ? 164  MET B SD    1 
ATOM   5484 C  CE    . MET B 2 165 ? -36.033  -32.637 22.397  1.00 81.63  ? 164  MET B CE    1 
ATOM   5485 N  N     . THR B 2 166 ? -35.608  -36.529 27.533  1.00 99.19  ? 165  THR B N     1 
ATOM   5486 C  CA    . THR B 2 166 ? -34.864  -36.115 28.723  1.00 95.83  ? 165  THR B CA    1 
ATOM   5487 C  C     . THR B 2 166 ? -33.492  -36.795 28.781  1.00 108.22 ? 165  THR B C     1 
ATOM   5488 O  O     . THR B 2 166 ? -32.523  -36.212 29.274  1.00 107.36 ? 165  THR B O     1 
ATOM   5489 C  CB    . THR B 2 166 ? -35.652  -36.417 30.017  1.00 88.72  ? 165  THR B CB    1 
ATOM   5490 O  OG1   . THR B 2 166 ? -37.040  -36.122 29.819  1.00 99.68  ? 165  THR B OG1   1 
ATOM   5491 C  CG2   . THR B 2 166 ? -35.126  -35.585 31.184  1.00 88.81  ? 165  THR B CG2   1 
ATOM   5492 N  N     . LYS B 2 167 ? -33.421  -38.022 28.266  1.00 110.70 ? 166  LYS B N     1 
ATOM   5493 C  CA    . LYS B 2 167 ? -32.185  -38.808 28.273  1.00 106.11 ? 166  LYS B CA    1 
ATOM   5494 C  C     . LYS B 2 167 ? -31.158  -38.312 27.242  1.00 101.60 ? 166  LYS B C     1 
ATOM   5495 O  O     . LYS B 2 167 ? -29.950  -38.458 27.445  1.00 108.84 ? 166  LYS B O     1 
ATOM   5496 C  CB    . LYS B 2 167 ? -32.500  -40.282 28.017  1.00 102.49 ? 166  LYS B CB    1 
ATOM   5497 C  CG    . LYS B 2 167 ? -33.299  -40.949 29.125  1.00 102.82 ? 166  LYS B CG    1 
ATOM   5498 C  CD    . LYS B 2 167 ? -33.597  -42.402 28.795  1.00 110.30 ? 166  LYS B CD    1 
ATOM   5499 C  CE    . LYS B 2 167 ? -34.376  -43.075 29.913  1.00 100.23 ? 166  LYS B CE    1 
ATOM   5500 N  NZ    . LYS B 2 167 ? -34.696  -44.493 29.593  1.00 81.95  ? 166  LYS B NZ    1 
ATOM   5501 N  N     . ILE B 2 168 ? -31.642  -37.718 26.151  1.00 93.99  ? 167  ILE B N     1 
ATOM   5502 C  CA    . ILE B 2 168 ? -30.761  -37.196 25.098  1.00 98.65  ? 167  ILE B CA    1 
ATOM   5503 C  C     . ILE B 2 168 ? -30.322  -35.753 25.362  1.00 99.91  ? 167  ILE B C     1 
ATOM   5504 O  O     . ILE B 2 168 ? -29.308  -35.299 24.827  1.00 96.33  ? 167  ILE B O     1 
ATOM   5505 C  CB    . ILE B 2 168 ? -31.370  -37.351 23.676  1.00 94.50  ? 167  ILE B CB    1 
ATOM   5506 C  CG1   . ILE B 2 168 ? -32.690  -36.584 23.527  1.00 94.30  ? 167  ILE B CG1   1 
ATOM   5507 C  CG2   . ILE B 2 168 ? -31.569  -38.819 23.332  1.00 93.98  ? 167  ILE B CG2   1 
ATOM   5508 C  CD1   . ILE B 2 168 ? -32.561  -35.248 22.824  1.00 91.04  ? 167  ILE B CD1   1 
ATOM   5509 N  N     . LEU B 2 169 ? -31.089  -35.043 26.186  1.00 100.94 ? 168  LEU B N     1 
ATOM   5510 C  CA    . LEU B 2 169 ? -30.758  -33.672 26.578  1.00 101.31 ? 168  LEU B CA    1 
ATOM   5511 C  C     . LEU B 2 169 ? -29.962  -33.627 27.885  1.00 103.96 ? 168  LEU B C     1 
ATOM   5512 O  O     . LEU B 2 169 ? -29.553  -32.553 28.334  1.00 106.22 ? 168  LEU B O     1 
ATOM   5513 C  CB    . LEU B 2 169 ? -32.028  -32.816 26.692  1.00 97.44  ? 168  LEU B CB    1 
ATOM   5514 C  CG    . LEU B 2 169 ? -32.781  -32.450 25.406  1.00 91.15  ? 168  LEU B CG    1 
ATOM   5515 C  CD1   . LEU B 2 169 ? -34.176  -31.936 25.729  1.00 91.05  ? 168  LEU B CD1   1 
ATOM   5516 C  CD2   . LEU B 2 169 ? -32.014  -31.438 24.566  1.00 81.67  ? 168  LEU B CD2   1 
ATOM   5517 N  N     . GLU B 2 170 ? -29.743  -34.799 28.479  1.00 106.75 ? 169  GLU B N     1 
ATOM   5518 C  CA    . GLU B 2 170 ? -28.980  -34.933 29.724  1.00 107.62 ? 169  GLU B CA    1 
ATOM   5519 C  C     . GLU B 2 170 ? -27.489  -34.580 29.570  1.00 104.54 ? 169  GLU B C     1 
ATOM   5520 O  O     . GLU B 2 170 ? -26.934  -33.913 30.446  1.00 102.22 ? 169  GLU B O     1 
ATOM   5521 C  CB    . GLU B 2 170 ? -29.160  -36.338 30.323  1.00 101.98 ? 169  GLU B CB    1 
ATOM   5522 C  CG    . GLU B 2 170 ? -28.779  -36.470 31.794  1.00 109.16 ? 169  GLU B CG    1 
ATOM   5523 C  CD    . GLU B 2 170 ? -27.294  -36.710 32.016  1.00 117.49 ? 169  GLU B CD    1 
ATOM   5524 O  OE1   . GLU B 2 170 ? -26.675  -37.455 31.225  1.00 117.89 ? 169  GLU B OE1   1 
ATOM   5525 O  OE2   . GLU B 2 170 ? -26.743  -36.151 32.988  1.00 110.46 ? 169  GLU B OE2   1 
ATOM   5526 N  N     . PRO B 2 171 ? -26.835  -35.024 28.470  1.00 105.18 ? 170  PRO B N     1 
ATOM   5527 C  CA    . PRO B 2 171 ? -25.442  -34.606 28.260  1.00 108.89 ? 170  PRO B CA    1 
ATOM   5528 C  C     . PRO B 2 171 ? -25.295  -33.111 27.962  1.00 106.90 ? 170  PRO B C     1 
ATOM   5529 O  O     . PRO B 2 171 ? -24.223  -32.544 28.181  1.00 107.44 ? 170  PRO B O     1 
ATOM   5530 C  CB    . PRO B 2 171 ? -25.001  -35.434 27.046  1.00 107.02 ? 170  PRO B CB    1 
ATOM   5531 C  CG    . PRO B 2 171 ? -26.266  -35.804 26.351  1.00 106.34 ? 170  PRO B CG    1 
ATOM   5532 C  CD    . PRO B 2 171 ? -27.261  -36.005 27.453  1.00 102.85 ? 170  PRO B CD    1 
ATOM   5533 N  N     . PHE B 2 172 ? -26.366  -32.491 27.468  1.00 107.41 ? 171  PHE B N     1 
ATOM   5534 C  CA    . PHE B 2 172 ? -26.385  -31.056 27.192  1.00 100.47 ? 171  PHE B CA    1 
ATOM   5535 C  C     . PHE B 2 172 ? -26.687  -30.241 28.450  1.00 103.73 ? 171  PHE B C     1 
ATOM   5536 O  O     . PHE B 2 172 ? -26.168  -29.135 28.619  1.00 92.16  ? 171  PHE B O     1 
ATOM   5537 C  CB    . PHE B 2 172 ? -27.405  -30.733 26.098  1.00 79.58  ? 171  PHE B CB    1 
ATOM   5538 N  N     . ARG B 2 173 ? -27.527  -30.795 29.324  1.00 105.37 ? 172  ARG B N     1 
ATOM   5539 C  CA    . ARG B 2 173 ? -27.904  -30.140 30.578  1.00 102.78 ? 172  ARG B CA    1 
ATOM   5540 C  C     . ARG B 2 173 ? -26.786  -30.198 31.619  1.00 109.45 ? 172  ARG B C     1 
ATOM   5541 O  O     . ARG B 2 173 ? -26.605  -29.258 32.395  1.00 108.17 ? 172  ARG B O     1 
ATOM   5542 C  CB    . ARG B 2 173 ? -29.184  -30.758 31.146  1.00 92.32  ? 172  ARG B CB    1 
ATOM   5543 N  N     . LYS B 2 174 ? -26.047  -31.307 31.629  1.00 109.02 ? 173  LYS B N     1 
ATOM   5544 C  CA    . LYS B 2 174 ? -24.917  -31.491 32.541  1.00 108.39 ? 173  LYS B CA    1 
ATOM   5545 C  C     . LYS B 2 174 ? -23.713  -30.649 32.124  1.00 105.37 ? 173  LYS B C     1 
ATOM   5546 O  O     . LYS B 2 174 ? -22.907  -30.247 32.966  1.00 102.38 ? 173  LYS B O     1 
ATOM   5547 C  CB    . LYS B 2 174 ? -24.524  -32.968 32.620  1.00 99.39  ? 173  LYS B CB    1 
ATOM   5548 N  N     . GLN B 2 175 ? -23.599  -30.394 30.821  1.00 104.95 ? 174  GLN B N     1 
ATOM   5549 C  CA    . GLN B 2 175 ? -22.539  -29.552 30.271  1.00 105.66 ? 174  GLN B CA    1 
ATOM   5550 C  C     . GLN B 2 175 ? -22.776  -28.085 30.626  1.00 105.04 ? 174  GLN B C     1 
ATOM   5551 O  O     . GLN B 2 175 ? -21.850  -27.379 31.031  1.00 103.72 ? 174  GLN B O     1 
ATOM   5552 C  CB    . GLN B 2 175 ? -22.457  -29.725 28.750  1.00 106.10 ? 174  GLN B CB    1 
ATOM   5553 C  CG    . GLN B 2 175 ? -21.157  -29.240 28.120  1.00 102.73 ? 174  GLN B CG    1 
ATOM   5554 C  CD    . GLN B 2 175 ? -19.986  -30.176 28.369  1.00 110.70 ? 174  GLN B CD    1 
ATOM   5555 O  OE1   . GLN B 2 175 ? -20.150  -31.393 28.461  1.00 118.53 ? 174  GLN B OE1   1 
ATOM   5556 N  NE2   . GLN B 2 175 ? -18.790  -29.607 28.469  1.00 104.49 ? 174  GLN B NE2   1 
ATOM   5557 N  N     . ASN B 2 176 ? -24.022  -27.640 30.470  1.00 109.13 ? 175  ASN B N     1 
ATOM   5558 C  CA    . ASN B 2 176 ? -24.417  -26.272 30.795  1.00 106.48 ? 175  ASN B CA    1 
ATOM   5559 C  C     . ASN B 2 176 ? -25.551  -26.246 31.826  1.00 102.73 ? 175  ASN B C     1 
ATOM   5560 O  O     . ASN B 2 176 ? -26.726  -26.347 31.460  1.00 105.55 ? 175  ASN B O     1 
ATOM   5561 C  CB    . ASN B 2 176 ? -24.816  -25.508 29.526  1.00 99.19  ? 175  ASN B CB    1 
ATOM   5562 C  CG    . ASN B 2 176 ? -23.694  -25.435 28.505  1.00 92.73  ? 175  ASN B CG    1 
ATOM   5563 O  OD1   . ASN B 2 176 ? -23.274  -26.451 27.950  1.00 90.09  ? 175  ASN B OD1   1 
ATOM   5564 N  ND2   . ASN B 2 176 ? -23.214  -24.225 28.242  1.00 81.49  ? 175  ASN B ND2   1 
ATOM   5565 N  N     . PRO B 2 177 ? -25.199  -26.122 33.121  1.00 104.56 ? 176  PRO B N     1 
ATOM   5566 C  CA    . PRO B 2 177 ? -26.181  -26.132 34.209  1.00 104.71 ? 176  PRO B CA    1 
ATOM   5567 C  C     . PRO B 2 177 ? -27.020  -24.855 34.287  1.00 113.47 ? 176  PRO B C     1 
ATOM   5568 O  O     . PRO B 2 177 ? -28.192  -24.912 34.666  1.00 106.96 ? 176  PRO B O     1 
ATOM   5569 C  CB    . PRO B 2 177 ? -25.316  -26.271 35.473  1.00 99.07  ? 176  PRO B CB    1 
ATOM   5570 C  CG    . PRO B 2 177 ? -23.954  -26.659 34.996  1.00 100.16 ? 176  PRO B CG    1 
ATOM   5571 C  CD    . PRO B 2 177 ? -23.823  -26.041 33.640  1.00 99.38  ? 176  PRO B CD    1 
ATOM   5572 N  N     . ASP B 2 178 ? -26.420  -23.720 33.931  1.00 112.69 ? 177  ASP B N     1 
ATOM   5573 C  CA    . ASP B 2 178 ? -27.088  -22.418 34.020  1.00 112.71 ? 177  ASP B CA    1 
ATOM   5574 C  C     . ASP B 2 178 ? -27.984  -22.104 32.816  1.00 111.00 ? 177  ASP B C     1 
ATOM   5575 O  O     . ASP B 2 178 ? -28.791  -21.172 32.864  1.00 106.65 ? 177  ASP B O     1 
ATOM   5576 C  CB    . ASP B 2 178 ? -26.062  -21.296 34.240  1.00 113.61 ? 177  ASP B CB    1 
ATOM   5577 C  CG    . ASP B 2 178 ? -25.020  -21.220 33.133  1.00 109.40 ? 177  ASP B CG    1 
ATOM   5578 O  OD1   . ASP B 2 178 ? -24.374  -22.249 32.836  1.00 110.22 ? 177  ASP B OD1   1 
ATOM   5579 O  OD2   . ASP B 2 178 ? -24.838  -20.122 32.567  1.00 88.03  ? 177  ASP B OD2   1 
ATOM   5580 N  N     . ILE B 2 179 ? -27.839  -22.885 31.747  1.00 107.44 ? 178  ILE B N     1 
ATOM   5581 C  CA    . ILE B 2 179 ? -28.646  -22.714 30.536  1.00 103.13 ? 178  ILE B CA    1 
ATOM   5582 C  C     . ILE B 2 179 ? -29.949  -23.513 30.641  1.00 105.33 ? 178  ILE B C     1 
ATOM   5583 O  O     . ILE B 2 179 ? -29.935  -24.706 30.957  1.00 103.00 ? 178  ILE B O     1 
ATOM   5584 C  CB    . ILE B 2 179 ? -27.842  -23.074 29.256  1.00 95.09  ? 178  ILE B CB    1 
ATOM   5585 C  CG1   . ILE B 2 179 ? -26.925  -21.914 28.846  1.00 93.95  ? 178  ILE B CG1   1 
ATOM   5586 C  CG2   . ILE B 2 179 ? -28.761  -23.403 28.087  1.00 86.07  ? 178  ILE B CG2   1 
ATOM   5587 C  CD1   . ILE B 2 179 ? -25.590  -21.866 29.562  1.00 92.64  ? 178  ILE B CD1   1 
ATOM   5588 N  N     . VAL B 2 180 ? -31.068  -22.837 30.382  1.00 107.43 ? 179  VAL B N     1 
ATOM   5589 C  CA    . VAL B 2 180 ? -32.402  -23.427 30.530  1.00 104.65 ? 179  VAL B CA    1 
ATOM   5590 C  C     . VAL B 2 180 ? -32.982  -23.851 29.178  1.00 101.78 ? 179  VAL B C     1 
ATOM   5591 O  O     . VAL B 2 180 ? -32.913  -23.104 28.198  1.00 92.18  ? 179  VAL B O     1 
ATOM   5592 C  CB    . VAL B 2 180 ? -33.378  -22.453 31.236  1.00 103.09 ? 179  VAL B CB    1 
ATOM   5593 C  CG1   . VAL B 2 180 ? -34.681  -23.153 31.600  1.00 90.98  ? 179  VAL B CG1   1 
ATOM   5594 C  CG2   . VAL B 2 180 ? -32.740  -21.861 32.486  1.00 103.09 ? 179  VAL B CG2   1 
ATOM   5595 N  N     . ILE B 2 181 ? -33.547  -25.057 29.140  1.00 99.06  ? 180  ILE B N     1 
ATOM   5596 C  CA    . ILE B 2 181 ? -34.205  -25.590 27.943  1.00 95.60  ? 180  ILE B CA    1 
ATOM   5597 C  C     . ILE B 2 181 ? -35.645  -26.017 28.236  1.00 96.49  ? 180  ILE B C     1 
ATOM   5598 O  O     . ILE B 2 181 ? -35.939  -26.540 29.314  1.00 93.47  ? 180  ILE B O     1 
ATOM   5599 C  CB    . ILE B 2 181 ? -33.420  -26.768 27.316  1.00 92.30  ? 180  ILE B CB    1 
ATOM   5600 C  CG1   . ILE B 2 181 ? -33.001  -27.785 28.389  1.00 99.96  ? 180  ILE B CG1   1 
ATOM   5601 C  CG2   . ILE B 2 181 ? -32.209  -26.249 26.549  1.00 80.93  ? 180  ILE B CG2   1 
ATOM   5602 C  CD1   . ILE B 2 181 ? -32.620  -29.149 27.849  1.00 90.17  ? 180  ILE B CD1   1 
ATOM   5603 N  N     . TYR B 2 182 ? -36.535  -25.787 27.272  1.00 95.44  ? 181  TYR B N     1 
ATOM   5604 C  CA    . TYR B 2 182 ? -37.948  -26.144 27.410  1.00 94.92  ? 181  TYR B CA    1 
ATOM   5605 C  C     . TYR B 2 182 ? -38.525  -26.680 26.100  1.00 95.47  ? 181  TYR B C     1 
ATOM   5606 O  O     . TYR B 2 182 ? -38.248  -26.147 25.023  1.00 90.24  ? 181  TYR B O     1 
ATOM   5607 C  CB    . TYR B 2 182 ? -38.764  -24.944 27.909  1.00 93.95  ? 181  TYR B CB    1 
ATOM   5608 C  CG    . TYR B 2 182 ? -40.244  -25.216 28.096  1.00 96.10  ? 181  TYR B CG    1 
ATOM   5609 C  CD1   . TYR B 2 182 ? -40.704  -25.991 29.161  1.00 98.69  ? 181  TYR B CD1   1 
ATOM   5610 C  CD2   . TYR B 2 182 ? -41.186  -24.688 27.212  1.00 94.49  ? 181  TYR B CD2   1 
ATOM   5611 C  CE1   . TYR B 2 182 ? -42.058  -26.239 29.336  1.00 102.99 ? 181  TYR B CE1   1 
ATOM   5612 C  CE2   . TYR B 2 182 ? -42.541  -24.930 27.379  1.00 95.36  ? 181  TYR B CE2   1 
ATOM   5613 C  CZ    . TYR B 2 182 ? -42.972  -25.705 28.441  1.00 102.39 ? 181  TYR B CZ    1 
ATOM   5614 O  OH    . TYR B 2 182 ? -44.316  -25.948 28.610  1.00 96.70  ? 181  TYR B OH    1 
ATOM   5615 N  N     . GLN B 2 183 ? -39.329  -27.736 26.211  1.00 95.07  ? 182  GLN B N     1 
ATOM   5616 C  CA    . GLN B 2 183 ? -39.949  -28.378 25.055  1.00 96.53  ? 182  GLN B CA    1 
ATOM   5617 C  C     . GLN B 2 183 ? -41.466  -28.191 25.069  1.00 95.68  ? 182  GLN B C     1 
ATOM   5618 O  O     . GLN B 2 183 ? -42.128  -28.479 26.070  1.00 96.05  ? 182  GLN B O     1 
ATOM   5619 C  CB    . GLN B 2 183 ? -39.595  -29.869 25.024  1.00 94.29  ? 182  GLN B CB    1 
ATOM   5620 C  CG    . GLN B 2 183 ? -40.050  -30.606 23.771  1.00 89.64  ? 182  GLN B CG    1 
ATOM   5621 C  CD    . GLN B 2 183 ? -39.873  -32.112 23.869  1.00 91.10  ? 182  GLN B CD    1 
ATOM   5622 O  OE1   . GLN B 2 183 ? -39.937  -32.693 24.955  1.00 91.97  ? 182  GLN B OE1   1 
ATOM   5623 N  NE2   . GLN B 2 183 ? -39.658  -32.755 22.727  1.00 89.65  ? 182  GLN B NE2   1 
ATOM   5624 N  N     . TYR B 2 184 ? -42.002  -27.703 23.953  1.00 90.41  ? 183  TYR B N     1 
ATOM   5625 C  CA    . TYR B 2 184 ? -43.444  -27.538 23.783  1.00 88.24  ? 183  TYR B CA    1 
ATOM   5626 C  C     . TYR B 2 184 ? -43.857  -27.886 22.355  1.00 91.13  ? 183  TYR B C     1 
ATOM   5627 O  O     . TYR B 2 184 ? -43.420  -27.241 21.397  1.00 84.35  ? 183  TYR B O     1 
ATOM   5628 C  CB    . TYR B 2 184 ? -43.878  -26.112 24.145  1.00 89.11  ? 183  TYR B CB    1 
ATOM   5629 C  CG    . TYR B 2 184 ? -45.379  -25.911 24.205  1.00 85.80  ? 183  TYR B CG    1 
ATOM   5630 C  CD1   . TYR B 2 184 ? -46.124  -26.381 25.288  1.00 86.75  ? 183  TYR B CD1   1 
ATOM   5631 C  CD2   . TYR B 2 184 ? -46.054  -25.243 23.183  1.00 74.10  ? 183  TYR B CD2   1 
ATOM   5632 C  CE1   . TYR B 2 184 ? -47.498  -26.198 25.346  1.00 78.98  ? 183  TYR B CE1   1 
ATOM   5633 C  CE2   . TYR B 2 184 ? -47.427  -25.054 23.234  1.00 69.88  ? 183  TYR B CE2   1 
ATOM   5634 C  CZ    . TYR B 2 184 ? -48.144  -25.533 24.316  1.00 76.41  ? 183  TYR B CZ    1 
ATOM   5635 O  OH    . TYR B 2 184 ? -49.506  -25.348 24.370  1.00 78.28  ? 183  TYR B OH    1 
ATOM   5636 N  N     . MET B 2 185 ? -44.698  -28.913 22.235  1.00 89.24  ? 184  MET B N     1 
ATOM   5637 C  CA    . MET B 2 185 ? -45.176  -29.436 20.947  1.00 87.44  ? 184  MET B CA    1 
ATOM   5638 C  C     . MET B 2 185 ? -44.031  -29.944 20.059  1.00 88.46  ? 184  MET B C     1 
ATOM   5639 O  O     . MET B 2 185 ? -43.298  -30.854 20.450  1.00 87.79  ? 184  MET B O     1 
ATOM   5640 C  CB    . MET B 2 185 ? -46.066  -28.416 20.215  1.00 83.33  ? 184  MET B CB    1 
ATOM   5641 C  CG    . MET B 2 185 ? -47.294  -27.970 20.999  1.00 88.11  ? 184  MET B CG    1 
ATOM   5642 S  SD    . MET B 2 185 ? -48.490  -29.281 21.327  1.00 104.09 ? 184  MET B SD    1 
ATOM   5643 C  CE    . MET B 2 185 ? -49.253  -29.464 19.717  1.00 77.45  ? 184  MET B CE    1 
ATOM   5644 N  N     . ASP B 2 186 ? -43.881  -29.351 18.876  1.00 88.96  ? 185  ASP B N     1 
ATOM   5645 C  CA    . ASP B 2 186 ? -42.833  -29.744 17.932  1.00 89.33  ? 185  ASP B CA    1 
ATOM   5646 C  C     . ASP B 2 186 ? -41.674  -28.743 17.907  1.00 90.96  ? 185  ASP B C     1 
ATOM   5647 O  O     . ASP B 2 186 ? -40.681  -28.950 17.205  1.00 94.11  ? 185  ASP B O     1 
ATOM   5648 C  CB    . ASP B 2 186 ? -43.415  -29.921 16.524  1.00 92.67  ? 185  ASP B CB    1 
ATOM   5649 C  CG    . ASP B 2 186 ? -44.588  -30.891 16.487  1.00 93.73  ? 185  ASP B CG    1 
ATOM   5650 O  OD1   . ASP B 2 186 ? -44.469  -32.006 17.039  1.00 90.39  ? 185  ASP B OD1   1 
ATOM   5651 O  OD2   . ASP B 2 186 ? -45.629  -30.538 15.895  1.00 94.93  ? 185  ASP B OD2   1 
ATOM   5652 N  N     . ASP B 2 187 ? -41.808  -27.667 18.680  1.00 92.30  ? 186  ASP B N     1 
ATOM   5653 C  CA    . ASP B 2 187 ? -40.785  -26.625 18.758  1.00 96.44  ? 186  ASP B CA    1 
ATOM   5654 C  C     . ASP B 2 187 ? -39.966  -26.731 20.043  1.00 105.52 ? 186  ASP B C     1 
ATOM   5655 O  O     . ASP B 2 187 ? -40.496  -27.074 21.102  1.00 99.48  ? 186  ASP B O     1 
ATOM   5656 C  CB    . ASP B 2 187 ? -41.423  -25.235 18.658  1.00 96.38  ? 186  ASP B CB    1 
ATOM   5657 C  CG    . ASP B 2 187 ? -42.055  -24.973 17.299  1.00 96.71  ? 186  ASP B CG    1 
ATOM   5658 O  OD1   . ASP B 2 187 ? -42.775  -25.856 16.784  1.00 96.56  ? 186  ASP B OD1   1 
ATOM   5659 O  OD2   . ASP B 2 187 ? -41.839  -23.872 16.749  1.00 100.52 ? 186  ASP B OD2   1 
ATOM   5660 N  N     . LEU B 2 188 ? -38.673  -26.432 19.937  1.00 105.16 ? 187  LEU B N     1 
ATOM   5661 C  CA    . LEU B 2 188 ? -37.769  -26.460 21.084  1.00 101.12 ? 187  LEU B CA    1 
ATOM   5662 C  C     . LEU B 2 188 ? -37.291  -25.050 21.428  1.00 105.48 ? 187  LEU B C     1 
ATOM   5663 O  O     . LEU B 2 188 ? -36.830  -24.311 20.554  1.00 104.52 ? 187  LEU B O     1 
ATOM   5664 C  CB    . LEU B 2 188 ? -36.576  -27.384 20.809  1.00 99.55  ? 187  LEU B CB    1 
ATOM   5665 C  CG    . LEU B 2 188 ? -35.676  -27.795 21.980  1.00 91.12  ? 187  LEU B CG    1 
ATOM   5666 C  CD1   . LEU B 2 188 ? -36.366  -28.803 22.890  1.00 80.88  ? 187  LEU B CD1   1 
ATOM   5667 C  CD2   . LEU B 2 188 ? -34.363  -28.361 21.463  1.00 93.05  ? 187  LEU B CD2   1 
ATOM   5668 N  N     . TYR B 2 189 ? -37.407  -24.689 22.704  1.00 102.88 ? 188  TYR B N     1 
ATOM   5669 C  CA    . TYR B 2 189 ? -37.036  -23.356 23.177  1.00 103.97 ? 188  TYR B CA    1 
ATOM   5670 C  C     . TYR B 2 189 ? -35.789  -23.400 24.058  1.00 103.34 ? 188  TYR B C     1 
ATOM   5671 O  O     . TYR B 2 189 ? -35.773  -24.065 25.097  1.00 98.79  ? 188  TYR B O     1 
ATOM   5672 C  CB    . TYR B 2 189 ? -38.203  -22.707 23.932  1.00 98.41  ? 188  TYR B CB    1 
ATOM   5673 C  CG    . TYR B 2 189 ? -39.429  -22.450 23.080  1.00 95.01  ? 188  TYR B CG    1 
ATOM   5674 C  CD1   . TYR B 2 189 ? -39.582  -21.249 22.389  1.00 90.42  ? 188  TYR B CD1   1 
ATOM   5675 C  CD2   . TYR B 2 189 ? -40.438  -23.407 22.969  1.00 94.82  ? 188  TYR B CD2   1 
ATOM   5676 C  CE1   . TYR B 2 189 ? -40.703  -21.008 21.608  1.00 91.18  ? 188  TYR B CE1   1 
ATOM   5677 C  CE2   . TYR B 2 189 ? -41.562  -23.176 22.190  1.00 95.59  ? 188  TYR B CE2   1 
ATOM   5678 C  CZ    . TYR B 2 189 ? -41.689  -21.974 21.512  1.00 98.48  ? 188  TYR B CZ    1 
ATOM   5679 O  OH    . TYR B 2 189 ? -42.801  -21.738 20.738  1.00 89.20  ? 188  TYR B OH    1 
ATOM   5680 N  N     . VAL B 2 190 ? -34.746  -22.693 23.626  1.00 107.68 ? 189  VAL B N     1 
ATOM   5681 C  CA    . VAL B 2 190 ? -33.479  -22.631 24.358  1.00 106.81 ? 189  VAL B CA    1 
ATOM   5682 C  C     . VAL B 2 190 ? -33.155  -21.182 24.726  1.00 103.25 ? 189  VAL B C     1 
ATOM   5683 O  O     . VAL B 2 190 ? -33.096  -20.310 23.856  1.00 101.56 ? 189  VAL B O     1 
ATOM   5684 C  CB    . VAL B 2 190 ? -32.309  -23.244 23.547  1.00 106.43 ? 189  VAL B CB    1 
ATOM   5685 C  CG1   . VAL B 2 190 ? -31.032  -23.273 24.377  1.00 97.68  ? 189  VAL B CG1   1 
ATOM   5686 C  CG2   . VAL B 2 190 ? -32.652  -24.648 23.068  1.00 105.71 ? 189  VAL B CG2   1 
ATOM   5687 N  N     . GLY B 2 191 ? -32.950  -20.937 26.019  1.00 96.75  ? 190  GLY B N     1 
ATOM   5688 C  CA    . GLY B 2 191 ? -32.617  -19.605 26.522  1.00 97.56  ? 190  GLY B CA    1 
ATOM   5689 C  C     . GLY B 2 191 ? -31.222  -19.534 27.117  1.00 103.07 ? 190  GLY B C     1 
ATOM   5690 O  O     . GLY B 2 191 ? -30.771  -20.475 27.775  1.00 106.88 ? 190  GLY B O     1 
ATOM   5691 N  N     . SER B 2 192 ? -30.543  -18.412 26.885  1.00 105.17 ? 191  SER B N     1 
ATOM   5692 C  CA    . SER B 2 192 ? -29.176  -18.210 27.369  1.00 105.26 ? 191  SER B CA    1 
ATOM   5693 C  C     . SER B 2 192 ? -28.877  -16.743 27.684  1.00 103.91 ? 191  SER B C     1 
ATOM   5694 O  O     . SER B 2 192 ? -29.485  -15.837 27.107  1.00 105.57 ? 191  SER B O     1 
ATOM   5695 C  CB    . SER B 2 192 ? -28.163  -18.747 26.353  1.00 93.38  ? 191  SER B CB    1 
ATOM   5696 O  OG    . SER B 2 192 ? -28.296  -18.094 25.101  1.00 87.52  ? 191  SER B OG    1 
ATOM   5697 N  N     . ASP B 2 193 ? -27.936  -16.526 28.601  1.00 95.48  ? 192  ASP B N     1 
ATOM   5698 C  CA    . ASP B 2 193 ? -27.497  -15.182 28.979  1.00 102.19 ? 192  ASP B CA    1 
ATOM   5699 C  C     . ASP B 2 193 ? -26.164  -14.816 28.316  1.00 108.81 ? 192  ASP B C     1 
ATOM   5700 O  O     . ASP B 2 193 ? -25.451  -13.922 28.780  1.00 105.59 ? 192  ASP B O     1 
ATOM   5701 C  CB    . ASP B 2 193 ? -27.385  -15.065 30.505  1.00 102.84 ? 192  ASP B CB    1 
ATOM   5702 C  CG    . ASP B 2 193 ? -28.724  -15.222 31.209  1.00 103.41 ? 192  ASP B CG    1 
ATOM   5703 O  OD1   . ASP B 2 193 ? -29.719  -14.610 30.763  1.00 99.79  ? 192  ASP B OD1   1 
ATOM   5704 O  OD2   . ASP B 2 193 ? -28.778  -15.951 32.222  1.00 96.55  ? 192  ASP B OD2   1 
ATOM   5705 N  N     . LEU B 2 194 ? -25.845  -15.508 27.224  1.00 110.17 ? 193  LEU B N     1 
ATOM   5706 C  CA    . LEU B 2 194 ? -24.578  -15.322 26.514  1.00 108.30 ? 193  LEU B CA    1 
ATOM   5707 C  C     . LEU B 2 194 ? -24.648  -14.203 25.469  1.00 114.14 ? 193  LEU B C     1 
ATOM   5708 O  O     . LEU B 2 194 ? -25.727  -13.679 25.176  1.00 114.54 ? 193  LEU B O     1 
ATOM   5709 C  CB    . LEU B 2 194 ? -24.119  -16.641 25.873  1.00 105.07 ? 193  LEU B CB    1 
ATOM   5710 C  CG    . LEU B 2 194 ? -23.486  -17.711 26.774  1.00 101.25 ? 193  LEU B CG    1 
ATOM   5711 C  CD1   . LEU B 2 194 ? -24.531  -18.505 27.547  1.00 90.11  ? 193  LEU B CD1   1 
ATOM   5712 C  CD2   . LEU B 2 194 ? -22.621  -18.653 25.951  1.00 103.83 ? 193  LEU B CD2   1 
ATOM   5713 N  N     . GLU B 2 195 ? -23.489  -13.849 24.916  1.00 113.32 ? 194  GLU B N     1 
ATOM   5714 C  CA    . GLU B 2 195 ? -23.366  -12.754 23.950  1.00 110.30 ? 194  GLU B CA    1 
ATOM   5715 C  C     . GLU B 2 195 ? -23.886  -13.147 22.561  1.00 105.70 ? 194  GLU B C     1 
ATOM   5716 O  O     . GLU B 2 195 ? -24.196  -14.315 22.315  1.00 99.20  ? 194  GLU B O     1 
ATOM   5717 C  CB    . GLU B 2 195 ? -21.904  -12.291 23.871  1.00 107.96 ? 194  GLU B CB    1 
ATOM   5718 C  CG    . GLU B 2 195 ? -21.713  -10.818 23.531  1.00 112.09 ? 194  GLU B CG    1 
ATOM   5719 C  CD    . GLU B 2 195 ? -22.155  -9.882  24.644  1.00 114.34 ? 194  GLU B CD    1 
ATOM   5720 O  OE1   . GLU B 2 195 ? -21.861  -10.165 25.826  1.00 110.05 ? 194  GLU B OE1   1 
ATOM   5721 O  OE2   . GLU B 2 195 ? -22.791  -8.852  24.335  1.00 120.58 ? 194  GLU B OE2   1 
ATOM   5722 N  N     . ILE B 2 196 ? -23.978  -12.161 21.666  1.00 104.29 ? 195  ILE B N     1 
ATOM   5723 C  CA    . ILE B 2 196 ? -24.492  -12.350 20.302  1.00 116.29 ? 195  ILE B CA    1 
ATOM   5724 C  C     . ILE B 2 196 ? -23.721  -13.412 19.497  1.00 112.59 ? 195  ILE B C     1 
ATOM   5725 O  O     . ILE B 2 196 ? -24.330  -14.286 18.873  1.00 110.79 ? 195  ILE B O     1 
ATOM   5726 C  CB    . ILE B 2 196 ? -24.594  -11.000 19.529  1.00 111.06 ? 195  ILE B CB    1 
ATOM   5727 C  CG1   . ILE B 2 196 ? -25.156  -11.198 18.113  1.00 96.73  ? 195  ILE B CG1   1 
ATOM   5728 C  CG2   . ILE B 2 196 ? -23.256  -10.268 19.490  1.00 107.56 ? 195  ILE B CG2   1 
ATOM   5729 C  CD1   . ILE B 2 196 ? -26.659  -11.373 18.056  1.00 91.74  ? 195  ILE B CD1   1 
ATOM   5730 N  N     . GLY B 2 197 ? -22.392  -13.334 19.526  1.00 114.87 ? 196  GLY B N     1 
ATOM   5731 C  CA    . GLY B 2 197 ? -21.536  -14.290 18.826  1.00 113.80 ? 196  GLY B CA    1 
ATOM   5732 C  C     . GLY B 2 197 ? -21.465  -15.634 19.528  1.00 114.64 ? 196  GLY B C     1 
ATOM   5733 O  O     . GLY B 2 197 ? -21.236  -16.665 18.892  1.00 110.81 ? 196  GLY B O     1 
ATOM   5734 N  N     . GLN B 2 198 ? -21.663  -15.612 20.844  1.00 115.36 ? 197  GLN B N     1 
ATOM   5735 C  CA    . GLN B 2 198 ? -21.647  -16.820 21.666  1.00 114.32 ? 197  GLN B CA    1 
ATOM   5736 C  C     . GLN B 2 198 ? -22.925  -17.641 21.505  1.00 114.78 ? 197  GLN B C     1 
ATOM   5737 O  O     . GLN B 2 198 ? -22.881  -18.872 21.530  1.00 107.62 ? 197  GLN B O     1 
ATOM   5738 C  CB    . GLN B 2 198 ? -21.443  -16.459 23.142  1.00 110.03 ? 197  GLN B CB    1 
ATOM   5739 C  CG    . GLN B 2 198 ? -20.046  -15.963 23.494  1.00 114.93 ? 197  GLN B CG    1 
ATOM   5740 C  CD    . GLN B 2 198 ? -19.019  -17.079 23.608  1.00 114.38 ? 197  GLN B CD    1 
ATOM   5741 O  OE1   . GLN B 2 198 ? -19.364  -18.248 23.795  1.00 98.13  ? 197  GLN B OE1   1 
ATOM   5742 N  NE2   . GLN B 2 198 ? -17.746  -16.718 23.503  1.00 113.41 ? 197  GLN B NE2   1 
ATOM   5743 N  N     . HIS B 2 199 ? -24.054  -16.952 21.337  1.00 112.92 ? 198  HIS B N     1 
ATOM   5744 C  CA    . HIS B 2 199 ? -25.369  -17.593 21.244  1.00 113.08 ? 198  HIS B CA    1 
ATOM   5745 C  C     . HIS B 2 199 ? -25.530  -18.456 20.022  1.00 112.82 ? 198  HIS B C     1 
ATOM   5746 O  O     . HIS B 2 199 ? -26.089  -19.549 20.105  1.00 112.91 ? 198  HIS B O     1 
ATOM   5747 C  CB    . HIS B 2 199 ? -26.479  -16.548 21.298  1.00 107.25 ? 198  HIS B CB    1 
ATOM   5748 N  N     . ARG B 2 200 ? -25.038  -17.972 18.883  1.00 111.09 ? 199  ARG B N     1 
ATOM   5749 C  CA    . ARG B 2 200 ? -25.156  -18.686 17.608  1.00 107.17 ? 199  ARG B CA    1 
ATOM   5750 C  C     . ARG B 2 200 ? -24.316  -19.964 17.558  1.00 108.13 ? 199  ARG B C     1 
ATOM   5751 O  O     . ARG B 2 200 ? -24.686  -20.929 16.886  1.00 97.62  ? 199  ARG B O     1 
ATOM   5752 C  CB    . ARG B 2 200 ? -24.778  -17.766 16.445  1.00 95.34  ? 199  ARG B CB    1 
ATOM   5753 N  N     . THR B 2 201 ? -23.193  -19.960 18.272  1.00 118.22 ? 200  THR B N     1 
ATOM   5754 C  CA    . THR B 2 201 ? -22.273  -21.098 18.298  1.00 116.76 ? 200  THR B CA    1 
ATOM   5755 C  C     . THR B 2 201 ? -22.770  -22.212 19.225  1.00 109.71 ? 200  THR B C     1 
ATOM   5756 O  O     . THR B 2 201 ? -22.673  -23.394 18.888  1.00 104.65 ? 200  THR B O     1 
ATOM   5757 C  CB    . THR B 2 201 ? -20.848  -20.665 18.714  1.00 111.85 ? 200  THR B CB    1 
ATOM   5758 O  OG1   . THR B 2 201 ? -20.502  -19.441 18.052  1.00 105.19 ? 200  THR B OG1   1 
ATOM   5759 C  CG2   . THR B 2 201 ? -19.824  -21.737 18.352  1.00 103.36 ? 200  THR B CG2   1 
ATOM   5760 N  N     . LYS B 2 202 ? -23.305  -21.826 20.384  1.00 107.59 ? 201  LYS B N     1 
ATOM   5761 C  CA    . LYS B 2 202 ? -23.785  -22.782 21.389  1.00 104.05 ? 201  LYS B CA    1 
ATOM   5762 C  C     . LYS B 2 202 ? -25.054  -23.519 20.954  1.00 106.45 ? 201  LYS B C     1 
ATOM   5763 O  O     . LYS B 2 202 ? -25.291  -24.654 21.376  1.00 112.87 ? 201  LYS B O     1 
ATOM   5764 C  CB    . LYS B 2 202 ? -24.009  -22.090 22.741  1.00 100.27 ? 201  LYS B CB    1 
ATOM   5765 C  CG    . LYS B 2 202 ? -22.748  -21.547 23.404  1.00 106.23 ? 201  LYS B CG    1 
ATOM   5766 C  CD    . LYS B 2 202 ? -21.876  -22.648 23.989  1.00 106.53 ? 201  LYS B CD    1 
ATOM   5767 C  CE    . LYS B 2 202 ? -20.599  -22.078 24.586  1.00 100.40 ? 201  LYS B CE    1 
ATOM   5768 N  NZ    . LYS B 2 202 ? -19.721  -23.141 25.147  1.00 86.58  ? 201  LYS B NZ    1 
ATOM   5769 N  N     . ILE B 2 203 ? -25.864  -22.867 20.120  1.00 103.23 ? 202  ILE B N     1 
ATOM   5770 C  CA    . ILE B 2 203 ? -27.062  -23.483 19.542  1.00 108.36 ? 202  ILE B CA    1 
ATOM   5771 C  C     . ILE B 2 203 ? -26.673  -24.554 18.518  1.00 107.60 ? 202  ILE B C     1 
ATOM   5772 O  O     . ILE B 2 203 ? -27.298  -25.616 18.451  1.00 109.38 ? 202  ILE B O     1 
ATOM   5773 C  CB    . ILE B 2 203 ? -28.005  -22.420 18.913  1.00 106.43 ? 202  ILE B CB    1 
ATOM   5774 C  CG1   . ILE B 2 203 ? -28.617  -21.510 19.994  1.00 106.08 ? 202  ILE B CG1   1 
ATOM   5775 C  CG2   . ILE B 2 203 ? -29.096  -23.061 18.059  1.00 94.72  ? 202  ILE B CG2   1 
ATOM   5776 C  CD1   . ILE B 2 203 ? -29.483  -22.207 21.028  1.00 101.09 ? 202  ILE B CD1   1 
ATOM   5777 N  N     . GLU B 2 204 ? -25.628  -24.270 17.740  1.00 103.56 ? 203  GLU B N     1 
ATOM   5778 C  CA    . GLU B 2 204 ? -25.110  -25.205 16.738  1.00 103.60 ? 203  GLU B CA    1 
ATOM   5779 C  C     . GLU B 2 204 ? -24.476  -26.443 17.380  1.00 107.02 ? 203  GLU B C     1 
ATOM   5780 O  O     . GLU B 2 204 ? -24.470  -27.523 16.784  1.00 105.05 ? 203  GLU B O     1 
ATOM   5781 C  CB    . GLU B 2 204 ? -24.111  -24.499 15.810  1.00 100.19 ? 203  GLU B CB    1 
ATOM   5782 C  CG    . GLU B 2 204 ? -23.719  -25.285 14.561  1.00 101.60 ? 203  GLU B CG    1 
ATOM   5783 C  CD    . GLU B 2 204 ? -24.895  -25.595 13.648  1.00 111.70 ? 203  GLU B CD    1 
ATOM   5784 O  OE1   . GLU B 2 204 ? -25.707  -24.684 13.376  1.00 109.72 ? 203  GLU B OE1   1 
ATOM   5785 O  OE2   . GLU B 2 204 ? -25.001  -26.754 13.194  1.00 116.43 ? 203  GLU B OE2   1 
ATOM   5786 N  N     . GLU B 2 205 ? -23.949  -26.278 18.594  1.00 108.16 ? 204  GLU B N     1 
ATOM   5787 C  CA    . GLU B 2 205 ? -23.400  -27.390 19.375  1.00 109.09 ? 204  GLU B CA    1 
ATOM   5788 C  C     . GLU B 2 205 ? -24.486  -28.401 19.747  1.00 110.79 ? 204  GLU B C     1 
ATOM   5789 O  O     . GLU B 2 205 ? -24.234  -29.607 19.783  1.00 111.97 ? 204  GLU B O     1 
ATOM   5790 C  CB    . GLU B 2 205 ? -22.704  -26.875 20.638  1.00 105.13 ? 204  GLU B CB    1 
ATOM   5791 C  CG    . GLU B 2 205 ? -21.375  -26.176 20.384  1.00 106.79 ? 204  GLU B CG    1 
ATOM   5792 C  CD    . GLU B 2 205 ? -20.719  -25.660 21.654  1.00 113.05 ? 204  GLU B CD    1 
ATOM   5793 O  OE1   . GLU B 2 205 ? -20.839  -26.319 22.710  1.00 117.35 ? 204  GLU B OE1   1 
ATOM   5794 O  OE2   . GLU B 2 205 ? -20.072  -24.594 21.594  1.00 109.46 ? 204  GLU B OE2   1 
ATOM   5795 N  N     . LEU B 2 206 ? -25.687  -27.894 20.021  1.00 108.21 ? 205  LEU B N     1 
ATOM   5796 C  CA    . LEU B 2 206 ? -26.852  -28.732 20.296  1.00 109.18 ? 205  LEU B CA    1 
ATOM   5797 C  C     . LEU B 2 206 ? -27.451  -29.262 18.993  1.00 110.00 ? 205  LEU B C     1 
ATOM   5798 O  O     . LEU B 2 206 ? -28.005  -30.363 18.961  1.00 110.26 ? 205  LEU B O     1 
ATOM   5799 C  CB    . LEU B 2 206 ? -27.897  -27.945 21.097  1.00 101.22 ? 205  LEU B CB    1 
ATOM   5800 C  CG    . LEU B 2 206 ? -29.027  -28.701 21.808  1.00 103.13 ? 205  LEU B CG    1 
ATOM   5801 C  CD1   . LEU B 2 206 ? -29.346  -28.048 23.144  1.00 94.76  ? 205  LEU B CD1   1 
ATOM   5802 C  CD2   . LEU B 2 206 ? -30.277  -28.800 20.945  1.00 106.46 ? 205  LEU B CD2   1 
ATOM   5803 N  N     . ARG B 2 207 ? -27.334  -28.471 17.927  1.00 113.65 ? 206  ARG B N     1 
ATOM   5804 C  CA    . ARG B 2 207 ? -27.828  -28.850 16.601  1.00 106.62 ? 206  ARG B CA    1 
ATOM   5805 C  C     . ARG B 2 207 ? -27.007  -29.984 15.987  1.00 114.35 ? 206  ARG B C     1 
ATOM   5806 O  O     . ARG B 2 207 ? -27.547  -30.833 15.274  1.00 108.17 ? 206  ARG B O     1 
ATOM   5807 C  CB    . ARG B 2 207 ? -27.841  -27.640 15.665  1.00 98.42  ? 206  ARG B CB    1 
ATOM   5808 N  N     . GLN B 2 208 ? -25.704  -29.987 16.267  1.00 119.58 ? 207  GLN B N     1 
ATOM   5809 C  CA    . GLN B 2 208 ? -24.806  -31.054 15.824  1.00 119.48 ? 207  GLN B CA    1 
ATOM   5810 C  C     . GLN B 2 208 ? -25.010  -32.327 16.644  1.00 114.44 ? 207  GLN B C     1 
ATOM   5811 O  O     . GLN B 2 208 ? -24.725  -33.431 16.173  1.00 115.12 ? 207  GLN B O     1 
ATOM   5812 C  CB    . GLN B 2 208 ? -23.348  -30.599 15.909  1.00 107.06 ? 207  GLN B CB    1 
ATOM   5813 N  N     . HIS B 2 209 ? -25.502  -32.159 17.871  1.00 111.72 ? 208  HIS B N     1 
ATOM   5814 C  CA    . HIS B 2 209 ? -25.820  -33.276 18.760  1.00 112.93 ? 208  HIS B CA    1 
ATOM   5815 C  C     . HIS B 2 209 ? -27.060  -34.003 18.311  1.00 110.62 ? 208  HIS B C     1 
ATOM   5816 O  O     . HIS B 2 209 ? -27.227  -35.192 18.594  1.00 103.21 ? 208  HIS B O     1 
ATOM   5817 C  CB    . HIS B 2 209 ? -25.981  -32.782 20.195  1.00 101.28 ? 208  HIS B CB    1 
ATOM   5818 C  CG    . HIS B 2 209 ? -26.158  -33.890 21.208  1.00 104.15 ? 208  HIS B CG    1 
ATOM   5819 N  ND1   . HIS B 2 209 ? -27.367  -34.368 21.553  1.00 109.73 ? 208  HIS B ND1   1 
ATOM   5820 C  CD2   . HIS B 2 209 ? -25.223  -34.611 21.948  1.00 105.23 ? 208  HIS B CD2   1 
ATOM   5821 C  CE1   . HIS B 2 209 ? -27.217  -35.345 22.467  1.00 100.38 ? 208  HIS B CE1   1 
ATOM   5822 N  NE2   . HIS B 2 209 ? -25.905  -35.492 22.709  1.00 100.65 ? 208  HIS B NE2   1 
ATOM   5823 N  N     . LEU B 2 210 ? -27.940  -33.289 17.609  1.00 111.96 ? 209  LEU B N     1 
ATOM   5824 C  CA    . LEU B 2 210 ? -29.163  -33.872 17.053  1.00 109.08 ? 209  LEU B CA    1 
ATOM   5825 C  C     . LEU B 2 210 ? -28.854  -34.887 15.951  1.00 115.48 ? 209  LEU B C     1 
ATOM   5826 O  O     . LEU B 2 210 ? -29.538  -35.906 15.829  1.00 114.94 ? 209  LEU B O     1 
ATOM   5827 C  CB    . LEU B 2 210 ? -30.092  -32.775 16.517  1.00 106.32 ? 209  LEU B CB    1 
ATOM   5828 C  CG    . LEU B 2 210 ? -30.737  -31.796 17.506  1.00 109.03 ? 209  LEU B CG    1 
ATOM   5829 C  CD1   . LEU B 2 210 ? -31.277  -30.578 16.771  1.00 103.07 ? 209  LEU B CD1   1 
ATOM   5830 C  CD2   . LEU B 2 210 ? -31.837  -32.459 18.325  1.00 104.41 ? 209  LEU B CD2   1 
ATOM   5831 N  N     . LEU B 2 211 ? -27.819  -34.601 15.162  1.00 115.16 ? 210  LEU B N     1 
ATOM   5832 C  CA    . LEU B 2 211 ? -27.375  -35.490 14.084  1.00 111.80 ? 210  LEU B CA    1 
ATOM   5833 C  C     . LEU B 2 211 ? -26.714  -36.767 14.608  1.00 112.86 ? 210  LEU B C     1 
ATOM   5834 O  O     . LEU B 2 211 ? -26.660  -37.777 13.901  1.00 119.68 ? 210  LEU B O     1 
ATOM   5835 C  CB    . LEU B 2 211 ? -26.425  -34.756 13.125  1.00 106.22 ? 210  LEU B CB    1 
ATOM   5836 C  CG    . LEU B 2 211 ? -26.966  -33.920 11.950  1.00 95.50  ? 210  LEU B CG    1 
ATOM   5837 C  CD1   . LEU B 2 211 ? -27.778  -34.766 10.976  1.00 91.37  ? 210  LEU B CD1   1 
ATOM   5838 C  CD2   . LEU B 2 211 ? -27.765  -32.704 12.408  1.00 91.65  ? 210  LEU B CD2   1 
ATOM   5839 N  N     . ARG B 2 212 ? -26.213  -36.711 15.842  1.00 113.36 ? 211  ARG B N     1 
ATOM   5840 C  CA    . ARG B 2 212 ? -25.640  -37.880 16.510  1.00 121.40 ? 211  ARG B CA    1 
ATOM   5841 C  C     . ARG B 2 212 ? -26.718  -38.913 16.832  1.00 120.72 ? 211  ARG B C     1 
ATOM   5842 O  O     . ARG B 2 212 ? -26.456  -40.118 16.821  1.00 119.21 ? 211  ARG B O     1 
ATOM   5843 C  CB    . ARG B 2 212 ? -24.902  -37.467 17.786  1.00 119.33 ? 211  ARG B CB    1 
ATOM   5844 N  N     . TRP B 2 213 ? -27.926  -38.431 17.120  1.00 113.39 ? 212  TRP B N     1 
ATOM   5845 C  CA    . TRP B 2 213 ? -29.081  -39.298 17.334  1.00 115.49 ? 212  TRP B CA    1 
ATOM   5846 C  C     . TRP B 2 213 ? -29.761  -39.609 16.028  1.00 133.34 ? 212  TRP B C     1 
ATOM   5847 O  O     . TRP B 2 213 ? -30.453  -40.622 15.908  1.00 120.37 ? 212  TRP B O     1 
ATOM   5848 C  CB    . TRP B 2 213 ? -30.060  -38.661 18.315  1.00 108.65 ? 212  TRP B CB    1 
ATOM   5849 C  CG    . TRP B 2 213 ? -30.876  -39.670 19.089  1.00 119.90 ? 212  TRP B CG    1 
ATOM   5850 C  CD1   . TRP B 2 213 ? -32.192  -40.061 18.856  1.00 107.59 ? 212  TRP B CD1   1 
ATOM   5851 C  CD2   . TRP B 2 213 ? -30.446  -40.460 20.255  1.00 113.17 ? 212  TRP B CD2   1 
ATOM   5852 N  NE1   . TRP B 2 213 ? -32.593  -41.005 19.768  1.00 110.09 ? 212  TRP B NE1   1 
ATOM   5853 C  CE2   . TRP B 2 213 ? -31.597  -41.290 20.634  1.00 117.42 ? 212  TRP B CE2   1 
ATOM   5854 C  CE3   . TRP B 2 213 ? -29.271  -40.559 20.993  1.00 97.28  ? 212  TRP B CE3   1 
ATOM   5855 C  CZ2   . TRP B 2 213 ? -31.549  -42.170 21.707  1.00 110.13 ? 212  TRP B CZ2   1 
ATOM   5856 C  CZ3   . TRP B 2 213 ? -29.235  -41.450 22.074  1.00 97.02  ? 212  TRP B CZ3   1 
ATOM   5857 C  CH2   . TRP B 2 213 ? -30.347  -42.235 22.420  1.00 100.33 ? 212  TRP B CH2   1 
ATOM   5858 N  N     . GLY B 2 214 ? -29.568  -38.735 15.040  1.00 120.63 ? 213  GLY B N     1 
ATOM   5859 C  CA    . GLY B 2 214 ? -30.062  -38.967 13.682  1.00 120.18 ? 213  GLY B CA    1 
ATOM   5860 C  C     . GLY B 2 214 ? -31.102  -37.980 13.181  1.00 125.25 ? 213  GLY B C     1 
ATOM   5861 O  O     . GLY B 2 214 ? -31.279  -37.823 11.971  1.00 132.60 ? 213  GLY B O     1 
ATOM   5862 N  N     . LEU B 2 215 ? -31.787  -37.316 14.108  1.00 128.07 ? 214  LEU B N     1 
ATOM   5863 C  CA    . LEU B 2 215 ? -32.900  -36.426 13.769  1.00 120.16 ? 214  LEU B CA    1 
ATOM   5864 C  C     . LEU B 2 215 ? -32.455  -34.985 13.521  1.00 112.73 ? 214  LEU B C     1 
ATOM   5865 O  O     . LEU B 2 215 ? -31.411  -34.554 14.013  1.00 109.87 ? 214  LEU B O     1 
ATOM   5866 C  CB    . LEU B 2 215 ? -33.984  -36.473 14.859  1.00 113.80 ? 214  LEU B CB    1 
ATOM   5867 C  CG    . LEU B 2 215 ? -34.767  -37.768 15.150  1.00 116.30 ? 214  LEU B CG    1 
ATOM   5868 C  CD1   . LEU B 2 215 ? -35.269  -38.440 13.877  1.00 110.75 ? 214  LEU B CD1   1 
ATOM   5869 C  CD2   . LEU B 2 215 ? -33.970  -38.751 15.999  1.00 111.50 ? 214  LEU B CD2   1 
ATOM   5870 N  N     . THR B 2 216 ? -33.256  -34.249 12.753  1.00 115.32 ? 215  THR B N     1 
ATOM   5871 C  CA    . THR B 2 216 ? -32.966  -32.852 12.430  1.00 112.25 ? 215  THR B CA    1 
ATOM   5872 C  C     . THR B 2 216 ? -33.628  -31.905 13.426  1.00 97.26  ? 215  THR B C     1 
ATOM   5873 O  O     . THR B 2 216 ? -33.089  -30.844 13.742  1.00 93.40  ? 215  THR B O     1 
ATOM   5874 C  CB    . THR B 2 216 ? -33.423  -32.484 11.003  1.00 103.71 ? 215  THR B CB    1 
ATOM   5875 O  OG1   . THR B 2 216 ? -34.792  -32.867 10.819  1.00 97.66  ? 215  THR B OG1   1 
ATOM   5876 C  CG2   . THR B 2 216 ? -32.558  -33.182 9.960   1.00 89.61  ? 215  THR B CG2   1 
ATOM   5877 N  N     . GLY B 2 232 ? -33.389  -14.847 10.143  1.00 112.76 ? 231  GLY B N     1 
ATOM   5878 C  CA    . GLY B 2 232 ? -33.373  -13.898 11.250  1.00 101.98 ? 231  GLY B CA    1 
ATOM   5879 C  C     . GLY B 2 232 ? -34.437  -14.198 12.287  1.00 113.73 ? 231  GLY B C     1 
ATOM   5880 O  O     . GLY B 2 232 ? -35.372  -13.415 12.472  1.00 106.28 ? 231  GLY B O     1 
ATOM   5881 N  N     . TYR B 2 233 ? -34.291  -15.336 12.962  1.00 120.15 ? 232  TYR B N     1 
ATOM   5882 C  CA    . TYR B 2 233 ? -35.233  -15.758 13.995  1.00 118.39 ? 232  TYR B CA    1 
ATOM   5883 C  C     . TYR B 2 233 ? -34.527  -15.873 15.347  1.00 115.64 ? 232  TYR B C     1 
ATOM   5884 O  O     . TYR B 2 233 ? -33.941  -16.911 15.669  1.00 117.27 ? 232  TYR B O     1 
ATOM   5885 C  CB    . TYR B 2 233 ? -35.885  -17.096 13.616  1.00 113.00 ? 232  TYR B CB    1 
ATOM   5886 C  CG    . TYR B 2 233 ? -37.314  -17.277 14.099  1.00 116.09 ? 232  TYR B CG    1 
ATOM   5887 C  CD1   . TYR B 2 233 ? -37.678  -16.988 15.417  1.00 111.71 ? 232  TYR B CD1   1 
ATOM   5888 C  CD2   . TYR B 2 233 ? -38.298  -17.764 13.240  1.00 108.58 ? 232  TYR B CD2   1 
ATOM   5889 C  CE1   . TYR B 2 233 ? -38.983  -17.160 15.855  1.00 98.97  ? 232  TYR B CE1   1 
ATOM   5890 C  CE2   . TYR B 2 233 ? -39.605  -17.942 13.671  1.00 102.67 ? 232  TYR B CE2   1 
ATOM   5891 C  CZ    . TYR B 2 233 ? -39.941  -17.639 14.978  1.00 100.48 ? 232  TYR B CZ    1 
ATOM   5892 O  OH    . TYR B 2 233 ? -41.236  -17.813 15.409  1.00 104.20 ? 232  TYR B OH    1 
ATOM   5893 N  N     . GLU B 2 234 ? -34.583  -14.795 16.127  1.00 114.89 ? 233  GLU B N     1 
ATOM   5894 C  CA    . GLU B 2 234 ? -34.012  -14.766 17.477  1.00 108.44 ? 233  GLU B CA    1 
ATOM   5895 C  C     . GLU B 2 234 ? -34.798  -13.830 18.394  1.00 107.63 ? 233  GLU B C     1 
ATOM   5896 O  O     . GLU B 2 234 ? -35.093  -12.689 18.029  1.00 107.20 ? 233  GLU B O     1 
ATOM   5897 C  CB    . GLU B 2 234 ? -32.517  -14.408 17.451  1.00 113.82 ? 233  GLU B CB    1 
ATOM   5898 C  CG    . GLU B 2 234 ? -32.137  -13.250 16.536  1.00 112.41 ? 233  GLU B CG    1 
ATOM   5899 C  CD    . GLU B 2 234 ? -30.643  -13.173 16.267  1.00 109.33 ? 233  GLU B CD    1 
ATOM   5900 O  OE1   . GLU B 2 234 ? -29.848  -13.299 17.224  1.00 100.64 ? 233  GLU B OE1   1 
ATOM   5901 O  OE2   . GLU B 2 234 ? -30.263  -12.976 15.094  1.00 104.96 ? 233  GLU B OE2   1 
ATOM   5902 N  N     . LEU B 2 235 ? -35.130  -14.327 19.583  1.00 104.46 ? 234  LEU B N     1 
ATOM   5903 C  CA    . LEU B 2 235 ? -36.009  -13.618 20.515  1.00 107.00 ? 234  LEU B CA    1 
ATOM   5904 C  C     . LEU B 2 235 ? -35.257  -12.971 21.675  1.00 105.50 ? 234  LEU B C     1 
ATOM   5905 O  O     . LEU B 2 235 ? -34.184  -13.433 22.071  1.00 105.38 ? 234  LEU B O     1 
ATOM   5906 C  CB    . LEU B 2 235 ? -37.085  -14.566 21.062  1.00 98.53  ? 234  LEU B CB    1 
ATOM   5907 C  CG    . LEU B 2 235 ? -38.283  -14.944 20.182  1.00 95.44  ? 234  LEU B CG    1 
ATOM   5908 C  CD1   . LEU B 2 235 ? -37.908  -15.963 19.115  1.00 97.46  ? 234  LEU B CD1   1 
ATOM   5909 C  CD2   . LEU B 2 235 ? -39.409  -15.488 21.046  1.00 91.51  ? 234  LEU B CD2   1 
ATOM   5910 N  N     . HIS B 2 236 ? -35.837  -11.898 22.210  1.00 108.23 ? 235  HIS B N     1 
ATOM   5911 C  CA    . HIS B 2 236 ? -35.310  -11.221 23.392  1.00 106.55 ? 235  HIS B CA    1 
ATOM   5912 C  C     . HIS B 2 236 ? -36.417  -11.024 24.395  1.00 102.72 ? 235  HIS B C     1 
ATOM   5913 O  O     . HIS B 2 236 ? -37.188  -10.065 24.291  1.00 106.26 ? 235  HIS B O     1 
ATOM   5914 C  CB    . HIS B 2 236 ? -34.671  -9.885  23.018  1.00 104.79 ? 235  HIS B CB    1 
ATOM   5915 C  CG    . HIS B 2 236 ? -33.622  -9.990  21.935  1.00 108.42 ? 235  HIS B CG    1 
ATOM   5916 N  ND1   . HIS B 2 236 ? -32.363  -10.395 22.184  1.00 108.91 ? 235  HIS B ND1   1 
ATOM   5917 C  CD2   . HIS B 2 236 ? -33.687  -9.724  20.569  1.00 106.80 ? 235  HIS B CD2   1 
ATOM   5918 C  CE1   . HIS B 2 236 ? -31.657  -10.390 21.037  1.00 109.29 ? 235  HIS B CE1   1 
ATOM   5919 N  NE2   . HIS B 2 236 ? -32.469  -9.979  20.050  1.00 109.43 ? 235  HIS B NE2   1 
ATOM   5920 N  N     . PRO B 2 237 ? -36.522  -11.939 25.381  1.00 96.05  ? 236  PRO B N     1 
ATOM   5921 C  CA    . PRO B 2 237 ? -37.603  -11.893 26.372  1.00 93.34  ? 236  PRO B CA    1 
ATOM   5922 C  C     . PRO B 2 237 ? -37.461  -10.767 27.399  1.00 97.75  ? 236  PRO B C     1 
ATOM   5923 O  O     . PRO B 2 237 ? -38.451  -10.375 28.020  1.00 95.55  ? 236  PRO B O     1 
ATOM   5924 C  CB    . PRO B 2 237 ? -37.512  -13.259 27.057  1.00 93.14  ? 236  PRO B CB    1 
ATOM   5925 C  CG    . PRO B 2 237 ? -36.090  -13.666 26.899  1.00 98.29  ? 236  PRO B CG    1 
ATOM   5926 C  CD    . PRO B 2 237 ? -35.636  -13.102 25.584  1.00 97.43  ? 236  PRO B CD    1 
ATOM   5927 N  N     . ASP B 2 238 ? -36.242  -10.259 27.569  1.00 107.55 ? 237  ASP B N     1 
ATOM   5928 C  CA    . ASP B 2 238 ? -35.982  -9.136  28.471  1.00 102.69 ? 237  ASP B CA    1 
ATOM   5929 C  C     . ASP B 2 238 ? -36.406  -7.800  27.855  1.00 102.61 ? 237  ASP B C     1 
ATOM   5930 O  O     . ASP B 2 238 ? -36.577  -6.807  28.566  1.00 100.92 ? 237  ASP B O     1 
ATOM   5931 C  CB    . ASP B 2 238 ? -34.503  -9.096  28.881  1.00 96.28  ? 237  ASP B CB    1 
ATOM   5932 C  CG    . ASP B 2 238 ? -33.564  -8.890  27.698  1.00 105.72 ? 237  ASP B CG    1 
ATOM   5933 O  OD1   . ASP B 2 238 ? -33.771  -9.520  26.639  1.00 103.40 ? 237  ASP B OD1   1 
ATOM   5934 O  OD2   . ASP B 2 238 ? -32.607  -8.100  27.837  1.00 112.43 ? 237  ASP B OD2   1 
ATOM   5935 N  N     . LYS B 2 239 ? -36.576  -7.791  26.533  1.00 97.67  ? 238  LYS B N     1 
ATOM   5936 C  CA    . LYS B 2 239 ? -36.981  -6.592  25.798  1.00 95.55  ? 238  LYS B CA    1 
ATOM   5937 C  C     . LYS B 2 239 ? -38.501  -6.489  25.619  1.00 97.40  ? 238  LYS B C     1 
ATOM   5938 O  O     . LYS B 2 239 ? -38.990  -5.596  24.921  1.00 93.51  ? 238  LYS B O     1 
ATOM   5939 C  CB    . LYS B 2 239 ? -36.277  -6.532  24.437  1.00 97.83  ? 238  LYS B CB    1 
ATOM   5940 C  CG    . LYS B 2 239 ? -34.789  -6.222  24.513  1.00 107.46 ? 238  LYS B CG    1 
ATOM   5941 C  CD    . LYS B 2 239 ? -34.179  -6.104  23.125  1.00 112.22 ? 238  LYS B CD    1 
ATOM   5942 C  CE    . LYS B 2 239 ? -32.692  -5.798  23.199  1.00 113.79 ? 238  LYS B CE    1 
ATOM   5943 N  NZ    . LYS B 2 239 ? -32.082  -5.680  21.846  1.00 118.08 ? 238  LYS B NZ    1 
ATOM   5944 N  N     . TRP B 2 240 ? -39.241  -7.397  26.256  1.00 103.22 ? 239  TRP B N     1 
ATOM   5945 C  CA    . TRP B 2 240 ? -40.705  -7.396  26.190  1.00 100.00 ? 239  TRP B CA    1 
ATOM   5946 C  C     . TRP B 2 240 ? -41.342  -6.523  27.241  1.00 99.15  ? 239  TRP B C     1 
ATOM   5947 O  O     . TRP B 2 240 ? -42.521  -6.697  27.564  1.00 99.52  ? 239  TRP B O     1 
ATOM   5948 C  CB    . TRP B 2 240 ? -41.262  -8.817  26.298  1.00 99.67  ? 239  TRP B CB    1 
ATOM   5949 C  CG    . TRP B 2 240 ? -40.883  -9.748  25.168  1.00 105.07 ? 239  TRP B CG    1 
ATOM   5950 C  CD1   . TRP B 2 240 ? -40.461  -9.410  23.883  1.00 101.52 ? 239  TRP B CD1   1 
ATOM   5951 C  CD2   . TRP B 2 240 ? -40.922  -11.219 25.178  1.00 104.15 ? 239  TRP B CD2   1 
ATOM   5952 N  NE1   . TRP B 2 240 ? -40.223  -10.534 23.133  1.00 108.85 ? 239  TRP B NE1   1 
ATOM   5953 C  CE2   . TRP B 2 240 ? -40.481  -11.651 23.846  1.00 102.83 ? 239  TRP B CE2   1 
ATOM   5954 C  CE3   . TRP B 2 240 ? -41.255  -12.184 26.125  1.00 95.52  ? 239  TRP B CE3   1 
ATOM   5955 C  CZ2   . TRP B 2 240 ? -40.386  -12.992 23.502  1.00 96.30  ? 239  TRP B CZ2   1 
ATOM   5956 C  CZ3   . TRP B 2 240 ? -41.155  -13.534 25.765  1.00 93.78  ? 239  TRP B CZ3   1 
ATOM   5957 C  CH2   . TRP B 2 240 ? -40.731  -13.926 24.485  1.00 91.87  ? 239  TRP B CH2   1 
ATOM   5958 N  N     . THR B 2 241 ? -40.574  -5.576  27.779  1.00 104.12 ? 240  THR B N     1 
ATOM   5959 C  CA    . THR B 2 241 ? -41.055  -4.667  28.825  1.00 105.69 ? 240  THR B CA    1 
ATOM   5960 C  C     . THR B 2 241 ? -42.334  -3.944  28.404  1.00 107.39 ? 240  THR B C     1 
ATOM   5961 O  O     . THR B 2 241 ? -42.422  -3.412  27.294  1.00 105.33 ? 240  THR B O     1 
ATOM   5962 C  CB    . THR B 2 241 ? -39.985  -3.631  29.230  1.00 103.92 ? 240  THR B CB    1 
ATOM   5963 O  OG1   . THR B 2 241 ? -39.477  -2.977  28.061  1.00 107.47 ? 240  THR B OG1   1 
ATOM   5964 C  CG2   . THR B 2 241 ? -38.836  -4.303  29.974  1.00 90.24  ? 240  THR B CG2   1 
ATOM   5965 N  N     . VAL B 2 242 ? -43.318  -3.942  29.301  1.00 101.63 ? 241  VAL B N     1 
ATOM   5966 C  CA    . VAL B 2 242 ? -44.643  -3.382  29.027  1.00 101.96 ? 241  VAL B CA    1 
ATOM   5967 C  C     . VAL B 2 242 ? -44.589  -1.861  28.875  1.00 99.21  ? 241  VAL B C     1 
ATOM   5968 O  O     . VAL B 2 242 ? -44.186  -1.147  29.797  1.00 98.75  ? 241  VAL B O     1 
ATOM   5969 C  CB    . VAL B 2 242 ? -45.663  -3.776  30.124  1.00 98.28  ? 241  VAL B CB    1 
ATOM   5970 C  CG1   . VAL B 2 242 ? -47.028  -3.158  29.849  1.00 89.65  ? 241  VAL B CG1   1 
ATOM   5971 C  CG2   . VAL B 2 242 ? -45.782  -5.291  30.230  1.00 90.93  ? 241  VAL B CG2   1 
ATOM   5972 N  N     . GLN B 2 243 ? -44.992  -1.383  27.700  1.00 95.60  ? 242  GLN B N     1 
ATOM   5973 C  CA    . GLN B 2 243 ? -45.058  0.050   27.420  1.00 93.11  ? 242  GLN B CA    1 
ATOM   5974 C  C     . GLN B 2 243 ? -46.311  0.661   28.050  1.00 88.44  ? 242  GLN B C     1 
ATOM   5975 O  O     . GLN B 2 243 ? -47.416  0.152   27.850  1.00 93.30  ? 242  GLN B O     1 
ATOM   5976 C  CB    . GLN B 2 243 ? -45.027  0.312   25.910  1.00 92.72  ? 242  GLN B CB    1 
ATOM   5977 C  CG    . GLN B 2 243 ? -43.681  0.028   25.256  1.00 102.12 ? 242  GLN B CG    1 
ATOM   5978 C  CD    . GLN B 2 243 ? -43.687  0.265   23.756  1.00 107.82 ? 242  GLN B CD    1 
ATOM   5979 O  OE1   . GLN B 2 243 ? -44.594  -0.173  23.045  1.00 123.42 ? 242  GLN B OE1   1 
ATOM   5980 N  NE2   . GLN B 2 243 ? -42.663  0.953   23.264  1.00 85.07  ? 242  GLN B NE2   1 
ATOM   5981 N  N     . PRO B 2 244 ? -46.139  1.753   28.821  1.00 79.44  ? 243  PRO B N     1 
ATOM   5982 C  CA    . PRO B 2 244 ? -47.257  2.373   29.533  1.00 75.24  ? 243  PRO B CA    1 
ATOM   5983 C  C     . PRO B 2 244 ? -48.137  3.245   28.637  1.00 79.15  ? 243  PRO B C     1 
ATOM   5984 O  O     . PRO B 2 244 ? -47.694  3.696   27.577  1.00 80.41  ? 243  PRO B O     1 
ATOM   5985 C  CB    . PRO B 2 244 ? -46.560  3.233   30.589  1.00 78.16  ? 243  PRO B CB    1 
ATOM   5986 C  CG    . PRO B 2 244 ? -45.256  3.600   29.968  1.00 83.66  ? 243  PRO B CG    1 
ATOM   5987 C  CD    . PRO B 2 244 ? -44.865  2.454   29.075  1.00 82.77  ? 243  PRO B CD    1 
ATOM   5988 N  N     . ILE B 2 245 ? -49.374  3.471   29.073  1.00 77.27  ? 244  ILE B N     1 
ATOM   5989 C  CA    . ILE B 2 245 ? -50.314  4.333   28.361  1.00 74.95  ? 244  ILE B CA    1 
ATOM   5990 C  C     . ILE B 2 245 ? -50.060  5.788   28.756  1.00 70.11  ? 244  ILE B C     1 
ATOM   5991 O  O     . ILE B 2 245 ? -50.163  6.147   29.931  1.00 75.66  ? 244  ILE B O     1 
ATOM   5992 C  CB    . ILE B 2 245 ? -51.789  3.947   28.649  1.00 73.83  ? 244  ILE B CB    1 
ATOM   5993 C  CG1   . ILE B 2 245 ? -52.081  2.504   28.218  1.00 82.77  ? 244  ILE B CG1   1 
ATOM   5994 C  CG2   . ILE B 2 245 ? -52.751  4.894   27.944  1.00 65.58  ? 244  ILE B CG2   1 
ATOM   5995 C  CD1   . ILE B 2 245 ? -51.953  1.479   29.327  1.00 83.58  ? 244  ILE B CD1   1 
ATOM   5996 N  N     . VAL B 2 246 ? -49.717  6.615   27.770  1.00 65.44  ? 245  VAL B N     1 
ATOM   5997 C  CA    . VAL B 2 246 ? -49.448  8.036   28.010  1.00 68.61  ? 245  VAL B CA    1 
ATOM   5998 C  C     . VAL B 2 246 ? -50.599  8.930   27.546  1.00 68.73  ? 245  VAL B C     1 
ATOM   5999 O  O     . VAL B 2 246 ? -51.183  8.709   26.483  1.00 64.03  ? 245  VAL B O     1 
ATOM   6000 C  CB    . VAL B 2 246 ? -48.109  8.506   27.385  1.00 66.61  ? 245  VAL B CB    1 
ATOM   6001 C  CG1   . VAL B 2 246 ? -46.928  7.977   28.189  1.00 72.59  ? 245  VAL B CG1   1 
ATOM   6002 C  CG2   . VAL B 2 246 ? -47.997  8.096   25.921  1.00 65.51  ? 245  VAL B CG2   1 
ATOM   6003 N  N     . LEU B 2 247 ? -50.916  9.933   28.362  1.00 75.77  ? 246  LEU B N     1 
ATOM   6004 C  CA    . LEU B 2 247 ? -51.991  10.878  28.066  1.00 73.93  ? 246  LEU B CA    1 
ATOM   6005 C  C     . LEU B 2 247 ? -51.468  12.083  27.280  1.00 79.86  ? 246  LEU B C     1 
ATOM   6006 O  O     . LEU B 2 247 ? -50.309  12.471  27.452  1.00 87.53  ? 246  LEU B O     1 
ATOM   6007 C  CB    . LEU B 2 247 ? -52.676  11.333  29.362  1.00 69.13  ? 246  LEU B CB    1 
ATOM   6008 C  CG    . LEU B 2 247 ? -53.455  10.286  30.170  1.00 59.01  ? 246  LEU B CG    1 
ATOM   6009 C  CD1   . LEU B 2 247 ? -53.876  10.853  31.517  1.00 65.28  ? 246  LEU B CD1   1 
ATOM   6010 C  CD2   . LEU B 2 247 ? -54.666  9.771   29.404  1.00 58.19  ? 246  LEU B CD2   1 
ATOM   6011 N  N     . PRO B 2 248 ? -52.317  12.672  26.409  1.00 78.08  ? 247  PRO B N     1 
ATOM   6012 C  CA    . PRO B 2 248 ? -51.911  13.812  25.579  1.00 84.76  ? 247  PRO B CA    1 
ATOM   6013 C  C     . PRO B 2 248 ? -51.430  15.012  26.394  1.00 89.70  ? 247  PRO B C     1 
ATOM   6014 O  O     . PRO B 2 248 ? -52.163  15.525  27.245  1.00 87.43  ? 247  PRO B O     1 
ATOM   6015 C  CB    . PRO B 2 248 ? -53.193  14.166  24.815  1.00 83.07  ? 247  PRO B CB    1 
ATOM   6016 C  CG    . PRO B 2 248 ? -53.975  12.900  24.787  1.00 75.66  ? 247  PRO B CG    1 
ATOM   6017 C  CD    . PRO B 2 248 ? -53.698  12.247  26.108  1.00 77.70  ? 247  PRO B CD    1 
ATOM   6018 N  N     . GLU B 2 249 ? -50.196  15.438  26.132  1.00 97.52  ? 248  GLU B N     1 
ATOM   6019 C  CA    . GLU B 2 249 ? -49.610  16.600  26.791  1.00 93.29  ? 248  GLU B CA    1 
ATOM   6020 C  C     . GLU B 2 249 ? -49.954  17.857  25.994  1.00 91.66  ? 248  GLU B C     1 
ATOM   6021 O  O     . GLU B 2 249 ? -49.317  18.157  24.980  1.00 98.51  ? 248  GLU B O     1 
ATOM   6022 C  CB    . GLU B 2 249 ? -48.092  16.432  26.920  1.00 89.18  ? 248  GLU B CB    1 
ATOM   6023 C  CG    . GLU B 2 249 ? -47.458  17.234  28.049  1.00 83.44  ? 248  GLU B CG    1 
ATOM   6024 C  CD    . GLU B 2 249 ? -47.687  16.621  29.421  1.00 86.39  ? 248  GLU B CD    1 
ATOM   6025 O  OE1   . GLU B 2 249 ? -47.619  15.378  29.548  1.00 89.28  ? 248  GLU B OE1   1 
ATOM   6026 O  OE2   . GLU B 2 249 ? -47.927  17.386  30.378  1.00 79.54  ? 248  GLU B OE2   1 
ATOM   6027 N  N     . LYS B 2 250 ? -50.971  18.580  26.457  1.00 89.26  ? 249  LYS B N     1 
ATOM   6028 C  CA    . LYS B 2 250 ? -51.506  19.727  25.725  1.00 96.27  ? 249  LYS B CA    1 
ATOM   6029 C  C     . LYS B 2 250 ? -51.204  21.053  26.420  1.00 93.75  ? 249  LYS B C     1 
ATOM   6030 O  O     . LYS B 2 250 ? -51.233  21.145  27.650  1.00 88.43  ? 249  LYS B O     1 
ATOM   6031 C  CB    . LYS B 2 250 ? -53.017  19.563  25.519  1.00 83.82  ? 249  LYS B CB    1 
ATOM   6032 C  CG    . LYS B 2 250 ? -53.596  20.347  24.346  1.00 84.59  ? 249  LYS B CG    1 
ATOM   6033 C  CD    . LYS B 2 250 ? -53.233  19.739  22.995  1.00 94.85  ? 249  LYS B CD    1 
ATOM   6034 C  CE    . LYS B 2 250 ? -54.057  18.499  22.673  1.00 90.13  ? 249  LYS B CE    1 
ATOM   6035 N  NZ    . LYS B 2 250 ? -55.484  18.818  22.390  1.00 83.23  ? 249  LYS B NZ    1 
ATOM   6036 N  N     . ASP B 2 251 ? -50.917  22.075  25.615  1.00 93.96  ? 250  ASP B N     1 
ATOM   6037 C  CA    . ASP B 2 251 ? -50.623  23.416  26.115  1.00 95.28  ? 250  ASP B CA    1 
ATOM   6038 C  C     . ASP B 2 251 ? -51.905  24.175  26.464  1.00 88.45  ? 250  ASP B C     1 
ATOM   6039 O  O     . ASP B 2 251 ? -52.006  24.770  27.540  1.00 84.11  ? 250  ASP B O     1 
ATOM   6040 C  CB    . ASP B 2 251 ? -49.797  24.199  25.086  1.00 95.86  ? 250  ASP B CB    1 
ATOM   6041 C  CG    . ASP B 2 251 ? -49.256  25.509  25.638  1.00 106.62 ? 250  ASP B CG    1 
ATOM   6042 O  OD1   . ASP B 2 251 ? -48.656  25.501  26.735  1.00 107.57 ? 250  ASP B OD1   1 
ATOM   6043 O  OD2   . ASP B 2 251 ? -49.421  26.548  24.965  1.00 120.98 ? 250  ASP B OD2   1 
ATOM   6044 N  N     . SER B 2 252 ? -52.874  24.149  25.550  1.00 84.61  ? 251  SER B N     1 
ATOM   6045 C  CA    . SER B 2 252 ? -54.167  24.801  25.755  1.00 77.07  ? 251  SER B CA    1 
ATOM   6046 C  C     . SER B 2 252 ? -55.313  23.815  25.539  1.00 81.28  ? 251  SER B C     1 
ATOM   6047 O  O     . SER B 2 252 ? -55.402  23.173  24.490  1.00 83.65  ? 251  SER B O     1 
ATOM   6048 C  CB    . SER B 2 252 ? -54.316  26.012  24.830  1.00 74.22  ? 251  SER B CB    1 
ATOM   6049 O  OG    . SER B 2 252 ? -54.208  25.634  23.468  1.00 85.77  ? 251  SER B OG    1 
ATOM   6050 N  N     . TRP B 2 253 ? -56.187  23.708  26.537  1.00 76.34  ? 252  TRP B N     1 
ATOM   6051 C  CA    . TRP B 2 253 ? -57.278  22.733  26.521  1.00 73.86  ? 252  TRP B CA    1 
ATOM   6052 C  C     . TRP B 2 253 ? -58.595  23.339  26.132  1.00 70.54  ? 252  TRP B C     1 
ATOM   6053 O  O     . TRP B 2 253 ? -58.934  24.444  26.562  1.00 75.67  ? 252  TRP B O     1 
ATOM   6054 C  CB    . TRP B 2 253 ? -57.409  22.060  27.883  1.00 72.39  ? 252  TRP B CB    1 
ATOM   6055 C  CG    . TRP B 2 253 ? -56.217  21.219  28.273  1.00 71.56  ? 252  TRP B CG    1 
ATOM   6056 C  CD1   . TRP B 2 253 ? -54.998  21.658  28.787  1.00 81.04  ? 252  TRP B CD1   1 
ATOM   6057 C  CD2   . TRP B 2 253 ? -56.095  19.755  28.207  1.00 70.30  ? 252  TRP B CD2   1 
ATOM   6058 N  NE1   . TRP B 2 253 ? -54.158  20.601  29.028  1.00 85.27  ? 252  TRP B NE1   1 
ATOM   6059 C  CE2   . TRP B 2 253 ? -54.751  19.433  28.704  1.00 77.17  ? 252  TRP B CE2   1 
ATOM   6060 C  CE3   . TRP B 2 253 ? -56.929  18.719  27.798  1.00 68.47  ? 252  TRP B CE3   1 
ATOM   6061 C  CZ2   . TRP B 2 253 ? -54.288  18.126  28.778  1.00 74.60  ? 252  TRP B CZ2   1 
ATOM   6062 C  CZ3   . TRP B 2 253 ? -56.450  17.405  27.879  1.00 64.98  ? 252  TRP B CZ3   1 
ATOM   6063 C  CH2   . TRP B 2 253 ? -55.161  17.118  28.358  1.00 66.08  ? 252  TRP B CH2   1 
ATOM   6064 N  N     . THR B 2 254 ? -59.348  22.608  25.314  1.00 71.82  ? 253  THR B N     1 
ATOM   6065 C  CA    . THR B 2 254 ? -60.703  22.999  24.927  1.00 74.98  ? 253  THR B CA    1 
ATOM   6066 C  C     . THR B 2 254 ? -61.719  22.023  25.523  1.00 74.49  ? 253  THR B C     1 
ATOM   6067 O  O     . THR B 2 254 ? -61.341  20.958  26.017  1.00 77.13  ? 253  THR B O     1 
ATOM   6068 C  CB    . THR B 2 254 ? -60.871  23.054  23.393  1.00 73.52  ? 253  THR B CB    1 
ATOM   6069 O  OG1   . THR B 2 254 ? -60.561  21.775  22.825  1.00 72.85  ? 253  THR B OG1   1 
ATOM   6070 C  CG2   . THR B 2 254 ? -59.958  24.113  22.783  1.00 75.83  ? 253  THR B CG2   1 
ATOM   6071 N  N     . VAL B 2 255 ? -62.999  22.392  25.476  1.00 68.27  ? 254  VAL B N     1 
ATOM   6072 C  CA    . VAL B 2 255 ? -64.089  21.552  25.992  1.00 65.67  ? 254  VAL B CA    1 
ATOM   6073 C  C     . VAL B 2 255 ? -64.093  20.167  25.335  1.00 78.44  ? 254  VAL B C     1 
ATOM   6074 O  O     . VAL B 2 255 ? -64.253  19.152  26.018  1.00 81.37  ? 254  VAL B O     1 
ATOM   6075 C  CB    . VAL B 2 255 ? -65.468  22.241  25.829  1.00 63.37  ? 254  VAL B CB    1 
ATOM   6076 C  CG1   . VAL B 2 255 ? -66.610  21.288  26.158  1.00 60.49  ? 254  VAL B CG1   1 
ATOM   6077 C  CG2   . VAL B 2 255 ? -65.553  23.481  26.706  1.00 64.62  ? 254  VAL B CG2   1 
ATOM   6078 N  N     . ASN B 2 256 ? -63.899  20.140  24.017  1.00 74.96  ? 255  ASN B N     1 
ATOM   6079 C  CA    . ASN B 2 256 ? -63.843  18.893  23.252  1.00 74.08  ? 255  ASN B CA    1 
ATOM   6080 C  C     . ASN B 2 256 ? -62.678  17.989  23.659  1.00 79.08  ? 255  ASN B C     1 
ATOM   6081 O  O     . ASN B 2 256 ? -62.800  16.762  23.634  1.00 84.11  ? 255  ASN B O     1 
ATOM   6082 C  CB    . ASN B 2 256 ? -63.782  19.189  21.749  1.00 79.17  ? 255  ASN B CB    1 
ATOM   6083 C  CG    . ASN B 2 256 ? -63.976  17.947  20.897  1.00 78.42  ? 255  ASN B CG    1 
ATOM   6084 O  OD1   . ASN B 2 256 ? -63.103  17.579  20.113  1.00 77.38  ? 255  ASN B OD1   1 
ATOM   6085 N  ND2   . ASN B 2 256 ? -65.122  17.291  21.052  1.00 72.52  ? 255  ASN B ND2   1 
ATOM   6086 N  N     . ASP B 2 257 ? -61.556  18.604  24.032  1.00 76.83  ? 256  ASP B N     1 
ATOM   6087 C  CA    . ASP B 2 257 ? -60.372  17.873  24.487  1.00 82.96  ? 256  ASP B CA    1 
ATOM   6088 C  C     . ASP B 2 257 ? -60.582  17.229  25.858  1.00 76.09  ? 256  ASP B C     1 
ATOM   6089 O  O     . ASP B 2 257 ? -60.029  16.164  26.138  1.00 73.17  ? 256  ASP B O     1 
ATOM   6090 C  CB    . ASP B 2 257 ? -59.145  18.792  24.515  1.00 79.69  ? 256  ASP B CB    1 
ATOM   6091 C  CG    . ASP B 2 257 ? -58.697  19.220  23.125  1.00 80.10  ? 256  ASP B CG    1 
ATOM   6092 O  OD1   . ASP B 2 257 ? -58.796  18.410  22.177  1.00 76.43  ? 256  ASP B OD1   1 
ATOM   6093 O  OD2   . ASP B 2 257 ? -58.233  20.371  22.984  1.00 77.61  ? 256  ASP B OD2   1 
ATOM   6094 N  N     . ILE B 2 258 ? -61.379  17.882  26.703  1.00 72.63  ? 257  ILE B N     1 
ATOM   6095 C  CA    . ILE B 2 258 ? -61.721  17.350  28.024  1.00 68.43  ? 257  ILE B CA    1 
ATOM   6096 C  C     . ILE B 2 258 ? -62.752  16.225  27.899  1.00 66.67  ? 257  ILE B C     1 
ATOM   6097 O  O     . ILE B 2 258 ? -62.607  15.174  28.527  1.00 68.12  ? 257  ILE B O     1 
ATOM   6098 C  CB    . ILE B 2 258 ? -62.249  18.452  28.982  1.00 64.92  ? 257  ILE B CB    1 
ATOM   6099 C  CG1   . ILE B 2 258 ? -61.300  19.663  29.031  1.00 65.68  ? 257  ILE B CG1   1 
ATOM   6100 C  CG2   . ILE B 2 258 ? -62.503  17.889  30.379  1.00 60.33  ? 257  ILE B CG2   1 
ATOM   6101 C  CD1   . ILE B 2 258 ? -59.957  19.420  29.696  1.00 63.85  ? 257  ILE B CD1   1 
ATOM   6102 N  N     . GLN B 2 259 ? -63.778  16.450  27.078  1.00 69.42  ? 258  GLN B N     1 
ATOM   6103 C  CA    . GLN B 2 259 ? -64.870  15.488  26.884  1.00 70.73  ? 258  GLN B CA    1 
ATOM   6104 C  C     . GLN B 2 259 ? -64.402  14.138  26.335  1.00 77.34  ? 258  GLN B C     1 
ATOM   6105 O  O     . GLN B 2 259 ? -64.944  13.094  26.706  1.00 70.54  ? 258  GLN B O     1 
ATOM   6106 C  CB    . GLN B 2 259 ? -65.962  16.076  25.984  1.00 71.40  ? 258  GLN B CB    1 
ATOM   6107 C  CG    . GLN B 2 259 ? -66.843  17.113  26.667  1.00 64.43  ? 258  GLN B CG    1 
ATOM   6108 C  CD    . GLN B 2 259 ? -68.001  17.581  25.801  1.00 71.09  ? 258  GLN B CD    1 
ATOM   6109 O  OE1   . GLN B 2 259 ? -68.202  17.096  24.686  1.00 80.50  ? 258  GLN B OE1   1 
ATOM   6110 N  NE2   . GLN B 2 259 ? -68.775  18.529  26.318  1.00 67.24  ? 258  GLN B NE2   1 
ATOM   6111 N  N     . LYS B 2 260 ? -63.403  14.167  25.454  1.00 78.40  ? 259  LYS B N     1 
ATOM   6112 C  CA    . LYS B 2 260 ? -62.795  12.943  24.929  1.00 70.83  ? 259  LYS B CA    1 
ATOM   6113 C  C     . LYS B 2 260 ? -61.927  12.260  25.983  1.00 63.61  ? 259  LYS B C     1 
ATOM   6114 O  O     . LYS B 2 260 ? -61.842  11.032  26.023  1.00 64.79  ? 259  LYS B O     1 
ATOM   6115 C  CB    . LYS B 2 260 ? -61.963  13.231  23.676  1.00 75.25  ? 259  LYS B CB    1 
ATOM   6116 C  CG    . LYS B 2 260 ? -62.777  13.561  22.433  1.00 81.65  ? 259  LYS B CG    1 
ATOM   6117 C  CD    . LYS B 2 260 ? -62.006  13.263  21.151  1.00 79.97  ? 259  LYS B CD    1 
ATOM   6118 C  CE    . LYS B 2 260 ? -60.833  14.211  20.934  1.00 67.58  ? 259  LYS B CE    1 
ATOM   6119 N  NZ    . LYS B 2 260 ? -61.265  15.601  20.622  1.00 85.78  ? 259  LYS B NZ    1 
ATOM   6120 N  N     . LEU B 2 261 ? -61.288  13.066  26.830  1.00 64.71  ? 260  LEU B N     1 
ATOM   6121 C  CA    . LEU B 2 261 ? -60.417  12.563  27.891  1.00 58.46  ? 260  LEU B CA    1 
ATOM   6122 C  C     . LEU B 2 261 ? -61.220  11.912  29.019  1.00 57.80  ? 260  LEU B C     1 
ATOM   6123 O  O     . LEU B 2 261 ? -60.903  10.802  29.446  1.00 55.65  ? 260  LEU B O     1 
ATOM   6124 C  CB    . LEU B 2 261 ? -59.530  13.689  28.438  1.00 52.53  ? 260  LEU B CB    1 
ATOM   6125 C  CG    . LEU B 2 261 ? -58.326  13.326  29.316  1.00 50.57  ? 260  LEU B CG    1 
ATOM   6126 C  CD1   . LEU B 2 261 ? -57.186  12.747  28.488  1.00 47.43  ? 260  LEU B CD1   1 
ATOM   6127 C  CD2   . LEU B 2 261 ? -57.851  14.546  30.090  1.00 47.15  ? 260  LEU B CD2   1 
ATOM   6128 N  N     . VAL B 2 262 ? -62.259  12.605  29.485  1.00 65.24  ? 261  VAL B N     1 
ATOM   6129 C  CA    . VAL B 2 262 ? -63.127  12.109  30.561  1.00 58.96  ? 261  VAL B CA    1 
ATOM   6130 C  C     . VAL B 2 262 ? -63.790  10.781  30.182  1.00 61.06  ? 261  VAL B C     1 
ATOM   6131 O  O     . VAL B 2 262 ? -63.843  9.857   30.995  1.00 63.14  ? 261  VAL B O     1 
ATOM   6132 C  CB    . VAL B 2 262 ? -64.190  13.162  30.970  1.00 49.54  ? 261  VAL B CB    1 
ATOM   6133 C  CG1   . VAL B 2 262 ? -65.214  12.573  31.933  1.00 52.79  ? 261  VAL B CG1   1 
ATOM   6134 C  CG2   . VAL B 2 262 ? -63.524  14.378  31.599  1.00 51.06  ? 261  VAL B CG2   1 
ATOM   6135 N  N     . GLY B 2 263 ? -64.271  10.691  28.942  1.00 59.34  ? 262  GLY B N     1 
ATOM   6136 C  CA    . GLY B 2 263 ? -64.904  9.475   28.427  1.00 54.85  ? 262  GLY B CA    1 
ATOM   6137 C  C     . GLY B 2 263 ? -63.983  8.267   28.384  1.00 58.89  ? 262  GLY B C     1 
ATOM   6138 O  O     . GLY B 2 263 ? -64.417  7.141   28.635  1.00 58.28  ? 262  GLY B O     1 
ATOM   6139 N  N     . LYS B 2 264 ? -62.712  8.506   28.065  1.00 56.82  ? 263  LYS B N     1 
ATOM   6140 C  CA    . LYS B 2 264 ? -61.703  7.446   28.015  1.00 54.47  ? 263  LYS B CA    1 
ATOM   6141 C  C     . LYS B 2 264 ? -61.219  7.048   29.409  1.00 55.61  ? 263  LYS B C     1 
ATOM   6142 O  O     . LYS B 2 264 ? -60.979  5.868   29.673  1.00 57.32  ? 263  LYS B O     1 
ATOM   6143 C  CB    . LYS B 2 264 ? -60.513  7.871   27.148  1.00 50.31  ? 263  LYS B CB    1 
ATOM   6144 C  CG    . LYS B 2 264 ? -60.806  7.922   25.657  1.00 51.16  ? 263  LYS B CG    1 
ATOM   6145 C  CD    . LYS B 2 264 ? -59.640  8.527   24.891  1.00 59.71  ? 263  LYS B CD    1 
ATOM   6146 C  CE    . LYS B 2 264 ? -59.998  8.762   23.432  1.00 59.14  ? 263  LYS B CE    1 
ATOM   6147 N  NZ    . LYS B 2 264 ? -58.868  9.362   22.672  1.00 52.48  ? 263  LYS B NZ    1 
ATOM   6148 N  N     . LEU B 2 265 ? -61.079  8.037   30.291  1.00 57.55  ? 264  LEU B N     1 
ATOM   6149 C  CA    . LEU B 2 265 ? -60.597  7.811   31.656  1.00 54.88  ? 264  LEU B CA    1 
ATOM   6150 C  C     . LEU B 2 265 ? -61.644  7.158   32.560  1.00 59.26  ? 264  LEU B C     1 
ATOM   6151 O  O     . LEU B 2 265 ? -61.298  6.362   33.435  1.00 64.17  ? 264  LEU B O     1 
ATOM   6152 C  CB    . LEU B 2 265 ? -60.090  9.120   32.281  1.00 51.26  ? 264  LEU B CB    1 
ATOM   6153 C  CG    . LEU B 2 265 ? -58.627  9.578   32.118  1.00 57.96  ? 264  LEU B CG    1 
ATOM   6154 C  CD1   . LEU B 2 265 ? -57.661  8.674   32.873  1.00 58.16  ? 264  LEU B CD1   1 
ATOM   6155 C  CD2   . LEU B 2 265 ? -58.197  9.717   30.663  1.00 56.83  ? 264  LEU B CD2   1 
ATOM   6156 N  N     . ASN B 2 266 ? -62.915  7.499   32.346  1.00 60.19  ? 265  ASN B N     1 
ATOM   6157 C  CA    . ASN B 2 266 ? -64.023  6.902   33.099  1.00 58.01  ? 265  ASN B CA    1 
ATOM   6158 C  C     . ASN B 2 266 ? -64.206  5.419   32.781  1.00 62.67  ? 265  ASN B C     1 
ATOM   6159 O  O     . ASN B 2 266 ? -64.581  4.631   33.651  1.00 70.65  ? 265  ASN B O     1 
ATOM   6160 C  CB    . ASN B 2 266 ? -65.328  7.665   32.845  1.00 55.23  ? 265  ASN B CB    1 
ATOM   6161 C  CG    . ASN B 2 266 ? -66.482  7.156   33.693  1.00 56.29  ? 265  ASN B CG    1 
ATOM   6162 O  OD1   . ASN B 2 266 ? -66.343  6.950   34.900  1.00 60.88  ? 265  ASN B OD1   1 
ATOM   6163 N  ND2   . ASN B 2 266 ? -67.633  6.958   33.061  1.00 57.09  ? 265  ASN B ND2   1 
ATOM   6164 N  N     . TRP B 2 267 ? -63.942  5.052   31.528  1.00 58.94  ? 266  TRP B N     1 
ATOM   6165 C  CA    . TRP B 2 267 ? -63.965  3.657   31.096  1.00 57.70  ? 266  TRP B CA    1 
ATOM   6166 C  C     . TRP B 2 267 ? -62.777  2.907   31.636  1.00 59.01  ? 266  TRP B C     1 
ATOM   6167 O  O     . TRP B 2 267 ? -62.863  1.709   31.909  1.00 64.32  ? 266  TRP B O     1 
ATOM   6168 C  CB    . TRP B 2 267 ? -64.008  3.573   29.572  1.00 56.00  ? 266  TRP B CB    1 
ATOM   6169 C  CG    . TRP B 2 267 ? -63.927  2.165   29.029  1.00 54.30  ? 266  TRP B CG    1 
ATOM   6170 C  CD1   . TRP B 2 267 ? -64.978  1.285   28.784  1.00 56.25  ? 266  TRP B CD1   1 
ATOM   6171 C  CD2   . TRP B 2 267 ? -62.715  1.423   28.648  1.00 57.04  ? 266  TRP B CD2   1 
ATOM   6172 N  NE1   . TRP B 2 267 ? -64.514  0.090   28.294  1.00 59.68  ? 266  TRP B NE1   1 
ATOM   6173 C  CE2   . TRP B 2 267 ? -63.169  0.104   28.188  1.00 53.53  ? 266  TRP B CE2   1 
ATOM   6174 C  CE3   . TRP B 2 267 ? -61.353  1.707   28.644  1.00 49.26  ? 266  TRP B CE3   1 
ATOM   6175 C  CZ2   . TRP B 2 267 ? -62.280  -0.866  27.747  1.00 53.33  ? 266  TRP B CZ2   1 
ATOM   6176 C  CZ3   . TRP B 2 267 ? -60.467  0.719   28.196  1.00 55.48  ? 266  TRP B CZ3   1 
ATOM   6177 C  CH2   . TRP B 2 267 ? -60.921  -0.535  27.760  1.00 50.92  ? 266  TRP B CH2   1 
ATOM   6178 N  N     . ALA B 2 268 ? -61.660  3.614   31.799  1.00 55.83  ? 267  ALA B N     1 
ATOM   6179 C  CA    . ALA B 2 268 ? -60.417  3.022   32.294  1.00 56.33  ? 267  ALA B CA    1 
ATOM   6180 C  C     . ALA B 2 268 ? -60.370  2.913   33.822  1.00 61.77  ? 267  ALA B C     1 
ATOM   6181 O  O     . ALA B 2 268 ? -59.396  2.401   34.382  1.00 61.67  ? 267  ALA B O     1 
ATOM   6182 C  CB    . ALA B 2 268 ? -59.221  3.807   31.778  1.00 52.82  ? 267  ALA B CB    1 
ATOM   6183 N  N     . SER B 2 269 ? -61.423  3.389   34.485  1.00 62.70  ? 268  SER B N     1 
ATOM   6184 C  CA    . SER B 2 269 ? -61.513  3.357   35.947  1.00 62.41  ? 268  SER B CA    1 
ATOM   6185 C  C     . SER B 2 269 ? -61.693  1.941   36.495  1.00 71.01  ? 268  SER B C     1 
ATOM   6186 O  O     . SER B 2 269 ? -61.279  1.649   37.619  1.00 75.40  ? 268  SER B O     1 
ATOM   6187 C  CB    . SER B 2 269 ? -62.646  4.262   36.440  1.00 65.07  ? 268  SER B CB    1 
ATOM   6188 O  OG    . SER B 2 269 ? -63.913  3.764   36.045  1.00 77.37  ? 268  SER B OG    1 
ATOM   6189 N  N     . GLN B 2 270 ? -62.312  1.071   35.698  1.00 66.10  ? 269  GLN B N     1 
ATOM   6190 C  CA    . GLN B 2 270 ? -62.507  -0.331  36.075  1.00 72.80  ? 269  GLN B CA    1 
ATOM   6191 C  C     . GLN B 2 270 ? -61.228  -1.163  35.919  1.00 68.21  ? 269  GLN B C     1 
ATOM   6192 O  O     . GLN B 2 270 ? -61.105  -2.237  36.513  1.00 76.56  ? 269  GLN B O     1 
ATOM   6193 C  CB    . GLN B 2 270 ? -63.680  -0.956  35.305  1.00 74.98  ? 269  GLN B CB    1 
ATOM   6194 C  CG    . GLN B 2 270 ? -63.569  -0.896  33.786  1.00 67.67  ? 269  GLN B CG    1 
ATOM   6195 C  CD    . GLN B 2 270 ? -64.881  -1.198  33.081  1.00 66.77  ? 269  GLN B CD    1 
ATOM   6196 O  OE1   . GLN B 2 270 ? -65.710  -1.965  33.576  1.00 67.05  ? 269  GLN B OE1   1 
ATOM   6197 N  NE2   . GLN B 2 270 ? -65.072  -0.597  31.912  1.00 56.89  ? 269  GLN B NE2   1 
ATOM   6198 N  N     . ILE B 2 271 ? -60.288  -0.661  35.119  1.00 56.60  ? 270  ILE B N     1 
ATOM   6199 C  CA    . ILE B 2 271 ? -58.965  -1.273  34.987  1.00 62.00  ? 270  ILE B CA    1 
ATOM   6200 C  C     . ILE B 2 271 ? -58.039  -0.718  36.070  1.00 71.46  ? 270  ILE B C     1 
ATOM   6201 O  O     . ILE B 2 271 ? -57.468  -1.475  36.857  1.00 72.61  ? 270  ILE B O     1 
ATOM   6202 C  CB    . ILE B 2 271 ? -58.343  -1.035  33.590  1.00 63.27  ? 270  ILE B CB    1 
ATOM   6203 C  CG1   . ILE B 2 271 ? -59.323  -1.441  32.482  1.00 68.09  ? 270  ILE B CG1   1 
ATOM   6204 C  CG2   . ILE B 2 271 ? -57.027  -1.794  33.453  1.00 67.14  ? 270  ILE B CG2   1 
ATOM   6205 C  CD1   . ILE B 2 271 ? -58.980  -0.896  31.111  1.00 62.05  ? 270  ILE B CD1   1 
ATOM   6206 N  N     . TYR B 2 272 ? -57.902  0.607   36.098  1.00 72.27  ? 271  TYR B N     1 
ATOM   6207 C  CA    . TYR B 2 272 ? -57.109  1.294   37.113  1.00 69.82  ? 271  TYR B CA    1 
ATOM   6208 C  C     . TYR B 2 272 ? -58.041  2.036   38.074  1.00 71.18  ? 271  TYR B C     1 
ATOM   6209 O  O     . TYR B 2 272 ? -58.622  3.061   37.707  1.00 72.09  ? 271  TYR B O     1 
ATOM   6210 C  CB    . TYR B 2 272 ? -56.118  2.268   36.466  1.00 67.68  ? 271  TYR B CB    1 
ATOM   6211 C  CG    . TYR B 2 272 ? -55.175  1.643   35.458  1.00 69.72  ? 271  TYR B CG    1 
ATOM   6212 C  CD1   . TYR B 2 272 ? -53.972  1.064   35.864  1.00 76.61  ? 271  TYR B CD1   1 
ATOM   6213 C  CD2   . TYR B 2 272 ? -55.480  1.641   34.097  1.00 68.01  ? 271  TYR B CD2   1 
ATOM   6214 C  CE1   . TYR B 2 272 ? -53.104  0.493   34.945  1.00 76.75  ? 271  TYR B CE1   1 
ATOM   6215 C  CE2   . TYR B 2 272 ? -54.619  1.073   33.170  1.00 70.95  ? 271  TYR B CE2   1 
ATOM   6216 C  CZ    . TYR B 2 272 ? -53.432  0.501   33.600  1.00 74.89  ? 271  TYR B CZ    1 
ATOM   6217 O  OH    . TYR B 2 272 ? -52.574  -0.063  32.685  1.00 80.21  ? 271  TYR B OH    1 
ATOM   6218 N  N     . PRO B 2 273 ? -58.191  1.515   39.309  1.00 73.61  ? 272  PRO B N     1 
ATOM   6219 C  CA    . PRO B 2 273 ? -59.133  2.057   40.296  1.00 73.06  ? 272  PRO B CA    1 
ATOM   6220 C  C     . PRO B 2 273 ? -58.752  3.436   40.838  1.00 71.42  ? 272  PRO B C     1 
ATOM   6221 O  O     . PRO B 2 273 ? -59.613  4.148   41.359  1.00 64.46  ? 272  PRO B O     1 
ATOM   6222 C  CB    . PRO B 2 273 ? -59.093  1.023   41.431  1.00 73.48  ? 272  PRO B CB    1 
ATOM   6223 C  CG    . PRO B 2 273 ? -58.443  -0.191  40.853  1.00 69.06  ? 272  PRO B CG    1 
ATOM   6224 C  CD    . PRO B 2 273 ? -57.484  0.334   39.832  1.00 71.76  ? 272  PRO B CD    1 
ATOM   6225 N  N     . GLY B 2 274 ? -57.478  3.801   40.713  1.00 70.75  ? 273  GLY B N     1 
ATOM   6226 C  CA    . GLY B 2 274 ? -56.977  5.080   41.218  1.00 71.36  ? 273  GLY B CA    1 
ATOM   6227 C  C     . GLY B 2 274 ? -57.399  6.296   40.411  1.00 69.44  ? 273  GLY B C     1 
ATOM   6228 O  O     . GLY B 2 274 ? -57.328  7.425   40.904  1.00 71.66  ? 273  GLY B O     1 
ATOM   6229 N  N     . ILE B 2 275 ? -57.835  6.067   39.173  1.00 65.49  ? 274  ILE B N     1 
ATOM   6230 C  CA    . ILE B 2 275 ? -58.239  7.146   38.268  1.00 61.87  ? 274  ILE B CA    1 
ATOM   6231 C  C     . ILE B 2 275 ? -59.572  7.780   38.678  1.00 65.48  ? 274  ILE B C     1 
ATOM   6232 O  O     . ILE B 2 275 ? -60.552  7.080   38.949  1.00 66.20  ? 274  ILE B O     1 
ATOM   6233 C  CB    . ILE B 2 275 ? -58.257  6.674   36.789  1.00 58.32  ? 274  ILE B CB    1 
ATOM   6234 C  CG1   . ILE B 2 275 ? -56.894  6.915   36.130  1.00 59.77  ? 274  ILE B CG1   1 
ATOM   6235 C  CG2   . ILE B 2 275 ? -59.315  7.407   35.975  1.00 64.68  ? 274  ILE B CG2   1 
ATOM   6236 C  CD1   . ILE B 2 275 ? -55.833  5.885   36.453  1.00 64.05  ? 274  ILE B CD1   1 
ATOM   6237 N  N     . LYS B 2 276 ? -59.580  9.111   38.737  1.00 64.27  ? 275  LYS B N     1 
ATOM   6238 C  CA    . LYS B 2 276 ? -60.783  9.887   39.035  1.00 67.01  ? 275  LYS B CA    1 
ATOM   6239 C  C     . LYS B 2 276 ? -60.938  11.044  38.050  1.00 66.48  ? 275  LYS B C     1 
ATOM   6240 O  O     . LYS B 2 276 ? -59.946  11.614  37.589  1.00 65.50  ? 275  LYS B O     1 
ATOM   6241 C  CB    . LYS B 2 276 ? -60.747  10.417  40.472  1.00 69.31  ? 275  LYS B CB    1 
ATOM   6242 C  CG    . LYS B 2 276 ? -60.949  9.350   41.537  1.00 73.29  ? 275  LYS B CG    1 
ATOM   6243 C  CD    . LYS B 2 276 ? -60.923  9.949   42.934  1.00 87.65  ? 275  LYS B CD    1 
ATOM   6244 C  CE    . LYS B 2 276 ? -61.053  8.874   44.002  1.00 90.45  ? 275  LYS B CE    1 
ATOM   6245 N  NZ    . LYS B 2 276 ? -62.402  8.242   44.024  1.00 81.29  ? 275  LYS B NZ    1 
ATOM   6246 N  N     . VAL B 2 277 ? -62.186  11.380  37.735  1.00 68.27  ? 276  VAL B N     1 
ATOM   6247 C  CA    . VAL B 2 277 ? -62.496  12.445  36.773  1.00 60.43  ? 276  VAL B CA    1 
ATOM   6248 C  C     . VAL B 2 277 ? -63.322  13.578  37.394  1.00 67.97  ? 276  VAL B C     1 
ATOM   6249 O  O     . VAL B 2 277 ? -63.853  14.433  36.679  1.00 68.37  ? 276  VAL B O     1 
ATOM   6250 C  CB    . VAL B 2 277 ? -63.220  11.897  35.515  1.00 58.03  ? 276  VAL B CB    1 
ATOM   6251 C  CG1   . VAL B 2 277 ? -62.288  11.016  34.695  1.00 58.22  ? 276  VAL B CG1   1 
ATOM   6252 C  CG2   . VAL B 2 277 ? -64.491  11.145  35.893  1.00 58.48  ? 276  VAL B CG2   1 
ATOM   6253 N  N     . ARG B 2 278 ? -63.408  13.583  38.724  1.00 69.53  ? 277  ARG B N     1 
ATOM   6254 C  CA    . ARG B 2 278 ? -64.265  14.514  39.464  1.00 70.41  ? 277  ARG B CA    1 
ATOM   6255 C  C     . ARG B 2 278 ? -63.907  15.989  39.254  1.00 68.81  ? 277  ARG B C     1 
ATOM   6256 O  O     . ARG B 2 278 ? -64.794  16.819  39.045  1.00 65.95  ? 277  ARG B O     1 
ATOM   6257 C  CB    . ARG B 2 278 ? -64.257  14.171  40.959  1.00 78.27  ? 277  ARG B CB    1 
ATOM   6258 C  CG    . ARG B 2 278 ? -65.398  14.793  41.753  1.00 76.96  ? 277  ARG B CG    1 
ATOM   6259 C  CD    . ARG B 2 278 ? -65.330  14.430  43.230  1.00 84.81  ? 277  ARG B CD    1 
ATOM   6260 N  NE    . ARG B 2 278 ? -65.703  13.039  43.487  1.00 97.56  ? 277  ARG B NE    1 
ATOM   6261 C  CZ    . ARG B 2 278 ? -64.843  12.057  43.752  1.00 102.57 ? 277  ARG B CZ    1 
ATOM   6262 N  NH1   . ARG B 2 278 ? -63.538  12.297  43.804  1.00 95.58  ? 277  ARG B NH1   1 
ATOM   6263 N  NH2   . ARG B 2 278 ? -65.291  10.828  43.969  1.00 94.92  ? 277  ARG B NH2   1 
ATOM   6264 N  N     . GLN B 2 279 ? -62.614  16.305  39.310  1.00 68.03  ? 278  GLN B N     1 
ATOM   6265 C  CA    . GLN B 2 279 ? -62.148  17.685  39.156  1.00 77.17  ? 278  GLN B CA    1 
ATOM   6266 C  C     . GLN B 2 279 ? -62.160  18.152  37.700  1.00 67.26  ? 278  GLN B C     1 
ATOM   6267 O  O     . GLN B 2 279 ? -62.293  19.348  37.429  1.00 64.67  ? 278  GLN B O     1 
ATOM   6268 C  CB    . GLN B 2 279 ? -60.751  17.869  39.765  1.00 75.76  ? 278  GLN B CB    1 
ATOM   6269 C  CG    . GLN B 2 279 ? -60.676  17.659  41.274  1.00 73.57  ? 278  GLN B CG    1 
ATOM   6270 C  CD    . GLN B 2 279 ? -61.507  18.655  42.070  1.00 80.99  ? 278  GLN B CD    1 
ATOM   6271 O  OE1   . GLN B 2 279 ? -61.659  19.815  41.683  1.00 85.16  ? 278  GLN B OE1   1 
ATOM   6272 N  NE2   . GLN B 2 279 ? -62.045  18.202  43.197  1.00 83.86  ? 278  GLN B NE2   1 
ATOM   6273 N  N     . LEU B 2 280 ? -62.019  17.205  36.775  1.00 66.46  ? 279  LEU B N     1 
ATOM   6274 C  CA    . LEU B 2 280 ? -62.066  17.498  35.342  1.00 61.79  ? 279  LEU B CA    1 
ATOM   6275 C  C     . LEU B 2 280 ? -63.490  17.788  34.868  1.00 61.12  ? 279  LEU B C     1 
ATOM   6276 O  O     . LEU B 2 280 ? -63.692  18.554  33.924  1.00 59.22  ? 279  LEU B O     1 
ATOM   6277 C  CB    . LEU B 2 280 ? -61.459  16.348  34.530  1.00 61.72  ? 279  LEU B CB    1 
ATOM   6278 C  CG    . LEU B 2 280 ? -59.940  16.143  34.593  1.00 60.17  ? 279  LEU B CG    1 
ATOM   6279 C  CD1   . LEU B 2 280 ? -59.573  14.738  34.140  1.00 62.97  ? 279  LEU B CD1   1 
ATOM   6280 C  CD2   . LEU B 2 280 ? -59.196  17.186  33.769  1.00 47.21  ? 279  LEU B CD2   1 
ATOM   6281 N  N     . CYS B 2 281 ? -64.467  17.169  35.529  1.00 65.05  ? 280  CYS B N     1 
ATOM   6282 C  CA    . CYS B 2 281 ? -65.882  17.378  35.217  1.00 70.74  ? 280  CYS B CA    1 
ATOM   6283 C  C     . CYS B 2 281 ? -66.410  18.702  35.767  1.00 68.21  ? 280  CYS B C     1 
ATOM   6284 O  O     . CYS B 2 281 ? -67.370  19.262  35.230  1.00 62.51  ? 280  CYS B O     1 
ATOM   6285 C  CB    . CYS B 2 281 ? -66.727  16.214  35.738  1.00 82.93  ? 280  CYS B CB    1 
ATOM   6286 S  SG    . CYS B 2 281 ? -66.539  14.682  34.797  1.00 61.05  ? 280  CYS B SG    1 
ATOM   6287 N  N     . LYS B 2 282 ? -65.782  19.195  36.833  1.00 70.39  ? 281  LYS B N     1 
ATOM   6288 C  CA    . LYS B 2 282 ? -66.149  20.482  37.429  1.00 71.18  ? 281  LYS B CA    1 
ATOM   6289 C  C     . LYS B 2 282 ? -65.662  21.672  36.597  1.00 67.70  ? 281  LYS B C     1 
ATOM   6290 O  O     . LYS B 2 282 ? -66.073  22.812  36.834  1.00 69.80  ? 281  LYS B O     1 
ATOM   6291 C  CB    . LYS B 2 282 ? -65.641  20.586  38.871  1.00 75.70  ? 281  LYS B CB    1 
ATOM   6292 C  CG    . LYS B 2 282 ? -66.497  19.835  39.883  1.00 82.89  ? 281  LYS B CG    1 
ATOM   6293 C  CD    . LYS B 2 282 ? -66.231  20.292  41.311  1.00 94.02  ? 281  LYS B CD    1 
ATOM   6294 C  CE    . LYS B 2 282 ? -65.013  19.608  41.913  1.00 87.48  ? 281  LYS B CE    1 
ATOM   6295 N  NZ    . LYS B 2 282 ? -64.750  20.068  43.304  1.00 85.10  ? 281  LYS B NZ    1 
ATOM   6296 N  N     . LEU B 2 283 ? -64.790  21.398  35.629  1.00 65.67  ? 282  LEU B N     1 
ATOM   6297 C  CA    . LEU B 2 283 ? -64.335  22.407  34.672  1.00 62.71  ? 282  LEU B CA    1 
ATOM   6298 C  C     . LEU B 2 283 ? -65.451  22.778  33.697  1.00 65.51  ? 282  LEU B C     1 
ATOM   6299 O  O     . LEU B 2 283 ? -65.518  23.916  33.225  1.00 70.56  ? 282  LEU B O     1 
ATOM   6300 C  CB    . LEU B 2 283 ? -63.103  21.913  33.904  1.00 59.57  ? 282  LEU B CB    1 
ATOM   6301 C  CG    . LEU B 2 283 ? -61.780  21.747  34.661  1.00 60.57  ? 282  LEU B CG    1 
ATOM   6302 C  CD1   . LEU B 2 283 ? -60.825  20.863  33.874  1.00 63.95  ? 282  LEU B CD1   1 
ATOM   6303 C  CD2   . LEU B 2 283 ? -61.135  23.090  34.974  1.00 60.86  ? 282  LEU B CD2   1 
ATOM   6304 N  N     . LEU B 2 284 ? -66.318  21.812  33.400  1.00 63.18  ? 283  LEU B N     1 
ATOM   6305 C  CA    . LEU B 2 284 ? -67.482  22.042  32.548  1.00 60.57  ? 283  LEU B CA    1 
ATOM   6306 C  C     . LEU B 2 284 ? -68.699  22.407  33.395  1.00 65.88  ? 283  LEU B C     1 
ATOM   6307 O  O     . LEU B 2 284 ? -69.348  21.536  33.980  1.00 72.66  ? 283  LEU B O     1 
ATOM   6308 C  CB    . LEU B 2 284 ? -67.792  20.814  31.674  1.00 58.43  ? 283  LEU B CB    1 
ATOM   6309 C  CG    . LEU B 2 284 ? -66.779  20.218  30.681  1.00 55.43  ? 283  LEU B CG    1 
ATOM   6310 C  CD1   . LEU B 2 284 ? -65.995  21.287  29.929  1.00 54.70  ? 283  LEU B CD1   1 
ATOM   6311 C  CD2   . LEU B 2 284 ? -65.836  19.241  31.370  1.00 49.49  ? 283  LEU B CD2   1 
ATOM   6312 N  N     . ARG B 2 285 ? -68.989  23.703  33.463  1.00 68.50  ? 284  ARG B N     1 
ATOM   6313 C  CA    . ARG B 2 285 ? -70.147  24.204  34.198  1.00 68.31  ? 284  ARG B CA    1 
ATOM   6314 C  C     . ARG B 2 285 ? -71.160  24.811  33.231  1.00 70.07  ? 284  ARG B C     1 
ATOM   6315 O  O     . ARG B 2 285 ? -70.919  25.869  32.645  1.00 65.46  ? 284  ARG B O     1 
ATOM   6316 C  CB    . ARG B 2 285 ? -69.723  25.231  35.253  1.00 73.93  ? 284  ARG B CB    1 
ATOM   6317 C  CG    . ARG B 2 285 ? -68.929  24.648  36.412  1.00 75.21  ? 284  ARG B CG    1 
ATOM   6318 C  CD    . ARG B 2 285 ? -68.505  25.728  37.394  1.00 95.68  ? 284  ARG B CD    1 
ATOM   6319 N  NE    . ARG B 2 285 ? -67.713  25.186  38.497  1.00 121.03 ? 284  ARG B NE    1 
ATOM   6320 C  CZ    . ARG B 2 285 ? -67.206  25.909  39.493  1.00 119.04 ? 284  ARG B CZ    1 
ATOM   6321 N  NH1   . ARG B 2 285 ? -67.401  27.221  39.543  1.00 105.74 ? 284  ARG B NH1   1 
ATOM   6322 N  NH2   . ARG B 2 285 ? -66.500  25.315  40.446  1.00 109.43 ? 284  ARG B NH2   1 
ATOM   6323 N  N     . GLY B 2 286 ? -72.289  24.126  33.063  1.00 70.04  ? 285  GLY B N     1 
ATOM   6324 C  CA    . GLY B 2 286 ? -73.334  24.564  32.141  1.00 69.19  ? 285  GLY B CA    1 
ATOM   6325 C  C     . GLY B 2 286 ? -72.990  24.303  30.685  1.00 68.51  ? 285  GLY B C     1 
ATOM   6326 O  O     . GLY B 2 286 ? -71.923  23.766  30.376  1.00 67.14  ? 285  GLY B O     1 
ATOM   6327 N  N     . THR B 2 287 ? -73.897  24.692  29.791  1.00 65.19  ? 286  THR B N     1 
ATOM   6328 C  CA    . THR B 2 287 ? -73.721  24.471  28.352  1.00 63.12  ? 286  THR B CA    1 
ATOM   6329 C  C     . THR B 2 287 ? -72.588  25.316  27.761  1.00 66.58  ? 286  THR B C     1 
ATOM   6330 O  O     . THR B 2 287 ? -72.547  26.536  27.941  1.00 79.39  ? 286  THR B O     1 
ATOM   6331 C  CB    . THR B 2 287 ? -75.044  24.661  27.565  1.00 66.68  ? 286  THR B CB    1 
ATOM   6332 O  OG1   . THR B 2 287 ? -74.804  24.488  26.162  1.00 69.45  ? 286  THR B OG1   1 
ATOM   6333 C  CG2   . THR B 2 287 ? -75.659  26.041  27.816  1.00 81.11  ? 286  THR B CG2   1 
ATOM   6334 N  N     . LYS B 2 288 ? -71.665  24.649  27.071  1.00 60.52  ? 287  LYS B N     1 
ATOM   6335 C  CA    . LYS B 2 288 ? -70.493  25.301  26.485  1.00 67.01  ? 287  LYS B CA    1 
ATOM   6336 C  C     . LYS B 2 288 ? -70.160  24.741  25.103  1.00 70.28  ? 287  LYS B C     1 
ATOM   6337 O  O     . LYS B 2 288 ? -70.422  23.570  24.819  1.00 70.33  ? 287  LYS B O     1 
ATOM   6338 C  CB    . LYS B 2 288 ? -69.278  25.155  27.409  1.00 68.68  ? 287  LYS B CB    1 
ATOM   6339 C  CG    . LYS B 2 288 ? -69.235  26.143  28.564  1.00 75.28  ? 287  LYS B CG    1 
ATOM   6340 C  CD    . LYS B 2 288 ? -68.068  25.850  29.496  1.00 75.40  ? 287  LYS B CD    1 
ATOM   6341 C  CE    . LYS B 2 288 ? -67.808  26.998  30.461  1.00 76.08  ? 287  LYS B CE    1 
ATOM   6342 N  NZ    . LYS B 2 288 ? -68.922  27.217  31.426  1.00 64.91  ? 287  LYS B NZ    1 
ATOM   6343 N  N     . ALA B 2 289 ? -69.580  25.586  24.254  1.00 69.86  ? 288  ALA B N     1 
ATOM   6344 C  CA    . ALA B 2 289 ? -69.137  25.179  22.920  1.00 68.70  ? 288  ALA B CA    1 
ATOM   6345 C  C     . ALA B 2 289 ? -67.893  24.296  23.005  1.00 70.98  ? 288  ALA B C     1 
ATOM   6346 O  O     . ALA B 2 289 ? -67.126  24.394  23.961  1.00 77.94  ? 288  ALA B O     1 
ATOM   6347 C  CB    . ALA B 2 289 ? -68.867  26.402  22.056  1.00 78.39  ? 288  ALA B CB    1 
ATOM   6348 N  N     . LEU B 2 290 ? -67.702  23.439  22.003  1.00 68.33  ? 289  LEU B N     1 
ATOM   6349 C  CA    . LEU B 2 290 ? -66.571  22.505  21.975  1.00 71.81  ? 289  LEU B CA    1 
ATOM   6350 C  C     . LEU B 2 290 ? -65.218  23.200  21.807  1.00 76.35  ? 289  LEU B C     1 
ATOM   6351 O  O     . LEU B 2 290 ? -64.203  22.725  22.323  1.00 77.42  ? 289  LEU B O     1 
ATOM   6352 C  CB    . LEU B 2 290 ? -66.754  21.448  20.875  1.00 77.96  ? 289  LEU B CB    1 
ATOM   6353 C  CG    . LEU B 2 290 ? -67.710  20.253  21.045  1.00 75.62  ? 289  LEU B CG    1 
ATOM   6354 C  CD1   . LEU B 2 290 ? -67.525  19.544  22.382  1.00 79.00  ? 289  LEU B CD1   1 
ATOM   6355 C  CD2   . LEU B 2 290 ? -69.166  20.650  20.846  1.00 54.15  ? 289  LEU B CD2   1 
ATOM   6356 N  N     . THR B 2 291 ? -65.214  24.319  21.086  1.00 79.58  ? 290  THR B N     1 
ATOM   6357 C  CA    . THR B 2 291 ? -63.991  25.081  20.823  1.00 77.27  ? 290  THR B CA    1 
ATOM   6358 C  C     . THR B 2 291 ? -63.586  25.948  22.022  1.00 81.41  ? 290  THR B C     1 
ATOM   6359 O  O     . THR B 2 291 ? -62.433  26.380  22.122  1.00 86.06  ? 290  THR B O     1 
ATOM   6360 C  CB    . THR B 2 291 ? -64.139  25.966  19.564  1.00 76.06  ? 290  THR B CB    1 
ATOM   6361 O  OG1   . THR B 2 291 ? -64.887  25.265  18.562  1.00 78.07  ? 290  THR B OG1   1 
ATOM   6362 C  CG2   . THR B 2 291 ? -62.773  26.341  18.996  1.00 82.06  ? 290  THR B CG2   1 
ATOM   6363 N  N     . GLU B 2 292 ? -64.536  26.188  22.926  1.00 76.93  ? 291  GLU B N     1 
ATOM   6364 C  CA    . GLU B 2 292 ? -64.319  27.027  24.109  1.00 81.22  ? 291  GLU B CA    1 
ATOM   6365 C  C     . GLU B 2 292 ? -63.128  26.550  24.945  1.00 75.93  ? 291  GLU B C     1 
ATOM   6366 O  O     . GLU B 2 292 ? -63.078  25.394  25.372  1.00 80.13  ? 291  GLU B O     1 
ATOM   6367 C  CB    . GLU B 2 292 ? -65.592  27.086  24.960  1.00 86.70  ? 291  GLU B CB    1 
ATOM   6368 C  CG    . GLU B 2 292 ? -65.614  28.208  25.988  1.00 93.07  ? 291  GLU B CG    1 
ATOM   6369 C  CD    . GLU B 2 292 ? -66.967  28.383  26.656  1.00 96.66  ? 291  GLU B CD    1 
ATOM   6370 O  OE1   . GLU B 2 292 ? -67.999  28.039  26.040  1.00 92.26  ? 291  GLU B OE1   1 
ATOM   6371 O  OE2   . GLU B 2 292 ? -66.998  28.878  27.802  1.00 92.65  ? 291  GLU B OE2   1 
ATOM   6372 N  N     . VAL B 2 293 ? -62.177  27.455  25.166  1.00 73.37  ? 292  VAL B N     1 
ATOM   6373 C  CA    . VAL B 2 293 ? -60.918  27.134  25.843  1.00 74.07  ? 292  VAL B CA    1 
ATOM   6374 C  C     . VAL B 2 293 ? -61.065  27.185  27.366  1.00 72.73  ? 292  VAL B C     1 
ATOM   6375 O  O     . VAL B 2 293 ? -61.310  28.247  27.940  1.00 78.02  ? 292  VAL B O     1 
ATOM   6376 C  CB    . VAL B 2 293 ? -59.772  28.071  25.384  1.00 70.19  ? 292  VAL B CB    1 
ATOM   6377 C  CG1   . VAL B 2 293 ? -58.471  27.739  26.104  1.00 54.96  ? 292  VAL B CG1   1 
ATOM   6378 C  CG2   . VAL B 2 293 ? -59.577  27.984  23.877  1.00 77.32  ? 292  VAL B CG2   1 
ATOM   6379 N  N     . ILE B 2 294 ? -60.906  26.029  28.008  1.00 69.76  ? 293  ILE B N     1 
ATOM   6380 C  CA    . ILE B 2 294 ? -61.009  25.924  29.464  1.00 66.45  ? 293  ILE B CA    1 
ATOM   6381 C  C     . ILE B 2 294 ? -59.620  25.856  30.107  1.00 71.75  ? 293  ILE B C     1 
ATOM   6382 O  O     . ILE B 2 294 ? -58.848  24.936  29.820  1.00 66.08  ? 293  ILE B O     1 
ATOM   6383 C  CB    . ILE B 2 294 ? -61.853  24.696  29.897  1.00 64.70  ? 293  ILE B CB    1 
ATOM   6384 C  CG1   . ILE B 2 294 ? -63.267  24.746  29.290  1.00 64.34  ? 293  ILE B CG1   1 
ATOM   6385 C  CG2   . ILE B 2 294 ? -61.897  24.562  31.417  1.00 65.90  ? 293  ILE B CG2   1 
ATOM   6386 C  CD1   . ILE B 2 294 ? -64.150  25.885  29.767  1.00 74.08  ? 293  ILE B CD1   1 
ATOM   6387 N  N     . PRO B 2 295 ? -59.295  26.839  30.970  1.00 79.66  ? 294  PRO B N     1 
ATOM   6388 C  CA    . PRO B 2 295 ? -58.048  26.810  31.735  1.00 70.52  ? 294  PRO B CA    1 
ATOM   6389 C  C     . PRO B 2 295 ? -58.121  25.796  32.874  1.00 70.55  ? 294  PRO B C     1 
ATOM   6390 O  O     . PRO B 2 295 ? -59.166  25.661  33.516  1.00 72.17  ? 294  PRO B O     1 
ATOM   6391 C  CB    . PRO B 2 295 ? -57.940  28.235  32.302  1.00 63.66  ? 294  PRO B CB    1 
ATOM   6392 C  CG    . PRO B 2 295 ? -58.954  29.048  31.564  1.00 66.81  ? 294  PRO B CG    1 
ATOM   6393 C  CD    . PRO B 2 295 ? -60.041  28.087  31.202  1.00 72.30  ? 294  PRO B CD    1 
ATOM   6394 N  N     . LEU B 2 296 ? -57.018  25.092  33.115  1.00 71.46  ? 295  LEU B N     1 
ATOM   6395 C  CA    . LEU B 2 296 ? -56.961  24.077  34.166  1.00 78.56  ? 295  LEU B CA    1 
ATOM   6396 C  C     . LEU B 2 296 ? -56.564  24.665  35.516  1.00 75.69  ? 295  LEU B C     1 
ATOM   6397 O  O     . LEU B 2 296 ? -55.576  25.396  35.623  1.00 79.78  ? 295  LEU B O     1 
ATOM   6398 C  CB    . LEU B 2 296 ? -56.019  22.932  33.774  1.00 84.63  ? 295  LEU B CB    1 
ATOM   6399 C  CG    . LEU B 2 296 ? -56.628  21.704  33.084  1.00 77.94  ? 295  LEU B CG    1 
ATOM   6400 C  CD1   . LEU B 2 296 ? -57.132  22.017  31.682  1.00 71.79  ? 295  LEU B CD1   1 
ATOM   6401 C  CD2   . LEU B 2 296 ? -55.620  20.564  33.043  1.00 74.35  ? 295  LEU B CD2   1 
ATOM   6402 N  N     . THR B 2 297 ? -57.348  24.335  36.540  1.00 72.46  ? 296  THR B N     1 
ATOM   6403 C  CA    . THR B 2 297 ? -57.145  24.854  37.894  1.00 81.87  ? 296  THR B CA    1 
ATOM   6404 C  C     . THR B 2 297 ? -56.078  24.068  38.661  1.00 84.01  ? 296  THR B C     1 
ATOM   6405 O  O     . THR B 2 297 ? -55.434  23.174  38.107  1.00 83.20  ? 296  THR B O     1 
ATOM   6406 C  CB    . THR B 2 297 ? -58.464  24.863  38.700  1.00 76.14  ? 296  THR B CB    1 
ATOM   6407 O  OG1   . THR B 2 297 ? -59.072  23.566  38.647  1.00 73.62  ? 296  THR B OG1   1 
ATOM   6408 C  CG2   . THR B 2 297 ? -59.433  25.899  38.142  1.00 69.16  ? 296  THR B CG2   1 
ATOM   6409 N  N     . GLU B 2 298 ? -55.900  24.416  39.935  1.00 88.30  ? 297  GLU B N     1 
ATOM   6410 C  CA    . GLU B 2 298 ? -54.930  23.757  40.813  1.00 94.11  ? 297  GLU B CA    1 
ATOM   6411 C  C     . GLU B 2 298 ? -55.306  22.300  41.080  1.00 84.42  ? 297  GLU B C     1 
ATOM   6412 O  O     . GLU B 2 298 ? -54.434  21.436  41.188  1.00 87.27  ? 297  GLU B O     1 
ATOM   6413 C  CB    . GLU B 2 298 ? -54.807  24.511  42.144  1.00 102.48 ? 297  GLU B CB    1 
ATOM   6414 C  CG    . GLU B 2 298 ? -54.499  26.000  42.018  1.00 118.47 ? 297  GLU B CG    1 
ATOM   6415 C  CD    . GLU B 2 298 ? -53.096  26.284  41.508  1.00 130.56 ? 297  GLU B CD    1 
ATOM   6416 O  OE1   . GLU B 2 298 ? -52.133  25.662  42.008  1.00 125.91 ? 297  GLU B OE1   1 
ATOM   6417 O  OE2   . GLU B 2 298 ? -52.955  27.140  40.610  1.00 122.84 ? 297  GLU B OE2   1 
ATOM   6418 N  N     . GLU B 2 299 ? -56.609  22.043  41.181  1.00 81.44  ? 298  GLU B N     1 
ATOM   6419 C  CA    . GLU B 2 299 ? -57.134  20.703  41.439  1.00 81.72  ? 298  GLU B CA    1 
ATOM   6420 C  C     . GLU B 2 299 ? -57.143  19.838  40.180  1.00 77.95  ? 298  GLU B C     1 
ATOM   6421 O  O     . GLU B 2 299 ? -56.882  18.635  40.247  1.00 78.34  ? 298  GLU B O     1 
ATOM   6422 C  CB    . GLU B 2 299 ? -58.549  20.788  42.022  1.00 81.79  ? 298  GLU B CB    1 
ATOM   6423 C  CG    . GLU B 2 299 ? -58.636  21.419  43.407  1.00 83.21  ? 298  GLU B CG    1 
ATOM   6424 C  CD    . GLU B 2 299 ? -58.511  20.414  44.541  1.00 90.17  ? 298  GLU B CD    1 
ATOM   6425 O  OE1   . GLU B 2 299 ? -57.785  19.406  44.392  1.00 89.42  ? 298  GLU B OE1   1 
ATOM   6426 O  OE2   . GLU B 2 299 ? -59.147  20.635  45.592  1.00 100.03 ? 298  GLU B OE2   1 
ATOM   6427 N  N     . ALA B 2 300 ? -57.448  20.459  39.040  1.00 75.44  ? 299  ALA B N     1 
ATOM   6428 C  CA    . ALA B 2 300 ? -57.535  19.761  37.756  1.00 72.55  ? 299  ALA B CA    1 
ATOM   6429 C  C     . ALA B 2 300 ? -56.173  19.282  37.253  1.00 78.38  ? 299  ALA B C     1 
ATOM   6430 O  O     . ALA B 2 300 ? -56.064  18.193  36.684  1.00 75.10  ? 299  ALA B O     1 
ATOM   6431 C  CB    . ALA B 2 300 ? -58.208  20.647  36.716  1.00 68.15  ? 299  ALA B CB    1 
ATOM   6432 N  N     . GLU B 2 301 ? -55.146  20.104  37.464  1.00 78.09  ? 300  GLU B N     1 
ATOM   6433 C  CA    . GLU B 2 301 ? -53.775  19.765  37.078  1.00 71.43  ? 300  GLU B CA    1 
ATOM   6434 C  C     . GLU B 2 301 ? -53.187  18.679  37.976  1.00 74.11  ? 300  GLU B C     1 
ATOM   6435 O  O     . GLU B 2 301 ? -52.431  17.825  37.511  1.00 78.07  ? 300  GLU B O     1 
ATOM   6436 C  CB    . GLU B 2 301 ? -52.879  21.008  37.109  1.00 74.96  ? 300  GLU B CB    1 
ATOM   6437 C  CG    . GLU B 2 301 ? -53.086  21.978  35.951  1.00 83.95  ? 300  GLU B CG    1 
ATOM   6438 C  CD    . GLU B 2 301 ? -52.389  21.552  34.667  1.00 96.27  ? 300  GLU B CD    1 
ATOM   6439 O  OE1   . GLU B 2 301 ? -51.565  20.612  34.698  1.00 95.26  ? 300  GLU B OE1   1 
ATOM   6440 O  OE2   . GLU B 2 301 ? -52.665  22.169  33.617  1.00 95.29  ? 300  GLU B OE2   1 
ATOM   6441 N  N     . LEU B 2 302 ? -53.543  18.721  39.259  1.00 75.33  ? 301  LEU B N     1 
ATOM   6442 C  CA    . LEU B 2 302 ? -53.033  17.773  40.250  1.00 76.36  ? 301  LEU B CA    1 
ATOM   6443 C  C     . LEU B 2 302 ? -53.701  16.401  40.135  1.00 80.85  ? 301  LEU B C     1 
ATOM   6444 O  O     . LEU B 2 302 ? -53.089  15.380  40.458  1.00 85.14  ? 301  LEU B O     1 
ATOM   6445 C  CB    . LEU B 2 302 ? -53.201  18.340  41.665  1.00 72.83  ? 301  LEU B CB    1 
ATOM   6446 C  CG    . LEU B 2 302 ? -52.362  17.774  42.817  1.00 79.98  ? 301  LEU B CG    1 
ATOM   6447 C  CD1   . LEU B 2 302 ? -50.870  17.979  42.589  1.00 75.65  ? 301  LEU B CD1   1 
ATOM   6448 C  CD2   . LEU B 2 302 ? -52.787  18.412  44.131  1.00 79.40  ? 301  LEU B CD2   1 
ATOM   6449 N  N     . GLU B 2 303 ? -54.952  16.388  39.677  1.00 77.39  ? 302  GLU B N     1 
ATOM   6450 C  CA    . GLU B 2 303 ? -55.685  15.143  39.439  1.00 73.51  ? 302  GLU B CA    1 
ATOM   6451 C  C     . GLU B 2 303 ? -55.160  14.428  38.192  1.00 73.45  ? 302  GLU B C     1 
ATOM   6452 O  O     . GLU B 2 303 ? -54.960  13.211  38.206  1.00 75.78  ? 302  GLU B O     1 
ATOM   6453 C  CB    . GLU B 2 303 ? -57.191  15.415  39.316  1.00 69.35  ? 302  GLU B CB    1 
ATOM   6454 C  CG    . GLU B 2 303 ? -58.036  14.188  38.996  1.00 65.22  ? 302  GLU B CG    1 
ATOM   6455 C  CD    . GLU B 2 303 ? -59.520  14.494  38.935  1.00 68.55  ? 302  GLU B CD    1 
ATOM   6456 O  OE1   . GLU B 2 303 ? -60.154  14.584  40.007  1.00 71.12  ? 302  GLU B OE1   1 
ATOM   6457 O  OE2   . GLU B 2 303 ? -60.051  14.645  37.815  1.00 64.76  ? 302  GLU B OE2   1 
ATOM   6458 N  N     . LEU B 2 304 ? -54.931  15.196  37.127  1.00 74.54  ? 303  LEU B N     1 
ATOM   6459 C  CA    . LEU B 2 304 ? -54.473  14.657  35.847  1.00 73.70  ? 303  LEU B CA    1 
ATOM   6460 C  C     . LEU B 2 304 ? -53.036  14.135  35.929  1.00 74.88  ? 303  LEU B C     1 
ATOM   6461 O  O     . LEU B 2 304 ? -52.706  13.116  35.317  1.00 79.06  ? 303  LEU B O     1 
ATOM   6462 C  CB    . LEU B 2 304 ? -54.591  15.723  34.749  1.00 69.81  ? 303  LEU B CB    1 
ATOM   6463 C  CG    . LEU B 2 304 ? -55.050  15.303  33.346  1.00 70.56  ? 303  LEU B CG    1 
ATOM   6464 C  CD1   . LEU B 2 304 ? -55.546  16.513  32.568  1.00 76.76  ? 303  LEU B CD1   1 
ATOM   6465 C  CD2   . LEU B 2 304 ? -53.966  14.571  32.563  1.00 72.09  ? 303  LEU B CD2   1 
ATOM   6466 N  N     . ALA B 2 305 ? -52.194  14.837  36.687  1.00 78.22  ? 304  ALA B N     1 
ATOM   6467 C  CA    . ALA B 2 305 ? -50.790  14.459  36.862  1.00 82.53  ? 304  ALA B CA    1 
ATOM   6468 C  C     . ALA B 2 305 ? -50.630  13.175  37.675  1.00 83.38  ? 304  ALA B C     1 
ATOM   6469 O  O     . ALA B 2 305 ? -49.708  12.392  37.431  1.00 87.90  ? 304  ALA B O     1 
ATOM   6470 C  CB    . ALA B 2 305 ? -50.005  15.594  37.503  1.00 82.21  ? 304  ALA B CB    1 
ATOM   6471 N  N     . GLU B 2 306 ? -51.527  12.968  38.638  1.00 79.14  ? 305  GLU B N     1 
ATOM   6472 C  CA    . GLU B 2 306 ? -51.515  11.761  39.459  1.00 80.31  ? 305  GLU B CA    1 
ATOM   6473 C  C     . GLU B 2 306 ? -52.065  10.573  38.670  1.00 79.47  ? 305  GLU B C     1 
ATOM   6474 O  O     . GLU B 2 306 ? -51.615  9.441   38.852  1.00 83.20  ? 305  GLU B O     1 
ATOM   6475 C  CB    . GLU B 2 306 ? -52.314  11.970  40.748  1.00 89.67  ? 305  GLU B CB    1 
ATOM   6476 C  CG    . GLU B 2 306 ? -51.630  11.446  42.006  1.00 96.61  ? 305  GLU B CG    1 
ATOM   6477 C  CD    . GLU B 2 306 ? -51.446  9.938   42.018  1.00 89.76  ? 305  GLU B CD    1 
ATOM   6478 O  OE1   . GLU B 2 306 ? -52.418  9.209   41.727  1.00 98.27  ? 305  GLU B OE1   1 
ATOM   6479 O  OE2   . GLU B 2 306 ? -50.327  9.480   42.332  1.00 82.28  ? 305  GLU B OE2   1 
ATOM   6480 N  N     . ASN B 2 307 ? -53.033  10.845  37.793  1.00 77.72  ? 306  ASN B N     1 
ATOM   6481 C  CA    . ASN B 2 307 ? -53.583  9.835   36.886  1.00 73.16  ? 306  ASN B CA    1 
ATOM   6482 C  C     . ASN B 2 307 ? -52.544  9.307   35.898  1.00 71.09  ? 306  ASN B C     1 
ATOM   6483 O  O     . ASN B 2 307 ? -52.600  8.144   35.494  1.00 75.05  ? 306  ASN B O     1 
ATOM   6484 C  CB    . ASN B 2 307 ? -54.798  10.385  36.129  1.00 66.77  ? 306  ASN B CB    1 
ATOM   6485 C  CG    . ASN B 2 307 ? -56.037  10.497  37.001  1.00 66.59  ? 306  ASN B CG    1 
ATOM   6486 O  OD1   . ASN B 2 307 ? -56.138  9.864   38.054  1.00 67.93  ? 306  ASN B OD1   1 
ATOM   6487 N  ND2   . ASN B 2 307 ? -56.995  11.304  36.560  1.00 60.27  ? 306  ASN B ND2   1 
ATOM   6488 N  N     . ARG B 2 308 ? -51.604  10.170  35.516  1.00 68.82  ? 307  ARG B N     1 
ATOM   6489 C  CA    . ARG B 2 308 ? -50.479  9.784   34.664  1.00 69.09  ? 307  ARG B CA    1 
ATOM   6490 C  C     . ARG B 2 308 ? -49.486  8.884   35.401  1.00 76.15  ? 307  ARG B C     1 
ATOM   6491 O  O     . ARG B 2 308 ? -48.832  8.040   34.785  1.00 80.27  ? 307  ARG B O     1 
ATOM   6492 C  CB    . ARG B 2 308 ? -49.762  11.022  34.115  1.00 71.33  ? 307  ARG B CB    1 
ATOM   6493 C  CG    . ARG B 2 308 ? -50.396  11.607  32.862  1.00 76.58  ? 307  ARG B CG    1 
ATOM   6494 C  CD    . ARG B 2 308 ? -49.493  12.644  32.211  1.00 82.94  ? 307  ARG B CD    1 
ATOM   6495 N  NE    . ARG B 2 308 ? -49.659  13.975  32.791  1.00 83.68  ? 307  ARG B NE    1 
ATOM   6496 C  CZ    . ARG B 2 308 ? -50.305  14.981  32.205  1.00 85.03  ? 307  ARG B CZ    1 
ATOM   6497 N  NH1   . ARG B 2 308 ? -50.854  14.823  31.006  1.00 71.49  ? 307  ARG B NH1   1 
ATOM   6498 N  NH2   . ARG B 2 308 ? -50.400  16.153  32.818  1.00 83.58  ? 307  ARG B NH2   1 
ATOM   6499 N  N     . GLU B 2 309 ? -49.382  9.070   36.716  1.00 78.99  ? 308  GLU B N     1 
ATOM   6500 C  CA    . GLU B 2 309 ? -48.491  8.269   37.559  1.00 80.08  ? 308  GLU B CA    1 
ATOM   6501 C  C     . GLU B 2 309 ? -49.013  6.849   37.785  1.00 80.38  ? 308  GLU B C     1 
ATOM   6502 O  O     . GLU B 2 309 ? -48.226  5.915   37.954  1.00 85.45  ? 308  GLU B O     1 
ATOM   6503 C  CB    . GLU B 2 309 ? -48.249  8.961   38.905  1.00 80.56  ? 308  GLU B CB    1 
ATOM   6504 C  CG    . GLU B 2 309 ? -47.289  10.143  38.846  1.00 86.86  ? 308  GLU B CG    1 
ATOM   6505 C  CD    . GLU B 2 309 ? -45.841  9.730   38.633  1.00 93.88  ? 308  GLU B CD    1 
ATOM   6506 O  OE1   . GLU B 2 309 ? -45.415  8.699   39.197  1.00 88.64  ? 308  GLU B OE1   1 
ATOM   6507 O  OE2   . GLU B 2 309 ? -45.123  10.446  37.904  1.00 99.16  ? 308  GLU B OE2   1 
ATOM   6508 N  N     . ILE B 2 310 ? -50.337  6.699   37.790  1.00 70.40  ? 309  ILE B N     1 
ATOM   6509 C  CA    . ILE B 2 310 ? -50.982  5.392   37.956  1.00 75.47  ? 309  ILE B CA    1 
ATOM   6510 C  C     . ILE B 2 310 ? -50.817  4.542   36.693  1.00 77.78  ? 309  ILE B C     1 
ATOM   6511 O  O     . ILE B 2 310 ? -50.713  3.316   36.770  1.00 80.83  ? 309  ILE B O     1 
ATOM   6512 C  CB    . ILE B 2 310 ? -52.481  5.533   38.317  1.00 73.12  ? 309  ILE B CB    1 
ATOM   6513 C  CG1   . ILE B 2 310 ? -52.660  6.443   39.536  1.00 75.74  ? 309  ILE B CG1   1 
ATOM   6514 C  CG2   . ILE B 2 310 ? -53.108  4.170   38.593  1.00 80.61  ? 309  ILE B CG2   1 
ATOM   6515 C  CD1   . ILE B 2 310 ? -54.019  7.105   39.626  1.00 71.43  ? 309  ILE B CD1   1 
ATOM   6516 N  N     . LEU B 2 311 ? -50.784  5.202   35.537  1.00 73.84  ? 310  LEU B N     1 
ATOM   6517 C  CA    . LEU B 2 311 ? -50.619  4.521   34.252  1.00 73.59  ? 310  LEU B CA    1 
ATOM   6518 C  C     . LEU B 2 311 ? -49.183  4.049   34.018  1.00 79.24  ? 310  LEU B C     1 
ATOM   6519 O  O     . LEU B 2 311 ? -48.954  3.073   33.300  1.00 85.49  ? 310  LEU B O     1 
ATOM   6520 C  CB    . LEU B 2 311 ? -51.081  5.419   33.099  1.00 68.63  ? 310  LEU B CB    1 
ATOM   6521 C  CG    . LEU B 2 311 ? -52.561  5.822   33.047  1.00 65.66  ? 310  LEU B CG    1 
ATOM   6522 C  CD1   . LEU B 2 311 ? -52.791  6.890   31.988  1.00 62.97  ? 310  LEU B CD1   1 
ATOM   6523 C  CD2   . LEU B 2 311 ? -53.463  4.620   32.804  1.00 73.52  ? 310  LEU B CD2   1 
ATOM   6524 N  N     . LYS B 2 312 ? -48.225  4.747   34.627  1.00 75.14  ? 311  LYS B N     1 
ATOM   6525 C  CA    . LYS B 2 312 ? -46.807  4.403   34.509  1.00 80.14  ? 311  LYS B CA    1 
ATOM   6526 C  C     . LYS B 2 312 ? -46.425  3.221   35.402  1.00 82.03  ? 311  LYS B C     1 
ATOM   6527 O  O     . LYS B 2 312 ? -45.681  2.333   34.980  1.00 90.38  ? 311  LYS B O     1 
ATOM   6528 C  CB    . LYS B 2 312 ? -45.926  5.615   34.830  1.00 76.42  ? 311  LYS B CB    1 
ATOM   6529 C  CG    . LYS B 2 312 ? -45.927  6.694   33.758  1.00 73.98  ? 311  LYS B CG    1 
ATOM   6530 C  CD    . LYS B 2 312 ? -45.106  7.900   34.188  1.00 84.56  ? 311  LYS B CD    1 
ATOM   6531 C  CE    . LYS B 2 312 ? -45.141  8.996   33.135  1.00 89.19  ? 311  LYS B CE    1 
ATOM   6532 N  NZ    . LYS B 2 312 ? -44.354  10.190  33.549  1.00 106.14 ? 311  LYS B NZ    1 
ATOM   6533 N  N     . GLU B 2 313 ? -46.939  3.219   36.631  1.00 81.38  ? 312  GLU B N     1 
ATOM   6534 C  CA    . GLU B 2 313 ? -46.652  2.165   37.602  1.00 91.85  ? 312  GLU B CA    1 
ATOM   6535 C  C     . GLU B 2 313 ? -47.652  1.010   37.466  1.00 86.16  ? 312  GLU B C     1 
ATOM   6536 O  O     . GLU B 2 313 ? -48.858  1.249   37.376  1.00 81.64  ? 312  GLU B O     1 
ATOM   6537 C  CB    . GLU B 2 313 ? -46.675  2.736   39.026  1.00 99.37  ? 312  GLU B CB    1 
ATOM   6538 C  CG    . GLU B 2 313 ? -45.983  1.878   40.079  1.00 105.44 ? 312  GLU B CG    1 
ATOM   6539 C  CD    . GLU B 2 313 ? -44.473  1.819   39.910  1.00 114.67 ? 312  GLU B CD    1 
ATOM   6540 O  OE1   . GLU B 2 313 ? -43.856  2.861   39.602  1.00 102.83 ? 312  GLU B OE1   1 
ATOM   6541 O  OE2   . GLU B 2 313 ? -43.900  0.724   40.095  1.00 108.62 ? 312  GLU B OE2   1 
ATOM   6542 N  N     . PRO B 2 314 ? -47.151  -0.244  37.442  1.00 93.13  ? 313  PRO B N     1 
ATOM   6543 C  CA    . PRO B 2 314 ? -47.993  -1.444  37.327  1.00 87.85  ? 313  PRO B CA    1 
ATOM   6544 C  C     . PRO B 2 314 ? -49.095  -1.530  38.385  1.00 81.87  ? 313  PRO B C     1 
ATOM   6545 O  O     . PRO B 2 314 ? -48.898  -1.105  39.526  1.00 90.13  ? 313  PRO B O     1 
ATOM   6546 C  CB    . PRO B 2 314 ? -46.994  -2.587  37.514  1.00 91.76  ? 313  PRO B CB    1 
ATOM   6547 C  CG    . PRO B 2 314 ? -45.707  -2.032  37.014  1.00 99.69  ? 313  PRO B CG    1 
ATOM   6548 C  CD    . PRO B 2 314 ? -45.715  -0.585  37.417  1.00 93.17  ? 313  PRO B CD    1 
ATOM   6549 N  N     . VAL B 2 315 ? -50.241  -2.084  37.993  1.00 75.16  ? 314  VAL B N     1 
ATOM   6550 C  CA    . VAL B 2 315 ? -51.415  -2.176  38.864  1.00 80.69  ? 314  VAL B CA    1 
ATOM   6551 C  C     . VAL B 2 315 ? -51.404  -3.457  39.710  1.00 83.39  ? 314  VAL B C     1 
ATOM   6552 O  O     . VAL B 2 315 ? -50.926  -4.505  39.265  1.00 81.41  ? 314  VAL B O     1 
ATOM   6553 C  CB    . VAL B 2 315 ? -52.734  -2.023  38.055  1.00 74.79  ? 314  VAL B CB    1 
ATOM   6554 C  CG1   . VAL B 2 315 ? -52.993  -3.233  37.163  1.00 69.58  ? 314  VAL B CG1   1 
ATOM   6555 C  CG2   . VAL B 2 315 ? -53.920  -1.749  38.972  1.00 79.81  ? 314  VAL B CG2   1 
ATOM   6556 N  N     . HIS B 2 316 ? -51.921  -3.354  40.933  1.00 83.84  ? 315  HIS B N     1 
ATOM   6557 C  CA    . HIS B 2 316 ? -51.991  -4.483  41.862  1.00 86.42  ? 315  HIS B CA    1 
ATOM   6558 C  C     . HIS B 2 316 ? -53.137  -5.400  41.535  1.00 83.43  ? 315  HIS B C     1 
ATOM   6559 O  O     . HIS B 2 316 ? -54.068  -5.016  40.822  1.00 75.86  ? 315  HIS B O     1 
ATOM   6560 C  CB    . HIS B 2 316 ? -52.128  -3.986  43.299  1.00 87.40  ? 315  HIS B CB    1 
ATOM   6561 C  CG    . HIS B 2 316 ? -51.102  -2.950  43.691  1.00 94.56  ? 315  HIS B CG    1 
ATOM   6562 N  ND1   . HIS B 2 316 ? -49.861  -3.276  44.093  1.00 97.78  ? 315  HIS B ND1   1 
ATOM   6563 C  CD2   . HIS B 2 316 ? -51.178  -1.560  43.737  1.00 94.69  ? 315  HIS B CD2   1 
ATOM   6564 C  CE1   . HIS B 2 316 ? -49.174  -2.154  44.379  1.00 91.86  ? 315  HIS B CE1   1 
ATOM   6565 N  NE2   . HIS B 2 316 ? -49.982  -1.104  44.160  1.00 96.89  ? 315  HIS B NE2   1 
ATOM   6566 N  N     . GLY B 2 317 ? -53.077  -6.623  42.059  1.00 81.00  ? 316  GLY B N     1 
ATOM   6567 C  CA    . GLY B 2 317 ? -54.163  -7.591  41.911  1.00 78.63  ? 316  GLY B CA    1 
ATOM   6568 C  C     . GLY B 2 317 ? -54.119  -8.416  40.639  1.00 86.49  ? 316  GLY B C     1 
ATOM   6569 O  O     . GLY B 2 317 ? -55.074  -9.131  40.327  1.00 94.22  ? 316  GLY B O     1 
ATOM   6570 N  N     . VAL B 2 318 ? -53.013  -8.319  39.904  1.00 80.28  ? 317  VAL B N     1 
ATOM   6571 C  CA    . VAL B 2 318 ? -52.832  -9.078  38.668  1.00 77.82  ? 317  VAL B CA    1 
ATOM   6572 C  C     . VAL B 2 318 ? -51.853  -10.229 38.901  1.00 84.84  ? 317  VAL B C     1 
ATOM   6573 O  O     . VAL B 2 318 ? -50.661  -10.009 39.137  1.00 87.06  ? 317  VAL B O     1 
ATOM   6574 C  CB    . VAL B 2 318 ? -52.358  -8.179  37.501  1.00 79.20  ? 317  VAL B CB    1 
ATOM   6575 C  CG1   . VAL B 2 318 ? -52.184  -8.994  36.227  1.00 73.11  ? 317  VAL B CG1   1 
ATOM   6576 C  CG2   . VAL B 2 318 ? -53.343  -7.043  37.265  1.00 80.89  ? 317  VAL B CG2   1 
ATOM   6577 N  N     . TYR B 2 319 ? -52.373  -11.453 38.842  1.00 86.70  ? 318  TYR B N     1 
ATOM   6578 C  CA    . TYR B 2 319 ? -51.575  -12.656 39.077  1.00 86.60  ? 318  TYR B CA    1 
ATOM   6579 C  C     . TYR B 2 319 ? -51.995  -13.807 38.166  1.00 84.01  ? 318  TYR B C     1 
ATOM   6580 O  O     . TYR B 2 319 ? -53.171  -13.938 37.816  1.00 89.23  ? 318  TYR B O     1 
ATOM   6581 C  CB    . TYR B 2 319 ? -51.647  -13.078 40.553  1.00 85.31  ? 318  TYR B CB    1 
ATOM   6582 C  CG    . TYR B 2 319 ? -53.024  -13.494 41.035  1.00 93.09  ? 318  TYR B CG    1 
ATOM   6583 C  CD1   . TYR B 2 319 ? -53.961  -12.543 41.446  1.00 100.42 ? 318  TYR B CD1   1 
ATOM   6584 C  CD2   . TYR B 2 319 ? -53.387  -14.839 41.092  1.00 91.03  ? 318  TYR B CD2   1 
ATOM   6585 C  CE1   . TYR B 2 319 ? -55.219  -12.920 41.890  1.00 111.01 ? 318  TYR B CE1   1 
ATOM   6586 C  CE2   . TYR B 2 319 ? -54.643  -15.226 41.535  1.00 97.52  ? 318  TYR B CE2   1 
ATOM   6587 C  CZ    . TYR B 2 319 ? -55.554  -14.262 41.933  1.00 106.83 ? 318  TYR B CZ    1 
ATOM   6588 O  OH    . TYR B 2 319 ? -56.801  -14.641 42.374  1.00 92.56  ? 318  TYR B OH    1 
ATOM   6589 N  N     . TYR B 2 320 ? -51.023  -14.636 37.791  1.00 76.78  ? 319  TYR B N     1 
ATOM   6590 C  CA    . TYR B 2 320 ? -51.266  -15.784 36.921  1.00 76.39  ? 319  TYR B CA    1 
ATOM   6591 C  C     . TYR B 2 320 ? -51.911  -16.941 37.681  1.00 80.12  ? 319  TYR B C     1 
ATOM   6592 O  O     . TYR B 2 320 ? -51.502  -17.269 38.798  1.00 81.77  ? 319  TYR B O     1 
ATOM   6593 C  CB    . TYR B 2 320 ? -49.961  -16.236 36.251  1.00 78.22  ? 319  TYR B CB    1 
ATOM   6594 C  CG    . TYR B 2 320 ? -50.091  -17.474 35.386  1.00 82.73  ? 319  TYR B CG    1 
ATOM   6595 C  CD1   . TYR B 2 320 ? -50.738  -17.424 34.151  1.00 79.65  ? 319  TYR B CD1   1 
ATOM   6596 C  CD2   . TYR B 2 320 ? -49.558  -18.695 35.801  1.00 90.66  ? 319  TYR B CD2   1 
ATOM   6597 C  CE1   . TYR B 2 320 ? -50.856  -18.555 33.357  1.00 80.14  ? 319  TYR B CE1   1 
ATOM   6598 C  CE2   . TYR B 2 320 ? -49.670  -19.831 35.014  1.00 92.13  ? 319  TYR B CE2   1 
ATOM   6599 C  CZ    . TYR B 2 320 ? -50.319  -19.756 33.795  1.00 86.34  ? 319  TYR B CZ    1 
ATOM   6600 O  OH    . TYR B 2 320 ? -50.430  -20.881 33.013  1.00 90.84  ? 319  TYR B OH    1 
ATOM   6601 N  N     . ASP B 2 321 ? -52.919  -17.550 37.062  1.00 79.09  ? 320  ASP B N     1 
ATOM   6602 C  CA    . ASP B 2 321 ? -53.623  -18.689 37.642  1.00 76.39  ? 320  ASP B CA    1 
ATOM   6603 C  C     . ASP B 2 321 ? -53.592  -19.881 36.680  1.00 86.02  ? 320  ASP B C     1 
ATOM   6604 O  O     . ASP B 2 321 ? -54.144  -19.803 35.579  1.00 98.50  ? 320  ASP B O     1 
ATOM   6605 C  CB    . ASP B 2 321 ? -55.066  -18.305 37.992  1.00 73.50  ? 320  ASP B CB    1 
ATOM   6606 C  CG    . ASP B 2 321 ? -55.772  -19.359 38.832  1.00 76.59  ? 320  ASP B CG    1 
ATOM   6607 O  OD1   . ASP B 2 321 ? -55.116  -20.005 39.678  1.00 82.70  ? 320  ASP B OD1   1 
ATOM   6608 O  OD2   . ASP B 2 321 ? -56.995  -19.531 38.652  1.00 76.63  ? 320  ASP B OD2   1 
ATOM   6609 N  N     . PRO B 2 322 ? -52.933  -20.984 37.090  1.00 84.49  ? 321  PRO B N     1 
ATOM   6610 C  CA    . PRO B 2 322 ? -52.795  -22.189 36.261  1.00 90.13  ? 321  PRO B CA    1 
ATOM   6611 C  C     . PRO B 2 322 ? -54.116  -22.915 35.998  1.00 85.84  ? 321  PRO B C     1 
ATOM   6612 O  O     . PRO B 2 322 ? -54.241  -23.613 34.989  1.00 86.91  ? 321  PRO B O     1 
ATOM   6613 C  CB    . PRO B 2 322 ? -51.861  -23.084 37.088  1.00 91.93  ? 321  PRO B CB    1 
ATOM   6614 C  CG    . PRO B 2 322 ? -51.169  -22.161 38.033  1.00 84.42  ? 321  PRO B CG    1 
ATOM   6615 C  CD    . PRO B 2 322 ? -52.189  -21.113 38.355  1.00 81.11  ? 321  PRO B CD    1 
ATOM   6616 N  N     . SER B 2 323 ? -55.084  -22.751 36.898  1.00 78.03  ? 322  SER B N     1 
ATOM   6617 C  CA    . SER B 2 323 ? -56.381  -23.421 36.781  1.00 79.62  ? 322  SER B CA    1 
ATOM   6618 C  C     . SER B 2 323 ? -57.306  -22.771 35.748  1.00 77.83  ? 322  SER B C     1 
ATOM   6619 O  O     . SER B 2 323 ? -58.223  -23.419 35.238  1.00 77.86  ? 322  SER B O     1 
ATOM   6620 C  CB    . SER B 2 323 ? -57.074  -23.493 38.146  1.00 84.50  ? 322  SER B CB    1 
ATOM   6621 O  OG    . SER B 2 323 ? -57.314  -22.199 38.671  1.00 87.71  ? 322  SER B OG    1 
ATOM   6622 N  N     . LYS B 2 324 ? -57.061  -21.497 35.445  1.00 80.60  ? 323  LYS B N     1 
ATOM   6623 C  CA    . LYS B 2 324 ? -57.877  -20.752 34.483  1.00 78.34  ? 323  LYS B CA    1 
ATOM   6624 C  C     . LYS B 2 324 ? -57.213  -20.652 33.109  1.00 74.93  ? 323  LYS B C     1 
ATOM   6625 O  O     . LYS B 2 324 ? -55.985  -20.668 32.998  1.00 71.24  ? 323  LYS B O     1 
ATOM   6626 C  CB    . LYS B 2 324 ? -58.202  -19.354 35.017  1.00 75.43  ? 323  LYS B CB    1 
ATOM   6627 C  CG    . LYS B 2 324 ? -59.248  -19.331 36.121  1.00 73.82  ? 323  LYS B CG    1 
ATOM   6628 C  CD    . LYS B 2 324 ? -59.522  -17.911 36.591  1.00 68.49  ? 323  LYS B CD    1 
ATOM   6629 C  CE    . LYS B 2 324 ? -60.589  -17.872 37.674  1.00 76.20  ? 323  LYS B CE    1 
ATOM   6630 N  NZ    . LYS B 2 324 ? -60.119  -18.450 38.965  1.00 82.42  ? 323  LYS B NZ    1 
ATOM   6631 N  N     . ASP B 2 325 ? -58.041  -20.546 32.071  1.00 76.15  ? 324  ASP B N     1 
ATOM   6632 C  CA    . ASP B 2 325 ? -57.568  -20.430 30.692  1.00 73.39  ? 324  ASP B CA    1 
ATOM   6633 C  C     . ASP B 2 325 ? -57.142  -19.001 30.356  1.00 60.79  ? 324  ASP B C     1 
ATOM   6634 O  O     . ASP B 2 325 ? -57.658  -18.038 30.928  1.00 59.18  ? 324  ASP B O     1 
ATOM   6635 C  CB    . ASP B 2 325 ? -58.649  -20.901 29.712  1.00 77.48  ? 324  ASP B CB    1 
ATOM   6636 C  CG    . ASP B 2 325 ? -58.962  -22.384 29.849  1.00 81.16  ? 324  ASP B CG    1 
ATOM   6637 O  OD1   . ASP B 2 325 ? -58.017  -23.201 29.896  1.00 90.23  ? 324  ASP B OD1   1 
ATOM   6638 O  OD2   . ASP B 2 325 ? -60.161  -22.733 29.899  1.00 70.39  ? 324  ASP B OD2   1 
ATOM   6639 N  N     . LEU B 2 326 ? -56.199  -18.880 29.424  1.00 59.14  ? 325  LEU B N     1 
ATOM   6640 C  CA    . LEU B 2 326 ? -55.671  -17.583 29.002  1.00 59.18  ? 325  LEU B CA    1 
ATOM   6641 C  C     . LEU B 2 326 ? -56.441  -17.041 27.798  1.00 58.34  ? 325  LEU B C     1 
ATOM   6642 O  O     . LEU B 2 326 ? -56.833  -17.800 26.910  1.00 58.45  ? 325  LEU B O     1 
ATOM   6643 C  CB    . LEU B 2 326 ? -54.178  -17.703 28.676  1.00 50.82  ? 325  LEU B CB    1 
ATOM   6644 C  CG    . LEU B 2 326 ? -53.312  -16.439 28.614  1.00 65.70  ? 325  LEU B CG    1 
ATOM   6645 C  CD1   . LEU B 2 326 ? -53.129  -15.816 29.991  1.00 69.18  ? 325  LEU B CD1   1 
ATOM   6646 C  CD2   . LEU B 2 326 ? -51.960  -16.764 28.001  1.00 69.85  ? 325  LEU B CD2   1 
ATOM   6647 N  N     . ILE B 2 327 ? -56.660  -15.726 27.784  1.00 52.67  ? 326  ILE B N     1 
ATOM   6648 C  CA    . ILE B 2 327 ? -57.396  -15.057 26.706  1.00 50.92  ? 326  ILE B CA    1 
ATOM   6649 C  C     . ILE B 2 327 ? -56.551  -13.931 26.100  1.00 50.34  ? 326  ILE B C     1 
ATOM   6650 O  O     . ILE B 2 327 ? -55.875  -13.194 26.822  1.00 57.46  ? 326  ILE B O     1 
ATOM   6651 C  CB    . ILE B 2 327 ? -58.747  -14.465 27.199  1.00 55.74  ? 326  ILE B CB    1 
ATOM   6652 C  CG1   . ILE B 2 327 ? -59.468  -15.407 28.185  1.00 50.24  ? 326  ILE B CG1   1 
ATOM   6653 C  CG2   . ILE B 2 327 ? -59.641  -14.074 26.025  1.00 45.48  ? 326  ILE B CG2   1 
ATOM   6654 C  CD1   . ILE B 2 327 ? -60.032  -16.684 27.589  1.00 61.48  ? 326  ILE B CD1   1 
ATOM   6655 N  N     . ALA B 2 328 ? -56.594  -13.811 24.775  1.00 51.84  ? 327  ALA B N     1 
ATOM   6656 C  CA    . ALA B 2 328 ? -55.890  -12.748 24.060  1.00 50.98  ? 327  ALA B CA    1 
ATOM   6657 C  C     . ALA B 2 328 ? -56.823  -12.032 23.084  1.00 47.13  ? 327  ALA B C     1 
ATOM   6658 O  O     . ALA B 2 328 ? -57.438  -12.665 22.225  1.00 50.30  ? 327  ALA B O     1 
ATOM   6659 C  CB    . ALA B 2 328 ? -54.676  -13.308 23.333  1.00 57.26  ? 327  ALA B CB    1 
ATOM   6660 N  N     . GLU B 2 329 ? -56.924  -10.712 23.227  1.00 51.49  ? 328  GLU B N     1 
ATOM   6661 C  CA    . GLU B 2 329 ? -57.797  -9.899  22.379  1.00 50.29  ? 328  GLU B CA    1 
ATOM   6662 C  C     . GLU B 2 329 ? -56.996  -8.865  21.588  1.00 48.81  ? 328  GLU B C     1 
ATOM   6663 O  O     . GLU B 2 329 ? -56.184  -8.131  22.156  1.00 57.82  ? 328  GLU B O     1 
ATOM   6664 C  CB    . GLU B 2 329 ? -58.878  -9.213  23.222  1.00 57.82  ? 328  GLU B CB    1 
ATOM   6665 C  CG    . GLU B 2 329 ? -60.007  -8.586  22.414  1.00 52.69  ? 328  GLU B CG    1 
ATOM   6666 C  CD    . GLU B 2 329 ? -61.093  -7.963  23.278  1.00 66.17  ? 328  GLU B CD    1 
ATOM   6667 O  OE1   . GLU B 2 329 ? -60.971  -7.982  24.522  1.00 66.34  ? 328  GLU B OE1   1 
ATOM   6668 O  OE2   . GLU B 2 329 ? -62.078  -7.451  22.706  1.00 70.19  ? 328  GLU B OE2   1 
ATOM   6669 N  N     . ILE B 2 330 ? -57.234  -8.818  20.279  1.00 47.93  ? 329  ILE B N     1 
ATOM   6670 C  CA    . ILE B 2 330 ? -56.521  -7.909  19.378  1.00 48.47  ? 329  ILE B CA    1 
ATOM   6671 C  C     . ILE B 2 330 ? -57.479  -6.881  18.771  1.00 58.97  ? 329  ILE B C     1 
ATOM   6672 O  O     . ILE B 2 330 ? -58.593  -7.222  18.364  1.00 54.65  ? 329  ILE B O     1 
ATOM   6673 C  CB    . ILE B 2 330 ? -55.789  -8.678  18.249  1.00 55.47  ? 329  ILE B CB    1 
ATOM   6674 C  CG1   . ILE B 2 330 ? -54.976  -9.846  18.823  1.00 44.34  ? 329  ILE B CG1   1 
ATOM   6675 C  CG2   . ILE B 2 330 ? -54.885  -7.742  17.451  1.00 55.25  ? 329  ILE B CG2   1 
ATOM   6676 C  CD1   . ILE B 2 330 ? -54.641  -10.930 17.819  1.00 51.18  ? 329  ILE B CD1   1 
ATOM   6677 N  N     . GLN B 2 331 ? -57.037  -5.625  18.721  1.00 56.22  ? 330  GLN B N     1 
ATOM   6678 C  CA    . GLN B 2 331 ? -57.823  -4.536  18.140  1.00 58.73  ? 330  GLN B CA    1 
ATOM   6679 C  C     . GLN B 2 331 ? -57.122  -3.922  16.931  1.00 60.71  ? 330  GLN B C     1 
ATOM   6680 O  O     . GLN B 2 331 ? -55.895  -3.795  16.913  1.00 63.66  ? 330  GLN B O     1 
ATOM   6681 C  CB    . GLN B 2 331 ? -58.102  -3.444  19.179  1.00 59.24  ? 330  GLN B CB    1 
ATOM   6682 C  CG    . GLN B 2 331 ? -58.998  -3.864  20.337  1.00 60.21  ? 330  GLN B CG    1 
ATOM   6683 C  CD    . GLN B 2 331 ? -58.249  -4.571  21.453  1.00 60.63  ? 330  GLN B CD    1 
ATOM   6684 O  OE1   . GLN B 2 331 ? -57.023  -4.489  21.552  1.00 56.18  ? 330  GLN B OE1   1 
ATOM   6685 N  NE2   . GLN B 2 331 ? -58.989  -5.268  22.307  1.00 62.87  ? 330  GLN B NE2   1 
ATOM   6686 N  N     . LYS B 2 332 ? -57.912  -3.544  15.929  1.00 61.60  ? 331  LYS B N     1 
ATOM   6687 C  CA    . LYS B 2 332 ? -57.398  -2.860  14.745  1.00 63.74  ? 331  LYS B CA    1 
ATOM   6688 C  C     . LYS B 2 332 ? -57.470  -1.349  14.951  1.00 70.52  ? 331  LYS B C     1 
ATOM   6689 O  O     . LYS B 2 332 ? -58.541  -0.802  15.230  1.00 71.86  ? 331  LYS B O     1 
ATOM   6690 C  CB    . LYS B 2 332 ? -58.188  -3.273  13.499  1.00 66.65  ? 331  LYS B CB    1 
ATOM   6691 C  CG    . LYS B 2 332 ? -57.614  -2.761  12.186  1.00 69.51  ? 331  LYS B CG    1 
ATOM   6692 C  CD    . LYS B 2 332 ? -58.511  -3.124  11.014  1.00 64.18  ? 331  LYS B CD    1 
ATOM   6693 C  CE    . LYS B 2 332 ? -57.988  -2.534  9.715   1.00 64.97  ? 331  LYS B CE    1 
ATOM   6694 N  NZ    . LYS B 2 332 ? -58.865  -2.871  8.559   1.00 59.18  ? 331  LYS B NZ    1 
ATOM   6695 N  N     . GLN B 2 333 ? -56.325  -0.685  14.817  1.00 75.67  ? 332  GLN B N     1 
ATOM   6696 C  CA    . GLN B 2 333 ? -56.239  0.762   15.017  1.00 80.55  ? 332  GLN B CA    1 
ATOM   6697 C  C     . GLN B 2 333 ? -56.195  1.534   13.700  1.00 84.92  ? 332  GLN B C     1 
ATOM   6698 O  O     . GLN B 2 333 ? -56.515  2.725   13.661  1.00 85.77  ? 332  GLN B O     1 
ATOM   6699 C  CB    . GLN B 2 333 ? -55.026  1.121   15.887  1.00 78.91  ? 332  GLN B CB    1 
ATOM   6700 C  CG    . GLN B 2 333 ? -55.059  0.549   17.301  1.00 71.36  ? 332  GLN B CG    1 
ATOM   6701 C  CD    . GLN B 2 333 ? -56.283  0.974   18.097  1.00 83.40  ? 332  GLN B CD    1 
ATOM   6702 O  OE1   . GLN B 2 333 ? -56.939  0.146   18.730  1.00 85.03  ? 332  GLN B OE1   1 
ATOM   6703 N  NE2   . GLN B 2 333 ? -56.599  2.264   18.065  1.00 82.94  ? 332  GLN B NE2   1 
ATOM   6704 N  N     . GLY B 2 334 ? -55.801  0.850   12.628  1.00 79.58  ? 333  GLY B N     1 
ATOM   6705 C  CA    . GLY B 2 334 ? -55.703  1.463   11.306  1.00 88.55  ? 333  GLY B CA    1 
ATOM   6706 C  C     . GLY B 2 334 ? -54.320  2.014   11.017  1.00 88.73  ? 333  GLY B C     1 
ATOM   6707 O  O     . GLY B 2 334 ? -53.497  2.156   11.926  1.00 85.77  ? 333  GLY B O     1 
ATOM   6708 N  N     . GLN B 2 335 ? -54.074  2.320   9.742   1.00 81.71  ? 334  GLN B N     1 
ATOM   6709 C  CA    . GLN B 2 335 ? -52.788  2.853   9.260   1.00 86.45  ? 334  GLN B CA    1 
ATOM   6710 C  C     . GLN B 2 335 ? -51.604  1.914   9.535   1.00 82.88  ? 334  GLN B C     1 
ATOM   6711 O  O     . GLN B 2 335 ? -50.462  2.360   9.675   1.00 79.72  ? 334  GLN B O     1 
ATOM   6712 C  CB    . GLN B 2 335 ? -52.518  4.258   9.828   1.00 96.83  ? 334  GLN B CB    1 
ATOM   6713 C  CG    . GLN B 2 335 ? -53.547  5.315   9.444   1.00 92.34  ? 334  GLN B CG    1 
ATOM   6714 C  CD    . GLN B 2 335 ? -53.467  5.731   7.984   1.00 99.85  ? 334  GLN B CD    1 
ATOM   6715 O  OE1   . GLN B 2 335 ? -52.392  5.740   7.381   1.00 102.10 ? 334  GLN B OE1   1 
ATOM   6716 N  NE2   . GLN B 2 335 ? -54.611  6.088   7.411   1.00 94.38  ? 334  GLN B NE2   1 
ATOM   6717 N  N     . GLY B 2 336 ? -51.888  0.614   9.598   1.00 77.44  ? 335  GLY B N     1 
ATOM   6718 C  CA    . GLY B 2 336 ? -50.875  -0.395  9.898   1.00 79.27  ? 335  GLY B CA    1 
ATOM   6719 C  C     . GLY B 2 336 ? -50.478  -0.407  11.362  1.00 88.54  ? 335  GLY B C     1 
ATOM   6720 O  O     . GLY B 2 336 ? -49.290  -0.391  11.689  1.00 100.34 ? 335  GLY B O     1 
ATOM   6721 N  N     . GLN B 2 337 ? -51.480  -0.426  12.241  1.00 90.26  ? 336  GLN B N     1 
ATOM   6722 C  CA    . GLN B 2 337 ? -51.264  -0.469  13.688  1.00 88.67  ? 336  GLN B CA    1 
ATOM   6723 C  C     . GLN B 2 337 ? -52.249  -1.425  14.359  1.00 85.25  ? 336  GLN B C     1 
ATOM   6724 O  O     . GLN B 2 337 ? -53.460  -1.336  14.140  1.00 82.30  ? 336  GLN B O     1 
ATOM   6725 C  CB    . GLN B 2 337 ? -51.387  0.931   14.302  1.00 88.68  ? 336  GLN B CB    1 
ATOM   6726 C  CG    . GLN B 2 337 ? -50.197  1.846   14.044  1.00 90.99  ? 336  GLN B CG    1 
ATOM   6727 C  CD    . GLN B 2 337 ? -50.370  3.236   14.634  1.00 104.52 ? 336  GLN B CD    1 
ATOM   6728 O  OE1   . GLN B 2 337 ? -51.483  3.667   14.939  1.00 118.45 ? 336  GLN B OE1   1 
ATOM   6729 N  NE2   . GLN B 2 337 ? -49.260  3.948   14.793  1.00 113.31 ? 336  GLN B NE2   1 
ATOM   6730 N  N     . TRP B 2 338 ? -51.717  -2.339  15.167  1.00 76.51  ? 337  TRP B N     1 
ATOM   6731 C  CA    . TRP B 2 338 ? -52.529  -3.317  15.891  1.00 73.03  ? 337  TRP B CA    1 
ATOM   6732 C  C     . TRP B 2 338 ? -52.114  -3.380  17.333  1.00 69.63  ? 337  TRP B C     1 
ATOM   6733 O  O     . TRP B 2 338 ? -50.922  -3.449  17.638  1.00 74.42  ? 337  TRP B O     1 
ATOM   6734 C  CB    . TRP B 2 338 ? -52.406  -4.701  15.256  1.00 71.50  ? 337  TRP B CB    1 
ATOM   6735 C  CG    . TRP B 2 338 ? -52.862  -4.777  13.816  1.00 73.91  ? 337  TRP B CG    1 
ATOM   6736 C  CD1   . TRP B 2 338 ? -52.181  -4.337  12.682  1.00 79.47  ? 337  TRP B CD1   1 
ATOM   6737 C  CD2   . TRP B 2 338 ? -54.117  -5.350  13.304  1.00 66.77  ? 337  TRP B CD2   1 
ATOM   6738 N  NE1   . TRP B 2 338 ? -52.909  -4.580  11.546  1.00 78.36  ? 337  TRP B NE1   1 
ATOM   6739 C  CE2   . TRP B 2 338 ? -54.077  -5.186  11.845  1.00 71.76  ? 337  TRP B CE2   1 
ATOM   6740 C  CE3   . TRP B 2 338 ? -55.228  -5.954  13.885  1.00 65.70  ? 337  TRP B CE3   1 
ATOM   6741 C  CZ2   . TRP B 2 338 ? -55.114  -5.615  11.028  1.00 73.46  ? 337  TRP B CZ2   1 
ATOM   6742 C  CZ3   . TRP B 2 338 ? -56.266  -6.384  13.049  1.00 63.93  ? 337  TRP B CZ3   1 
ATOM   6743 C  CH2   . TRP B 2 338 ? -56.208  -6.217  11.656  1.00 66.17  ? 337  TRP B CH2   1 
ATOM   6744 N  N     . THR B 2 339 ? -53.094  -3.354  18.233  1.00 64.25  ? 338  THR B N     1 
ATOM   6745 C  CA    . THR B 2 339 ? -52.835  -3.465  19.672  1.00 61.85  ? 338  THR B CA    1 
ATOM   6746 C  C     . THR B 2 339 ? -53.470  -4.727  20.260  1.00 54.90  ? 338  THR B C     1 
ATOM   6747 O  O     . THR B 2 339 ? -54.494  -5.204  19.764  1.00 54.85  ? 338  THR B O     1 
ATOM   6748 C  CB    . THR B 2 339 ? -53.287  -2.202  20.447  1.00 58.63  ? 338  THR B CB    1 
ATOM   6749 O  OG1   . THR B 2 339 ? -52.994  -2.358  21.841  1.00 71.63  ? 338  THR B OG1   1 
ATOM   6750 C  CG2   . THR B 2 339 ? -54.782  -1.939  20.268  1.00 55.05  ? 338  THR B CG2   1 
ATOM   6751 N  N     . TYR B 2 340 ? -52.855  -5.262  21.313  1.00 58.60  ? 339  TYR B N     1 
ATOM   6752 C  CA    . TYR B 2 340 ? -53.290  -6.528  21.904  1.00 58.89  ? 339  TYR B CA    1 
ATOM   6753 C  C     . TYR B 2 340 ? -53.239  -6.530  23.433  1.00 54.13  ? 339  TYR B C     1 
ATOM   6754 O  O     . TYR B 2 340 ? -52.463  -5.787  24.040  1.00 55.82  ? 339  TYR B O     1 
ATOM   6755 C  CB    . TYR B 2 340 ? -52.458  -7.692  21.343  1.00 52.02  ? 339  TYR B CB    1 
ATOM   6756 C  CG    . TYR B 2 340 ? -51.060  -7.808  21.921  1.00 53.99  ? 339  TYR B CG    1 
ATOM   6757 C  CD1   . TYR B 2 340 ? -50.045  -6.932  21.533  1.00 66.88  ? 339  TYR B CD1   1 
ATOM   6758 C  CD2   . TYR B 2 340 ? -50.754  -8.796  22.857  1.00 54.29  ? 339  TYR B CD2   1 
ATOM   6759 C  CE1   . TYR B 2 340 ? -48.768  -7.036  22.063  1.00 78.02  ? 339  TYR B CE1   1 
ATOM   6760 C  CE2   . TYR B 2 340 ? -49.479  -8.907  23.390  1.00 62.19  ? 339  TYR B CE2   1 
ATOM   6761 C  CZ    . TYR B 2 340 ? -48.490  -8.025  22.989  1.00 76.65  ? 339  TYR B CZ    1 
ATOM   6762 O  OH    . TYR B 2 340 ? -47.223  -8.132  23.515  1.00 90.00  ? 339  TYR B OH    1 
ATOM   6763 N  N     . GLN B 2 341 ? -54.075  -7.371  24.043  1.00 55.78  ? 340  GLN B N     1 
ATOM   6764 C  CA    . GLN B 2 341 ? -54.093  -7.553  25.495  1.00 45.91  ? 340  GLN B CA    1 
ATOM   6765 C  C     . GLN B 2 341 ? -54.134  -9.037  25.854  1.00 48.59  ? 340  GLN B C     1 
ATOM   6766 O  O     . GLN B 2 341 ? -54.880  -9.808  25.247  1.00 50.22  ? 340  GLN B O     1 
ATOM   6767 C  CB    . GLN B 2 341 ? -55.295  -6.844  26.133  1.00 57.78  ? 340  GLN B CB    1 
ATOM   6768 C  CG    . GLN B 2 341 ? -55.348  -5.336  25.931  1.00 57.32  ? 340  GLN B CG    1 
ATOM   6769 C  CD    . GLN B 2 341 ? -56.085  -4.935  24.666  1.00 53.18  ? 340  GLN B CD    1 
ATOM   6770 O  OE1   . GLN B 2 341 ? -57.161  -5.456  24.367  1.00 55.58  ? 340  GLN B OE1   1 
ATOM   6771 N  NE2   . GLN B 2 341 ? -55.513  -3.997  23.921  1.00 52.88  ? 340  GLN B NE2   1 
ATOM   6772 N  N     . ILE B 2 342 ? -53.330  -9.426  26.840  1.00 53.24  ? 341  ILE B N     1 
ATOM   6773 C  CA    . ILE B 2 342 ? -53.337  -10.795 27.359  1.00 41.30  ? 341  ILE B CA    1 
ATOM   6774 C  C     . ILE B 2 342 ? -53.877  -10.790 28.789  1.00 48.85  ? 341  ILE B C     1 
ATOM   6775 O  O     . ILE B 2 342 ? -53.312  -10.141 29.673  1.00 57.44  ? 341  ILE B O     1 
ATOM   6776 C  CB    . ILE B 2 342 ? -51.934  -11.446 27.314  1.00 50.23  ? 341  ILE B CB    1 
ATOM   6777 C  CG1   . ILE B 2 342 ? -51.342  -11.365 25.900  1.00 51.62  ? 341  ILE B CG1   1 
ATOM   6778 C  CG2   . ILE B 2 342 ? -52.002  -12.895 27.783  1.00 49.24  ? 341  ILE B CG2   1 
ATOM   6779 C  CD1   . ILE B 2 342 ? -49.853  -11.636 25.827  1.00 53.14  ? 341  ILE B CD1   1 
ATOM   6780 N  N     . TYR B 2 343 ? -54.975  -11.513 29.002  1.00 56.03  ? 342  TYR B N     1 
ATOM   6781 C  CA    . TYR B 2 343 ? -55.648  -11.545 30.301  1.00 55.52  ? 342  TYR B CA    1 
ATOM   6782 C  C     . TYR B 2 343 ? -56.339  -12.881 30.574  1.00 58.79  ? 342  TYR B C     1 
ATOM   6783 O  O     . TYR B 2 343 ? -56.596  -13.658 29.655  1.00 57.78  ? 342  TYR B O     1 
ATOM   6784 C  CB    . TYR B 2 343 ? -56.659  -10.391 30.413  1.00 51.16  ? 342  TYR B CB    1 
ATOM   6785 C  CG    . TYR B 2 343 ? -57.791  -10.432 29.404  1.00 45.92  ? 342  TYR B CG    1 
ATOM   6786 C  CD1   . TYR B 2 343 ? -57.654  -9.843  28.146  1.00 45.46  ? 342  TYR B CD1   1 
ATOM   6787 C  CD2   . TYR B 2 343 ? -59.005  -11.049 29.712  1.00 55.15  ? 342  TYR B CD2   1 
ATOM   6788 C  CE1   . TYR B 2 343 ? -58.688  -9.876  27.222  1.00 55.12  ? 342  TYR B CE1   1 
ATOM   6789 C  CE2   . TYR B 2 343 ? -60.044  -11.087 28.794  1.00 54.53  ? 342  TYR B CE2   1 
ATOM   6790 C  CZ    . TYR B 2 343 ? -59.881  -10.499 27.552  1.00 46.42  ? 342  TYR B CZ    1 
ATOM   6791 O  OH    . TYR B 2 343 ? -60.910  -10.534 26.639  1.00 54.60  ? 342  TYR B OH    1 
ATOM   6792 N  N     . GLN B 2 344 ? -56.628  -13.138 31.848  1.00 58.38  ? 343  GLN B N     1 
ATOM   6793 C  CA    . GLN B 2 344 ? -57.418  -14.300 32.253  1.00 54.63  ? 343  GLN B CA    1 
ATOM   6794 C  C     . GLN B 2 344 ? -58.809  -13.850 32.689  1.00 57.28  ? 343  GLN B C     1 
ATOM   6795 O  O     . GLN B 2 344 ? -59.798  -14.554 32.473  1.00 60.46  ? 343  GLN B O     1 
ATOM   6796 C  CB    . GLN B 2 344 ? -56.723  -15.064 33.382  1.00 59.93  ? 343  GLN B CB    1 
ATOM   6797 C  CG    . GLN B 2 344 ? -55.416  -15.725 32.971  1.00 58.66  ? 343  GLN B CG    1 
ATOM   6798 C  CD    . GLN B 2 344 ? -54.720  -16.422 34.122  1.00 71.01  ? 343  GLN B CD    1 
ATOM   6799 O  OE1   . GLN B 2 344 ? -53.648  -16.003 34.556  1.00 76.83  ? 343  GLN B OE1   1 
ATOM   6800 N  NE2   . GLN B 2 344 ? -55.328  -17.490 34.626  1.00 75.16  ? 343  GLN B NE2   1 
ATOM   6801 N  N     . GLU B 2 345 ? -58.866  -12.672 33.306  1.00 62.50  ? 344  GLU B N     1 
ATOM   6802 C  CA    . GLU B 2 345 ? -60.121  -12.032 33.689  1.00 63.21  ? 344  GLU B CA    1 
ATOM   6803 C  C     . GLU B 2 345 ? -60.196  -10.636 33.067  1.00 58.88  ? 344  GLU B C     1 
ATOM   6804 O  O     . GLU B 2 345 ? -59.171  -9.957  32.957  1.00 54.54  ? 344  GLU B O     1 
ATOM   6805 C  CB    . GLU B 2 345 ? -60.239  -11.945 35.213  1.00 66.72  ? 344  GLU B CB    1 
ATOM   6806 C  CG    . GLU B 2 345 ? -60.488  -13.282 35.898  1.00 75.02  ? 344  GLU B CG    1 
ATOM   6807 C  CD    . GLU B 2 345 ? -60.721  -13.152 37.393  1.00 104.47 ? 344  GLU B CD    1 
ATOM   6808 O  OE1   . GLU B 2 345 ? -60.034  -12.335 38.045  1.00 109.52 ? 344  GLU B OE1   1 
ATOM   6809 O  OE2   . GLU B 2 345 ? -61.595  -13.871 37.920  1.00 106.23 ? 344  GLU B OE2   1 
ATOM   6810 N  N     . PRO B 2 346 ? -61.406  -10.206 32.651  1.00 53.33  ? 345  PRO B N     1 
ATOM   6811 C  CA    . PRO B 2 346 ? -61.599  -8.902  32.003  1.00 53.50  ? 345  PRO B CA    1 
ATOM   6812 C  C     . PRO B 2 346 ? -61.072  -7.725  32.825  1.00 56.30  ? 345  PRO B C     1 
ATOM   6813 O  O     . PRO B 2 346 ? -61.190  -7.722  34.053  1.00 56.29  ? 345  PRO B O     1 
ATOM   6814 C  CB    . PRO B 2 346 ? -63.120  -8.804  31.860  1.00 57.77  ? 345  PRO B CB    1 
ATOM   6815 C  CG    . PRO B 2 346 ? -63.575  -10.219 31.786  1.00 62.82  ? 345  PRO B CG    1 
ATOM   6816 C  CD    . PRO B 2 346 ? -62.668  -10.970 32.717  1.00 59.63  ? 345  PRO B CD    1 
ATOM   6817 N  N     . PHE B 2 347 ? -60.487  -6.750  32.128  1.00 60.23  ? 346  PHE B N     1 
ATOM   6818 C  CA    . PHE B 2 347 ? -59.943  -5.517  32.722  1.00 59.32  ? 346  PHE B CA    1 
ATOM   6819 C  C     . PHE B 2 347 ? -58.754  -5.738  33.670  1.00 58.23  ? 346  PHE B C     1 
ATOM   6820 O  O     . PHE B 2 347 ? -58.362  -4.833  34.412  1.00 58.37  ? 346  PHE B O     1 
ATOM   6821 C  CB    . PHE B 2 347 ? -61.048  -4.687  33.400  1.00 57.12  ? 346  PHE B CB    1 
ATOM   6822 C  CG    . PHE B 2 347 ? -62.241  -4.427  32.520  1.00 63.44  ? 346  PHE B CG    1 
ATOM   6823 C  CD1   . PHE B 2 347 ? -62.183  -3.479  31.502  1.00 60.22  ? 346  PHE B CD1   1 
ATOM   6824 C  CD2   . PHE B 2 347 ? -63.427  -5.128  32.711  1.00 70.37  ? 346  PHE B CD2   1 
ATOM   6825 C  CE1   . PHE B 2 347 ? -63.282  -3.240  30.690  1.00 67.38  ? 346  PHE B CE1   1 
ATOM   6826 C  CE2   . PHE B 2 347 ? -64.530  -4.893  31.903  1.00 71.86  ? 346  PHE B CE2   1 
ATOM   6827 C  CZ    . PHE B 2 347 ? -64.457  -3.947  30.892  1.00 78.72  ? 346  PHE B CZ    1 
ATOM   6828 N  N     . LYS B 2 348 ? -58.184  -6.942  33.628  1.00 57.36  ? 347  LYS B N     1 
ATOM   6829 C  CA    . LYS B 2 348 ? -57.013  -7.293  34.431  1.00 57.96  ? 347  LYS B CA    1 
ATOM   6830 C  C     . LYS B 2 348 ? -55.939  -7.911  33.538  1.00 56.48  ? 347  LYS B C     1 
ATOM   6831 O  O     . LYS B 2 348 ? -55.828  -9.136  33.431  1.00 53.01  ? 347  LYS B O     1 
ATOM   6832 C  CB    . LYS B 2 348 ? -57.396  -8.254  35.563  1.00 52.64  ? 347  LYS B CB    1 
ATOM   6833 C  CG    . LYS B 2 348 ? -58.293  -7.646  36.630  1.00 56.24  ? 347  LYS B CG    1 
ATOM   6834 C  CD    . LYS B 2 348 ? -58.732  -8.693  37.641  1.00 71.79  ? 347  LYS B CD    1 
ATOM   6835 C  CE    . LYS B 2 348 ? -59.744  -8.126  38.624  1.00 80.11  ? 347  LYS B CE    1 
ATOM   6836 N  NZ    . LYS B 2 348 ? -59.142  -7.137  39.563  1.00 78.46  ? 347  LYS B NZ    1 
ATOM   6837 N  N     . ASN B 2 349 ? -55.152  -7.050  32.899  1.00 54.92  ? 348  ASN B N     1 
ATOM   6838 C  CA    . ASN B 2 349 ? -54.159  -7.480  31.917  1.00 51.56  ? 348  ASN B CA    1 
ATOM   6839 C  C     . ASN B 2 349 ? -52.820  -7.877  32.532  1.00 53.80  ? 348  ASN B C     1 
ATOM   6840 O  O     . ASN B 2 349 ? -52.249  -7.137  33.337  1.00 64.26  ? 348  ASN B O     1 
ATOM   6841 C  CB    . ASN B 2 349 ? -53.948  -6.393  30.857  1.00 52.52  ? 348  ASN B CB    1 
ATOM   6842 C  CG    . ASN B 2 349 ? -55.211  -6.085  30.069  1.00 48.96  ? 348  ASN B CG    1 
ATOM   6843 O  OD1   . ASN B 2 349 ? -56.029  -6.968  29.804  1.00 57.21  ? 348  ASN B OD1   1 
ATOM   6844 N  ND2   . ASN B 2 349 ? -55.369  -4.825  29.682  1.00 50.16  ? 348  ASN B ND2   1 
ATOM   6845 N  N     . LEU B 2 350 ? -52.332  -9.054  32.145  1.00 51.58  ? 349  LEU B N     1 
ATOM   6846 C  CA    . LEU B 2 350 ? -51.020  -9.539  32.569  1.00 53.61  ? 349  LEU B CA    1 
ATOM   6847 C  C     . LEU B 2 350 ? -49.918  -8.990  31.666  1.00 56.70  ? 349  LEU B C     1 
ATOM   6848 O  O     . LEU B 2 350 ? -48.817  -8.688  32.131  1.00 64.09  ? 349  LEU B O     1 
ATOM   6849 C  CB    . LEU B 2 350 ? -50.978  -11.073 32.573  1.00 50.48  ? 349  LEU B CB    1 
ATOM   6850 C  CG    . LEU B 2 350 ? -51.628  -11.839 33.732  1.00 65.68  ? 349  LEU B CG    1 
ATOM   6851 C  CD1   . LEU B 2 350 ? -53.131  -11.987 33.541  1.00 66.32  ? 349  LEU B CD1   1 
ATOM   6852 C  CD2   . LEU B 2 350 ? -50.980  -13.207 33.881  1.00 65.60  ? 349  LEU B CD2   1 
ATOM   6853 N  N     . LYS B 2 351 ? -50.227  -8.865  30.376  1.00 54.48  ? 350  LYS B N     1 
ATOM   6854 C  CA    . LYS B 2 351 ? -49.272  -8.383  29.382  1.00 59.46  ? 350  LYS B CA    1 
ATOM   6855 C  C     . LYS B 2 351 ? -49.982  -7.591  28.286  1.00 57.10  ? 350  LYS B C     1 
ATOM   6856 O  O     . LYS B 2 351 ? -50.945  -8.073  27.683  1.00 58.80  ? 350  LYS B O     1 
ATOM   6857 C  CB    . LYS B 2 351 ? -48.503  -9.561  28.771  1.00 62.16  ? 350  LYS B CB    1 
ATOM   6858 C  CG    . LYS B 2 351 ? -47.145  -9.206  28.181  1.00 76.28  ? 350  LYS B CG    1 
ATOM   6859 C  CD    . LYS B 2 351 ? -46.068  -9.146  29.254  1.00 82.21  ? 350  LYS B CD    1 
ATOM   6860 C  CE    . LYS B 2 351 ? -44.686  -8.999  28.640  1.00 93.00  ? 350  LYS B CE    1 
ATOM   6861 N  NZ    . LYS B 2 351 ? -43.621  -8.937  29.678  1.00 74.28  ? 350  LYS B NZ    1 
ATOM   6862 N  N     . THR B 2 352 ? -49.503  -6.373  28.041  1.00 59.24  ? 351  THR B N     1 
ATOM   6863 C  CA    . THR B 2 352 ? -50.054  -5.505  26.997  1.00 58.04  ? 351  THR B CA    1 
ATOM   6864 C  C     . THR B 2 352 ? -48.970  -4.985  26.054  1.00 70.98  ? 351  THR B C     1 
ATOM   6865 O  O     . THR B 2 352 ? -47.774  -5.131  26.321  1.00 85.63  ? 351  THR B O     1 
ATOM   6866 C  CB    . THR B 2 352 ? -50.836  -4.309  27.587  1.00 52.06  ? 351  THR B CB    1 
ATOM   6867 O  OG1   . THR B 2 352 ? -50.116  -3.757  28.696  1.00 72.25  ? 351  THR B OG1   1 
ATOM   6868 C  CG2   . THR B 2 352 ? -52.218  -4.743  28.049  1.00 50.36  ? 351  THR B CG2   1 
ATOM   6869 N  N     . GLY B 2 353 ? -49.403  -4.377  24.952  1.00 67.55  ? 352  GLY B N     1 
ATOM   6870 C  CA    . GLY B 2 353 ? -48.496  -3.814  23.955  1.00 78.88  ? 352  GLY B CA    1 
ATOM   6871 C  C     . GLY B 2 353 ? -49.184  -3.597  22.621  1.00 75.09  ? 352  GLY B C     1 
ATOM   6872 O  O     . GLY B 2 353 ? -50.406  -3.737  22.512  1.00 68.27  ? 352  GLY B O     1 
ATOM   6873 N  N     . LYS B 2 354 ? -48.397  -3.253  21.606  1.00 79.05  ? 353  LYS B N     1 
ATOM   6874 C  CA    . LYS B 2 354 ? -48.923  -3.044  20.257  1.00 81.84  ? 353  LYS B CA    1 
ATOM   6875 C  C     . LYS B 2 354 ? -47.955  -3.502  19.163  1.00 91.63  ? 353  LYS B C     1 
ATOM   6876 O  O     . LYS B 2 354 ? -46.802  -3.065  19.113  1.00 95.74  ? 353  LYS B O     1 
ATOM   6877 C  CB    . LYS B 2 354 ? -49.358  -1.583  20.044  1.00 80.74  ? 353  LYS B CB    1 
ATOM   6878 C  CG    . LYS B 2 354 ? -48.322  -0.528  20.419  1.00 88.58  ? 353  LYS B CG    1 
ATOM   6879 C  CD    . LYS B 2 354 ? -48.877  0.885   20.288  1.00 86.29  ? 353  LYS B CD    1 
ATOM   6880 C  CE    . LYS B 2 354 ? -48.918  1.352   18.840  1.00 91.34  ? 353  LYS B CE    1 
ATOM   6881 N  NZ    . LYS B 2 354 ? -49.489  2.722   18.715  1.00 84.14  ? 353  LYS B NZ    1 
ATOM   6882 N  N     . TYR B 2 355 ? -48.435  -4.396  18.302  1.00 103.15 ? 354  TYR B N     1 
ATOM   6883 C  CA    . TYR B 2 355 ? -47.690  -4.820  17.120  1.00 97.91  ? 354  TYR B CA    1 
ATOM   6884 C  C     . TYR B 2 355 ? -48.093  -3.961  15.927  1.00 95.01  ? 354  TYR B C     1 
ATOM   6885 O  O     . TYR B 2 355 ? -49.181  -4.128  15.371  1.00 92.23  ? 354  TYR B O     1 
ATOM   6886 C  CB    . TYR B 2 355 ? -47.934  -6.302  16.819  1.00 90.57  ? 354  TYR B CB    1 
ATOM   6887 C  CG    . TYR B 2 355 ? -47.074  -7.249  17.624  1.00 97.46  ? 354  TYR B CG    1 
ATOM   6888 C  CD1   . TYR B 2 355 ? -45.812  -7.633  17.169  1.00 105.16 ? 354  TYR B CD1   1 
ATOM   6889 C  CD2   . TYR B 2 355 ? -47.521  -7.769  18.838  1.00 92.34  ? 354  TYR B CD2   1 
ATOM   6890 C  CE1   . TYR B 2 355 ? -45.019  -8.502  17.901  1.00 100.61 ? 354  TYR B CE1   1 
ATOM   6891 C  CE2   . TYR B 2 355 ? -46.735  -8.639  19.578  1.00 90.88  ? 354  TYR B CE2   1 
ATOM   6892 C  CZ    . TYR B 2 355 ? -45.486  -9.001  19.106  1.00 97.04  ? 354  TYR B CZ    1 
ATOM   6893 O  OH    . TYR B 2 355 ? -44.704  -9.865  19.837  1.00 92.92  ? 354  TYR B OH    1 
ATOM   6894 N  N     . ALA B 2 356 ? -47.212  -3.040  15.548  1.00 99.34  ? 355  ALA B N     1 
ATOM   6895 C  CA    . ALA B 2 356 ? -47.485  -2.099  14.464  1.00 100.61 ? 355  ALA B CA    1 
ATOM   6896 C  C     . ALA B 2 356 ? -47.597  -2.798  13.107  1.00 106.96 ? 355  ALA B C     1 
ATOM   6897 O  O     . ALA B 2 356 ? -48.705  -3.072  12.638  1.00 107.74 ? 355  ALA B O     1 
ATOM   6898 C  CB    . ALA B 2 356 ? -46.429  -1.001  14.429  1.00 91.68  ? 355  ALA B CB    1 
ATOM   6899 N  N     . ARG B 2 357 ? -46.452  -3.098  12.495  1.00 100.77 ? 356  ARG B N     1 
ATOM   6900 C  CA    . ARG B 2 357 ? -46.411  -3.684  11.156  1.00 98.35  ? 356  ARG B CA    1 
ATOM   6901 C  C     . ARG B 2 357 ? -45.058  -4.327  10.866  1.00 103.94 ? 356  ARG B C     1 
ATOM   6902 O  O     . ARG B 2 357 ? -44.022  -3.859  11.347  1.00 107.60 ? 356  ARG B O     1 
ATOM   6903 C  CB    . ARG B 2 357 ? -46.690  -2.604  10.102  1.00 93.54  ? 356  ARG B CB    1 
ATOM   6904 C  CG    . ARG B 2 357 ? -46.933  -3.131  8.694   1.00 92.35  ? 356  ARG B CG    1 
ATOM   6905 C  CD    . ARG B 2 357 ? -46.389  -2.179  7.639   1.00 102.13 ? 356  ARG B CD    1 
ATOM   6906 N  NE    . ARG B 2 357 ? -47.150  -0.933  7.559   1.00 98.65  ? 356  ARG B NE    1 
ATOM   6907 C  CZ    . ARG B 2 357 ? -48.173  -0.724  6.735   1.00 96.37  ? 356  ARG B CZ    1 
ATOM   6908 N  NH1   . ARG B 2 357 ? -48.577  -1.678  5.904   1.00 95.55  ? 356  ARG B NH1   1 
ATOM   6909 N  NH2   . ARG B 2 357 ? -48.798  0.445   6.741   1.00 84.38  ? 356  ARG B NH2   1 
ATOM   6910 N  N     . MET B 2 358 ? -45.078  -5.402  10.081  1.00 107.02 ? 357  MET B N     1 
ATOM   6911 C  CA    . MET B 2 358 ? -43.863  -5.934  9.477   1.00 105.92 ? 357  MET B CA    1 
ATOM   6912 C  C     . MET B 2 358 ? -43.510  -5.007  8.315   1.00 111.36 ? 357  MET B C     1 
ATOM   6913 O  O     . MET B 2 358 ? -44.282  -4.865  7.363   1.00 114.85 ? 357  MET B O     1 
ATOM   6914 C  CB    . MET B 2 358 ? -44.072  -7.373  9.000   1.00 105.75 ? 357  MET B CB    1 
ATOM   6915 C  CG    . MET B 2 358 ? -42.836  -8.258  9.091   1.00 106.55 ? 357  MET B CG    1 
ATOM   6916 S  SD    . MET B 2 358 ? -42.546  -8.948  10.735  1.00 156.84 ? 357  MET B SD    1 
ATOM   6917 C  CE    . MET B 2 358 ? -41.512  -7.692  11.486  1.00 91.41  ? 357  MET B CE    1 
ATOM   6918 N  N     . ARG B 2 359 ? -42.340  -4.381  8.414   1.00 111.72 ? 358  ARG B N     1 
ATOM   6919 C  CA    . ARG B 2 359 ? -41.983  -3.186  7.636   1.00 111.64 ? 358  ARG B CA    1 
ATOM   6920 C  C     . ARG B 2 359 ? -42.135  -3.246  6.110   1.00 119.11 ? 358  ARG B C     1 
ATOM   6921 O  O     . ARG B 2 359 ? -41.628  -4.159  5.454   1.00 118.19 ? 358  ARG B O     1 
ATOM   6922 C  CB    . ARG B 2 359 ? -40.563  -2.731  7.993   1.00 99.00  ? 358  ARG B CB    1 
ATOM   6923 N  N     . GLY B 2 360 ? -42.849  -2.256  5.572   1.00 114.40 ? 359  GLY B N     1 
ATOM   6924 C  CA    . GLY B 2 360 ? -42.878  -1.962  4.137   1.00 112.53 ? 359  GLY B CA    1 
ATOM   6925 C  C     . GLY B 2 360 ? -43.574  -2.950  3.219   1.00 110.38 ? 359  GLY B C     1 
ATOM   6926 O  O     . GLY B 2 360 ? -44.797  -3.101  3.267   1.00 106.65 ? 359  GLY B O     1 
ATOM   6927 N  N     . ALA B 2 361 ? -42.763  -3.610  2.390   1.00 110.53 ? 360  ALA B N     1 
ATOM   6928 C  CA    . ALA B 2 361 ? -43.178  -4.543  1.320   1.00 104.52 ? 360  ALA B CA    1 
ATOM   6929 C  C     . ALA B 2 361 ? -44.682  -4.689  1.026   1.00 103.32 ? 360  ALA B C     1 
ATOM   6930 O  O     . ALA B 2 361 ? -45.353  -3.721  0.655   1.00 94.44  ? 360  ALA B O     1 
ATOM   6931 C  CB    . ALA B 2 361 ? -42.528  -5.908  1.534   1.00 98.25  ? 360  ALA B CB    1 
ATOM   6932 N  N     . HIS B 2 362 ? -45.151  -5.919  1.224   1.00 104.13 ? 361  HIS B N     1 
ATOM   6933 C  CA    . HIS B 2 362 ? -46.493  -6.398  0.931   1.00 100.63 ? 361  HIS B CA    1 
ATOM   6934 C  C     . HIS B 2 362 ? -47.213  -6.804  2.205   1.00 100.59 ? 361  HIS B C     1 
ATOM   6935 O  O     . HIS B 2 362 ? -46.980  -7.901  2.681   1.00 99.13  ? 361  HIS B O     1 
ATOM   6936 C  CB    . HIS B 2 362 ? -46.352  -7.711  0.181   1.00 103.30 ? 361  HIS B CB    1 
ATOM   6937 C  CG    . HIS B 2 362 ? -46.309  -7.579  -1.302  1.00 109.50 ? 361  HIS B CG    1 
ATOM   6938 N  ND1   . HIS B 2 362 ? -46.863  -6.514  -1.971  1.00 112.79 ? 361  HIS B ND1   1 
ATOM   6939 C  CD2   . HIS B 2 362 ? -45.796  -8.397  -2.248  1.00 104.57 ? 361  HIS B CD2   1 
ATOM   6940 C  CE1   . HIS B 2 362 ? -46.682  -6.675  -3.269  1.00 114.57 ? 361  HIS B CE1   1 
ATOM   6941 N  NE2   . HIS B 2 362 ? -46.039  -7.811  -3.464  1.00 104.80 ? 361  HIS B NE2   1 
ATOM   6942 N  N     . THR B 2 363 ? -48.096  -5.978  2.751   1.00 98.63  ? 362  THR B N     1 
ATOM   6943 C  CA    . THR B 2 363 ? -48.835  -6.368  3.951   1.00 90.22  ? 362  THR B CA    1 
ATOM   6944 C  C     . THR B 2 363 ? -50.303  -5.962  3.864   1.00 81.23  ? 362  THR B C     1 
ATOM   6945 O  O     . THR B 2 363 ? -50.630  -4.862  3.411   1.00 76.72  ? 362  THR B O     1 
ATOM   6946 C  CB    . THR B 2 363 ? -48.221  -5.762  5.232   1.00 93.57  ? 362  THR B CB    1 
ATOM   6947 O  OG1   . THR B 2 363 ? -47.942  -4.371  5.025   1.00 97.88  ? 362  THR B OG1   1 
ATOM   6948 C  CG2   . THR B 2 363 ? -46.934  -6.485  5.616   1.00 94.52  ? 362  THR B CG2   1 
ATOM   6949 N  N     . ASN B 2 364 ? -51.178  -6.864  4.300   1.00 77.79  ? 363  ASN B N     1 
ATOM   6950 C  CA    . ASN B 2 364 ? -52.616  -6.607  4.349   1.00 76.62  ? 363  ASN B CA    1 
ATOM   6951 C  C     . ASN B 2 364 ? -53.184  -6.802  5.757   1.00 83.22  ? 363  ASN B C     1 
ATOM   6952 O  O     . ASN B 2 364 ? -52.433  -7.050  6.704   1.00 84.63  ? 363  ASN B O     1 
ATOM   6953 C  CB    . ASN B 2 364 ? -53.360  -7.471  3.319   1.00 75.48  ? 363  ASN B CB    1 
ATOM   6954 C  CG    . ASN B 2 364 ? -52.994  -8.943  3.408   1.00 83.17  ? 363  ASN B CG    1 
ATOM   6955 O  OD1   . ASN B 2 364 ? -53.284  -9.611  4.401   1.00 84.51  ? 363  ASN B OD1   1 
ATOM   6956 N  ND2   . ASN B 2 364 ? -52.367  -9.458  2.358   1.00 83.53  ? 363  ASN B ND2   1 
ATOM   6957 N  N     . ASP B 2 365 ? -54.505  -6.685  5.886   1.00 82.18  ? 364  ASP B N     1 
ATOM   6958 C  CA    . ASP B 2 365 ? -55.184  -6.815  7.177   1.00 72.60  ? 364  ASP B CA    1 
ATOM   6959 C  C     . ASP B 2 365 ? -55.101  -8.225  7.763   1.00 69.51  ? 364  ASP B C     1 
ATOM   6960 O  O     . ASP B 2 365 ? -55.088  -8.394  8.985   1.00 73.77  ? 364  ASP B O     1 
ATOM   6961 C  CB    . ASP B 2 365 ? -56.648  -6.376  7.060   1.00 69.81  ? 364  ASP B CB    1 
ATOM   6962 C  CG    . ASP B 2 365 ? -56.798  -4.882  6.813   1.00 76.14  ? 364  ASP B CG    1 
ATOM   6963 O  OD1   . ASP B 2 365 ? -56.020  -4.090  7.390   1.00 72.02  ? 364  ASP B OD1   1 
ATOM   6964 O  OD2   . ASP B 2 365 ? -57.705  -4.498  6.045   1.00 75.00  ? 364  ASP B OD2   1 
ATOM   6965 N  N     . VAL B 2 366 ? -55.045  -9.227  6.888   1.00 65.42  ? 365  VAL B N     1 
ATOM   6966 C  CA    . VAL B 2 366 ? -54.933  -10.626 7.305   1.00 69.98  ? 365  VAL B CA    1 
ATOM   6967 C  C     . VAL B 2 366 ? -53.494  -10.963 7.710   1.00 71.78  ? 365  VAL B C     1 
ATOM   6968 O  O     . VAL B 2 366 ? -53.268  -11.550 8.770   1.00 72.28  ? 365  VAL B O     1 
ATOM   6969 C  CB    . VAL B 2 366 ? -55.433  -11.597 6.206   1.00 62.60  ? 365  VAL B CB    1 
ATOM   6970 C  CG1   . VAL B 2 366 ? -55.266  -13.048 6.638   1.00 55.59  ? 365  VAL B CG1   1 
ATOM   6971 C  CG2   . VAL B 2 366 ? -56.891  -11.318 5.868   1.00 58.90  ? 365  VAL B CG2   1 
ATOM   6972 N  N     . LYS B 2 367 ? -52.534  -10.575 6.868   1.00 72.53  ? 366  LYS B N     1 
ATOM   6973 C  CA    . LYS B 2 367 ? -51.114  -10.860 7.095   1.00 74.08  ? 366  LYS B CA    1 
ATOM   6974 C  C     . LYS B 2 367 ? -50.593  -10.251 8.399   1.00 79.13  ? 366  LYS B C     1 
ATOM   6975 O  O     . LYS B 2 367 ? -49.889  -10.918 9.160   1.00 75.93  ? 366  LYS B O     1 
ATOM   6976 C  CB    . LYS B 2 367 ? -50.270  -10.380 5.906   1.00 78.52  ? 366  LYS B CB    1 
ATOM   6977 C  CG    . LYS B 2 367 ? -48.810  -10.808 5.959   1.00 83.45  ? 366  LYS B CG    1 
ATOM   6978 C  CD    . LYS B 2 367 ? -48.027  -10.267 4.775   1.00 93.35  ? 366  LYS B CD    1 
ATOM   6979 C  CE    . LYS B 2 367 ? -46.566  -10.684 4.844   1.00 101.92 ? 366  LYS B CE    1 
ATOM   6980 N  NZ    . LYS B 2 367 ? -45.783  -10.163 3.690   1.00 107.27 ? 366  LYS B NZ    1 
ATOM   6981 N  N     . GLN B 2 368 ? -50.947  -8.990  8.648   1.00 81.98  ? 367  GLN B N     1 
ATOM   6982 C  CA    . GLN B 2 368 ? -50.539  -8.282  9.864   1.00 82.42  ? 367  GLN B CA    1 
ATOM   6983 C  C     . GLN B 2 368 ? -51.137  -8.905  11.125  1.00 81.43  ? 367  GLN B C     1 
ATOM   6984 O  O     . GLN B 2 368 ? -50.518  -8.878  12.191  1.00 81.00  ? 367  GLN B O     1 
ATOM   6985 C  CB    . GLN B 2 368 ? -50.916  -6.800  9.780   1.00 80.73  ? 367  GLN B CB    1 
ATOM   6986 C  CG    . GLN B 2 368 ? -50.046  -5.984  8.834   1.00 85.56  ? 367  GLN B CG    1 
ATOM   6987 C  CD    . GLN B 2 368 ? -50.481  -4.533  8.732   1.00 87.50  ? 367  GLN B CD    1 
ATOM   6988 O  OE1   . GLN B 2 368 ? -50.821  -3.897  9.732   1.00 95.35  ? 367  GLN B OE1   1 
ATOM   6989 N  NE2   . GLN B 2 368 ? -50.463  -3.997  7.517   1.00 83.18  ? 367  GLN B NE2   1 
ATOM   6990 N  N     . LEU B 2 369 ? -52.340  -9.461  10.992  1.00 77.75  ? 368  LEU B N     1 
ATOM   6991 C  CA    . LEU B 2 369 ? -53.006  -10.164 12.087  1.00 69.27  ? 368  LEU B CA    1 
ATOM   6992 C  C     . LEU B 2 369 ? -52.398  -11.552 12.299  1.00 66.94  ? 368  LEU B C     1 
ATOM   6993 O  O     . LEU B 2 369 ? -52.234  -11.993 13.437  1.00 63.51  ? 368  LEU B O     1 
ATOM   6994 C  CB    . LEU B 2 369 ? -54.513  -10.266 11.820  1.00 62.81  ? 368  LEU B CB    1 
ATOM   6995 C  CG    . LEU B 2 369 ? -55.441  -10.814 12.912  1.00 56.32  ? 368  LEU B CG    1 
ATOM   6996 C  CD1   . LEU B 2 369 ? -55.517  -9.881  14.114  1.00 64.02  ? 368  LEU B CD1   1 
ATOM   6997 C  CD2   . LEU B 2 369 ? -56.831  -11.059 12.343  1.00 55.40  ? 368  LEU B CD2   1 
ATOM   6998 N  N     . THR B 2 370 ? -52.068  -12.226 11.197  1.00 72.35  ? 369  THR B N     1 
ATOM   6999 C  CA    . THR B 2 370 ? -51.448  -13.555 11.229  1.00 70.82  ? 369  THR B CA    1 
ATOM   7000 C  C     . THR B 2 370 ? -50.048  -13.500 11.849  1.00 78.64  ? 369  THR B C     1 
ATOM   7001 O  O     . THR B 2 370 ? -49.664  -14.392 12.610  1.00 76.83  ? 369  THR B O     1 
ATOM   7002 C  CB    . THR B 2 370 ? -51.379  -14.179 9.815   1.00 69.35  ? 369  THR B CB    1 
ATOM   7003 O  OG1   . THR B 2 370 ? -52.664  -14.092 9.186   1.00 66.34  ? 369  THR B OG1   1 
ATOM   7004 C  CG2   . THR B 2 370 ? -50.957  -15.643 9.878   1.00 69.82  ? 369  THR B CG2   1 
ATOM   7005 N  N     . GLU B 2 371 ? -49.302  -12.446 11.522  1.00 82.24  ? 370  GLU B N     1 
ATOM   7006 C  CA    . GLU B 2 371 ? -47.972  -12.214 12.088  1.00 83.64  ? 370  GLU B CA    1 
ATOM   7007 C  C     . GLU B 2 371 ? -48.041  -11.858 13.573  1.00 79.93  ? 370  GLU B C     1 
ATOM   7008 O  O     . GLU B 2 371 ? -47.116  -12.156 14.331  1.00 81.23  ? 370  GLU B O     1 
ATOM   7009 C  CB    . GLU B 2 371 ? -47.243  -11.108 11.320  1.00 90.04  ? 370  GLU B CB    1 
ATOM   7010 C  CG    . GLU B 2 371 ? -46.744  -11.522 9.942   1.00 100.78 ? 370  GLU B CG    1 
ATOM   7011 C  CD    . GLU B 2 371 ? -46.296  -10.345 9.093   1.00 115.38 ? 370  GLU B CD    1 
ATOM   7012 O  OE1   . GLU B 2 371 ? -46.918  -9.263  9.178   1.00 108.75 ? 370  GLU B OE1   1 
ATOM   7013 O  OE2   . GLU B 2 371 ? -45.317  -10.503 8.333   1.00 121.81 ? 370  GLU B OE2   1 
ATOM   7014 N  N     . ALA B 2 372 ? -49.141  -11.222 13.975  1.00 79.25  ? 371  ALA B N     1 
ATOM   7015 C  CA    . ALA B 2 372 ? -49.363  -10.841 15.368  1.00 77.82  ? 371  ALA B CA    1 
ATOM   7016 C  C     . ALA B 2 372 ? -49.727  -12.043 16.237  1.00 70.51  ? 371  ALA B C     1 
ATOM   7017 O  O     . ALA B 2 372 ? -49.149  -12.231 17.309  1.00 70.33  ? 371  ALA B O     1 
ATOM   7018 C  CB    . ALA B 2 372 ? -50.435  -9.764  15.463  1.00 63.71  ? 371  ALA B CB    1 
ATOM   7019 N  N     . VAL B 2 373 ? -50.678  -12.851 15.764  1.00 68.45  ? 372  VAL B N     1 
ATOM   7020 C  CA    . VAL B 2 373 ? -51.141  -14.047 16.482  1.00 65.47  ? 372  VAL B CA    1 
ATOM   7021 C  C     . VAL B 2 373 ? -49.983  -15.000 16.798  1.00 70.38  ? 372  VAL B C     1 
ATOM   7022 O  O     . VAL B 2 373 ? -49.847  -15.458 17.935  1.00 69.63  ? 372  VAL B O     1 
ATOM   7023 C  CB    . VAL B 2 373 ? -52.266  -14.782 15.707  1.00 61.66  ? 372  VAL B CB    1 
ATOM   7024 C  CG1   . VAL B 2 373 ? -52.542  -16.159 16.298  1.00 60.22  ? 372  VAL B CG1   1 
ATOM   7025 C  CG2   . VAL B 2 373 ? -53.542  -13.952 15.702  1.00 55.17  ? 372  VAL B CG2   1 
ATOM   7026 N  N     . GLN B 2 374 ? -49.150  -15.273 15.794  1.00 70.88  ? 373  GLN B N     1 
ATOM   7027 C  CA    . GLN B 2 374 ? -47.981  -16.143 15.952  1.00 76.35  ? 373  GLN B CA    1 
ATOM   7028 C  C     . GLN B 2 374 ? -46.964  -15.580 16.946  1.00 77.85  ? 373  GLN B C     1 
ATOM   7029 O  O     . GLN B 2 374 ? -46.344  -16.333 17.698  1.00 79.39  ? 373  GLN B O     1 
ATOM   7030 C  CB    . GLN B 2 374 ? -47.307  -16.399 14.601  1.00 78.14  ? 373  GLN B CB    1 
ATOM   7031 C  CG    . GLN B 2 374 ? -48.104  -17.288 13.657  1.00 79.56  ? 373  GLN B CG    1 
ATOM   7032 C  CD    . GLN B 2 374 ? -47.362  -17.611 12.371  1.00 79.18  ? 373  GLN B CD    1 
ATOM   7033 O  OE1   . GLN B 2 374 ? -47.310  -18.766 11.948  1.00 79.23  ? 373  GLN B OE1   1 
ATOM   7034 N  NE2   . GLN B 2 374 ? -46.784  -16.591 11.743  1.00 81.45  ? 373  GLN B NE2   1 
ATOM   7035 N  N     . LYS B 2 375 ? -46.805  -14.257 16.942  1.00 76.11  ? 374  LYS B N     1 
ATOM   7036 C  CA    . LYS B 2 375 ? -45.881  -13.573 17.847  1.00 75.68  ? 374  LYS B CA    1 
ATOM   7037 C  C     . LYS B 2 375 ? -46.388  -13.558 19.290  1.00 69.31  ? 374  LYS B C     1 
ATOM   7038 O  O     . LYS B 2 375 ? -45.597  -13.672 20.229  1.00 71.93  ? 374  LYS B O     1 
ATOM   7039 C  CB    . LYS B 2 375 ? -45.615  -12.145 17.365  1.00 80.94  ? 374  LYS B CB    1 
ATOM   7040 N  N     . ILE B 2 376 ? -47.702  -13.414 19.455  1.00 68.22  ? 375  ILE B N     1 
ATOM   7041 C  CA    . ILE B 2 376 ? -48.340  -13.439 20.776  1.00 66.99  ? 375  ILE B CA    1 
ATOM   7042 C  C     . ILE B 2 376 ? -48.315  -14.854 21.364  1.00 70.74  ? 375  ILE B C     1 
ATOM   7043 O  O     . ILE B 2 376 ? -48.078  -15.031 22.562  1.00 75.14  ? 375  ILE B O     1 
ATOM   7044 C  CB    . ILE B 2 376 ? -49.787  -12.885 20.726  1.00 57.72  ? 375  ILE B CB    1 
ATOM   7045 C  CG1   . ILE B 2 376 ? -49.778  -11.397 20.351  1.00 59.86  ? 375  ILE B CG1   1 
ATOM   7046 C  CG2   . ILE B 2 376 ? -50.497  -13.074 22.062  1.00 59.46  ? 375  ILE B CG2   1 
ATOM   7047 C  CD1   . ILE B 2 376 ? -51.084  -10.890 19.775  1.00 52.36  ? 375  ILE B CD1   1 
ATOM   7048 N  N     . THR B 2 377 ? -48.546  -15.852 20.509  1.00 72.17  ? 376  THR B N     1 
ATOM   7049 C  CA    . THR B 2 377 ? -48.525  -17.261 20.912  1.00 70.39  ? 376  THR B CA    1 
ATOM   7050 C  C     . THR B 2 377 ? -47.135  -17.686 21.396  1.00 76.50  ? 376  THR B C     1 
ATOM   7051 O  O     . THR B 2 377 ? -47.014  -18.380 22.408  1.00 71.44  ? 376  THR B O     1 
ATOM   7052 C  CB    . THR B 2 377 ? -48.990  -18.190 19.766  1.00 62.96  ? 376  THR B CB    1 
ATOM   7053 O  OG1   . THR B 2 377 ? -50.223  -17.704 19.220  1.00 60.56  ? 376  THR B OG1   1 
ATOM   7054 C  CG2   . THR B 2 377 ? -49.199  -19.617 20.265  1.00 65.54  ? 376  THR B CG2   1 
ATOM   7055 N  N     . THR B 2 378 ? -46.099  -17.256 20.676  1.00 74.63  ? 377  THR B N     1 
ATOM   7056 C  CA    . THR B 2 378 ? -44.709  -17.571 21.023  1.00 75.38  ? 377  THR B CA    1 
ATOM   7057 C  C     . THR B 2 378 ? -44.313  -16.956 22.369  1.00 78.64  ? 377  THR B C     1 
ATOM   7058 O  O     . THR B 2 378 ? -43.599  -17.582 23.156  1.00 87.53  ? 377  THR B O     1 
ATOM   7059 C  CB    . THR B 2 378 ? -43.726  -17.116 19.920  1.00 75.10  ? 377  THR B CB    1 
ATOM   7060 O  OG1   . THR B 2 378 ? -44.229  -17.504 18.635  1.00 83.76  ? 377  THR B OG1   1 
ATOM   7061 C  CG2   . THR B 2 378 ? -42.350  -17.742 20.120  1.00 78.02  ? 377  THR B CG2   1 
ATOM   7062 N  N     . GLU B 2 379 ? -44.788  -15.737 22.626  1.00 75.38  ? 378  GLU B N     1 
ATOM   7063 C  CA    . GLU B 2 379 ? -44.558  -15.054 23.901  1.00 78.21  ? 378  GLU B CA    1 
ATOM   7064 C  C     . GLU B 2 379 ? -45.274  -15.748 25.060  1.00 74.48  ? 378  GLU B C     1 
ATOM   7065 O  O     . GLU B 2 379 ? -44.781  -15.746 26.190  1.00 75.12  ? 378  GLU B O     1 
ATOM   7066 C  CB    . GLU B 2 379 ? -45.003  -13.590 23.821  1.00 77.83  ? 378  GLU B CB    1 
ATOM   7067 C  CG    . GLU B 2 379 ? -44.056  -12.682 23.048  1.00 86.92  ? 378  GLU B CG    1 
ATOM   7068 C  CD    . GLU B 2 379 ? -44.510  -11.231 23.014  1.00 92.43  ? 378  GLU B CD    1 
ATOM   7069 O  OE1   . GLU B 2 379 ? -45.540  -10.898 23.640  1.00 83.26  ? 378  GLU B OE1   1 
ATOM   7070 O  OE2   . GLU B 2 379 ? -43.829  -10.416 22.357  1.00 95.55  ? 378  GLU B OE2   1 
ATOM   7071 N  N     . SER B 2 380 ? -46.431  -16.338 24.767  1.00 73.41  ? 379  SER B N     1 
ATOM   7072 C  CA    . SER B 2 380 ? -47.243  -17.029 25.770  1.00 73.42  ? 379  SER B CA    1 
ATOM   7073 C  C     . SER B 2 380 ? -46.616  -18.341 26.243  1.00 79.58  ? 379  SER B C     1 
ATOM   7074 O  O     . SER B 2 380 ? -46.806  -18.746 27.392  1.00 79.62  ? 379  SER B O     1 
ATOM   7075 C  CB    . SER B 2 380 ? -48.653  -17.284 25.232  1.00 71.32  ? 379  SER B CB    1 
ATOM   7076 O  OG    . SER B 2 380 ? -49.312  -16.066 24.929  1.00 66.86  ? 379  SER B OG    1 
ATOM   7077 N  N     . ILE B 2 381 ? -45.874  -18.996 25.352  1.00 77.27  ? 380  ILE B N     1 
ATOM   7078 C  CA    . ILE B 2 381 ? -45.222  -20.273 25.656  1.00 77.52  ? 380  ILE B CA    1 
ATOM   7079 C  C     . ILE B 2 381 ? -43.970  -20.078 26.521  1.00 78.37  ? 380  ILE B C     1 
ATOM   7080 O  O     . ILE B 2 381 ? -43.684  -20.893 27.402  1.00 80.98  ? 380  ILE B O     1 
ATOM   7081 C  CB    . ILE B 2 381 ? -44.885  -21.063 24.366  1.00 78.27  ? 380  ILE B CB    1 
ATOM   7082 C  CG1   . ILE B 2 381 ? -46.162  -21.339 23.561  1.00 79.97  ? 380  ILE B CG1   1 
ATOM   7083 C  CG2   . ILE B 2 381 ? -44.187  -22.378 24.696  1.00 84.81  ? 380  ILE B CG2   1 
ATOM   7084 C  CD1   . ILE B 2 381 ? -45.929  -21.643 22.095  1.00 78.67  ? 380  ILE B CD1   1 
ATOM   7085 N  N     . VAL B 2 382 ? -43.240  -18.993 26.271  1.00 75.18  ? 381  VAL B N     1 
ATOM   7086 C  CA    . VAL B 2 382 ? -42.016  -18.681 27.017  1.00 75.29  ? 381  VAL B CA    1 
ATOM   7087 C  C     . VAL B 2 382 ? -42.320  -18.318 28.475  1.00 81.95  ? 381  VAL B C     1 
ATOM   7088 O  O     . VAL B 2 382 ? -41.666  -18.818 29.395  1.00 86.66  ? 381  VAL B O     1 
ATOM   7089 C  CB    . VAL B 2 382 ? -41.199  -17.555 26.333  1.00 71.51  ? 381  VAL B CB    1 
ATOM   7090 C  CG1   . VAL B 2 382 ? -39.966  -17.194 27.151  1.00 84.25  ? 381  VAL B CG1   1 
ATOM   7091 C  CG2   . VAL B 2 382 ? -40.787  -17.969 24.927  1.00 67.46  ? 381  VAL B CG2   1 
ATOM   7092 N  N     . ILE B 2 383 ? -43.322  -17.465 28.677  1.00 76.91  ? 382  ILE B N     1 
ATOM   7093 C  CA    . ILE B 2 383 ? -43.672  -16.972 30.012  1.00 75.31  ? 382  ILE B CA    1 
ATOM   7094 C  C     . ILE B 2 383 ? -44.493  -17.986 30.816  1.00 74.70  ? 382  ILE B C     1 
ATOM   7095 O  O     . ILE B 2 383 ? -44.204  -18.227 31.992  1.00 80.40  ? 382  ILE B O     1 
ATOM   7096 C  CB    . ILE B 2 383 ? -44.408  -15.609 29.949  1.00 71.19  ? 382  ILE B CB    1 
ATOM   7097 C  CG1   . ILE B 2 383 ? -43.606  -14.598 29.119  1.00 68.28  ? 382  ILE B CG1   1 
ATOM   7098 C  CG2   . ILE B 2 383 ? -44.656  -15.061 31.350  1.00 73.16  ? 382  ILE B CG2   1 
ATOM   7099 C  CD1   . ILE B 2 383 ? -44.403  -13.400 28.644  1.00 60.17  ? 382  ILE B CD1   1 
ATOM   7100 N  N     . TRP B 2 384 ? -45.499  -18.586 30.180  1.00 72.90  ? 383  TRP B N     1 
ATOM   7101 C  CA    . TRP B 2 384 ? -46.432  -19.475 30.881  1.00 82.06  ? 383  TRP B CA    1 
ATOM   7102 C  C     . TRP B 2 384 ? -46.399  -20.901 30.404  1.00 87.01  ? 383  TRP B C     1 
ATOM   7103 O  O     . TRP B 2 384 ? -46.401  -21.827 31.217  1.00 91.67  ? 383  TRP B O     1 
ATOM   7104 C  CB    . TRP B 2 384 ? -47.855  -18.927 30.805  1.00 84.37  ? 383  TRP B CB    1 
ATOM   7105 C  CG    . TRP B 2 384 ? -47.969  -17.480 31.226  1.00 77.30  ? 383  TRP B CG    1 
ATOM   7106 C  CD1   . TRP B 2 384 ? -47.820  -16.952 32.506  1.00 74.55  ? 383  TRP B CD1   1 
ATOM   7107 C  CD2   . TRP B 2 384 ? -48.264  -16.322 30.370  1.00 72.09  ? 383  TRP B CD2   1 
ATOM   7108 N  NE1   . TRP B 2 384 ? -47.997  -15.592 32.499  1.00 69.44  ? 383  TRP B NE1   1 
ATOM   7109 C  CE2   . TRP B 2 384 ? -48.266  -15.149 31.253  1.00 67.94  ? 383  TRP B CE2   1 
ATOM   7110 C  CE3   . TRP B 2 384 ? -48.517  -16.145 29.014  1.00 76.38  ? 383  TRP B CE3   1 
ATOM   7111 C  CZ2   . TRP B 2 384 ? -48.512  -13.869 30.776  1.00 72.35  ? 383  TRP B CZ2   1 
ATOM   7112 C  CZ3   . TRP B 2 384 ? -48.764  -14.849 28.544  1.00 70.39  ? 383  TRP B CZ3   1 
ATOM   7113 C  CH2   . TRP B 2 384 ? -48.761  -13.740 29.406  1.00 65.24  ? 383  TRP B CH2   1 
ATOM   7114 N  N     . GLY B 2 385 ? -46.382  -21.093 29.087  1.00 83.96  ? 384  GLY B N     1 
ATOM   7115 C  CA    . GLY B 2 385 ? -46.361  -22.433 28.501  1.00 86.90  ? 384  GLY B CA    1 
ATOM   7116 C  C     . GLY B 2 385 ? -47.720  -22.928 28.039  1.00 90.90  ? 384  GLY B C     1 
ATOM   7117 O  O     . GLY B 2 385 ? -47.919  -24.131 27.863  1.00 93.94  ? 384  GLY B O     1 
ATOM   7118 N  N     . LYS B 2 386 ? -48.655  -21.999 27.848  1.00 84.51  ? 385  LYS B N     1 
ATOM   7119 C  CA    . LYS B 2 386 ? -49.997  -22.325 27.364  1.00 84.45  ? 385  LYS B CA    1 
ATOM   7120 C  C     . LYS B 2 386 ? -50.443  -21.380 26.251  1.00 82.10  ? 385  LYS B C     1 
ATOM   7121 O  O     . LYS B 2 386 ? -50.116  -20.191 26.266  1.00 77.13  ? 385  LYS B O     1 
ATOM   7122 C  CB    . LYS B 2 386 ? -51.018  -22.298 28.507  1.00 83.80  ? 385  LYS B CB    1 
ATOM   7123 C  CG    . LYS B 2 386 ? -50.925  -23.473 29.472  1.00 97.47  ? 385  LYS B CG    1 
ATOM   7124 C  CD    . LYS B 2 386 ? -52.254  -23.749 30.165  1.00 99.48  ? 385  LYS B CD    1 
ATOM   7125 C  CE    . LYS B 2 386 ? -52.592  -22.699 31.215  1.00 87.91  ? 385  LYS B CE    1 
ATOM   7126 N  NZ    . LYS B 2 386 ? -53.908  -22.963 31.860  1.00 95.62  ? 385  LYS B NZ    1 
ATOM   7127 N  N     . THR B 2 387 ? -51.192  -21.921 25.293  1.00 80.71  ? 386  THR B N     1 
ATOM   7128 C  CA    . THR B 2 387 ? -51.728  -21.139 24.180  1.00 69.86  ? 386  THR B CA    1 
ATOM   7129 C  C     . THR B 2 387 ? -53.032  -20.444 24.582  1.00 69.34  ? 386  THR B C     1 
ATOM   7130 O  O     . THR B 2 387 ? -53.939  -21.090 25.114  1.00 71.52  ? 386  THR B O     1 
ATOM   7131 C  CB    . THR B 2 387 ? -51.970  -22.009 22.927  1.00 82.22  ? 386  THR B CB    1 
ATOM   7132 O  OG1   . THR B 2 387 ? -52.791  -23.132 23.271  1.00 113.48 ? 386  THR B OG1   1 
ATOM   7133 C  CG2   . THR B 2 387 ? -50.649  -22.507 22.350  1.00 70.74  ? 386  THR B CG2   1 
ATOM   7134 N  N     . PRO B 2 388 ? -53.128  -19.123 24.331  1.00 66.21  ? 387  PRO B N     1 
ATOM   7135 C  CA    . PRO B 2 388 ? -54.306  -18.351 24.730  1.00 65.67  ? 387  PRO B CA    1 
ATOM   7136 C  C     . PRO B 2 388 ? -55.468  -18.431 23.738  1.00 64.58  ? 387  PRO B C     1 
ATOM   7137 O  O     . PRO B 2 388 ? -55.262  -18.730 22.559  1.00 61.43  ? 387  PRO B O     1 
ATOM   7138 C  CB    . PRO B 2 388 ? -53.774  -16.919 24.796  1.00 59.91  ? 387  PRO B CB    1 
ATOM   7139 C  CG    . PRO B 2 388 ? -52.669  -16.883 23.796  1.00 59.19  ? 387  PRO B CG    1 
ATOM   7140 C  CD    . PRO B 2 388 ? -52.095  -18.272 23.707  1.00 65.72  ? 387  PRO B CD    1 
ATOM   7141 N  N     . LYS B 2 389 ? -56.677  -18.167 24.231  1.00 63.25  ? 388  LYS B N     1 
ATOM   7142 C  CA    . LYS B 2 389 ? -57.866  -18.050 23.391  1.00 61.41  ? 388  LYS B CA    1 
ATOM   7143 C  C     . LYS B 2 389 ? -57.859  -16.707 22.668  1.00 57.96  ? 388  LYS B C     1 
ATOM   7144 O  O     . LYS B 2 389 ? -57.895  -15.651 23.303  1.00 60.88  ? 388  LYS B O     1 
ATOM   7145 C  CB    . LYS B 2 389 ? -59.139  -18.190 24.232  1.00 65.45  ? 388  LYS B CB    1 
ATOM   7146 C  CG    . LYS B 2 389 ? -59.675  -19.608 24.360  1.00 74.94  ? 388  LYS B CG    1 
ATOM   7147 C  CD    . LYS B 2 389 ? -60.624  -19.947 23.219  1.00 78.57  ? 388  LYS B CD    1 
ATOM   7148 C  CE    . LYS B 2 389 ? -61.444  -21.188 23.531  1.00 92.04  ? 388  LYS B CE    1 
ATOM   7149 N  NZ    . LYS B 2 389 ? -62.428  -21.486 22.453  1.00 83.64  ? 388  LYS B NZ    1 
ATOM   7150 N  N     . PHE B 2 390 ? -57.812  -16.756 21.339  1.00 56.80  ? 389  PHE B N     1 
ATOM   7151 C  CA    . PHE B 2 390 ? -57.702  -15.545 20.527  1.00 53.57  ? 389  PHE B CA    1 
ATOM   7152 C  C     . PHE B 2 390 ? -59.050  -14.940 20.141  1.00 51.26  ? 389  PHE B C     1 
ATOM   7153 O  O     . PHE B 2 390 ? -59.895  -15.605 19.538  1.00 55.30  ? 389  PHE B O     1 
ATOM   7154 C  CB    . PHE B 2 390 ? -56.851  -15.802 19.278  1.00 53.68  ? 389  PHE B CB    1 
ATOM   7155 C  CG    . PHE B 2 390 ? -55.371  -15.727 19.528  1.00 52.35  ? 389  PHE B CG    1 
ATOM   7156 C  CD1   . PHE B 2 390 ? -54.691  -14.520 19.395  1.00 58.24  ? 389  PHE B CD1   1 
ATOM   7157 C  CD2   . PHE B 2 390 ? -54.655  -16.860 19.899  1.00 56.43  ? 389  PHE B CD2   1 
ATOM   7158 C  CE1   . PHE B 2 390 ? -53.326  -14.445 19.625  1.00 52.97  ? 389  PHE B CE1   1 
ATOM   7159 C  CE2   . PHE B 2 390 ? -53.289  -16.792 20.131  1.00 59.12  ? 389  PHE B CE2   1 
ATOM   7160 C  CZ    . PHE B 2 390 ? -52.624  -15.583 19.994  1.00 55.80  ? 389  PHE B CZ    1 
ATOM   7161 N  N     . LYS B 2 391 ? -59.236  -13.674 20.504  1.00 48.99  ? 390  LYS B N     1 
ATOM   7162 C  CA    . LYS B 2 391 ? -60.405  -12.901 20.102  1.00 52.35  ? 390  LYS B CA    1 
ATOM   7163 C  C     . LYS B 2 391 ? -60.033  -12.024 18.911  1.00 54.63  ? 390  LYS B C     1 
ATOM   7164 O  O     . LYS B 2 391 ? -59.255  -11.074 19.045  1.00 54.76  ? 390  LYS B O     1 
ATOM   7165 C  CB    . LYS B 2 391 ? -60.919  -12.047 21.264  1.00 53.98  ? 390  LYS B CB    1 
ATOM   7166 C  CG    . LYS B 2 391 ? -61.607  -12.833 22.370  1.00 53.02  ? 390  LYS B CG    1 
ATOM   7167 C  CD    . LYS B 2 391 ? -62.135  -11.908 23.455  1.00 59.32  ? 390  LYS B CD    1 
ATOM   7168 C  CE    . LYS B 2 391 ? -62.878  -12.675 24.539  1.00 59.80  ? 390  LYS B CE    1 
ATOM   7169 N  NZ    . LYS B 2 391 ? -64.174  -13.233 24.062  1.00 80.84  ? 390  LYS B NZ    1 
ATOM   7170 N  N     . LEU B 2 392 ? -60.587  -12.354 17.747  1.00 48.90  ? 391  LEU B N     1 
ATOM   7171 C  CA    . LEU B 2 392 ? -60.209  -11.701 16.494  1.00 58.89  ? 391  LEU B CA    1 
ATOM   7172 C  C     . LEU B 2 392 ? -61.308  -10.787 15.947  1.00 56.04  ? 391  LEU B C     1 
ATOM   7173 O  O     . LEU B 2 392 ? -62.485  -11.159 15.956  1.00 49.20  ? 391  LEU B O     1 
ATOM   7174 C  CB    . LEU B 2 392 ? -59.818  -12.748 15.442  1.00 45.97  ? 391  LEU B CB    1 
ATOM   7175 C  CG    . LEU B 2 392 ? -58.640  -13.686 15.740  1.00 58.51  ? 391  LEU B CG    1 
ATOM   7176 C  CD1   . LEU B 2 392 ? -58.666  -14.889 14.809  1.00 52.86  ? 391  LEU B CD1   1 
ATOM   7177 C  CD2   . LEU B 2 392 ? -57.302  -12.964 15.648  1.00 49.92  ? 391  LEU B CD2   1 
ATOM   7178 N  N     . PRO B 2 393 ? -60.925  -9.585  15.469  1.00 55.18  ? 392  PRO B N     1 
ATOM   7179 C  CA    . PRO B 2 393 ? -61.868  -8.667  14.832  1.00 50.66  ? 392  PRO B CA    1 
ATOM   7180 C  C     . PRO B 2 393 ? -62.002  -8.942  13.329  1.00 54.94  ? 392  PRO B C     1 
ATOM   7181 O  O     . PRO B 2 393 ? -61.741  -8.063  12.502  1.00 56.28  ? 392  PRO B O     1 
ATOM   7182 C  CB    . PRO B 2 393 ? -61.240  -7.295  15.093  1.00 45.95  ? 392  PRO B CB    1 
ATOM   7183 C  CG    . PRO B 2 393 ? -59.773  -7.558  15.188  1.00 44.76  ? 392  PRO B CG    1 
ATOM   7184 C  CD    . PRO B 2 393 ? -59.573  -9.002  15.566  1.00 54.27  ? 392  PRO B CD    1 
ATOM   7185 N  N     . ILE B 2 394 ? -62.410  -10.164 12.995  1.00 44.76  ? 393  ILE B N     1 
ATOM   7186 C  CA    . ILE B 2 394 ? -62.552  -10.608 11.608  1.00 41.09  ? 393  ILE B CA    1 
ATOM   7187 C  C     . ILE B 2 394 ? -63.684  -11.638 11.502  1.00 54.93  ? 393  ILE B C     1 
ATOM   7188 O  O     . ILE B 2 394 ? -64.013  -12.307 12.483  1.00 53.80  ? 393  ILE B O     1 
ATOM   7189 C  CB    . ILE B 2 394 ? -61.212  -11.170 11.053  1.00 56.31  ? 393  ILE B CB    1 
ATOM   7190 C  CG1   . ILE B 2 394 ? -61.278  -11.370 9.531   1.00 55.72  ? 393  ILE B CG1   1 
ATOM   7191 C  CG2   . ILE B 2 394 ? -60.803  -12.452 11.776  1.00 42.39  ? 393  ILE B CG2   1 
ATOM   7192 C  CD1   . ILE B 2 394 ? -59.928  -11.433 8.847   1.00 55.32  ? 393  ILE B CD1   1 
ATOM   7193 N  N     . GLN B 2 395 ? -64.287  -11.743 10.319  1.00 59.61  ? 394  GLN B N     1 
ATOM   7194 C  CA    . GLN B 2 395 ? -65.328  -12.739 10.065  1.00 50.17  ? 394  GLN B CA    1 
ATOM   7195 C  C     . GLN B 2 395 ? -64.736  -14.144 9.960   1.00 54.69  ? 394  GLN B C     1 
ATOM   7196 O  O     . GLN B 2 395 ? -63.570  -14.309 9.589   1.00 52.90  ? 394  GLN B O     1 
ATOM   7197 C  CB    . GLN B 2 395 ? -66.118  -12.393 8.799   1.00 52.74  ? 394  GLN B CB    1 
ATOM   7198 C  CG    . GLN B 2 395 ? -67.060  -11.207 8.956   1.00 52.92  ? 394  GLN B CG    1 
ATOM   7199 C  CD    . GLN B 2 395 ? -67.984  -11.013 7.766   1.00 70.62  ? 394  GLN B CD    1 
ATOM   7200 O  OE1   . GLN B 2 395 ? -67.626  -11.309 6.625   1.00 79.29  ? 394  GLN B OE1   1 
ATOM   7201 N  NE2   . GLN B 2 395 ? -69.183  -10.505 8.029   1.00 72.80  ? 394  GLN B NE2   1 
ATOM   7202 N  N     . LYS B 2 396 ? -65.547  -15.146 10.294  1.00 53.90  ? 395  LYS B N     1 
ATOM   7203 C  CA    . LYS B 2 396 ? -65.119  -16.548 10.302  1.00 50.43  ? 395  LYS B CA    1 
ATOM   7204 C  C     . LYS B 2 396 ? -64.753  -17.057 8.906   1.00 58.60  ? 395  LYS B C     1 
ATOM   7205 O  O     . LYS B 2 396 ? -63.735  -17.731 8.734   1.00 59.57  ? 395  LYS B O     1 
ATOM   7206 C  CB    . LYS B 2 396 ? -66.202  -17.434 10.930  1.00 53.01  ? 395  LYS B CB    1 
ATOM   7207 C  CG    . LYS B 2 396 ? -65.788  -18.882 11.152  1.00 59.31  ? 395  LYS B CG    1 
ATOM   7208 C  CD    . LYS B 2 396 ? -66.874  -19.670 11.864  1.00 53.14  ? 395  LYS B CD    1 
ATOM   7209 C  CE    . LYS B 2 396 ? -66.436  -21.103 12.118  1.00 51.48  ? 395  LYS B CE    1 
ATOM   7210 N  NZ    . LYS B 2 396 ? -67.480  -21.886 12.835  1.00 62.05  ? 395  LYS B NZ    1 
ATOM   7211 N  N     . GLU B 2 397 ? -65.584  -16.725 7.919   1.00 56.08  ? 396  GLU B N     1 
ATOM   7212 C  CA    . GLU B 2 397 ? -65.382  -17.161 6.537   1.00 56.21  ? 396  GLU B CA    1 
ATOM   7213 C  C     . GLU B 2 397 ? -64.165  -16.489 5.894   1.00 59.92  ? 396  GLU B C     1 
ATOM   7214 O  O     . GLU B 2 397 ? -63.477  -17.097 5.071   1.00 71.46  ? 396  GLU B O     1 
ATOM   7215 C  CB    . GLU B 2 397 ? -66.641  -16.895 5.706   1.00 59.21  ? 396  GLU B CB    1 
ATOM   7216 C  CG    . GLU B 2 397 ? -66.710  -17.672 4.398   1.00 61.99  ? 396  GLU B CG    1 
ATOM   7217 C  CD    . GLU B 2 397 ? -67.975  -17.396 3.604   1.00 64.57  ? 396  GLU B CD    1 
ATOM   7218 O  OE1   . GLU B 2 397 ? -68.466  -16.246 3.624   1.00 65.70  ? 396  GLU B OE1   1 
ATOM   7219 O  OE2   . GLU B 2 397 ? -68.482  -18.335 2.955   1.00 60.52  ? 396  GLU B OE2   1 
ATOM   7220 N  N     . THR B 2 398 ? -63.911  -15.240 6.279   1.00 56.36  ? 397  THR B N     1 
ATOM   7221 C  CA    . THR B 2 398 ? -62.782  -14.465 5.762   1.00 58.64  ? 397  THR B CA    1 
ATOM   7222 C  C     . THR B 2 398 ? -61.448  -14.989 6.299   1.00 56.16  ? 397  THR B C     1 
ATOM   7223 O  O     . THR B 2 398 ? -60.463  -15.072 5.561   1.00 57.79  ? 397  THR B O     1 
ATOM   7224 C  CB    . THR B 2 398 ? -62.929  -12.963 6.101   1.00 63.23  ? 397  THR B CB    1 
ATOM   7225 O  OG1   . THR B 2 398 ? -64.259  -12.526 5.792   1.00 66.80  ? 397  THR B OG1   1 
ATOM   7226 C  CG2   . THR B 2 398 ? -61.929  -12.120 5.314   1.00 45.51  ? 397  THR B CG2   1 
ATOM   7227 N  N     . TRP B 2 399 ? -61.432  -15.348 7.582   1.00 55.18  ? 398  TRP B N     1 
ATOM   7228 C  CA    . TRP B 2 399 ? -60.220  -15.817 8.254   1.00 55.85  ? 398  TRP B CA    1 
ATOM   7229 C  C     . TRP B 2 399 ? -59.827  -17.213 7.853   1.00 59.64  ? 398  TRP B C     1 
ATOM   7230 O  O     . TRP B 2 399 ? -58.654  -17.472 7.583   1.00 58.84  ? 398  TRP B O     1 
ATOM   7231 C  CB    . TRP B 2 399 ? -60.380  -15.718 9.769   1.00 49.44  ? 398  TRP B CB    1 
ATOM   7232 C  CG    . TRP B 2 399 ? -59.213  -16.280 10.548  1.00 50.69  ? 398  TRP B CG    1 
ATOM   7233 C  CD1   . TRP B 2 399 ? -59.160  -17.481 11.252  1.00 49.38  ? 398  TRP B CD1   1 
ATOM   7234 C  CD2   . TRP B 2 399 ? -57.881  -15.680 10.720  1.00 54.62  ? 398  TRP B CD2   1 
ATOM   7235 N  NE1   . TRP B 2 399 ? -57.929  -17.657 11.832  1.00 50.25  ? 398  TRP B NE1   1 
ATOM   7236 C  CE2   . TRP B 2 399 ? -57.115  -16.617 11.554  1.00 52.07  ? 398  TRP B CE2   1 
ATOM   7237 C  CE3   . TRP B 2 399 ? -57.270  -14.508 10.287  1.00 59.07  ? 398  TRP B CE3   1 
ATOM   7238 C  CZ2   . TRP B 2 399 ? -55.800  -16.368 11.922  1.00 54.99  ? 398  TRP B CZ2   1 
ATOM   7239 C  CZ3   . TRP B 2 399 ? -55.942  -14.268 10.666  1.00 53.46  ? 398  TRP B CZ3   1 
ATOM   7240 C  CH2   . TRP B 2 399 ? -55.227  -15.177 11.464  1.00 54.44  ? 398  TRP B CH2   1 
ATOM   7241 N  N     . GLU B 2 400 ? -60.804  -18.118 7.802   1.00 61.30  ? 399  GLU B N     1 
ATOM   7242 C  CA    . GLU B 2 400 ? -60.555  -19.538 7.518   1.00 67.75  ? 399  GLU B CA    1 
ATOM   7243 C  C     . GLU B 2 400 ? -60.057  -19.823 6.095   1.00 69.33  ? 399  GLU B C     1 
ATOM   7244 O  O     . GLU B 2 400 ? -59.588  -20.927 5.808   1.00 76.13  ? 399  GLU B O     1 
ATOM   7245 C  CB    . GLU B 2 400 ? -61.806  -20.374 7.816   1.00 69.50  ? 399  GLU B CB    1 
ATOM   7246 C  CG    . GLU B 2 400 ? -62.077  -20.609 9.297   1.00 68.64  ? 399  GLU B CG    1 
ATOM   7247 C  CD    . GLU B 2 400 ? -61.104  -21.584 9.940   1.00 82.49  ? 399  GLU B CD    1 
ATOM   7248 O  OE1   . GLU B 2 400 ? -60.717  -22.576 9.284   1.00 93.39  ? 399  GLU B OE1   1 
ATOM   7249 O  OE2   . GLU B 2 400 ? -60.731  -21.362 11.111  1.00 81.80  ? 399  GLU B OE2   1 
ATOM   7250 N  N     . THR B 2 401 ? -60.156  -18.826 5.218   1.00 63.45  ? 400  THR B N     1 
ATOM   7251 C  CA    . THR B 2 401 ? -59.752  -18.975 3.820   1.00 63.16  ? 400  THR B CA    1 
ATOM   7252 C  C     . THR B 2 401 ? -58.312  -18.509 3.576   1.00 63.74  ? 400  THR B C     1 
ATOM   7253 O  O     . THR B 2 401 ? -57.585  -19.116 2.786   1.00 68.27  ? 400  THR B O     1 
ATOM   7254 C  CB    . THR B 2 401 ? -60.714  -18.222 2.872   1.00 58.89  ? 400  THR B CB    1 
ATOM   7255 O  OG1   . THR B 2 401 ? -62.071  -18.466 3.265   1.00 65.85  ? 400  THR B OG1   1 
ATOM   7256 C  CG2   . THR B 2 401 ? -60.527  -18.674 1.426   1.00 71.65  ? 400  THR B CG2   1 
ATOM   7257 N  N     . TRP B 2 402 ? -57.903  -17.445 4.266   1.00 63.29  ? 401  TRP B N     1 
ATOM   7258 C  CA    . TRP B 2 402 ? -56.632  -16.773 3.975   1.00 60.30  ? 401  TRP B CA    1 
ATOM   7259 C  C     . TRP B 2 402 ? -55.552  -16.920 5.019   1.00 61.07  ? 401  TRP B C     1 
ATOM   7260 O  O     . TRP B 2 402 ? -54.431  -16.445 4.816   1.00 64.30  ? 401  TRP B O     1 
ATOM   7261 C  CB    . TRP B 2 402 ? -56.877  -15.293 3.684   1.00 63.23  ? 401  TRP B CB    1 
ATOM   7262 C  CG    . TRP B 2 402 ? -57.696  -15.053 2.439   1.00 68.69  ? 401  TRP B CG    1 
ATOM   7263 C  CD1   . TRP B 2 402 ? -59.015  -14.614 2.360   1.00 68.20  ? 401  TRP B CD1   1 
ATOM   7264 C  CD2   . TRP B 2 402 ? -57.274  -15.241 1.043   1.00 76.62  ? 401  TRP B CD2   1 
ATOM   7265 N  NE1   . TRP B 2 402 ? -59.423  -14.517 1.053   1.00 69.19  ? 401  TRP B NE1   1 
ATOM   7266 C  CE2   . TRP B 2 402 ? -58.429  -14.877 0.213   1.00 74.57  ? 401  TRP B CE2   1 
ATOM   7267 C  CE3   . TRP B 2 402 ? -56.100  -15.655 0.422   1.00 81.25  ? 401  TRP B CE3   1 
ATOM   7268 C  CZ2   . TRP B 2 402 ? -58.386  -14.935 -1.173  1.00 78.14  ? 401  TRP B CZ2   1 
ATOM   7269 C  CZ3   . TRP B 2 402 ? -56.069  -15.709 -0.977  1.00 80.96  ? 401  TRP B CZ3   1 
ATOM   7270 C  CH2   . TRP B 2 402 ? -57.185  -15.357 -1.753  1.00 81.24  ? 401  TRP B CH2   1 
ATOM   7271 N  N     . TRP B 2 403 ? -55.863  -17.580 6.134   1.00 60.03  ? 402  TRP B N     1 
ATOM   7272 C  CA    . TRP B 2 403 ? -54.905  -17.712 7.240   1.00 64.44  ? 402  TRP B CA    1 
ATOM   7273 C  C     . TRP B 2 403 ? -53.777  -18.669 6.953   1.00 69.60  ? 402  TRP B C     1 
ATOM   7274 O  O     . TRP B 2 403 ? -52.688  -18.533 7.515   1.00 70.43  ? 402  TRP B O     1 
ATOM   7275 C  CB    . TRP B 2 403 ? -55.613  -18.083 8.544   1.00 56.29  ? 402  TRP B CB    1 
ATOM   7276 C  CG    . TRP B 2 403 ? -55.987  -19.543 8.664   1.00 57.24  ? 402  TRP B CG    1 
ATOM   7277 C  CD1   . TRP B 2 403 ? -57.103  -20.183 8.131   1.00 64.71  ? 402  TRP B CD1   1 
ATOM   7278 C  CD2   . TRP B 2 403 ? -55.252  -20.598 9.379   1.00 57.29  ? 402  TRP B CD2   1 
ATOM   7279 N  NE1   . TRP B 2 403 ? -57.106  -21.517 8.454   1.00 67.65  ? 402  TRP B NE1   1 
ATOM   7280 C  CE2   . TRP B 2 403 ? -56.027  -21.832 9.200   1.00 60.70  ? 402  TRP B CE2   1 
ATOM   7281 C  CE3   . TRP B 2 403 ? -54.074  -20.643 10.119  1.00 58.87  ? 402  TRP B CE3   1 
ATOM   7282 C  CZ2   . TRP B 2 403 ? -55.621  -23.043 9.745   1.00 56.85  ? 402  TRP B CZ2   1 
ATOM   7283 C  CZ3   . TRP B 2 403 ? -53.675  -21.871 10.665  1.00 57.89  ? 402  TRP B CZ3   1 
ATOM   7284 C  CH2   . TRP B 2 403 ? -54.432  -23.040 10.481  1.00 56.05  ? 402  TRP B CH2   1 
ATOM   7285 N  N     . THR B 2 404 ? -54.026  -19.637 6.072   1.00 73.37  ? 403  THR B N     1 
ATOM   7286 C  CA    . THR B 2 404 ? -53.044  -20.672 5.731   1.00 69.82  ? 403  THR B CA    1 
ATOM   7287 C  C     . THR B 2 404 ? -51.897  -20.156 4.857   1.00 76.20  ? 403  THR B C     1 
ATOM   7288 O  O     . THR B 2 404 ? -50.831  -20.774 4.797   1.00 74.77  ? 403  THR B O     1 
ATOM   7289 C  CB    . THR B 2 404 ? -53.706  -21.874 5.022   1.00 71.26  ? 403  THR B CB    1 
ATOM   7290 O  OG1   . THR B 2 404 ? -54.474  -21.412 3.904   1.00 79.58  ? 403  THR B OG1   1 
ATOM   7291 C  CG2   . THR B 2 404 ? -54.614  -22.635 5.979   1.00 70.66  ? 403  THR B CG2   1 
ATOM   7292 N  N     . GLU B 2 405 ? -52.125  -19.027 4.188   1.00 78.19  ? 404  GLU B N     1 
ATOM   7293 C  CA    . GLU B 2 405 ? -51.152  -18.443 3.261   1.00 80.65  ? 404  GLU B CA    1 
ATOM   7294 C  C     . GLU B 2 405 ? -49.896  -17.917 3.958   1.00 79.75  ? 404  GLU B C     1 
ATOM   7295 O  O     . GLU B 2 405 ? -48.785  -18.079 3.447   1.00 90.16  ? 404  GLU B O     1 
ATOM   7296 C  CB    . GLU B 2 405 ? -51.799  -17.322 2.437   1.00 82.80  ? 404  GLU B CB    1 
ATOM   7297 C  CG    . GLU B 2 405 ? -52.934  -17.768 1.521   1.00 95.64  ? 404  GLU B CG    1 
ATOM   7298 C  CD    . GLU B 2 405 ? -52.461  -18.547 0.304   1.00 104.15 ? 404  GLU B CD    1 
ATOM   7299 O  OE1   . GLU B 2 405 ? -51.332  -18.302 -0.175  1.00 105.09 ? 404  GLU B OE1   1 
ATOM   7300 O  OE2   . GLU B 2 405 ? -53.229  -19.402 -0.184  1.00 100.62 ? 404  GLU B OE2   1 
ATOM   7301 N  N     . TYR B 2 406 ? -50.080  -17.294 5.120   1.00 75.67  ? 405  TYR B N     1 
ATOM   7302 C  CA    . TYR B 2 406 ? -48.980  -16.659 5.849   1.00 73.80  ? 405  TYR B CA    1 
ATOM   7303 C  C     . TYR B 2 406 ? -48.618  -17.400 7.141   1.00 74.41  ? 405  TYR B C     1 
ATOM   7304 O  O     . TYR B 2 406 ? -47.801  -16.923 7.933   1.00 77.00  ? 405  TYR B O     1 
ATOM   7305 C  CB    . TYR B 2 406 ? -49.317  -15.191 6.149   1.00 69.52  ? 405  TYR B CB    1 
ATOM   7306 C  CG    . TYR B 2 406 ? -49.809  -14.405 4.950   1.00 69.74  ? 405  TYR B CG    1 
ATOM   7307 C  CD1   . TYR B 2 406 ? -48.915  -13.911 3.998   1.00 75.90  ? 405  TYR B CD1   1 
ATOM   7308 C  CD2   . TYR B 2 406 ? -51.169  -14.151 4.769   1.00 72.82  ? 405  TYR B CD2   1 
ATOM   7309 C  CE1   . TYR B 2 406 ? -49.363  -13.191 2.900   1.00 87.70  ? 405  TYR B CE1   1 
ATOM   7310 C  CE2   . TYR B 2 406 ? -51.626  -13.432 3.675   1.00 77.94  ? 405  TYR B CE2   1 
ATOM   7311 C  CZ    . TYR B 2 406 ? -50.719  -12.954 2.745   1.00 85.44  ? 405  TYR B CZ    1 
ATOM   7312 O  OH    . TYR B 2 406 ? -51.168  -12.240 1.657   1.00 85.45  ? 405  TYR B OH    1 
ATOM   7313 N  N     . TRP B 2 407 ? -49.223  -18.570 7.336   1.00 70.70  ? 406  TRP B N     1 
ATOM   7314 C  CA    . TRP B 2 407 ? -49.000  -19.387 8.528   1.00 68.79  ? 406  TRP B CA    1 
ATOM   7315 C  C     . TRP B 2 407 ? -47.780  -20.253 8.375   1.00 73.69  ? 406  TRP B C     1 
ATOM   7316 O  O     . TRP B 2 407 ? -47.546  -20.825 7.308   1.00 86.37  ? 406  TRP B O     1 
ATOM   7317 C  CB    . TRP B 2 407 ? -50.228  -20.247 8.807   1.00 68.12  ? 406  TRP B CB    1 
ATOM   7318 C  CG    . TRP B 2 407 ? -50.299  -20.789 10.213  1.00 62.21  ? 406  TRP B CG    1 
ATOM   7319 C  CD1   . TRP B 2 407 ? -49.968  -22.070 10.646  1.00 61.95  ? 406  TRP B CD1   1 
ATOM   7320 C  CD2   . TRP B 2 407 ? -50.741  -20.081 11.425  1.00 66.06  ? 406  TRP B CD2   1 
ATOM   7321 N  NE1   . TRP B 2 407 ? -50.166  -22.197 11.998  1.00 64.91  ? 406  TRP B NE1   1 
ATOM   7322 C  CE2   . TRP B 2 407 ? -50.627  -21.045 12.526  1.00 67.06  ? 406  TRP B CE2   1 
ATOM   7323 C  CE3   . TRP B 2 407 ? -51.200  -18.797 11.698  1.00 69.81  ? 406  TRP B CE3   1 
ATOM   7324 C  CZ2   . TRP B 2 407 ? -50.963  -20.713 13.831  1.00 65.95  ? 406  TRP B CZ2   1 
ATOM   7325 C  CZ3   . TRP B 2 407 ? -51.537  -18.475 13.019  1.00 64.32  ? 406  TRP B CZ3   1 
ATOM   7326 C  CH2   . TRP B 2 407 ? -51.420  -19.411 14.058  1.00 60.18  ? 406  TRP B CH2   1 
ATOM   7327 N  N     . GLN B 2 408 ? -46.993  -20.356 9.445   1.00 71.90  ? 407  GLN B N     1 
ATOM   7328 C  CA    . GLN B 2 408 ? -45.754  -21.140 9.431   1.00 77.46  ? 407  GLN B CA    1 
ATOM   7329 C  C     . GLN B 2 408 ? -45.659  -22.147 10.578  1.00 76.11  ? 407  GLN B C     1 
ATOM   7330 O  O     . GLN B 2 408 ? -45.234  -23.287 10.373  1.00 88.51  ? 407  GLN B O     1 
ATOM   7331 C  CB    . GLN B 2 408 ? -44.527  -20.221 9.446   1.00 78.75  ? 407  GLN B CB    1 
ATOM   7332 C  CG    . GLN B 2 408 ? -44.201  -19.578 8.105   1.00 90.10  ? 407  GLN B CG    1 
ATOM   7333 C  CD    . GLN B 2 408 ? -42.835  -18.913 8.084   1.00 105.40 ? 407  GLN B CD    1 
ATOM   7334 O  OE1   . GLN B 2 408 ? -42.008  -19.203 7.219   1.00 101.46 ? 407  GLN B OE1   1 
ATOM   7335 N  NE2   . GLN B 2 408 ? -42.591  -18.019 9.038   1.00 109.60 ? 407  GLN B NE2   1 
ATOM   7336 N  N     . ALA B 2 409 ? -46.051  -21.718 11.777  1.00 71.18  ? 408  ALA B N     1 
ATOM   7337 C  CA    . ALA B 2 409 ? -45.942  -22.539 12.986  1.00 77.37  ? 408  ALA B CA    1 
ATOM   7338 C  C     . ALA B 2 409 ? -46.874  -23.749 12.966  1.00 78.36  ? 408  ALA B C     1 
ATOM   7339 O  O     . ALA B 2 409 ? -47.970  -23.692 12.406  1.00 78.12  ? 408  ALA B O     1 
ATOM   7340 C  CB    . ALA B 2 409 ? -46.198  -21.691 14.224  1.00 80.73  ? 408  ALA B CB    1 
ATOM   7341 N  N     . THR B 2 410 ? -46.425  -24.841 13.580  1.00 84.73  ? 409  THR B N     1 
ATOM   7342 C  CA    . THR B 2 410 ? -47.200  -26.084 13.638  1.00 87.24  ? 409  THR B CA    1 
ATOM   7343 C  C     . THR B 2 410 ? -48.318  -26.039 14.688  1.00 89.37  ? 409  THR B C     1 
ATOM   7344 O  O     . THR B 2 410 ? -49.274  -26.816 14.617  1.00 85.64  ? 409  THR B O     1 
ATOM   7345 C  CB    . THR B 2 410 ? -46.292  -27.317 13.867  1.00 92.56  ? 409  THR B CB    1 
ATOM   7346 O  OG1   . THR B 2 410 ? -47.092  -28.506 13.920  1.00 93.18  ? 409  THR B OG1   1 
ATOM   7347 C  CG2   . THR B 2 410 ? -45.491  -27.185 15.162  1.00 86.42  ? 409  THR B CG2   1 
ATOM   7348 N  N     . TRP B 2 411 ? -48.218  -25.175 15.667  1.00 88.88  ? 410  TRP B N     1 
ATOM   7349 C  CA    . TRP B 2 411 ? -49.284  -25.172 16.623  1.00 91.30  ? 410  TRP B CA    1 
ATOM   7350 C  C     . TRP B 2 411 ? -50.505  -24.544 16.007  1.00 82.01  ? 410  TRP B C     1 
ATOM   7351 O  O     . TRP B 2 411 ? -50.454  -23.901 14.981  1.00 77.09  ? 410  TRP B O     1 
ATOM   7352 C  CB    . TRP B 2 411 ? -48.902  -24.436 17.900  1.00 88.35  ? 410  TRP B CB    1 
ATOM   7353 C  CG    . TRP B 2 411 ? -48.358  -23.098 17.667  1.00 92.58  ? 410  TRP B CG    1 
ATOM   7354 C  CD1   . TRP B 2 411 ? -49.039  -21.994 17.270  1.00 86.17  ? 410  TRP B CD1   1 
ATOM   7355 C  CD2   . TRP B 2 411 ? -47.004  -22.701 17.820  1.00 88.89  ? 410  TRP B CD2   1 
ATOM   7356 N  NE1   . TRP B 2 411 ? -48.193  -20.927 17.168  1.00 83.01  ? 410  TRP B NE1   1 
ATOM   7357 C  CE2   . TRP B 2 411 ? -46.932  -21.339 17.497  1.00 87.34  ? 410  TRP B CE2   1 
ATOM   7358 C  CE3   . TRP B 2 411 ? -45.839  -23.369 18.189  1.00 89.07  ? 410  TRP B CE3   1 
ATOM   7359 C  CZ2   . TRP B 2 411 ? -45.745  -20.633 17.535  1.00 90.46  ? 410  TRP B CZ2   1 
ATOM   7360 C  CZ3   . TRP B 2 411 ? -44.660  -22.667 18.228  1.00 92.76  ? 410  TRP B CZ3   1 
ATOM   7361 C  CH2   . TRP B 2 411 ? -44.620  -21.312 17.906  1.00 95.74  ? 410  TRP B CH2   1 
ATOM   7362 N  N     . VAL B 2 412 ? -51.612  -24.753 16.673  1.00 79.24  ? 411  VAL B N     1 
ATOM   7363 C  CA    . VAL B 2 412 ? -52.902  -24.193 16.273  1.00 74.08  ? 411  VAL B CA    1 
ATOM   7364 C  C     . VAL B 2 412 ? -53.652  -23.664 17.499  1.00 69.42  ? 411  VAL B C     1 
ATOM   7365 O  O     . VAL B 2 412 ? -54.216  -24.447 18.269  1.00 66.60  ? 411  VAL B O     1 
ATOM   7366 C  CB    . VAL B 2 412 ? -53.776  -25.233 15.550  1.00 79.42  ? 411  VAL B CB    1 
ATOM   7367 C  CG1   . VAL B 2 412 ? -54.702  -24.552 14.554  1.00 72.40  ? 411  VAL B CG1   1 
ATOM   7368 C  CG2   . VAL B 2 412 ? -52.906  -26.270 14.856  1.00 78.22  ? 411  VAL B CG2   1 
ATOM   7369 N  N     . PRO B 2 413 ? -53.645  -22.330 17.692  1.00 67.95  ? 412  PRO B N     1 
ATOM   7370 C  CA    . PRO B 2 413 ? -54.334  -21.705 18.821  1.00 69.54  ? 412  PRO B CA    1 
ATOM   7371 C  C     . PRO B 2 413 ? -55.849  -21.702 18.639  1.00 61.50  ? 412  PRO B C     1 
ATOM   7372 O  O     . PRO B 2 413 ? -56.340  -21.513 17.522  1.00 64.53  ? 412  PRO B O     1 
ATOM   7373 C  CB    . PRO B 2 413 ? -53.799  -20.263 18.815  1.00 67.19  ? 412  PRO B CB    1 
ATOM   7374 C  CG    . PRO B 2 413 ? -52.625  -20.264 17.890  1.00 64.57  ? 412  PRO B CG    1 
ATOM   7375 C  CD    . PRO B 2 413 ? -52.917  -21.335 16.888  1.00 66.82  ? 412  PRO B CD    1 
ATOM   7376 N  N     . GLU B 2 414 ? -56.574  -21.915 19.734  1.00 62.26  ? 413  GLU B N     1 
ATOM   7377 C  CA    . GLU B 2 414 ? -58.033  -21.906 19.720  1.00 66.40  ? 413  GLU B CA    1 
ATOM   7378 C  C     . GLU B 2 414 ? -58.531  -20.466 19.635  1.00 64.95  ? 413  GLU B C     1 
ATOM   7379 O  O     . GLU B 2 414 ? -58.243  -19.651 20.514  1.00 71.67  ? 413  GLU B O     1 
ATOM   7380 C  CB    . GLU B 2 414 ? -58.581  -22.590 20.977  1.00 66.27  ? 413  GLU B CB    1 
ATOM   7381 C  CG    . GLU B 2 414 ? -59.929  -23.271 20.789  1.00 81.09  ? 413  GLU B CG    1 
ATOM   7382 C  CD    . GLU B 2 414 ? -59.822  -24.632 20.120  1.00 99.04  ? 413  GLU B CD    1 
ATOM   7383 O  OE1   . GLU B 2 414 ? -58.885  -25.394 20.444  1.00 88.06  ? 413  GLU B OE1   1 
ATOM   7384 O  OE2   . GLU B 2 414 ? -60.685  -24.943 19.273  1.00 93.67  ? 413  GLU B OE2   1 
ATOM   7385 N  N     . TRP B 2 415 ? -59.269  -20.155 18.571  1.00 57.76  ? 414  TRP B N     1 
ATOM   7386 C  CA    . TRP B 2 415 ? -59.718  -18.783 18.323  1.00 50.78  ? 414  TRP B CA    1 
ATOM   7387 C  C     . TRP B 2 415 ? -61.212  -18.617 18.246  1.00 57.99  ? 414  TRP B C     1 
ATOM   7388 O  O     . TRP B 2 415 ? -61.944  -19.563 17.945  1.00 63.52  ? 414  TRP B O     1 
ATOM   7389 C  CB    . TRP B 2 415 ? -59.054  -18.206 17.069  1.00 57.78  ? 414  TRP B CB    1 
ATOM   7390 C  CG    . TRP B 2 415 ? -59.140  -19.079 15.833  1.00 55.80  ? 414  TRP B CG    1 
ATOM   7391 C  CD1   . TRP B 2 415 ? -60.282  -19.629 15.252  1.00 57.98  ? 414  TRP B CD1   1 
ATOM   7392 C  CD2   . TRP B 2 415 ? -58.032  -19.508 14.965  1.00 51.01  ? 414  TRP B CD2   1 
ATOM   7393 N  NE1   . TRP B 2 415 ? -59.964  -20.356 14.133  1.00 58.11  ? 414  TRP B NE1   1 
ATOM   7394 C  CE2   . TRP B 2 415 ? -58.635  -20.324 13.902  1.00 56.84  ? 414  TRP B CE2   1 
ATOM   7395 C  CE3   . TRP B 2 415 ? -56.654  -19.312 14.964  1.00 48.14  ? 414  TRP B CE3   1 
ATOM   7396 C  CZ2   . TRP B 2 415 ? -57.873  -20.905 12.898  1.00 64.27  ? 414  TRP B CZ2   1 
ATOM   7397 C  CZ3   . TRP B 2 415 ? -55.896  -19.904 13.945  1.00 53.57  ? 414  TRP B CZ3   1 
ATOM   7398 C  CH2   . TRP B 2 415 ? -56.493  -20.681 12.938  1.00 64.18  ? 414  TRP B CH2   1 
ATOM   7399 N  N     . GLU B 2 416 ? -61.665  -17.398 18.532  1.00 51.64  ? 415  GLU B N     1 
ATOM   7400 C  CA    . GLU B 2 416 ? -63.065  -17.006 18.378  1.00 49.92  ? 415  GLU B CA    1 
ATOM   7401 C  C     . GLU B 2 416 ? -63.159  -15.633 17.708  1.00 56.09  ? 415  GLU B C     1 
ATOM   7402 O  O     . GLU B 2 416 ? -62.200  -14.856 17.729  1.00 50.78  ? 415  GLU B O     1 
ATOM   7403 C  CB    . GLU B 2 416 ? -63.795  -17.010 19.729  1.00 55.43  ? 415  GLU B CB    1 
ATOM   7404 C  CG    . GLU B 2 416 ? -63.261  -16.021 20.758  1.00 65.38  ? 415  GLU B CG    1 
ATOM   7405 C  CD    . GLU B 2 416 ? -64.123  -15.941 22.006  1.00 73.61  ? 415  GLU B CD    1 
ATOM   7406 O  OE1   . GLU B 2 416 ? -65.367  -15.919 21.883  1.00 70.71  ? 415  GLU B OE1   1 
ATOM   7407 O  OE2   . GLU B 2 416 ? -63.553  -15.902 23.117  1.00 93.01  ? 415  GLU B OE2   1 
ATOM   7408 N  N     . PHE B 2 417 ? -64.316  -15.342 17.119  1.00 55.22  ? 416  PHE B N     1 
ATOM   7409 C  CA    . PHE B 2 417 ? -64.512  -14.105 16.365  1.00 59.42  ? 416  PHE B CA    1 
ATOM   7410 C  C     . PHE B 2 417 ? -65.579  -13.224 17.013  1.00 57.25  ? 416  PHE B C     1 
ATOM   7411 O  O     . PHE B 2 417 ? -66.746  -13.614 17.109  1.00 63.42  ? 416  PHE B O     1 
ATOM   7412 C  CB    . PHE B 2 417 ? -64.867  -14.420 14.907  1.00 52.44  ? 416  PHE B CB    1 
ATOM   7413 C  CG    . PHE B 2 417 ? -63.931  -15.402 14.252  1.00 56.17  ? 416  PHE B CG    1 
ATOM   7414 C  CD1   . PHE B 2 417 ? -62.714  -14.982 13.725  1.00 59.21  ? 416  PHE B CD1   1 
ATOM   7415 C  CD2   . PHE B 2 417 ? -64.266  -16.750 14.166  1.00 49.69  ? 416  PHE B CD2   1 
ATOM   7416 C  CE1   . PHE B 2 417 ? -61.850  -15.886 13.125  1.00 53.12  ? 416  PHE B CE1   1 
ATOM   7417 C  CE2   . PHE B 2 417 ? -63.405  -17.659 13.568  1.00 59.94  ? 416  PHE B CE2   1 
ATOM   7418 C  CZ    . PHE B 2 417 ? -62.196  -17.226 13.045  1.00 50.09  ? 416  PHE B CZ    1 
ATOM   7419 N  N     . VAL B 2 418 ? -65.166  -12.039 17.461  1.00 54.82  ? 417  VAL B N     1 
ATOM   7420 C  CA    . VAL B 2 418 ? -66.045  -11.134 18.214  1.00 63.99  ? 417  VAL B CA    1 
ATOM   7421 C  C     . VAL B 2 418 ? -66.028  -9.687  17.708  1.00 64.27  ? 417  VAL B C     1 
ATOM   7422 O  O     . VAL B 2 418 ? -65.262  -9.337  16.807  1.00 56.93  ? 417  VAL B O     1 
ATOM   7423 C  CB    . VAL B 2 418 ? -65.730  -11.150 19.733  1.00 69.78  ? 417  VAL B CB    1 
ATOM   7424 C  CG1   . VAL B 2 418 ? -66.249  -12.426 20.383  1.00 78.10  ? 417  VAL B CG1   1 
ATOM   7425 C  CG2   . VAL B 2 418 ? -64.238  -10.971 19.990  1.00 55.19  ? 417  VAL B CG2   1 
ATOM   7426 N  N     . ASN B 2 419 ? -66.887  -8.862  18.305  1.00 68.14  ? 418  ASN B N     1 
ATOM   7427 C  CA    . ASN B 2 419 ? -67.006  -7.442  17.980  1.00 64.41  ? 418  ASN B CA    1 
ATOM   7428 C  C     . ASN B 2 419 ? -66.088  -6.570  18.839  1.00 66.22  ? 418  ASN B C     1 
ATOM   7429 O  O     . ASN B 2 419 ? -65.899  -6.839  20.028  1.00 75.34  ? 418  ASN B O     1 
ATOM   7430 C  CB    . ASN B 2 419 ? -68.475  -7.003  18.102  1.00 64.96  ? 418  ASN B CB    1 
ATOM   7431 C  CG    . ASN B 2 419 ? -68.633  -5.530  18.437  1.00 76.88  ? 418  ASN B CG    1 
ATOM   7432 O  OD1   . ASN B 2 419 ? -68.642  -5.144  19.607  1.00 83.12  ? 418  ASN B OD1   1 
ATOM   7433 N  ND2   . ASN B 2 419 ? -68.780  -4.702  17.409  1.00 70.69  ? 418  ASN B ND2   1 
ATOM   7434 N  N     . THR B 2 420 ? -65.525  -5.530  18.226  1.00 61.11  ? 419  THR B N     1 
ATOM   7435 C  CA    . THR B 2 420 ? -64.650  -4.589  18.923  1.00 58.25  ? 419  THR B CA    1 
ATOM   7436 C  C     . THR B 2 420 ? -65.407  -3.312  19.313  1.00 65.28  ? 419  THR B C     1 
ATOM   7437 O  O     . THR B 2 420 ? -65.901  -2.593  18.440  1.00 69.16  ? 419  THR B O     1 
ATOM   7438 C  CB    . THR B 2 420 ? -63.410  -4.229  18.073  1.00 56.76  ? 419  THR B CB    1 
ATOM   7439 O  OG1   . THR B 2 420 ? -62.753  -5.429  17.645  1.00 63.14  ? 419  THR B OG1   1 
ATOM   7440 C  CG2   . THR B 2 420 ? -62.429  -3.379  18.873  1.00 50.12  ? 419  THR B CG2   1 
ATOM   7441 N  N     . PRO B 2 421 ? -65.510  -3.040  20.630  1.00 58.28  ? 420  PRO B N     1 
ATOM   7442 C  CA    . PRO B 2 421 ? -66.103  -1.803  21.155  1.00 54.52  ? 420  PRO B CA    1 
ATOM   7443 C  C     . PRO B 2 421 ? -65.294  -0.556  20.778  1.00 65.10  ? 420  PRO B C     1 
ATOM   7444 O  O     . PRO B 2 421 ? -64.081  -0.654  20.577  1.00 67.66  ? 420  PRO B O     1 
ATOM   7445 C  CB    . PRO B 2 421 ? -66.064  -2.014  22.674  1.00 57.18  ? 420  PRO B CB    1 
ATOM   7446 C  CG    . PRO B 2 421 ? -66.034  -3.491  22.852  1.00 56.17  ? 420  PRO B CG    1 
ATOM   7447 C  CD    . PRO B 2 421 ? -65.202  -3.994  21.711  1.00 57.05  ? 420  PRO B CD    1 
ATOM   7448 N  N     . PRO B 2 422 ? -65.963  0.612   20.675  1.00 68.12  ? 421  PRO B N     1 
ATOM   7449 C  CA    . PRO B 2 422 ? -65.284  1.864   20.323  1.00 72.33  ? 421  PRO B CA    1 
ATOM   7450 C  C     . PRO B 2 422 ? -64.360  2.392   21.422  1.00 68.26  ? 421  PRO B C     1 
ATOM   7451 O  O     . PRO B 2 422 ? -63.337  3.009   21.117  1.00 69.36  ? 421  PRO B O     1 
ATOM   7452 C  CB    . PRO B 2 422 ? -66.443  2.847   20.094  1.00 68.67  ? 421  PRO B CB    1 
ATOM   7453 C  CG    . PRO B 2 422 ? -67.657  1.998   19.912  1.00 62.53  ? 421  PRO B CG    1 
ATOM   7454 C  CD    . PRO B 2 422 ? -67.421  0.800   20.778  1.00 61.45  ? 421  PRO B CD    1 
ATOM   7455 N  N     . LEU B 2 423 ? -64.719  2.147   22.682  1.00 63.03  ? 422  LEU B N     1 
ATOM   7456 C  CA    . LEU B 2 423 ? -63.965  2.662   23.829  1.00 58.67  ? 422  LEU B CA    1 
ATOM   7457 C  C     . LEU B 2 423 ? -62.628  1.953   24.051  1.00 60.47  ? 422  LEU B C     1 
ATOM   7458 O  O     . LEU B 2 423 ? -61.642  2.588   24.433  1.00 56.68  ? 422  LEU B O     1 
ATOM   7459 C  CB    . LEU B 2 423 ? -64.813  2.608   25.106  1.00 60.55  ? 422  LEU B CB    1 
ATOM   7460 C  CG    . LEU B 2 423 ? -65.964  3.612   25.248  1.00 62.91  ? 422  LEU B CG    1 
ATOM   7461 C  CD1   . LEU B 2 423 ? -66.953  3.144   26.305  1.00 70.58  ? 422  LEU B CD1   1 
ATOM   7462 C  CD2   . LEU B 2 423 ? -65.453  5.010   25.571  1.00 55.60  ? 422  LEU B CD2   1 
ATOM   7463 N  N     . VAL B 2 424 ? -62.603  0.642   23.813  1.00 65.32  ? 423  VAL B N     1 
ATOM   7464 C  CA    . VAL B 2 424 ? -61.386  -0.162  23.968  1.00 62.12  ? 423  VAL B CA    1 
ATOM   7465 C  C     . VAL B 2 424 ? -60.385  0.108   22.835  1.00 60.43  ? 423  VAL B C     1 
ATOM   7466 O  O     . VAL B 2 424 ? -59.176  -0.064  23.008  1.00 58.80  ? 423  VAL B O     1 
ATOM   7467 C  CB    . VAL B 2 424 ? -61.712  -1.675  24.100  1.00 50.90  ? 423  VAL B CB    1 
ATOM   7468 C  CG1   . VAL B 2 424 ? -62.134  -2.277  22.765  1.00 59.53  ? 423  VAL B CG1   1 
ATOM   7469 C  CG2   . VAL B 2 424 ? -60.534  -2.443  24.684  1.00 59.19  ? 423  VAL B CG2   1 
ATOM   7470 N  N     . LYS B 2 425 ? -60.901  0.542   21.686  1.00 61.87  ? 424  LYS B N     1 
ATOM   7471 C  CA    . LYS B 2 425 ? -60.080  0.865   20.522  1.00 67.17  ? 424  LYS B CA    1 
ATOM   7472 C  C     . LYS B 2 425 ? -59.366  2.205   20.707  1.00 72.84  ? 424  LYS B C     1 
ATOM   7473 O  O     . LYS B 2 425 ? -58.203  2.353   20.327  1.00 69.97  ? 424  LYS B O     1 
ATOM   7474 C  CB    . LYS B 2 425 ? -60.947  0.878   19.255  1.00 72.26  ? 424  LYS B CB    1 
ATOM   7475 C  CG    . LYS B 2 425 ? -60.181  0.887   17.935  1.00 70.08  ? 424  LYS B CG    1 
ATOM   7476 C  CD    . LYS B 2 425 ? -59.989  2.293   17.374  1.00 75.23  ? 424  LYS B CD    1 
ATOM   7477 C  CE    . LYS B 2 425 ? -61.261  2.847   16.745  1.00 90.81  ? 424  LYS B CE    1 
ATOM   7478 N  NZ    . LYS B 2 425 ? -61.638  2.137   15.491  1.00 98.68  ? 424  LYS B NZ    1 
ATOM   7479 N  N     . LEU B 2 426 ? -60.069  3.171   21.296  1.00 71.27  ? 425  LEU B N     1 
ATOM   7480 C  CA    . LEU B 2 426 ? -59.538  4.522   21.488  1.00 66.02  ? 425  LEU B CA    1 
ATOM   7481 C  C     . LEU B 2 426 ? -58.622  4.648   22.708  1.00 60.70  ? 425  LEU B C     1 
ATOM   7482 O  O     . LEU B 2 426 ? -57.878  5.623   22.829  1.00 64.16  ? 425  LEU B O     1 
ATOM   7483 C  CB    . LEU B 2 426 ? -60.680  5.543   21.578  1.00 57.33  ? 425  LEU B CB    1 
ATOM   7484 C  CG    . LEU B 2 426 ? -61.552  5.796   20.341  1.00 56.73  ? 425  LEU B CG    1 
ATOM   7485 C  CD1   . LEU B 2 426 ? -62.792  6.591   20.720  1.00 51.21  ? 425  LEU B CD1   1 
ATOM   7486 C  CD2   . LEU B 2 426 ? -60.780  6.500   19.233  1.00 68.28  ? 425  LEU B CD2   1 
ATOM   7487 N  N     . TRP B 2 427 ? -58.678  3.664   23.604  1.00 56.32  ? 426  TRP B N     1 
ATOM   7488 C  CA    . TRP B 2 427 ? -57.873  3.682   24.826  1.00 56.07  ? 426  TRP B CA    1 
ATOM   7489 C  C     . TRP B 2 427 ? -56.469  3.183   24.614  1.00 59.43  ? 426  TRP B C     1 
ATOM   7490 O  O     . TRP B 2 427 ? -55.510  3.809   25.072  1.00 65.70  ? 426  TRP B O     1 
ATOM   7491 C  CB    . TRP B 2 427 ? -58.560  2.891   25.939  1.00 55.97  ? 426  TRP B CB    1 
ATOM   7492 C  CG    . TRP B 2 427 ? -57.692  2.684   27.161  1.00 53.72  ? 426  TRP B CG    1 
ATOM   7493 C  CD1   . TRP B 2 427 ? -57.106  1.498   27.596  1.00 51.21  ? 426  TRP B CD1   1 
ATOM   7494 C  CD2   . TRP B 2 427 ? -57.267  3.697   28.139  1.00 54.81  ? 426  TRP B CD2   1 
ATOM   7495 N  NE1   . TRP B 2 427 ? -56.380  1.700   28.742  1.00 59.19  ? 426  TRP B NE1   1 
ATOM   7496 C  CE2   . TRP B 2 427 ? -56.433  2.994   29.122  1.00 60.13  ? 426  TRP B CE2   1 
ATOM   7497 C  CE3   . TRP B 2 427 ? -57.488  5.062   28.295  1.00 53.71  ? 426  TRP B CE3   1 
ATOM   7498 C  CZ2   . TRP B 2 427 ? -55.858  3.649   30.201  1.00 61.36  ? 426  TRP B CZ2   1 
ATOM   7499 C  CZ3   . TRP B 2 427 ? -56.903  5.712   29.389  1.00 48.59  ? 426  TRP B CZ3   1 
ATOM   7500 C  CH2   . TRP B 2 427 ? -56.108  5.020   30.317  1.00 53.89  ? 426  TRP B CH2   1 
ATOM   7501 N  N     . TYR B 2 428 ? -56.336  2.057   23.916  1.00 57.31  ? 427  TYR B N     1 
ATOM   7502 C  CA    . TYR B 2 428 ? -55.040  1.394   23.750  1.00 60.73  ? 427  TYR B CA    1 
ATOM   7503 C  C     . TYR B 2 428 ? -54.166  1.963   22.624  1.00 70.37  ? 427  TYR B C     1 
ATOM   7504 O  O     . TYR B 2 428 ? -53.067  1.459   22.375  1.00 78.61  ? 427  TYR B O     1 
ATOM   7505 C  CB    . TYR B 2 428 ? -55.224  -0.120  23.593  1.00 60.50  ? 427  TYR B CB    1 
ATOM   7506 C  CG    . TYR B 2 428 ? -55.623  -0.821  24.875  1.00 52.09  ? 427  TYR B CG    1 
ATOM   7507 C  CD1   . TYR B 2 428 ? -54.664  -1.188  25.820  1.00 52.52  ? 427  TYR B CD1   1 
ATOM   7508 C  CD2   . TYR B 2 428 ? -56.958  -1.119  25.143  1.00 54.78  ? 427  TYR B CD2   1 
ATOM   7509 C  CE1   . TYR B 2 428 ? -55.025  -1.828  26.996  1.00 51.45  ? 427  TYR B CE1   1 
ATOM   7510 C  CE2   . TYR B 2 428 ? -57.328  -1.760  26.316  1.00 55.53  ? 427  TYR B CE2   1 
ATOM   7511 C  CZ    . TYR B 2 428 ? -56.359  -2.112  27.238  1.00 52.75  ? 427  TYR B CZ    1 
ATOM   7512 O  OH    . TYR B 2 428 ? -56.724  -2.749  28.402  1.00 47.48  ? 427  TYR B OH    1 
ATOM   7513 N  N     . GLN B 2 429 ? -54.650  3.007   21.952  1.00 68.12  ? 428  GLN B N     1 
ATOM   7514 C  CA    . GLN B 2 429 ? -53.845  3.714   20.951  1.00 70.50  ? 428  GLN B CA    1 
ATOM   7515 C  C     . GLN B 2 429 ? -52.960  4.783   21.595  1.00 73.39  ? 428  GLN B C     1 
ATOM   7516 O  O     . GLN B 2 429 ? -51.998  5.254   20.984  1.00 88.61  ? 428  GLN B O     1 
ATOM   7517 C  CB    . GLN B 2 429 ? -54.719  4.313   19.840  1.00 72.03  ? 428  GLN B CB    1 
ATOM   7518 C  CG    . GLN B 2 429 ? -55.679  5.413   20.274  1.00 74.86  ? 428  GLN B CG    1 
ATOM   7519 C  CD    . GLN B 2 429 ? -56.423  6.047   19.109  1.00 69.26  ? 428  GLN B CD    1 
ATOM   7520 O  OE1   . GLN B 2 429 ? -56.213  5.692   17.948  1.00 59.28  ? 428  GLN B OE1   1 
ATOM   7521 N  NE2   . GLN B 2 429 ? -57.300  6.995   19.419  1.00 72.52  ? 428  GLN B NE2   1 
ATOM   7522 N  N     . LEU B 2 430 ? -53.295  5.154   22.830  1.00 67.51  ? 429  LEU B N     1 
ATOM   7523 C  CA    . LEU B 2 430 ? -52.490  6.089   23.615  1.00 68.76  ? 429  LEU B CA    1 
ATOM   7524 C  C     . LEU B 2 430 ? -51.275  5.399   24.240  1.00 74.79  ? 429  LEU B C     1 
ATOM   7525 O  O     . LEU B 2 430 ? -50.428  6.052   24.855  1.00 82.25  ? 429  LEU B O     1 
ATOM   7526 C  CB    . LEU B 2 430 ? -53.343  6.766   24.701  1.00 64.05  ? 429  LEU B CB    1 
ATOM   7527 C  CG    . LEU B 2 430 ? -54.191  8.014   24.393  1.00 69.80  ? 429  LEU B CG    1 
ATOM   7528 C  CD1   . LEU B 2 430 ? -53.342  9.163   23.861  1.00 86.95  ? 429  LEU B CD1   1 
ATOM   7529 C  CD2   . LEU B 2 430 ? -55.350  7.720   23.449  1.00 70.05  ? 429  LEU B CD2   1 
ATOM   7530 N  N     . GLU B 2 431 ? -51.200  4.079   24.074  1.00 72.19  ? 430  GLU B N     1 
ATOM   7531 C  CA    . GLU B 2 431 ? -50.070  3.282   24.542  1.00 75.50  ? 430  GLU B CA    1 
ATOM   7532 C  C     . GLU B 2 431 ? -48.841  3.543   23.670  1.00 82.11  ? 430  GLU B C     1 
ATOM   7533 O  O     . GLU B 2 431 ? -48.933  3.553   22.440  1.00 79.61  ? 430  GLU B O     1 
ATOM   7534 C  CB    . GLU B 2 431 ? -50.434  1.793   24.527  1.00 79.09  ? 430  GLU B CB    1 
ATOM   7535 C  CG    . GLU B 2 431 ? -49.449  0.885   25.251  1.00 83.89  ? 430  GLU B CG    1 
ATOM   7536 C  CD    . GLU B 2 431 ? -49.882  -0.573  25.267  1.00 84.34  ? 430  GLU B CD    1 
ATOM   7537 O  OE1   . GLU B 2 431 ? -50.657  -0.988  24.377  1.00 85.47  ? 430  GLU B OE1   1 
ATOM   7538 O  OE2   . GLU B 2 431 ? -49.440  -1.310  26.172  1.00 85.82  ? 430  GLU B OE2   1 
ATOM   7539 N  N     . LYS B 2 432 ? -47.699  3.757   24.320  1.00 79.88  ? 431  LYS B N     1 
ATOM   7540 C  CA    . LYS B 2 432 ? -46.446  4.055   23.627  1.00 79.90  ? 431  LYS B CA    1 
ATOM   7541 C  C     . LYS B 2 432 ? -45.869  2.817   22.947  1.00 85.87  ? 431  LYS B C     1 
ATOM   7542 O  O     . LYS B 2 432 ? -45.318  2.900   21.850  1.00 84.70  ? 431  LYS B O     1 
ATOM   7543 C  CB    . LYS B 2 432 ? -45.422  4.643   24.601  1.00 79.52  ? 431  LYS B CB    1 
ATOM   7544 O  "O5'" . DT  C 3 3   ? -75.423  -13.398 38.634  1.00 88.16  ? 2    DT  D "O5'" 1 
ATOM   7545 C  "C5'" . DT  C 3 3   ? -75.603  -12.006 38.953  1.00 93.23  ? 2    DT  D "C5'" 1 
ATOM   7546 C  "C4'" . DT  C 3 3   ? -76.858  -11.816 39.773  1.00 102.93 ? 2    DT  D "C4'" 1 
ATOM   7547 O  "O4'" . DT  C 3 3   ? -76.684  -10.693 40.664  1.00 105.28 ? 2    DT  D "O4'" 1 
ATOM   7548 C  "C3'" . DT  C 3 3   ? -78.107  -11.495 38.960  1.00 108.82 ? 2    DT  D "C3'" 1 
ATOM   7549 O  "O3'" . DT  C 3 3   ? -78.794  -12.704 38.619  1.00 122.98 ? 2    DT  D "O3'" 1 
ATOM   7550 C  "C2'" . DT  C 3 3   ? -78.944  -10.674 39.925  1.00 103.09 ? 2    DT  D "C2'" 1 
ATOM   7551 C  "C1'" . DT  C 3 3   ? -77.918  -10.003 40.839  1.00 100.36 ? 2    DT  D "C1'" 1 
ATOM   7552 N  N1    . DT  C 3 3   ? -77.681  -8.567  40.572  1.00 104.49 ? 2    DT  D N1    1 
ATOM   7553 C  C2    . DT  C 3 3   ? -78.718  -7.680  40.763  1.00 109.11 ? 2    DT  D C2    1 
ATOM   7554 O  O2    . DT  C 3 3   ? -79.830  -8.022  41.135  1.00 110.83 ? 2    DT  D O2    1 
ATOM   7555 N  N3    . DT  C 3 3   ? -78.406  -6.369  40.498  1.00 99.20  ? 2    DT  D N3    1 
ATOM   7556 C  C4    . DT  C 3 3   ? -77.188  -5.868  40.076  1.00 95.27  ? 2    DT  D C4    1 
ATOM   7557 O  O4    . DT  C 3 3   ? -77.057  -4.663  39.878  1.00 86.05  ? 2    DT  D O4    1 
ATOM   7558 C  C5    . DT  C 3 3   ? -76.144  -6.854  39.901  1.00 98.30  ? 2    DT  D C5    1 
ATOM   7559 C  C7    . DT  C 3 3   ? -74.790  -6.406  39.446  1.00 87.42  ? 2    DT  D C7    1 
ATOM   7560 C  C6    . DT  C 3 3   ? -76.438  -8.135  40.157  1.00 100.41 ? 2    DT  D C6    1 
ATOM   7561 P  P     . DA  C 3 4   ? -79.155  -13.081 37.102  1.00 130.91 ? 3    DA  D P     1 
ATOM   7562 O  OP1   . DA  C 3 4   ? -79.239  -14.562 37.015  1.00 116.22 ? 3    DA  D OP1   1 
ATOM   7563 O  OP2   . DA  C 3 4   ? -78.238  -12.348 36.191  1.00 107.23 ? 3    DA  D OP2   1 
ATOM   7564 O  "O5'" . DA  C 3 4   ? -80.618  -12.476 36.915  1.00 109.58 ? 3    DA  D "O5'" 1 
ATOM   7565 C  "C5'" . DA  C 3 4   ? -81.780  -13.128 37.469  1.00 106.56 ? 3    DA  D "C5'" 1 
ATOM   7566 C  "C4'" . DA  C 3 4   ? -82.975  -12.204 37.407  1.00 103.72 ? 3    DA  D "C4'" 1 
ATOM   7567 O  "O4'" . DA  C 3 4   ? -82.632  -10.954 38.042  1.00 106.73 ? 3    DA  D "O4'" 1 
ATOM   7568 C  "C3'" . DA  C 3 4   ? -83.433  -11.857 35.992  1.00 100.61 ? 3    DA  D "C3'" 1 
ATOM   7569 O  "O3'" . DA  C 3 4   ? -84.575  -12.658 35.663  1.00 109.47 ? 3    DA  D "O3'" 1 
ATOM   7570 C  "C2'" . DA  C 3 4   ? -83.832  -10.392 36.071  1.00 94.23  ? 3    DA  D "C2'" 1 
ATOM   7571 C  "C1'" . DA  C 3 4   ? -83.166  -9.849  37.330  1.00 98.04  ? 3    DA  D "C1'" 1 
ATOM   7572 N  N9    . DA  C 3 4   ? -82.076  -8.901  37.094  1.00 93.74  ? 3    DA  D N9    1 
ATOM   7573 C  C8    . DA  C 3 4   ? -80.728  -9.135  37.213  1.00 91.17  ? 3    DA  D C8    1 
ATOM   7574 N  N7    . DA  C 3 4   ? -79.984  -8.089  36.949  1.00 86.48  ? 3    DA  D N7    1 
ATOM   7575 C  C5    . DA  C 3 4   ? -80.902  -7.097  36.639  1.00 91.99  ? 3    DA  D C5    1 
ATOM   7576 C  C6    . DA  C 3 4   ? -80.750  -5.748  36.269  1.00 93.13  ? 3    DA  D C6    1 
ATOM   7577 N  N6    . DA  C 3 4   ? -79.566  -5.144  36.142  1.00 87.35  ? 3    DA  D N6    1 
ATOM   7578 N  N1    . DA  C 3 4   ? -81.871  -5.032  36.028  1.00 92.10  ? 3    DA  D N1    1 
ATOM   7579 C  C2    . DA  C 3 4   ? -83.058  -5.639  36.156  1.00 88.23  ? 3    DA  D C2    1 
ATOM   7580 N  N3    . DA  C 3 4   ? -83.330  -6.897  36.496  1.00 89.26  ? 3    DA  D N3    1 
ATOM   7581 C  C4    . DA  C 3 4   ? -82.196  -7.582  36.728  1.00 92.58  ? 3    DA  D C4    1 
ATOM   7582 P  P     . DT  C 3 5   ? -84.964  -13.043 34.156  1.00 113.10 ? 4    DT  D P     1 
ATOM   7583 O  OP1   . DT  C 3 5   ? -86.078  -14.024 34.214  1.00 104.73 ? 4    DT  D OP1   1 
ATOM   7584 O  OP2   . DT  C 3 5   ? -83.722  -13.391 33.418  1.00 85.23  ? 4    DT  D OP2   1 
ATOM   7585 O  "O5'" . DT  C 3 5   ? -85.522  -11.675 33.557  1.00 97.14  ? 4    DT  D "O5'" 1 
ATOM   7586 C  "C5'" . DT  C 3 5   ? -86.774  -11.116 34.005  1.00 91.05  ? 4    DT  D "C5'" 1 
ATOM   7587 C  "C4'" . DT  C 3 5   ? -87.093  -9.857  33.231  1.00 87.96  ? 4    DT  D "C4'" 1 
ATOM   7588 O  "O4'" . DT  C 3 5   ? -86.130  -8.827  33.558  1.00 86.35  ? 4    DT  D "O4'" 1 
ATOM   7589 C  "C3'" . DT  C 3 5   ? -87.062  -10.013 31.707  1.00 95.82  ? 4    DT  D "C3'" 1 
ATOM   7590 O  "O3'" . DT  C 3 5   ? -88.239  -9.450  31.116  1.00 98.12  ? 4    DT  D "O3'" 1 
ATOM   7591 C  "C2'" . DT  C 3 5   ? -85.809  -9.263  31.286  1.00 92.24  ? 4    DT  D "C2'" 1 
ATOM   7592 C  "C1'" . DT  C 3 5   ? -85.668  -8.210  32.369  1.00 86.75  ? 4    DT  D "C1'" 1 
ATOM   7593 N  N1    . DT  C 3 5   ? -84.283  -7.754  32.603  1.00 82.49  ? 4    DT  D N1    1 
ATOM   7594 C  C2    . DT  C 3 5   ? -84.034  -6.399  32.617  1.00 84.90  ? 4    DT  D C2    1 
ATOM   7595 O  O2    . DT  C 3 5   ? -84.902  -5.558  32.447  1.00 84.27  ? 4    DT  D O2    1 
ATOM   7596 N  N3    . DT  C 3 5   ? -82.720  -6.062  32.835  1.00 86.46  ? 4    DT  D N3    1 
ATOM   7597 C  C4    . DT  C 3 5   ? -81.658  -6.924  33.038  1.00 84.82  ? 4    DT  D C4    1 
ATOM   7598 O  O4    . DT  C 3 5   ? -80.531  -6.473  33.222  1.00 79.79  ? 4    DT  D O4    1 
ATOM   7599 C  C5    . DT  C 3 5   ? -81.993  -8.331  33.010  1.00 80.93  ? 4    DT  D C5    1 
ATOM   7600 C  C7    . DT  C 3 5   ? -80.909  -9.341  33.220  1.00 84.65  ? 4    DT  D C7    1 
ATOM   7601 C  C6    . DT  C 3 5   ? -83.271  -8.670  32.797  1.00 80.96  ? 4    DT  D C6    1 
ATOM   7602 P  P     . DG  C 3 6   ? -88.594  -9.649  29.562  1.00 98.68  ? 5    DG  D P     1 
ATOM   7603 O  OP1   . DG  C 3 6   ? -90.062  -9.847  29.458  1.00 114.24 ? 5    DG  D OP1   1 
ATOM   7604 O  OP2   . DG  C 3 6   ? -87.678  -10.654 28.961  1.00 78.92  ? 5    DG  D OP2   1 
ATOM   7605 O  "O5'" . DG  C 3 6   ? -88.236  -8.223  28.948  1.00 94.03  ? 5    DG  D "O5'" 1 
ATOM   7606 C  "C5'" . DG  C 3 6   ? -88.967  -7.043  29.337  1.00 101.41 ? 5    DG  D "C5'" 1 
ATOM   7607 C  "C4'" . DG  C 3 6   ? -88.391  -5.813  28.672  1.00 110.09 ? 5    DG  D "C4'" 1 
ATOM   7608 O  "O4'" . DG  C 3 6   ? -87.116  -5.481  29.272  1.00 104.82 ? 5    DG  D "O4'" 1 
ATOM   7609 C  "C3'" . DG  C 3 6   ? -88.142  -5.939  27.166  1.00 110.14 ? 5    DG  D "C3'" 1 
ATOM   7610 O  "O3'" . DG  C 3 6   ? -88.695  -4.806  26.486  1.00 115.80 ? 5    DG  D "O3'" 1 
ATOM   7611 C  "C2'" . DG  C 3 6   ? -86.627  -5.995  27.047  1.00 98.65  ? 5    DG  D "C2'" 1 
ATOM   7612 C  "C1'" . DG  C 3 6   ? -86.165  -5.209  28.259  1.00 96.38  ? 5    DG  D "C1'" 1 
ATOM   7613 N  N9    . DG  C 3 6   ? -84.852  -5.596  28.767  1.00 89.78  ? 5    DG  D N9    1 
ATOM   7614 C  C8    . DG  C 3 6   ? -84.467  -6.845  29.191  1.00 88.77  ? 5    DG  D C8    1 
ATOM   7615 N  N7    . DG  C 3 6   ? -83.228  -6.889  29.598  1.00 82.28  ? 5    DG  D N7    1 
ATOM   7616 C  C5    . DG  C 3 6   ? -82.767  -5.589  29.439  1.00 79.71  ? 5    DG  D C5    1 
ATOM   7617 C  C6    . DG  C 3 6   ? -81.493  -5.025  29.713  1.00 76.62  ? 5    DG  D C6    1 
ATOM   7618 O  O6    . DG  C 3 6   ? -80.485  -5.580  30.167  1.00 81.20  ? 5    DG  D O6    1 
ATOM   7619 N  N1    . DG  C 3 6   ? -81.456  -3.670  29.400  1.00 71.84  ? 5    DG  D N1    1 
ATOM   7620 C  C2    . DG  C 3 6   ? -82.507  -2.948  28.890  1.00 74.75  ? 5    DG  D C2    1 
ATOM   7621 N  N2    . DG  C 3 6   ? -82.274  -1.648  28.655  1.00 69.55  ? 5    DG  D N2    1 
ATOM   7622 N  N3    . DG  C 3 6   ? -83.700  -3.461  28.630  1.00 78.75  ? 5    DG  D N3    1 
ATOM   7623 C  C4    . DG  C 3 6   ? -83.758  -4.778  28.926  1.00 81.10  ? 5    DG  D C4    1 
ATOM   7624 P  P     . DC  C 3 7   ? -88.779  -4.717  24.886  1.00 132.10 ? 6    DC  D P     1 
ATOM   7625 O  OP1   . DC  C 3 7   ? -89.936  -3.850  24.542  1.00 107.79 ? 6    DC  D OP1   1 
ATOM   7626 O  OP2   . DC  C 3 7   ? -88.692  -6.084  24.310  1.00 102.13 ? 6    DC  D OP2   1 
ATOM   7627 O  "O5'" . DC  C 3 7   ? -87.443  -3.936  24.511  1.00 114.39 ? 6    DC  D "O5'" 1 
ATOM   7628 C  "C5'" . DC  C 3 7   ? -87.064  -2.734  25.211  1.00 109.16 ? 6    DC  D "C5'" 1 
ATOM   7629 C  "C4'" . DC  C 3 7   ? -85.698  -2.265  24.764  1.00 99.01  ? 6    DC  D "C4'" 1 
ATOM   7630 O  "O4'" . DC  C 3 7   ? -84.676  -2.890  25.572  1.00 96.52  ? 6    DC  D "O4'" 1 
ATOM   7631 C  "C3'" . DC  C 3 7   ? -85.347  -2.578  23.305  1.00 102.88 ? 6    DC  D "C3'" 1 
ATOM   7632 O  "O3'" . DC  C 3 7   ? -85.179  -1.364  22.562  1.00 104.39 ? 6    DC  D "O3'" 1 
ATOM   7633 C  "C2'" . DC  C 3 7   ? -84.054  -3.379  23.386  1.00 94.43  ? 6    DC  D "C2'" 1 
ATOM   7634 C  "C1'" . DC  C 3 7   ? -83.526  -3.059  24.770  1.00 83.70  ? 6    DC  D "C1'" 1 
ATOM   7635 N  N1    . DC  C 3 7   ? -82.698  -4.117  25.375  1.00 83.33  ? 6    DC  D N1    1 
ATOM   7636 C  C2    . DC  C 3 7   ? -81.404  -3.798  25.803  1.00 74.06  ? 6    DC  D C2    1 
ATOM   7637 O  O2    . DC  C 3 7   ? -80.997  -2.634  25.668  1.00 70.84  ? 6    DC  D O2    1 
ATOM   7638 N  N3    . DC  C 3 7   ? -80.634  -4.764  26.357  1.00 73.64  ? 6    DC  D N3    1 
ATOM   7639 C  C4    . DC  C 3 7   ? -81.109  -6.006  26.483  1.00 75.61  ? 6    DC  D C4    1 
ATOM   7640 N  N4    . DC  C 3 7   ? -80.315  -6.926  27.035  1.00 74.96  ? 6    DC  D N4    1 
ATOM   7641 C  C5    . DC  C 3 7   ? -82.422  -6.358  26.053  1.00 82.33  ? 6    DC  D C5    1 
ATOM   7642 C  C6    . DC  C 3 7   ? -83.175  -5.391  25.509  1.00 83.19  ? 6    DC  D C6    1 
ATOM   7643 P  P     . DC  C 3 8   ? -84.843  -1.356  20.992  1.00 103.92 ? 7    DC  D P     1 
ATOM   7644 O  OP1   . DC  C 3 8   ? -85.255  -0.037  20.449  1.00 80.59  ? 7    DC  D OP1   1 
ATOM   7645 O  OP2   . DC  C 3 8   ? -85.368  -2.601  20.371  1.00 102.66 ? 7    DC  D OP2   1 
ATOM   7646 O  "O5'" . DC  C 3 8   ? -83.249  -1.397  21.011  1.00 87.49  ? 7    DC  D "O5'" 1 
ATOM   7647 C  "C5'" . DC  C 3 8   ? -82.501  -2.178  20.058  1.00 80.70  ? 7    DC  D "C5'" 1 
ATOM   7648 C  "C4'" . DC  C 3 8   ? -81.043  -1.787  20.119  1.00 77.73  ? 7    DC  D "C4'" 1 
ATOM   7649 O  "O4'" . DC  C 3 8   ? -80.553  -1.955  21.467  1.00 71.87  ? 7    DC  D "O4'" 1 
ATOM   7650 C  "C3'" . DC  C 3 8   ? -80.105  -2.625  19.257  1.00 81.92  ? 7    DC  D "C3'" 1 
ATOM   7651 O  "O3'" . DC  C 3 8   ? -80.035  -2.105  17.925  1.00 91.24  ? 7    DC  D "O3'" 1 
ATOM   7652 C  "C2'" . DC  C 3 8   ? -78.776  -2.461  19.971  1.00 71.25  ? 7    DC  D "C2'" 1 
ATOM   7653 C  "C1'" . DC  C 3 8   ? -79.169  -2.295  21.438  1.00 63.46  ? 7    DC  D "C1'" 1 
ATOM   7654 N  N1    . DC  C 3 8   ? -78.977  -3.508  22.253  1.00 56.28  ? 7    DC  D N1    1 
ATOM   7655 C  C2    . DC  C 3 8   ? -77.707  -3.771  22.779  1.00 58.53  ? 7    DC  D C2    1 
ATOM   7656 O  O2    . DC  C 3 8   ? -76.787  -2.970  22.553  1.00 54.93  ? 7    DC  D O2    1 
ATOM   7657 N  N3    . DC  C 3 8   ? -77.517  -4.885  23.523  1.00 59.22  ? 7    DC  D N3    1 
ATOM   7658 C  C4    . DC  C 3 8   ? -78.535  -5.721  23.745  1.00 62.33  ? 7    DC  D C4    1 
ATOM   7659 N  N4    . DC  C 3 8   ? -78.303  -6.807  24.485  1.00 65.68  ? 7    DC  D N4    1 
ATOM   7660 C  C5    . DC  C 3 8   ? -79.838  -5.480  23.216  1.00 65.25  ? 7    DC  D C5    1 
ATOM   7661 C  C6    . DC  C 3 8   ? -80.012  -4.372  22.483  1.00 63.05  ? 7    DC  D C6    1 
ATOM   7662 P  P     . DT  C 3 9   ? -79.579  -3.027  16.693  1.00 77.91  ? 8    DT  D P     1 
ATOM   7663 O  OP1   . DT  C 3 9   ? -79.780  -2.243  15.447  1.00 84.81  ? 8    DT  D OP1   1 
ATOM   7664 O  OP2   . DT  C 3 9   ? -80.230  -4.356  16.831  1.00 72.45  ? 8    DT  D OP2   1 
ATOM   7665 O  "O5'" . DT  C 3 9   ? -78.013  -3.219  16.919  1.00 67.36  ? 8    DT  D "O5'" 1 
ATOM   7666 C  "C5'" . DT  C 3 9   ? -77.103  -2.107  16.797  1.00 66.25  ? 8    DT  D "C5'" 1 
ATOM   7667 C  "C4'" . DT  C 3 9   ? -75.709  -2.505  17.223  1.00 61.77  ? 8    DT  D "C4'" 1 
ATOM   7668 O  "O4'" . DT  C 3 9   ? -75.692  -2.870  18.621  1.00 55.96  ? 8    DT  D "O4'" 1 
ATOM   7669 C  "C3'" . DT  C 3 9   ? -75.129  -3.720  16.510  1.00 71.56  ? 8    DT  D "C3'" 1 
ATOM   7670 O  "O3'" . DT  C 3 9   ? -74.575  -3.371  15.238  1.00 80.84  ? 8    DT  D "O3'" 1 
ATOM   7671 C  "C2'" . DT  C 3 9   ? -74.060  -4.180  17.484  1.00 66.02  ? 8    DT  D "C2'" 1 
ATOM   7672 C  "C1'" . DT  C 3 9   ? -74.640  -3.808  18.850  1.00 57.87  ? 8    DT  D "C1'" 1 
ATOM   7673 N  N1    . DT  C 3 9   ? -75.198  -4.954  19.598  1.00 55.04  ? 8    DT  D N1    1 
ATOM   7674 C  C2    . DT  C 3 9   ? -74.345  -5.681  20.399  1.00 55.89  ? 8    DT  D C2    1 
ATOM   7675 O  O2    . DT  C 3 9   ? -73.161  -5.416  20.529  1.00 61.42  ? 8    DT  D O2    1 
ATOM   7676 N  N3    . DT  C 3 9   ? -74.936  -6.735  21.054  1.00 55.38  ? 8    DT  D N3    1 
ATOM   7677 C  C4    . DT  C 3 9   ? -76.260  -7.126  20.985  1.00 53.99  ? 8    DT  D C4    1 
ATOM   7678 O  O4    . DT  C 3 9   ? -76.646  -8.096  21.632  1.00 54.74  ? 8    DT  D O4    1 
ATOM   7679 C  C5    . DT  C 3 9   ? -77.096  -6.321  20.121  1.00 54.95  ? 8    DT  D C5    1 
ATOM   7680 C  C7    . DT  C 3 9   ? -78.544  -6.670  19.980  1.00 52.99  ? 8    DT  D C7    1 
ATOM   7681 C  C6    . DT  C 3 9   ? -76.529  -5.292  19.478  1.00 54.43  ? 8    DT  D C6    1 
ATOM   7682 P  P     . DA  C 3 10  ? -74.631  -4.430  14.035  1.00 65.30  ? 9    DA  D P     1 
ATOM   7683 O  OP1   . DA  C 3 10  ? -74.168  -3.737  12.804  1.00 67.21  ? 9    DA  D OP1   1 
ATOM   7684 O  OP2   . DA  C 3 10  ? -75.960  -5.093  14.042  1.00 57.16  ? 9    DA  D OP2   1 
ATOM   7685 O  "O5'" . DA  C 3 10  ? -73.537  -5.511  14.453  1.00 58.64  ? 9    DA  D "O5'" 1 
ATOM   7686 C  "C5'" . DA  C 3 10  ? -72.131  -5.228  14.315  1.00 58.77  ? 9    DA  D "C5'" 1 
ATOM   7687 C  "C4'" . DA  C 3 10  ? -71.301  -6.191  15.134  1.00 59.80  ? 9    DA  D "C4'" 1 
ATOM   7688 O  "O4'" . DA  C 3 10  ? -71.821  -6.302  16.475  1.00 56.61  ? 9    DA  D "O4'" 1 
ATOM   7689 C  "C3'" . DA  C 3 10  ? -71.267  -7.626  14.627  1.00 63.36  ? 9    DA  D "C3'" 1 
ATOM   7690 O  "O3'" . DA  C 3 10  ? -70.309  -7.786  13.574  1.00 58.28  ? 9    DA  D "O3'" 1 
ATOM   7691 C  "C2'" . DA  C 3 10  ? -70.855  -8.393  15.870  1.00 64.02  ? 9    DA  D "C2'" 1 
ATOM   7692 C  "C1'" . DA  C 3 10  ? -71.435  -7.563  17.018  1.00 58.54  ? 9    DA  D "C1'" 1 
ATOM   7693 N  N9    . DA  C 3 10  ? -72.607  -8.165  17.653  1.00 59.28  ? 9    DA  D N9    1 
ATOM   7694 C  C8    . DA  C 3 10  ? -73.928  -7.824  17.494  1.00 58.63  ? 9    DA  D C8    1 
ATOM   7695 N  N7    . DA  C 3 10  ? -74.753  -8.561  18.198  1.00 54.00  ? 9    DA  D N7    1 
ATOM   7696 C  C5    . DA  C 3 10  ? -73.921  -9.451  18.862  1.00 57.00  ? 9    DA  D C5    1 
ATOM   7697 C  C6    . DA  C 3 10  ? -74.181  -10.495 19.768  1.00 58.56  ? 9    DA  D C6    1 
ATOM   7698 N  N6    . DA  C 3 10  ? -75.407  -10.833 20.176  1.00 58.76  ? 9    DA  D N6    1 
ATOM   7699 N  N1    . DA  C 3 10  ? -73.126  -11.191 20.245  1.00 57.58  ? 9    DA  D N1    1 
ATOM   7700 C  C2    . DA  C 3 10  ? -71.896  -10.851 19.836  1.00 55.45  ? 9    DA  D C2    1 
ATOM   7701 N  N3    . DA  C 3 10  ? -71.524  -9.892  18.991  1.00 56.99  ? 9    DA  D N3    1 
ATOM   7702 C  C4    . DA  C 3 10  ? -72.596  -9.220  18.535  1.00 58.32  ? 9    DA  D C4    1 
ATOM   7703 P  P     . DT  C 3 11  ? -70.467  -8.978  12.512  1.00 50.99  ? 10   DT  D P     1 
ATOM   7704 O  OP1   . DT  C 3 11  ? -69.497  -8.733  11.414  1.00 68.65  ? 10   DT  D OP1   1 
ATOM   7705 O  OP2   . DT  C 3 11  ? -71.908  -9.144  12.189  1.00 50.87  ? 10   DT  D OP2   1 
ATOM   7706 O  "O5'" . DT  C 3 11  ? -69.993  -10.263 13.327  1.00 54.86  ? 10   DT  D "O5'" 1 
ATOM   7707 C  "C5'" . DT  C 3 11  ? -68.609  -10.440 13.687  1.00 55.38  ? 10   DT  D "C5'" 1 
ATOM   7708 C  "C4'" . DT  C 3 11  ? -68.436  -11.625 14.609  1.00 54.46  ? 10   DT  D "C4'" 1 
ATOM   7709 O  "O4'" . DT  C 3 11  ? -69.108  -11.392 15.868  1.00 56.00  ? 10   DT  D "O4'" 1 
ATOM   7710 C  "C3'" . DT  C 3 11  ? -69.025  -12.940 14.116  1.00 58.73  ? 10   DT  D "C3'" 1 
ATOM   7711 O  "O3'" . DT  C 3 11  ? -68.204  -13.603 13.149  1.00 47.62  ? 10   DT  D "O3'" 1 
ATOM   7712 C  "C2'" . DT  C 3 11  ? -69.139  -13.724 15.408  1.00 58.65  ? 10   DT  D "C2'" 1 
ATOM   7713 C  "C1'" . DT  C 3 11  ? -69.537  -12.644 16.412  1.00 55.77  ? 10   DT  D "C1'" 1 
ATOM   7714 N  N1    . DT  C 3 11  ? -70.994  -12.576 16.641  1.00 54.73  ? 10   DT  D N1    1 
ATOM   7715 C  C2    . DT  C 3 11  ? -71.544  -13.427 17.574  1.00 57.44  ? 10   DT  D C2    1 
ATOM   7716 O  O2    . DT  C 3 11  ? -70.882  -14.210 18.235  1.00 58.21  ? 10   DT  D O2    1 
ATOM   7717 N  N3    . DT  C 3 11  ? -72.905  -13.316 17.716  1.00 58.41  ? 10   DT  D N3    1 
ATOM   7718 C  C4    . DT  C 3 11  ? -73.752  -12.468 17.025  1.00 60.22  ? 10   DT  D C4    1 
ATOM   7719 O  O4    . DT  C 3 11  ? -74.957  -12.481 17.263  1.00 66.77  ? 10   DT  D O4    1 
ATOM   7720 C  C5    . DT  C 3 11  ? -73.108  -11.612 16.054  1.00 52.55  ? 10   DT  D C5    1 
ATOM   7721 C  C7    . DT  C 3 11  ? -73.944  -10.660 15.257  1.00 54.24  ? 10   DT  D C7    1 
ATOM   7722 C  C6    . DT  C 3 11  ? -71.781  -11.713 15.907  1.00 54.94  ? 10   DT  D C6    1 
ATOM   7723 P  P     . DA  C 3 12  ? -68.926  -14.563 12.084  1.00 44.72  ? 11   DA  D P     1 
ATOM   7724 O  OP1   . DA  C 3 12  ? -67.903  -15.001 11.102  1.00 56.19  ? 11   DA  D OP1   1 
ATOM   7725 O  OP2   . DA  C 3 12  ? -70.157  -13.886 11.599  1.00 44.82  ? 11   DA  D OP2   1 
ATOM   7726 O  "O5'" . DA  C 3 12  ? -69.373  -15.826 12.949  1.00 58.81  ? 11   DA  D "O5'" 1 
ATOM   7727 C  "C5'" . DA  C 3 12  ? -68.395  -16.679 13.576  1.00 56.66  ? 11   DA  D "C5'" 1 
ATOM   7728 C  "C4'" . DA  C 3 12  ? -69.045  -17.616 14.568  1.00 56.60  ? 11   DA  D "C4'" 1 
ATOM   7729 O  "O4'" . DA  C 3 12  ? -69.763  -16.881 15.584  1.00 62.18  ? 11   DA  D "O4'" 1 
ATOM   7730 C  "C3'" . DA  C 3 12  ? -70.087  -18.565 13.994  1.00 57.15  ? 11   DA  D "C3'" 1 
ATOM   7731 O  "O3'" . DA  C 3 12  ? -69.493  -19.688 13.335  1.00 61.59  ? 11   DA  D "O3'" 1 
ATOM   7732 C  "C2'" . DA  C 3 12  ? -70.850  -18.969 15.241  1.00 59.96  ? 11   DA  D "C2'" 1 
ATOM   7733 C  "C1'" . DA  C 3 12  ? -70.842  -17.685 16.069  1.00 57.05  ? 11   DA  D "C1'" 1 
ATOM   7734 N  N9    . DA  C 3 12  ? -72.078  -16.911 15.949  1.00 59.55  ? 11   DA  D N9    1 
ATOM   7735 C  C8    . DA  C 3 12  ? -72.300  -15.775 15.211  1.00 60.85  ? 11   DA  D C8    1 
ATOM   7736 N  N7    . DA  C 3 12  ? -73.527  -15.320 15.295  1.00 62.45  ? 11   DA  D N7    1 
ATOM   7737 C  C5    . DA  C 3 12  ? -74.160  -16.224 16.138  1.00 68.45  ? 11   DA  D C5    1 
ATOM   7738 C  C6    . DA  C 3 12  ? -75.477  -16.301 16.624  1.00 67.50  ? 11   DA  D C6    1 
ATOM   7739 N  N6    . DA  C 3 12  ? -76.432  -15.420 16.319  1.00 67.19  ? 11   DA  D N6    1 
ATOM   7740 N  N1    . DA  C 3 12  ? -75.783  -17.329 17.447  1.00 70.48  ? 11   DA  D N1    1 
ATOM   7741 C  C2    . DA  C 3 12  ? -74.824  -18.212 17.753  1.00 71.19  ? 11   DA  D C2    1 
ATOM   7742 N  N3    . DA  C 3 12  ? -73.552  -18.246 17.360  1.00 65.08  ? 11   DA  D N3    1 
ATOM   7743 C  C4    . DA  C 3 12  ? -73.280  -17.211 16.544  1.00 65.49  ? 11   DA  D C4    1 
ATOM   7744 P  P     . DG  C 3 13  ? -70.283  -20.356 12.112  1.00 64.02  ? 12   DG  D P     1 
ATOM   7745 O  OP1   . DG  C 3 13  ? -69.480  -21.508 11.627  1.00 58.46  ? 12   DG  D OP1   1 
ATOM   7746 O  OP2   . DG  C 3 13  ? -70.667  -19.282 11.159  1.00 69.39  ? 12   DG  D OP2   1 
ATOM   7747 O  "O5'" . DG  C 3 13  ? -71.613  -20.895 12.808  1.00 70.14  ? 12   DG  D "O5'" 1 
ATOM   7748 C  "C5'" . DG  C 3 13  ? -71.785  -22.296 13.095  1.00 77.44  ? 12   DG  D "C5'" 1 
ATOM   7749 C  "C4'" . DG  C 3 13  ? -72.416  -22.501 14.453  1.00 81.41  ? 12   DG  D "C4'" 1 
ATOM   7750 O  "O4'" . DG  C 3 13  ? -73.008  -21.281 14.948  1.00 80.32  ? 12   DG  D "O4'" 1 
ATOM   7751 C  "C3'" . DG  C 3 13  ? -73.562  -23.502 14.469  1.00 84.50  ? 12   DG  D "C3'" 1 
ATOM   7752 O  "O3'" . DG  C 3 13  ? -73.066  -24.843 14.501  1.00 87.00  ? 12   DG  D "O3'" 1 
ATOM   7753 C  "C2'" . DG  C 3 13  ? -74.308  -23.118 15.734  1.00 93.43  ? 12   DG  D "C2'" 1 
ATOM   7754 C  "C1'" . DG  C 3 13  ? -74.052  -21.612 15.865  1.00 80.87  ? 12   DG  D "C1'" 1 
ATOM   7755 N  N9    . DG  C 3 13  ? -75.207  -20.770 15.561  1.00 75.75  ? 12   DG  D N9    1 
ATOM   7756 C  C8    . DG  C 3 13  ? -75.277  -19.763 14.629  1.00 77.47  ? 12   DG  D C8    1 
ATOM   7757 N  N7    . DG  C 3 13  ? -76.446  -19.183 14.587  1.00 77.24  ? 12   DG  D N7    1 
ATOM   7758 C  C5    . DG  C 3 13  ? -77.193  -19.844 15.552  1.00 76.84  ? 12   DG  D C5    1 
ATOM   7759 C  C6    . DG  C 3 13  ? -78.539  -19.655 15.963  1.00 73.19  ? 12   DG  D C6    1 
ATOM   7760 O  O6    . DG  C 3 13  ? -79.367  -18.838 15.542  1.00 73.93  ? 12   DG  D O6    1 
ATOM   7761 N  N1    . DG  C 3 13  ? -78.895  -20.544 16.972  1.00 71.14  ? 12   DG  D N1    1 
ATOM   7762 C  C2    . DG  C 3 13  ? -78.066  -21.494 17.518  1.00 74.56  ? 12   DG  D C2    1 
ATOM   7763 N  N2    . DG  C 3 13  ? -78.595  -22.257 18.485  1.00 83.44  ? 12   DG  D N2    1 
ATOM   7764 N  N3    . DG  C 3 13  ? -76.809  -21.679 17.146  1.00 72.61  ? 12   DG  D N3    1 
ATOM   7765 C  C4    . DG  C 3 13  ? -76.442  -20.826 16.164  1.00 75.87  ? 12   DG  D C4    1 
ATOM   7766 P  P     . DT  C 3 14  ? -73.682  -25.941 13.509  1.00 90.25  ? 13   DT  D P     1 
ATOM   7767 O  OP1   . DT  C 3 14  ? -72.706  -27.055 13.398  1.00 101.53 ? 13   DT  D OP1   1 
ATOM   7768 O  OP2   . DT  C 3 14  ? -74.168  -25.269 12.275  1.00 61.95  ? 13   DT  D OP2   1 
ATOM   7769 O  "O5'" . DT  C 3 14  ? -74.948  -26.460 14.325  1.00 96.00  ? 13   DT  D "O5'" 1 
ATOM   7770 C  "C5'" . DT  C 3 14  ? -74.791  -27.045 15.632  1.00 87.65  ? 13   DT  D "C5'" 1 
ATOM   7771 C  "C4'" . DT  C 3 14  ? -76.102  -27.029 16.384  1.00 74.08  ? 13   DT  D "C4'" 1 
ATOM   7772 O  "O4'" . DT  C 3 14  ? -76.561  -25.671 16.551  1.00 69.82  ? 13   DT  D "O4'" 1 
ATOM   7773 C  "C3'" . DT  C 3 14  ? -77.254  -27.743 15.688  1.00 76.00  ? 13   DT  D "C3'" 1 
ATOM   7774 O  "O3'" . DT  C 3 14  ? -77.234  -29.139 16.009  1.00 79.37  ? 13   DT  D "O3'" 1 
ATOM   7775 C  "C2'" . DT  C 3 14  ? -78.475  -27.060 16.278  1.00 82.59  ? 13   DT  D "C2'" 1 
ATOM   7776 C  "C1'" . DT  C 3 14  ? -77.982  -25.661 16.658  1.00 74.69  ? 13   DT  D "C1'" 1 
ATOM   7777 N  N1    . DT  C 3 14  ? -78.498  -24.572 15.801  1.00 73.47  ? 13   DT  D N1    1 
ATOM   7778 C  C2    . DT  C 3 14  ? -79.792  -24.142 15.999  1.00 76.88  ? 13   DT  D C2    1 
ATOM   7779 O  O2    . DT  C 3 14  ? -80.532  -24.616 16.845  1.00 80.96  ? 13   DT  D O2    1 
ATOM   7780 N  N3    . DT  C 3 14  ? -80.191  -23.128 15.162  1.00 75.83  ? 13   DT  D N3    1 
ATOM   7781 C  C4    . DT  C 3 14  ? -79.443  -22.516 14.173  1.00 77.11  ? 13   DT  D C4    1 
ATOM   7782 O  O4    . DT  C 3 14  ? -79.938  -21.616 13.500  1.00 76.95  ? 13   DT  D O4    1 
ATOM   7783 C  C5    . DT  C 3 14  ? -78.094  -23.017 14.023  1.00 77.01  ? 13   DT  D C5    1 
ATOM   7784 C  C7    . DT  C 3 14  ? -77.209  -22.417 12.977  1.00 74.49  ? 13   DT  D C7    1 
ATOM   7785 C  C6    . DT  C 3 14  ? -77.696  -24.006 14.833  1.00 78.69  ? 13   DT  D C6    1 
ATOM   7786 P  P     . DT  C 3 15  ? -77.859  -30.233 15.018  1.00 85.91  ? 14   DT  D P     1 
ATOM   7787 O  OP1   . DT  C 3 15  ? -77.335  -31.562 15.424  1.00 88.89  ? 14   DT  D OP1   1 
ATOM   7788 O  OP2   . DT  C 3 15  ? -77.679  -29.775 13.615  1.00 64.98  ? 14   DT  D OP2   1 
ATOM   7789 O  "O5'" . DT  C 3 15  ? -79.414  -30.182 15.361  1.00 85.84  ? 14   DT  D "O5'" 1 
ATOM   7790 C  "C5'" . DT  C 3 15  ? -79.901  -30.508 16.678  1.00 70.12  ? 14   DT  D "C5'" 1 
ATOM   7791 C  "C4'" . DT  C 3 15  ? -81.387  -30.247 16.763  1.00 65.51  ? 14   DT  D "C4'" 1 
ATOM   7792 O  "O4'" . DT  C 3 15  ? -81.634  -28.838 16.547  1.00 72.66  ? 14   DT  D "O4'" 1 
ATOM   7793 C  "C3'" . DT  C 3 15  ? -82.221  -31.006 15.727  1.00 61.39  ? 14   DT  D "C3'" 1 
ATOM   7794 O  "O3'" . DT  C 3 15  ? -83.179  -31.860 16.366  1.00 60.95  ? 14   DT  D "O3'" 1 
ATOM   7795 C  "C2'" . DT  C 3 15  ? -82.870  -29.923 14.879  1.00 62.18  ? 14   DT  D "C2'" 1 
ATOM   7796 C  "C1'" . DT  C 3 15  ? -82.763  -28.660 15.713  1.00 71.63  ? 14   DT  D "C1'" 1 
ATOM   7797 N  N1    . DT  C 3 15  ? -82.537  -27.444 14.906  1.00 71.10  ? 14   DT  D N1    1 
ATOM   7798 C  C2    . DT  C 3 15  ? -83.525  -26.485 14.858  1.00 72.57  ? 14   DT  D C2    1 
ATOM   7799 O  O2    . DT  C 3 15  ? -84.583  -26.584 15.459  1.00 73.94  ? 14   DT  D O2    1 
ATOM   7800 N  N3    . DT  C 3 15  ? -83.226  -25.397 14.073  1.00 71.13  ? 14   DT  D N3    1 
ATOM   7801 C  C4    . DT  C 3 15  ? -82.067  -25.180 13.351  1.00 73.65  ? 14   DT  D C4    1 
ATOM   7802 O  O4    . DT  C 3 15  ? -81.941  -24.151 12.692  1.00 74.47  ? 14   DT  D O4    1 
ATOM   7803 C  C5    . DT  C 3 15  ? -81.076  -26.229 13.446  1.00 72.48  ? 14   DT  D C5    1 
ATOM   7804 C  C7    . DT  C 3 15  ? -79.789  -26.084 12.697  1.00 72.34  ? 14   DT  D C7    1 
ATOM   7805 C  C6    . DT  C 3 15  ? -81.359  -27.295 14.206  1.00 73.85  ? 14   DT  D C6    1 
ATOM   7806 P  P     . DA  C 3 16  ? -84.070  -32.890 15.519  1.00 57.93  ? 15   DA  D P     1 
ATOM   7807 O  OP1   . DA  C 3 16  ? -84.836  -33.734 16.472  1.00 67.27  ? 15   DA  D OP1   1 
ATOM   7808 O  OP2   . DA  C 3 16  ? -83.223  -33.536 14.483  1.00 53.69  ? 15   DA  D OP2   1 
ATOM   7809 O  "O5'" . DA  C 3 16  ? -85.084  -31.893 14.802  1.00 56.21  ? 15   DA  D "O5'" 1 
ATOM   7810 C  "C5'" . DA  C 3 16  ? -86.151  -32.378 13.968  1.00 49.06  ? 15   DA  D "C5'" 1 
ATOM   7811 C  "C4'" . DA  C 3 16  ? -87.174  -31.287 13.752  1.00 55.77  ? 15   DA  D "C4'" 1 
ATOM   7812 O  "O4'" . DA  C 3 16  ? -86.588  -29.987 13.985  1.00 49.82  ? 15   DA  D "O4'" 1 
ATOM   7813 C  "C3'" . DA  C 3 16  ? -87.722  -31.200 12.334  1.00 54.84  ? 15   DA  D "C3'" 1 
ATOM   7814 O  "O3'" . DA  C 3 16  ? -88.765  -32.159 12.125  1.00 55.86  ? 15   DA  D "O3'" 1 
ATOM   7815 C  "C2'" . DA  C 3 16  ? -88.229  -29.770 12.273  1.00 57.60  ? 15   DA  D "C2'" 1 
ATOM   7816 C  "C1'" . DA  C 3 16  ? -87.295  -29.011 13.221  1.00 55.68  ? 15   DA  D "C1'" 1 
ATOM   7817 N  N9    . DA  C 3 16  ? -86.313  -28.160 12.545  1.00 60.58  ? 15   DA  D N9    1 
ATOM   7818 C  C8    . DA  C 3 16  ? -84.951  -28.319 12.481  1.00 61.10  ? 15   DA  D C8    1 
ATOM   7819 N  N7    . DA  C 3 16  ? -84.340  -27.385 11.793  1.00 66.31  ? 15   DA  D N7    1 
ATOM   7820 C  C5    . DA  C 3 16  ? -85.370  -26.554 11.374  1.00 69.63  ? 15   DA  D C5    1 
ATOM   7821 C  C6    . DA  C 3 16  ? -85.383  -25.380 10.599  1.00 72.04  ? 15   DA  D C6    1 
ATOM   7822 N  N6    . DA  C 3 16  ? -84.284  -24.814 10.093  1.00 73.70  ? 15   DA  D N6    1 
ATOM   7823 N  N1    . DA  C 3 16  ? -86.578  -24.796 10.362  1.00 71.87  ? 15   DA  D N1    1 
ATOM   7824 C  C2    . DA  C 3 16  ? -87.680  -25.364 10.870  1.00 69.55  ? 15   DA  D C2    1 
ATOM   7825 N  N3    . DA  C 3 16  ? -87.796  -26.465 11.611  1.00 66.14  ? 15   DA  D N3    1 
ATOM   7826 C  C4    . DA  C 3 16  ? -86.591  -27.019 11.829  1.00 65.86  ? 15   DA  D C4    1 
ATOM   7827 P  P     . DT  C 3 17  ? -89.014  -32.760 10.660  1.00 47.61  ? 16   DT  D P     1 
ATOM   7828 O  OP1   . DT  C 3 17  ? -89.884  -33.956 10.786  1.00 59.06  ? 16   DT  D OP1   1 
ATOM   7829 O  OP2   . DT  C 3 17  ? -87.710  -32.877 9.955   1.00 72.68  ? 16   DT  D OP2   1 
ATOM   7830 O  "O5'" . DT  C 3 17  ? -89.859  -31.609 9.954   1.00 57.89  ? 16   DT  D "O5'" 1 
ATOM   7831 C  "C5'" . DT  C 3 17  ? -91.130  -31.194 10.490  1.00 62.84  ? 16   DT  D "C5'" 1 
ATOM   7832 C  "C4'" . DT  C 3 17  ? -91.573  -29.895 9.859   1.00 61.25  ? 16   DT  D "C4'" 1 
ATOM   7833 O  "O4'" . DT  C 3 17  ? -90.611  -28.855 10.136  1.00 58.04  ? 16   DT  D "O4'" 1 
ATOM   7834 C  "C3'" . DT  C 3 17  ? -91.685  -29.922 8.340   1.00 58.40  ? 16   DT  D "C3'" 1 
ATOM   7835 O  "O3'" . DT  C 3 17  ? -92.966  -30.422 7.942   1.00 53.90  ? 16   DT  D "O3'" 1 
ATOM   7836 C  "C2'" . DT  C 3 17  ? -91.519  -28.459 7.972   1.00 60.72  ? 16   DT  D "C2'" 1 
ATOM   7837 C  "C1'" . DT  C 3 17  ? -90.628  -27.896 9.080   1.00 60.17  ? 16   DT  D "C1'" 1 
ATOM   7838 N  N1    . DT  C 3 17  ? -89.230  -27.636 8.674   1.00 60.62  ? 16   DT  D N1    1 
ATOM   7839 C  C2    . DT  C 3 17  ? -88.964  -26.499 7.943   1.00 66.27  ? 16   DT  D C2    1 
ATOM   7840 O  O2    . DT  C 3 17  ? -89.825  -25.698 7.617   1.00 64.41  ? 16   DT  D O2    1 
ATOM   7841 N  N3    . DT  C 3 17  ? -87.642  -26.330 7.609   1.00 70.39  ? 16   DT  D N3    1 
ATOM   7842 C  C4    . DT  C 3 17  ? -86.586  -27.165 7.925   1.00 68.88  ? 16   DT  D C4    1 
ATOM   7843 O  O4    . DT  C 3 17  ? -85.450  -26.882 7.553   1.00 72.19  ? 16   DT  D O4    1 
ATOM   7844 C  C5    . DT  C 3 17  ? -86.938  -28.339 8.692   1.00 62.78  ? 16   DT  D C5    1 
ATOM   7845 C  C7    . DT  C 3 17  ? -85.862  -29.304 9.079   1.00 62.72  ? 16   DT  D C7    1 
ATOM   7846 C  C6    . DT  C 3 17  ? -88.224  -28.513 9.023   1.00 61.96  ? 16   DT  D C6    1 
ATOM   7847 P  P     . DT  C 3 18  ? -93.135  -31.252 6.582   1.00 70.53  ? 17   DT  D P     1 
ATOM   7848 O  OP1   . DT  C 3 18  ? -94.514  -31.804 6.556   1.00 58.46  ? 17   DT  D OP1   1 
ATOM   7849 O  OP2   . DT  C 3 18  ? -91.978  -32.172 6.432   1.00 73.15  ? 17   DT  D OP2   1 
ATOM   7850 O  "O5'" . DT  C 3 18  ? -93.024  -30.125 5.461   1.00 76.21  ? 17   DT  D "O5'" 1 
ATOM   7851 C  "C5'" . DT  C 3 18  ? -94.004  -29.072 5.370   1.00 70.90  ? 17   DT  D "C5'" 1 
ATOM   7852 C  "C4'" . DT  C 3 18  ? -93.529  -27.977 4.442   1.00 67.29  ? 17   DT  D "C4'" 1 
ATOM   7853 O  "O4'" . DT  C 3 18  ? -92.409  -27.275 5.023   1.00 61.87  ? 17   DT  D "O4'" 1 
ATOM   7854 C  "C3'" . DT  C 3 18  ? -93.016  -28.445 3.087   1.00 68.69  ? 17   DT  D "C3'" 1 
ATOM   7855 O  "O3'" . DT  C 3 18  ? -94.085  -28.686 2.165   1.00 68.16  ? 17   DT  D "O3'" 1 
ATOM   7856 C  "C2'" . DT  C 3 18  ? -92.150  -27.276 2.658   1.00 69.09  ? 17   DT  D "C2'" 1 
ATOM   7857 C  "C1'" . DT  C 3 18  ? -91.589  -26.750 3.979   1.00 64.09  ? 17   DT  D "C1'" 1 
ATOM   7858 N  N1    . DT  C 3 18  ? -90.191  -27.153 4.240   1.00 65.55  ? 17   DT  D N1    1 
ATOM   7859 C  C2    . DT  C 3 18  ? -89.185  -26.320 3.803   1.00 69.95  ? 17   DT  D C2    1 
ATOM   7860 O  O2    . DT  C 3 18  ? -89.395  -25.265 3.228   1.00 72.26  ? 17   DT  D O2    1 
ATOM   7861 N  N3    . DT  C 3 18  ? -87.914  -26.767 4.073   1.00 72.00  ? 17   DT  D N3    1 
ATOM   7862 C  C4    . DT  C 3 18  ? -87.559  -27.940 4.714   1.00 68.54  ? 17   DT  D C4    1 
ATOM   7863 O  O4    . DT  C 3 18  ? -86.373  -28.208 4.885   1.00 67.01  ? 17   DT  D O4    1 
ATOM   7864 C  C5    . DT  C 3 18  ? -88.665  -28.769 5.139   1.00 66.35  ? 17   DT  D C5    1 
ATOM   7865 C  C7    . DT  C 3 18  ? -88.379  -30.060 5.839   1.00 65.53  ? 17   DT  D C7    1 
ATOM   7866 C  C6    . DT  C 3 18  ? -89.908  -28.342 4.879   1.00 65.52  ? 17   DT  D C6    1 
ATOM   7867 P  P     . DG  C 3 19  ? -93.869  -29.706 0.944   1.00 80.11  ? 18   DG  D P     1 
ATOM   7868 O  OP1   . DG  C 3 19  ? -95.186  -29.910 0.288   1.00 76.09  ? 18   DG  D OP1   1 
ATOM   7869 O  OP2   . DG  C 3 19  ? -93.106  -30.884 1.432   1.00 76.30  ? 18   DG  D OP2   1 
ATOM   7870 O  "O5'" . DG  C 3 19  ? -92.934  -28.889 -0.054  1.00 85.57  ? 18   DG  D "O5'" 1 
ATOM   7871 C  "C5'" . DG  C 3 19  ? -93.390  -27.659 -0.650  1.00 87.58  ? 18   DG  D "C5'" 1 
ATOM   7872 C  "C4'" . DG  C 3 19  ? -92.243  -26.903 -1.281  1.00 82.84  ? 18   DG  D "C4'" 1 
ATOM   7873 O  "O4'" . DG  C 3 19  ? -91.276  -26.502 -0.287  1.00 81.58  ? 18   DG  D "O4'" 1 
ATOM   7874 C  "C3'" . DG  C 3 19  ? -91.427  -27.680 -2.304  1.00 82.30  ? 18   DG  D "C3'" 1 
ATOM   7875 O  "O3'" . DG  C 3 19  ? -92.082  -27.706 -3.576  1.00 84.02  ? 18   DG  D "O3'" 1 
ATOM   7876 C  "C2'" . DG  C 3 19  ? -90.136  -26.884 -2.342  1.00 80.80  ? 18   DG  D "C2'" 1 
ATOM   7877 C  "C1'" . DG  C 3 19  ? -89.992  -26.386 -0.902  1.00 78.84  ? 18   DG  D "C1'" 1 
ATOM   7878 N  N9    . DG  C 3 19  ? -89.037  -27.155 -0.108  1.00 76.11  ? 18   DG  D N9    1 
ATOM   7879 C  C8    . DG  C 3 19  ? -89.320  -28.077 0.870   1.00 75.09  ? 18   DG  D C8    1 
ATOM   7880 N  N7    . DG  C 3 19  ? -88.251  -28.610 1.398   1.00 75.96  ? 18   DG  D N7    1 
ATOM   7881 C  C5    . DG  C 3 19  ? -87.198  -28.008 0.722   1.00 76.02  ? 18   DG  D C5    1 
ATOM   7882 C  C6    . DG  C 3 19  ? -85.795  -28.187 0.857   1.00 79.20  ? 18   DG  D C6    1 
ATOM   7883 O  O6    . DG  C 3 19  ? -85.184  -28.935 1.630   1.00 84.74  ? 18   DG  D O6    1 
ATOM   7884 N  N1    . DG  C 3 19  ? -85.090  -27.376 -0.026  1.00 77.80  ? 18   DG  D N1    1 
ATOM   7885 C  C2    . DG  C 3 19  ? -85.656  -26.508 -0.927  1.00 77.72  ? 18   DG  D C2    1 
ATOM   7886 N  N2    . DG  C 3 19  ? -84.805  -25.812 -1.695  1.00 75.78  ? 18   DG  D N2    1 
ATOM   7887 N  N3    . DG  C 3 19  ? -86.961  -26.332 -1.063  1.00 76.45  ? 18   DG  D N3    1 
ATOM   7888 C  C4    . DG  C 3 19  ? -87.667  -27.109 -0.213  1.00 73.86  ? 18   DG  D C4    1 
ATOM   7889 P  P     . DT  C 3 20  ? -91.850  -28.930 -4.584  1.00 81.67  ? 19   DT  D P     1 
ATOM   7890 O  OP1   . DT  C 3 20  ? -92.942  -28.903 -5.590  1.00 92.28  ? 19   DT  D OP1   1 
ATOM   7891 O  OP2   . DT  C 3 20  ? -91.607  -30.169 -3.800  1.00 77.05  ? 19   DT  D OP2   1 
ATOM   7892 O  "O5'" . DT  C 3 20  ? -90.491  -28.524 -5.309  1.00 87.44  ? 19   DT  D "O5'" 1 
ATOM   7893 C  "C5'" . DT  C 3 20  ? -90.381  -27.283 -6.032  1.00 84.96  ? 19   DT  D "C5'" 1 
ATOM   7894 C  "C4'" . DT  C 3 20  ? -88.948  -27.033 -6.443  1.00 81.35  ? 19   DT  D "C4'" 1 
ATOM   7895 O  "O4'" . DT  C 3 20  ? -88.146  -26.721 -5.282  1.00 78.33  ? 19   DT  D "O4'" 1 
ATOM   7896 C  "C3'" . DT  C 3 20  ? -88.244  -28.219 -7.089  1.00 82.97  ? 19   DT  D "C3'" 1 
ATOM   7897 O  "O3'" . DT  C 3 20  ? -88.540  -28.304 -8.487  1.00 88.39  ? 19   DT  D "O3'" 1 
ATOM   7898 C  "C2'" . DT  C 3 20  ? -86.783  -27.905 -6.828  1.00 80.41  ? 19   DT  D "C2'" 1 
ATOM   7899 C  "C1'" . DT  C 3 20  ? -86.820  -27.219 -5.464  1.00 78.17  ? 19   DT  D "C1'" 1 
ATOM   7900 N  N1    . DT  C 3 20  ? -86.505  -28.112 -4.329  1.00 75.22  ? 19   DT  D N1    1 
ATOM   7901 C  C2    . DT  C 3 20  ? -85.183  -28.280 -3.980  1.00 75.66  ? 19   DT  D C2    1 
ATOM   7902 O  O2    . DT  C 3 20  ? -84.264  -27.722 -4.558  1.00 72.53  ? 19   DT  D O2    1 
ATOM   7903 N  N3    . DT  C 3 20  ? -84.975  -29.130 -2.922  1.00 77.73  ? 19   DT  D N3    1 
ATOM   7904 C  C4    . DT  C 3 20  ? -85.935  -29.812 -2.196  1.00 75.90  ? 19   DT  D C4    1 
ATOM   7905 O  O4    . DT  C 3 20  ? -85.595  -30.543 -1.269  1.00 75.00  ? 19   DT  D O4    1 
ATOM   7906 C  C5    . DT  C 3 20  ? -87.300  -29.591 -2.619  1.00 76.51  ? 19   DT  D C5    1 
ATOM   7907 C  C7    . DT  C 3 20  ? -88.408  -30.289 -1.895  1.00 76.17  ? 19   DT  D C7    1 
ATOM   7908 C  C6    . DT  C 3 20  ? -87.513  -28.766 -3.652  1.00 75.61  ? 19   DT  D C6    1 
ATOM   7909 P  P     . DG  C 3 21  ? -88.664  -29.743 -9.185  1.00 103.14 ? 20   DG  D P     1 
ATOM   7910 O  OP1   . DG  C 3 21  ? -89.108  -29.530 -10.586 1.00 89.69  ? 20   DG  D OP1   1 
ATOM   7911 O  OP2   . DG  C 3 21  ? -89.450  -30.640 -8.298  1.00 92.06  ? 20   DG  D OP2   1 
ATOM   7912 O  "O5'" . DG  C 3 21  ? -87.157  -30.262 -9.208  1.00 84.69  ? 20   DG  D "O5'" 1 
ATOM   7913 C  "C5'" . DG  C 3 21  ? -86.143  -29.537 -9.930  1.00 76.03  ? 20   DG  D "C5'" 1 
ATOM   7914 C  "C4'" . DG  C 3 21  ? -84.769  -30.107 -9.662  1.00 74.80  ? 20   DG  D "C4'" 1 
ATOM   7915 O  "O4'" . DG  C 3 21  ? -84.271  -29.682 -8.373  1.00 72.50  ? 20   DG  D "O4'" 1 
ATOM   7916 C  "C3'" . DG  C 3 21  ? -84.670  -31.625 -9.606  1.00 78.79  ? 20   DG  D "C3'" 1 
ATOM   7917 O  "O3'" . DG  C 3 21  ? -84.690  -32.231 -10.901 1.00 85.33  ? 20   DG  D "O3'" 1 
ATOM   7918 C  "C2'" . DG  C 3 21  ? -83.344  -31.811 -8.895  1.00 77.68  ? 20   DG  D "C2'" 1 
ATOM   7919 C  "C1'" . DG  C 3 21  ? -83.368  -30.673 -7.873  1.00 74.70  ? 20   DG  D "C1'" 1 
ATOM   7920 N  N9    . DG  C 3 21  ? -83.843  -31.103 -6.562  1.00 78.18  ? 20   DG  D N9    1 
ATOM   7921 C  C8    . DG  C 3 21  ? -85.117  -30.987 -6.058  1.00 80.49  ? 20   DG  D C8    1 
ATOM   7922 N  N7    . DG  C 3 21  ? -85.241  -31.491 -4.860  1.00 78.10  ? 20   DG  D N7    1 
ATOM   7923 C  C5    . DG  C 3 21  ? -83.977  -31.981 -4.560  1.00 73.78  ? 20   DG  D C5    1 
ATOM   7924 C  C6    . DG  C 3 21  ? -83.499  -32.641 -3.397  1.00 73.98  ? 20   DG  D C6    1 
ATOM   7925 O  O6    . DG  C 3 21  ? -84.116  -32.930 -2.365  1.00 74.51  ? 20   DG  D O6    1 
ATOM   7926 N  N1    . DG  C 3 21  ? -82.151  -32.968 -3.514  1.00 78.48  ? 20   DG  D N1    1 
ATOM   7927 C  C2    . DG  C 3 21  ? -81.363  -32.697 -4.606  1.00 72.71  ? 20   DG  D C2    1 
ATOM   7928 N  N2    . DG  C 3 21  ? -80.085  -33.094 -4.526  1.00 73.49  ? 20   DG  D N2    1 
ATOM   7929 N  N3    . DG  C 3 21  ? -81.798  -32.085 -5.695  1.00 73.58  ? 20   DG  D N3    1 
ATOM   7930 C  C4    . DG  C 3 21  ? -83.105  -31.757 -5.604  1.00 74.08  ? 20   DG  D C4    1 
ATOM   7931 P  P     . DG  C 3 22  ? -85.323  -33.698 -11.033 1.00 79.48  ? 21   DG  D P     1 
ATOM   7932 O  OP1   . DG  C 3 22  ? -85.106  -34.151 -12.431 1.00 72.91  ? 21   DG  D OP1   1 
ATOM   7933 O  OP2   . DG  C 3 22  ? -86.704  -33.662 -10.484 1.00 83.20  ? 21   DG  D OP2   1 
ATOM   7934 O  "O5'" . DG  C 3 22  ? -84.425  -34.576 -10.050 1.00 73.65  ? 21   DG  D "O5'" 1 
ATOM   7935 C  "C5'" . DG  C 3 22  ? -83.482  -35.529 -10.573 1.00 77.87  ? 21   DG  D "C5'" 1 
ATOM   7936 C  "C4'" . DG  C 3 22  ? -82.456  -35.926 -9.535  1.00 84.88  ? 21   DG  D "C4'" 1 
ATOM   7937 O  "O4'" . DG  C 3 22  ? -82.515  -35.087 -8.361  1.00 72.20  ? 21   DG  D "O4'" 1 
ATOM   7938 C  "C3'" . DG  C 3 22  ? -82.607  -37.337 -8.989  1.00 86.62  ? 21   DG  D "C3'" 1 
ATOM   7939 O  "O3'" . DG  C 3 22  ? -82.101  -38.303 -9.915  1.00 97.45  ? 21   DG  D "O3'" 1 
ATOM   7940 C  "C2'" . DG  C 3 22  ? -81.795  -37.265 -7.710  1.00 80.90  ? 21   DG  D "C2'" 1 
ATOM   7941 C  "C1'" . DG  C 3 22  ? -82.014  -35.823 -7.241  1.00 77.52  ? 21   DG  D "C1'" 1 
ATOM   7942 N  N9    . DG  C 3 22  ? -82.977  -35.698 -6.150  1.00 81.56  ? 21   DG  D N9    1 
ATOM   7943 C  C8    . DG  C 3 22  ? -84.204  -35.081 -6.196  1.00 81.19  ? 21   DG  D C8    1 
ATOM   7944 N  N7    . DG  C 3 22  ? -84.849  -35.137 -5.063  1.00 82.04  ? 21   DG  D N7    1 
ATOM   7945 C  C5    . DG  C 3 22  ? -83.999  -35.836 -4.217  1.00 79.39  ? 21   DG  D C5    1 
ATOM   7946 C  C6    . DG  C 3 22  ? -84.157  -36.206 -2.855  1.00 81.97  ? 21   DG  D C6    1 
ATOM   7947 O  O6    . DG  C 3 22  ? -85.112  -35.983 -2.101  1.00 83.07  ? 21   DG  D O6    1 
ATOM   7948 N  N1    . DG  C 3 22  ? -83.051  -36.907 -2.385  1.00 79.16  ? 21   DG  D N1    1 
ATOM   7949 C  C2    . DG  C 3 22  ? -81.935  -37.213 -3.125  1.00 73.92  ? 21   DG  D C2    1 
ATOM   7950 N  N2    . DG  C 3 22  ? -80.973  -37.897 -2.490  1.00 75.95  ? 21   DG  D N2    1 
ATOM   7951 N  N3    . DG  C 3 22  ? -81.775  -36.873 -4.394  1.00 73.68  ? 21   DG  D N3    1 
ATOM   7952 C  C4    . DG  C 3 22  ? -82.838  -36.190 -4.873  1.00 77.94  ? 21   DG  D C4    1 
ATOM   7953 P  P     . DC  C 3 23  ? -82.905  -39.671 -10.143 1.00 85.59  ? 22   DC  D P     1 
ATOM   7954 O  OP1   . DC  C 3 23  ? -82.360  -40.323 -11.362 1.00 83.99  ? 22   DC  D OP1   1 
ATOM   7955 O  OP2   . DC  C 3 23  ? -84.363  -39.402 -10.048 1.00 72.69  ? 22   DC  D OP2   1 
ATOM   7956 O  "O5'" . DC  C 3 23  ? -82.472  -40.533 -8.875  1.00 81.10  ? 22   DC  D "O5'" 1 
ATOM   7957 C  "C5'" . DC  C 3 23  ? -81.090  -40.873 -8.653  1.00 80.75  ? 22   DC  D "C5'" 1 
ATOM   7958 C  "C4'" . DC  C 3 23  ? -80.873  -41.333 -7.230  1.00 82.62  ? 22   DC  D "C4'" 1 
ATOM   7959 O  "O4'" . DC  C 3 23  ? -81.329  -40.327 -6.302  1.00 81.47  ? 22   DC  D "O4'" 1 
ATOM   7960 C  "C3'" . DC  C 3 23  ? -81.634  -42.592 -6.832  1.00 91.40  ? 22   DC  D "C3'" 1 
ATOM   7961 O  "O3'" . DC  C 3 23  ? -80.901  -43.763 -7.206  1.00 107.22 ? 22   DC  D "O3'" 1 
ATOM   7962 C  "C2'" . DC  C 3 23  ? -81.725  -42.460 -5.322  1.00 91.02  ? 22   DC  D "C2'" 1 
ATOM   7963 C  "C1'" . DC  C 3 23  ? -81.665  -40.952 -5.066  1.00 84.66  ? 22   DC  D "C1'" 1 
ATOM   7964 N  N1    . DC  C 3 23  ? -82.932  -40.370 -4.588  1.00 84.01  ? 22   DC  D N1    1 
ATOM   7965 C  C2    . DC  C 3 23  ? -83.267  -40.501 -3.235  1.00 81.38  ? 22   DC  D C2    1 
ATOM   7966 O  O2    . DC  C 3 23  ? -82.484  -41.095 -2.478  1.00 78.22  ? 22   DC  D O2    1 
ATOM   7967 N  N3    . DC  C 3 23  ? -84.431  -39.974 -2.788  1.00 86.21  ? 22   DC  D N3    1 
ATOM   7968 C  C4    . DC  C 3 23  ? -85.246  -39.341 -3.635  1.00 82.66  ? 22   DC  D C4    1 
ATOM   7969 N  N4    . DC  C 3 23  ? -86.383  -38.836 -3.150  1.00 83.19  ? 22   DC  D N4    1 
ATOM   7970 C  C5    . DC  C 3 23  ? -84.930  -39.195 -5.018  1.00 77.29  ? 22   DC  D C5    1 
ATOM   7971 C  C6    . DC  C 3 23  ? -83.775  -39.722 -5.448  1.00 81.93  ? 22   DC  D C6    1 
ATOM   7972 P  P     . DC  C 3 24  ? -81.637  -45.171 -7.432  1.00 124.59 ? 23   DC  D P     1 
ATOM   7973 O  OP1   . DC  C 3 24  ? -80.709  -46.046 -8.195  1.00 107.59 ? 23   DC  D OP1   1 
ATOM   7974 O  OP2   . DC  C 3 24  ? -83.003  -44.921 -7.959  1.00 88.98  ? 23   DC  D OP2   1 
ATOM   7975 O  "O5'" . DC  C 3 24  ? -81.776  -45.759 -5.957  1.00 98.21  ? 23   DC  D "O5'" 1 
ATOM   7976 C  "C5'" . DC  C 3 24  ? -80.611  -46.028 -5.151  1.00 100.77 ? 23   DC  D "C5'" 1 
ATOM   7977 C  "C4'" . DC  C 3 24  ? -80.995  -46.173 -3.696  1.00 97.90  ? 23   DC  D "C4'" 1 
ATOM   7978 O  "O4'" . DC  C 3 24  ? -81.937  -45.137 -3.326  1.00 90.36  ? 23   DC  D "O4'" 1 
ATOM   7979 C  "C3'" . DC  C 3 24  ? -81.653  -47.507 -3.331  1.00 104.64 ? 23   DC  D "C3'" 1 
ATOM   7980 O  "O3'" . DC  C 3 24  ? -81.010  -48.085 -2.190  1.00 100.33 ? 23   DC  D "O3'" 1 
ATOM   7981 C  "C2'" . DC  C 3 24  ? -83.093  -47.139 -3.012  1.00 95.32  ? 23   DC  D "C2'" 1 
ATOM   7982 C  "C1'" . DC  C 3 24  ? -82.976  -45.700 -2.547  1.00 89.08  ? 23   DC  D "C1'" 1 
ATOM   7983 N  N1    . DC  C 3 24  ? -84.189  -44.890 -2.751  1.00 85.01  ? 23   DC  D N1    1 
ATOM   7984 C  C2    . DC  C 3 24  ? -84.989  -44.582 -1.645  1.00 87.96  ? 23   DC  D C2    1 
ATOM   7985 O  O2    . DC  C 3 24  ? -84.652  -44.997 -0.526  1.00 89.48  ? 23   DC  D O2    1 
ATOM   7986 N  N3    . DC  C 3 24  ? -86.107  -43.840 -1.824  1.00 86.53  ? 23   DC  D N3    1 
ATOM   7987 C  C4    . DC  C 3 24  ? -86.436  -43.411 -3.045  1.00 83.96  ? 23   DC  D C4    1 
ATOM   7988 N  N4    . DC  C 3 24  ? -87.546  -42.682 -3.175  1.00 79.65  ? 23   DC  D N4    1 
ATOM   7989 C  C5    . DC  C 3 24  ? -85.639  -43.712 -4.189  1.00 86.08  ? 23   DC  D C5    1 
ATOM   7990 C  C6    . DC  C 3 24  ? -84.535  -44.448 -3.998  1.00 87.67  ? 23   DC  D C6    1 
ATOM   7991 P  P     . A   D 4 4   ? -100.473 -49.125 10.242  1.00 165.37 ? 4    A   R P     1 
ATOM   7992 O  OP1   . A   D 4 4   ? -100.513 -48.203 11.407  1.00 141.74 ? 4    A   R OP1   1 
ATOM   7993 O  OP2   . A   D 4 4   ? -101.425 -50.267 10.173  1.00 131.59 ? 4    A   R OP2   1 
ATOM   7994 O  "O5'" . A   D 4 4   ? -98.985  -49.616 9.966   1.00 134.48 ? 4    A   R "O5'" 1 
ATOM   7995 C  "C5'" . A   D 4 4   ? -98.090  -48.833 9.185   1.00 126.61 ? 4    A   R "C5'" 1 
ATOM   7996 C  "C4'" . A   D 4 4   ? -96.751  -48.692 9.860   1.00 133.32 ? 4    A   R "C4'" 1 
ATOM   7997 O  "O4'" . A   D 4 4   ? -96.302  -50.002 10.312  1.00 130.92 ? 4    A   R "O4'" 1 
ATOM   7998 C  "C3'" . A   D 4 4   ? -95.629  -48.139 8.981   1.00 131.10 ? 4    A   R "C3'" 1 
ATOM   7999 O  "O3'" . A   D 4 4   ? -94.743  -47.360 9.788   1.00 142.81 ? 4    A   R "O3'" 1 
ATOM   8000 C  "C2'" . A   D 4 4   ? -94.916  -49.410 8.521   1.00 121.01 ? 4    A   R "C2'" 1 
ATOM   8001 O  "O2'" . A   D 4 4   ? -93.574  -49.226 8.125   1.00 111.68 ? 4    A   R "O2'" 1 
ATOM   8002 C  "C1'" . A   D 4 4   ? -95.023  -50.274 9.771   1.00 127.73 ? 4    A   R "C1'" 1 
ATOM   8003 N  N9    . A   D 4 4   ? -94.918  -51.713 9.523   1.00 121.74 ? 4    A   R N9    1 
ATOM   8004 C  C8    . A   D 4 4   ? -95.554  -52.504 8.591   1.00 120.49 ? 4    A   R C8    1 
ATOM   8005 N  N7    . A   D 4 4   ? -95.219  -53.775 8.660   1.00 117.26 ? 4    A   R N7    1 
ATOM   8006 C  C5    . A   D 4 4   ? -94.302  -53.818 9.705   1.00 118.55 ? 4    A   R C5    1 
ATOM   8007 C  C6    . A   D 4 4   ? -93.564  -54.861 10.294  1.00 108.55 ? 4    A   R C6    1 
ATOM   8008 N  N6    . A   D 4 4   ? -93.621  -56.131 9.898   1.00 100.02 ? 4    A   R N6    1 
ATOM   8009 N  N1    . A   D 4 4   ? -92.741  -54.552 11.323  1.00 107.28 ? 4    A   R N1    1 
ATOM   8010 C  C2    . A   D 4 4   ? -92.663  -53.279 11.734  1.00 110.49 ? 4    A   R C2    1 
ATOM   8011 N  N3    . A   D 4 4   ? -93.304  -52.212 11.263  1.00 119.54 ? 4    A   R N3    1 
ATOM   8012 C  C4    . A   D 4 4   ? -94.112  -52.556 10.242  1.00 119.89 ? 4    A   R C4    1 
HETATM 8013 O  "O5'" . 3DR D 4 5   ? -94.813  -45.775 7.853   1.00 136.30 ? 5    3DR R "O5'" 1 
HETATM 8014 P  P     . 3DR D 4 5   ? -94.099  -45.998 9.219   1.00 153.32 ? 5    3DR R P     1 
HETATM 8015 O  OP1   . 3DR D 4 5   ? -92.565  -46.204 9.080   1.00 120.74 ? 5    3DR R OP1   1 
HETATM 8016 O  OP2   . 3DR D 4 5   ? -94.422  -44.872 10.185  1.00 119.87 ? 5    3DR R OP2   1 
HETATM 8017 C  "C2'" . 3DR D 4 5   ? -97.353  -42.782 5.982   1.00 119.59 ? 5    3DR R "C2'" 1 
HETATM 8018 C  "C5'" . 3DR D 4 5   ? -94.893  -44.510 7.337   1.00 121.82 ? 5    3DR R "C5'" 1 
HETATM 8019 C  "C4'" . 3DR D 4 5   ? -95.650  -44.304 6.072   1.00 118.60 ? 5    3DR R "C4'" 1 
HETATM 8020 O  "O4'" . 3DR D 4 5   ? -96.851  -44.985 6.124   1.00 119.03 ? 5    3DR R "O4'" 1 
HETATM 8021 C  "C1'" . 3DR D 4 5   ? -97.788  -44.080 6.572   1.00 109.47 ? 5    3DR R "C1'" 1 
HETATM 8022 C  "C3'" . 3DR D 4 5   ? -95.972  -42.852 5.892   1.00 126.70 ? 5    3DR R "C3'" 1 
HETATM 8023 O  "O3'" . 3DR D 4 5   ? -95.501  -42.396 4.622   1.00 143.92 ? 5    3DR R "O3'" 1 
ATOM   8024 P  P     . G   D 4 6   ? -95.218  -40.824 4.357   1.00 188.99 ? 6    G   R P     1 
ATOM   8025 O  OP1   . G   D 4 6   ? -95.929  -40.062 5.415   1.00 140.15 ? 6    G   R OP1   1 
ATOM   8026 O  OP2   . G   D 4 6   ? -95.556  -40.553 2.933   1.00 129.49 ? 6    G   R OP2   1 
ATOM   8027 O  "O5'" . G   D 4 6   ? -93.636  -40.693 4.568   1.00 135.61 ? 6    G   R "O5'" 1 
ATOM   8028 C  "C5'" . G   D 4 6   ? -93.080  -40.417 5.851   1.00 120.37 ? 6    G   R "C5'" 1 
ATOM   8029 C  "C4'" . G   D 4 6   ? -91.898  -41.313 6.135   1.00 119.06 ? 6    G   R "C4'" 1 
ATOM   8030 O  "O4'" . G   D 4 6   ? -91.905  -42.424 5.200   1.00 131.06 ? 6    G   R "O4'" 1 
ATOM   8031 C  "C3'" . G   D 4 6   ? -90.524  -40.671 5.973   1.00 113.79 ? 6    G   R "C3'" 1 
ATOM   8032 O  "O3'" . G   D 4 6   ? -90.082  -40.020 7.159   1.00 119.32 ? 6    G   R "O3'" 1 
ATOM   8033 C  "C2'" . G   D 4 6   ? -89.634  -41.840 5.545   1.00 111.01 ? 6    G   R "C2'" 1 
ATOM   8034 O  "O2'" . G   D 4 6   ? -89.209  -42.595 6.671   1.00 105.58 ? 6    G   R "O2'" 1 
ATOM   8035 C  "C1'" . G   D 4 6   ? -90.606  -42.693 4.735   1.00 117.68 ? 6    G   R "C1'" 1 
ATOM   8036 N  N9    . G   D 4 6   ? -90.568  -42.385 3.291   1.00 118.59 ? 6    G   R N9    1 
ATOM   8037 C  C8    . G   D 4 6   ? -91.557  -41.708 2.613   1.00 113.28 ? 6    G   R C8    1 
ATOM   8038 N  N7    . G   D 4 6   ? -91.306  -41.574 1.344   1.00 113.71 ? 6    G   R N7    1 
ATOM   8039 C  C5    . G   D 4 6   ? -90.081  -42.205 1.161   1.00 104.01 ? 6    G   R C5    1 
ATOM   8040 C  C6    . G   D 4 6   ? -89.304  -42.369 -0.019  1.00 100.96 ? 6    G   R C6    1 
ATOM   8041 O  O6    . G   D 4 6   ? -89.564  -41.993 -1.171  1.00 100.18 ? 6    G   R O6    1 
ATOM   8042 N  N1    . G   D 4 6   ? -88.127  -43.080 0.221   1.00 106.60 ? 6    G   R N1    1 
ATOM   8043 C  C2    . G   D 4 6   ? -87.737  -43.545 1.456   1.00 102.12 ? 6    G   R C2    1 
ATOM   8044 N  N2    . G   D 4 6   ? -86.567  -44.205 1.477   1.00 95.67  ? 6    G   R N2    1 
ATOM   8045 N  N3    . G   D 4 6   ? -88.453  -43.400 2.572   1.00 109.09 ? 6    G   R N3    1 
ATOM   8046 C  C4    . G   D 4 6   ? -89.608  -42.720 2.355   1.00 113.47 ? 6    G   R C4    1 
ATOM   8047 P  P     . G   D 4 7   ? -88.981  -38.938 7.077   1.00 121.83 ? 7    G   R P     1 
ATOM   8048 O  OP1   . G   D 4 7   ? -88.914  -38.339 8.435   1.00 91.01  ? 7    G   R OP1   1 
ATOM   8049 O  OP2   . G   D 4 7   ? -89.333  -38.078 5.917   1.00 123.63 ? 7    G   R OP2   1 
ATOM   8050 O  "O5'" . G   D 4 7   ? -87.585  -39.639 6.764   1.00 104.98 ? 7    G   R "O5'" 1 
ATOM   8051 C  "C5'" . G   D 4 7   ? -86.913  -40.438 7.759   1.00 96.35  ? 7    G   R "C5'" 1 
ATOM   8052 C  "C4'" . G   D 4 7   ? -85.797  -41.242 7.133   1.00 104.84 ? 7    G   R "C4'" 1 
ATOM   8053 O  "O4'" . G   D 4 7   ? -86.320  -42.018 6.020   1.00 108.60 ? 7    G   R "O4'" 1 
ATOM   8054 C  "C3'" . G   D 4 7   ? -84.648  -40.439 6.539   1.00 104.53 ? 7    G   R "C3'" 1 
ATOM   8055 O  "O3'" . G   D 4 7   ? -83.677  -40.100 7.524   1.00 97.59  ? 7    G   R "O3'" 1 
ATOM   8056 C  "C2'" . G   D 4 7   ? -84.086  -41.402 5.499   1.00 102.28 ? 7    G   R "C2'" 1 
ATOM   8057 O  "O2'" . G   D 4 7   ? -83.199  -42.369 6.026   1.00 90.46  ? 7    G   R "O2'" 1 
ATOM   8058 C  "C1'" . G   D 4 7   ? -85.362  -42.065 4.976   1.00 101.36 ? 7    G   R "C1'" 1 
ATOM   8059 N  N9    . G   D 4 7   ? -85.924  -41.399 3.803   1.00 94.76  ? 7    G   R N9    1 
ATOM   8060 C  C8    . G   D 4 7   ? -87.097  -40.686 3.740   1.00 97.98  ? 7    G   R C8    1 
ATOM   8061 N  N7    . G   D 4 7   ? -87.341  -40.204 2.552   1.00 95.90  ? 7    G   R N7    1 
ATOM   8062 C  C5    . G   D 4 7   ? -86.262  -40.620 1.784   1.00 92.78  ? 7    G   R C5    1 
ATOM   8063 C  C6    . G   D 4 7   ? -85.970  -40.400 0.412   1.00 88.56  ? 7    G   R C6    1 
ATOM   8064 O  O6    . G   D 4 7   ? -86.628  -39.771 -0.426  1.00 88.08  ? 7    G   R O6    1 
ATOM   8065 N  N1    . G   D 4 7   ? -84.770  -41.000 0.042   1.00 87.15  ? 7    G   R N1    1 
ATOM   8066 C  C2    . G   D 4 7   ? -83.955  -41.721 0.881   1.00 87.10  ? 7    G   R C2    1 
ATOM   8067 N  N2    . G   D 4 7   ? -82.838  -42.223 0.334   1.00 82.96  ? 7    G   R N2    1 
ATOM   8068 N  N3    . G   D 4 7   ? -84.216  -41.934 2.161   1.00 91.27  ? 7    G   R N3    1 
ATOM   8069 C  C4    . G   D 4 7   ? -85.378  -41.359 2.542   1.00 93.24  ? 7    G   R C4    1 
ATOM   8070 P  P     . C   D 4 8   ? -82.859  -38.724 7.424   1.00 119.98 ? 8    C   R P     1 
ATOM   8071 O  OP1   . C   D 4 8   ? -82.047  -38.593 8.661   1.00 104.69 ? 8    C   R OP1   1 
ATOM   8072 O  OP2   . C   D 4 8   ? -83.802  -37.638 7.053   1.00 85.97  ? 8    C   R OP2   1 
ATOM   8073 O  "O5'" . C   D 4 8   ? -81.873  -38.964 6.194   1.00 110.16 ? 8    C   R "O5'" 1 
ATOM   8074 C  "C5'" . C   D 4 8   ? -80.738  -39.844 6.312   1.00 106.31 ? 8    C   R "C5'" 1 
ATOM   8075 C  "C4'" . C   D 4 8   ? -80.028  -39.981 4.984   1.00 97.22  ? 8    C   R "C4'" 1 
ATOM   8076 O  "O4'" . C   D 4 8   ? -80.957  -40.464 3.979   1.00 96.67  ? 8    C   R "O4'" 1 
ATOM   8077 C  "C3'" . C   D 4 8   ? -79.475  -38.697 4.385   1.00 94.86  ? 8    C   R "C3'" 1 
ATOM   8078 O  "O3'" . C   D 4 8   ? -78.217  -38.336 4.946   1.00 97.43  ? 8    C   R "O3'" 1 
ATOM   8079 C  "C2'" . C   D 4 8   ? -79.360  -39.060 2.908   1.00 88.54  ? 8    C   R "C2'" 1 
ATOM   8080 O  "O2'" . C   D 4 8   ? -78.177  -39.760 2.576   1.00 82.85  ? 8    C   R "O2'" 1 
ATOM   8081 C  "C1'" . C   D 4 8   ? -80.591  -39.948 2.708   1.00 87.70  ? 8    C   R "C1'" 1 
ATOM   8082 N  N1    . C   D 4 8   ? -81.747  -39.231 2.139   1.00 82.15  ? 8    C   R N1    1 
ATOM   8083 C  C2    . C   D 4 8   ? -81.755  -38.942 0.769   1.00 83.15  ? 8    C   R C2    1 
ATOM   8084 O  O2    . C   D 4 8   ? -80.794  -39.305 0.073   1.00 89.33  ? 8    C   R O2    1 
ATOM   8085 N  N3    . C   D 4 8   ? -82.810  -38.280 0.239   1.00 80.77  ? 8    C   R N3    1 
ATOM   8086 C  C4    . C   D 4 8   ? -83.825  -37.906 1.022   1.00 82.03  ? 8    C   R C4    1 
ATOM   8087 N  N4    . C   D 4 8   ? -84.845  -37.256 0.457   1.00 80.23  ? 8    C   R N4    1 
ATOM   8088 C  C5    . C   D 4 8   ? -83.841  -38.186 2.420   1.00 86.97  ? 8    C   R C5    1 
ATOM   8089 C  C6    . C   D 4 8   ? -82.792  -38.843 2.932   1.00 85.09  ? 8    C   R C6    1 
ATOM   8090 P  P     . C   D 4 9   ? -77.811  -36.790 5.087   1.00 88.75  ? 9    C   R P     1 
ATOM   8091 O  OP1   . C   D 4 9   ? -76.538  -36.727 5.851   1.00 83.94  ? 9    C   R OP1   1 
ATOM   8092 O  OP2   . C   D 4 9   ? -78.992  -36.032 5.576   1.00 77.43  ? 9    C   R OP2   1 
ATOM   8093 O  "O5'" . C   D 4 9   ? -77.529  -36.336 3.586   1.00 88.25  ? 9    C   R "O5'" 1 
ATOM   8094 C  "C5'" . C   D 4 9   ? -76.362  -36.800 2.877   1.00 85.91  ? 9    C   R "C5'" 1 
ATOM   8095 C  "C4'" . C   D 4 9   ? -76.275  -36.162 1.510   1.00 85.54  ? 9    C   R "C4'" 1 
ATOM   8096 O  "O4'" . C   D 4 9   ? -77.359  -36.642 0.673   1.00 83.16  ? 9    C   R "O4'" 1 
ATOM   8097 C  "C3'" . C   D 4 9   ? -76.427  -34.649 1.461   1.00 80.80  ? 9    C   R "C3'" 1 
ATOM   8098 O  "O3'" . C   D 4 9   ? -75.218  -33.977 1.803   1.00 83.02  ? 9    C   R "O3'" 1 
ATOM   8099 C  "C2'" . C   D 4 9   ? -76.827  -34.417 0.007   1.00 79.89  ? 9    C   R "C2'" 1 
ATOM   8100 O  "O2'" . C   D 4 9   ? -75.735  -34.356 -0.889  1.00 82.18  ? 9    C   R "O2'" 1 
ATOM   8101 C  "C1'" . C   D 4 9   ? -77.697  -35.646 -0.279  1.00 79.99  ? 9    C   R "C1'" 1 
ATOM   8102 N  N1    . C   D 4 9   ? -79.145  -35.379 -0.191  1.00 78.32  ? 9    C   R N1    1 
ATOM   8103 C  C2    . C   D 4 9   ? -79.798  -34.824 -1.298  1.00 78.81  ? 9    C   R C2    1 
ATOM   8104 O  O2    . C   D 4 9   ? -79.142  -34.577 -2.321  1.00 78.66  ? 9    C   R O2    1 
ATOM   8105 N  N3    . C   D 4 9   ? -81.127  -34.573 -1.225  1.00 76.80  ? 9    C   R N3    1 
ATOM   8106 C  C4    . C   D 4 9   ? -81.798  -34.854 -0.106  1.00 75.22  ? 9    C   R C4    1 
ATOM   8107 N  N4    . C   D 4 9   ? -83.107  -34.591 -0.079  1.00 72.67  ? 9    C   R N4    1 
ATOM   8108 C  C5    . C   D 4 9   ? -81.158  -35.419 1.036   1.00 81.11  ? 9    C   R C5    1 
ATOM   8109 C  C6    . C   D 4 9   ? -79.843  -35.662 0.950   1.00 82.47  ? 9    C   R C6    1 
ATOM   8110 P  P     . A   D 4 10  ? -75.269  -32.526 2.484   1.00 86.38  ? 10   A   R P     1 
ATOM   8111 O  OP1   . A   D 4 10  ? -73.908  -32.222 2.997   1.00 81.41  ? 10   A   R OP1   1 
ATOM   8112 O  OP2   . A   D 4 10  ? -76.428  -32.470 3.412   1.00 90.24  ? 10   A   R OP2   1 
ATOM   8113 O  "O5'" . A   D 4 10  ? -75.574  -31.560 1.253   1.00 78.83  ? 10   A   R "O5'" 1 
ATOM   8114 C  "C5'" . A   D 4 10  ? -74.566  -31.290 0.260   1.00 84.13  ? 10   A   R "C5'" 1 
ATOM   8115 C  "C4'" . A   D 4 10  ? -75.143  -30.502 -0.893  1.00 86.12  ? 10   A   R "C4'" 1 
ATOM   8116 O  "O4'" . A   D 4 10  ? -76.183  -31.272 -1.549  1.00 83.01  ? 10   A   R "O4'" 1 
ATOM   8117 C  "C3'" . A   D 4 10  ? -75.826  -29.187 -0.533  1.00 84.67  ? 10   A   R "C3'" 1 
ATOM   8118 O  "O3'" . A   D 4 10  ? -74.870  -28.146 -0.363  1.00 88.36  ? 10   A   R "O3'" 1 
ATOM   8119 C  "C2'" . A   D 4 10  ? -76.736  -28.964 -1.735  1.00 81.71  ? 10   A   R "C2'" 1 
ATOM   8120 O  "O2'" . A   D 4 10  ? -76.093  -28.369 -2.845  1.00 81.39  ? 10   A   R "O2'" 1 
ATOM   8121 C  "C1'" . A   D 4 10  ? -77.174  -30.395 -2.062  1.00 76.14  ? 10   A   R "C1'" 1 
ATOM   8122 N  N9    . A   D 4 10  ? -78.463  -30.757 -1.471  1.00 73.41  ? 10   A   R N9    1 
ATOM   8123 C  C8    . A   D 4 10  ? -78.688  -31.553 -0.375  1.00 74.83  ? 10   A   R C8    1 
ATOM   8124 N  N7    . A   D 4 10  ? -79.957  -31.696 -0.077  1.00 72.78  ? 10   A   R N7    1 
ATOM   8125 C  C5    . A   D 4 10  ? -80.612  -30.940 -1.039  1.00 71.48  ? 10   A   R C5    1 
ATOM   8126 C  C6    . A   D 4 10  ? -81.975  -30.678 -1.270  1.00 73.29  ? 10   A   R C6    1 
ATOM   8127 N  N6    . A   D 4 10  ? -82.962  -31.174 -0.520  1.00 76.90  ? 10   A   R N6    1 
ATOM   8128 N  N1    . A   D 4 10  ? -82.293  -29.881 -2.314  1.00 76.31  ? 10   A   R N1    1 
ATOM   8129 C  C2    . A   D 4 10  ? -81.302  -29.387 -3.068  1.00 74.40  ? 10   A   R C2    1 
ATOM   8130 N  N3    . A   D 4 10  ? -79.986  -29.558 -2.949  1.00 74.01  ? 10   A   R N3    1 
ATOM   8131 C  C4    . A   D 4 10  ? -79.704  -30.355 -1.903  1.00 74.00  ? 10   A   R C4    1 
ATOM   8132 P  P     . C   D 4 11  ? -75.026  -27.094 0.837   1.00 92.74  ? 11   C   R P     1 
ATOM   8133 O  OP1   . C   D 4 11  ? -73.738  -26.367 0.975   1.00 91.15  ? 11   C   R OP1   1 
ATOM   8134 O  OP2   . C   D 4 11  ? -75.605  -27.785 2.018   1.00 87.90  ? 11   C   R OP2   1 
ATOM   8135 O  "O5'" . C   D 4 11  ? -76.118  -26.082 0.268   1.00 78.86  ? 11   C   R "O5'" 1 
ATOM   8136 C  "C5'" . C   D 4 11  ? -75.853  -25.298 -0.911  1.00 79.78  ? 11   C   R "C5'" 1 
ATOM   8137 C  "C4'" . C   D 4 11  ? -77.143  -24.823 -1.537  1.00 79.47  ? 11   C   R "C4'" 1 
ATOM   8138 O  "O4'" . C   D 4 11  ? -77.989  -25.961 -1.848  1.00 77.33  ? 11   C   R "O4'" 1 
ATOM   8139 C  "C3'" . C   D 4 11  ? -78.029  -23.950 -0.663  1.00 77.62  ? 11   C   R "C3'" 1 
ATOM   8140 O  "O3'" . C   D 4 11  ? -77.584  -22.598 -0.633  1.00 84.71  ? 11   C   R "O3'" 1 
ATOM   8141 C  "C2'" . C   D 4 11  ? -79.388  -24.102 -1.340  1.00 75.55  ? 11   C   R "C2'" 1 
ATOM   8142 O  "O2'" . C   D 4 11  ? -79.580  -23.245 -2.447  1.00 68.56  ? 11   C   R "O2'" 1 
ATOM   8143 C  "C1'" . C   D 4 11  ? -79.351  -25.566 -1.792  1.00 75.82  ? 11   C   R "C1'" 1 
ATOM   8144 N  N1    . C   D 4 11  ? -80.073  -26.478 -0.886  1.00 76.47  ? 11   C   R N1    1 
ATOM   8145 C  C2    . C   D 4 11  ? -81.466  -26.571 -0.992  1.00 74.26  ? 11   C   R C2    1 
ATOM   8146 O  O2    . C   D 4 11  ? -82.049  -25.892 -1.851  1.00 72.38  ? 11   C   R O2    1 
ATOM   8147 N  N3    . C   D 4 11  ? -82.139  -27.401 -0.162  1.00 72.89  ? 11   C   R N3    1 
ATOM   8148 C  C4    . C   D 4 11  ? -81.474  -28.116 0.750   1.00 73.14  ? 11   C   R C4    1 
ATOM   8149 N  N4    . C   D 4 11  ? -82.178  -28.922 1.548   1.00 72.45  ? 11   C   R N4    1 
ATOM   8150 C  C5    . C   D 4 11  ? -80.056  -28.039 0.881   1.00 69.98  ? 11   C   R C5    1 
ATOM   8151 C  C6    . C   D 4 11  ? -79.402  -27.213 0.053   1.00 71.28  ? 11   C   R C6    1 
ATOM   8152 P  P     . A   D 4 12  ? -77.826  -21.701 0.674   1.00 80.05  ? 12   A   R P     1 
ATOM   8153 O  OP1   . A   D 4 12  ? -77.054  -20.443 0.508   1.00 72.23  ? 12   A   R OP1   1 
ATOM   8154 O  OP2   . A   D 4 12  ? -77.605  -22.539 1.881   1.00 75.41  ? 12   A   R OP2   1 
ATOM   8155 O  "O5'" . A   D 4 12  ? -79.381  -21.357 0.595   1.00 75.44  ? 12   A   R "O5'" 1 
ATOM   8156 C  "C5'" . A   D 4 12  ? -79.898  -20.516 -0.454  1.00 76.00  ? 12   A   R "C5'" 1 
ATOM   8157 C  "C4'" . A   D 4 12  ? -81.406  -20.605 -0.519  1.00 76.84  ? 12   A   R "C4'" 1 
ATOM   8158 O  "O4'" . A   D 4 12  ? -81.817  -21.983 -0.707  1.00 78.76  ? 12   A   R "O4'" 1 
ATOM   8159 C  "C3'" . A   D 4 12  ? -82.160  -20.173 0.732   1.00 77.57  ? 12   A   R "C3'" 1 
ATOM   8160 O  "O3'" . A   D 4 12  ? -82.275  -18.756 0.801   1.00 81.36  ? 12   A   R "O3'" 1 
ATOM   8161 C  "C2'" . A   D 4 12  ? -83.510  -20.858 0.539   1.00 77.11  ? 12   A   R "C2'" 1 
ATOM   8162 O  "O2'" . A   D 4 12  ? -84.410  -20.138 -0.279  1.00 66.74  ? 12   A   R "O2'" 1 
ATOM   8163 C  "C1'" . A   D 4 12  ? -83.100  -22.174 -0.132  1.00 74.83  ? 12   A   R "C1'" 1 
ATOM   8164 N  N9    . A   D 4 12  ? -83.031  -23.305 0.796   1.00 77.96  ? 12   A   R N9    1 
ATOM   8165 C  C8    . A   D 4 12  ? -81.908  -23.928 1.284   1.00 74.96  ? 12   A   R C8    1 
ATOM   8166 N  N7    . A   D 4 12  ? -82.166  -24.916 2.105   1.00 71.02  ? 12   A   R N7    1 
ATOM   8167 C  C5    . A   D 4 12  ? -83.553  -24.947 2.164   1.00 71.84  ? 12   A   R C5    1 
ATOM   8168 C  C6    . A   D 4 12  ? -84.452  -25.770 2.866   1.00 71.81  ? 12   A   R C6    1 
ATOM   8169 N  N6    . A   D 4 12  ? -84.073  -26.762 3.674   1.00 71.56  ? 12   A   R N6    1 
ATOM   8170 N  N1    . A   D 4 12  ? -85.774  -25.536 2.706   1.00 71.45  ? 12   A   R N1    1 
ATOM   8171 C  C2    . A   D 4 12  ? -86.154  -24.541 1.894   1.00 75.66  ? 12   A   R C2    1 
ATOM   8172 N  N3    . A   D 4 12  ? -85.406  -23.701 1.181   1.00 78.09  ? 12   A   R N3    1 
ATOM   8173 C  C4    . A   D 4 12  ? -84.099  -23.960 1.362   1.00 76.52  ? 12   A   R C4    1 
ATOM   8174 P  P     . A   D 4 13  ? -82.328  -18.011 2.220   1.00 84.34  ? 13   A   R P     1 
ATOM   8175 O  OP1   . A   D 4 13  ? -82.030  -16.574 1.988   1.00 88.73  ? 13   A   R OP1   1 
ATOM   8176 O  OP2   . A   D 4 13  ? -81.517  -18.776 3.202   1.00 75.52  ? 13   A   R OP2   1 
ATOM   8177 O  "O5'" . A   D 4 13  ? -83.860  -18.152 2.634   1.00 77.37  ? 13   A   R "O5'" 1 
ATOM   8178 C  "C5'" . A   D 4 13  ? -84.895  -17.489 1.881   1.00 80.79  ? 13   A   R "C5'" 1 
ATOM   8179 C  "C4'" . A   D 4 13  ? -86.252  -18.053 2.230   1.00 86.38  ? 13   A   R "C4'" 1 
ATOM   8180 O  "O4'" . A   D 4 13  ? -86.288  -19.473 1.923   1.00 84.43  ? 13   A   R "O4'" 1 
ATOM   8181 C  "C3'" . A   D 4 13  ? -86.656  -17.969 3.699   1.00 90.05  ? 13   A   R "C3'" 1 
ATOM   8182 O  "O3'" . A   D 4 13  ? -87.209  -16.699 4.028   1.00 90.53  ? 13   A   R "O3'" 1 
ATOM   8183 C  "C2'" . A   D 4 13  ? -87.680  -19.092 3.807   1.00 87.61  ? 13   A   R "C2'" 1 
ATOM   8184 O  "O2'" . A   D 4 13  ? -88.972  -18.743 3.351   1.00 87.41  ? 13   A   R "O2'" 1 
ATOM   8185 C  "C1'" . A   D 4 13  ? -87.056  -20.155 2.902   1.00 81.00  ? 13   A   R "C1'" 1 
ATOM   8186 N  N9    . A   D 4 13  ? -86.174  -21.076 3.621   1.00 77.95  ? 13   A   R N9    1 
ATOM   8187 C  C8    . A   D 4 13  ? -84.802  -21.062 3.667   1.00 77.04  ? 13   A   R C8    1 
ATOM   8188 N  N7    . A   D 4 13  ? -84.288  -22.018 4.403   1.00 74.27  ? 13   A   R N7    1 
ATOM   8189 C  C5    . A   D 4 13  ? -85.396  -22.703 4.880   1.00 74.60  ? 13   A   R C5    1 
ATOM   8190 C  C6    . A   D 4 13  ? -85.526  -23.825 5.718   1.00 73.02  ? 13   A   R C6    1 
ATOM   8191 N  N6    . A   D 4 13  ? -84.489  -24.478 6.249   1.00 69.70  ? 13   A   R N6    1 
ATOM   8192 N  N1    . A   D 4 13  ? -86.775  -24.257 6.000   1.00 73.34  ? 13   A   R N1    1 
ATOM   8193 C  C2    . A   D 4 13  ? -87.815  -23.600 5.469   1.00 72.84  ? 13   A   R C2    1 
ATOM   8194 N  N3    . A   D 4 13  ? -87.821  -22.537 4.667   1.00 76.27  ? 13   A   R N3    1 
ATOM   8195 C  C4    . A   D 4 13  ? -86.565  -22.132 4.408   1.00 76.83  ? 13   A   R C4    1 
ATOM   8196 P  P     . U   D 4 14  ? -87.032  -16.104 5.507   1.00 97.78  ? 14   U   R P     1 
ATOM   8197 O  OP1   . U   D 4 14  ? -87.482  -14.689 5.477   1.00 98.09  ? 14   U   R OP1   1 
ATOM   8198 O  OP2   . U   D 4 14  ? -85.666  -16.425 5.993   1.00 78.63  ? 14   U   R OP2   1 
ATOM   8199 O  "O5'" . U   D 4 14  ? -88.075  -16.949 6.366   1.00 103.81 ? 14   U   R "O5'" 1 
ATOM   8200 C  "C5'" . U   D 4 14  ? -89.491  -16.843 6.124   1.00 98.41  ? 14   U   R "C5'" 1 
ATOM   8201 C  "C4'" . U   D 4 14  ? -90.247  -17.924 6.861   1.00 99.08  ? 14   U   R "C4'" 1 
ATOM   8202 O  "O4'" . U   D 4 14  ? -89.807  -19.235 6.413   1.00 93.08  ? 14   U   R "O4'" 1 
ATOM   8203 C  "C3'" . U   D 4 14  ? -90.050  -17.978 8.367   1.00 96.78  ? 14   U   R "C3'" 1 
ATOM   8204 O  "O3'" . U   D 4 14  ? -90.801  -16.995 9.074   1.00 91.21  ? 14   U   R "O3'" 1 
ATOM   8205 C  "C2'" . U   D 4 14  ? -90.492  -19.401 8.681   1.00 95.68  ? 14   U   R "C2'" 1 
ATOM   8206 O  "O2'" . U   D 4 14  ? -91.895  -19.566 8.761   1.00 88.46  ? 14   U   R "O2'" 1 
ATOM   8207 C  "C1'" . U   D 4 14  ? -89.919  -20.164 7.483   1.00 88.63  ? 14   U   R "C1'" 1 
ATOM   8208 N  N1    . U   D 4 14  ? -88.589  -20.734 7.754   1.00 82.35  ? 14   U   R N1    1 
ATOM   8209 C  C2    . U   D 4 14  ? -88.530  -21.937 8.435   1.00 80.05  ? 14   U   R C2    1 
ATOM   8210 O  O2    . U   D 4 14  ? -89.523  -22.543 8.800   1.00 77.49  ? 14   U   R O2    1 
ATOM   8211 N  N3    . U   D 4 14  ? -87.260  -22.406 8.664   1.00 79.63  ? 14   U   R N3    1 
ATOM   8212 C  C4    . U   D 4 14  ? -86.070  -21.811 8.301   1.00 79.24  ? 14   U   R C4    1 
ATOM   8213 O  O4    . U   D 4 14  ? -85.005  -22.365 8.581   1.00 76.85  ? 14   U   R O4    1 
ATOM   8214 C  C5    . U   D 4 14  ? -86.215  -20.569 7.605   1.00 82.61  ? 14   U   R C5    1 
ATOM   8215 C  C6    . U   D 4 14  ? -87.439  -20.083 7.364   1.00 84.16  ? 14   U   R C6    1 
ATOM   8216 P  P     . A   D 4 15  ? -90.186  -16.371 10.419  1.00 106.17 ? 15   A   R P     1 
ATOM   8217 O  OP1   . A   D 4 15  ? -91.096  -15.290 10.879  1.00 113.10 ? 15   A   R OP1   1 
ATOM   8218 O  OP2   . A   D 4 15  ? -88.750  -16.065 10.188  1.00 83.31  ? 15   A   R OP2   1 
ATOM   8219 O  "O5'" . A   D 4 15  ? -90.272  -17.575 11.460  1.00 97.58  ? 15   A   R "O5'" 1 
ATOM   8220 C  "C5'" . A   D 4 15  ? -91.548  -18.081 11.898  1.00 97.10  ? 15   A   R "C5'" 1 
ATOM   8221 C  "C4'" . A   D 4 15  ? -91.389  -19.400 12.618  1.00 88.73  ? 15   A   R "C4'" 1 
ATOM   8222 O  "O4'" . A   D 4 15  ? -90.613  -20.326 11.815  1.00 87.05  ? 15   A   R "O4'" 1 
ATOM   8223 C  "C3'" . A   D 4 15  ? -90.622  -19.365 13.934  1.00 88.08  ? 15   A   R "C3'" 1 
ATOM   8224 O  "O3'" . A   D 4 15  ? -91.419  -18.871 15.006  1.00 84.92  ? 15   A   R "O3'" 1 
ATOM   8225 C  "C2'" . A   D 4 15  ? -90.244  -20.832 14.114  1.00 94.73  ? 15   A   R "C2'" 1 
ATOM   8226 O  "O2'" . A   D 4 15  ? -91.259  -21.621 14.702  1.00 92.47  ? 15   A   R "O2'" 1 
ATOM   8227 C  "C1'" . A   D 4 15  ? -89.984  -21.270 12.668  1.00 88.52  ? 15   A   R "C1'" 1 
ATOM   8228 N  N9    . A   D 4 15  ? -88.559  -21.328 12.335  1.00 91.22  ? 15   A   R N9    1 
ATOM   8229 C  C8    . A   D 4 15  ? -87.846  -20.484 11.519  1.00 87.07  ? 15   A   R C8    1 
ATOM   8230 N  N7    . A   D 4 15  ? -86.575  -20.790 11.423  1.00 82.06  ? 15   A   R N7    1 
ATOM   8231 C  C5    . A   D 4 15  ? -86.440  -21.909 12.233  1.00 81.07  ? 15   A   R C5    1 
ATOM   8232 C  C6    . A   D 4 15  ? -85.333  -22.715 12.557  1.00 76.59  ? 15   A   R C6    1 
ATOM   8233 N  N6    . A   D 4 15  ? -84.102  -22.508 12.083  1.00 79.79  ? 15   A   R N6    1 
ATOM   8234 N  N1    . A   D 4 15  ? -85.537  -23.754 13.396  1.00 77.97  ? 15   A   R N1    1 
ATOM   8235 C  C2    . A   D 4 15  ? -86.772  -23.961 13.871  1.00 78.45  ? 15   A   R C2    1 
ATOM   8236 N  N3    . A   D 4 15  ? -87.891  -23.276 13.640  1.00 78.51  ? 15   A   R N3    1 
ATOM   8237 C  C4    . A   D 4 15  ? -87.654  -22.251 12.802  1.00 80.43  ? 15   A   R C4    1 
ATOM   8238 P  P     . A   D 4 16  ? -90.738  -18.012 16.176  1.00 87.46  ? 16   A   R P     1 
ATOM   8239 O  OP1   . A   D 4 16  ? -91.824  -17.493 17.047  1.00 94.95  ? 16   A   R OP1   1 
ATOM   8240 O  OP2   . A   D 4 16  ? -89.771  -17.060 15.570  1.00 86.13  ? 16   A   R OP2   1 
ATOM   8241 O  "O5'" . A   D 4 16  ? -89.912  -19.103 16.994  1.00 89.68  ? 16   A   R "O5'" 1 
ATOM   8242 C  "C5'" . A   D 4 16  ? -90.588  -20.121 17.757  1.00 91.64  ? 16   A   R "C5'" 1 
ATOM   8243 C  "C4'" . A   D 4 16  ? -89.634  -21.229 18.142  1.00 80.60  ? 16   A   R "C4'" 1 
ATOM   8244 O  "O4'" . A   D 4 16  ? -88.989  -21.768 16.959  1.00 79.26  ? 16   A   R "O4'" 1 
ATOM   8245 C  "C3'" . A   D 4 16  ? -88.462  -20.832 19.032  1.00 74.67  ? 16   A   R "C3'" 1 
ATOM   8246 O  "O3'" . A   D 4 16  ? -88.839  -20.714 20.400  1.00 70.48  ? 16   A   R "O3'" 1 
ATOM   8247 C  "C2'" . A   D 4 16  ? -87.491  -21.984 18.797  1.00 77.67  ? 16   A   R "C2'" 1 
ATOM   8248 O  "O2'" . A   D 4 16  ? -87.756  -23.130 19.581  1.00 77.98  ? 16   A   R "O2'" 1 
ATOM   8249 C  "C1'" . A   D 4 16  ? -87.713  -22.281 17.311  1.00 80.81  ? 16   A   R "C1'" 1 
ATOM   8250 N  N9    . A   D 4 16  ? -86.706  -21.664 16.447  1.00 88.71  ? 16   A   R N9    1 
ATOM   8251 C  C8    . A   D 4 16  ? -86.853  -20.575 15.624  1.00 82.29  ? 16   A   R C8    1 
ATOM   8252 N  N7    . A   D 4 16  ? -85.760  -20.250 14.976  1.00 77.06  ? 16   A   R N7    1 
ATOM   8253 C  C5    . A   D 4 16  ? -84.828  -21.184 15.407  1.00 75.40  ? 16   A   R C5    1 
ATOM   8254 C  C6    . A   D 4 16  ? -83.472  -21.384 15.090  1.00 77.25  ? 16   A   R C6    1 
ATOM   8255 N  N6    . A   D 4 16  ? -82.791  -20.620 14.233  1.00 85.06  ? 16   A   R N6    1 
ATOM   8256 N  N1    . A   D 4 16  ? -82.830  -22.408 15.694  1.00 75.95  ? 16   A   R N1    1 
ATOM   8257 C  C2    . A   D 4 16  ? -83.514  -23.175 16.554  1.00 76.12  ? 16   A   R C2    1 
ATOM   8258 N  N3    . A   D 4 16  ? -84.788  -23.088 16.932  1.00 79.26  ? 16   A   R N3    1 
ATOM   8259 C  C4    . A   D 4 16  ? -85.396  -22.060 16.315  1.00 79.17  ? 16   A   R C4    1 
ATOM   8260 P  P     . C   D 4 17  ? -88.062  -19.696 21.366  1.00 81.48  ? 17   C   R P     1 
ATOM   8261 O  OP1   . C   D 4 17  ? -88.837  -19.594 22.630  1.00 91.21  ? 17   C   R OP1   1 
ATOM   8262 O  OP2   . C   D 4 17  ? -87.744  -18.460 20.604  1.00 74.78  ? 17   C   R OP2   1 
ATOM   8263 O  "O5'" . C   D 4 17  ? -86.692  -20.451 21.675  1.00 72.39  ? 17   C   R "O5'" 1 
ATOM   8264 C  "C5'" . C   D 4 17  ? -86.672  -21.658 22.464  1.00 73.69  ? 17   C   R "C5'" 1 
ATOM   8265 C  "C4'" . C   D 4 17  ? -85.384  -22.418 22.248  1.00 70.69  ? 17   C   R "C4'" 1 
ATOM   8266 O  "O4'" . C   D 4 17  ? -85.089  -22.500 20.831  1.00 71.59  ? 17   C   R "O4'" 1 
ATOM   8267 C  "C3'" . C   D 4 17  ? -84.135  -21.794 22.847  1.00 67.50  ? 17   C   R "C3'" 1 
ATOM   8268 O  "O3'" . C   D 4 17  ? -84.012  -22.137 24.223  1.00 71.39  ? 17   C   R "O3'" 1 
ATOM   8269 C  "C2'" . C   D 4 17  ? -83.018  -22.420 22.014  1.00 73.48  ? 17   C   R "C2'" 1 
ATOM   8270 O  "O2'" . C   D 4 17  ? -82.567  -23.669 22.500  1.00 72.26  ? 17   C   R "O2'" 1 
ATOM   8271 C  "C1'" . C   D 4 17  ? -83.687  -22.584 20.644  1.00 79.38  ? 17   C   R "C1'" 1 
ATOM   8272 N  N1    . C   D 4 17  ? -83.283  -21.576 19.646  1.00 81.92  ? 17   C   R N1    1 
ATOM   8273 C  C2    . C   D 4 17  ? -82.014  -21.670 19.062  1.00 78.01  ? 17   C   R C2    1 
ATOM   8274 O  O2    . C   D 4 17  ? -81.262  -22.596 19.404  1.00 73.92  ? 17   C   R O2    1 
ATOM   8275 N  N3    . C   D 4 17  ? -81.640  -20.751 18.141  1.00 81.42  ? 17   C   R N3    1 
ATOM   8276 C  C4    . C   D 4 17  ? -82.480  -19.770 17.799  1.00 81.32  ? 17   C   R C4    1 
ATOM   8277 N  N4    . C   D 4 17  ? -82.069  -18.886 16.887  1.00 81.29  ? 17   C   R N4    1 
ATOM   8278 C  C5    . C   D 4 17  ? -83.779  -19.653 18.375  1.00 78.83  ? 17   C   R C5    1 
ATOM   8279 C  C6    . C   D 4 17  ? -84.136  -20.570 19.285  1.00 79.15  ? 17   C   R C6    1 
ATOM   8280 O  "O5'" . U   D 4 18  ? -82.676  -16.780 22.224  1.00 82.33  ? 18   U   R "O5'" 1 
ATOM   8281 C  "C5'" . U   D 4 18  ? -82.969  -18.037 22.865  1.00 81.93  ? 18   U   R "C5'" 1 
ATOM   8282 C  "C4'" . U   D 4 18  ? -81.817  -19.001 22.694  1.00 81.08  ? 18   U   R "C4'" 1 
ATOM   8283 O  "O4'" . U   D 4 18  ? -81.638  -19.300 21.284  1.00 82.32  ? 18   U   R "O4'" 1 
ATOM   8284 C  "C3'" . U   D 4 18  ? -80.459  -18.510 23.176  1.00 79.23  ? 18   U   R "C3'" 1 
ATOM   8285 O  "O3'" . U   D 4 18  ? -80.291  -18.805 24.558  1.00 80.67  ? 18   U   R "O3'" 1 
ATOM   8286 C  "C2'" . U   D 4 18  ? -79.493  -19.311 22.308  1.00 82.52  ? 18   U   R "C2'" 1 
ATOM   8287 O  "O2'" . U   D 4 18  ? -79.215  -20.608 22.797  1.00 84.88  ? 18   U   R "O2'" 1 
ATOM   8288 C  "C1'" . U   D 4 18  ? -80.255  -19.391 20.983  1.00 81.57  ? 18   U   R "C1'" 1 
ATOM   8289 N  N1    . U   D 4 18  ? -79.920  -18.332 20.016  1.00 78.25  ? 18   U   R N1    1 
ATOM   8290 C  C2    . U   D 4 18  ? -78.671  -18.363 19.419  1.00 76.23  ? 18   U   R C2    1 
ATOM   8291 O  O2    . U   D 4 18  ? -77.837  -19.217 19.669  1.00 72.82  ? 18   U   R O2    1 
ATOM   8292 N  N3    . U   D 4 18  ? -78.436  -17.348 18.526  1.00 78.03  ? 18   U   R N3    1 
ATOM   8293 C  C4    . U   D 4 18  ? -79.297  -16.333 18.166  1.00 72.48  ? 18   U   R C4    1 
ATOM   8294 O  O4    . U   D 4 18  ? -78.934  -15.492 17.342  1.00 70.41  ? 18   U   R O4    1 
ATOM   8295 C  C5    . U   D 4 18  ? -80.570  -16.374 18.820  1.00 74.80  ? 18   U   R C5    1 
ATOM   8296 C  C6    . U   D 4 18  ? -80.832  -17.350 19.698  1.00 80.00  ? 18   U   R C6    1 
ATOM   8297 P  P     . A   D 4 19  ? -79.406  -17.867 25.510  1.00 88.29  ? 19   A   R P     1 
ATOM   8298 O  OP1   . A   D 4 19  ? -79.656  -18.284 26.914  1.00 90.44  ? 19   A   R OP1   1 
ATOM   8299 O  OP2   . A   D 4 19  ? -79.623  -16.449 25.120  1.00 77.00  ? 19   A   R OP2   1 
ATOM   8300 O  "O5'" . A   D 4 19  ? -77.913  -18.265 25.121  1.00 77.96  ? 19   A   R "O5'" 1 
ATOM   8301 C  "C5'" . A   D 4 19  ? -77.377  -19.562 25.454  1.00 75.57  ? 19   A   R "C5'" 1 
ATOM   8302 C  "C4'" . A   D 4 19  ? -75.985  -19.721 24.887  1.00 78.44  ? 19   A   R "C4'" 1 
ATOM   8303 O  "O4'" . A   D 4 19  ? -76.055  -19.767 23.436  1.00 78.66  ? 19   A   R "O4'" 1 
ATOM   8304 C  "C3'" . A   D 4 19  ? -75.007  -18.593 25.203  1.00 79.84  ? 19   A   R "C3'" 1 
ATOM   8305 O  "O3'" . A   D 4 19  ? -74.361  -18.823 26.451  1.00 80.54  ? 19   A   R "O3'" 1 
ATOM   8306 C  "C2'" . A   D 4 19  ? -74.033  -18.668 24.031  1.00 76.46  ? 19   A   R "C2'" 1 
ATOM   8307 O  "O2'" . A   D 4 19  ? -73.008  -19.629 24.191  1.00 71.00  ? 19   A   R "O2'" 1 
ATOM   8308 C  "C1'" . A   D 4 19  ? -74.964  -19.053 22.879  1.00 80.89  ? 19   A   R "C1'" 1 
ATOM   8309 N  N9    . A   D 4 19  ? -75.494  -17.910 22.133  1.00 80.92  ? 19   A   R N9    1 
ATOM   8310 C  C8    . A   D 4 19  ? -76.780  -17.431 22.146  1.00 78.19  ? 19   A   R C8    1 
ATOM   8311 N  N7    . A   D 4 19  ? -76.967  -16.394 21.366  1.00 78.57  ? 19   A   R N7    1 
ATOM   8312 C  C5    . A   D 4 19  ? -75.719  -16.175 20.799  1.00 75.35  ? 19   A   R C5    1 
ATOM   8313 C  C6    . A   D 4 19  ? -75.252  -15.216 19.883  1.00 69.92  ? 19   A   R C6    1 
ATOM   8314 N  N6    . A   D 4 19  ? -76.020  -14.261 19.353  1.00 66.10  ? 19   A   R N6    1 
ATOM   8315 N  N1    . A   D 4 19  ? -73.950  -15.272 19.524  1.00 72.51  ? 19   A   R N1    1 
ATOM   8316 C  C2    . A   D 4 19  ? -73.180  -16.230 20.057  1.00 72.89  ? 19   A   R C2    1 
ATOM   8317 N  N3    . A   D 4 19  ? -73.503  -17.186 20.926  1.00 72.42  ? 19   A   R N3    1 
ATOM   8318 C  C4    . A   D 4 19  ? -74.802  -17.102 21.261  1.00 77.04  ? 19   A   R C4    1 
ATOM   8319 P  P     . U   D 4 20  ? -73.996  -17.607 27.430  1.00 84.17  ? 20   U   R P     1 
ATOM   8320 O  OP1   . U   D 4 20  ? -73.555  -18.185 28.725  1.00 103.51 ? 20   U   R OP1   1 
ATOM   8321 O  OP2   . U   D 4 20  ? -75.109  -16.624 27.410  1.00 70.10  ? 20   U   R OP2   1 
ATOM   8322 O  "O5'" . U   D 4 20  ? -72.733  -16.942 26.721  1.00 77.61  ? 20   U   R "O5'" 1 
ATOM   8323 C  "C5'" . U   D 4 20  ? -71.501  -17.671 26.557  1.00 75.49  ? 20   U   R "C5'" 1 
ATOM   8324 C  "C4'" . U   D 4 20  ? -70.578  -16.943 25.608  1.00 77.06  ? 20   U   R "C4'" 1 
ATOM   8325 O  "O4'" . U   D 4 20  ? -71.183  -16.884 24.289  1.00 83.38  ? 20   U   R "O4'" 1 
ATOM   8326 C  "C3'" . U   D 4 20  ? -70.285  -15.492 25.957  1.00 73.42  ? 20   U   R "C3'" 1 
ATOM   8327 O  "O3'" . U   D 4 20  ? -69.234  -15.401 26.913  1.00 70.78  ? 20   U   R "O3'" 1 
ATOM   8328 C  "C2'" . U   D 4 20  ? -69.900  -14.905 24.603  1.00 75.46  ? 20   U   R "C2'" 1 
ATOM   8329 O  "O2'" . U   D 4 20  ? -68.550  -15.123 24.242  1.00 75.53  ? 20   U   R "O2'" 1 
ATOM   8330 C  "C1'" . U   D 4 20  ? -70.837  -15.661 23.658  1.00 74.13  ? 20   U   R "C1'" 1 
ATOM   8331 N  N1    . U   D 4 20  ? -72.075  -14.934 23.333  1.00 68.86  ? 20   U   R N1    1 
ATOM   8332 C  C2    . U   D 4 20  ? -72.007  -13.932 22.381  1.00 65.28  ? 20   U   R C2    1 
ATOM   8333 O  O2    . U   D 4 20  ? -70.973  -13.628 21.810  1.00 67.81  ? 20   U   R O2    1 
ATOM   8334 N  N3    . U   D 4 20  ? -73.198  -13.298 22.126  1.00 68.30  ? 20   U   R N3    1 
ATOM   8335 C  C4    . U   D 4 20  ? -74.424  -13.555 22.705  1.00 69.62  ? 20   U   R C4    1 
ATOM   8336 O  O4    . U   D 4 20  ? -75.406  -12.893 22.365  1.00 68.88  ? 20   U   R O4    1 
ATOM   8337 C  C5    . U   D 4 20  ? -74.413  -14.606 23.677  1.00 72.53  ? 20   U   R C5    1 
ATOM   8338 C  C6    . U   D 4 20  ? -73.268  -15.244 23.950  1.00 72.46  ? 20   U   R C6    1 
ATOM   8339 P  P     . A   D 4 21  ? -69.269  -14.274 28.053  1.00 85.60  ? 21   A   R P     1 
ATOM   8340 O  OP1   . A   D 4 21  ? -68.205  -14.593 29.039  1.00 100.62 ? 21   A   R OP1   1 
ATOM   8341 O  OP2   . A   D 4 21  ? -70.669  -14.100 28.519  1.00 72.59  ? 21   A   R OP2   1 
ATOM   8342 O  "O5'" . A   D 4 21  ? -68.841  -12.960 27.260  1.00 85.61  ? 21   A   R "O5'" 1 
ATOM   8343 C  "C5'" . A   D 4 21  ? -67.571  -12.885 26.583  1.00 90.17  ? 21   A   R "C5'" 1 
ATOM   8344 C  "C4'" . A   D 4 21  ? -67.481  -11.621 25.760  1.00 88.17  ? 21   A   R "C4'" 1 
ATOM   8345 O  "O4'" . A   D 4 21  ? -68.239  -11.776 24.530  1.00 88.30  ? 21   A   R "O4'" 1 
ATOM   8346 C  "C3'" . A   D 4 21  ? -68.068  -10.366 26.394  1.00 88.75  ? 21   A   R "C3'" 1 
ATOM   8347 O  "O3'" . A   D 4 21  ? -67.186  -9.782  27.347  1.00 83.92  ? 21   A   R "O3'" 1 
ATOM   8348 C  "C2'" . A   D 4 21  ? -68.312  -9.489  25.172  1.00 92.56  ? 21   A   R "C2'" 1 
ATOM   8349 O  "O2'" . A   D 4 21  ? -67.160  -8.814  24.707  1.00 104.36 ? 21   A   R "O2'" 1 
ATOM   8350 C  "C1'" . A   D 4 21  ? -68.789  -10.522 24.149  1.00 86.27  ? 21   A   R "C1'" 1 
ATOM   8351 N  N9    . A   D 4 21  ? -70.246  -10.648 24.104  1.00 75.68  ? 21   A   R N9    1 
ATOM   8352 C  C8    . A   D 4 21  ? -71.028  -11.586 24.732  1.00 74.99  ? 21   A   R C8    1 
ATOM   8353 N  N7    . A   D 4 21  ? -72.312  -11.439 24.510  1.00 73.63  ? 21   A   R N7    1 
ATOM   8354 C  C5    . A   D 4 21  ? -72.382  -10.325 23.685  1.00 74.44  ? 21   A   R C5    1 
ATOM   8355 C  C6    . A   D 4 21  ? -73.466  -9.650  23.095  1.00 67.37  ? 21   A   R C6    1 
ATOM   8356 N  N6    . A   D 4 21  ? -74.741  -10.017 23.252  1.00 64.00  ? 21   A   R N6    1 
ATOM   8357 N  N1    . A   D 4 21  ? -73.193  -8.573  22.326  1.00 58.24  ? 21   A   R N1    1 
ATOM   8358 C  C2    . A   D 4 21  ? -71.914  -8.206  22.169  1.00 65.85  ? 21   A   R C2    1 
ATOM   8359 N  N3    . A   D 4 21  ? -70.811  -8.758  22.671  1.00 73.54  ? 21   A   R N3    1 
ATOM   8360 C  C4    . A   D 4 21  ? -71.117  -9.826  23.429  1.00 74.75  ? 21   A   R C4    1 
ATOM   8361 P  P     . G   D 4 22  ? -67.797  -9.048  28.635  1.00 128.81 ? 22   G   R P     1 
ATOM   8362 O  OP1   . G   D 4 22  ? -66.693  -8.837  29.607  1.00 120.97 ? 22   G   R OP1   1 
ATOM   8363 O  OP2   . G   D 4 22  ? -69.026  -9.763  29.069  1.00 104.37 ? 22   G   R OP2   1 
ATOM   8364 O  "O5'" . G   D 4 22  ? -68.226  -7.631  28.047  1.00 87.76  ? 22   G   R "O5'" 1 
ATOM   8365 C  "C5'" . G   D 4 22  ? -67.250  -6.765  27.439  1.00 90.26  ? 22   G   R "C5'" 1 
ATOM   8366 C  "C4'" . G   D 4 22  ? -67.918  -5.742  26.550  1.00 83.56  ? 22   G   R "C4'" 1 
ATOM   8367 O  "O4'" . G   D 4 22  ? -68.680  -6.401  25.504  1.00 78.17  ? 22   G   R "O4'" 1 
ATOM   8368 C  "C3'" . G   D 4 22  ? -68.950  -4.847  27.212  1.00 78.87  ? 22   G   R "C3'" 1 
ATOM   8369 O  "O3'" . G   D 4 22  ? -68.367  -3.824  28.011  1.00 89.73  ? 22   G   R "O3'" 1 
ATOM   8370 C  "C2'" . G   D 4 22  ? -69.711  -4.320  26.001  1.00 77.92  ? 22   G   R "C2'" 1 
ATOM   8371 O  "O2'" . G   D 4 22  ? -69.068  -3.250  25.337  1.00 76.46  ? 22   G   R "O2'" 1 
ATOM   8372 C  "C1'" . G   D 4 22  ? -69.761  -5.566  25.112  1.00 75.16  ? 22   G   R "C1'" 1 
ATOM   8373 N  N9    . G   D 4 22  ? -71.008  -6.310  25.265  1.00 69.11  ? 22   G   R N9    1 
ATOM   8374 C  C8    . G   D 4 22  ? -71.195  -7.493  25.939  1.00 74.63  ? 22   G   R C8    1 
ATOM   8375 N  N7    . G   D 4 22  ? -72.433  -7.906  25.915  1.00 70.39  ? 22   G   R N7    1 
ATOM   8376 C  C5    . G   D 4 22  ? -73.107  -6.931  25.191  1.00 64.60  ? 22   G   R C5    1 
ATOM   8377 C  C6    . G   D 4 22  ? -74.478  -6.834  24.834  1.00 67.90  ? 22   G   R C6    1 
ATOM   8378 O  O6    . G   D 4 22  ? -75.402  -7.614  25.096  1.00 70.61  ? 22   G   R O6    1 
ATOM   8379 N  N1    . G   D 4 22  ? -74.733  -5.682  24.094  1.00 65.44  ? 22   G   R N1    1 
ATOM   8380 C  C2    . G   D 4 22  ? -73.792  -4.746  23.742  1.00 64.54  ? 22   G   R C2    1 
ATOM   8381 N  N2    . G   D 4 22  ? -74.236  -3.702  23.026  1.00 58.44  ? 22   G   R N2    1 
ATOM   8382 N  N3    . G   D 4 22  ? -72.512  -4.826  24.067  1.00 64.52  ? 22   G   R N3    1 
ATOM   8383 C  C4    . G   D 4 22  ? -72.242  -5.937  24.785  1.00 64.80  ? 22   G   R C4    1 
ATOM   8384 P  P     . G   D 4 23  ? -69.129  -3.360  29.344  1.00 109.18 ? 23   G   R P     1 
ATOM   8385 O  OP1   . G   D 4 23  ? -68.209  -2.484  30.113  1.00 92.84  ? 23   G   R OP1   1 
ATOM   8386 O  OP2   . G   D 4 23  ? -69.723  -4.553  30.002  1.00 93.64  ? 23   G   R OP2   1 
ATOM   8387 O  "O5'" . G   D 4 23  ? -70.316  -2.463  28.773  1.00 76.87  ? 23   G   R "O5'" 1 
ATOM   8388 C  "C5'" . G   D 4 23  ? -70.033  -1.292  27.984  1.00 75.14  ? 23   G   R "C5'" 1 
ATOM   8389 C  "C4'" . G   D 4 23  ? -71.271  -0.810  27.265  1.00 74.38  ? 23   G   R "C4'" 1 
ATOM   8390 O  "O4'" . G   D 4 23  ? -71.860  -1.882  26.486  1.00 71.29  ? 23   G   R "O4'" 1 
ATOM   8391 C  "C3'" . G   D 4 23  ? -72.427  -0.361  28.141  1.00 76.09  ? 23   G   R "C3'" 1 
ATOM   8392 O  "O3'" . G   D 4 23  ? -72.198  0.926   28.704  1.00 79.72  ? 23   G   R "O3'" 1 
ATOM   8393 C  "C2'" . G   D 4 23  ? -73.591  -0.390  27.155  1.00 73.49  ? 23   G   R "C2'" 1 
ATOM   8394 O  "O2'" . G   D 4 23  ? -73.698  0.771   26.354  1.00 65.99  ? 23   G   R "O2'" 1 
ATOM   8395 C  "C1'" . G   D 4 23  ? -73.240  -1.612  26.296  1.00 66.31  ? 23   G   R "C1'" 1 
ATOM   8396 N  N9    . G   D 4 23  ? -74.007  -2.802  26.656  1.00 63.54  ? 23   G   R N9    1 
ATOM   8397 C  C8    . G   D 4 23  ? -73.533  -3.955  27.235  1.00 70.80  ? 23   G   R C8    1 
ATOM   8398 N  N7    . G   D 4 23  ? -74.466  -4.844  27.444  1.00 72.98  ? 23   G   R N7    1 
ATOM   8399 C  C5    . G   D 4 23  ? -75.627  -4.240  26.980  1.00 66.80  ? 23   G   R C5    1 
ATOM   8400 C  C6    . G   D 4 23  ? -76.963  -4.720  26.944  1.00 69.13  ? 23   G   R C6    1 
ATOM   8401 O  O6    . G   D 4 23  ? -77.402  -5.812  27.328  1.00 75.60  ? 23   G   R O6    1 
ATOM   8402 N  N1    . G   D 4 23  ? -77.829  -3.782  26.390  1.00 62.24  ? 23   G   R N1    1 
ATOM   8403 C  C2    . G   D 4 23  ? -77.460  -2.541  25.931  1.00 61.41  ? 23   G   R C2    1 
ATOM   8404 N  N2    . G   D 4 23  ? -78.443  -1.779  25.430  1.00 62.77  ? 23   G   R N2    1 
ATOM   8405 N  N3    . G   D 4 23  ? -76.219  -2.083  25.957  1.00 61.81  ? 23   G   R N3    1 
ATOM   8406 C  C4    . G   D 4 23  ? -75.360  -2.979  26.491  1.00 62.24  ? 23   G   R C4    1 
ATOM   8407 P  P     . C   D 4 24  ? -72.794  1.270   30.152  1.00 86.83  ? 24   C   R P     1 
ATOM   8408 O  OP1   . C   D 4 24  ? -72.068  2.456   30.673  1.00 94.96  ? 24   C   R OP1   1 
ATOM   8409 O  OP2   . C   D 4 24  ? -72.846  0.028   30.967  1.00 74.19  ? 24   C   R OP2   1 
ATOM   8410 O  "O5'" . C   D 4 24  ? -74.289  1.703   29.809  1.00 65.39  ? 24   C   R "O5'" 1 
ATOM   8411 C  "C5'" . C   D 4 24  ? -74.548  2.836   28.957  1.00 62.89  ? 24   C   R "C5'" 1 
ATOM   8412 C  "C4'" . C   D 4 24  ? -75.994  2.858   28.520  1.00 66.89  ? 24   C   R "C4'" 1 
ATOM   8413 O  "O4'" . C   D 4 24  ? -76.319  1.633   27.813  1.00 65.41  ? 24   C   R "O4'" 1 
ATOM   8414 C  "C3'" . C   D 4 24  ? -77.032  2.910   29.628  1.00 72.37  ? 24   C   R "C3'" 1 
ATOM   8415 O  "O3'" . C   D 4 24  ? -77.195  4.223   30.155  1.00 80.33  ? 24   C   R "O3'" 1 
ATOM   8416 C  "C2'" . C   D 4 24  ? -78.281  2.416   28.907  1.00 69.98  ? 24   C   R "C2'" 1 
ATOM   8417 O  "O2'" . C   D 4 24  ? -78.948  3.414   28.159  1.00 71.56  ? 24   C   R "O2'" 1 
ATOM   8418 C  "C1'" . C   D 4 24  ? -77.700  1.346   27.978  1.00 63.26  ? 24   C   R "C1'" 1 
ATOM   8419 N  N1    . C   D 4 24  ? -77.840  -0.024  28.506  1.00 59.90  ? 24   C   R N1    1 
ATOM   8420 C  C2    . C   D 4 24  ? -79.099  -0.636  28.471  1.00 63.46  ? 24   C   R C2    1 
ATOM   8421 O  O2    . C   D 4 24  ? -80.057  -0.012  27.989  1.00 61.90  ? 24   C   R O2    1 
ATOM   8422 N  N3    . C   D 4 24  ? -79.237  -1.891  28.958  1.00 68.33  ? 24   C   R N3    1 
ATOM   8423 C  C4    . C   D 4 24  ? -78.180  -2.530  29.467  1.00 66.28  ? 24   C   R C4    1 
ATOM   8424 N  N4    . C   D 4 24  ? -78.362  -3.766  29.935  1.00 62.73  ? 24   C   R N4    1 
ATOM   8425 C  C5    . C   D 4 24  ? -76.888  -1.929  29.517  1.00 64.01  ? 24   C   R C5    1 
ATOM   8426 C  C6    . C   D 4 24  ? -76.765  -0.686  29.031  1.00 65.64  ? 24   C   R C6    1 
ATOM   8427 P  P     . A   D 4 25  ? -77.580  4.425   31.700  1.00 96.44  ? 25   A   R P     1 
ATOM   8428 O  OP1   . A   D 4 25  ? -77.563  5.883   31.982  1.00 99.63  ? 25   A   R OP1   1 
ATOM   8429 O  OP2   . A   D 4 25  ? -76.742  3.513   32.521  1.00 66.65  ? 25   A   R OP2   1 
ATOM   8430 O  "O5'" . A   D 4 25  ? -79.088  3.915   31.780  1.00 65.04  ? 25   A   R "O5'" 1 
ATOM   8431 C  "C5'" . A   D 4 25  ? -80.145  4.610   31.087  1.00 71.00  ? 25   A   R "C5'" 1 
ATOM   8432 C  "C4'" . A   D 4 25  ? -81.443  3.843   31.182  1.00 71.97  ? 25   A   R "C4'" 1 
ATOM   8433 O  "O4'" . A   D 4 25  ? -81.325  2.576   30.480  1.00 74.49  ? 25   A   R "O4'" 1 
ATOM   8434 C  "C3'" . A   D 4 25  ? -81.888  3.448   32.586  1.00 81.17  ? 25   A   R "C3'" 1 
ATOM   8435 O  "O3'" . A   D 4 25  ? -82.533  4.531   33.248  1.00 89.45  ? 25   A   R "O3'" 1 
ATOM   8436 C  "C2'" . A   D 4 25  ? -82.828  2.283   32.300  1.00 77.40  ? 25   A   R "C2'" 1 
ATOM   8437 O  "O2'" . A   D 4 25  ? -84.136  2.675   31.930  1.00 73.41  ? 25   A   R "O2'" 1 
ATOM   8438 C  "C1'" . A   D 4 25  ? -82.115  1.594   31.134  1.00 74.21  ? 25   A   R "C1'" 1 
ATOM   8439 N  N9    . A   D 4 25  ? -81.237  0.503   31.558  1.00 73.62  ? 25   A   R N9    1 
ATOM   8440 C  C8    . A   D 4 25  ? -79.873  0.537   31.712  1.00 73.16  ? 25   A   R C8    1 
ATOM   8441 N  N7    . A   D 4 25  ? -79.356  -0.599  32.112  1.00 70.89  ? 25   A   R N7    1 
ATOM   8442 C  C5    . A   D 4 25  ? -80.454  -1.440  32.232  1.00 72.41  ? 25   A   R C5    1 
ATOM   8443 C  C6    . A   D 4 25  ? -80.576  -2.787  32.618  1.00 76.95  ? 25   A   R C6    1 
ATOM   8444 N  N6    . A   D 4 25  ? -79.542  -3.554  32.970  1.00 77.23  ? 25   A   R N6    1 
ATOM   8445 N  N1    . A   D 4 25  ? -81.816  -3.326  32.633  1.00 78.24  ? 25   A   R N1    1 
ATOM   8446 C  C2    . A   D 4 25  ? -82.853  -2.556  32.281  1.00 78.63  ? 25   A   R C2    1 
ATOM   8447 N  N3    . A   D 4 25  ? -82.865  -1.280  31.899  1.00 74.01  ? 25   A   R N3    1 
ATOM   8448 C  C4    . A   D 4 25  ? -81.619  -0.774  31.895  1.00 74.00  ? 25   A   R C4    1 
ATOM   8449 P  P     . U   D 4 26  ? -82.228  4.816   34.796  1.00 81.37  ? 26   U   R P     1 
ATOM   8450 O  OP1   . U   D 4 26  ? -82.711  6.186   35.108  1.00 90.68  ? 26   U   R OP1   1 
ATOM   8451 O  OP2   . U   D 4 26  ? -80.816  4.456   35.089  1.00 74.37  ? 26   U   R OP2   1 
ATOM   8452 O  "O5'" . U   D 4 26  ? -83.172  3.765   35.531  1.00 74.17  ? 26   U   R "O5'" 1 
ATOM   8453 C  "C5'" . U   D 4 26  ? -84.606  3.901   35.483  1.00 75.11  ? 26   U   R "C5'" 1 
ATOM   8454 C  "C4'" . U   D 4 26  ? -85.277  2.563   35.682  1.00 83.99  ? 26   U   R "C4'" 1 
ATOM   8455 O  "O4'" . U   D 4 26  ? -84.672  1.571   34.812  1.00 85.73  ? 26   U   R "O4'" 1 
ATOM   8456 C  "C3'" . U   D 4 26  ? -85.148  1.950   37.068  1.00 90.23  ? 26   U   R "C3'" 1 
ATOM   8457 O  "O3'" . U   D 4 26  ? -86.074  2.507   37.996  1.00 97.51  ? 26   U   R "O3'" 1 
ATOM   8458 C  "C2'" . U   D 4 26  ? -85.424  0.478   36.787  1.00 92.41  ? 26   U   R "C2'" 1 
ATOM   8459 O  "O2'" . U   D 4 26  ? -86.798  0.150   36.723  1.00 97.46  ? 26   U   R "O2'" 1 
ATOM   8460 C  "C1'" . U   D 4 26  ? -84.756  0.291   35.421  1.00 91.01  ? 26   U   R "C1'" 1 
ATOM   8461 N  N1    . U   D 4 26  ? -83.404  -0.284  35.504  1.00 86.49  ? 26   U   R N1    1 
ATOM   8462 C  C2    . U   D 4 26  ? -83.294  -1.660  35.592  1.00 89.31  ? 26   U   R C2    1 
ATOM   8463 O  O2    . U   D 4 26  ? -84.261  -2.404  35.594  1.00 90.77  ? 26   U   R O2    1 
ATOM   8464 N  N3    . U   D 4 26  ? -82.007  -2.131  35.673  1.00 88.80  ? 26   U   R N3    1 
ATOM   8465 C  C4    . U   D 4 26  ? -80.844  -1.391  35.679  1.00 85.01  ? 26   U   R C4    1 
ATOM   8466 O  O4    . U   D 4 26  ? -79.758  -1.968  35.756  1.00 91.26  ? 26   U   R O4    1 
ATOM   8467 C  C5    . U   D 4 26  ? -81.040  0.024   35.588  1.00 79.01  ? 26   U   R C5    1 
ATOM   8468 C  C6    . U   D 4 26  ? -82.283  0.518   35.508  1.00 81.14  ? 26   U   R C6    1 
ATOM   8469 P  P     . A   D 4 27  ? -85.649  2.698   39.532  1.00 108.30 ? 27   A   R P     1 
ATOM   8470 O  OP1   . A   D 4 27  ? -86.727  3.466   40.206  1.00 98.46  ? 27   A   R OP1   1 
ATOM   8471 O  OP2   . A   D 4 27  ? -84.253  3.206   39.579  1.00 82.28  ? 27   A   R OP2   1 
ATOM   8472 O  "O5'" . A   D 4 27  ? -85.651  1.211   40.107  1.00 107.76 ? 27   A   R "O5'" 1 
ATOM   8473 C  "C5'" . A   D 4 27  ? -86.883  0.485   40.288  1.00 113.19 ? 27   A   R "C5'" 1 
ATOM   8474 C  "C4'" . A   D 4 27  ? -86.639  -1.005  40.224  1.00 113.86 ? 27   A   R "C4'" 1 
ATOM   8475 O  "O4'" . A   D 4 27  ? -85.653  -1.297  39.201  1.00 121.79 ? 27   A   R "O4'" 1 
ATOM   8476 C  "C3'" . A   D 4 27  ? -86.077  -1.642  41.490  1.00 111.56 ? 27   A   R "C3'" 1 
ATOM   8477 O  "O3'" . A   D 4 27  ? -87.125  -1.971  42.395  1.00 106.40 ? 27   A   R "O3'" 1 
ATOM   8478 C  "C2'" . A   D 4 27  ? -85.391  -2.893  40.951  1.00 116.00 ? 27   A   R "C2'" 1 
ATOM   8479 O  "O2'" . A   D 4 27  ? -86.256  -3.999  40.785  1.00 109.24 ? 27   A   R "O2'" 1 
ATOM   8480 C  "C1'" . A   D 4 27  ? -84.868  -2.409  39.596  1.00 118.02 ? 27   A   R "C1'" 1 
ATOM   8481 N  N9    . A   D 4 27  ? -83.463  -1.999  39.622  1.00 110.01 ? 27   A   R N9    1 
ATOM   8482 C  C8    . A   D 4 27  ? -82.956  -0.723  39.664  1.00 98.84  ? 27   A   R C8    1 
ATOM   8483 N  N7    . A   D 4 27  ? -81.646  -0.675  39.678  1.00 92.79  ? 27   A   R N7    1 
ATOM   8484 C  C5    . A   D 4 27  ? -81.263  -2.009  39.644  1.00 89.81  ? 27   A   R C5    1 
ATOM   8485 C  C6    . A   D 4 27  ? -80.002  -2.633  39.639  1.00 101.47 ? 27   A   R C6    1 
ATOM   8486 N  N6    . A   D 4 27  ? -78.846  -1.966  39.670  1.00 107.65 ? 27   A   R N6    1 
ATOM   8487 N  N1    . A   D 4 27  ? -79.970  -3.983  39.601  1.00 96.81  ? 27   A   R N1    1 
ATOM   8488 C  C2    . A   D 4 27  ? -81.130  -4.652  39.571  1.00 94.74  ? 27   A   R C2    1 
ATOM   8489 N  N3    . A   D 4 27  ? -82.375  -4.179  39.571  1.00 97.12  ? 27   A   R N3    1 
ATOM   8490 C  C4    . A   D 4 27  ? -82.373  -2.835  39.609  1.00 102.52 ? 27   A   R C4    1 
HETATM 8491 CL CL    . EFZ E 5 .   ? -71.485  -34.689 -20.012 1.00 64.70  ? 1557 EFZ A CL    1 
HETATM 8492 F  F1    . EFZ E 5 .   ? -67.946  -36.796 -18.349 1.00 69.07  ? 1557 EFZ A F1    1 
HETATM 8493 F  F2    . EFZ E 5 .   ? -67.900  -37.365 -16.318 1.00 73.24  ? 1557 EFZ A F2    1 
HETATM 8494 F  F3    . EFZ E 5 .   ? -66.106  -37.132 -17.347 1.00 68.29  ? 1557 EFZ A F3    1 
HETATM 8495 O  O1    . EFZ E 5 .   ? -64.600  -33.242 -16.479 1.00 69.92  ? 1557 EFZ A O1    1 
HETATM 8496 O  O2    . EFZ E 5 .   ? -66.076  -34.919 -16.736 1.00 77.73  ? 1557 EFZ A O2    1 
HETATM 8497 N  N     . EFZ E 5 .   ? -66.237  -33.127 -18.032 1.00 71.64  ? 1557 EFZ A N     1 
HETATM 8498 C  C1    . EFZ E 5 .   ? -67.482  -33.523 -18.485 1.00 68.21  ? 1557 EFZ A C1    1 
HETATM 8499 C  C2    . EFZ E 5 .   ? -68.116  -32.778 -19.508 1.00 69.16  ? 1557 EFZ A C2    1 
HETATM 8500 C  C3    . EFZ E 5 .   ? -69.349  -33.180 -19.940 1.00 73.31  ? 1557 EFZ A C3    1 
HETATM 8501 C  C4    . EFZ E 5 .   ? -69.945  -34.251 -19.408 1.00 77.43  ? 1557 EFZ A C4    1 
HETATM 8502 C  C5    . EFZ E 5 .   ? -69.337  -34.967 -18.423 1.00 67.42  ? 1557 EFZ A C5    1 
HETATM 8503 C  C6    . EFZ E 5 .   ? -68.045  -34.534 -17.981 1.00 68.98  ? 1557 EFZ A C6    1 
HETATM 8504 C  C7    . EFZ E 5 .   ? -67.368  -35.290 -16.913 1.00 77.71  ? 1557 EFZ A C7    1 
HETATM 8505 C  C8    . EFZ E 5 .   ? -68.078  -35.184 -15.620 1.00 81.91  ? 1557 EFZ A C8    1 
HETATM 8506 C  C9    . EFZ E 5 .   ? -69.424  -35.863 -15.486 1.00 78.09  ? 1557 EFZ A C9    1 
HETATM 8507 C  C10   . EFZ E 5 .   ? -69.935  -36.123 -14.134 1.00 67.36  ? 1557 EFZ A C10   1 
HETATM 8508 C  C11   . EFZ E 5 .   ? -70.779  -34.993 -13.699 1.00 59.66  ? 1557 EFZ A C11   1 
HETATM 8509 C  C12   . EFZ E 5 .   ? -71.405  -36.234 -14.168 1.00 61.32  ? 1557 EFZ A C12   1 
HETATM 8510 C  C13   . EFZ E 5 .   ? -67.316  -36.692 -17.243 1.00 71.26  ? 1557 EFZ A C13   1 
HETATM 8511 C  C14   . EFZ E 5 .   ? -65.926  -33.560 -16.772 1.00 74.28  ? 1557 EFZ A C14   1 
HETATM 8512 CA CA    . CA  F 6 .   ? -87.180  -33.102 2.129   1.00 65.28  ? 100  CA  D CA    1 
HETATM 8513 CA CA    . CA  G 6 .   ? -74.518  -8.576  29.679  1.00 85.98  ? 100  CA  R CA    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  ?   ?   ?   A . n 
A 1 63  ILE 63  63  ?   ?   ?   A . n 
A 1 64  LYS 64  64  ?   ?   ?   A . n 
A 1 65  LYS 65  65  ?   ?   ?   A . n 
A 1 66  LYS 66  66  ?   ?   ?   A . n 
A 1 67  ASP 67  67  ?   ?   ?   A . n 
A 1 68  GLY 68  68  ?   ?   ?   A . n 
A 1 69  THR 69  69  ?   ?   ?   A . n 
A 1 70  LYS 70  70  ?   ?   ?   A . n 
A 1 71  TRP 71  71  ?   ?   ?   A . n 
A 1 72  ARG 72  72  ?   ?   ?   A . n 
A 1 73  LYS 73  73  ?   ?   ?   A . n 
A 1 74  LEU 74  74  ?   ?   ?   A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 HIS 235 235 235 HIS HIS A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 TRP 239 239 239 TRP TRP A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 TRP 252 252 252 TRP TRP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 GLN 258 258 258 GLN GLN A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 CYS 280 280 280 CYS CYS A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 MET 357 357 357 MET MET A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 HIS 361 361 361 HIS HIS A . n 
A 1 362 THR 362 362 362 THR THR A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 TRP 383 383 383 TRP TRP A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 PHE 389 389 389 PHE PHE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 TRP 402 402 402 TRP TRP A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 TRP 406 406 406 TRP TRP A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 GLU 413 413 413 GLU GLU A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 PHE 416 416 416 PHE PHE A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TYR 427 427 427 TYR TYR A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 ILE 434 434 434 ILE ILE A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 GLU 438 438 438 GLU GLU A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 SER 447 447 447 SER SER A . n 
A 1 448 ARG 448 448 448 ARG ARG A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ASN 460 460 460 ASN ASN A . n 
A 1 461 LYS 461 461 461 LYS LYS A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 GLN 464 464 464 GLN GLN A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 GLN 475 475 475 GLN GLN A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 GLU 478 478 478 GLU GLU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 HIS 483 483 483 HIS HIS A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLN 487 487 487 GLN GLN A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 ILE 495 495 495 ILE ILE A . n 
A 1 496 VAL 496 496 496 VAL VAL A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 ASP 498 498 498 ASP ASP A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 TYR 501 501 501 TYR TYR A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 PRO 510 510 510 PRO PRO A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 SER 513 513 513 SER SER A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 GLN 520 520 520 GLN GLN A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 ILE 522 522 522 ILE ILE A . n 
A 1 523 GLU 523 523 523 GLU GLU A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 TRP 535 535 535 TRP TRP A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 LYS 540 540 540 LYS LYS A . n 
A 1 541 GLY 541 541 541 GLY GLY A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASN 545 545 545 ASN ASN A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 ASP 549 549 549 ASP ASP A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 VAL 552 552 552 VAL VAL A . n 
A 1 553 SER 553 553 553 SER SER A . n 
A 1 554 ALA 554 554 554 ALA ALA A . n 
A 1 555 GLY 555 555 555 GLY GLY A . n 
A 1 556 ILE 556 556 556 ILE ILE A . n 
A 1 557 ARG 557 557 ?   ?   ?   A . n 
A 1 558 LYS 558 558 ?   ?   ?   A . n 
A 1 559 ILE 559 559 ?   ?   ?   A . n 
A 1 560 LEU 560 560 ?   ?   ?   A . n 
B 2 1   GLY 1   0   ?   ?   ?   B . n 
B 2 2   PRO 2   1   ?   ?   ?   B . n 
B 2 3   ILE 3   2   ?   ?   ?   B . n 
B 2 4   SER 4   3   ?   ?   ?   B . n 
B 2 5   PRO 5   4   ?   ?   ?   B . n 
B 2 6   ILE 6   5   ?   ?   ?   B . n 
B 2 7   GLU 7   6   ?   ?   ?   B . n 
B 2 8   THR 8   7   7   THR THR B . n 
B 2 9   VAL 9   8   8   VAL VAL B . n 
B 2 10  PRO 10  9   9   PRO PRO B . n 
B 2 11  VAL 11  10  10  VAL VAL B . n 
B 2 12  LYS 12  11  11  LYS LYS B . n 
B 2 13  LEU 13  12  12  LEU LEU B . n 
B 2 14  LYS 14  13  13  LYS LYS B . n 
B 2 15  PRO 15  14  14  PRO PRO B . n 
B 2 16  GLY 16  15  15  GLY GLY B . n 
B 2 17  MET 17  16  16  MET MET B . n 
B 2 18  ASP 18  17  17  ASP ASP B . n 
B 2 19  GLY 19  18  18  GLY GLY B . n 
B 2 20  PRO 20  19  19  PRO PRO B . n 
B 2 21  LYS 21  20  20  LYS LYS B . n 
B 2 22  VAL 22  21  21  VAL VAL B . n 
B 2 23  LYS 23  22  22  LYS LYS B . n 
B 2 24  GLN 24  23  23  GLN GLN B . n 
B 2 25  TRP 25  24  24  TRP TRP B . n 
B 2 26  PRO 26  25  25  PRO PRO B . n 
B 2 27  LEU 27  26  26  LEU LEU B . n 
B 2 28  THR 28  27  27  THR THR B . n 
B 2 29  GLU 29  28  28  GLU GLU B . n 
B 2 30  GLU 30  29  29  GLU GLU B . n 
B 2 31  LYS 31  30  30  LYS LYS B . n 
B 2 32  ILE 32  31  31  ILE ILE B . n 
B 2 33  LYS 33  32  32  LYS LYS B . n 
B 2 34  ALA 34  33  33  ALA ALA B . n 
B 2 35  LEU 35  34  34  LEU LEU B . n 
B 2 36  VAL 36  35  35  VAL VAL B . n 
B 2 37  GLU 37  36  36  GLU GLU B . n 
B 2 38  ILE 38  37  37  ILE ILE B . n 
B 2 39  CYS 39  38  38  CYS CYS B . n 
B 2 40  THR 40  39  39  THR THR B . n 
B 2 41  GLU 41  40  40  GLU GLU B . n 
B 2 42  MET 42  41  41  MET MET B . n 
B 2 43  GLU 43  42  42  GLU GLU B . n 
B 2 44  LYS 44  43  43  LYS LYS B . n 
B 2 45  GLU 45  44  44  GLU GLU B . n 
B 2 46  GLY 46  45  45  GLY GLY B . n 
B 2 47  LYS 47  46  46  LYS LYS B . n 
B 2 48  ILE 48  47  47  ILE ILE B . n 
B 2 49  SER 49  48  48  SER SER B . n 
B 2 50  LYS 50  49  49  LYS LYS B . n 
B 2 51  ILE 51  50  50  ILE ILE B . n 
B 2 52  GLY 52  51  51  GLY GLY B . n 
B 2 53  PRO 53  52  52  PRO PRO B . n 
B 2 54  GLU 54  53  53  GLU GLU B . n 
B 2 55  ASN 55  54  54  ASN ASN B . n 
B 2 56  PRO 56  55  55  PRO PRO B . n 
B 2 57  TYR 57  56  56  TYR TYR B . n 
B 2 58  ASN 58  57  57  ASN ASN B . n 
B 2 59  THR 59  58  58  THR THR B . n 
B 2 60  PRO 60  59  59  PRO PRO B . n 
B 2 61  VAL 61  60  60  VAL VAL B . n 
B 2 62  PHE 62  61  61  PHE PHE B . n 
B 2 63  ALA 63  62  62  ALA ALA B . n 
B 2 64  ILE 64  63  63  ILE ILE B . n 
B 2 65  LYS 65  64  64  LYS LYS B . n 
B 2 66  LYS 66  65  65  LYS LYS B . n 
B 2 67  LYS 67  66  66  LYS LYS B . n 
B 2 68  ASP 68  67  67  ASP ASP B . n 
B 2 69  GLY 69  68  68  GLY GLY B . n 
B 2 70  THR 70  69  69  THR THR B . n 
B 2 71  LYS 71  70  70  LYS LYS B . n 
B 2 72  TRP 72  71  71  TRP TRP B . n 
B 2 73  ARG 73  72  72  ARG ARG B . n 
B 2 74  LYS 74  73  73  LYS LYS B . n 
B 2 75  LEU 75  74  74  LEU LEU B . n 
B 2 76  VAL 76  75  75  VAL VAL B . n 
B 2 77  ASP 77  76  76  ASP ASP B . n 
B 2 78  PHE 78  77  77  PHE PHE B . n 
B 2 79  ARG 79  78  78  ARG ARG B . n 
B 2 80  GLU 80  79  79  GLU GLU B . n 
B 2 81  LEU 81  80  80  LEU LEU B . n 
B 2 82  ASN 82  81  81  ASN ASN B . n 
B 2 83  LYS 83  82  82  LYS LYS B . n 
B 2 84  LYS 84  83  83  LYS LYS B . n 
B 2 85  THR 85  84  84  THR THR B . n 
B 2 86  GLN 86  85  85  GLN GLN B . n 
B 2 87  ASP 87  86  86  ASP ASP B . n 
B 2 88  PHE 88  87  87  PHE PHE B . n 
B 2 89  TRP 89  88  88  TRP TRP B . n 
B 2 90  GLU 90  89  89  GLU GLU B . n 
B 2 91  VAL 91  90  90  VAL VAL B . n 
B 2 92  GLN 92  91  91  GLN GLN B . n 
B 2 93  LEU 93  92  92  LEU LEU B . n 
B 2 94  GLY 94  93  93  GLY GLY B . n 
B 2 95  ILE 95  94  94  ILE ILE B . n 
B 2 96  PRO 96  95  95  PRO PRO B . n 
B 2 97  HIS 97  96  96  HIS HIS B . n 
B 2 98  PRO 98  97  97  PRO PRO B . n 
B 2 99  ALA 99  98  98  ALA ALA B . n 
B 2 100 GLY 100 99  99  GLY GLY B . n 
B 2 101 LEU 101 100 100 LEU LEU B . n 
B 2 102 LYS 102 101 101 LYS LYS B . n 
B 2 103 LYS 103 102 102 LYS LYS B . n 
B 2 104 LYS 104 103 103 LYS LYS B . n 
B 2 105 LYS 105 104 104 LYS LYS B . n 
B 2 106 SER 106 105 105 SER SER B . n 
B 2 107 VAL 107 106 106 VAL VAL B . n 
B 2 108 THR 108 107 107 THR THR B . n 
B 2 109 VAL 109 108 108 VAL VAL B . n 
B 2 110 LEU 110 109 109 LEU LEU B . n 
B 2 111 ASP 111 110 110 ASP ASP B . n 
B 2 112 VAL 112 111 111 VAL VAL B . n 
B 2 113 GLY 113 112 112 GLY GLY B . n 
B 2 114 ASP 114 113 113 ASP ASP B . n 
B 2 115 ALA 115 114 114 ALA ALA B . n 
B 2 116 TYR 116 115 115 TYR TYR B . n 
B 2 117 PHE 117 116 116 PHE PHE B . n 
B 2 118 SER 118 117 117 SER SER B . n 
B 2 119 VAL 119 118 118 VAL VAL B . n 
B 2 120 PRO 120 119 119 PRO PRO B . n 
B 2 121 LEU 121 120 120 LEU LEU B . n 
B 2 122 ASP 122 121 121 ASP ASP B . n 
B 2 123 GLU 123 122 122 GLU GLU B . n 
B 2 124 ASP 124 123 123 ASP ASP B . n 
B 2 125 PHE 125 124 124 PHE PHE B . n 
B 2 126 ARG 126 125 125 ARG ARG B . n 
B 2 127 LYS 127 126 126 LYS LYS B . n 
B 2 128 TYR 128 127 127 TYR TYR B . n 
B 2 129 THR 129 128 128 THR THR B . n 
B 2 130 ALA 130 129 129 ALA ALA B . n 
B 2 131 PHE 131 130 130 PHE PHE B . n 
B 2 132 THR 132 131 131 THR THR B . n 
B 2 133 ILE 133 132 132 ILE ILE B . n 
B 2 134 PRO 134 133 133 PRO PRO B . n 
B 2 135 SER 135 134 134 SER SER B . n 
B 2 136 ILE 136 135 135 ILE ILE B . n 
B 2 137 ASN 137 136 136 ASN ASN B . n 
B 2 138 ASN 138 137 137 ASN ASN B . n 
B 2 139 GLU 139 138 138 GLU GLU B . n 
B 2 140 THR 140 139 139 THR THR B . n 
B 2 141 PRO 141 140 140 PRO PRO B . n 
B 2 142 GLY 142 141 141 GLY GLY B . n 
B 2 143 ILE 143 142 142 ILE ILE B . n 
B 2 144 ARG 144 143 143 ARG ARG B . n 
B 2 145 TYR 145 144 144 TYR TYR B . n 
B 2 146 GLN 146 145 145 GLN GLN B . n 
B 2 147 TYR 147 146 146 TYR TYR B . n 
B 2 148 ASN 148 147 147 ASN ASN B . n 
B 2 149 VAL 149 148 148 VAL VAL B . n 
B 2 150 LEU 150 149 149 LEU LEU B . n 
B 2 151 PRO 151 150 150 PRO PRO B . n 
B 2 152 GLN 152 151 151 GLN GLN B . n 
B 2 153 GLY 153 152 152 GLY GLY B . n 
B 2 154 TRP 154 153 153 TRP TRP B . n 
B 2 155 LYS 155 154 154 LYS LYS B . n 
B 2 156 GLY 156 155 155 GLY GLY B . n 
B 2 157 SER 157 156 156 SER SER B . n 
B 2 158 PRO 158 157 157 PRO PRO B . n 
B 2 159 ALA 159 158 158 ALA ALA B . n 
B 2 160 ILE 160 159 159 ILE ILE B . n 
B 2 161 PHE 161 160 160 PHE PHE B . n 
B 2 162 GLN 162 161 161 GLN GLN B . n 
B 2 163 SER 163 162 162 SER SER B . n 
B 2 164 SER 164 163 163 SER SER B . n 
B 2 165 MET 165 164 164 MET MET B . n 
B 2 166 THR 166 165 165 THR THR B . n 
B 2 167 LYS 167 166 166 LYS LYS B . n 
B 2 168 ILE 168 167 167 ILE ILE B . n 
B 2 169 LEU 169 168 168 LEU LEU B . n 
B 2 170 GLU 170 169 169 GLU GLU B . n 
B 2 171 PRO 171 170 170 PRO PRO B . n 
B 2 172 PHE 172 171 171 PHE PHE B . n 
B 2 173 ARG 173 172 172 ARG ARG B . n 
B 2 174 LYS 174 173 173 LYS LYS B . n 
B 2 175 GLN 175 174 174 GLN GLN B . n 
B 2 176 ASN 176 175 175 ASN ASN B . n 
B 2 177 PRO 177 176 176 PRO PRO B . n 
B 2 178 ASP 178 177 177 ASP ASP B . n 
B 2 179 ILE 179 178 178 ILE ILE B . n 
B 2 180 VAL 180 179 179 VAL VAL B . n 
B 2 181 ILE 181 180 180 ILE ILE B . n 
B 2 182 TYR 182 181 181 TYR TYR B . n 
B 2 183 GLN 183 182 182 GLN GLN B . n 
B 2 184 TYR 184 183 183 TYR TYR B . n 
B 2 185 MET 185 184 184 MET MET B . n 
B 2 186 ASP 186 185 185 ASP ASP B . n 
B 2 187 ASP 187 186 186 ASP ASP B . n 
B 2 188 LEU 188 187 187 LEU LEU B . n 
B 2 189 TYR 189 188 188 TYR TYR B . n 
B 2 190 VAL 190 189 189 VAL VAL B . n 
B 2 191 GLY 191 190 190 GLY GLY B . n 
B 2 192 SER 192 191 191 SER SER B . n 
B 2 193 ASP 193 192 192 ASP ASP B . n 
B 2 194 LEU 194 193 193 LEU LEU B . n 
B 2 195 GLU 195 194 194 GLU GLU B . n 
B 2 196 ILE 196 195 195 ILE ILE B . n 
B 2 197 GLY 197 196 196 GLY GLY B . n 
B 2 198 GLN 198 197 197 GLN GLN B . n 
B 2 199 HIS 199 198 198 HIS HIS B . n 
B 2 200 ARG 200 199 199 ARG ARG B . n 
B 2 201 THR 201 200 200 THR THR B . n 
B 2 202 LYS 202 201 201 LYS LYS B . n 
B 2 203 ILE 203 202 202 ILE ILE B . n 
B 2 204 GLU 204 203 203 GLU GLU B . n 
B 2 205 GLU 205 204 204 GLU GLU B . n 
B 2 206 LEU 206 205 205 LEU LEU B . n 
B 2 207 ARG 207 206 206 ARG ARG B . n 
B 2 208 GLN 208 207 207 GLN GLN B . n 
B 2 209 HIS 209 208 208 HIS HIS B . n 
B 2 210 LEU 210 209 209 LEU LEU B . n 
B 2 211 LEU 211 210 210 LEU LEU B . n 
B 2 212 ARG 212 211 211 ARG ARG B . n 
B 2 213 TRP 213 212 212 TRP TRP B . n 
B 2 214 GLY 214 213 213 GLY GLY B . n 
B 2 215 LEU 215 214 214 LEU LEU B . n 
B 2 216 THR 216 215 215 THR THR B . n 
B 2 217 THR 217 216 ?   ?   ?   B . n 
B 2 218 PRO 218 217 ?   ?   ?   B . n 
B 2 219 ASP 219 218 ?   ?   ?   B . n 
B 2 220 LYS 220 219 ?   ?   ?   B . n 
B 2 221 LYS 221 220 ?   ?   ?   B . n 
B 2 222 HIS 222 221 ?   ?   ?   B . n 
B 2 223 GLN 223 222 ?   ?   ?   B . n 
B 2 224 LYS 224 223 ?   ?   ?   B . n 
B 2 225 GLU 225 224 ?   ?   ?   B . n 
B 2 226 PRO 226 225 ?   ?   ?   B . n 
B 2 227 PRO 227 226 ?   ?   ?   B . n 
B 2 228 PHE 228 227 ?   ?   ?   B . n 
B 2 229 LEU 229 228 ?   ?   ?   B . n 
B 2 230 TRP 230 229 ?   ?   ?   B . n 
B 2 231 MET 231 230 ?   ?   ?   B . n 
B 2 232 GLY 232 231 231 GLY GLY B . n 
B 2 233 TYR 233 232 232 TYR TYR B . n 
B 2 234 GLU 234 233 233 GLU GLU B . n 
B 2 235 LEU 235 234 234 LEU LEU B . n 
B 2 236 HIS 236 235 235 HIS HIS B . n 
B 2 237 PRO 237 236 236 PRO PRO B . n 
B 2 238 ASP 238 237 237 ASP ASP B . n 
B 2 239 LYS 239 238 238 LYS LYS B . n 
B 2 240 TRP 240 239 239 TRP TRP B . n 
B 2 241 THR 241 240 240 THR THR B . n 
B 2 242 VAL 242 241 241 VAL VAL B . n 
B 2 243 GLN 243 242 242 GLN GLN B . n 
B 2 244 PRO 244 243 243 PRO PRO B . n 
B 2 245 ILE 245 244 244 ILE ILE B . n 
B 2 246 VAL 246 245 245 VAL VAL B . n 
B 2 247 LEU 247 246 246 LEU LEU B . n 
B 2 248 PRO 248 247 247 PRO PRO B . n 
B 2 249 GLU 249 248 248 GLU GLU B . n 
B 2 250 LYS 250 249 249 LYS LYS B . n 
B 2 251 ASP 251 250 250 ASP ASP B . n 
B 2 252 SER 252 251 251 SER SER B . n 
B 2 253 TRP 253 252 252 TRP TRP B . n 
B 2 254 THR 254 253 253 THR THR B . n 
B 2 255 VAL 255 254 254 VAL VAL B . n 
B 2 256 ASN 256 255 255 ASN ASN B . n 
B 2 257 ASP 257 256 256 ASP ASP B . n 
B 2 258 ILE 258 257 257 ILE ILE B . n 
B 2 259 GLN 259 258 258 GLN GLN B . n 
B 2 260 LYS 260 259 259 LYS LYS B . n 
B 2 261 LEU 261 260 260 LEU LEU B . n 
B 2 262 VAL 262 261 261 VAL VAL B . n 
B 2 263 GLY 263 262 262 GLY GLY B . n 
B 2 264 LYS 264 263 263 LYS LYS B . n 
B 2 265 LEU 265 264 264 LEU LEU B . n 
B 2 266 ASN 266 265 265 ASN ASN B . n 
B 2 267 TRP 267 266 266 TRP TRP B . n 
B 2 268 ALA 268 267 267 ALA ALA B . n 
B 2 269 SER 269 268 268 SER SER B . n 
B 2 270 GLN 270 269 269 GLN GLN B . n 
B 2 271 ILE 271 270 270 ILE ILE B . n 
B 2 272 TYR 272 271 271 TYR TYR B . n 
B 2 273 PRO 273 272 272 PRO PRO B . n 
B 2 274 GLY 274 273 273 GLY GLY B . n 
B 2 275 ILE 275 274 274 ILE ILE B . n 
B 2 276 LYS 276 275 275 LYS LYS B . n 
B 2 277 VAL 277 276 276 VAL VAL B . n 
B 2 278 ARG 278 277 277 ARG ARG B . n 
B 2 279 GLN 279 278 278 GLN GLN B . n 
B 2 280 LEU 280 279 279 LEU LEU B . n 
B 2 281 CYS 281 280 280 CYS CYS B . n 
B 2 282 LYS 282 281 281 LYS LYS B . n 
B 2 283 LEU 283 282 282 LEU LEU B . n 
B 2 284 LEU 284 283 283 LEU LEU B . n 
B 2 285 ARG 285 284 284 ARG ARG B . n 
B 2 286 GLY 286 285 285 GLY GLY B . n 
B 2 287 THR 287 286 286 THR THR B . n 
B 2 288 LYS 288 287 287 LYS LYS B . n 
B 2 289 ALA 289 288 288 ALA ALA B . n 
B 2 290 LEU 290 289 289 LEU LEU B . n 
B 2 291 THR 291 290 290 THR THR B . n 
B 2 292 GLU 292 291 291 GLU GLU B . n 
B 2 293 VAL 293 292 292 VAL VAL B . n 
B 2 294 ILE 294 293 293 ILE ILE B . n 
B 2 295 PRO 295 294 294 PRO PRO B . n 
B 2 296 LEU 296 295 295 LEU LEU B . n 
B 2 297 THR 297 296 296 THR THR B . n 
B 2 298 GLU 298 297 297 GLU GLU B . n 
B 2 299 GLU 299 298 298 GLU GLU B . n 
B 2 300 ALA 300 299 299 ALA ALA B . n 
B 2 301 GLU 301 300 300 GLU GLU B . n 
B 2 302 LEU 302 301 301 LEU LEU B . n 
B 2 303 GLU 303 302 302 GLU GLU B . n 
B 2 304 LEU 304 303 303 LEU LEU B . n 
B 2 305 ALA 305 304 304 ALA ALA B . n 
B 2 306 GLU 306 305 305 GLU GLU B . n 
B 2 307 ASN 307 306 306 ASN ASN B . n 
B 2 308 ARG 308 307 307 ARG ARG B . n 
B 2 309 GLU 309 308 308 GLU GLU B . n 
B 2 310 ILE 310 309 309 ILE ILE B . n 
B 2 311 LEU 311 310 310 LEU LEU B . n 
B 2 312 LYS 312 311 311 LYS LYS B . n 
B 2 313 GLU 313 312 312 GLU GLU B . n 
B 2 314 PRO 314 313 313 PRO PRO B . n 
B 2 315 VAL 315 314 314 VAL VAL B . n 
B 2 316 HIS 316 315 315 HIS HIS B . n 
B 2 317 GLY 317 316 316 GLY GLY B . n 
B 2 318 VAL 318 317 317 VAL VAL B . n 
B 2 319 TYR 319 318 318 TYR TYR B . n 
B 2 320 TYR 320 319 319 TYR TYR B . n 
B 2 321 ASP 321 320 320 ASP ASP B . n 
B 2 322 PRO 322 321 321 PRO PRO B . n 
B 2 323 SER 323 322 322 SER SER B . n 
B 2 324 LYS 324 323 323 LYS LYS B . n 
B 2 325 ASP 325 324 324 ASP ASP B . n 
B 2 326 LEU 326 325 325 LEU LEU B . n 
B 2 327 ILE 327 326 326 ILE ILE B . n 
B 2 328 ALA 328 327 327 ALA ALA B . n 
B 2 329 GLU 329 328 328 GLU GLU B . n 
B 2 330 ILE 330 329 329 ILE ILE B . n 
B 2 331 GLN 331 330 330 GLN GLN B . n 
B 2 332 LYS 332 331 331 LYS LYS B . n 
B 2 333 GLN 333 332 332 GLN GLN B . n 
B 2 334 GLY 334 333 333 GLY GLY B . n 
B 2 335 GLN 335 334 334 GLN GLN B . n 
B 2 336 GLY 336 335 335 GLY GLY B . n 
B 2 337 GLN 337 336 336 GLN GLN B . n 
B 2 338 TRP 338 337 337 TRP TRP B . n 
B 2 339 THR 339 338 338 THR THR B . n 
B 2 340 TYR 340 339 339 TYR TYR B . n 
B 2 341 GLN 341 340 340 GLN GLN B . n 
B 2 342 ILE 342 341 341 ILE ILE B . n 
B 2 343 TYR 343 342 342 TYR TYR B . n 
B 2 344 GLN 344 343 343 GLN GLN B . n 
B 2 345 GLU 345 344 344 GLU GLU B . n 
B 2 346 PRO 346 345 345 PRO PRO B . n 
B 2 347 PHE 347 346 346 PHE PHE B . n 
B 2 348 LYS 348 347 347 LYS LYS B . n 
B 2 349 ASN 349 348 348 ASN ASN B . n 
B 2 350 LEU 350 349 349 LEU LEU B . n 
B 2 351 LYS 351 350 350 LYS LYS B . n 
B 2 352 THR 352 351 351 THR THR B . n 
B 2 353 GLY 353 352 352 GLY GLY B . n 
B 2 354 LYS 354 353 353 LYS LYS B . n 
B 2 355 TYR 355 354 354 TYR TYR B . n 
B 2 356 ALA 356 355 355 ALA ALA B . n 
B 2 357 ARG 357 356 356 ARG ARG B . n 
B 2 358 MET 358 357 357 MET MET B . n 
B 2 359 ARG 359 358 358 ARG ARG B . n 
B 2 360 GLY 360 359 359 GLY GLY B . n 
B 2 361 ALA 361 360 360 ALA ALA B . n 
B 2 362 HIS 362 361 361 HIS HIS B . n 
B 2 363 THR 363 362 362 THR THR B . n 
B 2 364 ASN 364 363 363 ASN ASN B . n 
B 2 365 ASP 365 364 364 ASP ASP B . n 
B 2 366 VAL 366 365 365 VAL VAL B . n 
B 2 367 LYS 367 366 366 LYS LYS B . n 
B 2 368 GLN 368 367 367 GLN GLN B . n 
B 2 369 LEU 369 368 368 LEU LEU B . n 
B 2 370 THR 370 369 369 THR THR B . n 
B 2 371 GLU 371 370 370 GLU GLU B . n 
B 2 372 ALA 372 371 371 ALA ALA B . n 
B 2 373 VAL 373 372 372 VAL VAL B . n 
B 2 374 GLN 374 373 373 GLN GLN B . n 
B 2 375 LYS 375 374 374 LYS LYS B . n 
B 2 376 ILE 376 375 375 ILE ILE B . n 
B 2 377 THR 377 376 376 THR THR B . n 
B 2 378 THR 378 377 377 THR THR B . n 
B 2 379 GLU 379 378 378 GLU GLU B . n 
B 2 380 SER 380 379 379 SER SER B . n 
B 2 381 ILE 381 380 380 ILE ILE B . n 
B 2 382 VAL 382 381 381 VAL VAL B . n 
B 2 383 ILE 383 382 382 ILE ILE B . n 
B 2 384 TRP 384 383 383 TRP TRP B . n 
B 2 385 GLY 385 384 384 GLY GLY B . n 
B 2 386 LYS 386 385 385 LYS LYS B . n 
B 2 387 THR 387 386 386 THR THR B . n 
B 2 388 PRO 388 387 387 PRO PRO B . n 
B 2 389 LYS 389 388 388 LYS LYS B . n 
B 2 390 PHE 390 389 389 PHE PHE B . n 
B 2 391 LYS 391 390 390 LYS LYS B . n 
B 2 392 LEU 392 391 391 LEU LEU B . n 
B 2 393 PRO 393 392 392 PRO PRO B . n 
B 2 394 ILE 394 393 393 ILE ILE B . n 
B 2 395 GLN 395 394 394 GLN GLN B . n 
B 2 396 LYS 396 395 395 LYS LYS B . n 
B 2 397 GLU 397 396 396 GLU GLU B . n 
B 2 398 THR 398 397 397 THR THR B . n 
B 2 399 TRP 399 398 398 TRP TRP B . n 
B 2 400 GLU 400 399 399 GLU GLU B . n 
B 2 401 THR 401 400 400 THR THR B . n 
B 2 402 TRP 402 401 401 TRP TRP B . n 
B 2 403 TRP 403 402 402 TRP TRP B . n 
B 2 404 THR 404 403 403 THR THR B . n 
B 2 405 GLU 405 404 404 GLU GLU B . n 
B 2 406 TYR 406 405 405 TYR TYR B . n 
B 2 407 TRP 407 406 406 TRP TRP B . n 
B 2 408 GLN 408 407 407 GLN GLN B . n 
B 2 409 ALA 409 408 408 ALA ALA B . n 
B 2 410 THR 410 409 409 THR THR B . n 
B 2 411 TRP 411 410 410 TRP TRP B . n 
B 2 412 VAL 412 411 411 VAL VAL B . n 
B 2 413 PRO 413 412 412 PRO PRO B . n 
B 2 414 GLU 414 413 413 GLU GLU B . n 
B 2 415 TRP 415 414 414 TRP TRP B . n 
B 2 416 GLU 416 415 415 GLU GLU B . n 
B 2 417 PHE 417 416 416 PHE PHE B . n 
B 2 418 VAL 418 417 417 VAL VAL B . n 
B 2 419 ASN 419 418 418 ASN ASN B . n 
B 2 420 THR 420 419 419 THR THR B . n 
B 2 421 PRO 421 420 420 PRO PRO B . n 
B 2 422 PRO 422 421 421 PRO PRO B . n 
B 2 423 LEU 423 422 422 LEU LEU B . n 
B 2 424 VAL 424 423 423 VAL VAL B . n 
B 2 425 LYS 425 424 424 LYS LYS B . n 
B 2 426 LEU 426 425 425 LEU LEU B . n 
B 2 427 TRP 427 426 426 TRP TRP B . n 
B 2 428 TYR 428 427 427 TYR TYR B . n 
B 2 429 GLN 429 428 428 GLN GLN B . n 
B 2 430 LEU 430 429 429 LEU LEU B . n 
B 2 431 GLU 431 430 430 GLU GLU B . n 
B 2 432 LYS 432 431 431 LYS LYS B . n 
B 2 433 GLU 433 432 ?   ?   ?   B . n 
B 2 434 PRO 434 433 ?   ?   ?   B . n 
B 2 435 ILE 435 434 ?   ?   ?   B . n 
B 2 436 VAL 436 435 ?   ?   ?   B . n 
B 2 437 GLY 437 436 ?   ?   ?   B . n 
B 2 438 ALA 438 437 ?   ?   ?   B . n 
B 2 439 GLU 439 438 ?   ?   ?   B . n 
B 2 440 THR 440 439 ?   ?   ?   B . n 
B 2 441 PHE 441 440 ?   ?   ?   B . n 
C 3 1   DC  1   0   ?   ?   ?   D . n 
C 3 2   DG  2   1   ?   ?   ?   D . n 
C 3 3   DT  3   2   2   DT  DT  D . n 
C 3 4   DA  4   3   3   DA  DA  D . n 
C 3 5   DT  5   4   4   DT  DT  D . n 
C 3 6   DG  6   5   5   DG  DG  D . n 
C 3 7   DC  7   6   6   DC  DC  D . n 
C 3 8   DC  8   7   7   DC  DC  D . n 
C 3 9   DT  9   8   8   DT  DT  D . n 
C 3 10  DA  10  9   9   DA  DA  D . n 
C 3 11  DT  11  10  10  DT  DT  D . n 
C 3 12  DA  12  11  11  DA  DA  D . n 
C 3 13  DG  13  12  12  DG  DG  D . n 
C 3 14  DT  14  13  13  DT  DT  D . n 
C 3 15  DT  15  14  14  DT  DT  D . n 
C 3 16  DA  16  15  15  DA  DA  D . n 
C 3 17  DT  17  16  16  DT  DT  D . n 
C 3 18  DT  18  17  17  DT  DT  D . n 
C 3 19  DG  19  18  18  DG  DG  D . n 
C 3 20  DT  20  19  19  DT  DT  D . n 
C 3 21  DG  21  20  20  DG  DG  D . n 
C 3 22  DG  22  21  21  DG  DG  D . n 
C 3 23  DC  23  22  22  DC  DC  D . n 
C 3 24  DC  24  23  23  DC  DC  D . n 
D 4 1   A   1   1   ?   ?   ?   R . n 
D 4 2   U   2   2   ?   ?   ?   R . n 
D 4 3   G   3   3   ?   ?   ?   R . n 
D 4 4   A   4   4   4   A   A   R . n 
D 4 5   3DR 5   5   5   3DR 3DR R . n 
D 4 6   G   6   6   6   G   G   R . n 
D 4 7   G   7   7   7   G   G   R . n 
D 4 8   C   8   8   8   C   C   R . n 
D 4 9   C   9   9   9   C   C   R . n 
D 4 10  A   10  10  10  A   A   R . n 
D 4 11  C   11  11  11  C   C   R . n 
D 4 12  A   12  12  12  A   A   R . n 
D 4 13  A   13  13  13  A   A   R . n 
D 4 14  U   14  14  14  U   U   R . n 
D 4 15  A   15  15  15  A   A   R . n 
D 4 16  A   16  16  16  A   A   R . n 
D 4 17  C   17  17  17  C   C   R . n 
D 4 18  U   18  18  18  U   U   R . n 
D 4 19  A   19  19  19  A   A   R . n 
D 4 20  U   20  20  20  U   U   R . n 
D 4 21  A   21  21  21  A   A   R . n 
D 4 22  G   22  22  22  G   G   R . n 
D 4 23  G   23  23  23  G   G   R . n 
D 4 24  C   24  24  24  C   C   R . n 
D 4 25  A   25  25  25  A   A   R . n 
D 4 26  U   26  26  26  U   U   R . n 
D 4 27  A   27  27  27  A   A   R . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 EFZ 1 1557 1557 EFZ EFZ A . 
F 6 CA  1 100  100  CA  CA  D . 
G 6 CA  1 100  100  CA  CA  R . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12620 ? 
1 MORE         -68.4 ? 
1 'SSA (A^2)'  50960 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-01-16 
2 'Structure model' 1 1 2013-01-23 
3 'Structure model' 1 2 2013-02-20 
4 'Structure model' 1 3 2019-03-06 
5 'Structure model' 1 4 2019-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Database references'      
3 4 'Structure model' 'Data collection'          
4 4 'Structure model' 'Derived calculations'     
5 4 'Structure model' 'Experimental preparation' 
6 4 'Structure model' Other                      
7 5 'Structure model' 'Data collection'          
8 5 'Structure model' 'Experimental preparation' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow          
2 4 'Structure model' pdbx_database_proc          
3 4 'Structure model' pdbx_database_status        
4 4 'Structure model' pdbx_seq_map_depositor_info 
5 4 'Structure model' struct_conn                 
6 5 'Structure model' exptl_crystal_grow          
7 5 'Structure model' pdbx_seq_map_depositor_info 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                       
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval'      
3 4 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'              
5 5 'Structure model' '_exptl_crystal_grow.temp'                         
6 5 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
XSCALE 'data scaling'   .                 ? 3 
MOLREP phasing          .                 ? 4 
# 
_pdbx_entry_details.entry_id             4B3O 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;P66 MUTATIONS S68G, R83K, I411V, N477S, R461K, Y483H, V459I
P51 MUTATIONS S68G, R83K, I411V, N-TERMINAL G
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 6   ? ? 36.17   100.07  
2  1 GLU A 28  ? ? 74.39   -33.08  
3  1 PHE A 77  ? ? -95.23  36.57   
4  1 ASN A 137 ? ? 55.82   80.28   
5  1 PRO A 140 ? ? -23.37  -54.73  
6  1 MET A 184 ? ? 50.52   -103.17 
7  1 GLU A 248 ? ? -113.22 -112.59 
8  1 LYS A 249 ? ? -47.51  -71.69  
9  1 SER A 251 ? ? -50.93  106.16  
10 1 LYS A 287 ? ? 96.17   -117.29 
11 1 ALA A 288 ? ? -34.05  136.19  
12 1 VAL A 292 ? ? 54.83   71.65   
13 1 PHE A 346 ? ? 65.89   -6.59   
14 1 LYS A 353 ? ? -145.08 17.87   
15 1 TYR A 354 ? ? -31.90  115.00  
16 1 ALA A 355 ? ? -143.08 36.79   
17 1 ALA A 360 ? ? -90.85  -147.40 
18 1 HIS A 361 ? ? -131.54 -52.29  
19 1 THR A 362 ? ? 49.62   -151.72 
20 1 ASN A 363 ? ? -137.26 -146.37 
21 1 PRO A 392 ? ? -84.39  41.40   
22 1 THR A 450 ? ? 67.28   -18.13  
23 1 LYS A 451 ? ? 60.33   60.85   
24 1 ASP A 471 ? ? 53.58   70.40   
25 1 ASP A 511 ? ? -100.67 76.43   
26 1 GLU A 514 ? ? -77.39  37.81   
27 1 SER A 515 ? ? 65.80   99.87   
28 1 GLU A 516 ? ? 47.36   -72.08  
29 1 THR B 69  ? ? 63.81   -6.95   
30 1 MET B 184 ? ? 60.57   -119.89 
31 1 ALA B 355 ? ? -66.40  -80.72  
32 1 ALA B 360 ? ? 6.04    -118.40 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ILE 5   ? CG1 ? A ILE 5   CG1 
2   1 Y 1 A ILE 5   ? CG2 ? A ILE 5   CG2 
3   1 Y 1 A ILE 5   ? CD1 ? A ILE 5   CD1 
4   1 Y 1 A LYS 11  ? CG  ? A LYS 11  CG  
5   1 Y 1 A LYS 11  ? CD  ? A LYS 11  CD  
6   1 Y 1 A LYS 11  ? CE  ? A LYS 11  CE  
7   1 Y 1 A LYS 11  ? NZ  ? A LYS 11  NZ  
8   1 Y 1 A LYS 20  ? CG  ? A LYS 20  CG  
9   1 Y 1 A LYS 20  ? CD  ? A LYS 20  CD  
10  1 Y 1 A LYS 20  ? CE  ? A LYS 20  CE  
11  1 Y 1 A LYS 20  ? NZ  ? A LYS 20  NZ  
12  1 Y 1 A LYS 22  ? CG  ? A LYS 22  CG  
13  1 Y 1 A LYS 22  ? CD  ? A LYS 22  CD  
14  1 Y 1 A LYS 22  ? CE  ? A LYS 22  CE  
15  1 Y 1 A LYS 22  ? NZ  ? A LYS 22  NZ  
16  1 Y 1 A TRP 24  ? CG  ? A TRP 24  CG  
17  1 Y 1 A TRP 24  ? CD1 ? A TRP 24  CD1 
18  1 Y 1 A TRP 24  ? CD2 ? A TRP 24  CD2 
19  1 Y 1 A TRP 24  ? NE1 ? A TRP 24  NE1 
20  1 Y 1 A TRP 24  ? CE2 ? A TRP 24  CE2 
21  1 Y 1 A TRP 24  ? CE3 ? A TRP 24  CE3 
22  1 Y 1 A TRP 24  ? CZ2 ? A TRP 24  CZ2 
23  1 Y 1 A TRP 24  ? CZ3 ? A TRP 24  CZ3 
24  1 Y 1 A TRP 24  ? CH2 ? A TRP 24  CH2 
25  1 Y 1 A GLU 29  ? CG  ? A GLU 29  CG  
26  1 Y 1 A GLU 29  ? CD  ? A GLU 29  CD  
27  1 Y 1 A GLU 29  ? OE1 ? A GLU 29  OE1 
28  1 Y 1 A GLU 29  ? OE2 ? A GLU 29  OE2 
29  1 Y 1 A LYS 30  ? CG  ? A LYS 30  CG  
30  1 Y 1 A LYS 30  ? CD  ? A LYS 30  CD  
31  1 Y 1 A LYS 30  ? CE  ? A LYS 30  CE  
32  1 Y 1 A LYS 30  ? NZ  ? A LYS 30  NZ  
33  1 Y 1 A LYS 32  ? CG  ? A LYS 32  CG  
34  1 Y 1 A LYS 32  ? CD  ? A LYS 32  CD  
35  1 Y 1 A LYS 32  ? CE  ? A LYS 32  CE  
36  1 Y 1 A LYS 32  ? NZ  ? A LYS 32  NZ  
37  1 Y 1 A GLU 36  ? CG  ? A GLU 36  CG  
38  1 Y 1 A GLU 36  ? CD  ? A GLU 36  CD  
39  1 Y 1 A GLU 36  ? OE1 ? A GLU 36  OE1 
40  1 Y 1 A GLU 36  ? OE2 ? A GLU 36  OE2 
41  1 Y 1 A LYS 43  ? CG  ? A LYS 43  CG  
42  1 Y 1 A LYS 43  ? CD  ? A LYS 43  CD  
43  1 Y 1 A LYS 43  ? CE  ? A LYS 43  CE  
44  1 Y 1 A LYS 43  ? NZ  ? A LYS 43  NZ  
45  1 Y 1 A LYS 46  ? CG  ? A LYS 46  CG  
46  1 Y 1 A LYS 46  ? CD  ? A LYS 46  CD  
47  1 Y 1 A LYS 46  ? CE  ? A LYS 46  CE  
48  1 Y 1 A LYS 46  ? NZ  ? A LYS 46  NZ  
49  1 Y 1 A PHE 61  ? CG  ? A PHE 61  CG  
50  1 Y 1 A PHE 61  ? CD1 ? A PHE 61  CD1 
51  1 Y 1 A PHE 61  ? CD2 ? A PHE 61  CD2 
52  1 Y 1 A PHE 61  ? CE1 ? A PHE 61  CE1 
53  1 Y 1 A PHE 61  ? CE2 ? A PHE 61  CE2 
54  1 Y 1 A PHE 61  ? CZ  ? A PHE 61  CZ  
55  1 Y 1 A ARG 78  ? CG  ? A ARG 78  CG  
56  1 Y 1 A ARG 78  ? CD  ? A ARG 78  CD  
57  1 Y 1 A ARG 78  ? NE  ? A ARG 78  NE  
58  1 Y 1 A ARG 78  ? CZ  ? A ARG 78  CZ  
59  1 Y 1 A ARG 78  ? NH1 ? A ARG 78  NH1 
60  1 Y 1 A ARG 78  ? NH2 ? A ARG 78  NH2 
61  1 Y 1 A LYS 82  ? CG  ? A LYS 82  CG  
62  1 Y 1 A LYS 82  ? CD  ? A LYS 82  CD  
63  1 Y 1 A LYS 82  ? CE  ? A LYS 82  CE  
64  1 Y 1 A LYS 82  ? NZ  ? A LYS 82  NZ  
65  1 Y 1 A LYS 83  ? CG  ? A LYS 83  CG  
66  1 Y 1 A LYS 83  ? CD  ? A LYS 83  CD  
67  1 Y 1 A LYS 83  ? CE  ? A LYS 83  CE  
68  1 Y 1 A LYS 83  ? NZ  ? A LYS 83  NZ  
69  1 Y 1 A GLN 91  ? CG  ? A GLN 91  CG  
70  1 Y 1 A GLN 91  ? CD  ? A GLN 91  CD  
71  1 Y 1 A GLN 91  ? OE1 ? A GLN 91  OE1 
72  1 Y 1 A GLN 91  ? NE2 ? A GLN 91  NE2 
73  1 Y 1 A LEU 92  ? CG  ? A LEU 92  CG  
74  1 Y 1 A LEU 92  ? CD1 ? A LEU 92  CD1 
75  1 Y 1 A LEU 92  ? CD2 ? A LEU 92  CD2 
76  1 Y 1 A ASN 136 ? CG  ? A ASN 136 CG  
77  1 Y 1 A ASN 136 ? OD1 ? A ASN 136 OD1 
78  1 Y 1 A ASN 136 ? ND2 ? A ASN 136 ND2 
79  1 Y 1 A ASN 137 ? CG  ? A ASN 137 CG  
80  1 Y 1 A ASN 137 ? OD1 ? A ASN 137 OD1 
81  1 Y 1 A ASN 137 ? ND2 ? A ASN 137 ND2 
82  1 Y 1 A GLU 138 ? CG  ? A GLU 138 CG  
83  1 Y 1 A GLU 138 ? CD  ? A GLU 138 CD  
84  1 Y 1 A GLU 138 ? OE1 ? A GLU 138 OE1 
85  1 Y 1 A GLU 138 ? OE2 ? A GLU 138 OE2 
86  1 Y 1 A GLU 203 ? CG  ? A GLU 203 CG  
87  1 Y 1 A GLU 203 ? CD  ? A GLU 203 CD  
88  1 Y 1 A GLU 203 ? OE1 ? A GLU 203 OE1 
89  1 Y 1 A GLU 203 ? OE2 ? A GLU 203 OE2 
90  1 Y 1 A LYS 220 ? CG  ? A LYS 220 CG  
91  1 Y 1 A LYS 220 ? CD  ? A LYS 220 CD  
92  1 Y 1 A LYS 220 ? CE  ? A LYS 220 CE  
93  1 Y 1 A LYS 220 ? NZ  ? A LYS 220 NZ  
94  1 Y 1 A LYS 249 ? CG  ? A LYS 249 CG  
95  1 Y 1 A LYS 249 ? CD  ? A LYS 249 CD  
96  1 Y 1 A LYS 249 ? CE  ? A LYS 249 CE  
97  1 Y 1 A LYS 249 ? NZ  ? A LYS 249 NZ  
98  1 Y 1 A SER 251 ? OG  ? A SER 251 OG  
99  1 Y 1 A TRP 252 ? CG  ? A TRP 252 CG  
100 1 Y 1 A TRP 252 ? CD1 ? A TRP 252 CD1 
101 1 Y 1 A TRP 252 ? CD2 ? A TRP 252 CD2 
102 1 Y 1 A TRP 252 ? NE1 ? A TRP 252 NE1 
103 1 Y 1 A TRP 252 ? CE2 ? A TRP 252 CE2 
104 1 Y 1 A TRP 252 ? CE3 ? A TRP 252 CE3 
105 1 Y 1 A TRP 252 ? CZ2 ? A TRP 252 CZ2 
106 1 Y 1 A TRP 252 ? CZ3 ? A TRP 252 CZ3 
107 1 Y 1 A TRP 252 ? CH2 ? A TRP 252 CH2 
108 1 Y 1 A GLN 258 ? CG  ? A GLN 258 CG  
109 1 Y 1 A GLN 258 ? CD  ? A GLN 258 CD  
110 1 Y 1 A GLN 258 ? OE1 ? A GLN 258 OE1 
111 1 Y 1 A GLN 258 ? NE2 ? A GLN 258 NE2 
112 1 Y 1 A LYS 287 ? CG  ? A LYS 287 CG  
113 1 Y 1 A LYS 287 ? CD  ? A LYS 287 CD  
114 1 Y 1 A LYS 287 ? CE  ? A LYS 287 CE  
115 1 Y 1 A LYS 287 ? NZ  ? A LYS 287 NZ  
116 1 Y 1 A GLU 415 ? CG  ? A GLU 415 CG  
117 1 Y 1 A GLU 415 ? CD  ? A GLU 415 CD  
118 1 Y 1 A GLU 415 ? OE1 ? A GLU 415 OE1 
119 1 Y 1 A GLU 415 ? OE2 ? A GLU 415 OE2 
120 1 Y 1 A LYS 424 ? CG  ? A LYS 424 CG  
121 1 Y 1 A LYS 424 ? CD  ? A LYS 424 CD  
122 1 Y 1 A LYS 424 ? CE  ? A LYS 424 CE  
123 1 Y 1 A LYS 424 ? NZ  ? A LYS 424 NZ  
124 1 Y 1 A GLN 512 ? CG  ? A GLN 512 CG  
125 1 Y 1 A GLN 512 ? CD  ? A GLN 512 CD  
126 1 Y 1 A GLN 512 ? OE1 ? A GLN 512 OE1 
127 1 Y 1 A GLN 512 ? NE2 ? A GLN 512 NE2 
128 1 Y 1 A SER 515 ? OG  ? A SER 515 OG  
129 1 Y 1 B LYS 65  ? CG  ? B LYS 66  CG  
130 1 Y 1 B LYS 65  ? CD  ? B LYS 66  CD  
131 1 Y 1 B LYS 65  ? CE  ? B LYS 66  CE  
132 1 Y 1 B LYS 65  ? NZ  ? B LYS 66  NZ  
133 1 Y 1 B LYS 66  ? CG  ? B LYS 67  CG  
134 1 Y 1 B LYS 66  ? CD  ? B LYS 67  CD  
135 1 Y 1 B LYS 66  ? CE  ? B LYS 67  CE  
136 1 Y 1 B LYS 66  ? NZ  ? B LYS 67  NZ  
137 1 Y 1 B ASP 67  ? CG  ? B ASP 68  CG  
138 1 Y 1 B ASP 67  ? OD1 ? B ASP 68  OD1 
139 1 Y 1 B ASP 67  ? OD2 ? B ASP 68  OD2 
140 1 Y 1 B LYS 70  ? CG  ? B LYS 71  CG  
141 1 Y 1 B LYS 70  ? CD  ? B LYS 71  CD  
142 1 Y 1 B LYS 70  ? CE  ? B LYS 71  CE  
143 1 Y 1 B LYS 70  ? NZ  ? B LYS 71  NZ  
144 1 Y 1 B ARG 72  ? CB  ? B ARG 73  CB  
145 1 Y 1 B ARG 72  ? CG  ? B ARG 73  CG  
146 1 Y 1 B ARG 72  ? CD  ? B ARG 73  CD  
147 1 Y 1 B ARG 72  ? NE  ? B ARG 73  NE  
148 1 Y 1 B ARG 72  ? CZ  ? B ARG 73  CZ  
149 1 Y 1 B ARG 72  ? NH1 ? B ARG 73  NH1 
150 1 Y 1 B ARG 72  ? NH2 ? B ARG 73  NH2 
151 1 Y 1 B TRP 88  ? CG  ? B TRP 89  CG  
152 1 Y 1 B TRP 88  ? CD1 ? B TRP 89  CD1 
153 1 Y 1 B TRP 88  ? CD2 ? B TRP 89  CD2 
154 1 Y 1 B TRP 88  ? NE1 ? B TRP 89  NE1 
155 1 Y 1 B TRP 88  ? CE2 ? B TRP 89  CE2 
156 1 Y 1 B TRP 88  ? CE3 ? B TRP 89  CE3 
157 1 Y 1 B TRP 88  ? CZ2 ? B TRP 89  CZ2 
158 1 Y 1 B TRP 88  ? CZ3 ? B TRP 89  CZ3 
159 1 Y 1 B TRP 88  ? CH2 ? B TRP 89  CH2 
160 1 Y 1 B GLU 89  ? CG  ? B GLU 90  CG  
161 1 Y 1 B GLU 89  ? CD  ? B GLU 90  CD  
162 1 Y 1 B GLU 89  ? OE1 ? B GLU 90  OE1 
163 1 Y 1 B GLU 89  ? OE2 ? B GLU 90  OE2 
164 1 Y 1 B LYS 103 ? CG  ? B LYS 104 CG  
165 1 Y 1 B LYS 103 ? CD  ? B LYS 104 CD  
166 1 Y 1 B LYS 103 ? CE  ? B LYS 104 CE  
167 1 Y 1 B LYS 103 ? NZ  ? B LYS 104 NZ  
168 1 Y 1 B PHE 171 ? CG  ? B PHE 172 CG  
169 1 Y 1 B PHE 171 ? CD1 ? B PHE 172 CD1 
170 1 Y 1 B PHE 171 ? CD2 ? B PHE 172 CD2 
171 1 Y 1 B PHE 171 ? CE1 ? B PHE 172 CE1 
172 1 Y 1 B PHE 171 ? CE2 ? B PHE 172 CE2 
173 1 Y 1 B PHE 171 ? CZ  ? B PHE 172 CZ  
174 1 Y 1 B ARG 172 ? CG  ? B ARG 173 CG  
175 1 Y 1 B ARG 172 ? CD  ? B ARG 173 CD  
176 1 Y 1 B ARG 172 ? NE  ? B ARG 173 NE  
177 1 Y 1 B ARG 172 ? CZ  ? B ARG 173 CZ  
178 1 Y 1 B ARG 172 ? NH1 ? B ARG 173 NH1 
179 1 Y 1 B ARG 172 ? NH2 ? B ARG 173 NH2 
180 1 Y 1 B LYS 173 ? CG  ? B LYS 174 CG  
181 1 Y 1 B LYS 173 ? CD  ? B LYS 174 CD  
182 1 Y 1 B LYS 173 ? CE  ? B LYS 174 CE  
183 1 Y 1 B LYS 173 ? NZ  ? B LYS 174 NZ  
184 1 Y 1 B HIS 198 ? CG  ? B HIS 199 CG  
185 1 Y 1 B HIS 198 ? ND1 ? B HIS 199 ND1 
186 1 Y 1 B HIS 198 ? CD2 ? B HIS 199 CD2 
187 1 Y 1 B HIS 198 ? CE1 ? B HIS 199 CE1 
188 1 Y 1 B HIS 198 ? NE2 ? B HIS 199 NE2 
189 1 Y 1 B ARG 199 ? CG  ? B ARG 200 CG  
190 1 Y 1 B ARG 199 ? CD  ? B ARG 200 CD  
191 1 Y 1 B ARG 199 ? NE  ? B ARG 200 NE  
192 1 Y 1 B ARG 199 ? CZ  ? B ARG 200 CZ  
193 1 Y 1 B ARG 199 ? NH1 ? B ARG 200 NH1 
194 1 Y 1 B ARG 199 ? NH2 ? B ARG 200 NH2 
195 1 Y 1 B ARG 206 ? CG  ? B ARG 207 CG  
196 1 Y 1 B ARG 206 ? CD  ? B ARG 207 CD  
197 1 Y 1 B ARG 206 ? NE  ? B ARG 207 NE  
198 1 Y 1 B ARG 206 ? CZ  ? B ARG 207 CZ  
199 1 Y 1 B ARG 206 ? NH1 ? B ARG 207 NH1 
200 1 Y 1 B ARG 206 ? NH2 ? B ARG 207 NH2 
201 1 Y 1 B GLN 207 ? CG  ? B GLN 208 CG  
202 1 Y 1 B GLN 207 ? CD  ? B GLN 208 CD  
203 1 Y 1 B GLN 207 ? OE1 ? B GLN 208 OE1 
204 1 Y 1 B GLN 207 ? NE2 ? B GLN 208 NE2 
205 1 Y 1 B ARG 211 ? CG  ? B ARG 212 CG  
206 1 Y 1 B ARG 211 ? CD  ? B ARG 212 CD  
207 1 Y 1 B ARG 211 ? NE  ? B ARG 212 NE  
208 1 Y 1 B ARG 211 ? CZ  ? B ARG 212 CZ  
209 1 Y 1 B ARG 211 ? NH1 ? B ARG 212 NH1 
210 1 Y 1 B ARG 211 ? NH2 ? B ARG 212 NH2 
211 1 Y 1 B ARG 358 ? CG  ? B ARG 359 CG  
212 1 Y 1 B ARG 358 ? CD  ? B ARG 359 CD  
213 1 Y 1 B ARG 358 ? NE  ? B ARG 359 NE  
214 1 Y 1 B ARG 358 ? CZ  ? B ARG 359 CZ  
215 1 Y 1 B ARG 358 ? NH1 ? B ARG 359 NH1 
216 1 Y 1 B ARG 358 ? NH2 ? B ARG 359 NH2 
217 1 Y 1 B LYS 374 ? CG  ? B LYS 375 CG  
218 1 Y 1 B LYS 374 ? CD  ? B LYS 375 CD  
219 1 Y 1 B LYS 374 ? CE  ? B LYS 375 CE  
220 1 Y 1 B LYS 374 ? NZ  ? B LYS 375 NZ  
221 1 Y 1 B LYS 431 ? CG  ? B LYS 432 CG  
222 1 Y 1 B LYS 431 ? CD  ? B LYS 432 CD  
223 1 Y 1 B LYS 431 ? CE  ? B LYS 432 CE  
224 1 Y 1 B LYS 431 ? NZ  ? B LYS 432 NZ  
225 1 Y 1 D DT  2   ? P   ? C DT  3   P   
226 1 Y 1 D DT  2   ? OP1 ? C DT  3   OP1 
227 1 Y 1 D DT  2   ? OP2 ? C DT  3   OP2 
228 1 Y 1 R U   18  ? P   ? D U   18  P   
229 1 Y 1 R U   18  ? OP1 ? D U   18  OP1 
230 1 Y 1 R U   18  ? OP2 ? D U   18  OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 1   ? A PRO 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A ALA 62  ? A ALA 62  
5  1 Y 1 A ILE 63  ? A ILE 63  
6  1 Y 1 A LYS 64  ? A LYS 64  
7  1 Y 1 A LYS 65  ? A LYS 65  
8  1 Y 1 A LYS 66  ? A LYS 66  
9  1 Y 1 A ASP 67  ? A ASP 67  
10 1 Y 1 A GLY 68  ? A GLY 68  
11 1 Y 1 A THR 69  ? A THR 69  
12 1 Y 1 A LYS 70  ? A LYS 70  
13 1 Y 1 A TRP 71  ? A TRP 71  
14 1 Y 1 A ARG 72  ? A ARG 72  
15 1 Y 1 A LYS 73  ? A LYS 73  
16 1 Y 1 A LEU 74  ? A LEU 74  
17 1 Y 1 A ARG 557 ? A ARG 557 
18 1 Y 1 A LYS 558 ? A LYS 558 
19 1 Y 1 A ILE 559 ? A ILE 559 
20 1 Y 1 A LEU 560 ? A LEU 560 
21 1 Y 1 B GLY 0   ? B GLY 1   
22 1 Y 1 B PRO 1   ? B PRO 2   
23 1 Y 1 B ILE 2   ? B ILE 3   
24 1 Y 1 B SER 3   ? B SER 4   
25 1 Y 1 B PRO 4   ? B PRO 5   
26 1 Y 1 B ILE 5   ? B ILE 6   
27 1 Y 1 B GLU 6   ? B GLU 7   
28 1 Y 1 B THR 216 ? B THR 217 
29 1 Y 1 B PRO 217 ? B PRO 218 
30 1 Y 1 B ASP 218 ? B ASP 219 
31 1 Y 1 B LYS 219 ? B LYS 220 
32 1 Y 1 B LYS 220 ? B LYS 221 
33 1 Y 1 B HIS 221 ? B HIS 222 
34 1 Y 1 B GLN 222 ? B GLN 223 
35 1 Y 1 B LYS 223 ? B LYS 224 
36 1 Y 1 B GLU 224 ? B GLU 225 
37 1 Y 1 B PRO 225 ? B PRO 226 
38 1 Y 1 B PRO 226 ? B PRO 227 
39 1 Y 1 B PHE 227 ? B PHE 228 
40 1 Y 1 B LEU 228 ? B LEU 229 
41 1 Y 1 B TRP 229 ? B TRP 230 
42 1 Y 1 B MET 230 ? B MET 231 
43 1 Y 1 B GLU 432 ? B GLU 433 
44 1 Y 1 B PRO 433 ? B PRO 434 
45 1 Y 1 B ILE 434 ? B ILE 435 
46 1 Y 1 B VAL 435 ? B VAL 436 
47 1 Y 1 B GLY 436 ? B GLY 437 
48 1 Y 1 B ALA 437 ? B ALA 438 
49 1 Y 1 B GLU 438 ? B GLU 439 
50 1 Y 1 B THR 439 ? B THR 440 
51 1 Y 1 B PHE 440 ? B PHE 441 
52 1 Y 1 D DC  0   ? C DC  1   
53 1 Y 1 D DG  1   ? C DG  2   
54 1 Y 1 R A   1   ? D A   1   
55 1 Y 1 R U   2   ? D U   2   
56 1 Y 1 R G   3   ? D G   3   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4B3O 'double helix'        
4B3O 'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DT 3  1_555 D A 27 1_555 -1.031 -0.148 -0.904 6.311   -17.906 8.454  1  D_DT2:A27_R  D 2  ? R 27 ? 20 1 
1 C DA 4  1_555 D U 26 1_555 -0.049 0.040  -0.045 -11.968 -2.306  5.421  2  D_DA3:U26_R  D 3  ? R 26 ? 20 1 
1 C DT 5  1_555 D A 25 1_555 -0.368 0.003  -0.146 15.493  -1.488  2.950  3  D_DT4:A25_R  D 4  ? R 25 ? 20 1 
1 C DG 6  1_555 D C 24 1_555 0.699  -0.166 -0.262 9.213   -4.544  -1.197 4  D_DG5:C24_R  D 5  ? R 24 ? 19 1 
1 C DC 7  1_555 D G 23 1_555 0.612  -0.097 -0.491 11.884  -8.089  4.738  5  D_DC6:G23_R  D 6  ? R 23 ? 19 1 
1 C DC 8  1_555 D G 22 1_555 0.107  -0.068 -0.555 3.401   -0.754  3.157  6  D_DC7:G22_R  D 7  ? R 22 ? 19 1 
1 C DT 9  1_555 D A 21 1_555 -0.149 -0.063 -0.386 6.216   -6.133  6.284  7  D_DT8:A21_R  D 8  ? R 21 ? 20 1 
1 C DA 10 1_555 D U 20 1_555 0.104  -0.089 0.030  -2.418  -7.255  2.562  8  D_DA9:U20_R  D 9  ? R 20 ? 20 1 
1 C DT 11 1_555 D A 19 1_555 0.147  -0.125 -0.110 1.738   -8.484  -0.003 9  D_DT10:A19_R D 10 ? R 19 ? 20 1 
1 C DA 12 1_555 D U 18 1_555 -0.075 -0.154 -0.113 -6.687  -0.377  -5.566 10 D_DA11:U18_R D 11 ? R 18 ? 20 1 
1 C DG 13 1_555 D C 17 1_555 0.186  0.007  -0.207 -2.365  -6.305  1.025  11 D_DG12:C17_R D 12 ? R 17 ? 19 1 
1 C DT 14 1_555 D A 16 1_555 0.148  -0.131 0.091  2.293   -6.882  5.628  12 D_DT13:A16_R D 13 ? R 16 ? 20 1 
1 C DT 15 1_555 D A 15 1_555 0.056  -0.108 -0.561 13.400  -4.649  -5.161 13 D_DT14:A15_R D 14 ? R 15 ? 20 1 
1 C DA 16 1_555 D U 14 1_555 0.493  0.049  -0.254 -3.013  -5.305  -2.663 14 D_DA15:U14_R D 15 ? R 14 ? 20 1 
1 C DT 17 1_555 D A 13 1_555 -0.377 -0.168 -0.063 2.518   -11.584 0.773  15 D_DT16:A13_R D 16 ? R 13 ? 20 1 
1 C DT 18 1_555 D A 12 1_555 -0.176 -0.124 -0.514 8.386   -7.701  2.359  16 D_DT17:A12_R D 17 ? R 12 ? 20 1 
1 C DG 19 1_555 D C 11 1_555 0.047  -0.027 -0.301 -7.106  -2.646  1.525  17 D_DG18:C11_R D 18 ? R 11 ? 19 1 
1 C DT 20 1_555 D A 10 1_555 -0.142 -0.129 -0.288 5.226   -5.466  -2.973 18 D_DT19:A10_R D 19 ? R 10 ? 20 1 
1 C DG 21 1_555 D C 9  1_555 -0.357 -0.098 -0.442 -4.849  0.561   0.453  19 D_DG20:C9_R  D 20 ? R 9  ? 19 1 
1 C DG 22 1_555 D C 8  1_555 0.450  -0.070 -0.529 -5.609  -2.984  -2.211 20 D_DG21:C8_R  D 21 ? R 8  ? 19 1 
1 C DC 23 1_555 D G 7  1_555 0.799  -0.246 -0.417 1.683   -2.824  -3.325 21 D_DC22:G7_R  D 22 ? R 7  ? 19 1 
1 C DC 24 1_555 D G 6  1_555 -0.326 -0.011 -0.090 4.003   1.121   -1.653 22 D_DC23:G6_R  D 23 ? R 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DT 3  1_555 D A 27 1_555 C DA 4  1_555 D U 26 1_555 -1.308 -0.848 4.360 -10.568 5.712  38.924 -2.088 0.276  4.393 8.333   
15.417  40.667 1  DD_DT2DA3:U26A27_RR   D 2  ? R 27 ? D 3  ? R 26 ? 
1 C DA 4  1_555 D U 26 1_555 C DT 5  1_555 D A 25 1_555 -0.610 -0.926 2.784 0.941   5.913  26.728 -3.155 1.480  2.502 12.590  
-2.003  27.378 2  DD_DA3DT4:A25U26_RR   D 3  ? R 26 ? D 4  ? R 25 ? 
1 C DT 5  1_555 D A 25 1_555 C DG 6  1_555 D C 24 1_555 -0.613 -0.897 3.384 -3.053  10.604 37.873 -2.596 0.546  3.071 15.930  
4.587   39.391 3  DD_DT4DG5:C24A25_RR   D 4  ? R 25 ? D 5  ? R 24 ? 
1 C DG 6  1_555 D C 24 1_555 C DC 7  1_555 D G 23 1_555 0.663  -1.437 3.258 0.221   0.835  30.748 -2.871 -1.208 3.224 1.574   
-0.417  30.760 4  DD_DG5DC6:G23C24_RR   D 5  ? R 24 ? D 6  ? R 23 ? 
1 C DC 7  1_555 D G 23 1_555 C DC 8  1_555 D G 22 1_555 -0.353 -2.003 3.404 -0.309  12.450 25.610 -6.666 0.655  2.214 26.204  
0.650   28.432 5  DD_DC6DC7:G22G23_RR   D 6  ? R 23 ? D 7  ? R 22 ? 
1 C DC 8  1_555 D G 22 1_555 C DT 9  1_555 D A 21 1_555 -0.001 -1.444 3.279 0.861   6.912  26.854 -4.596 0.199  2.825 14.573  
-1.816  27.726 6  DD_DC7DT8:A21G22_RR   D 7  ? R 22 ? D 8  ? R 21 ? 
1 C DT 9  1_555 D A 21 1_555 C DA 10 1_555 D U 20 1_555 0.152  -1.240 3.349 -1.174  16.782 32.224 -4.203 -0.399 2.424 27.983  
1.958   36.247 7  DD_DT8DA9:U20A21_RR   D 8  ? R 21 ? D 9  ? R 20 ? 
1 C DA 10 1_555 D U 20 1_555 C DT 11 1_555 D A 19 1_555 -0.244 -1.260 3.172 1.091   2.310  34.574 -2.453 0.570  3.075 3.881   
-1.833  34.665 8  DD_DA9DT10:A19U20_RR  D 9  ? R 20 ? D 10 ? R 19 ? 
1 C DT 11 1_555 D A 19 1_555 C DA 12 1_555 D U 18 1_555 0.432  -1.488 3.346 2.165   9.079  33.126 -3.891 -0.403 2.872 15.544  
-3.707  34.381 9  DD_DT10DA11:U18A19_RR D 10 ? R 19 ? D 11 ? R 18 ? 
1 C DA 12 1_555 D U 18 1_555 C DG 13 1_555 D C 17 1_555 -1.260 -2.938 3.335 3.339   -3.548 5.389  -8.448 23.815 3.330 -30.693 
-28.877 7.264  10 DD_DA11DG12:C17U18_RR D 11 ? R 18 ? D 12 ? R 17 ? 
1 C DG 13 1_555 D C 17 1_555 C DT 14 1_555 D A 16 1_555 -0.131 -1.650 3.182 -2.654  -1.159 32.759 -2.719 -0.215 3.237 -2.050  
4.694   32.883 11 DD_DG12DT13:A16C17_RR D 12 ? R 17 ? D 13 ? R 16 ? 
1 C DT 14 1_555 D A 16 1_555 C DT 15 1_555 D A 15 1_555 -0.950 -1.247 2.925 4.648   6.668  32.174 -3.124 2.318  2.466 11.799  
-8.223  33.158 12 DD_DT13DT14:A15A16_RR D 13 ? R 16 ? D 14 ? R 15 ? 
1 C DT 15 1_555 D A 15 1_555 C DA 16 1_555 D U 14 1_555 -0.308 -1.618 3.643 -4.469  13.793 31.264 -4.941 -0.193 2.727 24.040  
7.789   34.386 13 DD_DT14DA15:U14A15_RR D 14 ? R 15 ? D 15 ? R 14 ? 
1 C DA 16 1_555 D U 14 1_555 C DT 17 1_555 D A 13 1_555 -0.054 -1.603 3.105 -2.635  0.226  29.362 -3.196 -0.427 3.085 0.444   
5.186   29.478 14 DD_DA15DT16:A13U14_RR D 15 ? R 14 ? D 16 ? R 13 ? 
1 C DT 17 1_555 D A 13 1_555 C DT 18 1_555 D A 12 1_555 0.269  -0.938 3.177 2.052   2.759  35.239 -1.934 -0.151 3.107 4.544   
-3.380  35.401 15 DD_DT16DT17:A12A13_RR D 16 ? R 13 ? D 17 ? R 12 ? 
1 C DT 18 1_555 D A 12 1_555 C DG 19 1_555 D C 11 1_555 -0.012 -1.423 3.653 -2.927  13.452 30.286 -4.817 -0.486 2.778 24.236  
5.273   33.202 16 DD_DT17DG18:C11A12_RR D 17 ? R 12 ? D 18 ? R 11 ? 
1 C DG 19 1_555 D C 11 1_555 C DT 20 1_555 D A 10 1_555 -0.630 -1.262 3.014 -0.891  4.663  30.972 -3.126 1.017  2.815 8.668   
1.656   31.325 17 DD_DG18DT19:A10C11_RR D 18 ? R 11 ? D 19 ? R 10 ? 
1 C DT 20 1_555 D A 10 1_555 C DG 21 1_555 D C 9  1_555 0.406  -1.349 3.375 -0.316  20.327 31.368 -4.599 -0.675 2.136 33.549  
0.522   37.240 18 DD_DT19DG20:C9A10_RR  D 19 ? R 10 ? D 20 ? R 9  ? 
1 C DG 21 1_555 D C 9  1_555 C DG 22 1_555 D C 8  1_555 0.582  -1.969 3.347 1.656   15.099 30.294 -5.568 -0.761 2.177 26.873  
-2.948  33.809 19 DD_DG20DG21:C8C9_RR   D 20 ? R 9  ? D 21 ? R 8  ? 
1 C DG 22 1_555 D C 8  1_555 C DC 23 1_555 D G 7  1_555 0.073  -1.789 3.187 0.894   2.344  33.682 -3.443 0.013  3.060 4.039   
-1.540  33.772 20 DD_DG21DC22:G7C8_RR   D 21 ? R 8  ? D 22 ? R 7  ? 
1 C DC 23 1_555 D G 7  1_555 C DC 24 1_555 D G 6  1_555 0.314  -1.235 3.584 3.127   -0.657 27.260 -2.424 0.190  3.625 -1.388  
-6.605  27.443 21 DD_DC22DC23:G6G7_RR   D 22 ? R 7  ? D 23 ? R 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 '(-)-6-CHLORO-4-CYCLOPROPYLETHYNYL-4-TRIFLUOROMETHYL-1,4-DIHYDRO-2H-3,1-BENZOXAZIN-2-ONE' EFZ 
6 'CALCIUM ION'                                                                             CA  
#