data_4B3Q
# 
_entry.id   4B3Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4B3Q         
PDBE  EBI-53439    
WWPDB D_1290053439 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A30 unspecified 'HIV-1 PROTEASE COMPLEXED WITH A TRIPEPTIDE INHIBITOR' 
PDB 1BV7 unspecified 
;COUNTERACTING HIV-1 PROTEASE DRUG RESISTANCE: STRUCTURAL ANALYSIS OF MUTANT PROTEASES COMPLEXED WITH XV638 AND SD146, CYCLIC UREA AMIDES WITH BROAD SPECIFICITIES
;
PDB 1BV9 unspecified 'HIV-1 PROTEASE (I84V) COMPLEXED WITH XV638 OF DUPONT PHARMACEUTICALS' 
PDB 1BVE unspecified 'HIV-1 PROTEASE-DMP323 COMPLEX IN SOLUTION, NMR, 28 STRUCTURES' 
PDB 1BVG unspecified 'HIV-1 PROTEASE-DMP323 COMPLEX IN SOLUTION, NMR MINIMIZED AVERAGE STRUCTURE' 
PDB 1BWA unspecified 'HIV-1 PROTEASE (V82F/I84V) DOUBLE MUTANT COMPLEXED WITH XV638 OF DUPONT PHARMACEUTICALS' 
PDB 1BWB unspecified 'HIV-1 PROTEASE (V82F/I84V) DOUBLE MUTANT COMPLEXED WITH SD146 OF DUPONT PHARMACEUTICALS' 
PDB 1C0T unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH BM+21.1326' 
PDB 1C0U unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH BM+50.0934' 
PDB 1C1B unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH GCA- 186' 
PDB 1C1C unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH TNK- 6123' 
PDB 1DMP unspecified 'STRUCTURE OF HIV-1 PROTEASE COMPLEX' 
PDB 1DTQ unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH PETT-1 (PETT131A94)' 
PDB 1DTT unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH PETT-2 (PETT130A94)' 
PDB 1E6J unspecified 'CRYSTAL STRUCTURE OF HIV-1 CAPSID PROTEIN (P24) IN COMPLEX WITH FAB13B5' 
PDB 1EP4 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH S-1153' 
PDB 1ESK unspecified 'SOLUTION STRUCTURE OF NCP7 FROM HIV-1' 
PDB 1EX4 unspecified 'HIV-1 INTEGRASE CATALYTIC CORE AND C-TERMINAL DOMAIN' 
PDB 1EXQ unspecified 'CRYSTAL STRUCTURE OF THE HIV-1 INTEGRASE CATALYTIC COREDOMAIN' 
PDB 1FB7 unspecified 
'CRYSTAL STRUCTURE OF AN IN VIVO HIV-1 PROTEASE MUTANT INCOMPLEX WITH SAQUINAVIR: INSIGHTS INTO THE MECHANISMS OFDRUG RESISTANCE' 
PDB 1FK9 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH DMP-266(EFAVIRENZ)' 
PDB 1FKO unspecified 
'CRYSTAL STRUCTURE OF NNRTI RESISTANT K103N MUTANT HIV- 1REVERSE TRANSCRIPTASE IN COMPLEX WITH DMP-266(EFAVIRENZ)' 
PDB 1FKP unspecified 'CRYSTAL STRUCTURE OF NNRTI RESISTANT K103N MUTANT HIV- 1REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1G6L unspecified '1.9A CRYSTAL STRUCTURE OF TETHERED HIV-1 PROTEASE' 
PDB 1HIV unspecified 'HIV-1 PROTEASE (HIV-1 PR) COMPLEX WITH U75875 (NOA- HIS-CHA-PSI[CH(OH)CH(OH)]VAL-ILE-APY)' 
PDB 1HVH unspecified 'NONPEPTIDE CYCLIC CYANOGUANIDINES AS HIV PROTEASE INHIBITORS' 
PDB 1HVR unspecified 'HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 (HIV-1) PROTEASE COMPLEXED WITH XK263 OF DUPONT MERCK' 
PDB 1HWR unspecified 'MOLECULAR RECOGNITION OF CYCLIC UREA HIV PROTEASE INHIBITORS' 
PDB 1HXB unspecified 'HIV-1 PROTEINASE COMPLEXED WITH RO 31-8959' 
PDB 1JKH unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH DMP-266(EFAVIRENZ)' 
PDB 1JLA unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH TNK-651' 
PDB 1JLB unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1JLC unspecified 'CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH PETT-2' 
PDB 1JLE unspecified 'CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSETRANSCRIPTASE' 
PDB 1JLF unspecified 'CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1JLG unspecified 'CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH UC-781' 
PDB 1JLQ unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH 739W94' 
PDB 1KLM unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH BHAP U- 90152' 
PDB 1LV1 unspecified 'CRYSTAL STRUCTURE ANALYSIS OF THE NON-ACTIVE SITE MUTANT OFTETHERED HIV-1 PROTEASE TO 2.1A RESOLUTION' 
PDB 1LW0 unspecified 'CRYSTAL STRUCTURE OF T215Y MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1LW2 unspecified 'CRYSTAL STRUCTURE OF T215Y MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH 1051U91' 
PDB 1LWC unspecified 'CRYSTAL STRUCTURE OF M184V MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1LWE unspecified 'CRYSTAL STRUCTURE OF M41L/T215Y MUTANT HIV-1 REVERSETRANSCRIPTASE (RTMN) IN COMPLEX WITH NEVIRAPINE' 
PDB 1LWF unspecified 
'CRYSTAL STRUCTURE OF A MUTANT HIV-1 REVERSE TRANSCRIPTASE(RTMQ+M184V: M41L/D67N/K70R/M184V/T215Y) IN COMPLEX WITHNEVIRAPINE' 
PDB 1NCP unspecified . 
PDB 1O1W unspecified 'SOLUTION STRUCTURE OF THE RNASE H DOMAIN OF THE HIV -1REVERSE TRANSCRIPTASE IN THE PRESENCE OF MAGNESIUM' 
PDB 1ODW unspecified 'NATIVE HIV-1 PROTEINASE' 
PDB 1ODY unspecified 'HIV-1 PROTEASE COMPLEXED WITH AN INHIBITOR LP-130' 
PDB 1QBR unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1QBS unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1QBT unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1QBU unspecified 'HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY' 
PDB 1REV unspecified 'HIV-1 REVERSE TRANSCRIPTASE' 
PDB 1RT1 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH MKC-442' 
PDB 1RT2 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH TNK-651' 
PDB 1RT3 unspecified 'AZT DRUG RESISTANT HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH 1051U91' 
PDB 1RT4 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC781' 
PDB 1RT5 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC10' 
PDB 1RT6 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC38' 
PDB 1RT7 unspecified 'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC84' 
PDB 1RTD unspecified 
'STRUCTURE OF A CATALYTIC COMPLEX OF HIV-1 REVERSE TRANSCRIPTASE: IMPLICATIONS FOR NUCLEOSIDE ANALOG DRUG RESISTANCE' 
PDB 1RTH unspecified . 
PDB 1RTI unspecified . 
PDB 1RTJ unspecified . 
PDB 1S1T unspecified 'CRYSTAL STRUCTURE OF L100I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH UC-781' 
PDB 1S1U unspecified 'CRYSTAL STRUCTURE OF L100I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1S1V unspecified 'CRYSTAL STRUCTURE OF L100I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH TNK-651' 
PDB 1S1W unspecified 'CRYSTAL STRUCTURE OF V106A MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH UC-781' 
PDB 1S1X unspecified 'CRYSTAL STRUCTURE OF V108I MUTANT HIV-1 REVERSETRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE' 
PDB 1T05 unspecified 
'HIV-1 REVERSE TRANSCRIPTASE CROSSLINKED TO TEMPLATE- PRIMERWITH TENOFOVIR-DIPHOSPHATE BOUND AS THE INCOMINGNUCLEOTIDE SUBSTRATE' 
PDB 1TAM unspecified 'HUMAN IMMUNODEFICIENCY VIRUS, NMR, MINIMIZED AVERAGE STRUCTURE' 
PDB 1TKT unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW426318' 
PDB 1TKX unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW490745' 
PDB 1TKZ unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW429576' 
PDB 1TL1 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW451211' 
PDB 1TL3 unspecified 'CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEXWITH GW450557' 
PDB 1VRT unspecified . 
PDB 1VRU unspecified . 
PDB 2WHH unspecified 'HIV-1 PROTEASE TETHERED DIMER Q-PRODUCT COMPLEX ALONG WITH NUCLEOPHILIC WATER MOLECULE' 
PDB 2WOM unspecified 'CRYSTAL STRUCTURE OF UK-453061 BOUND TO HIV-1 REVERSE TRANSCRIPTASE (K103N).' 
PDB 2WON unspecified 'CRYSTAL STRUCTURE OF UK-453061 BOUND TO HIV-1 REVERSE TRANSCRIPTASE (WILD-TYPE).' 
PDB 3PHV unspecified 'HIV-1 PROTEASE (ISOLATE HXB2)' 
PDB 4B37 unspecified 'STRUCTURES OF HIV-1 RT AND RNA-DNA COMPLEX REVEAL A UNIQUE RT CONFORMATION AND SUBSTRATE INTERFACE' 
PDB 4B3O unspecified 'STRUCTURES OF HIV-1 RT AND RNA-DNA COMPLEX REVEAL A UNIQUE RT CONFORMATION AND SUBSTRATE INTERFACE' 
PDB 4B3P unspecified 'STRUCTURES OF HIV-1 RT AND RNA-DNA COMPLEX REVEAL A UNIQUE RT CONFORMATION AND SUBSTRATE INTERFACE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4B3Q 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-25 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lapkouski, M.'    1 
'Tian, L.'         2 
'Miller, J.T.'     3 
'Le Grice, S.F.J.' 4 
'Yang, W.'         5 
# 
_citation.id                        primary 
_citation.title                     
'Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            20 
_citation.page_first                230 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23314251 
_citation.pdbx_database_id_DOI      10.1038/NSMB.2485 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lapkouski, M.'    1 ? 
primary 'Tian, L.'         2 ? 
primary 'Miller, J.T.'     3 ? 
primary 'Le Grice, S.F.J.' 4 ? 
primary 'Yang, W.'         5 ? 
# 
_cell.entry_id           4B3Q 
_cell.length_a           272.700 
_cell.length_b           272.700 
_cell.length_c           233.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4B3Q 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'REVERSE TRANSCRIPTASE/RIBONUCLEASE H'                                               64423.855 1 
'2.7.7.49, 2.7.7.7, 3.1.26.13, 3.1.13.2, 3.4.23.16' YES ? ? 
2 polymer     man 'P51 RT'                                                                             52973.785 1 ? YES ? ? 
3 polymer     syn 'PRIMER DNA'                                                                         7670.942  1 ? ?   ? ? 
4 polymer     syn 'TEMPLATE RNA'                                                                       10779.513 1 ? ?   ? ? 
5 non-polymer syn "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE" 266.298   1 ? ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'EXORIBONUCLEASE H, P66 RT, REVERSE TRANSCRIPTASE P66 SUBUNIT' 
2 'REVERSE TRANSCRIPTASE P51 SUBUNIT'                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFREL
NKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTNSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKIL
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFREL
NKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTNSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKIL
;
A ? 
2 'polypeptide(L)'        no no 
;MRGSHHHHHHGSQLPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKK
DGTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQY
NVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPP
FLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAEN
REILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKT
PKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;MRGSHHHHHHGSQLPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKK
DGTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQY
NVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPP
FLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAEN
REILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKT
PKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no no 
;(DT)(DC)(DG)(DT)(DA)(DT)(DG)(DC)(DC)(DT)(DA)(DT)(DA)(DG)(DT)(DT)(DA)(DT)(DT)(DG)
(DT)(DG)(DG)(DC)(DC)
;
TCGTATGCCTATAGTTATTGTGGCC D ? 
4 polyribonucleotide      no no AUGANGGCCACAAUAACUAUAGGCAUACGACCAC AUGANGGCCACAAUAACUAUAGGCAUACGACCAC R ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  GLY n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  LYS n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 ARG n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 GLN n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 CYS n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 VAL n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 SER n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 LYS n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 THR n 
1 469 LEU n 
1 470 THR n 
1 471 ASP n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 HIS n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASN n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 GLN n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
1 559 ILE n 
1 560 LEU n 
2 1   MET n 
2 2   ARG n 
2 3   GLY n 
2 4   SER n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  GLY n 
2 12  SER n 
2 13  GLN n 
2 14  LEU n 
2 15  PRO n 
2 16  ILE n 
2 17  SER n 
2 18  PRO n 
2 19  ILE n 
2 20  GLU n 
2 21  THR n 
2 22  VAL n 
2 23  PRO n 
2 24  VAL n 
2 25  LYS n 
2 26  LEU n 
2 27  LYS n 
2 28  PRO n 
2 29  GLY n 
2 30  MET n 
2 31  ASP n 
2 32  GLY n 
2 33  PRO n 
2 34  LYS n 
2 35  VAL n 
2 36  LYS n 
2 37  GLN n 
2 38  TRP n 
2 39  PRO n 
2 40  LEU n 
2 41  THR n 
2 42  GLU n 
2 43  GLU n 
2 44  LYS n 
2 45  ILE n 
2 46  LYS n 
2 47  ALA n 
2 48  LEU n 
2 49  VAL n 
2 50  GLU n 
2 51  ILE n 
2 52  CYS n 
2 53  THR n 
2 54  GLU n 
2 55  MET n 
2 56  GLU n 
2 57  LYS n 
2 58  GLU n 
2 59  GLY n 
2 60  LYS n 
2 61  ILE n 
2 62  SER n 
2 63  LYS n 
2 64  ILE n 
2 65  GLY n 
2 66  PRO n 
2 67  GLU n 
2 68  ASN n 
2 69  PRO n 
2 70  TYR n 
2 71  ASN n 
2 72  THR n 
2 73  PRO n 
2 74  VAL n 
2 75  PHE n 
2 76  ALA n 
2 77  ILE n 
2 78  LYS n 
2 79  LYS n 
2 80  LYS n 
2 81  ASP n 
2 82  GLY n 
2 83  THR n 
2 84  LYS n 
2 85  TRP n 
2 86  ARG n 
2 87  LYS n 
2 88  LEU n 
2 89  VAL n 
2 90  ASP n 
2 91  PHE n 
2 92  ARG n 
2 93  GLU n 
2 94  LEU n 
2 95  ASN n 
2 96  LYS n 
2 97  LYS n 
2 98  THR n 
2 99  GLN n 
2 100 ASP n 
2 101 PHE n 
2 102 TRP n 
2 103 GLU n 
2 104 VAL n 
2 105 GLN n 
2 106 LEU n 
2 107 GLY n 
2 108 ILE n 
2 109 PRO n 
2 110 HIS n 
2 111 PRO n 
2 112 ALA n 
2 113 GLY n 
2 114 LEU n 
2 115 LYS n 
2 116 LYS n 
2 117 LYS n 
2 118 LYS n 
2 119 SER n 
2 120 VAL n 
2 121 THR n 
2 122 VAL n 
2 123 LEU n 
2 124 ASP n 
2 125 VAL n 
2 126 GLY n 
2 127 ASP n 
2 128 ALA n 
2 129 TYR n 
2 130 PHE n 
2 131 SER n 
2 132 VAL n 
2 133 PRO n 
2 134 LEU n 
2 135 ASP n 
2 136 GLU n 
2 137 ASP n 
2 138 PHE n 
2 139 ARG n 
2 140 LYS n 
2 141 TYR n 
2 142 THR n 
2 143 ALA n 
2 144 PHE n 
2 145 THR n 
2 146 ILE n 
2 147 PRO n 
2 148 SER n 
2 149 ILE n 
2 150 ASN n 
2 151 ASN n 
2 152 GLU n 
2 153 THR n 
2 154 PRO n 
2 155 GLY n 
2 156 ILE n 
2 157 ARG n 
2 158 TYR n 
2 159 GLN n 
2 160 TYR n 
2 161 ASN n 
2 162 VAL n 
2 163 LEU n 
2 164 PRO n 
2 165 GLN n 
2 166 GLY n 
2 167 TRP n 
2 168 LYS n 
2 169 GLY n 
2 170 SER n 
2 171 PRO n 
2 172 ALA n 
2 173 ILE n 
2 174 PHE n 
2 175 GLN n 
2 176 SER n 
2 177 SER n 
2 178 MET n 
2 179 THR n 
2 180 LYS n 
2 181 ILE n 
2 182 LEU n 
2 183 GLU n 
2 184 PRO n 
2 185 PHE n 
2 186 ARG n 
2 187 LYS n 
2 188 GLN n 
2 189 ASN n 
2 190 PRO n 
2 191 ASP n 
2 192 ILE n 
2 193 VAL n 
2 194 ILE n 
2 195 TYR n 
2 196 GLN n 
2 197 TYR n 
2 198 MET n 
2 199 ASP n 
2 200 ASP n 
2 201 LEU n 
2 202 TYR n 
2 203 VAL n 
2 204 GLY n 
2 205 SER n 
2 206 ASP n 
2 207 LEU n 
2 208 GLU n 
2 209 ILE n 
2 210 GLY n 
2 211 GLN n 
2 212 HIS n 
2 213 ARG n 
2 214 THR n 
2 215 LYS n 
2 216 ILE n 
2 217 GLU n 
2 218 GLU n 
2 219 LEU n 
2 220 ARG n 
2 221 GLN n 
2 222 HIS n 
2 223 LEU n 
2 224 LEU n 
2 225 ARG n 
2 226 TRP n 
2 227 GLY n 
2 228 LEU n 
2 229 THR n 
2 230 THR n 
2 231 PRO n 
2 232 ASP n 
2 233 LYS n 
2 234 LYS n 
2 235 HIS n 
2 236 GLN n 
2 237 LYS n 
2 238 GLU n 
2 239 PRO n 
2 240 PRO n 
2 241 PHE n 
2 242 LEU n 
2 243 TRP n 
2 244 MET n 
2 245 GLY n 
2 246 TYR n 
2 247 GLU n 
2 248 LEU n 
2 249 HIS n 
2 250 PRO n 
2 251 ASP n 
2 252 LYS n 
2 253 TRP n 
2 254 THR n 
2 255 VAL n 
2 256 GLN n 
2 257 PRO n 
2 258 ILE n 
2 259 VAL n 
2 260 LEU n 
2 261 PRO n 
2 262 GLU n 
2 263 LYS n 
2 264 ASP n 
2 265 SER n 
2 266 TRP n 
2 267 THR n 
2 268 VAL n 
2 269 ASN n 
2 270 ASP n 
2 271 ILE n 
2 272 GLN n 
2 273 LYS n 
2 274 LEU n 
2 275 VAL n 
2 276 GLY n 
2 277 LYS n 
2 278 LEU n 
2 279 ASN n 
2 280 TRP n 
2 281 ALA n 
2 282 SER n 
2 283 GLN n 
2 284 ILE n 
2 285 TYR n 
2 286 PRO n 
2 287 GLY n 
2 288 ILE n 
2 289 LYS n 
2 290 VAL n 
2 291 ARG n 
2 292 GLN n 
2 293 LEU n 
2 294 CYS n 
2 295 LYS n 
2 296 LEU n 
2 297 LEU n 
2 298 ARG n 
2 299 GLY n 
2 300 THR n 
2 301 LYS n 
2 302 ALA n 
2 303 LEU n 
2 304 THR n 
2 305 GLU n 
2 306 VAL n 
2 307 ILE n 
2 308 PRO n 
2 309 LEU n 
2 310 THR n 
2 311 GLU n 
2 312 GLU n 
2 313 ALA n 
2 314 GLU n 
2 315 LEU n 
2 316 GLU n 
2 317 LEU n 
2 318 ALA n 
2 319 GLU n 
2 320 ASN n 
2 321 ARG n 
2 322 GLU n 
2 323 ILE n 
2 324 LEU n 
2 325 LYS n 
2 326 GLU n 
2 327 PRO n 
2 328 VAL n 
2 329 HIS n 
2 330 GLY n 
2 331 VAL n 
2 332 TYR n 
2 333 TYR n 
2 334 ASP n 
2 335 PRO n 
2 336 SER n 
2 337 LYS n 
2 338 ASP n 
2 339 LEU n 
2 340 ILE n 
2 341 ALA n 
2 342 GLU n 
2 343 ILE n 
2 344 GLN n 
2 345 LYS n 
2 346 GLN n 
2 347 GLY n 
2 348 GLN n 
2 349 GLY n 
2 350 GLN n 
2 351 TRP n 
2 352 THR n 
2 353 TYR n 
2 354 GLN n 
2 355 ILE n 
2 356 TYR n 
2 357 GLN n 
2 358 GLU n 
2 359 PRO n 
2 360 PHE n 
2 361 LYS n 
2 362 ASN n 
2 363 LEU n 
2 364 LYS n 
2 365 THR n 
2 366 GLY n 
2 367 LYS n 
2 368 TYR n 
2 369 ALA n 
2 370 ARG n 
2 371 MET n 
2 372 ARG n 
2 373 GLY n 
2 374 ALA n 
2 375 HIS n 
2 376 THR n 
2 377 ASN n 
2 378 ASP n 
2 379 VAL n 
2 380 LYS n 
2 381 GLN n 
2 382 LEU n 
2 383 THR n 
2 384 GLU n 
2 385 ALA n 
2 386 VAL n 
2 387 GLN n 
2 388 LYS n 
2 389 ILE n 
2 390 THR n 
2 391 THR n 
2 392 GLU n 
2 393 SER n 
2 394 ILE n 
2 395 VAL n 
2 396 ILE n 
2 397 TRP n 
2 398 GLY n 
2 399 LYS n 
2 400 THR n 
2 401 PRO n 
2 402 LYS n 
2 403 PHE n 
2 404 LYS n 
2 405 LEU n 
2 406 PRO n 
2 407 ILE n 
2 408 GLN n 
2 409 LYS n 
2 410 GLU n 
2 411 THR n 
2 412 TRP n 
2 413 GLU n 
2 414 THR n 
2 415 TRP n 
2 416 TRP n 
2 417 THR n 
2 418 GLU n 
2 419 TYR n 
2 420 TRP n 
2 421 GLN n 
2 422 ALA n 
2 423 THR n 
2 424 TRP n 
2 425 VAL n 
2 426 PRO n 
2 427 GLU n 
2 428 TRP n 
2 429 GLU n 
2 430 PHE n 
2 431 VAL n 
2 432 ASN n 
2 433 THR n 
2 434 PRO n 
2 435 PRO n 
2 436 LEU n 
2 437 VAL n 
2 438 LYS n 
2 439 LEU n 
2 440 TRP n 
2 441 TYR n 
2 442 GLN n 
2 443 LEU n 
2 444 GLU n 
2 445 LYS n 
2 446 GLU n 
2 447 PRO n 
2 448 ILE n 
2 449 VAL n 
2 450 GLY n 
2 451 ALA n 
2 452 GLU n 
2 453 THR n 
2 454 PHE n 
3 1   DT  n 
3 2   DC  n 
3 3   DG  n 
3 4   DT  n 
3 5   DA  n 
3 6   DT  n 
3 7   DG  n 
3 8   DC  n 
3 9   DC  n 
3 10  DT  n 
3 11  DA  n 
3 12  DT  n 
3 13  DA  n 
3 14  DG  n 
3 15  DT  n 
3 16  DT  n 
3 17  DA  n 
3 18  DT  n 
3 19  DT  n 
3 20  DG  n 
3 21  DT  n 
3 22  DG  n 
3 23  DG  n 
3 24  DC  n 
3 25  DC  n 
4 1   A   n 
4 2   U   n 
4 3   G   n 
4 4   A   n 
4 5   N   n 
4 6   G   n 
4 7   G   n 
4 8   C   n 
4 9   C   n 
4 10  A   n 
4 11  C   n 
4 12  A   n 
4 13  A   n 
4 14  U   n 
4 15  A   n 
4 16  A   n 
4 17  C   n 
4 18  U   n 
4 19  A   n 
4 20  U   n 
4 21  A   n 
4 22  G   n 
4 23  G   n 
4 24  C   n 
4 25  A   n 
4 26  U   n 
4 27  A   n 
4 28  C   n 
4 29  G   n 
4 30  A   n 
4 31  C   n 
4 32  C   n 
4 33  A   n 
4 34  C   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'HUMAN IMMUNODEFICIENCY VIRUS 1' 11676 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 1007065 ? ? ? ? ? ? 
M15 ? ? ? ? ? ? ? PLASMID PDMI.1 ? ? ? ? ? 
2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'HUMAN IMMUNODEFICIENCY VIRUS 1' 11676 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 1007065 ? ? ? ? ? ? 
M15 ? ? ? ? ? ? ? PLASMID PDMI.1 ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
4 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP POL_HV1H2 1 ? ? P04585 ? 
2 UNP POL_HV1H2 2 ? ? P04585 ? 
3 PDB 4B3Q      3 ? ? 4B3Q   ? 
4 PDB 4B3Q      4 ? ? 4B3Q   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4B3Q A 1  ? 560 ? P04585 588 ? 1147 ? 1  560 
2 2 4B3Q B 15 ? 454 ? P04585 588 ? 1027 ? 1  440 
3 3 4B3Q D 1  ? 25  ? 4B3Q   -1  ? 23   ? -1 23  
4 4 4B3Q R 1  ? 34  ? 4B3Q   1   ? 34   ? 1  34  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4B3Q GLY A 68  ? UNP P04585 SER 655  'engineered mutation' 68  1  
1 4B3Q LYS A 83  ? UNP P04585 ARG 670  'engineered mutation' 83  2  
1 4B3Q VAL A 411 ? UNP P04585 ILE 998  'engineered mutation' 411 3  
1 4B3Q SER A 447 ? UNP P04585 ASN 1034 'engineered mutation' 447 4  
1 4B3Q LYS A 461 ? UNP P04585 ARG 1048 'engineered mutation' 461 5  
1 4B3Q HIS A 483 ? UNP P04585 TYR 1070 'engineered mutation' 483 6  
1 4B3Q ILE A 559 ? UNP P04585 VAL 1146 'engineered mutation' 559 7  
2 4B3Q MET B 1   ? UNP P04585 ?   ?    'expression tag'      -13 8  
2 4B3Q ARG B 2   ? UNP P04585 ?   ?    'expression tag'      -12 9  
2 4B3Q GLY B 3   ? UNP P04585 ?   ?    'expression tag'      -11 10 
2 4B3Q SER B 4   ? UNP P04585 ?   ?    'expression tag'      -10 11 
2 4B3Q HIS B 5   ? UNP P04585 ?   ?    'expression tag'      -9  12 
2 4B3Q HIS B 6   ? UNP P04585 ?   ?    'expression tag'      -8  13 
2 4B3Q HIS B 7   ? UNP P04585 ?   ?    'expression tag'      -7  14 
2 4B3Q HIS B 8   ? UNP P04585 ?   ?    'expression tag'      -6  15 
2 4B3Q HIS B 9   ? UNP P04585 ?   ?    'expression tag'      -5  16 
2 4B3Q HIS B 10  ? UNP P04585 ?   ?    'expression tag'      -4  17 
2 4B3Q GLY B 11  ? UNP P04585 ?   ?    'expression tag'      -3  18 
2 4B3Q SER B 12  ? UNP P04585 ?   ?    'expression tag'      -2  19 
2 4B3Q GLN B 13  ? UNP P04585 ?   ?    'expression tag'      -1  20 
2 4B3Q LEU B 14  ? UNP P04585 ?   ?    'expression tag'      0   21 
2 4B3Q GLY B 82  ? UNP P04585 SER 655  'engineered mutation' 68  22 
2 4B3Q LYS B 97  ? UNP P04585 ARG 670  'engineered mutation' 83  23 
2 4B3Q VAL B 425 ? UNP P04585 ILE 998  'engineered mutation' 411 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                                                         ? 'C10 H14 N5 O7 P' 
347.221 
ALA 'L-peptide linking' y ALANINE                                                                              ? 'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking' y ARGININE                                                                             ? 'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                           ? 'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                      ? 'C4 H7 N O4'      
133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                                                          ? 'C9 H14 N3 O8 P'  
323.197 
CYS 'L-peptide linking' y CYSTEINE                                                                             ? 'C3 H7 N O2 S'    
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                 ? 'C10 H14 N5 O6 P' 
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                  ? 'C9 H14 N3 O7 P'  
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                 ? 'C10 H14 N5 O7 P' 
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                         ? 'C10 H15 N2 O8 P' 
322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                                                         ? 'C10 H14 N5 O8 P' 
363.221 
GLN 'L-peptide linking' y GLUTAMINE                                                                            ? 'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                      ? 'C5 H9 N O4'      
147.129 
GLY 'peptide linking'   y GLYCINE                                                                              ? 'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                            ? 'C6 H10 N3 O2 1'  
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                           ? 'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                              ? 'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking' y LYSINE                                                                               ? 'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking' y METHIONINE                                                                           ? 'C5 H11 N O2 S'   
149.211 
N   'RNA linking'       . 
;ANY 5'-MONOPHOSPHATE NUCLEOTIDE
;
"1-DEOXY-RIBOFURANOSE-5'-PHOSPHATE"      'C5 H11 O7 P'     214.110 
NVP non-polymer         . "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE" 
'NON-NUCLEOSIDE RT INHIBITOR NEVIRAPINE' 'C15 H14 N4 O'    266.298 
PHE 'L-peptide linking' y PHENYLALANINE                                                                        ? 'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking' y PROLINE                                                                              ? 'C5 H9 N O2'      
115.130 
SER 'L-peptide linking' y SERINE                                                                               ? 'C3 H7 N O3'      
105.093 
THR 'L-peptide linking' y THREONINE                                                                            ? 'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                           ? 'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                             ? 'C9 H11 N O3'     
181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                                                           ? 'C9 H13 N2 O9 P'  
324.181 
VAL 'L-peptide linking' y VALINE                                                                               ? 'C5 H11 N O2'     
117.146 
# 
_exptl.entry_id          4B3Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      6 
_exptl_crystal.density_percent_sol   82 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'RT COMPLEX WAS MIXED WITH RESERVOIR SOLUTION CONTAINING 1.8M (NH4)2SO4, 50MM TRIS HCL (PH8.5), AND 25MM MGSO4. VAPOR DIFFUSION 4C.' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARRESEARCH MAR300' 
_diffrn_detector.pdbx_collection_date   2011-07-09 
_diffrn_detector.details                'ADJUSTABLE FOCUS K-B PAIR SI MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL CRYO-COOLED SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_wavelength             1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4B3Q 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             60.00 
_reflns.d_resolution_high            5.00 
_reflns.number_obs                   14646 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.14 
_reflns.pdbx_netI_over_sigmaI        14.80 
_reflns.B_iso_Wilson_estimate        170.34 
_reflns.pdbx_redundancy              6.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             5.00 
_reflns_shell.d_res_low              5.09 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.87 
_reflns_shell.meanI_over_sigI_obs    1.70 
_reflns_shell.pdbx_redundancy        6.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4B3Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     13005 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.987 
_refine.ls_d_res_high                            5.000 
_refine.ls_percent_reflns_obs                    89.81 
_refine.ls_R_factor_obs                          0.3632 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.3610 
_refine.ls_R_factor_R_free                       0.4073 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  662 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               149 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRIES 1RTD, 1FK9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            1.13 
_refine.pdbx_overall_phase_error                 49.26 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7535 
_refine_hist.pdbx_number_atoms_nucleic_acid   878 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8433 
_refine_hist.d_res_high                       5.000 
_refine_hist.d_res_low                        29.987 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 8737  'X-RAY DIFFRACTION' ? 
f_angle_d          0.802  ? ? 12103 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.780 ? ? 3303  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.054  ? ? 1370  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1384  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 5.0003 5.3844  2161 0.4427 80.00 0.4691 . . 128 . . 
'X-RAY DIFFRACTION' . 5.3844 5.9225  2327 0.4300 85.00 0.4145 . . 115 . . 
'X-RAY DIFFRACTION' . 5.9225 6.7709  2435 0.4222 90.00 0.4532 . . 152 . . 
'X-RAY DIFFRACTION' . 6.7709 8.4983  2648 0.3810 96.00 0.3910 . . 135 . . 
'X-RAY DIFFRACTION' . 8.4983 29.9871 2772 0.3050 98.00 0.3815 . . 132 . . 
# 
_struct.entry_id                  4B3Q 
_struct.title                     
'Structures of HIV-1 RT and RNA-DNA Complex Reveal a Unique RT Conformation and Substrate Interface' 
_struct.pdbx_descriptor           
'REVERSE TRANSCRIPTASE/RIBONUCLEASE H (E.C.2.7.7.49, 2.7.7.7, 3.1.26.13, 3.1.13.2, 3.4.23.16), P51 RT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4B3Q 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA/RNA 
_struct_keywords.text            'HYDROLASE-DNA-RNA COMPLEX, RNASE H, HYBRID' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 30  ? GLY A 45  ? LYS A 30  GLY A 45  1 ? 16 
HELX_P HELX_P2  2  PHE A 77  ? THR A 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  3  ASP A 113 ? VAL A 118 ? ASP A 113 VAL A 118 1 ? 6  
HELX_P HELX_P4  4  ASP A 121 ? LYS A 126 ? ASP A 121 LYS A 126 1 ? 6  
HELX_P HELX_P5  5  GLY A 155 ? LEU A 168 ? GLY A 155 LEU A 168 1 ? 14 
HELX_P HELX_P6  6  LEU A 168 ? ASN A 175 ? LEU A 168 ASN A 175 1 ? 8  
HELX_P HELX_P7  7  GLU A 194 ? ARG A 211 ? GLU A 194 ARG A 211 1 ? 18 
HELX_P HELX_P8  8  VAL A 254 ? SER A 268 ? VAL A 254 SER A 268 1 ? 15 
HELX_P HELX_P9  9  VAL A 276 ? LYS A 281 ? VAL A 276 LYS A 281 1 ? 6  
HELX_P HELX_P10 10 LEU A 282 ? GLY A 285 ? LEU A 282 GLY A 285 5 ? 4  
HELX_P HELX_P11 11 THR A 296 ? GLU A 312 ? THR A 296 GLU A 312 1 ? 17 
HELX_P HELX_P12 12 ASN A 363 ? ILE A 382 ? ASN A 363 ILE A 382 1 ? 20 
HELX_P HELX_P13 13 GLN A 394 ? TYR A 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 14 THR A 473 ? ASP A 488 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P15 15 SER A 499 ? ALA A 508 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 16 LEU A 517 ? LYS A 528 ? LEU A 517 LYS A 528 1 ? 12 
HELX_P HELX_P17 17 ASN A 545 ? SER A 553 ? ASN A 545 SER A 553 1 ? 9  
HELX_P HELX_P18 18 THR B 41  ? GLY B 59  ? THR B 27  GLY B 45  1 ? 19 
HELX_P HELX_P19 19 PHE B 91  ? LYS B 96  ? PHE B 77  LYS B 82  1 ? 6  
HELX_P HELX_P20 20 ASP B 100 ? LEU B 106 ? ASP B 86  LEU B 92  1 ? 7  
HELX_P HELX_P21 21 GLY B 126 ? SER B 131 ? GLY B 112 SER B 117 5 ? 6  
HELX_P HELX_P22 22 PHE B 138 ? ALA B 143 ? PHE B 124 ALA B 129 5 ? 6  
HELX_P HELX_P23 23 SER B 148 ? GLU B 152 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P24 24 GLY B 169 ? ASN B 189 ? GLY B 155 ASN B 175 1 ? 21 
HELX_P HELX_P25 25 GLU B 208 ? GLY B 227 ? GLU B 194 GLY B 213 1 ? 20 
HELX_P HELX_P26 26 THR B 267 ? ALA B 281 ? THR B 253 ALA B 267 1 ? 15 
HELX_P HELX_P27 27 VAL B 290 ? LYS B 295 ? VAL B 276 LYS B 281 1 ? 6  
HELX_P HELX_P28 28 THR B 310 ? GLU B 326 ? THR B 296 GLU B 312 1 ? 17 
HELX_P HELX_P29 29 VAL B 379 ? TRP B 397 ? VAL B 365 TRP B 383 1 ? 19 
HELX_P HELX_P30 30 GLN B 408 ? TRP B 416 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P31 31 PRO B 434 ? LEU B 439 ? PRO B 420 LEU B 425 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DA 5  N1 ? ? ? 1_555 D U 26 N3 ? ? D DA 3  R U 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C DA 5  N6 ? ? ? 1_555 D U 26 O4 ? ? D DA 3  R U 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C DT 6  N3 ? ? ? 1_555 D A 25 N1 ? ? D DT 4  R A 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C DT 6  O4 ? ? ? 1_555 D A 25 N6 ? ? D DT 4  R A 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C DG 7  N1 ? ? ? 1_555 D C 24 N3 ? ? D DG 5  R C 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C DG 7  N2 ? ? ? 1_555 D C 24 O2 ? ? D DG 5  R C 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C DG 7  O6 ? ? ? 1_555 D C 24 N4 ? ? D DG 5  R C 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C DC 8  N3 ? ? ? 1_555 D G 23 N1 ? ? D DC 6  R G 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C DC 8  N4 ? ? ? 1_555 D G 23 O6 ? ? D DC 6  R G 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C DC 8  O2 ? ? ? 1_555 D G 23 N2 ? ? D DC 6  R G 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C DC 9  N3 ? ? ? 1_555 D G 22 N1 ? ? D DC 7  R G 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C DC 9  N4 ? ? ? 1_555 D G 22 O6 ? ? D DC 7  R G 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C DC 9  O2 ? ? ? 1_555 D G 22 N2 ? ? D DC 7  R G 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C DT 10 N3 ? ? ? 1_555 D A 21 N1 ? ? D DT 8  R A 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C DT 10 O4 ? ? ? 1_555 D A 21 N6 ? ? D DT 8  R A 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C DA 11 N1 ? ? ? 1_555 D U 20 N3 ? ? D DA 9  R U 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C DA 11 N6 ? ? ? 1_555 D U 20 O4 ? ? D DA 9  R U 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D A 19 N1 ? ? D DT 10 R A 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D A 19 N6 ? ? D DT 10 R A 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C DA 13 N1 ? ? ? 1_555 D U 18 N3 ? ? D DA 11 R U 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DA 13 N6 ? ? ? 1_555 D U 18 O4 ? ? D DA 11 R U 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C DG 14 N1 ? ? ? 1_555 D C 17 N3 ? ? D DG 12 R C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DG 14 N2 ? ? ? 1_555 D C 17 O2 ? ? D DG 12 R C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DG 14 O6 ? ? ? 1_555 D C 17 N4 ? ? D DG 12 R C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DT 15 N3 ? ? ? 1_555 D A 16 N1 ? ? D DT 13 R A 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DT 15 O4 ? ? ? 1_555 D A 16 N6 ? ? D DT 13 R A 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DT 16 N3 ? ? ? 1_555 D A 15 N1 ? ? D DT 14 R A 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DT 16 O4 ? ? ? 1_555 D A 15 N6 ? ? D DT 14 R A 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DA 17 N1 ? ? ? 1_555 D U 14 N3 ? ? D DA 15 R U 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DA 17 N6 ? ? ? 1_555 D U 14 O4 ? ? D DA 15 R U 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DT 18 N3 ? ? ? 1_555 D A 13 N1 ? ? D DT 16 R A 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DT 18 O4 ? ? ? 1_555 D A 13 N6 ? ? D DT 16 R A 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? C DT 19 N3 ? ? ? 1_555 D A 12 N1 ? ? D DT 17 R A 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C DT 19 O4 ? ? ? 1_555 D A 12 N6 ? ? D DT 17 R A 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C DG 20 N1 ? ? ? 1_555 D C 11 N3 ? ? D DG 18 R C 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C DG 20 N2 ? ? ? 1_555 D C 11 O2 ? ? D DG 18 R C 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C DG 20 O6 ? ? ? 1_555 D C 11 N4 ? ? D DG 18 R C 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C DT 21 N3 ? ? ? 1_555 D A 10 N1 ? ? D DT 19 R A 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? C DT 21 O4 ? ? ? 1_555 D A 10 N6 ? ? D DT 19 R A 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C DG 22 N1 ? ? ? 1_555 D C 9  N3 ? ? D DG 20 R C 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? C DG 22 N2 ? ? ? 1_555 D C 9  O2 ? ? D DG 20 R C 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? C DG 22 O6 ? ? ? 1_555 D C 9  N4 ? ? D DG 20 R C 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? C DG 23 N1 ? ? ? 1_555 D C 8  N3 ? ? D DG 21 R C 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? C DG 23 N2 ? ? ? 1_555 D C 8  O2 ? ? D DG 21 R C 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? C DG 23 O6 ? ? ? 1_555 D C 8  N4 ? ? D DG 21 R C 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? C DC 24 N3 ? ? ? 1_555 D G 7  N1 ? ? D DC 22 R G 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? C DC 24 N4 ? ? ? 1_555 D G 7  O6 ? ? D DC 22 R G 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? C DC 24 O2 ? ? ? 1_555 D G 7  N2 ? ? D DC 22 R G 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? C DC 25 N3 ? ? ? 1_555 D G 6  N1 ? ? D DC 23 R G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? C DC 25 N4 ? ? ? 1_555 D G 6  O6 ? ? D DC 23 R G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? C DC 25 O2 ? ? ? 1_555 D G 6  N2 ? ? D DC 23 R G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 3 ? 
AC ? 4 ? 
AD ? 5 ? 
AE ? 5 ? 
BA ? 3 ? 
BB ? 2 ? 
BC ? 4 ? 
BD ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? parallel      
AD 4 5 ? parallel      
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? parallel      
AE 4 5 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? parallel      
BD 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 47  ? ILE A 50  ? ILE A 47  ILE A 50  
AA 2 ARG A 143 ? TYR A 146 ? ARG A 143 TYR A 146 
AA 3 ALA A 129 ? THR A 131 ? ALA A 129 THR A 131 
AB 1 SER A 105 ? ASP A 110 ? SER A 105 ASP A 110 
AB 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
AB 3 VAL A 179 ? TYR A 183 ? VAL A 179 TYR A 183 
AC 1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
AC 2 TYR A 232 ? LEU A 234 ? TYR A 232 LEU A 234 
AC 3 LYS A 238 ? VAL A 241 ? LYS A 238 VAL A 241 
AC 4 GLY A 316 ? VAL A 317 ? GLY A 316 VAL A 317 
AD 1 LYS A 350 ? TYR A 354 ? LYS A 350 TYR A 354 
AD 2 GLN A 336 ? TYR A 342 ? GLN A 336 TYR A 342 
AD 3 ILE A 326 ? GLY A 333 ? ILE A 326 GLY A 333 
AD 4 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
AD 5 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
AE 1 GLN A 464 ? THR A 470 ? GLN A 464 THR A 470 
AE 2 LEU A 452 ? THR A 459 ? LEU A 452 THR A 459 
AE 3 GLU A 438 ? SER A 447 ? GLU A 438 SER A 447 
AE 4 VAL A 493 ? THR A 497 ? VAL A 493 THR A 497 
AE 5 VAL A 531 ? TRP A 535 ? VAL A 531 TRP A 535 
BA 1 ILE B 61  ? SER B 62  ? ILE B 47  SER B 48  
BA 2 ARG B 157 ? TYR B 160 ? ARG B 143 TYR B 146 
BA 3 PHE B 144 ? THR B 145 ? PHE B 130 THR B 131 
BB 1 VAL B 74  ? LYS B 78  ? VAL B 60  LYS B 64  
BB 2 TRP B 85  ? VAL B 89  ? TRP B 71  VAL B 75  
BC 1 VAL B 193 ? TYR B 197 ? VAL B 179 TYR B 183 
BC 2 ASP B 200 ? SER B 205 ? ASP B 186 SER B 191 
BC 3 SER B 119 ? ASP B 124 ? SER B 105 ASP B 110 
BC 4 GLU B 247 ? LEU B 248 ? GLU B 233 LEU B 234 
BD 1 LYS B 361 ? TYR B 368 ? LYS B 347 TYR B 354 
BD 2 TRP B 351 ? GLU B 358 ? TRP B 337 GLU B 344 
BD 3 ILE B 340 ? LYS B 345 ? ILE B 326 LYS B 331 
BD 4 LYS B 402 ? LEU B 405 ? LYS B 388 LEU B 391 
BD 5 TRP B 428 ? PHE B 430 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 50  ? N ILE A 50  O ARG A 143 ? O ARG A 143 
AA 2 3 N TYR A 144 ? N TYR A 144 O PHE A 130 ? O PHE A 130 
AB 1 2 N LEU A 109 ? N LEU A 109 O LEU A 187 ? O LEU A 187 
AB 2 3 N GLY A 190 ? N GLY A 190 O VAL A 179 ? O VAL A 179 
AC 1 2 N TRP A 229 ? N TRP A 229 O TYR A 232 ? O TYR A 232 
AC 2 3 N GLU A 233 ? N GLU A 233 O THR A 240 ? O THR A 240 
AC 3 4 N TRP A 239 ? N TRP A 239 O GLY A 316 ? O GLY A 316 
AD 1 2 N TYR A 354 ? N TYR A 354 O TRP A 337 ? O TRP A 337 
AD 2 3 N TYR A 342 ? N TYR A 342 O ILE A 326 ? O ILE A 326 
AD 3 4 N ALA A 327 ? N ALA A 327 O LYS A 388 ? O LYS A 388 
AD 4 5 N LEU A 391 ? N LEU A 391 O GLU A 415 ? O GLU A 415 
AE 1 2 N LEU A 469 ? N LEU A 469 O GLY A 453 ? O GLY A 453 
AE 2 3 N VAL A 458 ? N VAL A 458 O TYR A 441 ? O TYR A 441 
AE 3 4 N PHE A 440 ? N PHE A 440 O ASN A 494 ? O ASN A 494 
AE 4 5 N ILE A 495 ? N ILE A 495 O TYR A 532 ? O TYR A 532 
BA 1 2 N SER B 62  ? N SER B 48  O GLN B 159 ? O GLN B 145 
BA 2 3 N TYR B 158 ? N TYR B 144 O PHE B 144 ? O PHE B 130 
BB 1 2 N ILE B 77  ? N ILE B 63  O ARG B 86  ? O ARG B 72  
BC 1 2 N TYR B 197 ? N TYR B 183 O ASP B 200 ? O ASP B 186 
BC 2 3 N SER B 205 ? N SER B 191 O SER B 119 ? O SER B 105 
BC 3 4 N VAL B 120 ? N VAL B 106 O LEU B 248 ? O LEU B 234 
BD 1 2 N TYR B 368 ? N TYR B 354 O TRP B 351 ? O TRP B 337 
BD 2 3 N TYR B 356 ? N TYR B 342 O ILE B 340 ? O ILE B 326 
BD 3 4 N ALA B 341 ? N ALA B 327 O LYS B 402 ? O LYS B 388 
BD 4 5 N LEU B 405 ? N LEU B 391 O GLU B 429 ? O GLU B 415 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE NVP A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 LEU A 100 ? LEU A 100 . ? 1_555 ? 
2 AC1 8 LYS A 101 ? LYS A 101 . ? 1_555 ? 
3 AC1 8 LYS A 103 ? LYS A 103 . ? 1_555 ? 
4 AC1 8 VAL A 106 ? VAL A 106 . ? 1_555 ? 
5 AC1 8 TYR A 181 ? TYR A 181 . ? 1_555 ? 
6 AC1 8 LEU A 234 ? LEU A 234 . ? 1_555 ? 
7 AC1 8 HIS A 235 ? HIS A 235 . ? 1_555 ? 
8 AC1 8 TYR A 318 ? TYR A 318 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4B3Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4B3Q 
_atom_sites.fract_transf_matrix[1][1]   0.003667 
_atom_sites.fract_transf_matrix[1][2]   0.002117 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004234 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004290 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PRO A 1 1   ? 34.667  2.623  -6.570  1.00 148.25 ? 1   PRO A N     1 
ATOM   2    C CA    . PRO A 1 1   ? 35.291  1.598  -7.407  1.00 149.30 ? 1   PRO A CA    1 
ATOM   3    C C     . PRO A 1 1   ? 36.795  1.819  -7.582  1.00 145.82 ? 1   PRO A C     1 
ATOM   4    O O     . PRO A 1 1   ? 37.492  0.942  -8.098  1.00 140.98 ? 1   PRO A O     1 
ATOM   5    C CB    . PRO A 1 1   ? 34.576  1.764  -8.753  1.00 150.86 ? 1   PRO A CB    1 
ATOM   6    C CG    . PRO A 1 1   ? 33.252  2.352  -8.403  1.00 156.02 ? 1   PRO A CG    1 
ATOM   7    C CD    . PRO A 1 1   ? 33.515  3.259  -7.235  1.00 148.54 ? 1   PRO A CD    1 
ATOM   8    N N     . ILE A 1 2   ? 37.280  2.981  -7.149  1.00 153.26 ? 2   ILE A N     1 
ATOM   9    C CA    . ILE A 1 2   ? 38.691  3.349  -7.290  1.00 156.36 ? 2   ILE A CA    1 
ATOM   10   C C     . ILE A 1 2   ? 39.249  3.944  -5.989  1.00 152.84 ? 2   ILE A C     1 
ATOM   11   O O     . ILE A 1 2   ? 40.415  3.726  -5.649  1.00 144.93 ? 2   ILE A O     1 
ATOM   12   C CB    . ILE A 1 2   ? 38.910  4.289  -8.516  1.00 149.08 ? 2   ILE A CB    1 
ATOM   13   C CG1   . ILE A 1 2   ? 40.402  4.398  -8.902  1.00 144.09 ? 2   ILE A CG1   1 
ATOM   14   C CG2   . ILE A 1 2   ? 38.201  5.631  -8.337  1.00 147.72 ? 2   ILE A CG2   1 
ATOM   15   C CD1   . ILE A 1 2   ? 41.178  5.542  -8.271  1.00 138.00 ? 2   ILE A CD1   1 
ATOM   16   N N     . SER A 1 3   ? 38.403  4.670  -5.260  1.00 158.37 ? 3   SER A N     1 
ATOM   17   C CA    . SER A 1 3   ? 38.816  5.371  -4.046  1.00 156.58 ? 3   SER A CA    1 
ATOM   18   C C     . SER A 1 3   ? 38.422  4.619  -2.772  1.00 157.26 ? 3   SER A C     1 
ATOM   19   O O     . SER A 1 3   ? 37.266  4.216  -2.622  1.00 158.08 ? 3   SER A O     1 
ATOM   20   C CB    . SER A 1 3   ? 38.231  6.786  -4.029  1.00 151.11 ? 3   SER A CB    1 
ATOM   21   O OG    . SER A 1 3   ? 36.815  6.758  -4.072  1.00 148.47 ? 3   SER A OG    1 
ATOM   22   N N     . PRO A 1 4   ? 39.389  4.425  -1.852  1.00 143.52 ? 4   PRO A N     1 
ATOM   23   C CA    . PRO A 1 4   ? 39.138  3.748  -0.582  1.00 127.04 ? 4   PRO A CA    1 
ATOM   24   C C     . PRO A 1 4   ? 38.793  4.715  0.557   1.00 129.09 ? 4   PRO A C     1 
ATOM   25   O O     . PRO A 1 4   ? 38.655  5.919  0.325   1.00 147.60 ? 4   PRO A O     1 
ATOM   26   C CB    . PRO A 1 4   ? 40.470  3.045  -0.305  1.00 128.43 ? 4   PRO A CB    1 
ATOM   27   C CG    . PRO A 1 4   ? 41.502  3.875  -1.003  1.00 129.36 ? 4   PRO A CG    1 
ATOM   28   C CD    . PRO A 1 4   ? 40.816  4.763  -2.010  1.00 151.09 ? 4   PRO A CD    1 
ATOM   29   N N     . ILE A 1 5   ? 38.646  4.172  1.767   1.00 115.95 ? 5   ILE A N     1 
ATOM   30   C CA    . ILE A 1 5   ? 38.388  4.945  2.995   1.00 124.26 ? 5   ILE A CA    1 
ATOM   31   C C     . ILE A 1 5   ? 37.086  5.761  2.979   1.00 145.22 ? 5   ILE A C     1 
ATOM   32   O O     . ILE A 1 5   ? 36.982  6.780  3.667   1.00 149.34 ? 5   ILE A O     1 
ATOM   33   C CB    . ILE A 1 5   ? 39.586  5.851  3.369   1.00 127.46 ? 5   ILE A CB    1 
ATOM   34   N N     . GLU A 1 6   ? 36.105  5.286  2.207   1.00 156.70 ? 6   GLU A N     1 
ATOM   35   C CA    . GLU A 1 6   ? 34.764  5.897  2.059   1.00 161.37 ? 6   GLU A CA    1 
ATOM   36   C C     . GLU A 1 6   ? 34.687  7.436  2.071   1.00 151.93 ? 6   GLU A C     1 
ATOM   37   O O     . GLU A 1 6   ? 34.854  8.078  3.112   1.00 138.11 ? 6   GLU A O     1 
ATOM   38   C CB    . GLU A 1 6   ? 33.740  5.269  3.027   1.00 162.29 ? 6   GLU A CB    1 
ATOM   39   C CG    . GLU A 1 6   ? 34.104  5.305  4.508   1.00 164.56 ? 6   GLU A CG    1 
ATOM   40   C CD    . GLU A 1 6   ? 33.080  4.609  5.389   1.00 152.08 ? 6   GLU A CD    1 
ATOM   41   O OE1   . GLU A 1 6   ? 32.612  3.510  5.020   1.00 140.10 ? 6   GLU A OE1   1 
ATOM   42   O OE2   . GLU A 1 6   ? 32.743  5.163  6.456   1.00 151.31 ? 6   GLU A OE2   1 
ATOM   43   N N     . THR A 1 7   ? 34.413  8.005  0.899   1.00 146.63 ? 7   THR A N     1 
ATOM   44   C CA    . THR A 1 7   ? 34.348  9.459  0.714   1.00 137.90 ? 7   THR A CA    1 
ATOM   45   C C     . THR A 1 7   ? 33.190  10.105 1.475   1.00 142.69 ? 7   THR A C     1 
ATOM   46   O O     . THR A 1 7   ? 32.090  9.551  1.543   1.00 160.46 ? 7   THR A O     1 
ATOM   47   C CB    . THR A 1 7   ? 34.238  9.843  -0.777  1.00 145.63 ? 7   THR A CB    1 
ATOM   48   O OG1   . THR A 1 7   ? 33.149  9.131  -1.380  1.00 160.67 ? 7   THR A OG1   1 
ATOM   49   C CG2   . THR A 1 7   ? 35.527  9.515  -1.520  1.00 145.68 ? 7   THR A CG2   1 
ATOM   50   N N     . VAL A 1 8   ? 33.456  11.280 2.042   1.00 130.23 ? 8   VAL A N     1 
ATOM   51   C CA    . VAL A 1 8   ? 32.451  12.053 2.772   1.00 143.69 ? 8   VAL A CA    1 
ATOM   52   C C     . VAL A 1 8   ? 31.858  13.119 1.844   1.00 143.01 ? 8   VAL A C     1 
ATOM   53   O O     . VAL A 1 8   ? 32.603  13.912 1.260   1.00 141.49 ? 8   VAL A O     1 
ATOM   54   C CB    . VAL A 1 8   ? 33.049  12.710 4.041   1.00 141.73 ? 8   VAL A CB    1 
ATOM   55   C CG1   . VAL A 1 8   ? 31.981  13.462 4.824   1.00 144.17 ? 8   VAL A CG1   1 
ATOM   56   C CG2   . VAL A 1 8   ? 33.710  11.664 4.928   1.00 133.36 ? 8   VAL A CG2   1 
ATOM   57   N N     . PRO A 1 9   ? 30.516  13.133 1.697   1.00 143.70 ? 9   PRO A N     1 
ATOM   58   C CA    . PRO A 1 9   ? 29.830  14.086 0.814   1.00 141.31 ? 9   PRO A CA    1 
ATOM   59   C C     . PRO A 1 9   ? 30.011  15.548 1.230   1.00 139.31 ? 9   PRO A C     1 
ATOM   60   O O     . PRO A 1 9   ? 29.712  15.916 2.370   1.00 136.14 ? 9   PRO A O     1 
ATOM   61   C CB    . PRO A 1 9   ? 28.354  13.672 0.918   1.00 144.44 ? 9   PRO A CB    1 
ATOM   62   C CG    . PRO A 1 9   ? 28.254  12.889 2.183   1.00 143.36 ? 9   PRO A CG    1 
ATOM   63   C CD    . PRO A 1 9   ? 29.569  12.183 2.310   1.00 150.06 ? 9   PRO A CD    1 
ATOM   64   N N     . VAL A 1 10  ? 30.512  16.359 0.300   1.00 141.28 ? 10  VAL A N     1 
ATOM   65   C CA    . VAL A 1 10  ? 30.723  17.791 0.524   1.00 140.12 ? 10  VAL A CA    1 
ATOM   66   C C     . VAL A 1 10  ? 29.932  18.592 -0.513  1.00 138.20 ? 10  VAL A C     1 
ATOM   67   O O     . VAL A 1 10  ? 30.019  18.324 -1.714  1.00 129.41 ? 10  VAL A O     1 
ATOM   68   C CB    . VAL A 1 10  ? 32.224  18.171 0.458   1.00 155.59 ? 10  VAL A CB    1 
ATOM   69   C CG1   . VAL A 1 10  ? 32.426  19.652 0.753   1.00 159.12 ? 10  VAL A CG1   1 
ATOM   70   C CG2   . VAL A 1 10  ? 33.043  17.330 1.429   1.00 168.93 ? 10  VAL A CG2   1 
ATOM   71   N N     . LYS A 1 11  ? 29.159  19.567 -0.038  1.00 136.20 ? 11  LYS A N     1 
ATOM   72   C CA    . LYS A 1 11  ? 28.338  20.409 -0.907  1.00 141.86 ? 11  LYS A CA    1 
ATOM   73   C C     . LYS A 1 11  ? 28.707  21.888 -0.787  1.00 137.71 ? 11  LYS A C     1 
ATOM   74   O O     . LYS A 1 11  ? 29.207  22.329 0.250   1.00 138.25 ? 11  LYS A O     1 
ATOM   75   C CB    . LYS A 1 11  ? 26.853  20.210 -0.596  1.00 139.63 ? 11  LYS A CB    1 
ATOM   76   N N     . LEU A 1 12  ? 28.456  22.642 -1.855  1.00 125.69 ? 12  LEU A N     1 
ATOM   77   C CA    . LEU A 1 12  ? 28.732  24.079 -1.885  1.00 125.77 ? 12  LEU A CA    1 
ATOM   78   C C     . LEU A 1 12  ? 27.609  24.891 -1.238  1.00 136.27 ? 12  LEU A C     1 
ATOM   79   O O     . LEU A 1 12  ? 26.568  24.343 -0.864  1.00 139.65 ? 12  LEU A O     1 
ATOM   80   C CB    . LEU A 1 12  ? 28.957  24.555 -3.326  1.00 133.09 ? 12  LEU A CB    1 
ATOM   81   C CG    . LEU A 1 12  ? 30.248  24.170 -4.055  1.00 154.41 ? 12  LEU A CG    1 
ATOM   82   C CD1   . LEU A 1 12  ? 30.092  24.416 -5.546  1.00 159.94 ? 12  LEU A CD1   1 
ATOM   83   C CD2   . LEU A 1 12  ? 31.451  24.931 -3.515  1.00 158.33 ? 12  LEU A CD2   1 
ATOM   84   N N     . LYS A 1 13  ? 27.834  26.198 -1.109  1.00 154.69 ? 13  LYS A N     1 
ATOM   85   C CA    . LYS A 1 13  ? 26.837  27.122 -0.568  1.00 154.93 ? 13  LYS A CA    1 
ATOM   86   C C     . LYS A 1 13  ? 25.693  27.346 -1.560  1.00 147.70 ? 13  LYS A C     1 
ATOM   87   O O     . LYS A 1 13  ? 25.935  27.475 -2.763  1.00 152.67 ? 13  LYS A O     1 
ATOM   88   C CB    . LYS A 1 13  ? 27.485  28.461 -0.201  1.00 155.19 ? 13  LYS A CB    1 
ATOM   89   C CG    . LYS A 1 13  ? 28.357  28.418 1.044   1.00 154.37 ? 13  LYS A CG    1 
ATOM   90   C CD    . LYS A 1 13  ? 28.920  29.794 1.369   1.00 142.87 ? 13  LYS A CD    1 
ATOM   91   C CE    . LYS A 1 13  ? 29.749  29.776 2.645   1.00 147.58 ? 13  LYS A CE    1 
ATOM   92   N NZ    . LYS A 1 13  ? 28.920  29.574 3.866   1.00 150.86 ? 13  LYS A NZ    1 
ATOM   93   N N     . PRO A 1 14  ? 24.441  27.390 -1.058  1.00 135.70 ? 14  PRO A N     1 
ATOM   94   C CA    . PRO A 1 14  ? 23.263  27.619 -1.903  1.00 135.96 ? 14  PRO A CA    1 
ATOM   95   C C     . PRO A 1 14  ? 23.180  29.041 -2.464  1.00 135.06 ? 14  PRO A C     1 
ATOM   96   O O     . PRO A 1 14  ? 22.418  29.288 -3.402  1.00 136.58 ? 14  PRO A O     1 
ATOM   97   C CB    . PRO A 1 14  ? 22.086  27.363 -0.949  1.00 144.84 ? 14  PRO A CB    1 
ATOM   98   C CG    . PRO A 1 14  ? 22.661  26.607 0.202   1.00 143.50 ? 14  PRO A CG    1 
ATOM   99   C CD    . PRO A 1 14  ? 24.058  27.125 0.339   1.00 131.00 ? 14  PRO A CD    1 
ATOM   100  N N     . GLY A 1 15  ? 23.958  29.958 -1.891  1.00 134.75 ? 15  GLY A N     1 
ATOM   101  C CA    . GLY A 1 15  ? 23.969  31.358 -2.314  1.00 147.19 ? 15  GLY A CA    1 
ATOM   102  C C     . GLY A 1 15  ? 24.602  31.586 -3.674  1.00 147.24 ? 15  GLY A C     1 
ATOM   103  O O     . GLY A 1 15  ? 24.017  32.250 -4.533  1.00 152.46 ? 15  GLY A O     1 
ATOM   104  N N     . MET A 1 16  ? 25.800  31.037 -3.868  1.00 148.41 ? 16  MET A N     1 
ATOM   105  C CA    . MET A 1 16  ? 26.538  31.193 -5.125  1.00 157.79 ? 16  MET A CA    1 
ATOM   106  C C     . MET A 1 16  ? 27.280  29.920 -5.535  1.00 152.23 ? 16  MET A C     1 
ATOM   107  O O     . MET A 1 16  ? 27.620  29.087 -4.691  1.00 151.19 ? 16  MET A O     1 
ATOM   108  C CB    . MET A 1 16  ? 27.507  32.383 -5.046  1.00 167.51 ? 16  MET A CB    1 
ATOM   109  C CG    . MET A 1 16  ? 28.546  32.297 -3.936  1.00 165.74 ? 16  MET A CG    1 
ATOM   110  S SD    . MET A 1 16  ? 29.650  33.723 -3.907  1.00 160.16 ? 16  MET A SD    1 
ATOM   111  C CE    . MET A 1 16  ? 30.707  33.304 -2.524  1.00 168.35 ? 16  MET A CE    1 
ATOM   112  N N     . ASP A 1 17  ? 27.525  29.784 -6.837  1.00 153.60 ? 17  ASP A N     1 
ATOM   113  C CA    . ASP A 1 17  ? 28.244  28.635 -7.390  1.00 138.37 ? 17  ASP A CA    1 
ATOM   114  C C     . ASP A 1 17  ? 29.762  28.809 -7.288  1.00 139.92 ? 17  ASP A C     1 
ATOM   115  O O     . ASP A 1 17  ? 30.247  29.737 -6.635  1.00 150.55 ? 17  ASP A O     1 
ATOM   116  C CB    . ASP A 1 17  ? 27.825  28.393 -8.847  1.00 135.93 ? 17  ASP A CB    1 
ATOM   117  C CG    . ASP A 1 17  ? 26.383  27.928 -8.975  1.00 139.44 ? 17  ASP A CG    1 
ATOM   118  O OD1   . ASP A 1 17  ? 25.495  28.521 -8.325  1.00 146.00 ? 17  ASP A OD1   1 
ATOM   119  O OD2   . ASP A 1 17  ? 26.138  26.964 -9.730  1.00 127.00 ? 17  ASP A OD2   1 
ATOM   120  N N     . GLY A 1 18  ? 30.504  27.912 -7.937  1.00 135.80 ? 18  GLY A N     1 
ATOM   121  C CA    . GLY A 1 18  ? 31.967  27.934 -7.912  1.00 146.71 ? 18  GLY A CA    1 
ATOM   122  C C     . GLY A 1 18  ? 32.597  29.047 -8.736  1.00 171.11 ? 18  GLY A C     1 
ATOM   123  O O     . GLY A 1 18  ? 31.904  29.975 -9.162  1.00 182.83 ? 18  GLY A O     1 
ATOM   124  N N     . PRO A 1 19  ? 33.923  28.961 -8.966  1.00 174.39 ? 19  PRO A N     1 
ATOM   125  C CA    . PRO A 1 19  ? 34.661  29.988 -9.709  1.00 177.75 ? 19  PRO A CA    1 
ATOM   126  C C     . PRO A 1 19  ? 34.323  30.016 -11.200 1.00 171.79 ? 19  PRO A C     1 
ATOM   127  O O     . PRO A 1 19  ? 34.022  28.975 -11.791 1.00 161.45 ? 19  PRO A O     1 
ATOM   128  C CB    . PRO A 1 19  ? 36.125  29.589 -9.502  1.00 167.25 ? 19  PRO A CB    1 
ATOM   129  C CG    . PRO A 1 19  ? 36.087  28.122 -9.248  1.00 148.62 ? 19  PRO A CG    1 
ATOM   130  C CD    . PRO A 1 19  ? 34.809  27.877 -8.499  1.00 146.98 ? 19  PRO A CD    1 
ATOM   131  N N     . LYS A 1 20  ? 34.376  31.208 -11.790 1.00 163.73 ? 20  LYS A N     1 
ATOM   132  C CA    . LYS A 1 20  ? 34.099  31.398 -13.213 1.00 151.89 ? 20  LYS A CA    1 
ATOM   133  C C     . LYS A 1 20  ? 35.136  32.314 -13.872 1.00 145.99 ? 20  LYS A C     1 
ATOM   134  O O     . LYS A 1 20  ? 34.903  32.857 -14.956 1.00 149.11 ? 20  LYS A O     1 
ATOM   135  C CB    . LYS A 1 20  ? 32.685  31.953 -13.410 1.00 143.10 ? 20  LYS A CB    1 
ATOM   136  N N     . VAL A 1 21  ? 36.281  32.469 -13.209 1.00 152.52 ? 21  VAL A N     1 
ATOM   137  C CA    . VAL A 1 21  ? 37.370  33.323 -13.691 1.00 160.88 ? 21  VAL A CA    1 
ATOM   138  C C     . VAL A 1 21  ? 38.108  32.688 -14.878 1.00 160.88 ? 21  VAL A C     1 
ATOM   139  O O     . VAL A 1 21  ? 38.371  31.482 -14.887 1.00 152.92 ? 21  VAL A O     1 
ATOM   140  C CB    . VAL A 1 21  ? 38.345  33.708 -12.542 1.00 163.13 ? 21  VAL A CB    1 
ATOM   141  C CG1   . VAL A 1 21  ? 38.910  32.472 -11.849 1.00 162.25 ? 21  VAL A CG1   1 
ATOM   142  C CG2   . VAL A 1 21  ? 39.466  34.613 -13.039 1.00 163.35 ? 21  VAL A CG2   1 
ATOM   143  N N     . LYS A 1 22  ? 38.420  33.512 -15.877 1.00 163.67 ? 22  LYS A N     1 
ATOM   144  C CA    . LYS A 1 22  ? 39.121  33.069 -17.083 1.00 154.22 ? 22  LYS A CA    1 
ATOM   145  C C     . LYS A 1 22  ? 40.599  32.766 -16.820 1.00 156.53 ? 22  LYS A C     1 
ATOM   146  O O     . LYS A 1 22  ? 41.148  33.153 -15.785 1.00 162.01 ? 22  LYS A O     1 
ATOM   147  C CB    . LYS A 1 22  ? 38.983  34.116 -18.193 1.00 155.84 ? 22  LYS A CB    1 
ATOM   148  N N     . GLN A 1 23  ? 41.230  32.075 -17.768 1.00 152.83 ? 23  GLN A N     1 
ATOM   149  C CA    . GLN A 1 23  ? 42.632  31.670 -17.652 1.00 152.11 ? 23  GLN A CA    1 
ATOM   150  C C     . GLN A 1 23  ? 43.605  32.840 -17.801 1.00 158.99 ? 23  GLN A C     1 
ATOM   151  O O     . GLN A 1 23  ? 43.334  33.803 -18.522 1.00 167.88 ? 23  GLN A O     1 
ATOM   152  C CB    . GLN A 1 23  ? 42.963  30.576 -18.674 1.00 140.17 ? 23  GLN A CB    1 
ATOM   153  C CG    . GLN A 1 23  ? 42.393  29.202 -18.340 1.00 136.83 ? 23  GLN A CG    1 
ATOM   154  C CD    . GLN A 1 23  ? 43.101  28.527 -17.177 1.00 140.22 ? 23  GLN A CD    1 
ATOM   155  O OE1   . GLN A 1 23  ? 42.469  28.142 -16.193 1.00 140.30 ? 23  GLN A OE1   1 
ATOM   156  N NE2   . GLN A 1 23  ? 44.418  28.379 -17.285 1.00 138.23 ? 23  GLN A NE2   1 
ATOM   157  N N     . TRP A 1 24  ? 44.739  32.735 -17.110 1.00 152.21 ? 24  TRP A N     1 
ATOM   158  C CA    . TRP A 1 24  ? 45.792  33.750 -17.141 1.00 149.84 ? 24  TRP A CA    1 
ATOM   159  C C     . TRP A 1 24  ? 46.586  33.689 -18.423 1.00 157.49 ? 24  TRP A C     1 
ATOM   160  O O     . TRP A 1 24  ? 46.588  32.653 -19.095 1.00 149.70 ? 24  TRP A O     1 
ATOM   161  C CB    . TRP A 1 24  ? 46.716  33.572 -15.938 1.00 135.37 ? 24  TRP A CB    1 
ATOM   162  N N     . PRO A 1 25  ? 47.267  34.799 -18.790 1.00 167.16 ? 25  PRO A N     1 
ATOM   163  C CA    . PRO A 1 25  ? 48.130  34.829 -19.979 1.00 168.49 ? 25  PRO A CA    1 
ATOM   164  C C     . PRO A 1 25  ? 49.243  33.778 -19.947 1.00 173.12 ? 25  PRO A C     1 
ATOM   165  O O     . PRO A 1 25  ? 49.691  33.377 -18.870 1.00 173.00 ? 25  PRO A O     1 
ATOM   166  C CB    . PRO A 1 25  ? 48.733  36.243 -19.951 1.00 158.57 ? 25  PRO A CB    1 
ATOM   167  C CG    . PRO A 1 25  ? 48.470  36.767 -18.579 1.00 157.97 ? 25  PRO A CG    1 
ATOM   168  C CD    . PRO A 1 25  ? 47.183  36.129 -18.160 1.00 162.44 ? 25  PRO A CD    1 
ATOM   169  N N     . LEU A 1 26  ? 49.680  33.354 -21.131 1.00 175.79 ? 26  LEU A N     1 
ATOM   170  C CA    . LEU A 1 26  ? 50.634  32.252 -21.276 1.00 160.70 ? 26  LEU A CA    1 
ATOM   171  C C     . LEU A 1 26  ? 52.063  32.636 -20.889 1.00 162.78 ? 26  LEU A C     1 
ATOM   172  O O     . LEU A 1 26  ? 52.463  33.796 -21.016 1.00 168.74 ? 26  LEU A O     1 
ATOM   173  C CB    . LEU A 1 26  ? 50.605  31.700 -22.708 1.00 150.05 ? 26  LEU A CB    1 
ATOM   174  C CG    . LEU A 1 26  ? 49.253  31.338 -23.339 1.00 150.72 ? 26  LEU A CG    1 
ATOM   175  C CD1   . LEU A 1 26  ? 49.439  30.910 -24.787 1.00 143.26 ? 26  LEU A CD1   1 
ATOM   176  C CD2   . LEU A 1 26  ? 48.524  30.259 -22.548 1.00 152.66 ? 26  LEU A CD2   1 
ATOM   177  N N     . THR A 1 27  ? 52.820  31.645 -20.421 1.00 151.91 ? 27  THR A N     1 
ATOM   178  C CA    . THR A 1 27  ? 54.212  31.834 -20.012 1.00 155.74 ? 27  THR A CA    1 
ATOM   179  C C     . THR A 1 27  ? 55.153  30.978 -20.866 1.00 152.95 ? 27  THR A C     1 
ATOM   180  O O     . THR A 1 27  ? 56.269  31.399 -21.180 1.00 155.70 ? 27  THR A O     1 
ATOM   181  C CB    . THR A 1 27  ? 54.412  31.501 -18.516 1.00 145.99 ? 27  THR A CB    1 
ATOM   182  O OG1   . THR A 1 27  ? 53.322  32.032 -17.751 1.00 152.80 ? 27  THR A OG1   1 
ATOM   183  C CG2   . THR A 1 27  ? 55.722  32.087 -17.994 1.00 136.44 ? 27  THR A CG2   1 
ATOM   184  N N     . GLU A 1 28  ? 54.686  29.780 -21.227 1.00 157.38 ? 28  GLU A N     1 
ATOM   185  C CA    . GLU A 1 28  ? 55.417  28.820 -22.076 1.00 154.77 ? 28  GLU A CA    1 
ATOM   186  C C     . GLU A 1 28  ? 56.615  28.151 -21.386 1.00 143.33 ? 28  GLU A C     1 
ATOM   187  O O     . GLU A 1 28  ? 56.843  26.952 -21.562 1.00 137.45 ? 28  GLU A O     1 
ATOM   188  C CB    . GLU A 1 28  ? 55.829  29.449 -23.417 1.00 156.06 ? 28  GLU A CB    1 
ATOM   189  C CG    . GLU A 1 28  ? 56.181  28.444 -24.506 1.00 153.18 ? 28  GLU A CG    1 
ATOM   190  C CD    . GLU A 1 28  ? 56.519  29.099 -25.834 1.00 159.76 ? 28  GLU A CD    1 
ATOM   191  O OE1   . GLU A 1 28  ? 55.803  30.037 -26.247 1.00 163.69 ? 28  GLU A OE1   1 
ATOM   192  O OE2   . GLU A 1 28  ? 57.501  28.666 -26.475 1.00 160.96 ? 28  GLU A OE2   1 
ATOM   193  N N     . GLU A 1 29  ? 57.367  28.927 -20.608 1.00 147.29 ? 29  GLU A N     1 
ATOM   194  C CA    . GLU A 1 29  ? 58.552  28.427 -19.909 1.00 154.75 ? 29  GLU A CA    1 
ATOM   195  C C     . GLU A 1 29  ? 58.208  27.542 -18.708 1.00 146.02 ? 29  GLU A C     1 
ATOM   196  O O     . GLU A 1 29  ? 59.004  26.686 -18.315 1.00 146.30 ? 29  GLU A O     1 
ATOM   197  C CB    . GLU A 1 29  ? 59.439  29.592 -19.463 1.00 163.95 ? 29  GLU A CB    1 
ATOM   198  N N     . LYS A 1 30  ? 57.023  27.752 -18.137 1.00 134.07 ? 30  LYS A N     1 
ATOM   199  C CA    . LYS A 1 30  ? 56.582  27.013 -16.953 1.00 136.96 ? 30  LYS A CA    1 
ATOM   200  C C     . LYS A 1 30  ? 55.593  25.892 -17.275 1.00 151.13 ? 30  LYS A C     1 
ATOM   201  O O     . LYS A 1 30  ? 55.420  24.966 -16.478 1.00 158.55 ? 30  LYS A O     1 
ATOM   202  C CB    . LYS A 1 30  ? 55.973  27.971 -15.925 1.00 136.66 ? 30  LYS A CB    1 
ATOM   203  N N     . ILE A 1 31  ? 54.952  25.979 -18.441 1.00 156.67 ? 31  ILE A N     1 
ATOM   204  C CA    . ILE A 1 31  ? 53.946  24.998 -18.865 1.00 154.99 ? 31  ILE A CA    1 
ATOM   205  C C     . ILE A 1 31  ? 54.570  23.631 -19.172 1.00 150.59 ? 31  ILE A C     1 
ATOM   206  O O     . ILE A 1 31  ? 54.006  22.594 -18.812 1.00 143.56 ? 31  ILE A O     1 
ATOM   207  C CB    . ILE A 1 31  ? 53.128  25.501 -20.082 1.00 150.76 ? 31  ILE A CB    1 
ATOM   208  C CG1   . ILE A 1 31  ? 52.524  26.882 -19.795 1.00 156.00 ? 31  ILE A CG1   1 
ATOM   209  C CG2   . ILE A 1 31  ? 52.033  24.504 -20.451 1.00 135.66 ? 31  ILE A CG2   1 
ATOM   210  C CD1   . ILE A 1 31  ? 51.988  27.600 -21.017 1.00 144.94 ? 31  ILE A CD1   1 
ATOM   211  N N     . LYS A 1 32  ? 55.735  23.645 -19.820 1.00 155.86 ? 32  LYS A N     1 
ATOM   212  C CA    . LYS A 1 32  ? 56.437  22.422 -20.228 1.00 155.13 ? 32  LYS A CA    1 
ATOM   213  C C     . LYS A 1 32  ? 56.791  21.501 -19.057 1.00 155.95 ? 32  LYS A C     1 
ATOM   214  O O     . LYS A 1 32  ? 56.778  20.276 -19.200 1.00 147.15 ? 32  LYS A O     1 
ATOM   215  C CB    . LYS A 1 32  ? 57.700  22.771 -21.020 1.00 154.90 ? 32  LYS A CB    1 
ATOM   216  N N     . ALA A 1 33  ? 57.107  22.097 -17.909 1.00 161.62 ? 33  ALA A N     1 
ATOM   217  C CA    . ALA A 1 33  ? 57.437  21.343 -16.699 1.00 157.63 ? 33  ALA A CA    1 
ATOM   218  C C     . ALA A 1 33  ? 56.194  20.760 -16.025 1.00 157.50 ? 33  ALA A C     1 
ATOM   219  O O     . ALA A 1 33  ? 56.274  19.730 -15.351 1.00 159.96 ? 33  ALA A O     1 
ATOM   220  C CB    . ALA A 1 33  ? 58.210  22.220 -15.725 1.00 148.78 ? 33  ALA A CB    1 
ATOM   221  N N     . LEU A 1 34  ? 55.054  21.423 -16.214 1.00 154.04 ? 34  LEU A N     1 
ATOM   222  C CA    . LEU A 1 34  ? 53.788  21.007 -15.604 1.00 146.45 ? 34  LEU A CA    1 
ATOM   223  C C     . LEU A 1 34  ? 53.151  19.797 -16.294 1.00 145.21 ? 34  LEU A C     1 
ATOM   224  O O     . LEU A 1 34  ? 52.286  19.135 -15.715 1.00 145.74 ? 34  LEU A O     1 
ATOM   225  C CB    . LEU A 1 34  ? 52.795  22.176 -15.573 1.00 139.90 ? 34  LEU A CB    1 
ATOM   226  C CG    . LEU A 1 34  ? 53.067  23.342 -14.614 1.00 144.24 ? 34  LEU A CG    1 
ATOM   227  C CD1   . LEU A 1 34  ? 52.302  24.582 -15.052 1.00 149.78 ? 34  LEU A CD1   1 
ATOM   228  C CD2   . LEU A 1 34  ? 52.728  22.982 -13.174 1.00 136.76 ? 34  LEU A CD2   1 
ATOM   229  N N     . VAL A 1 35  ? 53.581  19.518 -17.525 1.00 143.56 ? 35  VAL A N     1 
ATOM   230  C CA    . VAL A 1 35  ? 53.070  18.385 -18.304 1.00 136.39 ? 35  VAL A CA    1 
ATOM   231  C C     . VAL A 1 35  ? 53.452  17.050 -17.656 1.00 141.05 ? 35  VAL A C     1 
ATOM   232  O O     . VAL A 1 35  ? 52.625  16.139 -17.564 1.00 127.89 ? 35  VAL A O     1 
ATOM   233  C CB    . VAL A 1 35  ? 53.562  18.429 -19.773 1.00 140.87 ? 35  VAL A CB    1 
ATOM   234  C CG1   . VAL A 1 35  ? 52.979  17.278 -20.582 1.00 135.36 ? 35  VAL A CG1   1 
ATOM   235  C CG2   . VAL A 1 35  ? 53.200  19.756 -20.424 1.00 146.76 ? 35  VAL A CG2   1 
ATOM   236  N N     . GLU A 1 36  ? 54.700  16.953 -17.198 1.00 158.25 ? 36  GLU A N     1 
ATOM   237  C CA    . GLU A 1 36  ? 55.217  15.741 -16.558 1.00 161.68 ? 36  GLU A CA    1 
ATOM   238  C C     . GLU A 1 36  ? 54.596  15.483 -15.184 1.00 157.89 ? 36  GLU A C     1 
ATOM   239  O O     . GLU A 1 36  ? 54.493  14.333 -14.750 1.00 169.28 ? 36  GLU A O     1 
ATOM   240  C CB    . GLU A 1 36  ? 56.741  15.809 -16.440 1.00 146.42 ? 36  GLU A CB    1 
ATOM   241  N N     . ILE A 1 37  ? 54.189  16.557 -14.509 1.00 143.99 ? 37  ILE A N     1 
ATOM   242  C CA    . ILE A 1 37  ? 53.563  16.470 -13.186 1.00 136.13 ? 37  ILE A CA    1 
ATOM   243  C C     . ILE A 1 37  ? 52.130  15.939 -13.291 1.00 144.76 ? 37  ILE A C     1 
ATOM   244  O O     . ILE A 1 37  ? 51.714  15.098 -12.489 1.00 152.19 ? 37  ILE A O     1 
ATOM   245  C CB    . ILE A 1 37  ? 53.578  17.839 -12.454 1.00 127.64 ? 37  ILE A CB    1 
ATOM   246  C CG1   . ILE A 1 37  ? 54.982  18.474 -12.471 1.00 136.84 ? 37  ILE A CG1   1 
ATOM   247  C CG2   . ILE A 1 37  ? 53.036  17.716 -11.031 1.00 131.08 ? 37  ILE A CG2   1 
ATOM   248  C CD1   . ILE A 1 37  ? 56.070  17.687 -11.760 1.00 150.08 ? 37  ILE A CD1   1 
ATOM   249  N N     . CYS A 1 38  ? 51.391  16.427 -14.286 1.00 139.50 ? 38  CYS A N     1 
ATOM   250  C CA    . CYS A 1 38  ? 50.002  16.019 -14.512 1.00 135.89 ? 38  CYS A CA    1 
ATOM   251  C C     . CYS A 1 38  ? 49.879  14.578 -15.010 1.00 132.36 ? 38  CYS A C     1 
ATOM   252  O O     . CYS A 1 38  ? 48.895  13.898 -14.712 1.00 128.97 ? 38  CYS A O     1 
ATOM   253  C CB    . CYS A 1 38  ? 49.313  16.974 -15.491 1.00 148.37 ? 38  CYS A CB    1 
ATOM   254  S SG    . CYS A 1 38  ? 49.077  18.652 -14.858 1.00 182.07 ? 38  CYS A SG    1 
ATOM   255  N N     . THR A 1 39  ? 50.877  14.125 -15.766 1.00 136.84 ? 39  THR A N     1 
ATOM   256  C CA    . THR A 1 39  ? 50.908  12.757 -16.291 1.00 142.20 ? 39  THR A CA    1 
ATOM   257  C C     . THR A 1 39  ? 51.216  11.748 -15.180 1.00 142.86 ? 39  THR A C     1 
ATOM   258  O O     . THR A 1 39  ? 50.677  10.638 -15.174 1.00 139.53 ? 39  THR A O     1 
ATOM   259  C CB    . THR A 1 39  ? 51.935  12.612 -17.437 1.00 147.04 ? 39  THR A CB    1 
ATOM   260  O OG1   . THR A 1 39  ? 51.812  13.718 -18.340 1.00 146.20 ? 39  THR A OG1   1 
ATOM   261  C CG2   . THR A 1 39  ? 51.716  11.313 -18.209 1.00 149.27 ? 39  THR A CG2   1 
ATOM   262  N N     . GLU A 1 40  ? 52.076  12.147 -14.244 1.00 146.36 ? 40  GLU A N     1 
ATOM   263  C CA    . GLU A 1 40  ? 52.467  11.300 -13.116 1.00 143.45 ? 40  GLU A CA    1 
ATOM   264  C C     . GLU A 1 40  ? 51.324  11.118 -12.114 1.00 137.57 ? 40  GLU A C     1 
ATOM   265  O O     . GLU A 1 40  ? 51.149  10.034 -11.554 1.00 129.00 ? 40  GLU A O     1 
ATOM   266  C CB    . GLU A 1 40  ? 53.705  11.880 -12.418 1.00 150.75 ? 40  GLU A CB    1 
ATOM   267  C CG    . GLU A 1 40  ? 54.410  10.924 -11.462 1.00 146.61 ? 40  GLU A CG    1 
ATOM   268  C CD    . GLU A 1 40  ? 55.127  9.786  -12.169 1.00 157.04 ? 40  GLU A CD    1 
ATOM   269  O OE1   . GLU A 1 40  ? 55.782  10.032 -13.205 1.00 160.52 ? 40  GLU A OE1   1 
ATOM   270  O OE2   . GLU A 1 40  ? 55.043  8.639  -11.680 1.00 163.46 ? 40  GLU A OE2   1 
ATOM   271  N N     . MET A 1 41  ? 50.552  12.183 -11.901 1.00 140.18 ? 41  MET A N     1 
ATOM   272  C CA    . MET A 1 41  ? 49.414  12.158 -10.979 1.00 145.49 ? 41  MET A CA    1 
ATOM   273  C C     . MET A 1 41  ? 48.209  11.416 -11.560 1.00 145.77 ? 41  MET A C     1 
ATOM   274  O O     . MET A 1 41  ? 47.370  10.905 -10.814 1.00 152.45 ? 41  MET A O     1 
ATOM   275  C CB    . MET A 1 41  ? 49.012  13.581 -10.577 1.00 147.71 ? 41  MET A CB    1 
ATOM   276  C CG    . MET A 1 41  ? 49.997  14.272 -9.647  1.00 149.66 ? 41  MET A CG    1 
ATOM   277  S SD    . MET A 1 41  ? 49.478  15.939 -9.198  1.00 160.61 ? 41  MET A SD    1 
ATOM   278  C CE    . MET A 1 41  ? 50.820  16.433 -8.119  1.00 170.33 ? 41  MET A CE    1 
ATOM   279  N N     . GLU A 1 42  ? 48.133  11.363 -12.889 1.00 143.94 ? 42  GLU A N     1 
ATOM   280  C CA    . GLU A 1 42  ? 47.050  10.673 -13.590 1.00 142.62 ? 42  GLU A CA    1 
ATOM   281  C C     . GLU A 1 42  ? 47.197  9.153  -13.498 1.00 134.28 ? 42  GLU A C     1 
ATOM   282  O O     . GLU A 1 42  ? 46.202  8.433  -13.381 1.00 129.53 ? 42  GLU A O     1 
ATOM   283  C CB    . GLU A 1 42  ? 46.998  11.116 -15.056 1.00 143.28 ? 42  GLU A CB    1 
ATOM   284  C CG    . GLU A 1 42  ? 45.708  10.758 -15.783 1.00 149.53 ? 42  GLU A CG    1 
ATOM   285  C CD    . GLU A 1 42  ? 45.704  11.190 -17.239 1.00 153.17 ? 42  GLU A CD    1 
ATOM   286  O OE1   . GLU A 1 42  ? 46.340  12.215 -17.570 1.00 149.89 ? 42  GLU A OE1   1 
ATOM   287  O OE2   . GLU A 1 42  ? 45.055  10.505 -18.057 1.00 152.04 ? 42  GLU A OE2   1 
ATOM   288  N N     . LYS A 1 43  ? 48.441  8.678  -13.552 1.00 134.14 ? 43  LYS A N     1 
ATOM   289  C CA    . LYS A 1 43  ? 48.743  7.248  -13.481 1.00 148.13 ? 43  LYS A CA    1 
ATOM   290  C C     . LYS A 1 43  ? 48.537  6.679  -12.077 1.00 147.60 ? 43  LYS A C     1 
ATOM   291  O O     . LYS A 1 43  ? 48.157  5.516  -11.924 1.00 147.92 ? 43  LYS A O     1 
ATOM   292  C CB    . LYS A 1 43  ? 50.174  6.980  -13.952 1.00 159.71 ? 43  LYS A CB    1 
ATOM   293  N N     . GLU A 1 44  ? 48.792  7.504  -11.063 1.00 141.27 ? 44  GLU A N     1 
ATOM   294  C CA    . GLU A 1 44  ? 48.631  7.103  -9.664  1.00 144.90 ? 44  GLU A CA    1 
ATOM   295  C C     . GLU A 1 44  ? 47.160  7.042  -9.253  1.00 146.59 ? 44  GLU A C     1 
ATOM   296  O O     . GLU A 1 44  ? 46.746  6.125  -8.540  1.00 153.49 ? 44  GLU A O     1 
ATOM   297  C CB    . GLU A 1 44  ? 49.400  8.051  -8.737  1.00 145.14 ? 44  GLU A CB    1 
ATOM   298  C CG    . GLU A 1 44  ? 50.915  7.942  -8.840  1.00 142.75 ? 44  GLU A CG    1 
ATOM   299  C CD    . GLU A 1 44  ? 51.643  8.903  -7.916  1.00 133.81 ? 44  GLU A CD    1 
ATOM   300  O OE1   . GLU A 1 44  ? 51.246  9.028  -6.737  1.00 131.03 ? 44  GLU A OE1   1 
ATOM   301  O OE2   . GLU A 1 44  ? 52.625  9.529  -8.369  1.00 126.58 ? 44  GLU A OE2   1 
ATOM   302  N N     . GLY A 1 45  ? 46.381  8.023  -9.706  1.00 142.23 ? 45  GLY A N     1 
ATOM   303  C CA    . GLY A 1 45  ? 44.957  8.101  -9.391  1.00 136.81 ? 45  GLY A CA    1 
ATOM   304  C C     . GLY A 1 45  ? 44.599  9.336  -8.587  1.00 128.25 ? 45  GLY A C     1 
ATOM   305  O O     . GLY A 1 45  ? 43.869  9.251  -7.596  1.00 136.04 ? 45  GLY A O     1 
ATOM   306  N N     . LYS A 1 46  ? 45.116  10.485 -9.018  1.00 125.83 ? 46  LYS A N     1 
ATOM   307  C CA    . LYS A 1 46  ? 44.858  11.761 -8.352  1.00 125.97 ? 46  LYS A CA    1 
ATOM   308  C C     . LYS A 1 46  ? 43.991  12.680 -9.210  1.00 129.85 ? 46  LYS A C     1 
ATOM   309  O O     . LYS A 1 46  ? 43.089  13.347 -8.700  1.00 137.63 ? 46  LYS A O     1 
ATOM   310  C CB    . LYS A 1 46  ? 46.174  12.456 -7.991  1.00 146.88 ? 46  LYS A CB    1 
ATOM   311  N N     . ILE A 1 47  ? 44.277  12.713 -10.511 1.00 127.44 ? 47  ILE A N     1 
ATOM   312  C CA    . ILE A 1 47  ? 43.514  13.523 -11.467 1.00 140.39 ? 47  ILE A CA    1 
ATOM   313  C C     . ILE A 1 47  ? 43.103  12.714 -12.698 1.00 140.29 ? 47  ILE A C     1 
ATOM   314  O O     . ILE A 1 47  ? 43.826  11.812 -13.130 1.00 141.09 ? 47  ILE A O     1 
ATOM   315  C CB    . ILE A 1 47  ? 44.275  14.802 -11.899 1.00 148.16 ? 47  ILE A CB    1 
ATOM   316  C CG1   . ILE A 1 47  ? 45.720  14.475 -12.308 1.00 149.92 ? 47  ILE A CG1   1 
ATOM   317  C CG2   . ILE A 1 47  ? 44.236  15.848 -10.790 1.00 156.89 ? 47  ILE A CG2   1 
ATOM   318  C CD1   . ILE A 1 47  ? 46.411  15.568 -13.098 1.00 145.03 ? 47  ILE A CD1   1 
ATOM   319  N N     . SER A 1 48  ? 41.937  13.043 -13.252 1.00 140.62 ? 48  SER A N     1 
ATOM   320  C CA    . SER A 1 48  ? 41.404  12.349 -14.425 1.00 140.46 ? 48  SER A CA    1 
ATOM   321  C C     . SER A 1 48  ? 41.025  13.319 -15.543 1.00 136.41 ? 48  SER A C     1 
ATOM   322  O O     . SER A 1 48  ? 40.653  14.467 -15.283 1.00 138.74 ? 48  SER A O     1 
ATOM   323  C CB    . SER A 1 48  ? 40.195  11.493 -14.037 1.00 138.05 ? 48  SER A CB    1 
ATOM   324  O OG    . SER A 1 48  ? 40.567  10.461 -13.141 1.00 149.79 ? 48  SER A OG    1 
ATOM   325  N N     . LYS A 1 49  ? 41.121  12.844 -16.783 1.00 139.56 ? 49  LYS A N     1 
ATOM   326  C CA    . LYS A 1 49  ? 40.795  13.648 -17.961 1.00 144.88 ? 49  LYS A CA    1 
ATOM   327  C C     . LYS A 1 49  ? 39.286  13.777 -18.157 1.00 146.63 ? 49  LYS A C     1 
ATOM   328  O O     . LYS A 1 49  ? 38.552  12.789 -18.073 1.00 139.53 ? 49  LYS A O     1 
ATOM   329  C CB    . LYS A 1 49  ? 41.436  13.052 -19.219 1.00 147.56 ? 49  LYS A CB    1 
ATOM   330  C CG    . LYS A 1 49  ? 42.949  13.193 -19.285 1.00 156.49 ? 49  LYS A CG    1 
ATOM   331  C CD    . LYS A 1 49  ? 43.499  12.597 -20.572 1.00 153.19 ? 49  LYS A CD    1 
ATOM   332  C CE    . LYS A 1 49  ? 45.008  12.756 -20.656 1.00 153.68 ? 49  LYS A CE    1 
ATOM   333  N NZ    . LYS A 1 49  ? 45.558  12.177 -21.913 1.00 152.46 ? 49  LYS A NZ    1 
ATOM   334  N N     . ILE A 1 50  ? 38.836  15.003 -18.414 1.00 152.59 ? 50  ILE A N     1 
ATOM   335  C CA    . ILE A 1 50  ? 37.419  15.290 -18.658 1.00 152.27 ? 50  ILE A CA    1 
ATOM   336  C C     . ILE A 1 50  ? 37.215  16.096 -19.943 1.00 157.09 ? 50  ILE A C     1 
ATOM   337  O O     . ILE A 1 50  ? 38.135  16.765 -20.419 1.00 162.51 ? 50  ILE A O     1 
ATOM   338  C CB    . ILE A 1 50  ? 36.750  16.017 -17.465 1.00 151.72 ? 50  ILE A CB    1 
ATOM   339  C CG1   . ILE A 1 50  ? 37.623  17.179 -16.968 1.00 153.39 ? 50  ILE A CG1   1 
ATOM   340  C CG2   . ILE A 1 50  ? 36.448  15.028 -16.345 1.00 144.79 ? 50  ILE A CG2   1 
ATOM   341  C CD1   . ILE A 1 50  ? 36.882  18.216 -16.148 1.00 151.56 ? 50  ILE A CD1   1 
ATOM   342  N N     . GLY A 1 51  ? 36.005  16.025 -20.494 1.00 153.88 ? 51  GLY A N     1 
ATOM   343  C CA    . GLY A 1 51  ? 35.670  16.721 -21.734 1.00 156.64 ? 51  GLY A CA    1 
ATOM   344  C C     . GLY A 1 51  ? 35.174  18.143 -21.525 1.00 160.51 ? 51  GLY A C     1 
ATOM   345  O O     . GLY A 1 51  ? 35.570  18.803 -20.561 1.00 160.77 ? 51  GLY A O     1 
ATOM   346  N N     . PRO A 1 52  ? 34.303  18.626 -22.433 1.00 157.17 ? 52  PRO A N     1 
ATOM   347  C CA    . PRO A 1 52  ? 33.759  19.982 -22.368 1.00 152.95 ? 52  PRO A CA    1 
ATOM   348  C C     . PRO A 1 52  ? 32.458  20.084 -21.562 1.00 147.44 ? 52  PRO A C     1 
ATOM   349  O O     . PRO A 1 52  ? 31.774  21.111 -21.620 1.00 150.06 ? 52  PRO A O     1 
ATOM   350  C CB    . PRO A 1 52  ? 33.505  20.315 -23.840 1.00 152.00 ? 52  PRO A CB    1 
ATOM   351  C CG    . PRO A 1 52  ? 33.232  18.994 -24.487 1.00 147.33 ? 52  PRO A CG    1 
ATOM   352  C CD    . PRO A 1 52  ? 33.823  17.907 -23.628 1.00 148.27 ? 52  PRO A CD    1 
ATOM   353  N N     . GLU A 1 53  ? 32.132  19.030 -20.815 1.00 143.31 ? 53  GLU A N     1 
ATOM   354  C CA    . GLU A 1 53  ? 30.911  18.982 -20.008 1.00 132.77 ? 53  GLU A CA    1 
ATOM   355  C C     . GLU A 1 53  ? 31.000  19.855 -18.756 1.00 130.23 ? 53  GLU A C     1 
ATOM   356  O O     . GLU A 1 53  ? 29.977  20.307 -18.235 1.00 122.58 ? 53  GLU A O     1 
ATOM   357  C CB    . GLU A 1 53  ? 30.581  17.536 -19.617 1.00 145.86 ? 53  GLU A CB    1 
ATOM   358  C CG    . GLU A 1 53  ? 30.152  16.643 -20.776 1.00 154.29 ? 53  GLU A CG    1 
ATOM   359  C CD    . GLU A 1 53  ? 28.772  16.980 -21.315 1.00 166.49 ? 53  GLU A CD    1 
ATOM   360  O OE1   . GLU A 1 53  ? 27.849  17.223 -20.508 1.00 164.49 ? 53  GLU A OE1   1 
ATOM   361  O OE2   . GLU A 1 53  ? 28.607  16.991 -22.553 1.00 165.76 ? 53  GLU A OE2   1 
ATOM   362  N N     . ASN A 1 54  ? 32.223  20.086 -18.283 1.00 138.94 ? 54  ASN A N     1 
ATOM   363  C CA    . ASN A 1 54  ? 32.464  20.879 -17.081 1.00 144.18 ? 54  ASN A CA    1 
ATOM   364  C C     . ASN A 1 54  ? 32.634  22.368 -17.402 1.00 155.59 ? 54  ASN A C     1 
ATOM   365  O O     . ASN A 1 54  ? 33.556  22.743 -18.132 1.00 161.32 ? 54  ASN A O     1 
ATOM   366  C CB    . ASN A 1 54  ? 33.690  20.346 -16.332 1.00 151.50 ? 54  ASN A CB    1 
ATOM   367  C CG    . ASN A 1 54  ? 33.664  20.669 -14.849 1.00 153.41 ? 54  ASN A CG    1 
ATOM   368  O OD1   . ASN A 1 54  ? 33.400  21.802 -14.443 1.00 150.47 ? 54  ASN A OD1   1 
ATOM   369  N ND2   . ASN A 1 54  ? 33.953  19.667 -14.028 1.00 160.80 ? 54  ASN A ND2   1 
ATOM   370  N N     . PRO A 1 55  ? 31.739  23.220 -16.863 1.00 157.51 ? 55  PRO A N     1 
ATOM   371  C CA    . PRO A 1 55  ? 31.794  24.664 -17.100 1.00 159.44 ? 55  PRO A CA    1 
ATOM   372  C C     . PRO A 1 55  ? 32.721  25.413 -16.137 1.00 155.80 ? 55  PRO A C     1 
ATOM   373  O O     . PRO A 1 55  ? 33.138  26.534 -16.438 1.00 142.77 ? 55  PRO A O     1 
ATOM   374  C CB    . PRO A 1 55  ? 30.339  25.119 -16.888 1.00 149.58 ? 55  PRO A CB    1 
ATOM   375  C CG    . PRO A 1 55  ? 29.560  23.901 -16.488 1.00 145.51 ? 55  PRO A CG    1 
ATOM   376  C CD    . PRO A 1 55  ? 30.549  22.854 -16.078 1.00 144.35 ? 55  PRO A CD    1 
ATOM   377  N N     . TYR A 1 56  ? 33.032  24.797 -14.998 1.00 160.55 ? 56  TYR A N     1 
ATOM   378  C CA    . TYR A 1 56  ? 33.852  25.427 -13.961 1.00 152.38 ? 56  TYR A CA    1 
ATOM   379  C C     . TYR A 1 56  ? 35.333  25.459 -14.333 1.00 148.58 ? 56  TYR A C     1 
ATOM   380  O O     . TYR A 1 56  ? 35.856  24.512 -14.925 1.00 151.78 ? 56  TYR A O     1 
ATOM   381  C CB    . TYR A 1 56  ? 33.657  24.717 -12.617 1.00 154.08 ? 56  TYR A CB    1 
ATOM   382  C CG    . TYR A 1 56  ? 32.248  24.810 -12.069 1.00 148.42 ? 56  TYR A CG    1 
ATOM   383  C CD1   . TYR A 1 56  ? 31.860  25.886 -11.270 1.00 130.96 ? 56  TYR A CD1   1 
ATOM   384  C CD2   . TYR A 1 56  ? 31.303  23.822 -12.347 1.00 151.92 ? 56  TYR A CD2   1 
ATOM   385  C CE1   . TYR A 1 56  ? 30.571  25.976 -10.766 1.00 142.35 ? 56  TYR A CE1   1 
ATOM   386  C CE2   . TYR A 1 56  ? 30.011  23.904 -11.848 1.00 155.90 ? 56  TYR A CE2   1 
ATOM   387  C CZ    . TYR A 1 56  ? 29.651  24.981 -11.058 1.00 156.63 ? 56  TYR A CZ    1 
ATOM   388  O OH    . TYR A 1 56  ? 28.371  25.066 -10.560 1.00 153.45 ? 56  TYR A OH    1 
ATOM   389  N N     . ASN A 1 57  ? 35.997  26.556 -13.975 1.00 142.01 ? 57  ASN A N     1 
ATOM   390  C CA    . ASN A 1 57  ? 37.408  26.759 -14.297 1.00 143.12 ? 57  ASN A CA    1 
ATOM   391  C C     . ASN A 1 57  ? 38.220  27.249 -13.099 1.00 145.85 ? 57  ASN A C     1 
ATOM   392  O O     . ASN A 1 57  ? 37.761  28.097 -12.330 1.00 153.63 ? 57  ASN A O     1 
ATOM   393  C CB    . ASN A 1 57  ? 37.549  27.736 -15.471 1.00 148.34 ? 57  ASN A CB    1 
ATOM   394  C CG    . ASN A 1 57  ? 38.974  27.833 -15.994 1.00 154.05 ? 57  ASN A CG    1 
ATOM   395  O OD1   . ASN A 1 57  ? 39.740  26.869 -15.940 1.00 160.01 ? 57  ASN A OD1   1 
ATOM   396  N ND2   . ASN A 1 57  ? 39.332  29.002 -16.511 1.00 148.82 ? 57  ASN A ND2   1 
ATOM   397  N N     . THR A 1 58  ? 39.428  26.706 -12.954 1.00 143.94 ? 58  THR A N     1 
ATOM   398  C CA    . THR A 1 58  ? 40.340  27.088 -11.877 1.00 139.86 ? 58  THR A CA    1 
ATOM   399  C C     . THR A 1 58  ? 41.712  27.453 -12.455 1.00 137.51 ? 58  THR A C     1 
ATOM   400  O O     . THR A 1 58  ? 42.322  26.641 -13.158 1.00 138.72 ? 58  THR A O     1 
ATOM   401  C CB    . THR A 1 58  ? 40.485  25.961 -10.829 1.00 137.27 ? 58  THR A CB    1 
ATOM   402  O OG1   . THR A 1 58  ? 39.189  25.458 -10.478 1.00 132.86 ? 58  THR A OG1   1 
ATOM   403  C CG2   . THR A 1 58  ? 41.182  26.468 -9.571  1.00 131.17 ? 58  THR A CG2   1 
ATOM   404  N N     . PRO A 1 59  ? 42.196  28.680 -12.170 1.00 133.21 ? 59  PRO A N     1 
ATOM   405  C CA    . PRO A 1 59  ? 43.493  29.139 -12.678 1.00 150.04 ? 59  PRO A CA    1 
ATOM   406  C C     . PRO A 1 59  ? 44.679  28.436 -12.014 1.00 155.11 ? 59  PRO A C     1 
ATOM   407  O O     . PRO A 1 59  ? 44.633  28.133 -10.819 1.00 154.49 ? 59  PRO A O     1 
ATOM   408  C CB    . PRO A 1 59  ? 43.497  30.633 -12.336 1.00 164.46 ? 59  PRO A CB    1 
ATOM   409  C CG    . PRO A 1 59  ? 42.571  30.761 -11.177 1.00 151.95 ? 59  PRO A CG    1 
ATOM   410  C CD    . PRO A 1 59  ? 41.503  29.730 -11.399 1.00 140.19 ? 59  PRO A CD    1 
ATOM   411  N N     . VAL A 1 60  ? 45.727  28.187 -12.797 1.00 153.86 ? 60  VAL A N     1 
ATOM   412  C CA    . VAL A 1 60  ? 46.931  27.515 -12.308 1.00 139.70 ? 60  VAL A CA    1 
ATOM   413  C C     . VAL A 1 60  ? 48.011  28.545 -11.973 1.00 147.94 ? 60  VAL A C     1 
ATOM   414  O O     . VAL A 1 60  ? 48.384  29.365 -12.817 1.00 161.52 ? 60  VAL A O     1 
ATOM   415  C CB    . VAL A 1 60  ? 47.470  26.486 -13.332 1.00 129.04 ? 60  VAL A CB    1 
ATOM   416  C CG1   . VAL A 1 60  ? 48.674  25.739 -12.772 1.00 134.57 ? 60  VAL A CG1   1 
ATOM   417  C CG2   . VAL A 1 60  ? 46.380  25.500 -13.730 1.00 129.16 ? 60  VAL A CG2   1 
ATOM   418  N N     . PHE A 1 61  ? 48.500  28.495 -10.736 1.00 142.79 ? 61  PHE A N     1 
ATOM   419  C CA    . PHE A 1 61  ? 49.541  29.408 -10.268 1.00 151.80 ? 61  PHE A CA    1 
ATOM   420  C C     . PHE A 1 61  ? 50.929  28.787 -10.399 1.00 153.66 ? 61  PHE A C     1 
ATOM   421  O O     . PHE A 1 61  ? 51.131  27.615 -10.078 1.00 151.23 ? 61  PHE A O     1 
ATOM   422  C CB    . PHE A 1 61  ? 49.282  29.820 -8.817  1.00 145.86 ? 61  PHE A CB    1 
ATOM   423  N N     . VAL A 1 75  ? 48.421  26.096 -8.120  1.00 135.71 ? 75  VAL A N     1 
ATOM   424  C CA    . VAL A 1 75  ? 47.001  26.295 -8.394  1.00 142.60 ? 75  VAL A CA    1 
ATOM   425  C C     . VAL A 1 75  ? 46.343  27.042 -7.233  1.00 152.18 ? 75  VAL A C     1 
ATOM   426  O O     . VAL A 1 75  ? 46.419  26.608 -6.080  1.00 156.97 ? 75  VAL A O     1 
ATOM   427  C CB    . VAL A 1 75  ? 46.270  24.955 -8.651  1.00 143.43 ? 75  VAL A CB    1 
ATOM   428  C CG1   . VAL A 1 75  ? 44.842  25.198 -9.120  1.00 149.22 ? 75  VAL A CG1   1 
ATOM   429  C CG2   . VAL A 1 75  ? 47.021  24.117 -9.677  1.00 145.92 ? 75  VAL A CG2   1 
ATOM   430  N N     . ASP A 1 76  ? 45.706  28.167 -7.549  1.00 155.13 ? 76  ASP A N     1 
ATOM   431  C CA    . ASP A 1 76  ? 45.044  29.000 -6.547  1.00 151.10 ? 76  ASP A CA    1 
ATOM   432  C C     . ASP A 1 76  ? 43.609  28.540 -6.301  1.00 152.67 ? 76  ASP A C     1 
ATOM   433  O O     . ASP A 1 76  ? 42.835  28.357 -7.244  1.00 143.38 ? 76  ASP A O     1 
ATOM   434  C CB    . ASP A 1 76  ? 45.070  30.473 -6.971  1.00 148.61 ? 76  ASP A CB    1 
ATOM   435  C CG    . ASP A 1 76  ? 44.562  31.410 -5.884  1.00 149.49 ? 76  ASP A CG    1 
ATOM   436  O OD1   . ASP A 1 76  ? 44.980  31.263 -4.714  1.00 143.27 ? 76  ASP A OD1   1 
ATOM   437  O OD2   . ASP A 1 76  ? 43.741  32.295 -6.202  1.00 155.00 ? 76  ASP A OD2   1 
ATOM   438  N N     . PHE A 1 77  ? 43.268  28.355 -5.027  1.00 159.23 ? 77  PHE A N     1 
ATOM   439  C CA    . PHE A 1 77  ? 41.927  27.930 -4.627  1.00 159.88 ? 77  PHE A CA    1 
ATOM   440  C C     . PHE A 1 77  ? 41.240  28.976 -3.743  1.00 159.39 ? 77  PHE A C     1 
ATOM   441  O O     . PHE A 1 77  ? 40.336  28.650 -2.968  1.00 158.94 ? 77  PHE A O     1 
ATOM   442  C CB    . PHE A 1 77  ? 41.984  26.576 -3.908  1.00 158.58 ? 77  PHE A CB    1 
ATOM   443  C CG    . PHE A 1 77  ? 42.421  25.435 -4.785  1.00 152.42 ? 77  PHE A CG    1 
ATOM   444  C CD1   . PHE A 1 77  ? 41.497  24.747 -5.567  1.00 146.41 ? 77  PHE A CD1   1 
ATOM   445  C CD2   . PHE A 1 77  ? 43.755  25.039 -4.823  1.00 145.55 ? 77  PHE A CD2   1 
ATOM   446  C CE1   . PHE A 1 77  ? 41.896  23.692 -6.375  1.00 146.82 ? 77  PHE A CE1   1 
ATOM   447  C CE2   . PHE A 1 77  ? 44.159  23.984 -5.629  1.00 142.43 ? 77  PHE A CE2   1 
ATOM   448  C CZ    . PHE A 1 77  ? 43.229  23.310 -6.405  1.00 147.50 ? 77  PHE A CZ    1 
ATOM   449  N N     . ARG A 1 78  ? 41.671  30.230 -3.875  1.00 162.24 ? 78  ARG A N     1 
ATOM   450  C CA    . ARG A 1 78  ? 41.137  31.339 -3.081  1.00 160.97 ? 78  ARG A CA    1 
ATOM   451  C C     . ARG A 1 78  ? 39.690  31.678 -3.441  1.00 152.72 ? 78  ARG A C     1 
ATOM   452  O O     . ARG A 1 78  ? 38.903  32.064 -2.573  1.00 155.09 ? 78  ARG A O     1 
ATOM   453  C CB    . ARG A 1 78  ? 42.021  32.579 -3.232  1.00 156.79 ? 78  ARG A CB    1 
ATOM   454  N N     . GLU A 1 79  ? 39.351  31.533 -4.721  1.00 150.05 ? 79  GLU A N     1 
ATOM   455  C CA    . GLU A 1 79  ? 37.998  31.791 -5.210  1.00 146.99 ? 79  GLU A CA    1 
ATOM   456  C C     . GLU A 1 79  ? 37.044  30.655 -4.834  1.00 140.86 ? 79  GLU A C     1 
ATOM   457  O O     . GLU A 1 79  ? 35.849  30.882 -4.627  1.00 144.67 ? 79  GLU A O     1 
ATOM   458  C CB    . GLU A 1 79  ? 38.011  31.999 -6.729  1.00 146.24 ? 79  GLU A CB    1 
ATOM   459  C CG    . GLU A 1 79  ? 36.768  32.676 -7.296  1.00 139.06 ? 79  GLU A CG    1 
ATOM   460  C CD    . GLU A 1 79  ? 36.663  34.147 -6.925  1.00 150.53 ? 79  GLU A CD    1 
ATOM   461  O OE1   . GLU A 1 79  ? 37.688  34.861 -6.983  1.00 164.31 ? 79  GLU A OE1   1 
ATOM   462  O OE2   . GLU A 1 79  ? 35.547  34.593 -6.583  1.00 156.04 ? 79  GLU A OE2   1 
ATOM   463  N N     . LEU A 1 80  ? 37.583  29.441 -4.745  1.00 135.73 ? 80  LEU A N     1 
ATOM   464  C CA    . LEU A 1 80  ? 36.802  28.252 -4.402  1.00 140.07 ? 80  LEU A CA    1 
ATOM   465  C C     . LEU A 1 80  ? 36.403  28.227 -2.925  1.00 141.72 ? 80  LEU A C     1 
ATOM   466  O O     . LEU A 1 80  ? 35.287  27.825 -2.589  1.00 142.98 ? 80  LEU A O     1 
ATOM   467  C CB    . LEU A 1 80  ? 37.577  26.978 -4.768  1.00 148.28 ? 80  LEU A CB    1 
ATOM   468  C CG    . LEU A 1 80  ? 36.875  25.618 -4.657  1.00 158.68 ? 80  LEU A CG    1 
ATOM   469  C CD1   . LEU A 1 80  ? 35.870  25.410 -5.782  1.00 147.23 ? 80  LEU A CD1   1 
ATOM   470  C CD2   . LEU A 1 80  ? 37.897  24.492 -4.646  1.00 166.62 ? 80  LEU A CD2   1 
ATOM   471  N N     . ASN A 1 81  ? 37.316  28.664 -2.057  1.00 139.74 ? 81  ASN A N     1 
ATOM   472  C CA    . ASN A 1 81  ? 37.099  28.663 -0.605  1.00 140.11 ? 81  ASN A CA    1 
ATOM   473  C C     . ASN A 1 81  ? 35.933  29.536 -0.141  1.00 150.47 ? 81  ASN A C     1 
ATOM   474  O O     . ASN A 1 81  ? 35.282  29.228 0.861   1.00 153.64 ? 81  ASN A O     1 
ATOM   475  C CB    . ASN A 1 81  ? 38.383  29.062 0.133   1.00 142.78 ? 81  ASN A CB    1 
ATOM   476  C CG    . ASN A 1 81  ? 39.471  28.006 0.035   1.00 148.73 ? 81  ASN A CG    1 
ATOM   477  O OD1   . ASN A 1 81  ? 39.194  26.807 -0.030  1.00 141.08 ? 81  ASN A OD1   1 
ATOM   478  N ND2   . ASN A 1 81  ? 40.723  28.451 0.033   1.00 168.07 ? 81  ASN A ND2   1 
ATOM   479  N N     . LYS A 1 82  ? 35.680  30.622 -0.870  1.00 153.47 ? 82  LYS A N     1 
ATOM   480  C CA    . LYS A 1 82  ? 34.559  31.516 -0.583  1.00 149.06 ? 82  LYS A CA    1 
ATOM   481  C C     . LYS A 1 82  ? 33.220  30.877 -0.953  1.00 147.48 ? 82  LYS A C     1 
ATOM   482  O O     . LYS A 1 82  ? 32.204  31.127 -0.301  1.00 151.89 ? 82  LYS A O     1 
ATOM   483  C CB    . LYS A 1 82  ? 34.730  32.845 -1.323  1.00 145.82 ? 82  LYS A CB    1 
ATOM   484  N N     . LYS A 1 83  ? 33.233  30.054 -2.001  1.00 139.71 ? 83  LYS A N     1 
ATOM   485  C CA    . LYS A 1 83  ? 32.040  29.345 -2.461  1.00 132.43 ? 83  LYS A CA    1 
ATOM   486  C C     . LYS A 1 83  ? 31.755  28.097 -1.626  1.00 140.07 ? 83  LYS A C     1 
ATOM   487  O O     . LYS A 1 83  ? 30.603  27.674 -1.506  1.00 144.15 ? 83  LYS A O     1 
ATOM   488  C CB    . LYS A 1 83  ? 32.181  28.967 -3.937  1.00 129.20 ? 83  LYS A CB    1 
ATOM   489  N N     . THR A 1 84  ? 32.811  27.515 -1.057  1.00 144.30 ? 84  THR A N     1 
ATOM   490  C CA    . THR A 1 84  ? 32.699  26.316 -0.224  1.00 143.06 ? 84  THR A CA    1 
ATOM   491  C C     . THR A 1 84  ? 32.064  26.652 1.126   1.00 144.79 ? 84  THR A C     1 
ATOM   492  O O     . THR A 1 84  ? 32.308  27.724 1.686   1.00 149.37 ? 84  THR A O     1 
ATOM   493  C CB    . THR A 1 84  ? 34.077  25.649 -0.004  1.00 142.26 ? 84  THR A CB    1 
ATOM   494  O OG1   . THR A 1 84  ? 34.815  25.643 -1.233  1.00 147.36 ? 84  THR A OG1   1 
ATOM   495  C CG2   . THR A 1 84  ? 33.919  24.213 0.484   1.00 138.81 ? 84  THR A CG2   1 
ATOM   496  N N     . GLN A 1 85  ? 31.249  25.728 1.634   1.00 134.77 ? 85  GLN A N     1 
ATOM   497  C CA    . GLN A 1 85  ? 30.563  25.889 2.920   1.00 141.38 ? 85  GLN A CA    1 
ATOM   498  C C     . GLN A 1 85  ? 31.536  25.980 4.098   1.00 137.06 ? 85  GLN A C     1 
ATOM   499  O O     . GLN A 1 85  ? 32.689  25.551 4.000   1.00 136.58 ? 85  GLN A O     1 
ATOM   500  C CB    . GLN A 1 85  ? 29.556  24.751 3.144   1.00 144.51 ? 85  GLN A CB    1 
ATOM   501  C CG    . GLN A 1 85  ? 30.173  23.363 3.275   1.00 145.24 ? 85  GLN A CG    1 
ATOM   502  C CD    . GLN A 1 85  ? 29.150  22.281 3.582   1.00 149.99 ? 85  GLN A CD    1 
ATOM   503  O OE1   . GLN A 1 85  ? 29.331  21.490 4.507   1.00 150.92 ? 85  GLN A OE1   1 
ATOM   504  N NE2   . GLN A 1 85  ? 28.071  22.242 2.806   1.00 146.40 ? 85  GLN A NE2   1 
ATOM   505  N N     . ASP A 1 86  ? 31.058  26.542 5.207   1.00 139.17 ? 86  ASP A N     1 
ATOM   506  C CA    . ASP A 1 86  ? 31.865  26.700 6.415   1.00 143.68 ? 86  ASP A CA    1 
ATOM   507  C C     . ASP A 1 86  ? 32.103  25.363 7.111   1.00 139.06 ? 86  ASP A C     1 
ATOM   508  O O     . ASP A 1 86  ? 31.176  24.568 7.287   1.00 139.39 ? 86  ASP A O     1 
ATOM   509  C CB    . ASP A 1 86  ? 31.201  27.688 7.381   1.00 144.53 ? 86  ASP A CB    1 
ATOM   510  C CG    . ASP A 1 86  ? 31.094  29.093 6.806   1.00 154.27 ? 86  ASP A CG    1 
ATOM   511  O OD1   . ASP A 1 86  ? 32.098  29.603 6.263   1.00 156.19 ? 86  ASP A OD1   1 
ATOM   512  O OD2   . ASP A 1 86  ? 30.003  29.692 6.909   1.00 155.95 ? 86  ASP A OD2   1 
ATOM   513  N N     . PHE A 1 87  ? 33.355  25.122 7.491   1.00 142.97 ? 87  PHE A N     1 
ATOM   514  C CA    . PHE A 1 87  ? 33.734  23.918 8.227   1.00 131.68 ? 87  PHE A CA    1 
ATOM   515  C C     . PHE A 1 87  ? 34.112  24.258 9.665   1.00 132.63 ? 87  PHE A C     1 
ATOM   516  O O     . PHE A 1 87  ? 34.521  25.385 9.958   1.00 149.28 ? 87  PHE A O     1 
ATOM   517  C CB    . PHE A 1 87  ? 34.900  23.204 7.535   1.00 132.67 ? 87  PHE A CB    1 
ATOM   518  C CG    . PHE A 1 87  ? 34.533  22.563 6.226   1.00 131.99 ? 87  PHE A CG    1 
ATOM   519  C CD1   . PHE A 1 87  ? 33.979  21.287 6.191   1.00 134.07 ? 87  PHE A CD1   1 
ATOM   520  C CD2   . PHE A 1 87  ? 34.751  23.229 5.024   1.00 140.90 ? 87  PHE A CD2   1 
ATOM   521  C CE1   . PHE A 1 87  ? 33.642  20.691 4.984   1.00 141.27 ? 87  PHE A CE1   1 
ATOM   522  C CE2   . PHE A 1 87  ? 34.416  22.639 3.815   1.00 142.16 ? 87  PHE A CE2   1 
ATOM   523  C CZ    . PHE A 1 87  ? 33.862  21.369 3.794   1.00 141.72 ? 87  PHE A CZ    1 
ATOM   524  N N     . TRP A 1 88  ? 33.968  23.278 10.555  1.00 125.38 ? 88  TRP A N     1 
ATOM   525  C CA    . TRP A 1 88  ? 34.351  23.435 11.957  1.00 131.16 ? 88  TRP A CA    1 
ATOM   526  C C     . TRP A 1 88  ? 35.847  23.494 12.096  1.00 149.44 ? 88  TRP A C     1 
ATOM   527  O O     . TRP A 1 88  ? 36.572  22.783 11.395  1.00 149.78 ? 88  TRP A O     1 
ATOM   528  C CB    . TRP A 1 88  ? 33.768  22.307 12.805  1.00 126.92 ? 88  TRP A CB    1 
ATOM   529  C CG    . TRP A 1 88  ? 34.086  22.415 14.280  1.00 140.19 ? 88  TRP A CG    1 
ATOM   530  C CD1   . TRP A 1 88  ? 34.846  21.538 15.051  1.00 143.44 ? 88  TRP A CD1   1 
ATOM   531  C CD2   . TRP A 1 88  ? 33.671  23.477 15.213  1.00 149.93 ? 88  TRP A CD2   1 
ATOM   532  N NE1   . TRP A 1 88  ? 34.921  21.966 16.353  1.00 150.72 ? 88  TRP A NE1   1 
ATOM   533  C CE2   . TRP A 1 88  ? 34.242  23.121 16.519  1.00 156.09 ? 88  TRP A CE2   1 
ATOM   534  C CE3   . TRP A 1 88  ? 32.913  24.639 15.102  1.00 146.89 ? 88  TRP A CE3   1 
ATOM   535  C CZ2   . TRP A 1 88  ? 34.047  23.908 17.646  1.00 157.58 ? 88  TRP A CZ2   1 
ATOM   536  C CZ3   . TRP A 1 88  ? 32.726  25.425 16.246  1.00 148.72 ? 88  TRP A CZ3   1 
ATOM   537  C CH2   . TRP A 1 88  ? 33.279  25.066 17.486  1.00 149.52 ? 88  TRP A CH2   1 
ATOM   538  N N     . GLU A 1 89  ? 36.312  24.351 13.004  1.00 161.09 ? 89  GLU A N     1 
ATOM   539  C CA    . GLU A 1 89  ? 37.742  24.592 13.221  1.00 159.19 ? 89  GLU A CA    1 
ATOM   540  C C     . GLU A 1 89  ? 38.533  23.324 13.553  1.00 153.63 ? 89  GLU A C     1 
ATOM   541  O O     . GLU A 1 89  ? 38.036  22.431 14.245  1.00 147.56 ? 89  GLU A O     1 
ATOM   542  C CB    . GLU A 1 89  ? 37.958  25.665 14.298  1.00 161.66 ? 89  GLU A CB    1 
ATOM   543  C CG    . GLU A 1 89  ? 37.236  25.411 15.616  1.00 164.30 ? 89  GLU A CG    1 
ATOM   544  C CD    . GLU A 1 89  ? 37.343  26.576 16.584  1.00 160.16 ? 89  GLU A CD    1 
ATOM   545  O OE1   . GLU A 1 89  ? 38.460  27.105 16.772  1.00 160.42 ? 89  GLU A OE1   1 
ATOM   546  O OE2   . GLU A 1 89  ? 36.307  26.958 17.168  1.00 154.01 ? 89  GLU A OE2   1 
ATOM   547  N N     . VAL A 1 90  ? 39.762  23.265 13.045  1.00 155.03 ? 90  VAL A N     1 
ATOM   548  C CA    . VAL A 1 90  ? 40.636  22.101 13.209  1.00 159.01 ? 90  VAL A CA    1 
ATOM   549  C C     . VAL A 1 90  ? 41.159  21.993 14.644  1.00 159.31 ? 90  VAL A C     1 
ATOM   550  O O     . VAL A 1 90  ? 41.025  20.945 15.281  1.00 155.74 ? 90  VAL A O     1 
ATOM   551  C CB    . VAL A 1 90  ? 41.814  22.130 12.202  1.00 159.30 ? 90  VAL A CB    1 
ATOM   552  C CG1   . VAL A 1 90  ? 42.722  20.920 12.384  1.00 148.67 ? 90  VAL A CG1   1 
ATOM   553  C CG2   . VAL A 1 90  ? 41.298  22.188 10.771  1.00 154.96 ? 90  VAL A CG2   1 
ATOM   554  N N     . GLN A 1 91  ? 41.745  23.079 15.145  1.00 157.01 ? 91  GLN A N     1 
ATOM   555  C CA    . GLN A 1 91  ? 42.315  23.105 16.489  1.00 144.73 ? 91  GLN A CA    1 
ATOM   556  C C     . GLN A 1 91  ? 41.638  24.146 17.377  1.00 145.94 ? 91  GLN A C     1 
ATOM   557  O O     . GLN A 1 91  ? 41.469  25.301 16.979  1.00 136.84 ? 91  GLN A O     1 
ATOM   558  C CB    . GLN A 1 91  ? 43.823  23.364 16.427  1.00 139.51 ? 91  GLN A CB    1 
ATOM   559  N N     . LEU A 1 92  ? 41.252  23.721 18.578  1.00 147.24 ? 92  LEU A N     1 
ATOM   560  C CA    . LEU A 1 92  ? 40.652  24.610 19.569  1.00 149.37 ? 92  LEU A CA    1 
ATOM   561  C C     . LEU A 1 92  ? 41.683  24.932 20.650  1.00 153.04 ? 92  LEU A C     1 
ATOM   562  O O     . LEU A 1 92  ? 41.787  24.230 21.660  1.00 153.39 ? 92  LEU A O     1 
ATOM   563  C CB    . LEU A 1 92  ? 39.387  23.972 20.170  1.00 152.86 ? 92  LEU A CB    1 
ATOM   564  C CG    . LEU A 1 92  ? 38.303  24.803 20.885  1.00 142.20 ? 92  LEU A CG    1 
ATOM   565  C CD1   . LEU A 1 92  ? 38.667  25.134 22.328  1.00 141.67 ? 92  LEU A CD1   1 
ATOM   566  C CD2   . LEU A 1 92  ? 37.927  26.065 20.115  1.00 135.68 ? 92  LEU A CD2   1 
ATOM   567  N N     . GLY A 1 93  ? 42.454  25.993 20.417  1.00 160.47 ? 93  GLY A N     1 
ATOM   568  C CA    . GLY A 1 93  ? 43.518  26.402 21.331  1.00 163.24 ? 93  GLY A CA    1 
ATOM   569  C C     . GLY A 1 93  ? 44.782  25.585 21.146  1.00 157.24 ? 93  GLY A C     1 
ATOM   570  O O     . GLY A 1 93  ? 44.741  24.353 21.160  1.00 144.88 ? 93  GLY A O     1 
ATOM   571  N N     . ILE A 1 94  ? 45.907  26.275 20.971  1.00 155.34 ? 94  ILE A N     1 
ATOM   572  C CA    . ILE A 1 94  ? 47.205  25.617 20.788  1.00 139.80 ? 94  ILE A CA    1 
ATOM   573  C C     . ILE A 1 94  ? 47.727  25.010 22.096  1.00 138.32 ? 94  ILE A C     1 
ATOM   574  O O     . ILE A 1 94  ? 47.700  25.669 23.140  1.00 140.92 ? 94  ILE A O     1 
ATOM   575  C CB    . ILE A 1 94  ? 48.266  26.557 20.161  1.00 137.75 ? 94  ILE A CB    1 
ATOM   576  C CG1   . ILE A 1 94  ? 48.335  27.898 20.908  1.00 144.32 ? 94  ILE A CG1   1 
ATOM   577  C CG2   . ILE A 1 94  ? 47.978  26.766 18.679  1.00 134.74 ? 94  ILE A CG2   1 
ATOM   578  C CD1   . ILE A 1 94  ? 49.626  28.664 20.703  1.00 142.80 ? 94  ILE A CD1   1 
ATOM   579  N N     . PRO A 1 95  ? 48.185  23.742 22.045  1.00 137.02 ? 95  PRO A N     1 
ATOM   580  C CA    . PRO A 1 95  ? 48.723  23.059 23.225  1.00 136.45 ? 95  PRO A CA    1 
ATOM   581  C C     . PRO A 1 95  ? 50.034  23.675 23.710  1.00 150.58 ? 95  PRO A C     1 
ATOM   582  O O     . PRO A 1 95  ? 50.933  23.938 22.906  1.00 162.30 ? 95  PRO A O     1 
ATOM   583  C CB    . PRO A 1 95  ? 48.962  21.626 22.729  1.00 137.42 ? 95  PRO A CB    1 
ATOM   584  C CG    . PRO A 1 95  ? 48.103  21.483 21.519  1.00 144.09 ? 95  PRO A CG    1 
ATOM   585  C CD    . PRO A 1 95  ? 48.114  22.839 20.883  1.00 142.94 ? 95  PRO A CD    1 
ATOM   586  N N     . HIS A 1 96  ? 50.127  23.902 25.018  1.00 151.34 ? 96  HIS A N     1 
ATOM   587  C CA    . HIS A 1 96  ? 51.321  24.477 25.630  1.00 151.08 ? 96  HIS A CA    1 
ATOM   588  C C     . HIS A 1 96  ? 52.200  23.392 26.195  1.00 149.95 ? 96  HIS A C     1 
ATOM   589  O O     . HIS A 1 96  ? 51.698  22.461 26.831  1.00 151.65 ? 96  HIS A O     1 
ATOM   590  C CB    . HIS A 1 96  ? 50.933  25.474 26.718  1.00 142.19 ? 96  HIS A CB    1 
ATOM   591  C CG    . HIS A 1 96  ? 52.002  26.498 27.017  1.00 137.41 ? 96  HIS A CG    1 
ATOM   592  N ND1   . HIS A 1 96  ? 52.983  26.280 27.911  1.00 141.30 ? 96  HIS A ND1   1 
ATOM   593  C CD2   . HIS A 1 96  ? 52.220  27.773 26.497  1.00 144.44 ? 96  HIS A CD2   1 
ATOM   594  C CE1   . HIS A 1 96  ? 53.788  27.358 27.965  1.00 150.54 ? 96  HIS A CE1   1 
ATOM   595  N NE2   . HIS A 1 96  ? 53.319  28.271 27.099  1.00 144.52 ? 96  HIS A NE2   1 
ATOM   596  N N     . PRO A 1 97  ? 53.527  23.490 25.966  1.00 149.06 ? 97  PRO A N     1 
ATOM   597  C CA    . PRO A 1 97  ? 54.499  22.489 26.432  1.00 148.86 ? 97  PRO A CA    1 
ATOM   598  C C     . PRO A 1 97  ? 54.531  22.271 27.949  1.00 148.93 ? 97  PRO A C     1 
ATOM   599  O O     . PRO A 1 97  ? 54.987  21.220 28.405  1.00 154.56 ? 97  PRO A O     1 
ATOM   600  C CB    . PRO A 1 97  ? 55.840  23.055 25.955  1.00 158.64 ? 97  PRO A CB    1 
ATOM   601  C CG    . PRO A 1 97  ? 55.492  23.894 24.776  1.00 156.13 ? 97  PRO A CG    1 
ATOM   602  C CD    . PRO A 1 97  ? 54.173  24.516 25.125  1.00 150.94 ? 97  PRO A CD    1 
ATOM   603  N N     . ALA A 1 98  ? 54.056  23.253 28.713  1.00 152.85 ? 98  ALA A N     1 
ATOM   604  C CA    . ALA A 1 98  ? 54.035  23.168 30.175  1.00 154.78 ? 98  ALA A CA    1 
ATOM   605  C C     . ALA A 1 98  ? 52.958  22.217 30.698  1.00 149.27 ? 98  ALA A C     1 
ATOM   606  O O     . ALA A 1 98  ? 53.124  21.608 31.758  1.00 152.64 ? 98  ALA A O     1 
ATOM   607  C CB    . ALA A 1 98  ? 53.864  24.552 30.784  1.00 152.03 ? 98  ALA A CB    1 
ATOM   608  N N     . GLY A 1 99  ? 51.862  22.095 29.952  1.00 142.01 ? 99  GLY A N     1 
ATOM   609  C CA    . GLY A 1 99  ? 50.740  21.242 30.346  1.00 140.84 ? 99  GLY A CA    1 
ATOM   610  C C     . GLY A 1 99  ? 50.834  19.805 29.863  1.00 137.39 ? 99  GLY A C     1 
ATOM   611  O O     . GLY A 1 99  ? 49.976  18.981 30.187  1.00 138.55 ? 99  GLY A O     1 
ATOM   612  N N     . LEU A 1 100 ? 51.875  19.507 29.088  1.00 142.39 ? 100 LEU A N     1 
ATOM   613  C CA    . LEU A 1 100 ? 52.091  18.162 28.554  1.00 146.16 ? 100 LEU A CA    1 
ATOM   614  C C     . LEU A 1 100 ? 52.659  17.219 29.613  1.00 146.22 ? 100 LEU A C     1 
ATOM   615  O O     . LEU A 1 100 ? 53.254  17.663 30.598  1.00 148.67 ? 100 LEU A O     1 
ATOM   616  C CB    . LEU A 1 100 ? 53.023  18.205 27.335  1.00 145.22 ? 100 LEU A CB    1 
ATOM   617  C CG    . LEU A 1 100 ? 52.604  18.997 26.090  1.00 149.84 ? 100 LEU A CG    1 
ATOM   618  C CD1   . LEU A 1 100 ? 53.774  19.106 25.123  1.00 152.25 ? 100 LEU A CD1   1 
ATOM   619  C CD2   . LEU A 1 100 ? 51.399  18.373 25.400  1.00 144.64 ? 100 LEU A CD2   1 
ATOM   620  N N     . LYS A 1 101 ? 52.467  15.918 29.402  1.00 142.42 ? 101 LYS A N     1 
ATOM   621  C CA    . LYS A 1 101 ? 52.984  14.893 30.308  1.00 148.48 ? 101 LYS A CA    1 
ATOM   622  C C     . LYS A 1 101 ? 54.413  14.500 29.940  1.00 149.80 ? 101 LYS A C     1 
ATOM   623  O O     . LYS A 1 101 ? 54.770  14.461 28.759  1.00 150.13 ? 101 LYS A O     1 
ATOM   624  C CB    . LYS A 1 101 ? 52.079  13.657 30.300  1.00 150.24 ? 101 LYS A CB    1 
ATOM   625  C CG    . LYS A 1 101 ? 50.716  13.873 30.940  1.00 147.85 ? 101 LYS A CG    1 
ATOM   626  C CD    . LYS A 1 101 ? 49.875  12.608 30.890  1.00 144.98 ? 101 LYS A CD    1 
ATOM   627  C CE    . LYS A 1 101 ? 48.512  12.825 31.527  1.00 139.23 ? 101 LYS A CE    1 
ATOM   628  N NZ    . LYS A 1 101 ? 47.677  11.593 31.485  1.00 145.75 ? 101 LYS A NZ    1 
ATOM   629  N N     . LYS A 1 102 ? 55.221  14.211 30.958  1.00 147.68 ? 102 LYS A N     1 
ATOM   630  C CA    . LYS A 1 102 ? 56.616  13.819 30.766  1.00 142.63 ? 102 LYS A CA    1 
ATOM   631  C C     . LYS A 1 102 ? 56.714  12.388 30.240  1.00 143.79 ? 102 LYS A C     1 
ATOM   632  O O     . LYS A 1 102 ? 56.147  11.461 30.824  1.00 139.00 ? 102 LYS A O     1 
ATOM   633  C CB    . LYS A 1 102 ? 57.402  13.969 32.073  1.00 146.99 ? 102 LYS A CB    1 
ATOM   634  C CG    . LYS A 1 102 ? 58.915  13.897 31.913  1.00 148.42 ? 102 LYS A CG    1 
ATOM   635  C CD    . LYS A 1 102 ? 59.639  14.070 33.241  1.00 145.87 ? 102 LYS A CD    1 
ATOM   636  C CE    . LYS A 1 102 ? 59.636  12.789 34.064  1.00 150.24 ? 102 LYS A CE    1 
ATOM   637  N NZ    . LYS A 1 102 ? 60.345  12.961 35.362  1.00 137.68 ? 102 LYS A NZ    1 
ATOM   638  N N     . LYS A 1 103 ? 57.434  12.222 29.132  1.00 145.96 ? 103 LYS A N     1 
ATOM   639  C CA    . LYS A 1 103 ? 57.582  10.920 28.481  1.00 148.71 ? 103 LYS A CA    1 
ATOM   640  C C     . LYS A 1 103 ? 59.046  10.490 28.405  1.00 142.34 ? 103 LYS A C     1 
ATOM   641  O O     . LYS A 1 103 ? 59.945  11.331 28.317  1.00 143.49 ? 103 LYS A O     1 
ATOM   642  C CB    . LYS A 1 103 ? 56.963  10.941 27.075  1.00 150.31 ? 103 LYS A CB    1 
ATOM   643  C CG    . LYS A 1 103 ? 55.504  11.384 27.012  1.00 151.25 ? 103 LYS A CG    1 
ATOM   644  C CD    . LYS A 1 103 ? 54.567  10.383 27.672  1.00 147.22 ? 103 LYS A CD    1 
ATOM   645  C CE    . LYS A 1 103 ? 53.133  10.887 27.678  1.00 142.63 ? 103 LYS A CE    1 
ATOM   646  N NZ    . LYS A 1 103 ? 52.222  9.951  28.392  1.00 140.94 ? 103 LYS A NZ    1 
ATOM   647  N N     . LYS A 1 104 ? 59.273  9.179  28.436  1.00 142.93 ? 104 LYS A N     1 
ATOM   648  C CA    . LYS A 1 104 ? 60.621  8.614  28.382  1.00 140.80 ? 104 LYS A CA    1 
ATOM   649  C C     . LYS A 1 104 ? 61.203  8.666  26.967  1.00 139.83 ? 104 LYS A C     1 
ATOM   650  O O     . LYS A 1 104 ? 62.333  9.119  26.773  1.00 137.19 ? 104 LYS A O     1 
ATOM   651  C CB    . LYS A 1 104 ? 60.624  7.174  28.917  1.00 151.16 ? 104 LYS A CB    1 
ATOM   652  C CG    . LYS A 1 104 ? 62.006  6.571  29.141  1.00 153.36 ? 104 LYS A CG    1 
ATOM   653  C CD    . LYS A 1 104 ? 62.658  7.093  30.414  1.00 154.14 ? 104 LYS A CD    1 
ATOM   654  C CE    . LYS A 1 104 ? 64.040  6.493  30.612  1.00 156.94 ? 104 LYS A CE    1 
ATOM   655  N NZ    . LYS A 1 104 ? 64.694  6.999  31.850  1.00 165.53 ? 104 LYS A NZ    1 
ATOM   656  N N     . SER A 1 105 ? 60.425  8.202  25.991  1.00 147.40 ? 105 SER A N     1 
ATOM   657  C CA    . SER A 1 105 ? 60.849  8.190  24.592  1.00 147.64 ? 105 SER A CA    1 
ATOM   658  C C     . SER A 1 105 ? 59.780  8.791  23.683  1.00 145.23 ? 105 SER A C     1 
ATOM   659  O O     . SER A 1 105 ? 58.613  8.394  23.736  1.00 144.35 ? 105 SER A O     1 
ATOM   660  C CB    . SER A 1 105 ? 61.191  6.767  24.144  1.00 156.93 ? 105 SER A CB    1 
ATOM   661  O OG    . SER A 1 105 ? 62.257  6.232  24.910  1.00 159.42 ? 105 SER A OG    1 
ATOM   662  N N     . VAL A 1 106 ? 60.188  9.753  22.859  1.00 146.48 ? 106 VAL A N     1 
ATOM   663  C CA    . VAL A 1 106 ? 59.279  10.436 21.936  1.00 142.37 ? 106 VAL A CA    1 
ATOM   664  C C     . VAL A 1 106 ? 59.739  10.239 20.491  1.00 142.29 ? 106 VAL A C     1 
ATOM   665  O O     . VAL A 1 106 ? 60.901  10.492 20.159  1.00 143.07 ? 106 VAL A O     1 
ATOM   666  C CB    . VAL A 1 106 ? 59.159  11.948 22.255  1.00 141.90 ? 106 VAL A CB    1 
ATOM   667  C CG1   . VAL A 1 106 ? 58.109  12.608 21.371  1.00 143.65 ? 106 VAL A CG1   1 
ATOM   668  C CG2   . VAL A 1 106 ? 58.815  12.167 23.722  1.00 144.69 ? 106 VAL A CG2   1 
ATOM   669  N N     . THR A 1 107 ? 58.820  9.781  19.643  1.00 142.03 ? 107 THR A N     1 
ATOM   670  C CA    . THR A 1 107 ? 59.107  9.542  18.229  1.00 141.42 ? 107 THR A CA    1 
ATOM   671  C C     . THR A 1 107 ? 58.035  10.180 17.344  1.00 138.67 ? 107 THR A C     1 
ATOM   672  O O     . THR A 1 107 ? 56.837  9.974  17.556  1.00 136.73 ? 107 THR A O     1 
ATOM   673  C CB    . THR A 1 107 ? 59.214  8.032  17.921  1.00 149.26 ? 107 THR A CB    1 
ATOM   674  O OG1   . THR A 1 107 ? 60.036  7.394  18.907  1.00 150.76 ? 107 THR A OG1   1 
ATOM   675  C CG2   . THR A 1 107 ? 59.818  7.797  16.540  1.00 148.81 ? 107 THR A CG2   1 
ATOM   676  N N     . VAL A 1 108 ? 58.479  10.957 16.358  1.00 139.35 ? 108 VAL A N     1 
ATOM   677  C CA    . VAL A 1 108 ? 57.578  11.629 15.420  1.00 138.55 ? 108 VAL A CA    1 
ATOM   678  C C     . VAL A 1 108 ? 57.443  10.830 14.117  1.00 136.68 ? 108 VAL A C     1 
ATOM   679  O O     . VAL A 1 108 ? 58.383  10.150 13.693  1.00 146.39 ? 108 VAL A O     1 
ATOM   680  C CB    . VAL A 1 108 ? 58.022  13.094 15.153  1.00 137.21 ? 108 VAL A CB    1 
ATOM   681  C CG1   . VAL A 1 108 ? 59.247  13.154 14.246  1.00 139.55 ? 108 VAL A CG1   1 
ATOM   682  C CG2   . VAL A 1 108 ? 56.878  13.918 14.574  1.00 139.42 ? 108 VAL A CG2   1 
ATOM   683  N N     . LEU A 1 109 ? 56.264  10.905 13.502  1.00 139.18 ? 109 LEU A N     1 
ATOM   684  C CA    . LEU A 1 109 ? 56.003  10.235 12.230  1.00 144.27 ? 109 LEU A CA    1 
ATOM   685  C C     . LEU A 1 109 ? 55.481  11.221 11.188  1.00 143.52 ? 109 LEU A C     1 
ATOM   686  O O     . LEU A 1 109 ? 54.450  11.868 11.392  1.00 151.52 ? 109 LEU A O     1 
ATOM   687  C CB    . LEU A 1 109 ? 55.015  9.075  12.410  1.00 154.50 ? 109 LEU A CB    1 
ATOM   688  C CG    . LEU A 1 109 ? 55.508  7.778  13.063  1.00 155.28 ? 109 LEU A CG    1 
ATOM   689  C CD1   . LEU A 1 109 ? 55.408  7.837  14.581  1.00 153.86 ? 109 LEU A CD1   1 
ATOM   690  C CD2   . LEU A 1 109 ? 54.715  6.593  12.532  1.00 148.93 ? 109 LEU A CD2   1 
ATOM   691  N N     . ASP A 1 110 ? 56.207  11.334 10.077  1.00 140.56 ? 110 ASP A N     1 
ATOM   692  C CA    . ASP A 1 110 ? 55.825  12.220 8.980   1.00 142.49 ? 110 ASP A CA    1 
ATOM   693  C C     . ASP A 1 110 ? 55.060  11.451 7.907   1.00 149.79 ? 110 ASP A C     1 
ATOM   694  O O     . ASP A 1 110 ? 55.576  10.492 7.329   1.00 156.00 ? 110 ASP A O     1 
ATOM   695  C CB    . ASP A 1 110 ? 57.060  12.899 8.376   1.00 138.25 ? 110 ASP A CB    1 
ATOM   696  C CG    . ASP A 1 110 ? 57.781  13.801 9.366   1.00 139.32 ? 110 ASP A CG    1 
ATOM   697  O OD1   . ASP A 1 110 ? 57.108  14.564 10.093  1.00 138.96 ? 110 ASP A OD1   1 
ATOM   698  O OD2   . ASP A 1 110 ? 59.029  13.754 9.409   1.00 149.97 ? 110 ASP A OD2   1 
ATOM   699  N N     . VAL A 1 111 ? 53.826  11.879 7.651   1.00 141.06 ? 111 VAL A N     1 
ATOM   700  C CA    . VAL A 1 111 ? 52.956  11.207 6.687   1.00 146.61 ? 111 VAL A CA    1 
ATOM   701  C C     . VAL A 1 111 ? 53.274  11.642 5.255   1.00 140.05 ? 111 VAL A C     1 
ATOM   702  O O     . VAL A 1 111 ? 53.162  12.822 4.911   1.00 118.33 ? 111 VAL A O     1 
ATOM   703  C CB    . VAL A 1 111 ? 51.458  11.436 7.010   1.00 147.29 ? 111 VAL A CB    1 
ATOM   704  C CG1   . VAL A 1 111 ? 50.568  10.837 5.929   1.00 160.95 ? 111 VAL A CG1   1 
ATOM   705  C CG2   . VAL A 1 111 ? 51.107  10.841 8.366   1.00 162.10 ? 111 VAL A CG2   1 
ATOM   706  N N     . GLY A 1 112 ? 53.683  10.677 4.435   1.00 151.07 ? 112 GLY A N     1 
ATOM   707  C CA    . GLY A 1 112 ? 53.935  10.909 3.014   1.00 149.67 ? 112 GLY A CA    1 
ATOM   708  C C     . GLY A 1 112 ? 52.683  10.656 2.197   1.00 155.24 ? 112 GLY A C     1 
ATOM   709  O O     . GLY A 1 112 ? 51.978  9.668  2.424   1.00 164.33 ? 112 GLY A O     1 
ATOM   710  N N     . ASP A 1 113 ? 52.417  11.551 1.243   1.00 141.92 ? 113 ASP A N     1 
ATOM   711  C CA    . ASP A 1 113 ? 51.195  11.528 0.426   1.00 154.50 ? 113 ASP A CA    1 
ATOM   712  C C     . ASP A 1 113 ? 49.937  11.542 1.302   1.00 160.26 ? 113 ASP A C     1 
ATOM   713  O O     . ASP A 1 113 ? 49.132  10.607 1.278   1.00 170.37 ? 113 ASP A O     1 
ATOM   714  C CB    . ASP A 1 113 ? 51.191  10.336 -0.547  1.00 155.17 ? 113 ASP A CB    1 
ATOM   715  C CG    . ASP A 1 113 ? 52.333  10.390 -1.550  1.00 145.55 ? 113 ASP A CG    1 
ATOM   716  O OD1   . ASP A 1 113 ? 52.569  11.466 -2.143  1.00 141.84 ? 113 ASP A OD1   1 
ATOM   717  O OD2   . ASP A 1 113 ? 52.998  9.351  -1.746  1.00 152.97 ? 113 ASP A OD2   1 
ATOM   718  N N     . ALA A 1 114 ? 49.790  12.615 2.076   1.00 151.14 ? 114 ALA A N     1 
ATOM   719  C CA    . ALA A 1 114 ? 48.698  12.753 3.039   1.00 152.12 ? 114 ALA A CA    1 
ATOM   720  C C     . ALA A 1 114 ? 47.355  13.030 2.363   1.00 141.66 ? 114 ALA A C     1 
ATOM   721  O O     . ALA A 1 114 ? 46.397  12.275 2.542   1.00 136.09 ? 114 ALA A O     1 
ATOM   722  C CB    . ALA A 1 114 ? 49.024  13.840 4.054   1.00 149.32 ? 114 ALA A CB    1 
ATOM   723  N N     . TYR A 1 115 ? 47.297  14.110 1.586   1.00 134.91 ? 115 TYR A N     1 
ATOM   724  C CA    . TYR A 1 115 ? 46.072  14.506 0.891   1.00 136.75 ? 115 TYR A CA    1 
ATOM   725  C C     . TYR A 1 115 ? 45.856  13.706 -0.395  1.00 131.36 ? 115 TYR A C     1 
ATOM   726  O O     . TYR A 1 115 ? 44.757  13.702 -0.956  1.00 141.18 ? 115 TYR A O     1 
ATOM   727  C CB    . TYR A 1 115 ? 46.081  16.011 0.600   1.00 150.86 ? 115 TYR A CB    1 
ATOM   728  C CG    . TYR A 1 115 ? 46.198  16.877 1.838   1.00 156.61 ? 115 TYR A CG    1 
ATOM   729  C CD1   . TYR A 1 115 ? 45.076  17.179 2.611   1.00 158.13 ? 115 TYR A CD1   1 
ATOM   730  C CD2   . TYR A 1 115 ? 47.431  17.394 2.236   1.00 157.58 ? 115 TYR A CD2   1 
ATOM   731  C CE1   . TYR A 1 115 ? 45.180  17.969 3.746   1.00 157.60 ? 115 TYR A CE1   1 
ATOM   732  C CE2   . TYR A 1 115 ? 47.544  18.186 3.369   1.00 155.13 ? 115 TYR A CE2   1 
ATOM   733  C CZ    . TYR A 1 115 ? 46.417  18.471 4.119   1.00 155.42 ? 115 TYR A CZ    1 
ATOM   734  O OH    . TYR A 1 115 ? 46.525  19.257 5.244   1.00 156.63 ? 115 TYR A OH    1 
ATOM   735  N N     . PHE A 1 116 ? 46.911  13.031 -0.849  1.00 130.53 ? 116 PHE A N     1 
ATOM   736  C CA    . PHE A 1 116 ? 46.851  12.179 -2.037  1.00 133.75 ? 116 PHE A CA    1 
ATOM   737  C C     . PHE A 1 116 ? 46.184  10.836 -1.738  1.00 148.43 ? 116 PHE A C     1 
ATOM   738  O O     . PHE A 1 116 ? 45.658  10.182 -2.642  1.00 157.13 ? 116 PHE A O     1 
ATOM   739  C CB    . PHE A 1 116 ? 48.255  11.952 -2.609  1.00 144.17 ? 116 PHE A CB    1 
ATOM   740  C CG    . PHE A 1 116 ? 48.940  13.212 -3.064  1.00 142.82 ? 116 PHE A CG    1 
ATOM   741  C CD1   . PHE A 1 116 ? 48.715  13.722 -4.340  1.00 136.87 ? 116 PHE A CD1   1 
ATOM   742  C CD2   . PHE A 1 116 ? 49.818  13.887 -2.221  1.00 147.07 ? 116 PHE A CD2   1 
ATOM   743  C CE1   . PHE A 1 116 ? 49.347  14.882 -4.762  1.00 137.27 ? 116 PHE A CE1   1 
ATOM   744  C CE2   . PHE A 1 116 ? 50.452  15.048 -2.638  1.00 148.28 ? 116 PHE A CE2   1 
ATOM   745  C CZ    . PHE A 1 116 ? 50.217  15.546 -3.910  1.00 146.73 ? 116 PHE A CZ    1 
ATOM   746  N N     . SER A 1 117 ? 46.215  10.432 -0.469  1.00 152.36 ? 117 SER A N     1 
ATOM   747  C CA    . SER A 1 117 ? 45.615  9.172  -0.031  1.00 157.66 ? 117 SER A CA    1 
ATOM   748  C C     . SER A 1 117 ? 44.115  9.316  0.229   1.00 159.83 ? 117 SER A C     1 
ATOM   749  O O     . SER A 1 117 ? 43.314  8.531  -0.283  1.00 159.49 ? 117 SER A O     1 
ATOM   750  C CB    . SER A 1 117 ? 46.324  8.646  1.220   1.00 155.24 ? 117 SER A CB    1 
ATOM   751  O OG    . SER A 1 117 ? 46.231  9.574  2.287   1.00 159.33 ? 117 SER A OG    1 
ATOM   752  N N     . VAL A 1 118 ? 43.748  10.319 1.026   1.00 160.39 ? 118 VAL A N     1 
ATOM   753  C CA    . VAL A 1 118 ? 42.346  10.591 1.349   1.00 151.58 ? 118 VAL A CA    1 
ATOM   754  C C     . VAL A 1 118 ? 41.667  11.281 0.161   1.00 147.55 ? 118 VAL A C     1 
ATOM   755  O O     . VAL A 1 118 ? 42.075  12.376 -0.237  1.00 155.96 ? 118 VAL A O     1 
ATOM   756  C CB    . VAL A 1 118 ? 42.201  11.435 2.638   1.00 148.11 ? 118 VAL A CB    1 
ATOM   757  C CG1   . VAL A 1 118 ? 40.735  11.689 2.960   1.00 127.99 ? 118 VAL A CG1   1 
ATOM   758  C CG2   . VAL A 1 118 ? 42.882  10.742 3.810   1.00 159.16 ? 118 VAL A CG2   1 
ATOM   759  N N     . PRO A 1 119 ? 40.631  10.636 -0.410  1.00 132.73 ? 119 PRO A N     1 
ATOM   760  C CA    . PRO A 1 119 ? 39.984  11.120 -1.627  1.00 137.52 ? 119 PRO A CA    1 
ATOM   761  C C     . PRO A 1 119 ? 38.840  12.110 -1.383  1.00 147.79 ? 119 PRO A C     1 
ATOM   762  O O     . PRO A 1 119 ? 38.488  12.390 -0.235  1.00 155.40 ? 119 PRO A O     1 
ATOM   763  C CB    . PRO A 1 119 ? 39.453  9.835  -2.265  1.00 138.83 ? 119 PRO A CB    1 
ATOM   764  C CG    . PRO A 1 119 ? 39.241  8.892  -1.124  1.00 143.42 ? 119 PRO A CG    1 
ATOM   765  C CD    . PRO A 1 119 ? 40.021  9.380  0.066   1.00 140.26 ? 119 PRO A CD    1 
ATOM   766  N N     . LEU A 1 120 ? 38.278  12.626 -2.475  1.00 149.60 ? 120 LEU A N     1 
ATOM   767  C CA    . LEU A 1 120 ? 37.174  13.581 -2.430  1.00 152.43 ? 120 LEU A CA    1 
ATOM   768  C C     . LEU A 1 120 ? 35.904  12.957 -3.011  1.00 143.27 ? 120 LEU A C     1 
ATOM   769  O O     . LEU A 1 120 ? 35.976  12.051 -3.846  1.00 142.68 ? 120 LEU A O     1 
ATOM   770  C CB    . LEU A 1 120 ? 37.552  14.851 -3.203  1.00 157.83 ? 120 LEU A CB    1 
ATOM   771  C CG    . LEU A 1 120 ? 36.724  16.132 -3.048  1.00 164.02 ? 120 LEU A CG    1 
ATOM   772  C CD1   . LEU A 1 120 ? 36.945  16.782 -1.688  1.00 167.84 ? 120 LEU A CD1   1 
ATOM   773  C CD2   . LEU A 1 120 ? 37.067  17.106 -4.164  1.00 166.98 ? 120 LEU A CD2   1 
ATOM   774  N N     . ASP A 1 121 ? 34.748  13.446 -2.561  1.00 133.01 ? 121 ASP A N     1 
ATOM   775  C CA    . ASP A 1 121 ? 33.447  12.952 -3.017  1.00 136.58 ? 121 ASP A CA    1 
ATOM   776  C C     . ASP A 1 121 ? 33.199  13.272 -4.492  1.00 144.22 ? 121 ASP A C     1 
ATOM   777  O O     . ASP A 1 121 ? 33.570  14.346 -4.971  1.00 149.30 ? 121 ASP A O     1 
ATOM   778  C CB    . ASP A 1 121 ? 32.323  13.534 -2.152  1.00 136.64 ? 121 ASP A CB    1 
ATOM   779  C CG    . ASP A 1 121 ? 30.971  12.889 -2.425  1.00 133.02 ? 121 ASP A CG    1 
ATOM   780  O OD1   . ASP A 1 121 ? 30.891  11.642 -2.452  1.00 130.66 ? 121 ASP A OD1   1 
ATOM   781  O OD2   . ASP A 1 121 ? 29.987  13.634 -2.615  1.00 126.87 ? 121 ASP A OD2   1 
ATOM   782  N N     . GLU A 1 122 ? 32.562  12.332 -5.191  1.00 144.14 ? 122 GLU A N     1 
ATOM   783  C CA    . GLU A 1 122 ? 32.289  12.434 -6.632  1.00 149.08 ? 122 GLU A CA    1 
ATOM   784  C C     . GLU A 1 122 ? 31.532  13.700 -7.043  1.00 155.05 ? 122 GLU A C     1 
ATOM   785  O O     . GLU A 1 122 ? 31.767  14.242 -8.126  1.00 156.41 ? 122 GLU A O     1 
ATOM   786  C CB    . GLU A 1 122 ? 31.526  11.197 -7.119  1.00 137.61 ? 122 GLU A CB    1 
ATOM   787  C CG    . GLU A 1 122 ? 32.379  9.945  -7.285  1.00 146.07 ? 122 GLU A CG    1 
ATOM   788  C CD    . GLU A 1 122 ? 33.208  9.944  -8.560  1.00 150.93 ? 122 GLU A CD    1 
ATOM   789  O OE1   . GLU A 1 122 ? 32.851  10.659 -9.522  1.00 150.84 ? 122 GLU A OE1   1 
ATOM   790  O OE2   . GLU A 1 122 ? 34.221  9.214  -8.604  1.00 156.37 ? 122 GLU A OE2   1 
ATOM   791  N N     . ASP A 1 123 ? 30.627  14.156 -6.180  1.00 150.78 ? 123 ASP A N     1 
ATOM   792  C CA    . ASP A 1 123 ? 29.823  15.351 -6.442  1.00 152.60 ? 123 ASP A CA    1 
ATOM   793  C C     . ASP A 1 123 ? 30.650  16.636 -6.404  1.00 153.41 ? 123 ASP A C     1 
ATOM   794  O O     . ASP A 1 123 ? 30.368  17.582 -7.143  1.00 154.68 ? 123 ASP A O     1 
ATOM   795  C CB    . ASP A 1 123 ? 28.658  15.445 -5.449  1.00 147.28 ? 123 ASP A CB    1 
ATOM   796  C CG    . ASP A 1 123 ? 27.657  14.310 -5.606  1.00 141.24 ? 123 ASP A CG    1 
ATOM   797  O OD1   . ASP A 1 123 ? 27.249  14.017 -6.751  1.00 140.06 ? 123 ASP A OD1   1 
ATOM   798  O OD2   . ASP A 1 123 ? 27.269  13.717 -4.578  1.00 144.22 ? 123 ASP A OD2   1 
ATOM   799  N N     . PHE A 1 124 ? 31.669  16.659 -5.546  1.00 146.41 ? 124 PHE A N     1 
ATOM   800  C CA    . PHE A 1 124 ? 32.527  17.833 -5.379  1.00 138.97 ? 124 PHE A CA    1 
ATOM   801  C C     . PHE A 1 124 ? 33.730  17.816 -6.328  1.00 138.16 ? 124 PHE A C     1 
ATOM   802  O O     . PHE A 1 124 ? 34.401  18.836 -6.505  1.00 149.71 ? 124 PHE A O     1 
ATOM   803  C CB    . PHE A 1 124 ? 32.992  17.948 -3.922  1.00 140.10 ? 124 PHE A CB    1 
ATOM   804  C CG    . PHE A 1 124 ? 33.338  19.351 -3.501  1.00 148.84 ? 124 PHE A CG    1 
ATOM   805  C CD1   . PHE A 1 124 ? 32.345  20.229 -3.076  1.00 152.53 ? 124 PHE A CD1   1 
ATOM   806  C CD2   . PHE A 1 124 ? 34.657  19.794 -3.518  1.00 155.97 ? 124 PHE A CD2   1 
ATOM   807  C CE1   . PHE A 1 124 ? 32.660  21.522 -2.685  1.00 159.31 ? 124 PHE A CE1   1 
ATOM   808  C CE2   . PHE A 1 124 ? 34.978  21.086 -3.130  1.00 147.06 ? 124 PHE A CE2   1 
ATOM   809  C CZ    . PHE A 1 124 ? 33.979  21.951 -2.711  1.00 146.61 ? 124 PHE A CZ    1 
ATOM   810  N N     . ARG A 1 125 ? 33.987  16.660 -6.939  1.00 132.91 ? 125 ARG A N     1 
ATOM   811  C CA    . ARG A 1 125 ? 35.120  16.479 -7.856  1.00 139.03 ? 125 ARG A CA    1 
ATOM   812  C C     . ARG A 1 125 ? 35.044  17.357 -9.107  1.00 145.71 ? 125 ARG A C     1 
ATOM   813  O O     . ARG A 1 125 ? 36.075  17.772 -9.642  1.00 156.01 ? 125 ARG A O     1 
ATOM   814  C CB    . ARG A 1 125 ? 35.259  15.008 -8.262  1.00 139.09 ? 125 ARG A CB    1 
ATOM   815  C CG    . ARG A 1 125 ? 35.908  14.126 -7.207  1.00 142.26 ? 125 ARG A CG    1 
ATOM   816  C CD    . ARG A 1 125 ? 36.007  12.682 -7.672  1.00 142.28 ? 125 ARG A CD    1 
ATOM   817  N NE    . ARG A 1 125 ? 36.598  11.821 -6.649  1.00 133.81 ? 125 ARG A NE    1 
ATOM   818  C CZ    . ARG A 1 125 ? 36.966  10.557 -6.841  1.00 136.28 ? 125 ARG A CZ    1 
ATOM   819  N NH1   . ARG A 1 125 ? 36.815  9.981  -8.028  1.00 143.62 ? 125 ARG A NH1   1 
ATOM   820  N NH2   . ARG A 1 125 ? 37.493  9.864  -5.841  1.00 135.68 ? 125 ARG A NH2   1 
ATOM   821  N N     . LYS A 1 126 ? 33.824  17.634 -9.565  1.00 142.77 ? 126 LYS A N     1 
ATOM   822  C CA    . LYS A 1 126 ? 33.607  18.439 -10.771 1.00 149.15 ? 126 LYS A CA    1 
ATOM   823  C C     . LYS A 1 126 ? 33.834  19.938 -10.552 1.00 148.25 ? 126 LYS A C     1 
ATOM   824  O O     . LYS A 1 126 ? 34.069  20.680 -11.509 1.00 147.02 ? 126 LYS A O     1 
ATOM   825  C CB    . LYS A 1 126 ? 32.215  18.173 -11.366 1.00 143.23 ? 126 LYS A CB    1 
ATOM   826  C CG    . LYS A 1 126 ? 31.040  18.526 -10.465 1.00 148.64 ? 126 LYS A CG    1 
ATOM   827  C CD    . LYS A 1 126 ? 29.732  18.020 -11.055 1.00 156.81 ? 126 LYS A CD    1 
ATOM   828  C CE    . LYS A 1 126 ? 28.527  18.522 -10.274 1.00 160.22 ? 126 LYS A CE    1 
ATOM   829  N NZ    . LYS A 1 126 ? 28.232  19.956 -10.551 1.00 163.68 ? 126 LYS A NZ    1 
ATOM   830  N N     . TYR A 1 127 ? 33.767  20.375 -9.296  1.00 147.84 ? 127 TYR A N     1 
ATOM   831  C CA    . TYR A 1 127 ? 33.983  21.781 -8.950  1.00 151.55 ? 127 TYR A CA    1 
ATOM   832  C C     . TYR A 1 127 ? 35.467  22.134 -8.830  1.00 157.72 ? 127 TYR A C     1 
ATOM   833  O O     . TYR A 1 127 ? 35.840  23.307 -8.910  1.00 170.41 ? 127 TYR A O     1 
ATOM   834  C CB    . TYR A 1 127 ? 33.247  22.145 -7.655  1.00 148.79 ? 127 TYR A CB    1 
ATOM   835  C CG    . TYR A 1 127 ? 31.750  21.914 -7.695  1.00 145.24 ? 127 TYR A CG    1 
ATOM   836  C CD1   . TYR A 1 127 ? 30.934  22.627 -8.576  1.00 152.98 ? 127 TYR A CD1   1 
ATOM   837  C CD2   . TYR A 1 127 ? 31.147  20.994 -6.839  1.00 144.85 ? 127 TYR A CD2   1 
ATOM   838  C CE1   . TYR A 1 127 ? 29.563  22.419 -8.610  1.00 151.75 ? 127 TYR A CE1   1 
ATOM   839  C CE2   . TYR A 1 127 ? 29.776  20.781 -6.865  1.00 146.79 ? 127 TYR A CE2   1 
ATOM   840  C CZ    . TYR A 1 127 ? 28.990  21.496 -7.751  1.00 149.47 ? 127 TYR A CZ    1 
ATOM   841  O OH    . TYR A 1 127 ? 27.630  21.287 -7.780  1.00 157.55 ? 127 TYR A OH    1 
ATOM   842  N N     . THR A 1 128 ? 36.304  21.114 -8.643  1.00 147.04 ? 128 THR A N     1 
ATOM   843  C CA    . THR A 1 128 ? 37.750  21.300 -8.489  1.00 151.47 ? 128 THR A CA    1 
ATOM   844  C C     . THR A 1 128 ? 38.510  21.111 -9.808  1.00 146.93 ? 128 THR A C     1 
ATOM   845  O O     . THR A 1 128 ? 39.708  20.810 -9.810  1.00 164.84 ? 128 THR A O     1 
ATOM   846  C CB    . THR A 1 128 ? 38.332  20.360 -7.409  1.00 154.58 ? 128 THR A CB    1 
ATOM   847  O OG1   . THR A 1 128 ? 37.938  19.009 -7.680  1.00 147.42 ? 128 THR A OG1   1 
ATOM   848  C CG2   . THR A 1 128 ? 37.845  20.761 -6.021  1.00 158.56 ? 128 THR A CG2   1 
ATOM   849  N N     . ALA A 1 129 ? 37.809  21.300 -10.925 1.00 137.71 ? 129 ALA A N     1 
ATOM   850  C CA    . ALA A 1 129 ? 38.397  21.150 -12.255 1.00 138.94 ? 129 ALA A CA    1 
ATOM   851  C C     . ALA A 1 129 ? 39.237  22.366 -12.641 1.00 153.47 ? 129 ALA A C     1 
ATOM   852  O O     . ALA A 1 129 ? 38.791  23.508 -12.508 1.00 153.12 ? 129 ALA A O     1 
ATOM   853  C CB    . ALA A 1 129 ? 37.311  20.899 -13.291 1.00 132.39 ? 129 ALA A CB    1 
ATOM   854  N N     . PHE A 1 130 ? 40.453  22.106 -13.117 1.00 161.98 ? 130 PHE A N     1 
ATOM   855  C CA    . PHE A 1 130 ? 41.377  23.164 -13.528 1.00 162.14 ? 130 PHE A CA    1 
ATOM   856  C C     . PHE A 1 130 ? 41.855  22.976 -14.968 1.00 157.39 ? 130 PHE A C     1 
ATOM   857  O O     . PHE A 1 130 ? 41.945  21.848 -15.459 1.00 152.49 ? 130 PHE A O     1 
ATOM   858  C CB    . PHE A 1 130 ? 42.570  23.255 -12.562 1.00 159.14 ? 130 PHE A CB    1 
ATOM   859  C CG    . PHE A 1 130 ? 43.511  22.080 -12.629 1.00 149.70 ? 130 PHE A CG    1 
ATOM   860  C CD1   . PHE A 1 130 ? 43.221  20.893 -11.961 1.00 146.77 ? 130 PHE A CD1   1 
ATOM   861  C CD2   . PHE A 1 130 ? 44.701  22.167 -13.346 1.00 153.33 ? 130 PHE A CD2   1 
ATOM   862  C CE1   . PHE A 1 130 ? 44.091  19.814 -12.019 1.00 142.82 ? 130 PHE A CE1   1 
ATOM   863  C CE2   . PHE A 1 130 ? 45.575  21.091 -13.408 1.00 151.12 ? 130 PHE A CE2   1 
ATOM   864  C CZ    . PHE A 1 130 ? 45.270  19.914 -12.742 1.00 145.26 ? 130 PHE A CZ    1 
ATOM   865  N N     . THR A 1 131 ? 42.163  24.087 -15.634 1.00 157.31 ? 131 THR A N     1 
ATOM   866  C CA    . THR A 1 131 ? 42.619  24.060 -17.022 1.00 151.82 ? 131 THR A CA    1 
ATOM   867  C C     . THR A 1 131 ? 44.086  24.473 -17.128 1.00 148.78 ? 131 THR A C     1 
ATOM   868  O O     . THR A 1 131 ? 44.485  25.526 -16.621 1.00 146.33 ? 131 THR A O     1 
ATOM   869  C CB    . THR A 1 131 ? 41.757  24.970 -17.924 1.00 151.10 ? 131 THR A CB    1 
ATOM   870  O OG1   . THR A 1 131 ? 40.371  24.801 -17.599 1.00 150.47 ? 131 THR A OG1   1 
ATOM   871  C CG2   . THR A 1 131 ? 41.971  24.637 -19.398 1.00 144.23 ? 131 THR A CG2   1 
ATOM   872  N N     . ILE A 1 132 ? 44.880  23.630 -17.784 1.00 146.89 ? 132 ILE A N     1 
ATOM   873  C CA    . ILE A 1 132 ? 46.289  23.919 -18.048 1.00 157.84 ? 132 ILE A CA    1 
ATOM   874  C C     . ILE A 1 132 ? 46.410  24.914 -19.214 1.00 161.91 ? 132 ILE A C     1 
ATOM   875  O O     . ILE A 1 132 ? 45.757  24.736 -20.247 1.00 146.30 ? 132 ILE A O     1 
ATOM   876  C CB    . ILE A 1 132 ? 47.105  22.615 -18.296 1.00 151.97 ? 132 ILE A CB    1 
ATOM   877  C CG1   . ILE A 1 132 ? 48.613  22.894 -18.384 1.00 162.08 ? 132 ILE A CG1   1 
ATOM   878  C CG2   . ILE A 1 132 ? 46.609  21.856 -19.524 1.00 133.57 ? 132 ILE A CG2   1 
ATOM   879  C CD1   . ILE A 1 132 ? 49.314  22.958 -17.042 1.00 155.68 ? 132 ILE A CD1   1 
ATOM   880  N N     . PRO A 1 133 ? 47.219  25.982 -19.037 1.00 174.92 ? 133 PRO A N     1 
ATOM   881  C CA    . PRO A 1 133 ? 47.442  26.981 -20.089 1.00 173.33 ? 133 PRO A CA    1 
ATOM   882  C C     . PRO A 1 133 ? 47.898  26.373 -21.417 1.00 170.62 ? 133 PRO A C     1 
ATOM   883  O O     . PRO A 1 133 ? 48.669  25.410 -21.430 1.00 171.19 ? 133 PRO A O     1 
ATOM   884  C CB    . PRO A 1 133 ? 48.545  27.861 -19.500 1.00 165.41 ? 133 PRO A CB    1 
ATOM   885  C CG    . PRO A 1 133 ? 48.323  27.784 -18.031 1.00 162.83 ? 133 PRO A CG    1 
ATOM   886  C CD    . PRO A 1 133 ? 47.853  26.381 -17.765 1.00 168.99 ? 133 PRO A CD    1 
ATOM   887  N N     . SER A 1 134 ? 47.415  26.947 -22.518 1.00 166.07 ? 134 SER A N     1 
ATOM   888  C CA    . SER A 1 134 ? 47.671  26.433 -23.865 1.00 154.42 ? 134 SER A CA    1 
ATOM   889  C C     . SER A 1 134 ? 49.115  26.633 -24.329 1.00 156.81 ? 134 SER A C     1 
ATOM   890  O O     . SER A 1 134 ? 49.870  27.404 -23.732 1.00 153.43 ? 134 SER A O     1 
ATOM   891  C CB    . SER A 1 134 ? 46.702  27.067 -24.868 1.00 151.67 ? 134 SER A CB    1 
ATOM   892  O OG    . SER A 1 134 ? 46.852  28.476 -24.910 1.00 154.33 ? 134 SER A OG    1 
ATOM   893  N N     . ILE A 1 135 ? 49.485  25.929 -25.397 1.00 156.50 ? 135 ILE A N     1 
ATOM   894  C CA    . ILE A 1 135 ? 50.823  26.032 -25.979 1.00 155.96 ? 135 ILE A CA    1 
ATOM   895  C C     . ILE A 1 135 ? 50.879  27.178 -26.993 1.00 151.16 ? 135 ILE A C     1 
ATOM   896  O O     . ILE A 1 135 ? 51.681  28.104 -26.845 1.00 152.89 ? 135 ILE A O     1 
ATOM   897  C CB    . ILE A 1 135 ? 51.269  24.702 -26.643 1.00 148.72 ? 135 ILE A CB    1 
ATOM   898  C CG1   . ILE A 1 135 ? 51.060  23.501 -25.700 1.00 144.59 ? 135 ILE A CG1   1 
ATOM   899  C CG2   . ILE A 1 135 ? 52.711  24.791 -27.137 1.00 150.64 ? 135 ILE A CG2   1 
ATOM   900  C CD1   . ILE A 1 135 ? 51.862  23.529 -24.410 1.00 144.18 ? 135 ILE A CD1   1 
ATOM   901  N N     . ASN A 1 136 ? 50.023  27.108 -28.013 1.00 146.16 ? 136 ASN A N     1 
ATOM   902  C CA    . ASN A 1 136 ? 49.970  28.119 -29.071 1.00 145.93 ? 136 ASN A CA    1 
ATOM   903  C C     . ASN A 1 136 ? 48.598  28.207 -29.740 1.00 156.20 ? 136 ASN A C     1 
ATOM   904  O O     . ASN A 1 136 ? 47.845  27.230 -29.761 1.00 152.00 ? 136 ASN A O     1 
ATOM   905  C CB    . ASN A 1 136 ? 51.048  27.850 -30.126 1.00 144.76 ? 136 ASN A CB    1 
ATOM   906  N N     . ASN A 1 137 ? 48.291  29.389 -30.279 1.00 165.56 ? 137 ASN A N     1 
ATOM   907  C CA    . ASN A 1 137 ? 47.049  29.659 -31.023 1.00 167.68 ? 137 ASN A CA    1 
ATOM   908  C C     . ASN A 1 137 ? 45.747  29.428 -30.241 1.00 158.98 ? 137 ASN A C     1 
ATOM   909  O O     . ASN A 1 137 ? 44.708  29.108 -30.830 1.00 156.68 ? 137 ASN A O     1 
ATOM   910  C CB    . ASN A 1 137 ? 47.033  28.898 -32.359 1.00 164.13 ? 137 ASN A CB    1 
ATOM   911  N N     . GLU A 1 138 ? 45.818  29.606 -28.920 1.00 154.65 ? 138 GLU A N     1 
ATOM   912  C CA    . GLU A 1 138 ? 44.671  29.459 -28.011 1.00 149.04 ? 138 GLU A CA    1 
ATOM   913  C C     . GLU A 1 138 ? 43.924  28.130 -28.172 1.00 155.38 ? 138 GLU A C     1 
ATOM   914  O O     . GLU A 1 138 ? 42.741  28.102 -28.525 1.00 160.34 ? 138 GLU A O     1 
ATOM   915  C CB    . GLU A 1 138 ? 43.714  30.654 -28.136 1.00 147.17 ? 138 GLU A CB    1 
ATOM   916  N N     . THR A 1 139 ? 44.634  27.035 -27.912 1.00 162.67 ? 139 THR A N     1 
ATOM   917  C CA    . THR A 1 139 ? 44.062  25.689 -27.975 1.00 153.62 ? 139 THR A CA    1 
ATOM   918  C C     . THR A 1 139 ? 43.339  25.336 -26.671 1.00 159.54 ? 139 THR A C     1 
ATOM   919  O O     . THR A 1 139 ? 43.719  25.828 -25.606 1.00 161.11 ? 139 THR A O     1 
ATOM   920  C CB    . THR A 1 139 ? 45.142  24.623 -28.269 1.00 143.27 ? 139 THR A CB    1 
ATOM   921  O OG1   . THR A 1 139 ? 46.274  24.831 -27.414 1.00 138.12 ? 139 THR A OG1   1 
ATOM   922  C CG2   . THR A 1 139 ? 45.587  24.692 -29.725 1.00 139.23 ? 139 THR A CG2   1 
ATOM   923  N N     . PRO A 1 140 ? 42.289  24.490 -26.750 1.00 157.88 ? 140 PRO A N     1 
ATOM   924  C CA    . PRO A 1 140 ? 41.568  24.057 -25.546 1.00 158.05 ? 140 PRO A CA    1 
ATOM   925  C C     . PRO A 1 140 ? 42.431  23.235 -24.583 1.00 159.34 ? 140 PRO A C     1 
ATOM   926  O O     . PRO A 1 140 ? 42.250  23.327 -23.367 1.00 163.13 ? 140 PRO A O     1 
ATOM   927  C CB    . PRO A 1 140 ? 40.423  23.198 -26.104 1.00 154.75 ? 140 PRO A CB    1 
ATOM   928  C CG    . PRO A 1 140 ? 40.856  22.809 -27.477 1.00 147.20 ? 140 PRO A CG    1 
ATOM   929  C CD    . PRO A 1 140 ? 41.655  23.973 -27.977 1.00 145.77 ? 140 PRO A CD    1 
ATOM   930  N N     . GLY A 1 141 ? 43.356  22.448 -25.130 1.00 152.09 ? 141 GLY A N     1 
ATOM   931  C CA    . GLY A 1 141 ? 44.261  21.627 -24.327 1.00 152.92 ? 141 GLY A CA    1 
ATOM   932  C C     . GLY A 1 141 ? 43.582  20.426 -23.696 1.00 150.38 ? 141 GLY A C     1 
ATOM   933  O O     . GLY A 1 141 ? 42.583  19.921 -24.216 1.00 141.34 ? 141 GLY A O     1 
ATOM   934  N N     . ILE A 1 142 ? 44.131  19.970 -22.572 1.00 154.85 ? 142 ILE A N     1 
ATOM   935  C CA    . ILE A 1 142 ? 43.582  18.827 -21.842 1.00 152.38 ? 142 ILE A CA    1 
ATOM   936  C C     . ILE A 1 142 ? 43.061  19.275 -20.475 1.00 154.14 ? 142 ILE A C     1 
ATOM   937  O O     . ILE A 1 142 ? 43.787  19.896 -19.695 1.00 159.26 ? 142 ILE A O     1 
ATOM   938  C CB    . ILE A 1 142 ? 44.623  17.688 -21.669 1.00 154.59 ? 142 ILE A CB    1 
ATOM   939  C CG1   . ILE A 1 142 ? 45.390  17.413 -22.977 1.00 158.84 ? 142 ILE A CG1   1 
ATOM   940  C CG2   . ILE A 1 142 ? 43.963  16.424 -21.124 1.00 149.74 ? 142 ILE A CG2   1 
ATOM   941  C CD1   . ILE A 1 142 ? 44.556  16.890 -24.134 1.00 150.91 ? 142 ILE A CD1   1 
ATOM   942  N N     . ARG A 1 143 ? 41.797  18.957 -20.202 1.00 150.73 ? 143 ARG A N     1 
ATOM   943  C CA    . ARG A 1 143 ? 41.146  19.324 -18.945 1.00 154.15 ? 143 ARG A CA    1 
ATOM   944  C C     . ARG A 1 143 ? 41.393  18.277 -17.860 1.00 149.99 ? 143 ARG A C     1 
ATOM   945  O O     . ARG A 1 143 ? 41.386  17.074 -18.133 1.00 143.90 ? 143 ARG A O     1 
ATOM   946  C CB    . ARG A 1 143 ? 39.639  19.511 -19.157 1.00 154.61 ? 143 ARG A CB    1 
ATOM   947  C CG    . ARG A 1 143 ? 39.255  20.706 -20.022 1.00 154.12 ? 143 ARG A CG    1 
ATOM   948  C CD    . ARG A 1 143 ? 39.019  21.964 -19.198 1.00 150.27 ? 143 ARG A CD    1 
ATOM   949  N NE    . ARG A 1 143 ? 37.811  21.867 -18.379 1.00 144.90 ? 143 ARG A NE    1 
ATOM   950  C CZ    . ARG A 1 143 ? 37.241  22.887 -17.742 1.00 152.49 ? 143 ARG A CZ    1 
ATOM   951  N NH1   . ARG A 1 143 ? 37.756  24.108 -17.821 1.00 153.67 ? 143 ARG A NH1   1 
ATOM   952  N NH2   . ARG A 1 143 ? 36.145  22.687 -17.024 1.00 153.67 ? 143 ARG A NH2   1 
ATOM   953  N N     . TYR A 1 144 ? 41.610  18.748 -16.634 1.00 156.49 ? 144 TYR A N     1 
ATOM   954  C CA    . TYR A 1 144 ? 41.850  17.871 -15.487 1.00 155.93 ? 144 TYR A CA    1 
ATOM   955  C C     . TYR A 1 144 ? 41.024  18.290 -14.273 1.00 152.56 ? 144 TYR A C     1 
ATOM   956  O O     . TYR A 1 144 ? 40.785  19.480 -14.055 1.00 152.26 ? 144 TYR A O     1 
ATOM   957  C CB    . TYR A 1 144 ? 43.337  17.860 -15.116 1.00 162.17 ? 144 TYR A CB    1 
ATOM   958  C CG    . TYR A 1 144 ? 44.248  17.273 -16.172 1.00 161.74 ? 144 TYR A CG    1 
ATOM   959  C CD1   . TYR A 1 144 ? 44.455  15.895 -16.255 1.00 151.71 ? 144 TYR A CD1   1 
ATOM   960  C CD2   . TYR A 1 144 ? 44.915  18.095 -17.080 1.00 163.54 ? 144 TYR A CD2   1 
ATOM   961  C CE1   . TYR A 1 144 ? 45.293  15.354 -17.218 1.00 148.81 ? 144 TYR A CE1   1 
ATOM   962  C CE2   . TYR A 1 144 ? 45.756  17.563 -18.046 1.00 161.52 ? 144 TYR A CE2   1 
ATOM   963  C CZ    . TYR A 1 144 ? 45.941  16.193 -18.110 1.00 158.55 ? 144 TYR A CZ    1 
ATOM   964  O OH    . TYR A 1 144 ? 46.774  15.660 -19.068 1.00 163.73 ? 144 TYR A OH    1 
ATOM   965  N N     . GLN A 1 145 ? 40.596  17.304 -13.488 1.00 147.99 ? 145 GLN A N     1 
ATOM   966  C CA    . GLN A 1 145 ? 39.862  17.553 -12.245 1.00 146.49 ? 145 GLN A CA    1 
ATOM   967  C C     . GLN A 1 145 ? 40.421  16.730 -11.085 1.00 147.98 ? 145 GLN A C     1 
ATOM   968  O O     . GLN A 1 145 ? 40.850  15.589 -11.273 1.00 147.01 ? 145 GLN A O     1 
ATOM   969  C CB    . GLN A 1 145 ? 38.358  17.297 -12.424 1.00 142.96 ? 145 GLN A CB    1 
ATOM   970  C CG    . GLN A 1 145 ? 37.982  15.883 -12.851 1.00 146.51 ? 145 GLN A CG    1 
ATOM   971  C CD    . GLN A 1 145 ? 36.487  15.621 -12.783 1.00 146.80 ? 145 GLN A CD    1 
ATOM   972  O OE1   . GLN A 1 145 ? 35.672  16.488 -13.103 1.00 153.11 ? 145 GLN A OE1   1 
ATOM   973  N NE2   . GLN A 1 145 ? 36.120  14.412 -12.372 1.00 143.76 ? 145 GLN A NE2   1 
ATOM   974  N N     . TYR A 1 146 ? 40.413  17.318 -9.890  1.00 146.84 ? 146 TYR A N     1 
ATOM   975  C CA    . TYR A 1 146 ? 40.924  16.655 -8.692  1.00 143.31 ? 146 TYR A CA    1 
ATOM   976  C C     . TYR A 1 146 ? 39.970  15.580 -8.177  1.00 155.33 ? 146 TYR A C     1 
ATOM   977  O O     . TYR A 1 146 ? 38.799  15.854 -7.898  1.00 162.96 ? 146 TYR A O     1 
ATOM   978  C CB    . TYR A 1 146 ? 41.214  17.675 -7.585  1.00 137.73 ? 146 TYR A CB    1 
ATOM   979  C CG    . TYR A 1 146 ? 42.525  18.414 -7.743  1.00 146.25 ? 146 TYR A CG    1 
ATOM   980  C CD1   . TYR A 1 146 ? 43.723  17.850 -7.301  1.00 147.29 ? 146 TYR A CD1   1 
ATOM   981  C CD2   . TYR A 1 146 ? 42.568  19.681 -8.324  1.00 159.34 ? 146 TYR A CD2   1 
ATOM   982  C CE1   . TYR A 1 146 ? 44.927  18.525 -7.441  1.00 144.82 ? 146 TYR A CE1   1 
ATOM   983  C CE2   . TYR A 1 146 ? 43.767  20.363 -8.466  1.00 153.19 ? 146 TYR A CE2   1 
ATOM   984  C CZ    . TYR A 1 146 ? 44.942  19.781 -8.024  1.00 149.40 ? 146 TYR A CZ    1 
ATOM   985  O OH    . TYR A 1 146 ? 46.134  20.455 -8.165  1.00 153.92 ? 146 TYR A OH    1 
ATOM   986  N N     . ASN A 1 147 ? 40.482  14.357 -8.064  1.00 157.45 ? 147 ASN A N     1 
ATOM   987  C CA    . ASN A 1 147 ? 39.731  13.241 -7.492  1.00 154.52 ? 147 ASN A CA    1 
ATOM   988  C C     . ASN A 1 147 ? 39.984  13.105 -5.993  1.00 146.45 ? 147 ASN A C     1 
ATOM   989  O O     . ASN A 1 147 ? 39.122  12.629 -5.250  1.00 146.90 ? 147 ASN A O     1 
ATOM   990  C CB    . ASN A 1 147 ? 40.073  11.931 -8.209  1.00 149.84 ? 147 ASN A CB    1 
ATOM   991  C CG    . ASN A 1 147 ? 39.654  11.932 -9.669  1.00 145.93 ? 147 ASN A CG    1 
ATOM   992  O OD1   . ASN A 1 147 ? 38.548  12.352 -10.014 1.00 136.13 ? 147 ASN A OD1   1 
ATOM   993  N ND2   . ASN A 1 147 ? 40.537  11.449 -10.534 1.00 151.73 ? 147 ASN A ND2   1 
ATOM   994  N N     . VAL A 1 148 ? 41.173  13.523 -5.565  1.00 135.26 ? 148 VAL A N     1 
ATOM   995  C CA    . VAL A 1 148 ? 41.554  13.520 -4.151  1.00 133.82 ? 148 VAL A CA    1 
ATOM   996  C C     . VAL A 1 148 ? 41.520  14.939 -3.574  1.00 136.01 ? 148 VAL A C     1 
ATOM   997  O O     . VAL A 1 148 ? 41.063  15.872 -4.241  1.00 135.20 ? 148 VAL A O     1 
ATOM   998  C CB    . VAL A 1 148 ? 42.942  12.869 -3.926  1.00 138.83 ? 148 VAL A CB    1 
ATOM   999  C CG1   . VAL A 1 148 ? 42.879  11.370 -4.181  1.00 145.69 ? 148 VAL A CG1   1 
ATOM   1000 C CG2   . VAL A 1 148 ? 44.009  13.524 -4.798  1.00 145.72 ? 148 VAL A CG2   1 
ATOM   1001 N N     . LEU A 1 149 ? 41.995  15.093 -2.339  1.00 140.15 ? 149 LEU A N     1 
ATOM   1002 C CA    . LEU A 1 149 ? 42.042  16.398 -1.678  1.00 140.80 ? 149 LEU A CA    1 
ATOM   1003 C C     . LEU A 1 149 ? 43.100  17.308 -2.309  1.00 146.19 ? 149 LEU A C     1 
ATOM   1004 O O     . LEU A 1 149 ? 44.282  16.955 -2.339  1.00 159.77 ? 149 LEU A O     1 
ATOM   1005 C CB    . LEU A 1 149 ? 42.301  16.243 -0.174  1.00 145.16 ? 149 LEU A CB    1 
ATOM   1006 C CG    . LEU A 1 149 ? 41.221  15.602 0.707   1.00 154.14 ? 149 LEU A CG    1 
ATOM   1007 C CD1   . LEU A 1 149 ? 41.797  15.249 2.070   1.00 155.83 ? 149 LEU A CD1   1 
ATOM   1008 C CD2   . LEU A 1 149 ? 40.003  16.503 0.858   1.00 154.49 ? 149 LEU A CD2   1 
ATOM   1009 N N     . PRO A 1 150 ? 42.674  18.479 -2.822  1.00 141.92 ? 150 PRO A N     1 
ATOM   1010 C CA    . PRO A 1 150 ? 43.597  19.421 -3.456  1.00 148.93 ? 150 PRO A CA    1 
ATOM   1011 C C     . PRO A 1 150 ? 44.425  20.207 -2.439  1.00 152.24 ? 150 PRO A C     1 
ATOM   1012 O O     . PRO A 1 150 ? 44.001  20.381 -1.294  1.00 154.19 ? 150 PRO A O     1 
ATOM   1013 C CB    . PRO A 1 150 ? 42.664  20.359 -4.224  1.00 153.72 ? 150 PRO A CB    1 
ATOM   1014 C CG    . PRO A 1 150 ? 41.390  20.337 -3.454  1.00 152.82 ? 150 PRO A CG    1 
ATOM   1015 C CD    . PRO A 1 150 ? 41.280  18.966 -2.847  1.00 142.82 ? 150 PRO A CD    1 
ATOM   1016 N N     . GLN A 1 151 ? 45.596  20.672 -2.868  1.00 148.30 ? 151 GLN A N     1 
ATOM   1017 C CA    . GLN A 1 151 ? 46.489  21.448 -2.010  1.00 150.52 ? 151 GLN A CA    1 
ATOM   1018 C C     . GLN A 1 151 ? 46.059  22.913 -1.957  1.00 145.80 ? 151 GLN A C     1 
ATOM   1019 O O     . GLN A 1 151 ? 46.125  23.627 -2.961  1.00 143.92 ? 151 GLN A O     1 
ATOM   1020 C CB    . GLN A 1 151 ? 47.943  21.333 -2.488  1.00 155.54 ? 151 GLN A CB    1 
ATOM   1021 C CG    . GLN A 1 151 ? 48.535  19.929 -2.414  1.00 151.07 ? 151 GLN A CG    1 
ATOM   1022 C CD    . GLN A 1 151 ? 48.824  19.468 -0.994  1.00 146.99 ? 151 GLN A CD    1 
ATOM   1023 O OE1   . GLN A 1 151 ? 49.111  20.273 -0.107  1.00 141.13 ? 151 GLN A OE1   1 
ATOM   1024 N NE2   . GLN A 1 151 ? 48.758  18.159 -0.778  1.00 148.77 ? 151 GLN A NE2   1 
ATOM   1025 N N     . GLY A 1 152 ? 45.611  23.347 -0.781  1.00 140.88 ? 152 GLY A N     1 
ATOM   1026 C CA    . GLY A 1 152 ? 45.184  24.729 -0.569  1.00 145.82 ? 152 GLY A CA    1 
ATOM   1027 C C     . GLY A 1 152 ? 43.681  24.909 -0.461  1.00 143.25 ? 152 GLY A C     1 
ATOM   1028 O O     . GLY A 1 152 ? 43.154  25.975 -0.787  1.00 144.55 ? 152 GLY A O     1 
ATOM   1029 N N     . TRP A 1 153 ? 42.994  23.867 0.002   1.00 149.13 ? 153 TRP A N     1 
ATOM   1030 C CA    . TRP A 1 153 ? 41.543  23.900 0.175   1.00 143.06 ? 153 TRP A CA    1 
ATOM   1031 C C     . TRP A 1 153 ? 41.175  24.010 1.630   1.00 149.67 ? 153 TRP A C     1 
ATOM   1032 O O     . TRP A 1 153 ? 41.853  23.448 2.494   1.00 160.94 ? 153 TRP A O     1 
ATOM   1033 C CB    . TRP A 1 153 ? 40.902  22.672 -0.472  1.00 142.62 ? 153 TRP A CB    1 
ATOM   1034 C CG    . TRP A 1 153 ? 39.391  22.637 -0.407  1.00 141.21 ? 153 TRP A CG    1 
ATOM   1035 C CD1   . TRP A 1 153 ? 38.497  23.636 -0.788  1.00 150.46 ? 153 TRP A CD1   1 
ATOM   1036 C CD2   . TRP A 1 153 ? 38.543  21.526 0.054   1.00 145.34 ? 153 TRP A CD2   1 
ATOM   1037 N NE1   . TRP A 1 153 ? 37.199  23.236 -0.588  1.00 157.24 ? 153 TRP A NE1   1 
ATOM   1038 C CE2   . TRP A 1 153 ? 37.155  21.983 -0.088  1.00 152.23 ? 153 TRP A CE2   1 
ATOM   1039 C CE3   . TRP A 1 153 ? 38.786  20.250 0.554   1.00 147.30 ? 153 TRP A CE3   1 
ATOM   1040 C CZ2   . TRP A 1 153 ? 36.077  21.181 0.263   1.00 147.57 ? 153 TRP A CZ2   1 
ATOM   1041 C CZ3   . TRP A 1 153 ? 37.689  19.451 0.904   1.00 151.17 ? 153 TRP A CZ3   1 
ATOM   1042 C CH2   . TRP A 1 153 ? 36.369  19.907 0.761   1.00 143.49 ? 153 TRP A CH2   1 
ATOM   1043 N N     . LYS A 1 154 ? 40.096  24.742 1.903   1.00 142.44 ? 154 LYS A N     1 
ATOM   1044 C CA    . LYS A 1 154 ? 39.651  25.037 3.268   1.00 147.01 ? 154 LYS A CA    1 
ATOM   1045 C C     . LYS A 1 154 ? 39.221  23.792 4.049   1.00 145.17 ? 154 LYS A C     1 
ATOM   1046 O O     . LYS A 1 154 ? 39.466  23.695 5.254   1.00 146.70 ? 154 LYS A O     1 
ATOM   1047 C CB    . LYS A 1 154 ? 38.514  26.065 3.241   1.00 137.25 ? 154 LYS A CB    1 
ATOM   1048 C CG    . LYS A 1 154 ? 38.225  26.733 4.577   1.00 134.68 ? 154 LYS A CG    1 
ATOM   1049 C CD    . LYS A 1 154 ? 37.059  27.702 4.469   1.00 138.09 ? 154 LYS A CD    1 
ATOM   1050 C CE    . LYS A 1 154 ? 36.754  28.352 5.809   1.00 139.58 ? 154 LYS A CE    1 
ATOM   1051 N NZ    . LYS A 1 154 ? 35.605  29.295 5.720   1.00 151.09 ? 154 LYS A NZ    1 
ATOM   1052 N N     . GLY A 1 155 ? 38.585  22.848 3.358   1.00 141.90 ? 155 GLY A N     1 
ATOM   1053 C CA    . GLY A 1 155 ? 38.085  21.626 3.988   1.00 143.98 ? 155 GLY A CA    1 
ATOM   1054 C C     . GLY A 1 155 ? 39.072  20.472 4.020   1.00 135.91 ? 155 GLY A C     1 
ATOM   1055 O O     . GLY A 1 155 ? 38.735  19.379 4.480   1.00 131.36 ? 155 GLY A O     1 
ATOM   1056 N N     . SER A 1 156 ? 40.288  20.713 3.534   1.00 129.52 ? 156 SER A N     1 
ATOM   1057 C CA    . SER A 1 156 ? 41.331  19.683 3.478   1.00 137.35 ? 156 SER A CA    1 
ATOM   1058 C C     . SER A 1 156 ? 41.889  19.265 4.850   1.00 144.34 ? 156 SER A C     1 
ATOM   1059 O O     . SER A 1 156 ? 42.044  18.068 5.099   1.00 151.63 ? 156 SER A O     1 
ATOM   1060 C CB    . SER A 1 156 ? 42.464  20.096 2.530   1.00 147.86 ? 156 SER A CB    1 
ATOM   1061 O OG    . SER A 1 156 ? 42.051  20.017 1.177   1.00 145.99 ? 156 SER A OG    1 
ATOM   1062 N N     . PRO A 1 157 ? 42.195  20.238 5.740   1.00 151.42 ? 157 PRO A N     1 
ATOM   1063 C CA    . PRO A 1 157 ? 42.689  19.836 7.063   1.00 150.06 ? 157 PRO A CA    1 
ATOM   1064 C C     . PRO A 1 157 ? 41.589  19.322 7.998   1.00 144.14 ? 157 PRO A C     1 
ATOM   1065 O O     . PRO A 1 157 ? 41.892  18.679 9.006   1.00 151.69 ? 157 PRO A O     1 
ATOM   1066 C CB    . PRO A 1 157 ? 43.295  21.128 7.617   1.00 154.69 ? 157 PRO A CB    1 
ATOM   1067 C CG    . PRO A 1 157 ? 42.527  22.215 6.951   1.00 158.89 ? 157 PRO A CG    1 
ATOM   1068 C CD    . PRO A 1 157 ? 42.216  21.706 5.573   1.00 157.44 ? 157 PRO A CD    1 
ATOM   1069 N N     . ALA A 1 158 ? 40.332  19.603 7.660   1.00 131.66 ? 158 ALA A N     1 
ATOM   1070 C CA    . ALA A 1 158 ? 39.190  19.186 8.473   1.00 134.80 ? 158 ALA A CA    1 
ATOM   1071 C C     . ALA A 1 158 ? 38.850  17.707 8.284   1.00 136.46 ? 158 ALA A C     1 
ATOM   1072 O O     . ALA A 1 158 ? 38.670  16.979 9.262   1.00 135.34 ? 158 ALA A O     1 
ATOM   1073 C CB    . ALA A 1 158 ? 37.978  20.059 8.176   1.00 145.59 ? 158 ALA A CB    1 
ATOM   1074 N N     . ILE A 1 159 ? 38.767  17.275 7.026   1.00 135.43 ? 159 ILE A N     1 
ATOM   1075 C CA    . ILE A 1 159 ? 38.420  15.890 6.687   1.00 141.42 ? 159 ILE A CA    1 
ATOM   1076 C C     . ILE A 1 159 ? 39.564  14.925 7.016   1.00 140.98 ? 159 ILE A C     1 
ATOM   1077 O O     . ILE A 1 159 ? 39.325  13.824 7.520   1.00 137.04 ? 159 ILE A O     1 
ATOM   1078 C CB    . ILE A 1 159 ? 37.994  15.751 5.203   1.00 142.31 ? 159 ILE A CB    1 
ATOM   1079 C CG1   . ILE A 1 159 ? 36.801  16.667 4.898   1.00 138.54 ? 159 ILE A CG1   1 
ATOM   1080 C CG2   . ILE A 1 159 ? 37.644  14.303 4.867   1.00 143.70 ? 159 ILE A CG2   1 
ATOM   1081 C CD1   . ILE A 1 159 ? 36.570  16.931 3.424   1.00 141.68 ? 159 ILE A CD1   1 
ATOM   1082 N N     . PHE A 1 160 ? 40.797  15.350 6.741   1.00 142.33 ? 160 PHE A N     1 
ATOM   1083 C CA    . PHE A 1 160 ? 41.989  14.534 6.988   1.00 143.44 ? 160 PHE A CA    1 
ATOM   1084 C C     . PHE A 1 160 ? 42.182  14.205 8.471   1.00 143.85 ? 160 PHE A C     1 
ATOM   1085 O O     . PHE A 1 160 ? 42.597  13.096 8.814   1.00 146.29 ? 160 PHE A O     1 
ATOM   1086 C CB    . PHE A 1 160 ? 43.240  15.219 6.423   1.00 144.42 ? 160 PHE A CB    1 
ATOM   1087 C CG    . PHE A 1 160 ? 44.494  14.395 6.542   1.00 141.17 ? 160 PHE A CG    1 
ATOM   1088 C CD1   . PHE A 1 160 ? 44.756  13.366 5.642   1.00 147.88 ? 160 PHE A CD1   1 
ATOM   1089 C CD2   . PHE A 1 160 ? 45.418  14.651 7.551   1.00 142.51 ? 160 PHE A CD2   1 
ATOM   1090 C CE1   . PHE A 1 160 ? 45.910  12.605 5.751   1.00 154.23 ? 160 PHE A CE1   1 
ATOM   1091 C CE2   . PHE A 1 160 ? 46.574  13.893 7.663   1.00 149.07 ? 160 PHE A CE2   1 
ATOM   1092 C CZ    . PHE A 1 160 ? 46.821  12.870 6.762   1.00 154.34 ? 160 PHE A CZ    1 
ATOM   1093 N N     . GLN A 1 161 ? 41.883  15.173 9.336   1.00 146.07 ? 161 GLN A N     1 
ATOM   1094 C CA    . GLN A 1 161 ? 41.985  14.986 10.784  1.00 149.19 ? 161 GLN A CA    1 
ATOM   1095 C C     . GLN A 1 161 ? 40.891  14.050 11.300  1.00 142.37 ? 161 GLN A C     1 
ATOM   1096 O O     . GLN A 1 161 ? 41.136  13.233 12.190  1.00 134.68 ? 161 GLN A O     1 
ATOM   1097 C CB    . GLN A 1 161 ? 41.919  16.334 11.508  1.00 160.40 ? 161 GLN A CB    1 
ATOM   1098 C CG    . GLN A 1 161 ? 42.374  16.289 12.961  1.00 165.55 ? 161 GLN A CG    1 
ATOM   1099 C CD    . GLN A 1 161 ? 42.124  17.589 13.703  1.00 160.53 ? 161 GLN A CD    1 
ATOM   1100 O OE1   . GLN A 1 161 ? 41.046  18.178 13.610  1.00 151.82 ? 161 GLN A OE1   1 
ATOM   1101 N NE2   . GLN A 1 161 ? 43.121  18.038 14.457  1.00 161.17 ? 161 GLN A NE2   1 
ATOM   1102 N N     . SER A 1 162 ? 39.693  14.175 10.732  1.00 143.14 ? 162 SER A N     1 
ATOM   1103 C CA    . SER A 1 162 ? 38.551  13.339 11.103  1.00 145.41 ? 162 SER A CA    1 
ATOM   1104 C C     . SER A 1 162 ? 38.716  11.898 10.619  1.00 140.89 ? 162 SER A C     1 
ATOM   1105 O O     . SER A 1 162 ? 38.247  10.962 11.271  1.00 144.78 ? 162 SER A O     1 
ATOM   1106 C CB    . SER A 1 162 ? 37.251  13.935 10.555  1.00 149.32 ? 162 SER A CB    1 
ATOM   1107 O OG    . SER A 1 162 ? 36.122  13.203 11.001  1.00 151.69 ? 162 SER A OG    1 
ATOM   1108 N N     . SER A 1 163 ? 39.380  11.732 9.477   1.00 137.15 ? 163 SER A N     1 
ATOM   1109 C CA    . SER A 1 163 ? 39.655  10.411 8.913   1.00 142.43 ? 163 SER A CA    1 
ATOM   1110 C C     . SER A 1 163 ? 40.746  9.680  9.694   1.00 142.59 ? 163 SER A C     1 
ATOM   1111 O O     . SER A 1 163 ? 40.679  8.462  9.867   1.00 148.30 ? 163 SER A O     1 
ATOM   1112 C CB    . SER A 1 163 ? 40.048  10.524 7.438   1.00 138.34 ? 163 SER A CB    1 
ATOM   1113 O OG    . SER A 1 163 ? 39.002  11.096 6.672   1.00 146.43 ? 163 SER A OG    1 
ATOM   1114 N N     . MET A 1 164 ? 41.739  10.433 10.165  1.00 140.54 ? 164 MET A N     1 
ATOM   1115 C CA    . MET A 1 164 ? 42.853  9.883  10.941  1.00 148.29 ? 164 MET A CA    1 
ATOM   1116 C C     . MET A 1 164 ? 42.410  9.440  12.339  1.00 148.52 ? 164 MET A C     1 
ATOM   1117 O O     . MET A 1 164 ? 42.974  8.500  12.905  1.00 144.26 ? 164 MET A O     1 
ATOM   1118 C CB    . MET A 1 164 ? 43.996  10.902 11.033  1.00 148.12 ? 164 MET A CB    1 
ATOM   1119 C CG    . MET A 1 164 ? 45.318  10.343 11.547  1.00 148.47 ? 164 MET A CG    1 
ATOM   1120 S SD    . MET A 1 164 ? 46.069  9.101  10.473  1.00 143.26 ? 164 MET A SD    1 
ATOM   1121 C CE    . MET A 1 164 ? 46.723  10.121 9.154   1.00 136.09 ? 164 MET A CE    1 
ATOM   1122 N N     . THR A 1 165 ? 41.402  10.122 12.882  1.00 150.88 ? 165 THR A N     1 
ATOM   1123 C CA    . THR A 1 165 ? 40.827  9.779  14.185  1.00 151.85 ? 165 THR A CA    1 
ATOM   1124 C C     . THR A 1 165 ? 40.132  8.414  14.134  1.00 149.13 ? 165 THR A C     1 
ATOM   1125 O O     . THR A 1 165 ? 40.199  7.642  15.093  1.00 141.59 ? 165 THR A O     1 
ATOM   1126 C CB    . THR A 1 165 ? 39.833  10.859 14.671  1.00 150.07 ? 165 THR A CB    1 
ATOM   1127 O OG1   . THR A 1 165 ? 40.404  12.160 14.485  1.00 144.69 ? 165 THR A OG1   1 
ATOM   1128 C CG2   . THR A 1 165 ? 39.499  10.672 16.149  1.00 145.71 ? 165 THR A CG2   1 
ATOM   1129 N N     . LYS A 1 166 ? 39.479  8.126  13.008  1.00 154.71 ? 166 LYS A N     1 
ATOM   1130 C CA    . LYS A 1 166 ? 38.802  6.846  12.791  1.00 153.73 ? 166 LYS A CA    1 
ATOM   1131 C C     . LYS A 1 166 ? 39.792  5.696  12.594  1.00 153.13 ? 166 LYS A C     1 
ATOM   1132 O O     . LYS A 1 166 ? 39.503  4.553  12.959  1.00 157.45 ? 166 LYS A O     1 
ATOM   1133 C CB    . LYS A 1 166 ? 37.851  6.932  11.593  1.00 153.38 ? 166 LYS A CB    1 
ATOM   1134 C CG    . LYS A 1 166 ? 36.629  7.811  11.824  1.00 147.11 ? 166 LYS A CG    1 
ATOM   1135 C CD    . LYS A 1 166 ? 35.711  7.844  10.609  1.00 152.50 ? 166 LYS A CD    1 
ATOM   1136 C CE    . LYS A 1 166 ? 34.834  6.603  10.523  1.00 158.94 ? 166 LYS A CE    1 
ATOM   1137 N NZ    . LYS A 1 166 ? 33.935  6.639  9.336   1.00 165.95 ? 166 LYS A NZ    1 
ATOM   1138 N N     . ILE A 1 167 ? 40.950  6.007  12.013  1.00 146.56 ? 167 ILE A N     1 
ATOM   1139 C CA    . ILE A 1 167 ? 42.023  5.030  11.810  1.00 143.09 ? 167 ILE A CA    1 
ATOM   1140 C C     . ILE A 1 167 ? 42.675  4.660  13.146  1.00 144.15 ? 167 ILE A C     1 
ATOM   1141 O O     . ILE A 1 167 ? 42.897  3.481  13.431  1.00 145.20 ? 167 ILE A O     1 
ATOM   1142 C CB    . ILE A 1 167 ? 43.083  5.548  10.805  1.00 136.36 ? 167 ILE A CB    1 
ATOM   1143 C CG1   . ILE A 1 167 ? 42.464  5.713  9.411   1.00 139.35 ? 167 ILE A CG1   1 
ATOM   1144 C CG2   . ILE A 1 167 ? 44.282  4.607  10.738  1.00 136.72 ? 167 ILE A CG2   1 
ATOM   1145 C CD1   . ILE A 1 167 ? 43.239  6.627  8.484   1.00 138.32 ? 167 ILE A CD1   1 
ATOM   1146 N N     . LEU A 1 168 ? 42.961  5.674  13.962  1.00 142.75 ? 168 LEU A N     1 
ATOM   1147 C CA    . LEU A 1 168 ? 43.589  5.476  15.270  1.00 148.54 ? 168 LEU A CA    1 
ATOM   1148 C C     . LEU A 1 168 ? 42.570  5.279  16.398  1.00 148.58 ? 168 LEU A C     1 
ATOM   1149 O O     . LEU A 1 168 ? 42.913  5.385  17.579  1.00 147.35 ? 168 LEU A O     1 
ATOM   1150 C CB    . LEU A 1 168 ? 44.535  6.641  15.595  1.00 154.37 ? 168 LEU A CB    1 
ATOM   1151 C CG    . LEU A 1 168 ? 45.963  6.608  15.035  1.00 164.53 ? 168 LEU A CG    1 
ATOM   1152 C CD1   . LEU A 1 168 ? 46.011  6.983  13.560  1.00 159.79 ? 168 LEU A CD1   1 
ATOM   1153 C CD2   . LEU A 1 168 ? 46.859  7.536  15.841  1.00 154.61 ? 168 LEU A CD2   1 
ATOM   1154 N N     . GLU A 1 169 ? 41.324  4.985  16.028  1.00 148.71 ? 169 GLU A N     1 
ATOM   1155 C CA    . GLU A 1 169 ? 40.252  4.747  16.998  1.00 150.40 ? 169 GLU A CA    1 
ATOM   1156 C C     . GLU A 1 169 ? 40.413  3.412  17.746  1.00 149.97 ? 169 GLU A C     1 
ATOM   1157 O O     . GLU A 1 169 ? 40.326  3.392  18.976  1.00 146.95 ? 169 GLU A O     1 
ATOM   1158 C CB    . GLU A 1 169 ? 38.872  4.852  16.327  1.00 153.96 ? 169 GLU A CB    1 
ATOM   1159 C CG    . GLU A 1 169 ? 37.719  5.171  17.272  1.00 156.51 ? 169 GLU A CG    1 
ATOM   1160 C CD    . GLU A 1 169 ? 37.180  3.953  18.005  1.00 162.25 ? 169 GLU A CD    1 
ATOM   1161 O OE1   . GLU A 1 169 ? 37.125  2.858  17.404  1.00 165.68 ? 169 GLU A OE1   1 
ATOM   1162 O OE2   . GLU A 1 169 ? 36.801  4.095  19.186  1.00 163.52 ? 169 GLU A OE2   1 
ATOM   1163 N N     . PRO A 1 170 ? 40.645  2.295  17.016  1.00 153.35 ? 170 PRO A N     1 
ATOM   1164 C CA    . PRO A 1 170 ? 40.840  1.024  17.719  1.00 156.56 ? 170 PRO A CA    1 
ATOM   1165 C C     . PRO A 1 170 ? 42.240  0.871  18.318  1.00 152.44 ? 170 PRO A C     1 
ATOM   1166 O O     . PRO A 1 170 ? 42.432  0.056  19.224  1.00 152.84 ? 170 PRO A O     1 
ATOM   1167 C CB    . PRO A 1 170 ? 40.624  -0.032 16.620  1.00 160.78 ? 170 PRO A CB    1 
ATOM   1168 C CG    . PRO A 1 170 ? 40.085  0.704  15.436  1.00 154.47 ? 170 PRO A CG    1 
ATOM   1169 C CD    . PRO A 1 170 ? 40.620  2.094  15.557  1.00 153.81 ? 170 PRO A CD    1 
ATOM   1170 N N     . PHE A 1 171 ? 43.199  1.647  17.815  1.00 145.51 ? 171 PHE A N     1 
ATOM   1171 C CA    . PHE A 1 171 ? 44.591  1.571  18.263  1.00 138.43 ? 171 PHE A CA    1 
ATOM   1172 C C     . PHE A 1 171 ? 44.783  2.132  19.673  1.00 142.41 ? 171 PHE A C     1 
ATOM   1173 O O     . PHE A 1 171 ? 45.629  1.647  20.428  1.00 141.51 ? 171 PHE A O     1 
ATOM   1174 C CB    . PHE A 1 171 ? 45.514  2.292  17.273  1.00 125.91 ? 171 PHE A CB    1 
ATOM   1175 C CG    . PHE A 1 171 ? 46.962  1.902  17.393  1.00 126.80 ? 171 PHE A CG    1 
ATOM   1176 C CD1   . PHE A 1 171 ? 47.452  0.780  16.731  1.00 140.70 ? 171 PHE A CD1   1 
ATOM   1177 C CD2   . PHE A 1 171 ? 47.840  2.659  18.164  1.00 129.11 ? 171 PHE A CD2   1 
ATOM   1178 C CE1   . PHE A 1 171 ? 48.787  0.418  16.839  1.00 152.80 ? 171 PHE A CE1   1 
ATOM   1179 C CE2   . PHE A 1 171 ? 49.176  2.301  18.275  1.00 142.12 ? 171 PHE A CE2   1 
ATOM   1180 C CZ    . PHE A 1 171 ? 49.650  1.180  17.611  1.00 147.11 ? 171 PHE A CZ    1 
ATOM   1181 N N     . ARG A 1 172 ? 43.997  3.151  20.017  1.00 141.44 ? 172 ARG A N     1 
ATOM   1182 C CA    . ARG A 1 172 ? 44.052  3.774  21.342  1.00 142.80 ? 172 ARG A CA    1 
ATOM   1183 C C     . ARG A 1 172 ? 43.438  2.885  22.423  1.00 153.50 ? 172 ARG A C     1 
ATOM   1184 O O     . ARG A 1 172 ? 43.863  2.922  23.580  1.00 155.70 ? 172 ARG A O     1 
ATOM   1185 C CB    . ARG A 1 172 ? 43.359  5.140  21.329  1.00 140.10 ? 172 ARG A CB    1 
ATOM   1186 C CG    . ARG A 1 172 ? 44.113  6.221  20.570  1.00 138.67 ? 172 ARG A CG    1 
ATOM   1187 C CD    . ARG A 1 172 ? 43.315  7.514  20.516  1.00 149.31 ? 172 ARG A CD    1 
ATOM   1188 N NE    . ARG A 1 172 ? 43.916  8.495  19.612  1.00 147.47 ? 172 ARG A NE    1 
ATOM   1189 C CZ    . ARG A 1 172 ? 44.784  9.434  19.980  1.00 140.02 ? 172 ARG A CZ    1 
ATOM   1190 N NH1   . ARG A 1 172 ? 45.172  9.540  21.246  1.00 145.84 ? 172 ARG A NH1   1 
ATOM   1191 N NH2   . ARG A 1 172 ? 45.267  10.275 19.075  1.00 135.82 ? 172 ARG A NH2   1 
ATOM   1192 N N     . LYS A 1 173 ? 42.439  2.093  22.036  1.00 153.93 ? 173 LYS A N     1 
ATOM   1193 C CA    . LYS A 1 173 ? 41.768  1.168  22.952  1.00 150.05 ? 173 LYS A CA    1 
ATOM   1194 C C     . LYS A 1 173 ? 42.626  -0.057 23.267  1.00 150.72 ? 173 LYS A C     1 
ATOM   1195 O O     . LYS A 1 173 ? 42.558  -0.600 24.372  1.00 148.17 ? 173 LYS A O     1 
ATOM   1196 C CB    . LYS A 1 173 ? 40.413  0.732  22.388  1.00 148.73 ? 173 LYS A CB    1 
ATOM   1197 C CG    . LYS A 1 173 ? 39.336  1.804  22.450  1.00 155.21 ? 173 LYS A CG    1 
ATOM   1198 C CD    . LYS A 1 173 ? 38.001  1.274  21.952  1.00 148.65 ? 173 LYS A CD    1 
ATOM   1199 C CE    . LYS A 1 173 ? 36.904  2.317  22.097  1.00 149.07 ? 173 LYS A CE    1 
ATOM   1200 N NZ    . LYS A 1 173 ? 35.590  1.812  21.612  1.00 144.48 ? 173 LYS A NZ    1 
ATOM   1201 N N     . GLN A 1 174 ? 43.425  -0.485 22.291  1.00 152.76 ? 174 GLN A N     1 
ATOM   1202 C CA    . GLN A 1 174 ? 44.332  -1.622 22.458  1.00 151.69 ? 174 GLN A CA    1 
ATOM   1203 C C     . GLN A 1 174 ? 45.502  -1.283 23.381  1.00 150.87 ? 174 GLN A C     1 
ATOM   1204 O O     . GLN A 1 174 ? 45.934  -2.118 24.179  1.00 155.11 ? 174 GLN A O     1 
ATOM   1205 C CB    . GLN A 1 174 ? 44.853  -2.107 21.101  1.00 143.80 ? 174 GLN A CB    1 
ATOM   1206 C CG    . GLN A 1 174 ? 43.823  -2.853 20.263  1.00 141.73 ? 174 GLN A CG    1 
ATOM   1207 C CD    . GLN A 1 174 ? 44.362  -3.295 18.913  1.00 139.67 ? 174 GLN A CD    1 
ATOM   1208 O OE1   . GLN A 1 174 ? 45.520  -3.699 18.789  1.00 136.99 ? 174 GLN A OE1   1 
ATOM   1209 N NE2   . GLN A 1 174 ? 43.516  -3.227 17.891  1.00 144.47 ? 174 GLN A NE2   1 
ATOM   1210 N N     . ASN A 1 175 ? 46.006  -0.055 23.263  1.00 145.03 ? 175 ASN A N     1 
ATOM   1211 C CA    . ASN A 1 175 ? 47.097  0.428  24.107  1.00 143.16 ? 175 ASN A CA    1 
ATOM   1212 C C     . ASN A 1 175 ? 46.743  1.754  24.789  1.00 150.58 ? 175 ASN A C     1 
ATOM   1213 O O     . ASN A 1 175 ? 46.937  2.826  24.208  1.00 152.31 ? 175 ASN A O     1 
ATOM   1214 C CB    . ASN A 1 175 ? 48.394  0.556  23.297  1.00 136.21 ? 175 ASN A CB    1 
ATOM   1215 C CG    . ASN A 1 175 ? 48.874  -0.772 22.737  1.00 132.95 ? 175 ASN A CG    1 
ATOM   1216 O OD1   . ASN A 1 175 ? 49.108  -0.901 21.535  1.00 124.86 ? 175 ASN A OD1   1 
ATOM   1217 N ND2   . ASN A 1 175 ? 49.024  -1.767 23.607  1.00 138.57 ? 175 ASN A ND2   1 
ATOM   1218 N N     . PRO A 1 176 ? 46.207  1.682  26.024  1.00 151.69 ? 176 PRO A N     1 
ATOM   1219 C CA    . PRO A 1 176 ? 45.818  2.874  26.782  1.00 150.63 ? 176 PRO A CA    1 
ATOM   1220 C C     . PRO A 1 176 ? 47.003  3.607  27.413  1.00 154.17 ? 176 PRO A C     1 
ATOM   1221 O O     . PRO A 1 176 ? 46.880  4.781  27.771  1.00 148.97 ? 176 PRO A O     1 
ATOM   1222 C CB    . PRO A 1 176 ? 44.902  2.315  27.886  1.00 149.08 ? 176 PRO A CB    1 
ATOM   1223 C CG    . PRO A 1 176 ? 44.656  0.881  27.538  1.00 149.93 ? 176 PRO A CG    1 
ATOM   1224 C CD    . PRO A 1 176 ? 45.846  0.449  26.742  1.00 150.11 ? 176 PRO A CD    1 
ATOM   1225 N N     . ASP A 1 177 ? 48.134  2.916  27.545  1.00 158.72 ? 177 ASP A N     1 
ATOM   1226 C CA    . ASP A 1 177 ? 49.329  3.471  28.186  1.00 152.69 ? 177 ASP A CA    1 
ATOM   1227 C C     . ASP A 1 177 ? 50.047  4.522  27.336  1.00 154.39 ? 177 ASP A C     1 
ATOM   1228 O O     . ASP A 1 177 ? 50.699  5.419  27.876  1.00 156.92 ? 177 ASP A O     1 
ATOM   1229 C CB    . ASP A 1 177 ? 50.301  2.351  28.585  1.00 145.95 ? 177 ASP A CB    1 
ATOM   1230 C CG    . ASP A 1 177 ? 50.777  1.527  27.396  1.00 149.03 ? 177 ASP A CG    1 
ATOM   1231 O OD1   . ASP A 1 177 ? 49.930  1.056  26.606  1.00 156.14 ? 177 ASP A OD1   1 
ATOM   1232 O OD2   . ASP A 1 177 ? 52.005  1.352  27.252  1.00 144.20 ? 177 ASP A OD2   1 
ATOM   1233 N N     . ILE A 1 178 ? 49.923  4.408  26.015  1.00 149.86 ? 178 ILE A N     1 
ATOM   1234 C CA    . ILE A 1 178 ? 50.567  5.345  25.090  1.00 144.39 ? 178 ILE A CA    1 
ATOM   1235 C C     . ILE A 1 178 ? 49.660  6.528  24.738  1.00 154.16 ? 178 ILE A C     1 
ATOM   1236 O O     . ILE A 1 178 ? 48.439  6.380  24.640  1.00 158.36 ? 178 ILE A O     1 
ATOM   1237 C CB    . ILE A 1 178 ? 51.073  4.650  23.799  1.00 134.17 ? 178 ILE A CB    1 
ATOM   1238 C CG1   . ILE A 1 178 ? 49.926  3.947  23.059  1.00 148.98 ? 178 ILE A CG1   1 
ATOM   1239 C CG2   . ILE A 1 178 ? 52.200  3.676  24.125  1.00 129.51 ? 178 ILE A CG2   1 
ATOM   1240 C CD1   . ILE A 1 178 ? 50.225  3.612  21.611  1.00 150.11 ? 178 ILE A CD1   1 
ATOM   1241 N N     . VAL A 1 179 ? 50.269  7.699  24.561  1.00 155.20 ? 179 VAL A N     1 
ATOM   1242 C CA    . VAL A 1 179 ? 49.540  8.914  24.192  1.00 153.59 ? 179 VAL A CA    1 
ATOM   1243 C C     . VAL A 1 179 ? 49.996  9.397  22.815  1.00 144.51 ? 179 VAL A C     1 
ATOM   1244 O O     . VAL A 1 179 ? 51.167  9.733  22.619  1.00 141.82 ? 179 VAL A O     1 
ATOM   1245 C CB    . VAL A 1 179 ? 49.712  10.036 25.246  1.00 149.16 ? 179 VAL A CB    1 
ATOM   1246 C CG1   . VAL A 1 179 ? 48.965  11.295 24.825  1.00 142.84 ? 179 VAL A CG1   1 
ATOM   1247 C CG2   . VAL A 1 179 ? 49.227  9.571  26.613  1.00 152.98 ? 179 VAL A CG2   1 
ATOM   1248 N N     . ILE A 1 180 ? 49.061  9.420  21.867  1.00 150.30 ? 180 ILE A N     1 
ATOM   1249 C CA    . ILE A 1 180 ? 49.346  9.835  20.493  1.00 148.66 ? 180 ILE A CA    1 
ATOM   1250 C C     . ILE A 1 180 ? 48.628  11.146 20.169  1.00 147.22 ? 180 ILE A C     1 
ATOM   1251 O O     . ILE A 1 180 ? 47.443  11.307 20.474  1.00 145.64 ? 180 ILE A O     1 
ATOM   1252 C CB    . ILE A 1 180 ? 48.942  8.751  19.463  1.00 154.16 ? 180 ILE A CB    1 
ATOM   1253 C CG1   . ILE A 1 180 ? 49.368  7.356  19.939  1.00 154.60 ? 180 ILE A CG1   1 
ATOM   1254 C CG2   . ILE A 1 180 ? 49.546  9.059  18.096  1.00 151.98 ? 180 ILE A CG2   1 
ATOM   1255 C CD1   . ILE A 1 180 ? 48.613  6.216  19.285  1.00 158.79 ? 180 ILE A CD1   1 
ATOM   1256 N N     . TYR A 1 181 ? 49.358  12.074 19.556  1.00 148.43 ? 181 TYR A N     1 
ATOM   1257 C CA    . TYR A 1 181 ? 48.805  13.362 19.141  1.00 143.27 ? 181 TYR A CA    1 
ATOM   1258 C C     . TYR A 1 181 ? 48.960  13.562 17.635  1.00 142.97 ? 181 TYR A C     1 
ATOM   1259 O O     . TYR A 1 181 ? 49.964  13.156 17.046  1.00 140.66 ? 181 TYR A O     1 
ATOM   1260 C CB    . TYR A 1 181 ? 49.482  14.506 19.904  1.00 144.05 ? 181 TYR A CB    1 
ATOM   1261 C CG    . TYR A 1 181 ? 48.938  15.885 19.586  1.00 142.30 ? 181 TYR A CG    1 
ATOM   1262 C CD1   . TYR A 1 181 ? 47.798  16.372 20.225  1.00 143.24 ? 181 TYR A CD1   1 
ATOM   1263 C CD2   . TYR A 1 181 ? 49.569  16.706 18.650  1.00 139.30 ? 181 TYR A CD2   1 
ATOM   1264 C CE1   . TYR A 1 181 ? 47.298  17.633 19.937  1.00 142.02 ? 181 TYR A CE1   1 
ATOM   1265 C CE2   . TYR A 1 181 ? 49.077  17.969 18.356  1.00 135.42 ? 181 TYR A CE2   1 
ATOM   1266 C CZ    . TYR A 1 181 ? 47.943  18.427 19.001  1.00 138.67 ? 181 TYR A CZ    1 
ATOM   1267 O OH    . TYR A 1 181 ? 47.451  19.679 18.712  1.00 154.11 ? 181 TYR A OH    1 
ATOM   1268 N N     . GLN A 1 182 ? 47.959  14.193 17.025  1.00 140.34 ? 182 GLN A N     1 
ATOM   1269 C CA    . GLN A 1 182 ? 47.984  14.497 15.594  1.00 135.08 ? 182 GLN A CA    1 
ATOM   1270 C C     . GLN A 1 182 ? 47.978  16.004 15.329  1.00 122.89 ? 182 GLN A C     1 
ATOM   1271 O O     . GLN A 1 182 ? 47.176  16.745 15.904  1.00 124.76 ? 182 GLN A O     1 
ATOM   1272 C CB    . GLN A 1 182 ? 46.825  13.804 14.860  1.00 145.24 ? 182 GLN A CB    1 
ATOM   1273 C CG    . GLN A 1 182 ? 45.445  14.016 15.473  1.00 139.83 ? 182 GLN A CG    1 
ATOM   1274 C CD    . GLN A 1 182 ? 44.343  13.292 14.722  1.00 133.82 ? 182 GLN A CD    1 
ATOM   1275 O OE1   . GLN A 1 182 ? 44.320  13.269 13.490  1.00 127.68 ? 182 GLN A OE1   1 
ATOM   1276 N NE2   . GLN A 1 182 ? 43.413  12.702 15.465  1.00 135.23 ? 182 GLN A NE2   1 
ATOM   1277 N N     . TYR A 1 183 ? 48.889  16.444 14.463  1.00 124.63 ? 183 TYR A N     1 
ATOM   1278 C CA    . TYR A 1 183 ? 48.994  17.850 14.080  1.00 128.64 ? 183 TYR A CA    1 
ATOM   1279 C C     . TYR A 1 183 ? 49.166  17.978 12.567  1.00 131.51 ? 183 TYR A C     1 
ATOM   1280 O O     . TYR A 1 183 ? 50.245  17.708 12.032  1.00 130.84 ? 183 TYR A O     1 
ATOM   1281 C CB    . TYR A 1 183 ? 50.151  18.531 14.826  1.00 136.91 ? 183 TYR A CB    1 
ATOM   1282 C CG    . TYR A 1 183 ? 50.372  19.985 14.455  1.00 138.82 ? 183 TYR A CG    1 
ATOM   1283 C CD1   . TYR A 1 183 ? 49.571  20.993 14.992  1.00 141.23 ? 183 TYR A CD1   1 
ATOM   1284 C CD2   . TYR A 1 183 ? 51.389  20.352 13.573  1.00 140.30 ? 183 TYR A CD2   1 
ATOM   1285 C CE1   . TYR A 1 183 ? 49.771  22.323 14.655  1.00 142.78 ? 183 TYR A CE1   1 
ATOM   1286 C CE2   . TYR A 1 183 ? 51.597  21.680 13.230  1.00 136.86 ? 183 TYR A CE2   1 
ATOM   1287 C CZ    . TYR A 1 183 ? 50.787  22.660 13.774  1.00 135.89 ? 183 TYR A CZ    1 
ATOM   1288 O OH    . TYR A 1 183 ? 50.992  23.978 13.436  1.00 143.08 ? 183 TYR A OH    1 
ATOM   1289 N N     . MET A 1 184 ? 48.088  18.389 11.896  1.00 138.47 ? 184 MET A N     1 
ATOM   1290 C CA    . MET A 1 184 ? 48.042  18.545 10.433  1.00 148.63 ? 184 MET A CA    1 
ATOM   1291 C C     . MET A 1 184 ? 48.508  17.292 9.681   1.00 142.82 ? 184 MET A C     1 
ATOM   1292 O O     . MET A 1 184 ? 47.691  16.447 9.312   1.00 154.63 ? 184 MET A O     1 
ATOM   1293 C CB    . MET A 1 184 ? 48.816  19.792 9.977   1.00 157.41 ? 184 MET A CB    1 
ATOM   1294 C CG    . MET A 1 184 ? 48.172  21.111 10.376  1.00 162.06 ? 184 MET A CG    1 
ATOM   1295 S SD    . MET A 1 184 ? 49.112  22.543 9.812   1.00 117.87 ? 184 MET A SD    1 
ATOM   1296 C CE    . MET A 1 184 ? 48.096  23.880 10.434  1.00 132.32 ? 184 MET A CE    1 
ATOM   1297 N N     . ASP A 1 185 ? 49.818  17.185 9.461   1.00 137.88 ? 185 ASP A N     1 
ATOM   1298 C CA    . ASP A 1 185 ? 50.413  16.031 8.789   1.00 146.54 ? 185 ASP A CA    1 
ATOM   1299 C C     . ASP A 1 185 ? 51.284  15.209 9.739   1.00 143.48 ? 185 ASP A C     1 
ATOM   1300 O O     . ASP A 1 185 ? 51.361  13.985 9.616   1.00 131.28 ? 185 ASP A O     1 
ATOM   1301 C CB    . ASP A 1 185 ? 51.239  16.478 7.577   1.00 145.08 ? 185 ASP A CB    1 
ATOM   1302 C CG    . ASP A 1 185 ? 50.388  17.094 6.477   1.00 143.13 ? 185 ASP A CG    1 
ATOM   1303 O OD1   . ASP A 1 185 ? 49.593  18.015 6.768   1.00 138.90 ? 185 ASP A OD1   1 
ATOM   1304 O OD2   . ASP A 1 185 ? 50.525  16.664 5.312   1.00 147.90 ? 185 ASP A OD2   1 
ATOM   1305 N N     . ASP A 1 186 ? 51.935  15.890 10.681  1.00 146.42 ? 186 ASP A N     1 
ATOM   1306 C CA    . ASP A 1 186 ? 52.842  15.248 11.632  1.00 148.27 ? 186 ASP A CA    1 
ATOM   1307 C C     . ASP A 1 186 ? 52.097  14.604 12.800  1.00 143.76 ? 186 ASP A C     1 
ATOM   1308 O O     . ASP A 1 186 ? 51.114  15.154 13.302  1.00 143.84 ? 186 ASP A O     1 
ATOM   1309 C CB    . ASP A 1 186 ? 53.867  16.258 12.161  1.00 153.25 ? 186 ASP A CB    1 
ATOM   1310 C CG    . ASP A 1 186 ? 54.816  16.760 11.081  1.00 151.82 ? 186 ASP A CG    1 
ATOM   1311 O OD1   . ASP A 1 186 ? 54.395  16.893 9.911   1.00 158.00 ? 186 ASP A OD1   1 
ATOM   1312 O OD2   . ASP A 1 186 ? 55.990  17.034 11.409  1.00 148.27 ? 186 ASP A OD2   1 
ATOM   1313 N N     . LEU A 1 187 ? 52.577  13.436 13.223  1.00 136.66 ? 187 LEU A N     1 
ATOM   1314 C CA    . LEU A 1 187 ? 52.007  12.719 14.363  1.00 137.65 ? 187 LEU A CA    1 
ATOM   1315 C C     . LEU A 1 187 ? 53.058  12.471 15.442  1.00 140.97 ? 187 LEU A C     1 
ATOM   1316 O O     . LEU A 1 187 ? 54.139  11.948 15.160  1.00 144.35 ? 187 LEU A O     1 
ATOM   1317 C CB    . LEU A 1 187 ? 51.373  11.394 13.919  1.00 148.56 ? 187 LEU A CB    1 
ATOM   1318 C CG    . LEU A 1 187 ? 49.948  11.413 13.353  1.00 158.54 ? 187 LEU A CG    1 
ATOM   1319 C CD1   . LEU A 1 187 ? 49.924  11.815 11.884  1.00 157.15 ? 187 LEU A CD1   1 
ATOM   1320 C CD2   . LEU A 1 187 ? 49.297  10.051 13.535  1.00 154.89 ? 187 LEU A CD2   1 
ATOM   1321 N N     . TYR A 1 188 ? 52.729  12.851 16.675  1.00 140.75 ? 188 TYR A N     1 
ATOM   1322 C CA    . TYR A 1 188 ? 53.642  12.710 17.808  1.00 147.57 ? 188 TYR A CA    1 
ATOM   1323 C C     . TYR A 1 188 ? 53.246  11.543 18.709  1.00 149.26 ? 188 TYR A C     1 
ATOM   1324 O O     . TYR A 1 188 ? 52.103  11.458 19.166  1.00 151.08 ? 188 TYR A O     1 
ATOM   1325 C CB    . TYR A 1 188 ? 53.702  14.009 18.620  1.00 140.51 ? 188 TYR A CB    1 
ATOM   1326 C CG    . TYR A 1 188 ? 54.262  15.195 17.862  1.00 141.23 ? 188 TYR A CG    1 
ATOM   1327 C CD1   . TYR A 1 188 ? 55.635  15.443 17.831  1.00 141.91 ? 188 TYR A CD1   1 
ATOM   1328 C CD2   . TYR A 1 188 ? 53.419  16.074 17.181  1.00 148.99 ? 188 TYR A CD2   1 
ATOM   1329 C CE1   . TYR A 1 188 ? 56.153  16.528 17.140  1.00 142.34 ? 188 TYR A CE1   1 
ATOM   1330 C CE2   . TYR A 1 188 ? 53.928  17.162 16.487  1.00 150.65 ? 188 TYR A CE2   1 
ATOM   1331 C CZ    . TYR A 1 188 ? 55.296  17.384 16.471  1.00 140.58 ? 188 TYR A CZ    1 
ATOM   1332 O OH    . TYR A 1 188 ? 55.805  18.462 15.784  1.00 141.70 ? 188 TYR A OH    1 
ATOM   1333 N N     . VAL A 1 189 ? 54.199  10.645 18.952  1.00 150.77 ? 189 VAL A N     1 
ATOM   1334 C CA    . VAL A 1 189 ? 53.987  9.482  19.816  1.00 152.52 ? 189 VAL A CA    1 
ATOM   1335 C C     . VAL A 1 189 ? 54.940  9.546  21.011  1.00 143.02 ? 189 VAL A C     1 
ATOM   1336 O O     . VAL A 1 189 ? 56.157  9.651  20.838  1.00 139.05 ? 189 VAL A O     1 
ATOM   1337 C CB    . VAL A 1 189 ? 54.179  8.149  19.051  1.00 159.70 ? 189 VAL A CB    1 
ATOM   1338 C CG1   . VAL A 1 189 ? 53.893  6.956  19.954  1.00 159.73 ? 189 VAL A CG1   1 
ATOM   1339 C CG2   . VAL A 1 189 ? 53.288  8.096  17.817  1.00 163.37 ? 189 VAL A CG2   1 
ATOM   1340 N N     . GLY A 1 190 ? 54.377  9.487  22.216  1.00 144.89 ? 190 GLY A N     1 
ATOM   1341 C CA    . GLY A 1 190 ? 55.162  9.537  23.448  1.00 141.46 ? 190 GLY A CA    1 
ATOM   1342 C C     . GLY A 1 190 ? 54.663  8.574  24.509  1.00 157.41 ? 190 GLY A C     1 
ATOM   1343 O O     . GLY A 1 190 ? 53.455  8.441  24.719  1.00 162.03 ? 190 GLY A O     1 
ATOM   1344 N N     . SER A 1 191 ? 55.600  7.904  25.178  1.00 152.60 ? 191 SER A N     1 
ATOM   1345 C CA    . SER A 1 191 ? 55.276  6.935  26.226  1.00 146.71 ? 191 SER A CA    1 
ATOM   1346 C C     . SER A 1 191 ? 56.338  6.895  27.326  1.00 143.77 ? 191 SER A C     1 
ATOM   1347 O O     . SER A 1 191 ? 57.456  7.384  27.143  1.00 146.61 ? 191 SER A O     1 
ATOM   1348 C CB    . SER A 1 191 ? 55.086  5.538  25.626  1.00 143.63 ? 191 SER A CB    1 
ATOM   1349 O OG    . SER A 1 191 ? 56.278  5.073  25.019  1.00 134.63 ? 191 SER A OG    1 
ATOM   1350 N N     . ASP A 1 192 ? 55.977  6.306  28.465  1.00 143.67 ? 192 ASP A N     1 
ATOM   1351 C CA    . ASP A 1 192 ? 56.887  6.158  29.602  1.00 149.61 ? 192 ASP A CA    1 
ATOM   1352 C C     . ASP A 1 192 ? 57.655  4.833  29.561  1.00 147.83 ? 192 ASP A C     1 
ATOM   1353 O O     . ASP A 1 192 ? 58.418  4.519  30.480  1.00 157.38 ? 192 ASP A O     1 
ATOM   1354 C CB    . ASP A 1 192 ? 56.119  6.286  30.924  1.00 150.54 ? 192 ASP A CB    1 
ATOM   1355 C CG    . ASP A 1 192 ? 55.511  7.666  31.121  1.00 149.88 ? 192 ASP A CG    1 
ATOM   1356 O OD1   . ASP A 1 192 ? 54.779  8.137  30.224  1.00 145.42 ? 192 ASP A OD1   1 
ATOM   1357 O OD2   . ASP A 1 192 ? 55.768  8.281  32.178  1.00 154.34 ? 192 ASP A OD2   1 
ATOM   1358 N N     . LEU A 1 193 ? 57.454  4.069  28.488  1.00 140.52 ? 193 LEU A N     1 
ATOM   1359 C CA    . LEU A 1 193 ? 58.095  2.765  28.310  1.00 141.56 ? 193 LEU A CA    1 
ATOM   1360 C C     . LEU A 1 193 ? 59.583  2.886  27.971  1.00 144.79 ? 193 LEU A C     1 
ATOM   1361 O O     . LEU A 1 193 ? 60.073  3.975  27.657  1.00 151.75 ? 193 LEU A O     1 
ATOM   1362 C CB    . LEU A 1 193 ? 57.372  1.956  27.225  1.00 148.93 ? 193 LEU A CB    1 
ATOM   1363 C CG    . LEU A 1 193 ? 55.930  1.497  27.479  1.00 162.59 ? 193 LEU A CG    1 
ATOM   1364 C CD1   . LEU A 1 193 ? 55.252  1.130  26.167  1.00 163.77 ? 193 LEU A CD1   1 
ATOM   1365 C CD2   . LEU A 1 193 ? 55.873  0.332  28.458  1.00 156.36 ? 193 LEU A CD2   1 
ATOM   1366 N N     . GLU A 1 194 ? 60.289  1.758  28.037  1.00 141.50 ? 194 GLU A N     1 
ATOM   1367 C CA    . GLU A 1 194 ? 61.719  1.695  27.722  1.00 150.02 ? 194 GLU A CA    1 
ATOM   1368 C C     . GLU A 1 194 ? 61.984  1.887  26.228  1.00 143.92 ? 194 GLU A C     1 
ATOM   1369 O O     . GLU A 1 194 ? 61.072  1.763  25.406  1.00 136.61 ? 194 GLU A O     1 
ATOM   1370 C CB    . GLU A 1 194 ? 62.316  0.367  28.201  1.00 142.51 ? 194 GLU A CB    1 
ATOM   1371 C CG    . GLU A 1 194 ? 62.394  0.223  29.715  1.00 145.55 ? 194 GLU A CG    1 
ATOM   1372 C CD    . GLU A 1 194 ? 62.972  -1.111 30.156  1.00 155.08 ? 194 GLU A CD    1 
ATOM   1373 O OE1   . GLU A 1 194 ? 63.978  -1.561 29.565  1.00 166.25 ? 194 GLU A OE1   1 
ATOM   1374 O OE2   . GLU A 1 194 ? 62.424  -1.708 31.107  1.00 149.62 ? 194 GLU A OE2   1 
ATOM   1375 N N     . ILE A 1 195 ? 63.239  2.183  25.889  1.00 160.22 ? 195 ILE A N     1 
ATOM   1376 C CA    . ILE A 1 195 ? 63.649  2.460  24.505  1.00 156.44 ? 195 ILE A CA    1 
ATOM   1377 C C     . ILE A 1 195 ? 63.473  1.256  23.565  1.00 148.78 ? 195 ILE A C     1 
ATOM   1378 O O     . ILE A 1 195 ? 63.230  1.427  22.368  1.00 142.54 ? 195 ILE A O     1 
ATOM   1379 C CB    . ILE A 1 195 ? 65.095  3.033  24.442  1.00 161.15 ? 195 ILE A CB    1 
ATOM   1380 C CG1   . ILE A 1 195 ? 65.391  3.670  23.076  1.00 155.66 ? 195 ILE A CG1   1 
ATOM   1381 C CG2   . ILE A 1 195 ? 66.138  1.980  24.806  1.00 159.36 ? 195 ILE A CG2   1 
ATOM   1382 C CD1   . ILE A 1 195 ? 64.812  5.058  22.894  1.00 147.24 ? 195 ILE A CD1   1 
ATOM   1383 N N     . GLY A 1 196 ? 63.585  0.050  24.118  1.00 143.00 ? 196 GLY A N     1 
ATOM   1384 C CA    . GLY A 1 196 ? 63.411  -1.182 23.350  1.00 143.81 ? 196 GLY A CA    1 
ATOM   1385 C C     . GLY A 1 196 ? 61.957  -1.488 23.039  1.00 145.93 ? 196 GLY A C     1 
ATOM   1386 O O     . GLY A 1 196 ? 61.631  -1.925 21.933  1.00 144.79 ? 196 GLY A O     1 
ATOM   1387 N N     . GLN A 1 197 ? 61.087  -1.256 24.020  1.00 150.31 ? 197 GLN A N     1 
ATOM   1388 C CA    . GLN A 1 197 ? 59.651  -1.508 23.876  1.00 156.21 ? 197 GLN A CA    1 
ATOM   1389 C C     . GLN A 1 197 ? 58.950  -0.433 23.046  1.00 151.21 ? 197 GLN A C     1 
ATOM   1390 O O     . GLN A 1 197 ? 57.946  -0.710 22.385  1.00 149.41 ? 197 GLN A O     1 
ATOM   1391 C CB    . GLN A 1 197 ? 58.984  -1.628 25.250  1.00 161.86 ? 197 GLN A CB    1 
ATOM   1392 C CG    . GLN A 1 197 ? 59.367  -2.879 26.029  1.00 163.75 ? 197 GLN A CG    1 
ATOM   1393 C CD    . GLN A 1 197 ? 58.690  -2.965 27.386  1.00 163.84 ? 197 GLN A CD    1 
ATOM   1394 O OE1   . GLN A 1 197 ? 58.034  -3.958 27.700  1.00 164.45 ? 197 GLN A OE1   1 
ATOM   1395 N NE2   . GLN A 1 197 ? 58.846  -1.923 28.197  1.00 164.04 ? 197 GLN A NE2   1 
ATOM   1396 N N     . HIS A 1 198 ? 59.484  0.787  23.087  1.00 147.80 ? 198 HIS A N     1 
ATOM   1397 C CA    . HIS A 1 198 ? 58.917  1.924  22.358  1.00 147.92 ? 198 HIS A CA    1 
ATOM   1398 C C     . HIS A 1 198 ? 59.135  1.818  20.873  1.00 147.06 ? 198 HIS A C     1 
ATOM   1399 O O     . HIS A 1 198 ? 58.288  2.245  20.086  1.00 151.98 ? 198 HIS A O     1 
ATOM   1400 C CB    . HIS A 1 198 ? 59.492  3.235  22.889  1.00 135.71 ? 198 HIS A CB    1 
ATOM   1401 C CG    . HIS A 1 198 ? 58.856  4.471  22.294  1.00 143.94 ? 198 HIS A CG    1 
ATOM   1402 N ND1   . HIS A 1 198 ? 57.633  4.900  22.653  1.00 152.83 ? 198 HIS A ND1   1 
ATOM   1403 C CD2   . HIS A 1 198 ? 59.326  5.375  21.343  1.00 146.05 ? 198 HIS A CD2   1 
ATOM   1404 C CE1   . HIS A 1 198 ? 57.330  6.017  21.966  1.00 154.96 ? 198 HIS A CE1   1 
ATOM   1405 N NE2   . HIS A 1 198 ? 58.368  6.308  21.166  1.00 153.10 ? 198 HIS A NE2   1 
ATOM   1406 N N     . ARG A 1 199 ? 60.271  1.242  20.481  1.00 140.19 ? 199 ARG A N     1 
ATOM   1407 C CA    . ARG A 1 199 ? 60.629  1.081  19.071  1.00 135.99 ? 199 ARG A CA    1 
ATOM   1408 C C     . ARG A 1 199 ? 59.739  0.056  18.364  1.00 135.71 ? 199 ARG A C     1 
ATOM   1409 O O     . ARG A 1 199 ? 59.485  0.169  17.162  1.00 131.45 ? 199 ARG A O     1 
ATOM   1410 C CB    . ARG A 1 199 ? 62.105  0.685  18.939  1.00 138.65 ? 199 ARG A CB    1 
ATOM   1411 C CG    . ARG A 1 199 ? 62.734  0.993  17.584  1.00 141.67 ? 199 ARG A CG    1 
ATOM   1412 C CD    . ARG A 1 199 ? 63.090  2.467  17.434  1.00 142.27 ? 199 ARG A CD    1 
ATOM   1413 N NE    . ARG A 1 199 ? 64.201  2.861  18.301  1.00 141.05 ? 199 ARG A NE    1 
ATOM   1414 C CZ    . ARG A 1 199 ? 64.694  4.095  18.388  1.00 143.23 ? 199 ARG A CZ    1 
ATOM   1415 N NH1   . ARG A 1 199 ? 64.182  5.080  17.660  1.00 152.73 ? 199 ARG A NH1   1 
ATOM   1416 N NH2   . ARG A 1 199 ? 65.705  4.344  19.208  1.00 134.58 ? 199 ARG A NH2   1 
ATOM   1417 N N     . THR A 1 200 ? 59.272  -0.937 19.119  1.00 135.70 ? 200 THR A N     1 
ATOM   1418 C CA    . THR A 1 200 ? 58.401  -1.988 18.592  1.00 141.90 ? 200 THR A CA    1 
ATOM   1419 C C     . THR A 1 200 ? 56.977  -1.471 18.355  1.00 149.48 ? 200 THR A C     1 
ATOM   1420 O O     . THR A 1 200 ? 56.302  -1.903 17.417  1.00 156.46 ? 200 THR A O     1 
ATOM   1421 C CB    . THR A 1 200 ? 58.360  -3.213 19.534  1.00 145.93 ? 200 THR A CB    1 
ATOM   1422 O OG1   . THR A 1 200 ? 59.671  -3.468 20.055  1.00 133.11 ? 200 THR A OG1   1 
ATOM   1423 C CG2   . THR A 1 200 ? 57.863  -4.454 18.798  1.00 153.15 ? 200 THR A CG2   1 
ATOM   1424 N N     . LYS A 1 201 ? 56.538  -0.544 19.205  1.00 145.80 ? 201 LYS A N     1 
ATOM   1425 C CA    . LYS A 1 201 ? 55.190  0.030  19.123  1.00 139.43 ? 201 LYS A CA    1 
ATOM   1426 C C     . LYS A 1 201 ? 55.000  0.924  17.897  1.00 145.36 ? 201 LYS A C     1 
ATOM   1427 O O     . LYS A 1 201 ? 53.912  0.965  17.317  1.00 148.65 ? 201 LYS A O     1 
ATOM   1428 C CB    . LYS A 1 201 ? 54.850  0.806  20.402  1.00 137.16 ? 201 LYS A CB    1 
ATOM   1429 C CG    . LYS A 1 201 ? 54.693  -0.054 21.651  1.00 136.23 ? 201 LYS A CG    1 
ATOM   1430 C CD    . LYS A 1 201 ? 53.383  -0.829 21.653  1.00 138.32 ? 201 LYS A CD    1 
ATOM   1431 C CE    . LYS A 1 201 ? 53.277  -1.728 22.874  1.00 139.48 ? 201 LYS A CE    1 
ATOM   1432 N NZ    . LYS A 1 201 ? 52.023  -2.532 22.866  1.00 147.70 ? 201 LYS A NZ    1 
ATOM   1433 N N     . ILE A 1 202 ? 56.059  1.637  17.514  1.00 146.03 ? 202 ILE A N     1 
ATOM   1434 C CA    . ILE A 1 202 ? 56.046  2.492  16.323  1.00 145.96 ? 202 ILE A CA    1 
ATOM   1435 C C     . ILE A 1 202 ? 56.022  1.654  15.039  1.00 144.34 ? 202 ILE A C     1 
ATOM   1436 O O     . ILE A 1 202 ? 55.352  2.017  14.068  1.00 143.24 ? 202 ILE A O     1 
ATOM   1437 C CB    . ILE A 1 202 ? 57.219  3.511  16.339  1.00 140.31 ? 202 ILE A CB    1 
ATOM   1438 C CG1   . ILE A 1 202 ? 56.790  4.818  17.017  1.00 147.03 ? 202 ILE A CG1   1 
ATOM   1439 C CG2   . ILE A 1 202 ? 57.715  3.835  14.936  1.00 135.58 ? 202 ILE A CG2   1 
ATOM   1440 C CD1   . ILE A 1 202 ? 56.769  4.777  18.531  1.00 151.47 ? 202 ILE A CD1   1 
ATOM   1441 N N     . GLU A 1 203 ? 56.736  0.528  15.055  1.00 143.01 ? 203 GLU A N     1 
ATOM   1442 C CA    . GLU A 1 203 ? 56.764  -0.405 13.926  1.00 143.67 ? 203 GLU A CA    1 
ATOM   1443 C C     . GLU A 1 203 ? 55.384  -1.021 13.675  1.00 155.36 ? 203 GLU A C     1 
ATOM   1444 O O     . GLU A 1 203 ? 55.003  -1.260 12.526  1.00 150.35 ? 203 GLU A O     1 
ATOM   1445 C CB    . GLU A 1 203 ? 57.808  -1.503 14.164  1.00 141.70 ? 203 GLU A CB    1 
ATOM   1446 C CG    . GLU A 1 203 ? 58.188  -2.307 12.925  1.00 148.96 ? 203 GLU A CG    1 
ATOM   1447 C CD    . GLU A 1 203 ? 58.977  -1.502 11.904  1.00 148.57 ? 203 GLU A CD    1 
ATOM   1448 O OE1   . GLU A 1 203 ? 59.867  -0.721 12.304  1.00 150.86 ? 203 GLU A OE1   1 
ATOM   1449 O OE2   . GLU A 1 203 ? 58.703  -1.652 10.694  1.00 147.26 ? 203 GLU A OE2   1 
ATOM   1450 N N     . GLU A 1 204 ? 54.646  -1.271 14.755  1.00 155.52 ? 204 GLU A N     1 
ATOM   1451 C CA    . GLU A 1 204 ? 53.271  -1.765 14.674  1.00 155.34 ? 204 GLU A CA    1 
ATOM   1452 C C     . GLU A 1 204 ? 52.306  -0.655 14.254  1.00 148.78 ? 204 GLU A C     1 
ATOM   1453 O O     . GLU A 1 204 ? 51.275  -0.923 13.634  1.00 148.21 ? 204 GLU A O     1 
ATOM   1454 C CB    . GLU A 1 204 ? 52.831  -2.366 16.012  1.00 154.12 ? 204 GLU A CB    1 
ATOM   1455 C CG    . GLU A 1 204 ? 53.535  -3.665 16.380  1.00 154.72 ? 204 GLU A CG    1 
ATOM   1456 C CD    . GLU A 1 204 ? 53.090  -4.225 17.720  1.00 155.13 ? 204 GLU A CD    1 
ATOM   1457 O OE1   . GLU A 1 204 ? 51.871  -4.233 17.998  1.00 157.53 ? 204 GLU A OE1   1 
ATOM   1458 O OE2   . GLU A 1 204 ? 53.963  -4.668 18.495  1.00 151.48 ? 204 GLU A OE2   1 
ATOM   1459 N N     . LEU A 1 205 ? 52.653  0.584  14.601  1.00 145.04 ? 205 LEU A N     1 
ATOM   1460 C CA    . LEU A 1 205 ? 51.862  1.760  14.237  1.00 137.79 ? 205 LEU A CA    1 
ATOM   1461 C C     . LEU A 1 205 ? 52.017  2.085  12.750  1.00 131.61 ? 205 LEU A C     1 
ATOM   1462 O O     . LEU A 1 205 ? 51.077  2.567  12.114  1.00 128.79 ? 205 LEU A O     1 
ATOM   1463 C CB    . LEU A 1 205 ? 52.270  2.961  15.100  1.00 140.05 ? 205 LEU A CB    1 
ATOM   1464 C CG    . LEU A 1 205 ? 51.305  4.142  15.269  1.00 140.15 ? 205 LEU A CG    1 
ATOM   1465 C CD1   . LEU A 1 205 ? 51.451  4.750  16.656  1.00 146.79 ? 205 LEU A CD1   1 
ATOM   1466 C CD2   . LEU A 1 205 ? 51.507  5.204  14.197  1.00 145.31 ? 205 LEU A CD2   1 
ATOM   1467 N N     . ARG A 1 206 ? 53.205  1.815  12.209  1.00 131.64 ? 206 ARG A N     1 
ATOM   1468 C CA    . ARG A 1 206 ? 53.502  2.032  10.791  1.00 137.62 ? 206 ARG A CA    1 
ATOM   1469 C C     . ARG A 1 206 ? 52.714  1.087  9.884   1.00 133.22 ? 206 ARG A C     1 
ATOM   1470 O O     . ARG A 1 206 ? 52.279  1.479  8.799   1.00 124.23 ? 206 ARG A O     1 
ATOM   1471 C CB    . ARG A 1 206 ? 55.002  1.873  10.525  1.00 139.78 ? 206 ARG A CB    1 
ATOM   1472 C CG    . ARG A 1 206 ? 55.851  3.060  10.951  1.00 135.99 ? 206 ARG A CG    1 
ATOM   1473 C CD    . ARG A 1 206 ? 57.336  2.744  10.846  1.00 132.02 ? 206 ARG A CD    1 
ATOM   1474 N NE    . ARG A 1 206 ? 57.761  2.515  9.465   1.00 134.10 ? 206 ARG A NE    1 
ATOM   1475 C CZ    . ARG A 1 206 ? 58.939  2.009  9.109   1.00 143.22 ? 206 ARG A CZ    1 
ATOM   1476 N NH1   . ARG A 1 206 ? 59.833  1.665  10.029  1.00 148.29 ? 206 ARG A NH1   1 
ATOM   1477 N NH2   . ARG A 1 206 ? 59.224  1.842  7.825   1.00 141.59 ? 206 ARG A NH2   1 
ATOM   1478 N N     . GLN A 1 207 ? 52.540  -0.153 10.337  1.00 141.33 ? 207 GLN A N     1 
ATOM   1479 C CA    . GLN A 1 207 ? 51.793  -1.170 9.593   1.00 146.99 ? 207 GLN A CA    1 
ATOM   1480 C C     . GLN A 1 207 ? 50.289  -0.896 9.601   1.00 145.37 ? 207 GLN A C     1 
ATOM   1481 O O     . GLN A 1 207 ? 49.572  -1.306 8.685   1.00 146.96 ? 207 GLN A O     1 
ATOM   1482 C CB    . GLN A 1 207 ? 52.077  -2.567 10.154  1.00 153.82 ? 207 GLN A CB    1 
ATOM   1483 C CG    . GLN A 1 207 ? 53.493  -3.068 9.904   1.00 147.78 ? 207 GLN A CG    1 
ATOM   1484 C CD    . GLN A 1 207 ? 53.750  -4.444 10.494  1.00 151.55 ? 207 GLN A CD    1 
ATOM   1485 O OE1   . GLN A 1 207 ? 52.879  -5.316 10.484  1.00 163.87 ? 207 GLN A OE1   1 
ATOM   1486 N NE2   . GLN A 1 207 ? 54.959  -4.648 11.006  1.00 144.70 ? 207 GLN A NE2   1 
ATOM   1487 N N     . HIS A 1 208 ? 49.824  -0.204 10.640  1.00 142.60 ? 208 HIS A N     1 
ATOM   1488 C CA    . HIS A 1 208 ? 48.416  0.166  10.778  1.00 147.03 ? 208 HIS A CA    1 
ATOM   1489 C C     . HIS A 1 208 ? 48.033  1.266  9.824   1.00 143.62 ? 208 HIS A C     1 
ATOM   1490 O O     . HIS A 1 208 ? 46.896  1.316  9.351   1.00 147.06 ? 208 HIS A O     1 
ATOM   1491 C CB    . HIS A 1 208 ? 48.117  0.583  12.215  1.00 144.80 ? 208 HIS A CB    1 
ATOM   1492 C CG    . HIS A 1 208 ? 46.643  0.685  12.528  1.00 142.52 ? 208 HIS A CG    1 
ATOM   1493 N ND1   . HIS A 1 208 ? 45.933  -0.350 13.010  1.00 146.52 ? 208 HIS A ND1   1 
ATOM   1494 C CD2   . HIS A 1 208 ? 45.754  1.752  12.412  1.00 134.00 ? 208 HIS A CD2   1 
ATOM   1495 C CE1   . HIS A 1 208 ? 44.654  0.030  13.194  1.00 143.59 ? 208 HIS A CE1   1 
ATOM   1496 N NE2   . HIS A 1 208 ? 44.547  1.317  12.827  1.00 131.38 ? 208 HIS A NE2   1 
ATOM   1497 N N     . LEU A 1 209 ? 48.984  2.154  9.537   1.00 136.25 ? 209 LEU A N     1 
ATOM   1498 C CA    . LEU A 1 209 ? 48.766  3.268  8.612   1.00 133.15 ? 209 LEU A CA    1 
ATOM   1499 C C     . LEU A 1 209 ? 49.004  2.861  7.157   1.00 129.26 ? 209 LEU A C     1 
ATOM   1500 O O     . LEU A 1 209 ? 48.460  3.478  6.238   1.00 130.98 ? 209 LEU A O     1 
ATOM   1501 C CB    . LEU A 1 209 ? 49.660  4.460  8.976   1.00 142.90 ? 209 LEU A CB    1 
ATOM   1502 C CG    . LEU A 1 209 ? 49.548  5.100  10.367  1.00 154.84 ? 209 LEU A CG    1 
ATOM   1503 C CD1   . LEU A 1 209 ? 50.682  6.092  10.579  1.00 151.54 ? 209 LEU A CD1   1 
ATOM   1504 C CD2   . LEU A 1 209 ? 48.199  5.775  10.584  1.00 161.75 ? 209 LEU A CD2   1 
ATOM   1505 N N     . LEU A 1 210 ? 49.816  1.823  6.961   1.00 123.95 ? 210 LEU A N     1 
ATOM   1506 C CA    . LEU A 1 210 ? 50.155  1.319  5.627   1.00 128.86 ? 210 LEU A CA    1 
ATOM   1507 C C     . LEU A 1 210 ? 48.971  0.613  4.958   1.00 139.49 ? 210 LEU A C     1 
ATOM   1508 O O     . LEU A 1 210 ? 48.908  0.523  3.729   1.00 142.20 ? 210 LEU A O     1 
ATOM   1509 C CB    . LEU A 1 210 ? 51.362  0.374  5.709   1.00 134.92 ? 210 LEU A CB    1 
ATOM   1510 C CG    . LEU A 1 210 ? 52.133  0.025  4.429   1.00 138.81 ? 210 LEU A CG    1 
ATOM   1511 C CD1   . LEU A 1 210 ? 52.979  1.197  3.949   1.00 127.17 ? 210 LEU A CD1   1 
ATOM   1512 C CD2   . LEU A 1 210 ? 53.005  -1.200 4.657   1.00 149.51 ? 210 LEU A CD2   1 
ATOM   1513 N N     . ARG A 1 211 ? 48.042  0.122  5.777   1.00 145.23 ? 211 ARG A N     1 
ATOM   1514 C CA    . ARG A 1 211 ? 46.840  -0.569 5.303   1.00 148.65 ? 211 ARG A CA    1 
ATOM   1515 C C     . ARG A 1 211 ? 45.920  0.339  4.485   1.00 154.11 ? 211 ARG A C     1 
ATOM   1516 O O     . ARG A 1 211 ? 45.301  -0.107 3.516   1.00 152.99 ? 211 ARG A O     1 
ATOM   1517 C CB    . ARG A 1 211 ? 46.073  -1.165 6.487   1.00 148.67 ? 211 ARG A CB    1 
ATOM   1518 C CG    . ARG A 1 211 ? 46.694  -2.431 7.060   1.00 140.87 ? 211 ARG A CG    1 
ATOM   1519 C CD    . ARG A 1 211 ? 46.407  -2.585 8.547   1.00 145.29 ? 211 ARG A CD    1 
ATOM   1520 N NE    . ARG A 1 211 ? 44.978  -2.663 8.849   1.00 156.33 ? 211 ARG A NE    1 
ATOM   1521 C CZ    . ARG A 1 211 ? 44.469  -2.775 10.074  1.00 159.01 ? 211 ARG A CZ    1 
ATOM   1522 N NH1   . ARG A 1 211 ? 45.267  -2.827 11.134  1.00 153.31 ? 211 ARG A NH1   1 
ATOM   1523 N NH2   . ARG A 1 211 ? 43.155  -2.836 10.241  1.00 162.03 ? 211 ARG A NH2   1 
ATOM   1524 N N     . TRP A 1 212 ? 45.838  1.608  4.881   1.00 148.56 ? 212 TRP A N     1 
ATOM   1525 C CA    . TRP A 1 212 ? 45.015  2.596  4.183   1.00 150.51 ? 212 TRP A CA    1 
ATOM   1526 C C     . TRP A 1 212 ? 45.732  3.192  3.004   1.00 148.45 ? 212 TRP A C     1 
ATOM   1527 O O     . TRP A 1 212 ? 45.111  3.504  1.986   1.00 148.15 ? 212 TRP A O     1 
ATOM   1528 C CB    . TRP A 1 212 ? 44.567  3.694  5.142   1.00 151.08 ? 212 TRP A CB    1 
ATOM   1529 C CG    . TRP A 1 212 ? 43.726  3.185  6.290   1.00 146.42 ? 212 TRP A CG    1 
ATOM   1530 C CD1   . TRP A 1 212 ? 44.162  2.786  7.551   1.00 133.90 ? 212 TRP A CD1   1 
ATOM   1531 C CD2   . TRP A 1 212 ? 42.267  2.998  6.316   1.00 157.87 ? 212 TRP A CD2   1 
ATOM   1532 N NE1   . TRP A 1 212 ? 43.107  2.380  8.330   1.00 135.48 ? 212 TRP A NE1   1 
ATOM   1533 C CE2   . TRP A 1 212 ? 41.944  2.482  7.653   1.00 151.50 ? 212 TRP A CE2   1 
ATOM   1534 C CE3   . TRP A 1 212 ? 41.236  3.199  5.403   1.00 163.59 ? 212 TRP A CE3   1 
ATOM   1535 C CZ2   . TRP A 1 212 ? 40.641  2.188  8.033   1.00 161.15 ? 212 TRP A CZ2   1 
ATOM   1536 C CZ3   . TRP A 1 212 ? 39.926  2.899  5.800   1.00 164.72 ? 212 TRP A CZ3   1 
ATOM   1537 C CH2   . TRP A 1 212 ? 39.638  2.406  7.083   1.00 166.19 ? 212 TRP A CH2   1 
ATOM   1538 N N     . GLY A 1 213 ? 47.048  3.353  3.135   1.00 143.00 ? 213 GLY A N     1 
ATOM   1539 C CA    . GLY A 1 213 ? 47.879  3.908  2.068   1.00 142.67 ? 213 GLY A CA    1 
ATOM   1540 C C     . GLY A 1 213 ? 48.626  5.159  2.491   1.00 142.83 ? 213 GLY A C     1 
ATOM   1541 O O     . GLY A 1 213 ? 48.586  6.177  1.798   1.00 136.63 ? 213 GLY A O     1 
ATOM   1542 N N     . LEU A 1 214 ? 49.309  5.075  3.630   1.00 142.85 ? 214 LEU A N     1 
ATOM   1543 C CA    . LEU A 1 214 ? 50.070  6.200  4.171   1.00 143.36 ? 214 LEU A CA    1 
ATOM   1544 C C     . LEU A 1 214 ? 51.550  5.847  4.294   1.00 150.17 ? 214 LEU A C     1 
ATOM   1545 O O     . LEU A 1 214 ? 51.906  4.814  4.867   1.00 160.31 ? 214 LEU A O     1 
ATOM   1546 C CB    . LEU A 1 214 ? 49.506  6.633  5.531   1.00 138.92 ? 214 LEU A CB    1 
ATOM   1547 C CG    . LEU A 1 214 ? 48.031  7.051  5.608   1.00 132.72 ? 214 LEU A CG    1 
ATOM   1548 C CD1   . LEU A 1 214 ? 47.524  6.981  7.041   1.00 136.79 ? 214 LEU A CD1   1 
ATOM   1549 C CD2   . LEU A 1 214 ? 47.804  8.440  5.027   1.00 132.51 ? 214 LEU A CD2   1 
ATOM   1550 N N     . THR A 1 215 ? 52.404  6.711  3.748   1.00 141.88 ? 215 THR A N     1 
ATOM   1551 C CA    . THR A 1 215 ? 53.848  6.482  3.736   1.00 137.54 ? 215 THR A CA    1 
ATOM   1552 C C     . THR A 1 215 ? 54.496  6.969  5.033   1.00 135.68 ? 215 THR A C     1 
ATOM   1553 O O     . THR A 1 215 ? 54.303  8.116  5.445   1.00 133.75 ? 215 THR A O     1 
ATOM   1554 C CB    . THR A 1 215 ? 54.521  7.161  2.522   1.00 130.45 ? 215 THR A CB    1 
ATOM   1555 O OG1   . THR A 1 215 ? 53.744  6.924  1.341   1.00 133.97 ? 215 THR A OG1   1 
ATOM   1556 C CG2   . THR A 1 215 ? 55.933  6.623  2.309   1.00 133.03 ? 215 THR A CG2   1 
ATOM   1557 N N     . THR A 1 216 ? 55.259  6.081  5.668   1.00 146.46 ? 216 THR A N     1 
ATOM   1558 C CA    . THR A 1 216 ? 55.970  6.391  6.910   1.00 148.81 ? 216 THR A CA    1 
ATOM   1559 C C     . THR A 1 216 ? 57.466  6.095  6.773   1.00 154.83 ? 216 THR A C     1 
ATOM   1560 O O     . THR A 1 216 ? 57.842  5.070  6.197   1.00 160.06 ? 216 THR A O     1 
ATOM   1561 C CB    . THR A 1 216 ? 55.401  5.603  8.110   1.00 153.89 ? 216 THR A CB    1 
ATOM   1562 O OG1   . THR A 1 216 ? 55.285  4.216  7.767   1.00 168.21 ? 216 THR A OG1   1 
ATOM   1563 C CG2   . THR A 1 216 ? 54.032  6.141  8.515   1.00 141.46 ? 216 THR A CG2   1 
ATOM   1564 N N     . PRO A 1 217 ? 58.325  6.995  7.297   1.00 155.53 ? 217 PRO A N     1 
ATOM   1565 C CA    . PRO A 1 217 ? 59.779  6.812  7.232   1.00 151.02 ? 217 PRO A CA    1 
ATOM   1566 C C     . PRO A 1 217 ? 60.266  5.657  8.106   1.00 150.10 ? 217 PRO A C     1 
ATOM   1567 O O     . PRO A 1 217 ? 59.618  5.312  9.097   1.00 151.22 ? 217 PRO A O     1 
ATOM   1568 C CB    . PRO A 1 217 ? 60.331  8.141  7.768   1.00 141.56 ? 217 PRO A CB    1 
ATOM   1569 C CG    . PRO A 1 217 ? 59.196  9.107  7.685   1.00 143.23 ? 217 PRO A CG    1 
ATOM   1570 C CD    . PRO A 1 217 ? 57.973  8.279  7.927   1.00 150.12 ? 217 PRO A CD    1 
ATOM   1571 N N     . ASP A 1 218 ? 61.403  5.075  7.731   1.00 151.98 ? 218 ASP A N     1 
ATOM   1572 C CA    . ASP A 1 218 ? 61.988  3.950  8.464   1.00 152.18 ? 218 ASP A CA    1 
ATOM   1573 C C     . ASP A 1 218 ? 62.772  4.397  9.703   1.00 157.45 ? 218 ASP A C     1 
ATOM   1574 O O     . ASP A 1 218 ? 62.821  5.589  10.017  1.00 157.53 ? 218 ASP A O     1 
ATOM   1575 C CB    . ASP A 1 218 ? 62.860  3.090  7.534   1.00 146.73 ? 218 ASP A CB    1 
ATOM   1576 C CG    . ASP A 1 218 ? 63.905  3.901  6.783   1.00 147.91 ? 218 ASP A CG    1 
ATOM   1577 O OD1   . ASP A 1 218 ? 64.837  4.431  7.426   1.00 154.30 ? 218 ASP A OD1   1 
ATOM   1578 O OD2   . ASP A 1 218 ? 63.792  4.009  5.544   1.00 145.11 ? 218 ASP A OD2   1 
ATOM   1579 N N     . LYS A 1 219 ? 63.379  3.432  10.394  1.00 162.06 ? 219 LYS A N     1 
ATOM   1580 C CA    . LYS A 1 219 ? 64.128  3.676  11.631  1.00 163.50 ? 219 LYS A CA    1 
ATOM   1581 C C     . LYS A 1 219 ? 65.309  4.633  11.438  1.00 161.78 ? 219 LYS A C     1 
ATOM   1582 O O     . LYS A 1 219 ? 65.601  5.450  12.315  1.00 161.11 ? 219 LYS A O     1 
ATOM   1583 C CB    . LYS A 1 219 ? 64.611  2.347  12.225  1.00 153.38 ? 219 LYS A CB    1 
ATOM   1584 C CG    . LYS A 1 219 ? 65.099  2.430  13.664  1.00 148.42 ? 219 LYS A CG    1 
ATOM   1585 C CD    . LYS A 1 219 ? 65.610  1.083  14.150  1.00 143.63 ? 219 LYS A CD    1 
ATOM   1586 C CE    . LYS A 1 219 ? 66.157  1.177  15.565  1.00 148.30 ? 219 LYS A CE    1 
ATOM   1587 N NZ    . LYS A 1 219 ? 66.660  -0.137 16.054  1.00 151.42 ? 219 LYS A NZ    1 
ATOM   1588 N N     . LYS A 1 220 ? 65.977  4.526  10.291  1.00 161.46 ? 220 LYS A N     1 
ATOM   1589 C CA    . LYS A 1 220 ? 67.127  5.374  9.969   1.00 150.97 ? 220 LYS A CA    1 
ATOM   1590 C C     . LYS A 1 220 ? 66.725  6.810  9.624   1.00 154.33 ? 220 LYS A C     1 
ATOM   1591 O O     . LYS A 1 220 ? 67.514  7.740  9.805   1.00 151.63 ? 220 LYS A O     1 
ATOM   1592 C CB    . LYS A 1 220 ? 67.937  4.764  8.822   1.00 154.39 ? 220 LYS A CB    1 
ATOM   1593 N N     . HIS A 1 221 ? 65.500  6.980  9.129   1.00 156.52 ? 221 HIS A N     1 
ATOM   1594 C CA    . HIS A 1 221 ? 64.988  8.293  8.731   1.00 151.02 ? 221 HIS A CA    1 
ATOM   1595 C C     . HIS A 1 221 ? 64.197  8.980  9.816   1.00 149.38 ? 221 HIS A C     1 
ATOM   1596 O O     . HIS A 1 221 ? 63.629  10.053 9.593   1.00 138.57 ? 221 HIS A O     1 
ATOM   1597 C CB    . HIS A 1 221 ? 64.158  8.174  7.455   1.00 145.66 ? 221 HIS A CB    1 
ATOM   1598 C CG    . HIS A 1 221 ? 64.980  7.916  6.215   1.00 146.44 ? 221 HIS A CG    1 
ATOM   1599 N ND1   . HIS A 1 221 ? 65.387  6.684  5.861   1.00 153.63 ? 221 HIS A ND1   1 
ATOM   1600 C CD2   . HIS A 1 221 ? 65.465  8.786  5.240   1.00 142.94 ? 221 HIS A CD2   1 
ATOM   1601 C CE1   . HIS A 1 221 ? 66.097  6.757  4.719   1.00 150.48 ? 221 HIS A CE1   1 
ATOM   1602 N NE2   . HIS A 1 221 ? 66.144  8.045  4.340   1.00 139.73 ? 221 HIS A NE2   1 
ATOM   1603 N N     . GLN A 1 222 ? 64.161  8.373  11.002  1.00 153.99 ? 222 GLN A N     1 
ATOM   1604 C CA    . GLN A 1 222 ? 63.458  8.941  12.155  1.00 150.85 ? 222 GLN A CA    1 
ATOM   1605 C C     . GLN A 1 222 ? 64.202  10.139 12.741  1.00 151.16 ? 222 GLN A C     1 
ATOM   1606 O O     . GLN A 1 222 ? 65.434  10.145 12.810  1.00 154.72 ? 222 GLN A O     1 
ATOM   1607 C CB    . GLN A 1 222 ? 63.237  7.877  13.233  1.00 145.33 ? 222 GLN A CB    1 
ATOM   1608 C CG    . GLN A 1 222 ? 62.066  6.943  12.957  1.00 141.15 ? 222 GLN A CG    1 
ATOM   1609 C CD    . GLN A 1 222 ? 61.978  5.780  13.932  1.00 147.82 ? 222 GLN A CD    1 
ATOM   1610 O OE1   . GLN A 1 222 ? 61.478  4.709  13.587  1.00 153.25 ? 222 GLN A OE1   1 
ATOM   1611 N NE2   . GLN A 1 222 ? 62.463  5.984  15.154  1.00 155.34 ? 222 GLN A NE2   1 
ATOM   1612 N N     . LYS A 1 223 ? 63.441  11.146 13.164  1.00 147.22 ? 223 LYS A N     1 
ATOM   1613 C CA    . LYS A 1 223 ? 64.004  12.386 13.702  1.00 135.76 ? 223 LYS A CA    1 
ATOM   1614 C C     . LYS A 1 223 ? 64.480  12.237 15.147  1.00 145.92 ? 223 LYS A C     1 
ATOM   1615 O O     . LYS A 1 223 ? 63.958  11.414 15.904  1.00 155.65 ? 223 LYS A O     1 
ATOM   1616 C CB    . LYS A 1 223 ? 62.992  13.532 13.592  1.00 137.10 ? 223 LYS A CB    1 
ATOM   1617 C CG    . LYS A 1 223 ? 62.749  14.019 12.172  1.00 140.05 ? 223 LYS A CG    1 
ATOM   1618 C CD    . LYS A 1 223 ? 61.767  15.178 12.145  1.00 153.81 ? 223 LYS A CD    1 
ATOM   1619 C CE    . LYS A 1 223 ? 61.547  15.683 10.728  1.00 156.90 ? 223 LYS A CE    1 
ATOM   1620 N NZ    . LYS A 1 223 ? 60.592  16.825 10.686  1.00 151.76 ? 223 LYS A NZ    1 
ATOM   1621 N N     . GLU A 1 224 ? 65.472  13.045 15.514  1.00 141.87 ? 224 GLU A N     1 
ATOM   1622 C CA    . GLU A 1 224 ? 66.066  13.023 16.851  1.00 144.36 ? 224 GLU A CA    1 
ATOM   1623 C C     . GLU A 1 224 ? 65.162  13.687 17.900  1.00 148.44 ? 224 GLU A C     1 
ATOM   1624 O O     . GLU A 1 224 ? 64.336  14.534 17.552  1.00 153.47 ? 224 GLU A O     1 
ATOM   1625 C CB    . GLU A 1 224 ? 67.444  13.695 16.830  1.00 148.87 ? 224 GLU A CB    1 
ATOM   1626 C CG    . GLU A 1 224 ? 68.530  12.876 16.146  1.00 161.48 ? 224 GLU A CG    1 
ATOM   1627 C CD    . GLU A 1 224 ? 69.906  13.511 16.245  1.00 160.75 ? 224 GLU A CD    1 
ATOM   1628 O OE1   . GLU A 1 224 ? 70.272  13.995 17.338  1.00 156.20 ? 224 GLU A OE1   1 
ATOM   1629 O OE2   . GLU A 1 224 ? 70.626  13.527 15.224  1.00 158.75 ? 224 GLU A OE2   1 
ATOM   1630 N N     . PRO A 1 225 ? 65.315  13.295 19.187  1.00 149.66 ? 225 PRO A N     1 
ATOM   1631 C CA    . PRO A 1 225 ? 64.572  13.848 20.330  1.00 156.36 ? 225 PRO A CA    1 
ATOM   1632 C C     . PRO A 1 225 ? 64.399  15.379 20.386  1.00 153.27 ? 225 PRO A C     1 
ATOM   1633 O O     . PRO A 1 225 ? 63.352  15.838 20.848  1.00 154.81 ? 225 PRO A O     1 
ATOM   1634 C CB    . PRO A 1 225 ? 65.359  13.343 21.555  1.00 149.05 ? 225 PRO A CB    1 
ATOM   1635 C CG    . PRO A 1 225 ? 66.383  12.380 21.037  1.00 142.41 ? 225 PRO A CG    1 
ATOM   1636 C CD    . PRO A 1 225 ? 66.088  12.109 19.593  1.00 141.56 ? 225 PRO A CD    1 
ATOM   1637 N N     . PRO A 1 226 ? 65.411  16.170 19.956  1.00 149.56 ? 226 PRO A N     1 
ATOM   1638 C CA    . PRO A 1 226 ? 65.128  17.606 19.850  1.00 145.00 ? 226 PRO A CA    1 
ATOM   1639 C C     . PRO A 1 226 ? 64.174  17.932 18.698  1.00 147.15 ? 226 PRO A C     1 
ATOM   1640 O O     . PRO A 1 226 ? 64.493  17.673 17.533  1.00 150.07 ? 226 PRO A O     1 
ATOM   1641 C CB    . PRO A 1 226 ? 66.510  18.224 19.596  1.00 140.17 ? 226 PRO A CB    1 
ATOM   1642 C CG    . PRO A 1 226 ? 67.477  17.228 20.135  1.00 149.36 ? 226 PRO A CG    1 
ATOM   1643 C CD    . PRO A 1 226 ? 66.856  15.899 19.828  1.00 152.48 ? 226 PRO A CD    1 
ATOM   1644 N N     . PHE A 1 227 ? 63.010  18.487 19.035  1.00 144.98 ? 227 PHE A N     1 
ATOM   1645 C CA    . PHE A 1 227 ? 62.002  18.863 18.042  1.00 149.34 ? 227 PHE A CA    1 
ATOM   1646 C C     . PHE A 1 227 ? 61.775  20.373 18.006  1.00 145.65 ? 227 PHE A C     1 
ATOM   1647 O O     . PHE A 1 227 ? 62.013  21.071 18.995  1.00 141.32 ? 227 PHE A O     1 
ATOM   1648 C CB    . PHE A 1 227 ? 60.671  18.149 18.312  1.00 154.46 ? 227 PHE A CB    1 
ATOM   1649 C CG    . PHE A 1 227 ? 60.760  16.648 18.279  1.00 155.44 ? 227 PHE A CG    1 
ATOM   1650 C CD1   . PHE A 1 227 ? 61.010  15.974 17.087  1.00 152.93 ? 227 PHE A CD1   1 
ATOM   1651 C CD2   . PHE A 1 227 ? 60.572  15.905 19.439  1.00 157.24 ? 227 PHE A CD2   1 
ATOM   1652 C CE1   . PHE A 1 227 ? 61.087  14.589 17.058  1.00 153.20 ? 227 PHE A CE1   1 
ATOM   1653 C CE2   . PHE A 1 227 ? 60.648  14.520 19.417  1.00 151.18 ? 227 PHE A CE2   1 
ATOM   1654 C CZ    . PHE A 1 227 ? 60.905  13.861 18.224  1.00 150.88 ? 227 PHE A CZ    1 
ATOM   1655 N N     . LEU A 1 228 ? 61.311  20.864 16.859  1.00 154.35 ? 228 LEU A N     1 
ATOM   1656 C CA    . LEU A 1 228 ? 60.970  22.274 16.690  1.00 155.21 ? 228 LEU A CA    1 
ATOM   1657 C C     . LEU A 1 228 ? 59.508  22.423 16.270  1.00 159.53 ? 228 LEU A C     1 
ATOM   1658 O O     . LEU A 1 228 ? 59.140  22.105 15.136  1.00 168.66 ? 228 LEU A O     1 
ATOM   1659 C CB    . LEU A 1 228 ? 61.901  22.944 15.670  1.00 147.29 ? 228 LEU A CB    1 
ATOM   1660 C CG    . LEU A 1 228 ? 63.395  23.048 15.999  1.00 139.44 ? 228 LEU A CG    1 
ATOM   1661 C CD1   . LEU A 1 228 ? 64.202  23.316 14.738  1.00 133.91 ? 228 LEU A CD1   1 
ATOM   1662 C CD2   . LEU A 1 228 ? 63.670  24.115 17.051  1.00 143.15 ? 228 LEU A CD2   1 
ATOM   1663 N N     . TRP A 1 229 ? 58.682  22.900 17.199  1.00 152.83 ? 229 TRP A N     1 
ATOM   1664 C CA    . TRP A 1 229 ? 57.247  23.056 16.969  1.00 154.65 ? 229 TRP A CA    1 
ATOM   1665 C C     . TRP A 1 229 ? 56.742  24.344 17.553  1.00 156.86 ? 229 TRP A C     1 
ATOM   1666 O O     . TRP A 1 229 ? 56.950  24.619 18.738  1.00 159.14 ? 229 TRP A O     1 
ATOM   1667 C CB    . TRP A 1 229 ? 56.486  21.866 17.550  1.00 154.64 ? 229 TRP A CB    1 
ATOM   1668 C CG    . TRP A 1 229 ? 54.995  21.906 17.306  1.00 157.86 ? 229 TRP A CG    1 
ATOM   1669 C CD1   . TRP A 1 229 ? 54.310  21.509 16.161  1.00 156.89 ? 229 TRP A CD1   1 
ATOM   1670 C CD2   . TRP A 1 229 ? 53.949  22.369 18.232  1.00 153.36 ? 229 TRP A CD2   1 
ATOM   1671 N NE1   . TRP A 1 229 ? 52.958  21.691 16.309  1.00 152.34 ? 229 TRP A NE1   1 
ATOM   1672 C CE2   . TRP A 1 229 ? 52.673  22.202 17.525  1.00 150.25 ? 229 TRP A CE2   1 
ATOM   1673 C CE3   . TRP A 1 229 ? 53.942  22.886 19.524  1.00 147.11 ? 229 TRP A CE3   1 
ATOM   1674 C CZ2   . TRP A 1 229 ? 51.459  22.544 18.106  1.00 141.57 ? 229 TRP A CZ2   1 
ATOM   1675 C CZ3   . TRP A 1 229 ? 52.711  23.227 20.099  1.00 145.79 ? 229 TRP A CZ3   1 
ATOM   1676 C CH2   . TRP A 1 229 ? 51.501  23.060 19.406  1.00 147.56 ? 229 TRP A CH2   1 
ATOM   1677 N N     . MET A 1 230 ? 56.079  25.142 16.713  1.00 156.50 ? 230 MET A N     1 
ATOM   1678 C CA    . MET A 1 230 ? 55.508  26.447 17.094  1.00 152.80 ? 230 MET A CA    1 
ATOM   1679 C C     . MET A 1 230 ? 56.524  27.436 17.684  1.00 149.06 ? 230 MET A C     1 
ATOM   1680 O O     . MET A 1 230 ? 56.159  28.341 18.440  1.00 141.22 ? 230 MET A O     1 
ATOM   1681 C CB    . MET A 1 230 ? 54.304  26.271 18.035  1.00 147.81 ? 230 MET A CB    1 
ATOM   1682 C CG    . MET A 1 230 ? 53.019  25.840 17.345  1.00 147.48 ? 230 MET A CG    1 
ATOM   1683 S SD    . MET A 1 230 ? 52.268  27.154 16.363  1.00 122.14 ? 230 MET A SD    1 
ATOM   1684 C CE    . MET A 1 230 ? 50.735  26.372 15.866  1.00 150.32 ? 230 MET A CE    1 
ATOM   1685 N N     . GLY A 1 231 ? 57.794  27.265 17.321  1.00 148.48 ? 231 GLY A N     1 
ATOM   1686 C CA    . GLY A 1 231 ? 58.871  28.117 17.819  1.00 145.90 ? 231 GLY A CA    1 
ATOM   1687 C C     . GLY A 1 231 ? 59.408  27.694 19.175  1.00 148.76 ? 231 GLY A C     1 
ATOM   1688 O O     . GLY A 1 231 ? 60.072  28.478 19.857  1.00 147.37 ? 231 GLY A O     1 
ATOM   1689 N N     . TYR A 1 232 ? 59.120  26.452 19.563  1.00 151.89 ? 232 TYR A N     1 
ATOM   1690 C CA    . TYR A 1 232 ? 59.591  25.900 20.832  1.00 151.44 ? 232 TYR A CA    1 
ATOM   1691 C C     . TYR A 1 232 ? 60.542  24.728 20.604  1.00 150.77 ? 232 TYR A C     1 
ATOM   1692 O O     . TYR A 1 232 ? 60.291  23.871 19.752  1.00 143.52 ? 232 TYR A O     1 
ATOM   1693 C CB    . TYR A 1 232 ? 58.415  25.440 21.701  1.00 153.13 ? 232 TYR A CB    1 
ATOM   1694 C CG    . TYR A 1 232 ? 57.371  26.500 21.985  1.00 145.58 ? 232 TYR A CG    1 
ATOM   1695 C CD1   . TYR A 1 232 ? 57.555  27.435 23.005  1.00 147.73 ? 232 TYR A CD1   1 
ATOM   1696 C CD2   . TYR A 1 232 ? 56.190  26.557 21.246  1.00 138.11 ? 232 TYR A CD2   1 
ATOM   1697 C CE1   . TYR A 1 232 ? 56.597  28.402 23.271  1.00 147.14 ? 232 TYR A CE1   1 
ATOM   1698 C CE2   . TYR A 1 232 ? 55.227  27.520 21.504  1.00 133.37 ? 232 TYR A CE2   1 
ATOM   1699 C CZ    . TYR A 1 232 ? 55.435  28.439 22.516  1.00 137.44 ? 232 TYR A CZ    1 
ATOM   1700 O OH    . TYR A 1 232 ? 54.478  29.394 22.772  1.00 142.49 ? 232 TYR A OH    1 
ATOM   1701 N N     . GLU A 1 233 ? 61.631  24.700 21.369  1.00 156.97 ? 233 GLU A N     1 
ATOM   1702 C CA    . GLU A 1 233 ? 62.568  23.580 21.347  1.00 161.79 ? 233 GLU A CA    1 
ATOM   1703 C C     . GLU A 1 233 ? 62.107  22.526 22.351  1.00 156.51 ? 233 GLU A C     1 
ATOM   1704 O O     . GLU A 1 233 ? 62.007  22.800 23.551  1.00 164.45 ? 233 GLU A O     1 
ATOM   1705 C CB    . GLU A 1 233 ? 63.990  24.055 21.662  1.00 163.90 ? 233 GLU A CB    1 
ATOM   1706 C CG    . GLU A 1 233 ? 65.076  23.028 21.372  1.00 158.11 ? 233 GLU A CG    1 
ATOM   1707 C CD    . GLU A 1 233 ? 66.474  23.538 21.679  1.00 142.92 ? 233 GLU A CD    1 
ATOM   1708 O OE1   . GLU A 1 233 ? 66.781  24.703 21.344  1.00 121.66 ? 233 GLU A OE1   1 
ATOM   1709 O OE2   . GLU A 1 233 ? 67.270  22.770 22.258  1.00 148.91 ? 233 GLU A OE2   1 
ATOM   1710 N N     . LEU A 1 234 ? 61.825  21.326 21.850  1.00 146.52 ? 234 LEU A N     1 
ATOM   1711 C CA    . LEU A 1 234 ? 61.250  20.257 22.667  1.00 143.61 ? 234 LEU A CA    1 
ATOM   1712 C C     . LEU A 1 234 ? 62.277  19.203 23.074  1.00 148.66 ? 234 LEU A C     1 
ATOM   1713 O O     . LEU A 1 234 ? 63.116  18.793 22.270  1.00 143.21 ? 234 LEU A O     1 
ATOM   1714 C CB    . LEU A 1 234 ? 60.075  19.596 21.937  1.00 143.38 ? 234 LEU A CB    1 
ATOM   1715 C CG    . LEU A 1 234 ? 58.824  20.446 21.681  1.00 144.96 ? 234 LEU A CG    1 
ATOM   1716 C CD1   . LEU A 1 234 ? 58.039  19.901 20.497  1.00 157.35 ? 234 LEU A CD1   1 
ATOM   1717 C CD2   . LEU A 1 234 ? 57.942  20.536 22.920  1.00 148.00 ? 234 LEU A CD2   1 
ATOM   1718 N N     . HIS A 1 235 ? 62.195  18.777 24.332  1.00 147.31 ? 235 HIS A N     1 
ATOM   1719 C CA    . HIS A 1 235 ? 63.059  17.731 24.878  1.00 148.77 ? 235 HIS A CA    1 
ATOM   1720 C C     . HIS A 1 235 ? 62.235  16.731 25.649  1.00 143.79 ? 235 HIS A C     1 
ATOM   1721 O O     . HIS A 1 235 ? 61.141  17.064 26.114  1.00 140.68 ? 235 HIS A O     1 
ATOM   1722 C CB    . HIS A 1 235 ? 64.139  18.341 25.769  1.00 154.05 ? 235 HIS A CB    1 
ATOM   1723 C CG    . HIS A 1 235 ? 65.090  19.258 25.036  1.00 148.72 ? 235 HIS A CG    1 
ATOM   1724 N ND1   . HIS A 1 235 ? 66.222  18.815 24.459  1.00 138.73 ? 235 HIS A ND1   1 
ATOM   1725 C CD2   . HIS A 1 235 ? 65.040  20.631 24.802  1.00 151.64 ? 235 HIS A CD2   1 
ATOM   1726 C CE1   . HIS A 1 235 ? 66.866  19.848 23.884  1.00 133.01 ? 235 HIS A CE1   1 
ATOM   1727 N NE2   . HIS A 1 235 ? 66.141  20.959 24.094  1.00 139.64 ? 235 HIS A NE2   1 
ATOM   1728 N N     . PRO A 1 236 ? 62.736  15.485 25.790  1.00 145.20 ? 236 PRO A N     1 
ATOM   1729 C CA    . PRO A 1 236 ? 62.002  14.437 26.515  1.00 142.90 ? 236 PRO A CA    1 
ATOM   1730 C C     . PRO A 1 236 ? 61.744  14.738 27.996  1.00 144.87 ? 236 PRO A C     1 
ATOM   1731 O O     . PRO A 1 236 ? 60.794  14.200 28.570  1.00 143.45 ? 236 PRO A O     1 
ATOM   1732 C CB    . PRO A 1 236 ? 62.916  13.214 26.384  1.00 159.22 ? 236 PRO A CB    1 
ATOM   1733 C CG    . PRO A 1 236 ? 63.714  13.469 25.154  1.00 152.27 ? 236 PRO A CG    1 
ATOM   1734 C CD    . PRO A 1 236 ? 63.956  14.949 25.156  1.00 150.75 ? 236 PRO A CD    1 
ATOM   1735 N N     . ASP A 1 237 ? 62.575  15.586 28.600  1.00 144.89 ? 237 ASP A N     1 
ATOM   1736 C CA    . ASP A 1 237 ? 62.452  15.908 30.026  1.00 144.84 ? 237 ASP A CA    1 
ATOM   1737 C C     . ASP A 1 237 ? 62.129  17.376 30.315  1.00 147.51 ? 237 ASP A C     1 
ATOM   1738 O O     . ASP A 1 237 ? 61.521  17.689 31.341  1.00 150.58 ? 237 ASP A O     1 
ATOM   1739 C CB    . ASP A 1 237 ? 63.707  15.466 30.795  1.00 146.50 ? 237 ASP A CB    1 
ATOM   1740 C CG    . ASP A 1 237 ? 64.993  16.001 30.186  1.00 153.59 ? 237 ASP A CG    1 
ATOM   1741 O OD1   . ASP A 1 237 ? 65.262  17.214 30.313  1.00 158.15 ? 237 ASP A OD1   1 
ATOM   1742 O OD2   . ASP A 1 237 ? 65.737  15.203 29.578  1.00 157.42 ? 237 ASP A OD2   1 
ATOM   1743 N N     . LYS A 1 238 ? 62.535  18.266 29.411  1.00 147.49 ? 238 LYS A N     1 
ATOM   1744 C CA    . LYS A 1 238 ? 62.320  19.707 29.578  1.00 146.61 ? 238 LYS A CA    1 
ATOM   1745 C C     . LYS A 1 238 ? 61.836  20.376 28.286  1.00 148.01 ? 238 LYS A C     1 
ATOM   1746 O O     . LYS A 1 238 ? 61.653  19.710 27.266  1.00 146.54 ? 238 LYS A O     1 
ATOM   1747 C CB    . LYS A 1 238 ? 63.599  20.384 30.097  1.00 155.62 ? 238 LYS A CB    1 
ATOM   1748 C CG    . LYS A 1 238 ? 64.792  20.311 29.154  1.00 157.53 ? 238 LYS A CG    1 
ATOM   1749 C CD    . LYS A 1 238 ? 66.054  20.846 29.812  1.00 152.98 ? 238 LYS A CD    1 
ATOM   1750 C CE    . LYS A 1 238 ? 67.243  20.773 28.867  1.00 138.73 ? 238 LYS A CE    1 
ATOM   1751 N NZ    . LYS A 1 238 ? 68.486  21.294 29.499  1.00 132.49 ? 238 LYS A NZ    1 
ATOM   1752 N N     . TRP A 1 239 ? 61.616  21.689 28.344  1.00 148.29 ? 239 TRP A N     1 
ATOM   1753 C CA    . TRP A 1 239 ? 61.279  22.479 27.157  1.00 147.69 ? 239 TRP A CA    1 
ATOM   1754 C C     . TRP A 1 239 ? 61.780  23.891 27.275  1.00 147.99 ? 239 TRP A C     1 
ATOM   1755 O O     . TRP A 1 239 ? 61.735  24.487 28.354  1.00 142.85 ? 239 TRP A O     1 
ATOM   1756 C CB    . TRP A 1 239 ? 59.776  22.451 26.875  1.00 139.56 ? 239 TRP A CB    1 
ATOM   1757 C CG    . TRP A 1 239 ? 58.928  23.206 27.874  1.00 149.54 ? 239 TRP A CG    1 
ATOM   1758 C CD1   . TRP A 1 239 ? 58.370  22.722 29.054  1.00 152.43 ? 239 TRP A CD1   1 
ATOM   1759 C CD2   . TRP A 1 239 ? 58.504  24.614 27.802  1.00 148.81 ? 239 TRP A CD2   1 
ATOM   1760 N NE1   . TRP A 1 239 ? 57.656  23.703 29.698  1.00 153.32 ? 239 TRP A NE1   1 
ATOM   1761 C CE2   . TRP A 1 239 ? 57.696  24.860 29.003  1.00 150.60 ? 239 TRP A CE2   1 
ATOM   1762 C CE3   . TRP A 1 239 ? 58.706  25.654 26.900  1.00 140.59 ? 239 TRP A CE3   1 
ATOM   1763 C CZ2   . TRP A 1 239 ? 57.128  26.099 29.266  1.00 147.31 ? 239 TRP A CZ2   1 
ATOM   1764 C CZ3   . TRP A 1 239 ? 58.128  26.900 27.178  1.00 143.05 ? 239 TRP A CZ3   1 
ATOM   1765 C CH2   . TRP A 1 239 ? 57.358  27.114 28.333  1.00 146.98 ? 239 TRP A CH2   1 
ATOM   1766 N N     . THR A 1 240 ? 62.265  24.436 26.162  1.00 152.68 ? 240 THR A N     1 
ATOM   1767 C CA    . THR A 1 240 ? 62.797  25.800 26.130  1.00 154.19 ? 240 THR A CA    1 
ATOM   1768 C C     . THR A 1 240 ? 62.392  26.551 24.858  1.00 148.39 ? 240 THR A C     1 
ATOM   1769 O O     . THR A 1 240 ? 62.148  25.941 23.814  1.00 151.40 ? 240 THR A O     1 
ATOM   1770 C CB    . THR A 1 240 ? 64.336  25.827 26.315  1.00 156.27 ? 240 THR A CB    1 
ATOM   1771 O OG1   . THR A 1 240 ? 64.805  27.182 26.284  1.00 166.07 ? 240 THR A OG1   1 
ATOM   1772 C CG2   . THR A 1 240 ? 65.048  25.017 25.227  1.00 147.36 ? 240 THR A CG2   1 
ATOM   1773 N N     . VAL A 1 241 ? 62.316  27.876 24.963  1.00 142.65 ? 241 VAL A N     1 
ATOM   1774 C CA    . VAL A 1 241 ? 61.976  28.735 23.829  1.00 135.60 ? 241 VAL A CA    1 
ATOM   1775 C C     . VAL A 1 241 ? 63.231  29.065 23.011  1.00 144.99 ? 241 VAL A C     1 
ATOM   1776 O O     . VAL A 1 241 ? 64.344  29.083 23.546  1.00 160.99 ? 241 VAL A O     1 
ATOM   1777 C CB    . VAL A 1 241 ? 61.229  30.016 24.293  1.00 135.36 ? 241 VAL A CB    1 
ATOM   1778 C CG1   . VAL A 1 241 ? 62.168  30.991 24.996  1.00 146.68 ? 241 VAL A CG1   1 
ATOM   1779 C CG2   . VAL A 1 241 ? 60.514  30.690 23.128  1.00 135.82 ? 241 VAL A CG2   1 
ATOM   1780 N N     . GLN A 1 242 ? 63.043  29.304 21.714  1.00 136.83 ? 242 GLN A N     1 
ATOM   1781 C CA    . GLN A 1 242 ? 64.136  29.684 20.817  1.00 145.80 ? 242 GLN A CA    1 
ATOM   1782 C C     . GLN A 1 242 ? 64.667  31.079 21.158  1.00 156.02 ? 242 GLN A C     1 
ATOM   1783 O O     . GLN A 1 242 ? 63.877  32.000 21.382  1.00 162.83 ? 242 GLN A O     1 
ATOM   1784 C CB    . GLN A 1 242 ? 63.682  29.632 19.355  1.00 143.62 ? 242 GLN A CB    1 
ATOM   1785 C CG    . GLN A 1 242 ? 63.452  28.226 18.816  1.00 151.58 ? 242 GLN A CG    1 
ATOM   1786 C CD    . GLN A 1 242 ? 63.067  28.208 17.347  1.00 152.77 ? 242 GLN A CD    1 
ATOM   1787 O OE1   . GLN A 1 242 ? 63.576  28.994 16.545  1.00 150.17 ? 242 GLN A OE1   1 
ATOM   1788 N NE2   . GLN A 1 242 ? 62.169  27.300 16.986  1.00 155.23 ? 242 GLN A NE2   1 
ATOM   1789 N N     . PRO A 1 243 ? 66.007  31.234 21.207  1.00 157.93 ? 243 PRO A N     1 
ATOM   1790 C CA    . PRO A 1 243 ? 66.640  32.512 21.553  1.00 151.93 ? 243 PRO A CA    1 
ATOM   1791 C C     . PRO A 1 243 ? 66.297  33.628 20.567  1.00 152.46 ? 243 PRO A C     1 
ATOM   1792 O O     . PRO A 1 243 ? 66.403  33.440 19.352  1.00 155.62 ? 243 PRO A O     1 
ATOM   1793 C CB    . PRO A 1 243 ? 68.140  32.191 21.492  1.00 147.26 ? 243 PRO A CB    1 
ATOM   1794 C CG    . PRO A 1 243 ? 68.225  30.715 21.677  1.00 151.78 ? 243 PRO A CG    1 
ATOM   1795 C CD    . PRO A 1 243 ? 67.009  30.174 20.989  1.00 154.74 ? 243 PRO A CD    1 
ATOM   1796 N N     . ILE A 1 244 ? 65.883  34.774 21.102  1.00 147.88 ? 244 ILE A N     1 
ATOM   1797 C CA    . ILE A 1 244 ? 65.511  35.931 20.289  1.00 146.15 ? 244 ILE A CA    1 
ATOM   1798 C C     . ILE A 1 244 ? 66.660  36.939 20.259  1.00 156.71 ? 244 ILE A C     1 
ATOM   1799 O O     . ILE A 1 244 ? 67.137  37.382 21.308  1.00 163.03 ? 244 ILE A O     1 
ATOM   1800 C CB    . ILE A 1 244 ? 64.215  36.616 20.797  1.00 136.27 ? 244 ILE A CB    1 
ATOM   1801 C CG1   . ILE A 1 244 ? 63.082  35.600 20.993  1.00 133.20 ? 244 ILE A CG1   1 
ATOM   1802 C CG2   . ILE A 1 244 ? 63.764  37.710 19.838  1.00 147.60 ? 244 ILE A CG2   1 
ATOM   1803 C CD1   . ILE A 1 244 ? 62.910  35.123 22.421  1.00 134.88 ? 244 ILE A CD1   1 
ATOM   1804 N N     . VAL A 1 245 ? 67.099  37.288 19.052  1.00 157.71 ? 245 VAL A N     1 
ATOM   1805 C CA    . VAL A 1 245 ? 68.199  38.232 18.864  1.00 156.60 ? 245 VAL A CA    1 
ATOM   1806 C C     . VAL A 1 245 ? 67.658  39.620 18.518  1.00 155.23 ? 245 VAL A C     1 
ATOM   1807 O O     . VAL A 1 245 ? 66.954  39.795 17.520  1.00 152.42 ? 245 VAL A O     1 
ATOM   1808 C CB    . VAL A 1 245 ? 69.190  37.755 17.774  1.00 155.35 ? 245 VAL A CB    1 
ATOM   1809 C CG1   . VAL A 1 245 ? 70.372  38.708 17.659  1.00 146.16 ? 245 VAL A CG1   1 
ATOM   1810 C CG2   . VAL A 1 245 ? 69.681  36.344 18.071  1.00 158.15 ? 245 VAL A CG2   1 
ATOM   1811 N N     . LEU A 1 246 ? 67.989  40.597 19.360  1.00 160.34 ? 246 LEU A N     1 
ATOM   1812 C CA    . LEU A 1 246 ? 67.580  41.988 19.155  1.00 154.85 ? 246 LEU A CA    1 
ATOM   1813 C C     . LEU A 1 246 ? 68.769  42.894 18.815  1.00 163.00 ? 246 LEU A C     1 
ATOM   1814 O O     . LEU A 1 246 ? 69.859  42.715 19.365  1.00 168.15 ? 246 LEU A O     1 
ATOM   1815 C CB    . LEU A 1 246 ? 66.798  42.538 20.367  1.00 142.22 ? 246 LEU A CB    1 
ATOM   1816 C CG    . LEU A 1 246 ? 67.009  42.146 21.845  1.00 149.90 ? 246 LEU A CG    1 
ATOM   1817 C CD1   . LEU A 1 246 ? 66.314  40.831 22.182  1.00 145.19 ? 246 LEU A CD1   1 
ATOM   1818 C CD2   . LEU A 1 246 ? 68.469  42.119 22.288  1.00 154.70 ? 246 LEU A CD2   1 
ATOM   1819 N N     . PRO A 1 247 ? 68.566  43.859 17.894  1.00 158.83 ? 247 PRO A N     1 
ATOM   1820 C CA    . PRO A 1 247 ? 69.617  44.815 17.536  1.00 157.10 ? 247 PRO A CA    1 
ATOM   1821 C C     . PRO A 1 247 ? 69.953  45.756 18.693  1.00 149.91 ? 247 PRO A C     1 
ATOM   1822 O O     . PRO A 1 247 ? 69.052  46.346 19.295  1.00 142.27 ? 247 PRO A O     1 
ATOM   1823 C CB    . PRO A 1 247 ? 69.002  45.602 16.370  1.00 151.87 ? 247 PRO A CB    1 
ATOM   1824 C CG    . PRO A 1 247 ? 67.908  44.735 15.847  1.00 147.11 ? 247 PRO A CG    1 
ATOM   1825 C CD    . PRO A 1 247 ? 67.367  44.034 17.054  1.00 148.15 ? 247 PRO A CD    1 
ATOM   1826 N N     . GLU A 1 248 ? 71.243  45.881 18.994  1.00 151.02 ? 248 GLU A N     1 
ATOM   1827 C CA    . GLU A 1 248 ? 71.711  46.717 20.101  1.00 156.06 ? 248 GLU A CA    1 
ATOM   1828 C C     . GLU A 1 248 ? 72.637  47.842 19.626  1.00 157.61 ? 248 GLU A C     1 
ATOM   1829 O O     . GLU A 1 248 ? 73.862  47.770 19.773  1.00 158.90 ? 248 GLU A O     1 
ATOM   1830 C CB    . GLU A 1 248 ? 72.369  45.864 21.199  1.00 157.71 ? 248 GLU A CB    1 
ATOM   1831 C CG    . GLU A 1 248 ? 73.347  44.803 20.702  1.00 153.46 ? 248 GLU A CG    1 
ATOM   1832 C CD    . GLU A 1 248 ? 73.977  43.994 21.824  1.00 149.55 ? 248 GLU A CD    1 
ATOM   1833 O OE1   . GLU A 1 248 ? 73.999  44.471 22.982  1.00 151.01 ? 248 GLU A OE1   1 
ATOM   1834 O OE2   . GLU A 1 248 ? 74.460  42.874 21.544  1.00 146.00 ? 248 GLU A OE2   1 
ATOM   1835 N N     . LYS A 1 249 ? 72.033  48.879 19.051  1.00 161.82 ? 249 LYS A N     1 
ATOM   1836 C CA    . LYS A 1 249 ? 72.766  50.053 18.580  1.00 167.28 ? 249 LYS A CA    1 
ATOM   1837 C C     . LYS A 1 249 ? 71.921  51.320 18.708  1.00 171.46 ? 249 LYS A C     1 
ATOM   1838 O O     . LYS A 1 249 ? 72.204  52.178 19.548  1.00 175.20 ? 249 LYS A O     1 
ATOM   1839 C CB    . LYS A 1 249 ? 73.235  49.857 17.134  1.00 155.21 ? 249 LYS A CB    1 
ATOM   1840 N N     . ASP A 1 250 ? 70.888  51.429 17.873  1.00 170.23 ? 250 ASP A N     1 
ATOM   1841 C CA    . ASP A 1 250 ? 69.988  52.583 17.878  1.00 152.74 ? 250 ASP A CA    1 
ATOM   1842 C C     . ASP A 1 250 ? 68.530  52.156 17.729  1.00 146.54 ? 250 ASP A C     1 
ATOM   1843 O O     . ASP A 1 250 ? 68.229  51.171 17.050  1.00 146.44 ? 250 ASP A O     1 
ATOM   1844 C CB    . ASP A 1 250 ? 70.355  53.563 16.758  1.00 149.74 ? 250 ASP A CB    1 
ATOM   1845 C CG    . ASP A 1 250 ? 71.672  54.277 17.007  1.00 149.19 ? 250 ASP A CG    1 
ATOM   1846 O OD1   . ASP A 1 250 ? 72.739  53.652 16.829  1.00 149.66 ? 250 ASP A OD1   1 
ATOM   1847 O OD2   . ASP A 1 250 ? 71.640  55.474 17.365  1.00 144.74 ? 250 ASP A OD2   1 
ATOM   1848 N N     . SER A 1 251 ? 67.632  52.907 18.365  1.00 144.82 ? 251 SER A N     1 
ATOM   1849 C CA    . SER A 1 251 ? 66.195  52.678 18.239  1.00 145.37 ? 251 SER A CA    1 
ATOM   1850 C C     . SER A 1 251 ? 65.700  53.206 16.894  1.00 151.25 ? 251 SER A C     1 
ATOM   1851 O O     . SER A 1 251 ? 65.726  54.415 16.641  1.00 153.94 ? 251 SER A O     1 
ATOM   1852 C CB    . SER A 1 251 ? 65.437  53.340 19.393  1.00 141.64 ? 251 SER A CB    1 
ATOM   1853 N N     . TRP A 1 252 ? 65.256  52.289 16.037  1.00 148.40 ? 252 TRP A N     1 
ATOM   1854 C CA    . TRP A 1 252 ? 64.863  52.625 14.669  1.00 152.53 ? 252 TRP A CA    1 
ATOM   1855 C C     . TRP A 1 252 ? 63.374  52.714 14.485  1.00 159.00 ? 252 TRP A C     1 
ATOM   1856 O O     . TRP A 1 252 ? 62.618  51.965 15.109  1.00 154.72 ? 252 TRP A O     1 
ATOM   1857 C CB    . TRP A 1 252 ? 65.451  51.618 13.685  1.00 139.75 ? 252 TRP A CB    1 
ATOM   1858 N N     . THR A 1 253 ? 62.961  53.641 13.618  1.00 169.56 ? 253 THR A N     1 
ATOM   1859 C CA    . THR A 1 253 ? 61.556  53.864 13.210  1.00 165.39 ? 253 THR A CA    1 
ATOM   1860 C C     . THR A 1 253 ? 60.505  53.882 14.345  1.00 159.33 ? 253 THR A C     1 
ATOM   1861 O O     . THR A 1 253 ? 60.839  54.134 15.506  1.00 155.73 ? 253 THR A O     1 
ATOM   1862 C CB    . THR A 1 253 ? 61.141  52.960 12.008  1.00 163.37 ? 253 THR A CB    1 
ATOM   1863 O OG1   . THR A 1 253 ? 59.908  53.430 11.447  1.00 163.32 ? 253 THR A OG1   1 
ATOM   1864 C CG2   . THR A 1 253 ? 60.995  51.490 12.406  1.00 152.00 ? 253 THR A CG2   1 
ATOM   1865 N N     . VAL A 1 254 ? 59.243  53.642 13.991  1.00 157.41 ? 254 VAL A N     1 
ATOM   1866 C CA    . VAL A 1 254 ? 58.129  53.683 14.943  1.00 147.57 ? 254 VAL A CA    1 
ATOM   1867 C C     . VAL A 1 254 ? 57.555  52.289 15.235  1.00 147.42 ? 254 VAL A C     1 
ATOM   1868 O O     . VAL A 1 254 ? 57.236  51.973 16.385  1.00 145.53 ? 254 VAL A O     1 
ATOM   1869 C CB    . VAL A 1 254 ? 57.025  54.680 14.486  1.00 139.86 ? 254 VAL A CB    1 
ATOM   1870 C CG1   . VAL A 1 254 ? 56.524  54.361 13.080  1.00 133.73 ? 254 VAL A CG1   1 
ATOM   1871 C CG2   . VAL A 1 254 ? 55.870  54.731 15.480  1.00 137.80 ? 254 VAL A CG2   1 
ATOM   1872 N N     . ASN A 1 255 ? 57.447  51.461 14.197  1.00 151.01 ? 255 ASN A N     1 
ATOM   1873 C CA    . ASN A 1 255 ? 56.874  50.118 14.319  1.00 149.27 ? 255 ASN A CA    1 
ATOM   1874 C C     . ASN A 1 255 ? 57.787  49.104 15.012  1.00 148.69 ? 255 ASN A C     1 
ATOM   1875 O O     . ASN A 1 255 ? 57.305  48.125 15.586  1.00 153.90 ? 255 ASN A O     1 
ATOM   1876 C CB    . ASN A 1 255 ? 56.440  49.589 12.947  1.00 148.41 ? 255 ASN A CB    1 
ATOM   1877 C CG    . ASN A 1 255 ? 55.159  50.235 12.444  1.00 147.82 ? 255 ASN A CG    1 
ATOM   1878 O OD1   . ASN A 1 255 ? 54.870  51.395 12.742  1.00 146.57 ? 255 ASN A OD1   1 
ATOM   1879 N ND2   . ASN A 1 255 ? 54.387  49.482 11.669  1.00 150.49 ? 255 ASN A ND2   1 
ATOM   1880 N N     . ASP A 1 256 ? 59.097  49.345 14.956  1.00 147.24 ? 256 ASP A N     1 
ATOM   1881 C CA    . ASP A 1 256 ? 60.084  48.469 15.595  1.00 150.47 ? 256 ASP A CA    1 
ATOM   1882 C C     . ASP A 1 256 ? 60.043  48.541 17.123  1.00 150.75 ? 256 ASP A C     1 
ATOM   1883 O O     . ASP A 1 256 ? 60.486  47.613 17.805  1.00 154.55 ? 256 ASP A O     1 
ATOM   1884 C CB    . ASP A 1 256 ? 61.496  48.776 15.082  1.00 155.18 ? 256 ASP A CB    1 
ATOM   1885 C CG    . ASP A 1 256 ? 61.760  48.198 13.699  1.00 164.48 ? 256 ASP A CG    1 
ATOM   1886 O OD1   . ASP A 1 256 ? 60.813  48.102 12.888  1.00 162.28 ? 256 ASP A OD1   1 
ATOM   1887 O OD2   . ASP A 1 256 ? 62.925  47.846 13.419  1.00 170.95 ? 256 ASP A OD2   1 
ATOM   1888 N N     . ILE A 1 257 ? 59.516  49.647 17.648  1.00 150.30 ? 257 ILE A N     1 
ATOM   1889 C CA    . ILE A 1 257 ? 59.294  49.810 19.086  1.00 151.93 ? 257 ILE A CA    1 
ATOM   1890 C C     . ILE A 1 257 ? 58.184  48.859 19.543  1.00 152.45 ? 257 ILE A C     1 
ATOM   1891 O O     . ILE A 1 257 ? 58.279  48.249 20.611  1.00 154.82 ? 257 ILE A O     1 
ATOM   1892 C CB    . ILE A 1 257 ? 58.936  51.275 19.454  1.00 151.58 ? 257 ILE A CB    1 
ATOM   1893 C CG1   . ILE A 1 257 ? 59.904  52.276 18.794  1.00 156.88 ? 257 ILE A CG1   1 
ATOM   1894 C CG2   . ILE A 1 257 ? 58.872  51.465 20.968  1.00 153.65 ? 257 ILE A CG2   1 
ATOM   1895 C CD1   . ILE A 1 257 ? 61.356  52.174 19.228  1.00 161.43 ? 257 ILE A CD1   1 
ATOM   1896 N N     . GLN A 1 258 ? 57.145  48.736 18.718  1.00 151.31 ? 258 GLN A N     1 
ATOM   1897 C CA    . GLN A 1 258 ? 56.037  47.813 18.968  1.00 148.04 ? 258 GLN A CA    1 
ATOM   1898 C C     . GLN A 1 258 ? 56.455  46.356 18.766  1.00 148.22 ? 258 GLN A C     1 
ATOM   1899 O O     . GLN A 1 258 ? 55.873  45.450 19.367  1.00 140.32 ? 258 GLN A O     1 
ATOM   1900 C CB    . GLN A 1 258 ? 54.848  48.147 18.064  1.00 130.13 ? 258 GLN A CB    1 
ATOM   1901 N N     . LYS A 1 259 ? 57.459  46.144 17.916  1.00 149.24 ? 259 LYS A N     1 
ATOM   1902 C CA    . LYS A 1 259 ? 58.025  44.815 17.676  1.00 146.01 ? 259 LYS A CA    1 
ATOM   1903 C C     . LYS A 1 259 ? 58.777  44.296 18.901  1.00 147.42 ? 259 LYS A C     1 
ATOM   1904 O O     . LYS A 1 259 ? 58.798  43.090 19.157  1.00 149.74 ? 259 LYS A O     1 
ATOM   1905 C CB    . LYS A 1 259 ? 58.951  44.829 16.456  1.00 142.97 ? 259 LYS A CB    1 
ATOM   1906 C CG    . LYS A 1 259 ? 58.228  44.911 15.121  1.00 139.70 ? 259 LYS A CG    1 
ATOM   1907 C CD    . LYS A 1 259 ? 59.213  44.933 13.961  1.00 138.73 ? 259 LYS A CD    1 
ATOM   1908 C CE    . LYS A 1 259 ? 58.501  45.031 12.620  1.00 138.33 ? 259 LYS A CE    1 
ATOM   1909 N NZ    . LYS A 1 259 ? 57.762  43.785 12.270  1.00 150.69 ? 259 LYS A NZ    1 
ATOM   1910 N N     . LEU A 1 260 ? 59.391  45.214 19.647  1.00 148.40 ? 260 LEU A N     1 
ATOM   1911 C CA    . LEU A 1 260 ? 60.083  44.885 20.893  1.00 147.93 ? 260 LEU A CA    1 
ATOM   1912 C C     . LEU A 1 260 ? 59.101  44.476 21.990  1.00 146.65 ? 260 LEU A C     1 
ATOM   1913 O O     . LEU A 1 260 ? 59.426  43.649 22.844  1.00 151.75 ? 260 LEU A O     1 
ATOM   1914 C CB    . LEU A 1 260 ? 60.943  46.064 21.365  1.00 149.64 ? 260 LEU A CB    1 
ATOM   1915 C CG    . LEU A 1 260 ? 62.197  46.420 20.557  1.00 160.19 ? 260 LEU A CG    1 
ATOM   1916 C CD1   . LEU A 1 260 ? 62.650  47.838 20.872  1.00 158.15 ? 260 LEU A CD1   1 
ATOM   1917 C CD2   . LEU A 1 260 ? 63.326  45.427 20.802  1.00 161.18 ? 260 LEU A CD2   1 
ATOM   1918 N N     . VAL A 1 261 ? 57.905  45.064 21.957  1.00 144.88 ? 261 VAL A N     1 
ATOM   1919 C CA    . VAL A 1 261 ? 56.821  44.706 22.876  1.00 141.84 ? 261 VAL A CA    1 
ATOM   1920 C C     . VAL A 1 261 ? 56.313  43.297 22.557  1.00 136.36 ? 261 VAL A C     1 
ATOM   1921 O O     . VAL A 1 261 ? 56.026  42.513 23.464  1.00 134.33 ? 261 VAL A O     1 
ATOM   1922 C CB    . VAL A 1 261 ? 55.654  45.723 22.815  1.00 145.55 ? 261 VAL A CB    1 
ATOM   1923 C CG1   . VAL A 1 261 ? 54.595  45.404 23.862  1.00 144.80 ? 261 VAL A CG1   1 
ATOM   1924 C CG2   . VAL A 1 261 ? 56.165  47.144 23.008  1.00 159.38 ? 261 VAL A CG2   1 
ATOM   1925 N N     . GLY A 1 262 ? 56.217  42.988 21.263  1.00 136.56 ? 262 GLY A N     1 
ATOM   1926 C CA    . GLY A 1 262 ? 55.802  41.666 20.792  1.00 142.24 ? 262 GLY A CA    1 
ATOM   1927 C C     . GLY A 1 262 ? 56.805  40.573 21.116  1.00 136.37 ? 262 GLY A C     1 
ATOM   1928 O O     . GLY A 1 262 ? 56.423  39.428 21.368  1.00 128.85 ? 262 GLY A O     1 
ATOM   1929 N N     . LYS A 1 263 ? 58.089  40.930 21.102  1.00 144.31 ? 263 LYS A N     1 
ATOM   1930 C CA    . LYS A 1 263 ? 59.166  40.013 21.480  1.00 143.73 ? 263 LYS A CA    1 
ATOM   1931 C C     . LYS A 1 263 ? 59.156  39.736 22.983  1.00 149.12 ? 263 LYS A C     1 
ATOM   1932 O O     . LYS A 1 263 ? 59.457  38.622 23.417  1.00 148.06 ? 263 LYS A O     1 
ATOM   1933 C CB    . LYS A 1 263 ? 60.528  40.567 21.052  1.00 166.40 ? 263 LYS A CB    1 
ATOM   1934 C CG    . LYS A 1 263 ? 60.810  40.452 19.562  1.00 165.98 ? 263 LYS A CG    1 
ATOM   1935 C CD    . LYS A 1 263 ? 62.130  41.112 19.198  1.00 162.74 ? 263 LYS A CD    1 
ATOM   1936 C CE    . LYS A 1 263 ? 62.413  40.995 17.709  1.00 157.29 ? 263 LYS A CE    1 
ATOM   1937 N NZ    . LYS A 1 263 ? 63.704  41.637 17.336  1.00 144.78 ? 263 LYS A NZ    1 
ATOM   1938 N N     . LEU A 1 264 ? 58.811  40.758 23.765  1.00 152.26 ? 264 LEU A N     1 
ATOM   1939 C CA    . LEU A 1 264 ? 58.659  40.623 25.214  1.00 153.27 ? 264 LEU A CA    1 
ATOM   1940 C C     . LEU A 1 264 ? 57.372  39.879 25.569  1.00 147.38 ? 264 LEU A C     1 
ATOM   1941 O O     . LEU A 1 264 ? 57.306  39.199 26.596  1.00 150.52 ? 264 LEU A O     1 
ATOM   1942 C CB    . LEU A 1 264 ? 58.683  41.996 25.894  1.00 150.01 ? 264 LEU A CB    1 
ATOM   1943 C CG    . LEU A 1 264 ? 60.029  42.722 26.017  1.00 149.29 ? 264 LEU A CG    1 
ATOM   1944 C CD1   . LEU A 1 264 ? 59.812  44.206 26.270  1.00 145.20 ? 264 LEU A CD1   1 
ATOM   1945 C CD2   . LEU A 1 264 ? 60.902  42.112 27.106  1.00 148.15 ? 264 LEU A CD2   1 
ATOM   1946 N N     . ASN A 1 265 ? 56.359  40.018 24.715  1.00 142.14 ? 265 ASN A N     1 
ATOM   1947 C CA    . ASN A 1 265 ? 55.091  39.302 24.863  1.00 140.93 ? 265 ASN A CA    1 
ATOM   1948 C C     . ASN A 1 265 ? 55.264  37.792 24.698  1.00 141.74 ? 265 ASN A C     1 
ATOM   1949 O O     . ASN A 1 265 ? 54.630  37.005 25.404  1.00 140.09 ? 265 ASN A O     1 
ATOM   1950 C CB    . ASN A 1 265 ? 54.057  39.834 23.861  1.00 153.07 ? 265 ASN A CB    1 
ATOM   1951 C CG    . ASN A 1 265 ? 52.707  39.146 23.981  1.00 153.86 ? 265 ASN A CG    1 
ATOM   1952 O OD1   . ASN A 1 265 ? 52.110  38.751 22.979  1.00 158.29 ? 265 ASN A OD1   1 
ATOM   1953 N ND2   . ASN A 1 265 ? 52.218  38.999 25.209  1.00 155.66 ? 265 ASN A ND2   1 
ATOM   1954 N N     . TRP A 1 266 ? 56.129  37.403 23.763  1.00 145.02 ? 266 TRP A N     1 
ATOM   1955 C CA    . TRP A 1 266 ? 56.448  35.998 23.522  1.00 151.94 ? 266 TRP A CA    1 
ATOM   1956 C C     . TRP A 1 266 ? 57.391  35.462 24.566  1.00 148.81 ? 266 TRP A C     1 
ATOM   1957 O O     . TRP A 1 266 ? 57.466  34.250 24.781  1.00 143.95 ? 266 TRP A O     1 
ATOM   1958 C CB    . TRP A 1 266 ? 57.037  35.819 22.127  1.00 156.42 ? 266 TRP A CB    1 
ATOM   1959 C CG    . TRP A 1 266 ? 57.040  34.386 21.652  1.00 153.62 ? 266 TRP A CG    1 
ATOM   1960 C CD1   . TRP A 1 266 ? 58.126  33.518 21.575  1.00 151.08 ? 266 TRP A CD1   1 
ATOM   1961 C CD2   . TRP A 1 266 ? 55.891  33.600 21.178  1.00 141.37 ? 266 TRP A CD2   1 
ATOM   1962 N NE1   . TRP A 1 266 ? 57.741  32.291 21.097  1.00 139.55 ? 266 TRP A NE1   1 
ATOM   1963 C CE2   . TRP A 1 266 ? 56.416  32.270 20.840  1.00 136.04 ? 266 TRP A CE2   1 
ATOM   1964 C CE3   . TRP A 1 266 ? 54.533  33.853 21.005  1.00 141.78 ? 266 TRP A CE3   1 
ATOM   1965 C CZ2   . TRP A 1 266 ? 55.599  31.259 20.353  1.00 143.57 ? 266 TRP A CZ2   1 
ATOM   1966 C CZ3   . TRP A 1 266 ? 53.720  32.825 20.513  1.00 148.04 ? 266 TRP A CZ3   1 
ATOM   1967 C CH2   . TRP A 1 266 ? 54.242  31.560 20.195  1.00 152.37 ? 266 TRP A CH2   1 
ATOM   1968 N N     . ALA A 1 267 ? 58.117  36.365 25.222  1.00 149.34 ? 267 ALA A N     1 
ATOM   1969 C CA    . ALA A 1 267 ? 59.043  36.004 26.293  1.00 147.62 ? 267 ALA A CA    1 
ATOM   1970 C C     . ALA A 1 267 ? 58.348  35.933 27.656  1.00 140.83 ? 267 ALA A C     1 
ATOM   1971 O O     . ALA A 1 267 ? 58.912  35.411 28.620  1.00 148.10 ? 267 ALA A O     1 
ATOM   1972 C CB    . ALA A 1 267 ? 60.206  36.985 26.337  1.00 162.41 ? 267 ALA A CB    1 
ATOM   1973 N N     . SER A 1 268 ? 57.123  36.452 27.722  1.00 138.26 ? 268 SER A N     1 
ATOM   1974 C CA    . SER A 1 268 ? 56.345  36.498 28.963  1.00 144.74 ? 268 SER A CA    1 
ATOM   1975 C C     . SER A 1 268 ? 55.868  35.125 29.439  1.00 141.51 ? 268 SER A C     1 
ATOM   1976 O O     . SER A 1 268 ? 55.559  34.946 30.620  1.00 144.21 ? 268 SER A O     1 
ATOM   1977 C CB    . SER A 1 268 ? 55.146  37.437 28.805  1.00 147.27 ? 268 SER A CB    1 
ATOM   1978 O OG    . SER A 1 268 ? 55.564  38.772 28.583  1.00 159.51 ? 268 SER A OG    1 
ATOM   1979 N N     . GLN A 1 269 ? 55.813  34.163 28.519  1.00 138.44 ? 269 GLN A N     1 
ATOM   1980 C CA    . GLN A 1 269 ? 55.337  32.812 28.825  1.00 133.56 ? 269 GLN A CA    1 
ATOM   1981 C C     . GLN A 1 269 ? 56.352  31.962 29.599  1.00 130.84 ? 269 GLN A C     1 
ATOM   1982 O O     . GLN A 1 269 ? 55.982  30.958 30.213  1.00 127.99 ? 269 GLN A O     1 
ATOM   1983 C CB    . GLN A 1 269 ? 54.889  32.088 27.547  1.00 137.15 ? 269 GLN A CB    1 
ATOM   1984 C CG    . GLN A 1 269 ? 55.991  31.846 26.524  1.00 135.77 ? 269 GLN A CG    1 
ATOM   1985 C CD    . GLN A 1 269 ? 55.489  31.163 25.265  1.00 141.49 ? 269 GLN A CD    1 
ATOM   1986 O OE1   . GLN A 1 269 ? 54.697  30.222 25.324  1.00 139.10 ? 269 GLN A OE1   1 
ATOM   1987 N NE2   . GLN A 1 269 ? 55.958  31.632 24.114  1.00 144.82 ? 269 GLN A NE2   1 
ATOM   1988 N N     . ILE A 1 270 ? 57.620  32.369 29.571  1.00 140.65 ? 270 ILE A N     1 
ATOM   1989 C CA    . ILE A 1 270 ? 58.686  31.633 30.261  1.00 148.31 ? 270 ILE A CA    1 
ATOM   1990 C C     . ILE A 1 270 ? 59.495  32.502 31.238  1.00 150.24 ? 270 ILE A C     1 
ATOM   1991 O O     . ILE A 1 270 ? 59.825  32.054 32.340  1.00 138.16 ? 270 ILE A O     1 
ATOM   1992 C CB    . ILE A 1 270 ? 59.596  30.853 29.264  1.00 154.48 ? 270 ILE A CB    1 
ATOM   1993 C CG1   . ILE A 1 270 ? 60.640  29.998 29.998  1.00 155.29 ? 270 ILE A CG1   1 
ATOM   1994 C CG2   . ILE A 1 270 ? 60.253  31.779 28.247  1.00 158.07 ? 270 ILE A CG2   1 
ATOM   1995 C CD1   . ILE A 1 270 ? 60.101  28.699 30.561  1.00 158.73 ? 270 ILE A CD1   1 
ATOM   1996 N N     . TYR A 1 271 ? 59.794  33.738 30.841  1.00 152.61 ? 271 TYR A N     1 
ATOM   1997 C CA    . TYR A 1 271 ? 60.518  34.675 31.703  1.00 145.60 ? 271 TYR A CA    1 
ATOM   1998 C C     . TYR A 1 271 ? 59.554  35.431 32.622  1.00 146.97 ? 271 TYR A C     1 
ATOM   1999 O O     . TYR A 1 271 ? 58.602  36.054 32.142  1.00 152.51 ? 271 TYR A O     1 
ATOM   2000 C CB    . TYR A 1 271 ? 61.348  35.662 30.874  1.00 145.64 ? 271 TYR A CB    1 
ATOM   2001 C CG    . TYR A 1 271 ? 62.396  35.019 29.990  1.00 150.26 ? 271 TYR A CG    1 
ATOM   2002 C CD1   . TYR A 1 271 ? 63.630  34.624 30.509  1.00 153.95 ? 271 TYR A CD1   1 
ATOM   2003 C CD2   . TYR A 1 271 ? 62.160  34.818 28.632  1.00 153.67 ? 271 TYR A CD2   1 
ATOM   2004 C CE1   . TYR A 1 271 ? 64.593  34.038 29.702  1.00 156.68 ? 271 TYR A CE1   1 
ATOM   2005 C CE2   . TYR A 1 271 ? 63.116  34.232 27.816  1.00 152.36 ? 271 TYR A CE2   1 
ATOM   2006 C CZ    . TYR A 1 271 ? 64.330  33.845 28.355  1.00 152.74 ? 271 TYR A CZ    1 
ATOM   2007 O OH    . TYR A 1 271 ? 65.282  33.264 27.549  1.00 152.17 ? 271 TYR A OH    1 
ATOM   2008 N N     . PRO A 1 272 ? 59.795  35.374 33.947  1.00 141.90 ? 272 PRO A N     1 
ATOM   2009 C CA    . PRO A 1 272 ? 58.919  36.038 34.919  1.00 154.72 ? 272 PRO A CA    1 
ATOM   2010 C C     . PRO A 1 272 ? 59.113  37.556 35.000  1.00 156.04 ? 272 PRO A C     1 
ATOM   2011 O O     . PRO A 1 272 ? 58.155  38.280 35.277  1.00 153.04 ? 272 PRO A O     1 
ATOM   2012 C CB    . PRO A 1 272 ? 59.302  35.376 36.246  1.00 147.93 ? 272 PRO A CB    1 
ATOM   2013 C CG    . PRO A 1 272 ? 60.713  34.937 36.059  1.00 133.57 ? 272 PRO A CG    1 
ATOM   2014 C CD    . PRO A 1 272 ? 60.868  34.600 34.603  1.00 130.42 ? 272 PRO A CD    1 
ATOM   2015 N N     . GLY A 1 273 ? 60.337  38.024 34.760  1.00 157.32 ? 273 GLY A N     1 
ATOM   2016 C CA    . GLY A 1 273 ? 60.660  39.446 34.858  1.00 157.38 ? 273 GLY A CA    1 
ATOM   2017 C C     . GLY A 1 273 ? 60.562  40.175 33.532  1.00 156.73 ? 273 GLY A C     1 
ATOM   2018 O O     . GLY A 1 273 ? 61.579  40.540 32.939  1.00 162.14 ? 273 GLY A O     1 
ATOM   2019 N N     . ILE A 1 274 ? 59.330  40.385 33.070  1.00 149.33 ? 274 ILE A N     1 
ATOM   2020 C CA    . ILE A 1 274 ? 59.071  41.078 31.807  1.00 148.72 ? 274 ILE A CA    1 
ATOM   2021 C C     . ILE A 1 274 ? 58.152  42.281 32.032  1.00 143.98 ? 274 ILE A C     1 
ATOM   2022 O O     . ILE A 1 274 ? 57.006  42.128 32.464  1.00 142.95 ? 274 ILE A O     1 
ATOM   2023 C CB    . ILE A 1 274 ? 58.462  40.127 30.743  1.00 147.50 ? 274 ILE A CB    1 
ATOM   2024 C CG1   . ILE A 1 274 ? 59.396  38.937 30.448  1.00 148.24 ? 274 ILE A CG1   1 
ATOM   2025 C CG2   . ILE A 1 274 ? 58.103  40.880 29.465  1.00 153.91 ? 274 ILE A CG2   1 
ATOM   2026 C CD1   . ILE A 1 274 ? 60.743  39.293 29.845  1.00 152.23 ? 274 ILE A CD1   1 
ATOM   2027 N N     . LYS A 1 275 ? 58.669  43.472 31.737  1.00 146.29 ? 275 LYS A N     1 
ATOM   2028 C CA    . LYS A 1 275 ? 57.909  44.715 31.874  1.00 148.25 ? 275 LYS A CA    1 
ATOM   2029 C C     . LYS A 1 275 ? 57.614  45.326 30.506  1.00 150.10 ? 275 LYS A C     1 
ATOM   2030 O O     . LYS A 1 275 ? 58.512  45.461 29.671  1.00 153.14 ? 275 LYS A O     1 
ATOM   2031 C CB    . LYS A 1 275 ? 58.663  45.717 32.754  1.00 156.86 ? 275 LYS A CB    1 
ATOM   2032 C CG    . LYS A 1 275 ? 58.789  45.306 34.215  1.00 154.99 ? 275 LYS A CG    1 
ATOM   2033 C CD    . LYS A 1 275 ? 59.518  46.355 35.043  1.00 159.74 ? 275 LYS A CD    1 
ATOM   2034 C CE    . LYS A 1 275 ? 58.605  47.508 35.436  1.00 158.42 ? 275 LYS A CE    1 
ATOM   2035 N NZ    . LYS A 1 275 ? 59.321  48.534 36.243  1.00 147.67 ? 275 LYS A NZ    1 
ATOM   2036 N N     . VAL A 1 276 ? 56.351  45.690 30.285  1.00 147.62 ? 276 VAL A N     1 
ATOM   2037 C CA    . VAL A 1 276 ? 55.900  46.217 28.990  1.00 150.16 ? 276 VAL A CA    1 
ATOM   2038 C C     . VAL A 1 276 ? 55.101  47.522 29.101  1.00 142.62 ? 276 VAL A C     1 
ATOM   2039 O O     . VAL A 1 276 ? 54.701  48.096 28.084  1.00 142.35 ? 276 VAL A O     1 
ATOM   2040 C CB    . VAL A 1 276 ? 55.071  45.173 28.196  1.00 147.37 ? 276 VAL A CB    1 
ATOM   2041 C CG1   . VAL A 1 276 ? 55.965  44.066 27.652  1.00 146.18 ? 276 VAL A CG1   1 
ATOM   2042 C CG2   . VAL A 1 276 ? 53.943  44.601 29.047  1.00 151.11 ? 276 VAL A CG2   1 
ATOM   2043 N N     . ARG A 1 277 ? 54.882  47.986 30.330  1.00 137.99 ? 277 ARG A N     1 
ATOM   2044 C CA    . ARG A 1 277 ? 54.040  49.159 30.592  1.00 135.42 ? 277 ARG A CA    1 
ATOM   2045 C C     . ARG A 1 277 ? 54.584  50.474 30.028  1.00 145.25 ? 277 ARG A C     1 
ATOM   2046 O O     . ARG A 1 277 ? 53.833  51.252 29.434  1.00 144.74 ? 277 ARG A O     1 
ATOM   2047 C CB    . ARG A 1 277 ? 53.760  49.305 32.094  1.00 136.56 ? 277 ARG A CB    1 
ATOM   2048 C CG    . ARG A 1 277 ? 52.637  48.420 32.625  1.00 140.90 ? 277 ARG A CG    1 
ATOM   2049 C CD    . ARG A 1 277 ? 51.273  48.803 32.059  1.00 151.28 ? 277 ARG A CD    1 
ATOM   2050 N NE    . ARG A 1 277 ? 50.913  50.193 32.346  1.00 151.13 ? 277 ARG A NE    1 
ATOM   2051 C CZ    . ARG A 1 277 ? 50.185  50.588 33.388  1.00 150.27 ? 277 ARG A CZ    1 
ATOM   2052 N NH1   . ARG A 1 277 ? 49.724  49.705 34.264  1.00 152.17 ? 277 ARG A NH1   1 
ATOM   2053 N NH2   . ARG A 1 277 ? 49.917  51.876 33.554  1.00 144.01 ? 277 ARG A NH2   1 
ATOM   2054 N N     . GLN A 1 278 ? 55.880  50.717 30.215  1.00 148.64 ? 278 GLN A N     1 
ATOM   2055 C CA    . GLN A 1 278 ? 56.509  51.963 29.768  1.00 148.67 ? 278 GLN A CA    1 
ATOM   2056 C C     . GLN A 1 278 ? 56.721  52.013 28.253  1.00 148.26 ? 278 GLN A C     1 
ATOM   2057 O O     . GLN A 1 278 ? 56.757  53.095 27.663  1.00 146.18 ? 278 GLN A O     1 
ATOM   2058 C CB    . GLN A 1 278 ? 57.836  52.202 30.500  1.00 147.01 ? 278 GLN A CB    1 
ATOM   2059 C CG    . GLN A 1 278 ? 57.704  52.437 32.002  1.00 147.15 ? 278 GLN A CG    1 
ATOM   2060 C CD    . GLN A 1 278 ? 56.977  53.726 32.351  1.00 146.39 ? 278 GLN A CD    1 
ATOM   2061 O OE1   . GLN A 1 278 ? 56.071  53.730 33.184  1.00 143.79 ? 278 GLN A OE1   1 
ATOM   2062 N NE2   . GLN A 1 278 ? 57.372  54.825 31.717  1.00 147.57 ? 278 GLN A NE2   1 
ATOM   2063 N N     . LEU A 1 279 ? 56.860  50.840 27.636  1.00 149.01 ? 279 LEU A N     1 
ATOM   2064 C CA    . LEU A 1 279 ? 57.021  50.733 26.184  1.00 152.14 ? 279 LEU A CA    1 
ATOM   2065 C C     . LEU A 1 279 ? 55.716  51.010 25.436  1.00 154.73 ? 279 LEU A C     1 
ATOM   2066 O O     . LEU A 1 279 ? 55.734  51.528 24.317  1.00 154.78 ? 279 LEU A O     1 
ATOM   2067 C CB    . LEU A 1 279 ? 57.574  49.357 25.795  1.00 150.40 ? 279 LEU A CB    1 
ATOM   2068 C CG    . LEU A 1 279 ? 59.094  49.148 25.801  1.00 136.08 ? 279 LEU A CG    1 
ATOM   2069 C CD1   . LEU A 1 279 ? 59.636  48.928 27.207  1.00 136.37 ? 279 LEU A CD1   1 
ATOM   2070 C CD2   . LEU A 1 279 ? 59.463  47.976 24.906  1.00 138.86 ? 279 LEU A CD2   1 
ATOM   2071 N N     . CYS A 1 280 ? 54.592  50.661 26.061  1.00 154.05 ? 280 CYS A N     1 
ATOM   2072 C CA    . CYS A 1 280 ? 53.267  50.881 25.479  1.00 152.88 ? 280 CYS A CA    1 
ATOM   2073 C C     . CYS A 1 280 ? 52.817  52.342 25.571  1.00 150.81 ? 280 CYS A C     1 
ATOM   2074 O O     . CYS A 1 280 ? 51.907  52.761 24.852  1.00 149.55 ? 280 CYS A O     1 
ATOM   2075 C CB    . CYS A 1 280 ? 52.230  49.966 26.137  1.00 147.39 ? 280 CYS A CB    1 
ATOM   2076 S SG    . CYS A 1 280 ? 52.386  48.220 25.694  1.00 137.28 ? 280 CYS A SG    1 
ATOM   2077 N N     . LYS A 1 281 ? 53.459  53.104 26.456  1.00 146.74 ? 281 LYS A N     1 
ATOM   2078 C CA    . LYS A 1 281 ? 53.164  54.529 26.632  1.00 141.06 ? 281 LYS A CA    1 
ATOM   2079 C C     . LYS A 1 281 ? 53.623  55.366 25.438  1.00 150.02 ? 281 LYS A C     1 
ATOM   2080 O O     . LYS A 1 281 ? 53.030  56.405 25.137  1.00 141.98 ? 281 LYS A O     1 
ATOM   2081 C CB    . LYS A 1 281 ? 53.801  55.059 27.920  1.00 151.73 ? 281 LYS A CB    1 
ATOM   2082 C CG    . LYS A 1 281 ? 53.126  54.582 29.197  1.00 148.85 ? 281 LYS A CG    1 
ATOM   2083 C CD    . LYS A 1 281 ? 53.794  55.172 30.428  1.00 149.93 ? 281 LYS A CD    1 
ATOM   2084 C CE    . LYS A 1 281 ? 53.109  54.709 31.703  1.00 145.88 ? 281 LYS A CE    1 
ATOM   2085 N NZ    . LYS A 1 281 ? 53.744  55.292 32.918  1.00 134.31 ? 281 LYS A NZ    1 
ATOM   2086 N N     . LEU A 1 282 ? 54.677  54.906 24.766  1.00 152.93 ? 282 LEU A N     1 
ATOM   2087 C CA    . LEU A 1 282 ? 55.208  55.576 23.579  1.00 158.21 ? 282 LEU A CA    1 
ATOM   2088 C C     . LEU A 1 282 ? 54.333  55.340 22.347  1.00 161.05 ? 282 LEU A C     1 
ATOM   2089 O O     . LEU A 1 282 ? 54.365  56.125 21.396  1.00 173.59 ? 282 LEU A O     1 
ATOM   2090 C CB    . LEU A 1 282 ? 56.646  55.123 23.297  1.00 147.56 ? 282 LEU A CB    1 
ATOM   2091 C CG    . LEU A 1 282 ? 57.737  55.414 24.336  1.00 151.20 ? 282 LEU A CG    1 
ATOM   2092 C CD1   . LEU A 1 282 ? 58.975  54.577 24.049  1.00 154.72 ? 282 LEU A CD1   1 
ATOM   2093 C CD2   . LEU A 1 282 ? 58.090  56.894 24.392  1.00 153.04 ? 282 LEU A CD2   1 
ATOM   2094 N N     . LEU A 1 283 ? 53.553  54.260 22.375  1.00 154.73 ? 283 LEU A N     1 
ATOM   2095 C CA    . LEU A 1 283 ? 52.666  53.897 21.268  1.00 152.98 ? 283 LEU A CA    1 
ATOM   2096 C C     . LEU A 1 283 ? 51.292  54.574 21.366  1.00 146.35 ? 283 LEU A C     1 
ATOM   2097 O O     . LEU A 1 283 ? 50.312  54.099 20.784  1.00 147.05 ? 283 LEU A O     1 
ATOM   2098 C CB    . LEU A 1 283 ? 52.511  52.371 21.185  1.00 157.49 ? 283 LEU A CB    1 
ATOM   2099 C CG    . LEU A 1 283 ? 53.742  51.527 20.832  1.00 155.38 ? 283 LEU A CG    1 
ATOM   2100 C CD1   . LEU A 1 283 ? 53.510  50.067 21.192  1.00 145.13 ? 283 LEU A CD1   1 
ATOM   2101 C CD2   . LEU A 1 283 ? 54.118  51.666 19.363  1.00 143.84 ? 283 LEU A CD2   1 
ATOM   2102 N N     . ARG A 1 284 ? 51.235  55.686 22.096  1.00 140.63 ? 284 ARG A N     1 
ATOM   2103 C CA    . ARG A 1 284 ? 50.000  56.450 22.274  1.00 147.96 ? 284 ARG A CA    1 
ATOM   2104 C C     . ARG A 1 284 ? 49.639  57.267 21.033  1.00 151.98 ? 284 ARG A C     1 
ATOM   2105 O O     . ARG A 1 284 ? 48.468  57.591 20.816  1.00 141.34 ? 284 ARG A O     1 
ATOM   2106 C CB    . ARG A 1 284 ? 50.111  57.369 23.493  1.00 146.82 ? 284 ARG A CB    1 
ATOM   2107 N N     . GLY A 1 285 ? 50.648  57.595 20.227  1.00 157.72 ? 285 GLY A N     1 
ATOM   2108 C CA    . GLY A 1 285 ? 50.456  58.366 19.000  1.00 149.81 ? 285 GLY A CA    1 
ATOM   2109 C C     . GLY A 1 285 ? 49.766  57.569 17.909  1.00 147.19 ? 285 GLY A C     1 
ATOM   2110 O O     . GLY A 1 285 ? 50.257  56.518 17.492  1.00 143.19 ? 285 GLY A O     1 
ATOM   2111 N N     . THR A 1 286 ? 48.625  58.079 17.450  1.00 144.81 ? 286 THR A N     1 
ATOM   2112 C CA    . THR A 1 286 ? 47.823  57.414 16.421  1.00 147.60 ? 286 THR A CA    1 
ATOM   2113 C C     . THR A 1 286 ? 48.030  58.038 15.040  1.00 156.40 ? 286 THR A C     1 
ATOM   2114 O O     . THR A 1 286 ? 48.451  59.193 14.930  1.00 160.98 ? 286 THR A O     1 
ATOM   2115 C CB    . THR A 1 286 ? 46.319  57.430 16.769  1.00 141.18 ? 286 THR A CB    1 
ATOM   2116 O OG1   . THR A 1 286 ? 45.907  58.770 17.072  1.00 139.99 ? 286 THR A OG1   1 
ATOM   2117 C CG2   . THR A 1 286 ? 46.029  56.530 17.966  1.00 134.09 ? 286 THR A CG2   1 
ATOM   2118 N N     . LYS A 1 287 ? 47.726  57.258 14.000  1.00 157.92 ? 287 LYS A N     1 
ATOM   2119 C CA    . LYS A 1 287 ? 47.857  57.671 12.595  1.00 161.94 ? 287 LYS A CA    1 
ATOM   2120 C C     . LYS A 1 287 ? 49.278  58.111 12.229  1.00 173.26 ? 287 LYS A C     1 
ATOM   2121 O O     . LYS A 1 287 ? 49.560  59.307 12.106  1.00 176.33 ? 287 LYS A O     1 
ATOM   2122 C CB    . LYS A 1 287 ? 46.826  58.751 12.232  1.00 151.21 ? 287 LYS A CB    1 
ATOM   2123 N N     . ALA A 1 288 ? 50.167  57.133 12.062  1.00 173.19 ? 288 ALA A N     1 
ATOM   2124 C CA    . ALA A 1 288 ? 51.564  57.397 11.715  1.00 160.75 ? 288 ALA A CA    1 
ATOM   2125 C C     . ALA A 1 288 ? 52.170  56.269 10.885  1.00 155.04 ? 288 ALA A C     1 
ATOM   2126 O O     . ALA A 1 288 ? 52.010  55.090 11.210  1.00 147.25 ? 288 ALA A O     1 
ATOM   2127 C CB    . ALA A 1 288 ? 52.390  57.635 12.973  1.00 143.68 ? 288 ALA A CB    1 
ATOM   2128 N N     . LEU A 1 289 ? 52.861  56.645 9.811   1.00 158.57 ? 289 LEU A N     1 
ATOM   2129 C CA    . LEU A 1 289 ? 53.576  55.690 8.966   1.00 153.99 ? 289 LEU A CA    1 
ATOM   2130 C C     . LEU A 1 289 ? 55.042  55.607 9.387   1.00 151.44 ? 289 LEU A C     1 
ATOM   2131 O O     . LEU A 1 289 ? 55.549  54.524 9.688   1.00 135.92 ? 289 LEU A O     1 
ATOM   2132 C CB    . LEU A 1 289 ? 53.461  56.076 7.485   1.00 150.73 ? 289 LEU A CB    1 
ATOM   2133 C CG    . LEU A 1 289 ? 52.084  56.003 6.813   1.00 141.27 ? 289 LEU A CG    1 
ATOM   2134 C CD1   . LEU A 1 289 ? 52.060  56.851 5.550   1.00 138.29 ? 289 LEU A CD1   1 
ATOM   2135 C CD2   . LEU A 1 289 ? 51.684  54.565 6.505   1.00 146.38 ? 289 LEU A CD2   1 
ATOM   2136 N N     . THR A 1 290 ? 55.713  56.759 9.402   1.00 159.87 ? 290 THR A N     1 
ATOM   2137 C CA    . THR A 1 290 ? 57.094  56.865 9.871   1.00 150.97 ? 290 THR A CA    1 
ATOM   2138 C C     . THR A 1 290 ? 57.222  58.026 10.858  1.00 152.20 ? 290 THR A C     1 
ATOM   2139 O O     . THR A 1 290 ? 57.463  59.172 10.465  1.00 155.53 ? 290 THR A O     1 
ATOM   2140 C CB    . THR A 1 290 ? 58.096  57.045 8.707   1.00 145.28 ? 290 THR A CB    1 
ATOM   2141 O OG1   . THR A 1 290 ? 57.627  58.066 7.818   1.00 149.56 ? 290 THR A OG1   1 
ATOM   2142 C CG2   . THR A 1 290 ? 58.274  55.742 7.934   1.00 147.83 ? 290 THR A CG2   1 
ATOM   2143 N N     . GLU A 1 291 ? 57.046  57.718 12.141  1.00 151.05 ? 291 GLU A N     1 
ATOM   2144 C CA    . GLU A 1 291 ? 57.087  58.723 13.202  1.00 158.77 ? 291 GLU A CA    1 
ATOM   2145 C C     . GLU A 1 291 ? 58.484  58.849 13.811  1.00 155.67 ? 291 GLU A C     1 
ATOM   2146 O O     . GLU A 1 291 ? 58.957  59.961 14.057  1.00 152.80 ? 291 GLU A O     1 
ATOM   2147 C CB    . GLU A 1 291 ? 56.053  58.397 14.288  1.00 157.98 ? 291 GLU A CB    1 
ATOM   2148 C CG    . GLU A 1 291 ? 55.811  59.511 15.302  1.00 164.07 ? 291 GLU A CG    1 
ATOM   2149 C CD    . GLU A 1 291 ? 55.057  60.697 14.724  1.00 171.71 ? 291 GLU A CD    1 
ATOM   2150 O OE1   . GLU A 1 291 ? 54.065  60.485 13.993  1.00 164.84 ? 291 GLU A OE1   1 
ATOM   2151 O OE2   . GLU A 1 291 ? 55.452  61.846 15.011  1.00 175.99 ? 291 GLU A OE2   1 
ATOM   2152 N N     . VAL A 1 292 ? 59.129  57.701 14.038  1.00 153.71 ? 292 VAL A N     1 
ATOM   2153 C CA    . VAL A 1 292 ? 60.452  57.607 14.680  1.00 151.21 ? 292 VAL A CA    1 
ATOM   2154 C C     . VAL A 1 292 ? 60.439  58.215 16.090  1.00 152.40 ? 292 VAL A C     1 
ATOM   2155 O O     . VAL A 1 292 ? 60.666  59.416 16.270  1.00 154.93 ? 292 VAL A O     1 
ATOM   2156 C CB    . VAL A 1 292 ? 61.592  58.202 13.807  1.00 146.47 ? 292 VAL A CB    1 
ATOM   2157 C CG1   . VAL A 1 292 ? 62.954  57.927 14.433  1.00 138.16 ? 292 VAL A CG1   1 
ATOM   2158 C CG2   . VAL A 1 292 ? 61.546  57.632 12.395  1.00 149.64 ? 292 VAL A CG2   1 
ATOM   2159 N N     . ILE A 1 293 ? 60.163  57.369 17.080  1.00 149.33 ? 293 ILE A N     1 
ATOM   2160 C CA    . ILE A 1 293 ? 60.067  57.803 18.474  1.00 149.49 ? 293 ILE A CA    1 
ATOM   2161 C C     . ILE A 1 293 ? 61.436  57.744 19.156  1.00 161.15 ? 293 ILE A C     1 
ATOM   2162 O O     . ILE A 1 293 ? 62.069  56.684 19.185  1.00 160.09 ? 293 ILE A O     1 
ATOM   2163 C CB    . ILE A 1 293 ? 59.042  56.960 19.272  1.00 140.44 ? 293 ILE A CB    1 
ATOM   2164 C CG1   . ILE A 1 293 ? 57.700  56.889 18.530  1.00 132.89 ? 293 ILE A CG1   1 
ATOM   2165 C CG2   . ILE A 1 293 ? 58.851  57.531 20.674  1.00 136.40 ? 293 ILE A CG2   1 
ATOM   2166 C CD1   . ILE A 1 293 ? 56.786  55.774 18.997  1.00 142.91 ? 293 ILE A CD1   1 
ATOM   2167 N N     . PRO A 1 294 ? 61.902  58.888 19.697  1.00 163.48 ? 294 PRO A N     1 
ATOM   2168 C CA    . PRO A 1 294 ? 63.156  58.927 20.454  1.00 161.98 ? 294 PRO A CA    1 
ATOM   2169 C C     . PRO A 1 294 ? 63.020  58.259 21.822  1.00 161.81 ? 294 PRO A C     1 
ATOM   2170 O O     . PRO A 1 294 ? 61.935  58.262 22.410  1.00 154.90 ? 294 PRO A O     1 
ATOM   2171 C CB    . PRO A 1 294 ? 63.423  60.426 20.616  1.00 156.77 ? 294 PRO A CB    1 
ATOM   2172 C CG    . PRO A 1 294 ? 62.081  61.065 20.524  1.00 149.38 ? 294 PRO A CG    1 
ATOM   2173 C CD    . PRO A 1 294 ? 61.303  60.228 19.551  1.00 156.02 ? 294 PRO A CD    1 
ATOM   2174 N N     . LEU A 1 295 ? 64.120  57.694 22.315  1.00 161.87 ? 295 LEU A N     1 
ATOM   2175 C CA    . LEU A 1 295 ? 64.129  56.992 23.599  1.00 156.01 ? 295 LEU A CA    1 
ATOM   2176 C C     . LEU A 1 295 ? 64.135  57.950 24.788  1.00 162.25 ? 295 LEU A C     1 
ATOM   2177 O O     . LEU A 1 295 ? 64.780  59.001 24.747  1.00 175.77 ? 295 LEU A O     1 
ATOM   2178 C CB    . LEU A 1 295 ? 65.297  55.988 23.675  1.00 154.50 ? 295 LEU A CB    1 
ATOM   2179 C CG    . LEU A 1 295 ? 66.797  56.342 23.784  1.00 155.76 ? 295 LEU A CG    1 
ATOM   2180 C CD1   . LEU A 1 295 ? 67.247  57.413 22.796  1.00 152.60 ? 295 LEU A CD1   1 
ATOM   2181 C CD2   . LEU A 1 295 ? 67.204  56.715 25.206  1.00 155.83 ? 295 LEU A CD2   1 
ATOM   2182 N N     . THR A 1 296 ? 63.408  57.579 25.839  1.00 148.69 ? 296 THR A N     1 
ATOM   2183 C CA    . THR A 1 296 ? 63.321  58.388 27.057  1.00 154.83 ? 296 THR A CA    1 
ATOM   2184 C C     . THR A 1 296 ? 63.919  57.658 28.262  1.00 152.27 ? 296 THR A C     1 
ATOM   2185 O O     . THR A 1 296 ? 64.274  56.479 28.171  1.00 146.78 ? 296 THR A O     1 
ATOM   2186 C CB    . THR A 1 296 ? 61.868  58.814 27.364  1.00 149.99 ? 296 THR A CB    1 
ATOM   2187 O OG1   . THR A 1 296 ? 61.008  57.669 27.325  1.00 136.25 ? 296 THR A OG1   1 
ATOM   2188 C CG2   . THR A 1 296 ? 61.381  59.845 26.352  1.00 156.16 ? 296 THR A CG2   1 
ATOM   2189 N N     . GLU A 1 297 ? 64.027  58.368 29.384  1.00 156.38 ? 297 GLU A N     1 
ATOM   2190 C CA    . GLU A 1 297 ? 64.627  57.828 30.606  1.00 155.84 ? 297 GLU A CA    1 
ATOM   2191 C C     . GLU A 1 297 ? 63.759  56.754 31.267  1.00 154.24 ? 297 GLU A C     1 
ATOM   2192 O O     . GLU A 1 297 ? 64.273  55.731 31.723  1.00 156.76 ? 297 GLU A O     1 
ATOM   2193 C CB    . GLU A 1 297 ? 64.926  58.962 31.597  1.00 149.37 ? 297 GLU A CB    1 
ATOM   2194 C CG    . GLU A 1 297 ? 65.797  58.565 32.784  1.00 145.10 ? 297 GLU A CG    1 
ATOM   2195 C CD    . GLU A 1 297 ? 67.228  58.237 32.393  1.00 141.93 ? 297 GLU A CD    1 
ATOM   2196 O OE1   . GLU A 1 297 ? 67.874  59.066 31.717  1.00 135.02 ? 297 GLU A OE1   1 
ATOM   2197 O OE2   . GLU A 1 297 ? 67.707  57.144 32.762  1.00 140.84 ? 297 GLU A OE2   1 
ATOM   2198 N N     . GLU A 1 298 ? 62.449  56.991 31.310  1.00 149.74 ? 298 GLU A N     1 
ATOM   2199 C CA    . GLU A 1 298 ? 61.510  56.081 31.973  1.00 143.46 ? 298 GLU A CA    1 
ATOM   2200 C C     . GLU A 1 298 ? 61.171  54.834 31.150  1.00 144.20 ? 298 GLU A C     1 
ATOM   2201 O O     . GLU A 1 298 ? 60.837  53.789 31.713  1.00 141.87 ? 298 GLU A O     1 
ATOM   2202 C CB    . GLU A 1 298 ? 60.228  56.821 32.386  1.00 140.54 ? 298 GLU A CB    1 
ATOM   2203 C CG    . GLU A 1 298 ? 59.505  57.547 31.256  1.00 141.89 ? 298 GLU A CG    1 
ATOM   2204 C CD    . GLU A 1 298 ? 58.237  58.246 31.715  1.00 147.04 ? 298 GLU A CD    1 
ATOM   2205 O OE1   . GLU A 1 298 ? 58.251  58.882 32.791  1.00 153.57 ? 298 GLU A OE1   1 
ATOM   2206 O OE2   . GLU A 1 298 ? 57.220  58.159 30.995  1.00 146.68 ? 298 GLU A OE2   1 
ATOM   2207 N N     . ALA A 1 299 ? 61.261  54.948 29.826  1.00 146.43 ? 299 ALA A N     1 
ATOM   2208 C CA    . ALA A 1 299 ? 60.930  53.842 28.925  1.00 150.47 ? 299 ALA A CA    1 
ATOM   2209 C C     . ALA A 1 299 ? 62.075  52.841 28.771  1.00 140.12 ? 299 ALA A C     1 
ATOM   2210 O O     . ALA A 1 299 ? 61.841  51.634 28.674  1.00 146.26 ? 299 ALA A O     1 
ATOM   2211 C CB    . ALA A 1 299 ? 60.500  54.373 27.565  1.00 154.94 ? 299 ALA A CB    1 
ATOM   2212 N N     . GLU A 1 300 ? 63.306  53.349 28.750  1.00 132.98 ? 300 GLU A N     1 
ATOM   2213 C CA    . GLU A 1 300 ? 64.497  52.517 28.579  1.00 137.15 ? 300 GLU A CA    1 
ATOM   2214 C C     . GLU A 1 300 ? 64.972  51.913 29.907  1.00 137.91 ? 300 GLU A C     1 
ATOM   2215 O O     . GLU A 1 300 ? 65.838  51.034 29.922  1.00 140.69 ? 300 GLU A O     1 
ATOM   2216 C CB    . GLU A 1 300 ? 65.621  53.329 27.924  1.00 146.07 ? 300 GLU A CB    1 
ATOM   2217 C CG    . GLU A 1 300 ? 66.642  52.496 27.160  1.00 147.57 ? 300 GLU A CG    1 
ATOM   2218 C CD    . GLU A 1 300 ? 67.756  53.330 26.553  1.00 152.35 ? 300 GLU A CD    1 
ATOM   2219 O OE1   . GLU A 1 300 ? 68.327  54.185 27.264  1.00 158.36 ? 300 GLU A OE1   1 
ATOM   2220 O OE2   . GLU A 1 300 ? 68.070  53.123 25.362  1.00 146.94 ? 300 GLU A OE2   1 
ATOM   2221 N N     . LEU A 1 301 ? 64.393  52.385 31.010  1.00 134.88 ? 301 LEU A N     1 
ATOM   2222 C CA    . LEU A 1 301 ? 64.756  51.928 32.353  1.00 144.99 ? 301 LEU A CA    1 
ATOM   2223 C C     . LEU A 1 301 ? 64.371  50.467 32.591  1.00 146.20 ? 301 LEU A C     1 
ATOM   2224 O O     . LEU A 1 301 ? 65.148  49.703 33.168  1.00 148.52 ? 301 LEU A O     1 
ATOM   2225 C CB    . LEU A 1 301 ? 64.125  52.839 33.419  1.00 147.01 ? 301 LEU A CB    1 
ATOM   2226 C CG    . LEU A 1 301 ? 64.664  52.888 34.860  1.00 156.05 ? 301 LEU A CG    1 
ATOM   2227 C CD1   . LEU A 1 301 ? 64.082  51.782 35.734  1.00 153.27 ? 301 LEU A CD1   1 
ATOM   2228 C CD2   . LEU A 1 301 ? 66.188  52.881 34.913  1.00 160.56 ? 301 LEU A CD2   1 
ATOM   2229 N N     . GLU A 1 302 ? 63.174  50.088 32.146  1.00 146.84 ? 302 GLU A N     1 
ATOM   2230 C CA    . GLU A 1 302 ? 62.700  48.708 32.270  1.00 146.74 ? 302 GLU A CA    1 
ATOM   2231 C C     . GLU A 1 302 ? 63.178  47.825 31.114  1.00 143.53 ? 302 GLU A C     1 
ATOM   2232 O O     . GLU A 1 302 ? 63.113  46.597 31.196  1.00 136.78 ? 302 GLU A O     1 
ATOM   2233 C CB    . GLU A 1 302 ? 61.170  48.658 32.401  1.00 155.55 ? 302 GLU A CB    1 
ATOM   2234 C CG    . GLU A 1 302 ? 60.397  49.175 31.194  1.00 153.52 ? 302 GLU A CG    1 
ATOM   2235 C CD    . GLU A 1 302 ? 58.899  48.954 31.313  1.00 154.72 ? 302 GLU A CD    1 
ATOM   2236 O OE1   . GLU A 1 302 ? 58.347  49.124 32.422  1.00 158.30 ? 302 GLU A OE1   1 
ATOM   2237 O OE2   . GLU A 1 302 ? 58.267  48.608 30.293  1.00 153.89 ? 302 GLU A OE2   1 
ATOM   2238 N N     . LEU A 1 303 ? 63.656  48.460 30.046  1.00 145.60 ? 303 LEU A N     1 
ATOM   2239 C CA    . LEU A 1 303 ? 64.182  47.751 28.880  1.00 142.78 ? 303 LEU A CA    1 
ATOM   2240 C C     . LEU A 1 303 ? 65.578  47.185 29.151  1.00 136.77 ? 303 LEU A C     1 
ATOM   2241 O O     . LEU A 1 303 ? 65.966  46.169 28.570  1.00 129.68 ? 303 LEU A O     1 
ATOM   2242 C CB    . LEU A 1 303 ? 64.209  48.680 27.659  1.00 148.58 ? 303 LEU A CB    1 
ATOM   2243 C CG    . LEU A 1 303 ? 64.423  48.080 26.263  1.00 146.79 ? 303 LEU A CG    1 
ATOM   2244 C CD1   . LEU A 1 303 ? 63.186  47.336 25.779  1.00 151.64 ? 303 LEU A CD1   1 
ATOM   2245 C CD2   . LEU A 1 303 ? 64.807  49.170 25.274  1.00 147.88 ? 303 LEU A CD2   1 
ATOM   2246 N N     . ALA A 1 304 ? 66.318  47.849 30.038  1.00 145.80 ? 304 ALA A N     1 
ATOM   2247 C CA    . ALA A 1 304 ? 67.679  47.444 30.393  1.00 155.35 ? 304 ALA A CA    1 
ATOM   2248 C C     . ALA A 1 304 ? 67.714  46.169 31.238  1.00 151.02 ? 304 ALA A C     1 
ATOM   2249 O O     . ALA A 1 304 ? 68.601  45.330 31.066  1.00 143.74 ? 304 ALA A O     1 
ATOM   2250 C CB    . ALA A 1 304 ? 68.401  48.578 31.107  1.00 163.70 ? 304 ALA A CB    1 
ATOM   2251 N N     . GLU A 1 305 ? 66.749  46.033 32.147  1.00 149.74 ? 305 GLU A N     1 
ATOM   2252 C CA    . GLU A 1 305 ? 66.665  44.862 33.025  1.00 150.93 ? 305 GLU A CA    1 
ATOM   2253 C C     . GLU A 1 305 ? 66.083  43.632 32.323  1.00 145.05 ? 305 GLU A C     1 
ATOM   2254 O O     . GLU A 1 305 ? 66.323  42.500 32.749  1.00 140.37 ? 305 GLU A O     1 
ATOM   2255 C CB    . GLU A 1 305 ? 65.883  45.184 34.308  1.00 155.80 ? 305 GLU A CB    1 
ATOM   2256 C CG    . GLU A 1 305 ? 64.442  45.633 34.097  1.00 147.14 ? 305 GLU A CG    1 
ATOM   2257 C CD    . GLU A 1 305 ? 63.707  45.902 35.399  1.00 146.09 ? 305 GLU A CD    1 
ATOM   2258 O OE1   . GLU A 1 305 ? 63.836  45.096 36.346  1.00 151.67 ? 305 GLU A OE1   1 
ATOM   2259 O OE2   . GLU A 1 305 ? 62.987  46.920 35.472  1.00 136.27 ? 305 GLU A OE2   1 
ATOM   2260 N N     . ASN A 1 306 ? 65.322  43.861 31.253  1.00 143.19 ? 306 ASN A N     1 
ATOM   2261 C CA    . ASN A 1 306 ? 64.738  42.779 30.459  1.00 149.20 ? 306 ASN A CA    1 
ATOM   2262 C C     . ASN A 1 306 ? 65.773  42.024 29.625  1.00 140.97 ? 306 ASN A C     1 
ATOM   2263 O O     . ASN A 1 306 ? 65.625  40.824 29.381  1.00 137.28 ? 306 ASN A O     1 
ATOM   2264 C CB    . ASN A 1 306 ? 63.622  43.310 29.552  1.00 152.86 ? 306 ASN A CB    1 
ATOM   2265 C CG    . ASN A 1 306 ? 62.358  43.662 30.318  1.00 154.19 ? 306 ASN A CG    1 
ATOM   2266 O OD1   . ASN A 1 306 ? 62.037  43.048 31.337  1.00 161.41 ? 306 ASN A OD1   1 
ATOM   2267 N ND2   . ASN A 1 306 ? 61.627  44.653 29.821  1.00 151.31 ? 306 ASN A ND2   1 
ATOM   2268 N N     . ARG A 1 307 ? 66.813  42.735 29.195  1.00 143.50 ? 307 ARG A N     1 
ATOM   2269 C CA    . ARG A 1 307 ? 67.888  42.156 28.386  1.00 138.52 ? 307 ARG A CA    1 
ATOM   2270 C C     . ARG A 1 307 ? 68.821  41.266 29.208  1.00 141.82 ? 307 ARG A C     1 
ATOM   2271 O O     . ARG A 1 307 ? 69.456  40.357 28.667  1.00 143.28 ? 307 ARG A O     1 
ATOM   2272 C CB    . ARG A 1 307 ? 68.693  43.259 27.691  1.00 133.95 ? 307 ARG A CB    1 
ATOM   2273 C CG    . ARG A 1 307 ? 67.924  44.023 26.624  1.00 132.37 ? 307 ARG A CG    1 
ATOM   2274 C CD    . ARG A 1 307 ? 68.771  45.134 26.023  1.00 129.57 ? 307 ARG A CD    1 
ATOM   2275 N NE    . ARG A 1 307 ? 68.034  45.904 25.022  1.00 128.99 ? 307 ARG A NE    1 
ATOM   2276 C CZ    . ARG A 1 307 ? 68.527  46.943 24.351  1.00 142.47 ? 307 ARG A CZ    1 
ATOM   2277 N NH1   . ARG A 1 307 ? 69.771  47.356 24.563  1.00 157.59 ? 307 ARG A NH1   1 
ATOM   2278 N NH2   . ARG A 1 307 ? 67.772  47.573 23.461  1.00 145.59 ? 307 ARG A NH2   1 
ATOM   2279 N N     . GLU A 1 308 ? 68.898  41.536 30.511  1.00 142.90 ? 308 GLU A N     1 
ATOM   2280 C CA    . GLU A 1 308 ? 69.757  40.781 31.426  1.00 150.95 ? 308 GLU A CA    1 
ATOM   2281 C C     . GLU A 1 308 ? 69.224  39.374 31.702  1.00 154.40 ? 308 GLU A C     1 
ATOM   2282 O O     . GLU A 1 308 ? 70.003  38.436 31.884  1.00 157.68 ? 308 GLU A O     1 
ATOM   2283 C CB    . GLU A 1 308 ? 69.939  41.541 32.746  1.00 150.62 ? 308 GLU A CB    1 
ATOM   2284 C CG    . GLU A 1 308 ? 70.723  42.844 32.630  1.00 150.90 ? 308 GLU A CG    1 
ATOM   2285 C CD    . GLU A 1 308 ? 72.203  42.634 32.354  1.00 157.97 ? 308 GLU A CD    1 
ATOM   2286 O OE1   . GLU A 1 308 ? 72.812  41.734 32.972  1.00 153.16 ? 308 GLU A OE1   1 
ATOM   2287 O OE2   . GLU A 1 308 ? 72.759  43.373 31.515  1.00 162.74 ? 308 GLU A OE2   1 
ATOM   2288 N N     . ILE A 1 309 ? 67.899  39.240 31.733  1.00 141.15 ? 309 ILE A N     1 
ATOM   2289 C CA    . ILE A 1 309 ? 67.243  37.955 31.989  1.00 135.90 ? 309 ILE A CA    1 
ATOM   2290 C C     . ILE A 1 309 ? 67.301  37.054 30.751  1.00 131.54 ? 309 ILE A C     1 
ATOM   2291 O O     . ILE A 1 309 ? 67.357  35.827 30.869  1.00 130.46 ? 309 ILE A O     1 
ATOM   2292 C CB    . ILE A 1 309 ? 65.770  38.140 32.448  1.00 137.29 ? 309 ILE A CB    1 
ATOM   2293 C CG1   . ILE A 1 309 ? 65.634  39.284 33.472  1.00 134.99 ? 309 ILE A CG1   1 
ATOM   2294 C CG2   . ILE A 1 309 ? 65.191  36.835 32.990  1.00 146.51 ? 309 ILE A CG2   1 
ATOM   2295 C CD1   . ILE A 1 309 ? 66.323  39.061 34.807  1.00 141.47 ? 309 ILE A CD1   1 
ATOM   2296 N N     . LEU A 1 310 ? 67.301  37.675 29.572  1.00 135.29 ? 310 LEU A N     1 
ATOM   2297 C CA    . LEU A 1 310 ? 67.351  36.956 28.294  1.00 140.09 ? 310 LEU A CA    1 
ATOM   2298 C C     . LEU A 1 310 ? 68.697  36.273 28.035  1.00 140.49 ? 310 LEU A C     1 
ATOM   2299 O O     . LEU A 1 310 ? 68.780  35.342 27.230  1.00 142.06 ? 310 LEU A O     1 
ATOM   2300 C CB    . LEU A 1 310 ? 67.011  37.899 27.133  1.00 148.70 ? 310 LEU A CB    1 
ATOM   2301 C CG    . LEU A 1 310 ? 65.564  38.382 26.978  1.00 150.27 ? 310 LEU A CG    1 
ATOM   2302 C CD1   . LEU A 1 310 ? 65.512  39.650 26.138  1.00 154.46 ? 310 LEU A CD1   1 
ATOM   2303 C CD2   . LEU A 1 310 ? 64.671  37.303 26.379  1.00 147.26 ? 310 LEU A CD2   1 
ATOM   2304 N N     . LYS A 1 311 ? 69.741  36.742 28.718  1.00 142.73 ? 311 LYS A N     1 
ATOM   2305 C CA    . LYS A 1 311 ? 71.095  36.203 28.566  1.00 148.92 ? 311 LYS A CA    1 
ATOM   2306 C C     . LYS A 1 311 ? 71.228  34.784 29.122  1.00 143.11 ? 311 LYS A C     1 
ATOM   2307 O O     . LYS A 1 311 ? 71.872  33.930 28.507  1.00 141.27 ? 311 LYS A O     1 
ATOM   2308 C CB    . LYS A 1 311 ? 72.123  37.127 29.227  1.00 154.81 ? 311 LYS A CB    1 
ATOM   2309 C CG    . LYS A 1 311 ? 72.310  38.464 28.527  1.00 153.31 ? 311 LYS A CG    1 
ATOM   2310 C CD    . LYS A 1 311 ? 73.315  39.336 29.262  1.00 139.61 ? 311 LYS A CD    1 
ATOM   2311 C CE    . LYS A 1 311 ? 73.488  40.680 28.573  1.00 138.90 ? 311 LYS A CE    1 
ATOM   2312 N NZ    . LYS A 1 311 ? 74.465  41.549 29.287  1.00 145.49 ? 311 LYS A NZ    1 
ATOM   2313 N N     . GLU A 1 312 ? 70.619  34.543 30.281  1.00 136.83 ? 312 GLU A N     1 
ATOM   2314 C CA    . GLU A 1 312 ? 70.664  33.232 30.930  1.00 138.81 ? 312 GLU A CA    1 
ATOM   2315 C C     . GLU A 1 312 ? 69.570  32.306 30.393  1.00 139.16 ? 312 GLU A C     1 
ATOM   2316 O O     . GLU A 1 312 ? 68.390  32.668 30.405  1.00 139.57 ? 312 GLU A O     1 
ATOM   2317 C CB    . GLU A 1 312 ? 70.544  33.373 32.451  1.00 140.60 ? 312 GLU A CB    1 
ATOM   2318 C CG    . GLU A 1 312 ? 71.761  33.996 33.122  1.00 144.88 ? 312 GLU A CG    1 
ATOM   2319 C CD    . GLU A 1 312 ? 71.619  34.100 34.631  1.00 149.25 ? 312 GLU A CD    1 
ATOM   2320 O OE1   . GLU A 1 312 ? 71.155  33.126 35.264  1.00 150.94 ? 312 GLU A OE1   1 
ATOM   2321 O OE2   . GLU A 1 312 ? 71.985  35.156 35.189  1.00 148.46 ? 312 GLU A OE2   1 
ATOM   2322 N N     . PRO A 1 313 ? 69.961  31.108 29.912  1.00 138.74 ? 313 PRO A N     1 
ATOM   2323 C CA    . PRO A 1 313 ? 69.007  30.134 29.381  1.00 138.71 ? 313 PRO A CA    1 
ATOM   2324 C C     . PRO A 1 313 ? 68.231  29.423 30.488  1.00 141.14 ? 313 PRO A C     1 
ATOM   2325 O O     . PRO A 1 313 ? 68.826  28.959 31.465  1.00 144.50 ? 313 PRO A O     1 
ATOM   2326 C CB    . PRO A 1 313 ? 69.899  29.130 28.628  1.00 143.09 ? 313 PRO A CB    1 
ATOM   2327 C CG    . PRO A 1 313 ? 71.263  29.740 28.579  1.00 149.60 ? 313 PRO A CG    1 
ATOM   2328 C CD    . PRO A 1 313 ? 71.347  30.632 29.777  1.00 147.16 ? 313 PRO A CD    1 
ATOM   2329 N N     . VAL A 1 314 ? 66.911  29.349 30.328  1.00 140.19 ? 314 VAL A N     1 
ATOM   2330 C CA    . VAL A 1 314 ? 66.035  28.673 31.291  1.00 144.74 ? 314 VAL A CA    1 
ATOM   2331 C C     . VAL A 1 314 ? 65.130  27.646 30.608  1.00 150.22 ? 314 VAL A C     1 
ATOM   2332 O O     . VAL A 1 314 ? 64.796  27.786 29.428  1.00 149.50 ? 314 VAL A O     1 
ATOM   2333 C CB    . VAL A 1 314 ? 65.175  29.670 32.110  1.00 137.62 ? 314 VAL A CB    1 
ATOM   2334 C CG1   . VAL A 1 314 ? 66.025  30.391 33.148  1.00 144.86 ? 314 VAL A CG1   1 
ATOM   2335 C CG2   . VAL A 1 314 ? 64.460  30.664 31.201  1.00 135.66 ? 314 VAL A CG2   1 
ATOM   2336 N N     . HIS A 1 315 ? 64.741  26.618 31.360  1.00 150.93 ? 315 HIS A N     1 
ATOM   2337 C CA    . HIS A 1 315 ? 63.891  25.548 30.840  1.00 148.11 ? 315 HIS A CA    1 
ATOM   2338 C C     . HIS A 1 315 ? 62.661  25.336 31.678  1.00 144.20 ? 315 HIS A C     1 
ATOM   2339 O O     . HIS A 1 315 ? 62.688  25.519 32.898  1.00 141.38 ? 315 HIS A O     1 
ATOM   2340 C CB    . HIS A 1 315 ? 64.681  24.247 30.715  1.00 151.09 ? 315 HIS A CB    1 
ATOM   2341 C CG    . HIS A 1 315 ? 65.247  23.746 32.024  1.00 163.80 ? 315 HIS A CG    1 
ATOM   2342 N ND1   . HIS A 1 315 ? 66.449  24.133 32.488  1.00 167.21 ? 315 HIS A ND1   1 
ATOM   2343 C CD2   . HIS A 1 315 ? 64.728  22.861 32.968  1.00 165.59 ? 315 HIS A CD2   1 
ATOM   2344 C CE1   . HIS A 1 315 ? 66.690  23.529 33.667  1.00 164.80 ? 315 HIS A CE1   1 
ATOM   2345 N NE2   . HIS A 1 315 ? 65.635  22.751 33.960  1.00 169.30 ? 315 HIS A NE2   1 
ATOM   2346 N N     . GLY A 1 316 ? 61.571  24.944 31.022  1.00 136.70 ? 316 GLY A N     1 
ATOM   2347 C CA    . GLY A 1 316 ? 60.306  24.663 31.695  1.00 139.45 ? 316 GLY A CA    1 
ATOM   2348 C C     . GLY A 1 316 ? 60.134  23.194 32.039  1.00 146.53 ? 316 GLY A C     1 
ATOM   2349 O O     . GLY A 1 316 ? 60.838  22.334 31.504  1.00 148.05 ? 316 GLY A O     1 
ATOM   2350 N N     . VAL A 1 317 ? 59.191  22.913 32.936  1.00 155.29 ? 317 VAL A N     1 
ATOM   2351 C CA    . VAL A 1 317 ? 58.935  21.551 33.410  1.00 159.67 ? 317 VAL A CA    1 
ATOM   2352 C C     . VAL A 1 317 ? 57.563  21.066 32.935  1.00 154.54 ? 317 VAL A C     1 
ATOM   2353 O O     . VAL A 1 317 ? 56.620  21.854 32.827  1.00 154.97 ? 317 VAL A O     1 
ATOM   2354 C CB    . VAL A 1 317 ? 59.023  21.458 34.953  1.00 162.17 ? 317 VAL A CB    1 
ATOM   2355 C CG1   . VAL A 1 317 ? 59.109  20.007 35.408  1.00 171.87 ? 317 VAL A CG1   1 
ATOM   2356 C CG2   . VAL A 1 317 ? 60.224  22.234 35.475  1.00 147.07 ? 317 VAL A CG2   1 
ATOM   2357 N N     . TYR A 1 318 ? 57.466  19.769 32.649  1.00 149.90 ? 318 TYR A N     1 
ATOM   2358 C CA    . TYR A 1 318 ? 56.214  19.150 32.217  1.00 149.29 ? 318 TYR A CA    1 
ATOM   2359 C C     . TYR A 1 318 ? 55.249  18.921 33.382  1.00 149.79 ? 318 TYR A C     1 
ATOM   2360 O O     . TYR A 1 318 ? 55.665  18.848 34.541  1.00 146.92 ? 318 TYR A O     1 
ATOM   2361 C CB    . TYR A 1 318 ? 56.492  17.834 31.483  1.00 150.77 ? 318 TYR A CB    1 
ATOM   2362 C CG    . TYR A 1 318 ? 57.116  18.015 30.117  1.00 146.84 ? 318 TYR A CG    1 
ATOM   2363 C CD1   . TYR A 1 318 ? 56.322  18.219 28.988  1.00 150.06 ? 318 TYR A CD1   1 
ATOM   2364 C CD2   . TYR A 1 318 ? 58.500  17.981 29.950  1.00 146.10 ? 318 TYR A CD2   1 
ATOM   2365 C CE1   . TYR A 1 318 ? 56.889  18.386 27.734  1.00 155.60 ? 318 TYR A CE1   1 
ATOM   2366 C CE2   . TYR A 1 318 ? 59.076  18.146 28.700  1.00 147.69 ? 318 TYR A CE2   1 
ATOM   2367 C CZ    . TYR A 1 318 ? 58.267  18.349 27.596  1.00 151.49 ? 318 TYR A CZ    1 
ATOM   2368 O OH    . TYR A 1 318 ? 58.835  18.514 26.354  1.00 152.46 ? 318 TYR A OH    1 
ATOM   2369 N N     . TYR A 1 319 ? 53.962  18.808 33.057  1.00 148.98 ? 319 TYR A N     1 
ATOM   2370 C CA    . TYR A 1 319 ? 52.904  18.626 34.051  1.00 148.58 ? 319 TYR A CA    1 
ATOM   2371 C C     . TYR A 1 319 ? 52.890  17.217 34.644  1.00 149.07 ? 319 TYR A C     1 
ATOM   2372 O O     . TYR A 1 319 ? 53.037  16.226 33.924  1.00 140.65 ? 319 TYR A O     1 
ATOM   2373 C CB    . TYR A 1 319 ? 51.536  18.971 33.440  1.00 143.66 ? 319 TYR A CB    1 
ATOM   2374 C CG    . TYR A 1 319 ? 50.337  18.502 34.243  1.00 152.23 ? 319 TYR A CG    1 
ATOM   2375 C CD1   . TYR A 1 319 ? 49.989  19.120 35.446  1.00 151.44 ? 319 TYR A CD1   1 
ATOM   2376 C CD2   . TYR A 1 319 ? 49.545  17.445 33.793  1.00 157.82 ? 319 TYR A CD2   1 
ATOM   2377 C CE1   . TYR A 1 319 ? 48.892  18.693 36.179  1.00 148.13 ? 319 TYR A CE1   1 
ATOM   2378 C CE2   . TYR A 1 319 ? 48.446  17.012 34.520  1.00 161.44 ? 319 TYR A CE2   1 
ATOM   2379 C CZ    . TYR A 1 319 ? 48.124  17.639 35.711  1.00 153.85 ? 319 TYR A CZ    1 
ATOM   2380 O OH    . TYR A 1 319 ? 47.034  17.211 36.434  1.00 150.47 ? 319 TYR A OH    1 
ATOM   2381 N N     . ASP A 1 320 ? 52.714  17.147 35.962  1.00 151.24 ? 320 ASP A N     1 
ATOM   2382 C CA    . ASP A 1 320 ? 52.586  15.880 36.675  1.00 145.65 ? 320 ASP A CA    1 
ATOM   2383 C C     . ASP A 1 320 ? 51.219  15.815 37.364  1.00 146.26 ? 320 ASP A C     1 
ATOM   2384 O O     . ASP A 1 320 ? 50.879  16.705 38.147  1.00 142.91 ? 320 ASP A O     1 
ATOM   2385 C CB    . ASP A 1 320 ? 53.718  15.723 37.697  1.00 147.25 ? 320 ASP A CB    1 
ATOM   2386 C CG    . ASP A 1 320 ? 53.980  14.272 38.068  1.00 146.10 ? 320 ASP A CG    1 
ATOM   2387 O OD1   . ASP A 1 320 ? 53.063  13.603 38.591  1.00 148.75 ? 320 ASP A OD1   1 
ATOM   2388 O OD2   . ASP A 1 320 ? 55.116  13.802 37.848  1.00 145.99 ? 320 ASP A OD2   1 
ATOM   2389 N N     . PRO A 1 321 ? 50.429  14.764 37.065  1.00 149.56 ? 321 PRO A N     1 
ATOM   2390 C CA    . PRO A 1 321 ? 49.065  14.612 37.591  1.00 153.60 ? 321 PRO A CA    1 
ATOM   2391 C C     . PRO A 1 321 ? 48.990  14.403 39.106  1.00 156.65 ? 321 PRO A C     1 
ATOM   2392 O O     . PRO A 1 321 ? 47.985  14.764 39.723  1.00 163.73 ? 321 PRO A O     1 
ATOM   2393 C CB    . PRO A 1 321 ? 48.542  13.364 36.865  1.00 151.57 ? 321 PRO A CB    1 
ATOM   2394 C CG    . PRO A 1 321 ? 49.423  13.203 35.673  1.00 146.44 ? 321 PRO A CG    1 
ATOM   2395 C CD    . PRO A 1 321 ? 50.768  13.679 36.126  1.00 148.71 ? 321 PRO A CD    1 
ATOM   2396 N N     . SER A 1 322 ? 50.039  13.827 39.691  1.00 151.81 ? 322 SER A N     1 
ATOM   2397 C CA    . SER A 1 322 ? 50.061  13.517 41.122  1.00 149.79 ? 322 SER A CA    1 
ATOM   2398 C C     . SER A 1 322 ? 50.280  14.746 42.004  1.00 151.13 ? 322 SER A C     1 
ATOM   2399 O O     . SER A 1 322 ? 49.694  14.852 43.084  1.00 163.87 ? 322 SER A O     1 
ATOM   2400 C CB    . SER A 1 322 ? 51.114  12.447 41.428  1.00 143.72 ? 322 SER A CB    1 
ATOM   2401 O OG    . SER A 1 322 ? 52.413  12.887 41.074  1.00 145.88 ? 322 SER A OG    1 
ATOM   2402 N N     . LYS A 1 323 ? 51.123  15.668 41.540  1.00 143.49 ? 323 LYS A N     1 
ATOM   2403 C CA    . LYS A 1 323 ? 51.423  16.896 42.278  1.00 138.33 ? 323 LYS A CA    1 
ATOM   2404 C C     . LYS A 1 323 ? 50.448  18.024 41.944  1.00 140.07 ? 323 LYS A C     1 
ATOM   2405 O O     . LYS A 1 323 ? 49.971  18.130 40.811  1.00 133.91 ? 323 LYS A O     1 
ATOM   2406 C CB    . LYS A 1 323 ? 52.865  17.352 42.020  1.00 148.45 ? 323 LYS A CB    1 
ATOM   2407 C CG    . LYS A 1 323 ? 53.919  16.651 42.870  1.00 156.15 ? 323 LYS A CG    1 
ATOM   2408 C CD    . LYS A 1 323 ? 54.417  15.351 42.247  1.00 154.41 ? 323 LYS A CD    1 
ATOM   2409 C CE    . LYS A 1 323 ? 55.442  15.593 41.146  1.00 155.67 ? 323 LYS A CE    1 
ATOM   2410 N NZ    . LYS A 1 323 ? 56.737  16.111 41.672  1.00 144.77 ? 323 LYS A NZ    1 
ATOM   2411 N N     . ASP A 1 324 ? 50.163  18.860 42.940  1.00 143.49 ? 324 ASP A N     1 
ATOM   2412 C CA    . ASP A 1 324 ? 49.256  19.997 42.780  1.00 145.45 ? 324 ASP A CA    1 
ATOM   2413 C C     . ASP A 1 324 ? 49.988  21.237 42.268  1.00 151.38 ? 324 ASP A C     1 
ATOM   2414 O O     . ASP A 1 324 ? 51.187  21.404 42.505  1.00 158.66 ? 324 ASP A O     1 
ATOM   2415 C CB    . ASP A 1 324 ? 48.547  20.310 44.103  1.00 137.16 ? 324 ASP A CB    1 
ATOM   2416 C CG    . ASP A 1 324 ? 47.622  19.191 44.555  1.00 136.26 ? 324 ASP A CG    1 
ATOM   2417 O OD1   . ASP A 1 324 ? 46.827  18.691 43.728  1.00 142.15 ? 324 ASP A OD1   1 
ATOM   2418 O OD2   . ASP A 1 324 ? 47.682  18.817 45.745  1.00 128.82 ? 324 ASP A OD2   1 
ATOM   2419 N N     . LEU A 1 325 ? 49.254  22.101 41.569  1.00 145.71 ? 325 LEU A N     1 
ATOM   2420 C CA    . LEU A 1 325 ? 49.816  23.320 40.988  1.00 143.35 ? 325 LEU A CA    1 
ATOM   2421 C C     . LEU A 1 325 ? 49.779  24.478 41.985  1.00 143.38 ? 325 LEU A C     1 
ATOM   2422 O O     . LEU A 1 325 ? 48.762  24.705 42.647  1.00 134.68 ? 325 LEU A O     1 
ATOM   2423 C CB    . LEU A 1 325 ? 49.066  23.707 39.707  1.00 132.26 ? 325 LEU A CB    1 
ATOM   2424 C CG    . LEU A 1 325 ? 48.779  22.644 38.638  1.00 132.40 ? 325 LEU A CG    1 
ATOM   2425 C CD1   . LEU A 1 325 ? 47.706  23.135 37.678  1.00 130.19 ? 325 LEU A CD1   1 
ATOM   2426 C CD2   . LEU A 1 325 ? 50.036  22.240 37.878  1.00 137.74 ? 325 LEU A CD2   1 
ATOM   2427 N N     . ILE A 1 326 ? 50.892  25.201 42.086  1.00 148.93 ? 326 ILE A N     1 
ATOM   2428 C CA    . ILE A 1 326 ? 51.012  26.340 43.001  1.00 150.80 ? 326 ILE A CA    1 
ATOM   2429 C C     . ILE A 1 326 ? 51.334  27.621 42.228  1.00 146.30 ? 326 ILE A C     1 
ATOM   2430 O O     . ILE A 1 326 ? 52.283  27.660 41.440  1.00 146.14 ? 326 ILE A O     1 
ATOM   2431 C CB    . ILE A 1 326 ? 52.081  26.090 44.095  1.00 152.72 ? 326 ILE A CB    1 
ATOM   2432 C CG1   . ILE A 1 326 ? 51.774  24.803 44.873  1.00 148.45 ? 326 ILE A CG1   1 
ATOM   2433 C CG2   . ILE A 1 326 ? 52.173  27.278 45.046  1.00 154.10 ? 326 ILE A CG2   1 
ATOM   2434 C CD1   . ILE A 1 326 ? 52.967  24.205 45.591  1.00 144.61 ? 326 ILE A CD1   1 
ATOM   2435 N N     . ALA A 1 327 ? 50.534  28.661 42.459  1.00 144.35 ? 327 ALA A N     1 
ATOM   2436 C CA    . ALA A 1 327 ? 50.725  29.961 41.815  1.00 142.81 ? 327 ALA A CA    1 
ATOM   2437 C C     . ALA A 1 327 ? 50.938  31.071 42.843  1.00 146.34 ? 327 ALA A C     1 
ATOM   2438 O O     . ALA A 1 327 ? 50.354  31.043 43.928  1.00 152.46 ? 327 ALA A O     1 
ATOM   2439 C CB    . ALA A 1 327 ? 49.541  30.285 40.916  1.00 149.76 ? 327 ALA A CB    1 
ATOM   2440 N N     . GLU A 1 328 ? 51.775  32.046 42.490  1.00 144.40 ? 328 GLU A N     1 
ATOM   2441 C CA    . GLU A 1 328 ? 52.090  33.168 43.374  1.00 148.01 ? 328 GLU A CA    1 
ATOM   2442 C C     . GLU A 1 328 ? 52.052  34.497 42.617  1.00 147.40 ? 328 GLU A C     1 
ATOM   2443 O O     . GLU A 1 328 ? 52.503  34.581 41.473  1.00 142.88 ? 328 GLU A O     1 
ATOM   2444 C CB    . GLU A 1 328 ? 53.460  32.961 44.028  1.00 150.75 ? 328 GLU A CB    1 
ATOM   2445 C CG    . GLU A 1 328 ? 53.678  33.762 45.305  1.00 155.79 ? 328 GLU A CG    1 
ATOM   2446 C CD    . GLU A 1 328 ? 55.035  33.510 45.942  1.00 157.25 ? 328 GLU A CD    1 
ATOM   2447 O OE1   . GLU A 1 328 ? 56.032  33.348 45.204  1.00 154.02 ? 328 GLU A OE1   1 
ATOM   2448 O OE2   . GLU A 1 328 ? 55.105  33.475 47.188  1.00 156.63 ? 328 GLU A OE2   1 
ATOM   2449 N N     . ILE A 1 329 ? 51.517  35.528 43.269  1.00 149.86 ? 329 ILE A N     1 
ATOM   2450 C CA    . ILE A 1 329 ? 51.345  36.847 42.653  1.00 151.91 ? 329 ILE A CA    1 
ATOM   2451 C C     . ILE A 1 329 ? 52.411  37.832 43.141  1.00 148.99 ? 329 ILE A C     1 
ATOM   2452 O O     . ILE A 1 329 ? 52.667  37.940 44.343  1.00 146.19 ? 329 ILE A O     1 
ATOM   2453 C CB    . ILE A 1 329 ? 49.931  37.428 42.925  1.00 156.27 ? 329 ILE A CB    1 
ATOM   2454 C CG1   . ILE A 1 329 ? 48.832  36.370 42.703  1.00 157.21 ? 329 ILE A CG1   1 
ATOM   2455 C CG2   . ILE A 1 329 ? 49.680  38.687 42.099  1.00 150.87 ? 329 ILE A CG2   1 
ATOM   2456 C CD1   . ILE A 1 329 ? 48.686  35.865 41.279  1.00 158.23 ? 329 ILE A CD1   1 
ATOM   2457 N N     . GLN A 1 330 ? 53.028  38.541 42.196  1.00 147.25 ? 330 GLN A N     1 
ATOM   2458 C CA    . GLN A 1 330 ? 54.042  39.552 42.502  1.00 146.47 ? 330 GLN A CA    1 
ATOM   2459 C C     . GLN A 1 330 ? 53.720  40.889 41.837  1.00 141.71 ? 330 GLN A C     1 
ATOM   2460 O O     . GLN A 1 330 ? 53.081  40.930 40.783  1.00 136.82 ? 330 GLN A O     1 
ATOM   2461 C CB    . GLN A 1 330 ? 55.435  39.084 42.063  1.00 149.14 ? 330 GLN A CB    1 
ATOM   2462 C CG    . GLN A 1 330 ? 56.038  37.966 42.904  1.00 151.06 ? 330 GLN A CG    1 
ATOM   2463 C CD    . GLN A 1 330 ? 55.575  36.579 42.488  1.00 148.84 ? 330 GLN A CD    1 
ATOM   2464 O OE1   . GLN A 1 330 ? 55.596  35.645 43.289  1.00 151.31 ? 330 GLN A OE1   1 
ATOM   2465 N NE2   . GLN A 1 330 ? 55.160  36.436 41.232  1.00 148.06 ? 330 GLN A NE2   1 
ATOM   2466 N N     . LYS A 1 331 ? 54.170  41.975 42.462  1.00 147.71 ? 331 LYS A N     1 
ATOM   2467 C CA    . LYS A 1 331 ? 54.012  43.316 41.905  1.00 148.08 ? 331 LYS A CA    1 
ATOM   2468 C C     . LYS A 1 331 ? 55.374  43.896 41.526  1.00 153.43 ? 331 LYS A C     1 
ATOM   2469 O O     . LYS A 1 331 ? 56.281  43.972 42.358  1.00 147.06 ? 331 LYS A O     1 
ATOM   2470 C CB    . LYS A 1 331 ? 53.285  44.234 42.894  1.00 147.92 ? 331 LYS A CB    1 
ATOM   2471 C CG    . LYS A 1 331 ? 52.741  45.513 42.276  1.00 141.40 ? 331 LYS A CG    1 
ATOM   2472 C CD    . LYS A 1 331 ? 51.938  46.320 43.285  1.00 144.57 ? 331 LYS A CD    1 
ATOM   2473 C CE    . LYS A 1 331 ? 51.349  47.576 42.659  1.00 144.50 ? 331 LYS A CE    1 
ATOM   2474 N NZ    . LYS A 1 331 ? 50.270  47.278 41.676  1.00 150.63 ? 331 LYS A NZ    1 
ATOM   2475 N N     . GLN A 1 332 ? 55.504  44.297 40.263  1.00 158.73 ? 332 GLN A N     1 
ATOM   2476 C CA    . GLN A 1 332 ? 56.763  44.823 39.730  1.00 163.16 ? 332 GLN A CA    1 
ATOM   2477 C C     . GLN A 1 332 ? 56.667  46.294 39.316  1.00 160.73 ? 332 GLN A C     1 
ATOM   2478 O O     . GLN A 1 332 ? 57.687  46.967 39.154  1.00 160.00 ? 332 GLN A O     1 
ATOM   2479 C CB    . GLN A 1 332 ? 57.250  43.967 38.552  1.00 160.70 ? 332 GLN A CB    1 
ATOM   2480 C CG    . GLN A 1 332 ? 56.238  43.802 37.424  1.00 156.20 ? 332 GLN A CG    1 
ATOM   2481 C CD    . GLN A 1 332 ? 56.775  43.015 36.241  1.00 149.02 ? 332 GLN A CD    1 
ATOM   2482 O OE1   . GLN A 1 332 ? 56.303  43.176 35.116  1.00 147.42 ? 332 GLN A OE1   1 
ATOM   2483 N NE2   . GLN A 1 332 ? 57.761  42.156 36.487  1.00 141.40 ? 332 GLN A NE2   1 
ATOM   2484 N N     . GLY A 1 333 ? 55.439  46.779 39.143  1.00 155.79 ? 333 GLY A N     1 
ATOM   2485 C CA    . GLY A 1 333 ? 55.195  48.166 38.755  1.00 152.93 ? 333 GLY A CA    1 
ATOM   2486 C C     . GLY A 1 333 ? 53.779  48.624 39.048  1.00 151.18 ? 333 GLY A C     1 
ATOM   2487 O O     . GLY A 1 333 ? 52.991  47.893 39.653  1.00 145.88 ? 333 GLY A O     1 
ATOM   2488 N N     . GLN A 1 334 ? 53.460  49.842 38.615  1.00 153.42 ? 334 GLN A N     1 
ATOM   2489 C CA    . GLN A 1 334 ? 52.129  50.417 38.815  1.00 150.41 ? 334 GLN A CA    1 
ATOM   2490 C C     . GLN A 1 334 ? 51.115  49.876 37.804  1.00 150.48 ? 334 GLN A C     1 
ATOM   2491 O O     . GLN A 1 334 ? 51.243  50.095 36.596  1.00 150.26 ? 334 GLN A O     1 
ATOM   2492 C CB    . GLN A 1 334 ? 52.177  51.954 38.796  1.00 153.72 ? 334 GLN A CB    1 
ATOM   2493 C CG    . GLN A 1 334 ? 52.965  52.568 37.643  1.00 155.16 ? 334 GLN A CG    1 
ATOM   2494 C CD    . GLN A 1 334 ? 53.017  54.085 37.700  1.00 149.19 ? 334 GLN A CD    1 
ATOM   2495 O OE1   . GLN A 1 334 ? 54.095  54.679 37.679  1.00 140.46 ? 334 GLN A OE1   1 
ATOM   2496 N NE2   . GLN A 1 334 ? 51.851  54.720 37.774  1.00 151.32 ? 334 GLN A NE2   1 
ATOM   2497 N N     . GLY A 1 335 ? 50.117  49.158 38.315  1.00 148.48 ? 335 GLY A N     1 
ATOM   2498 C CA    . GLY A 1 335 ? 49.071  48.559 37.486  1.00 147.88 ? 335 GLY A CA    1 
ATOM   2499 C C     . GLY A 1 335 ? 49.549  47.398 36.633  1.00 147.82 ? 335 GLY A C     1 
ATOM   2500 O O     . GLY A 1 335 ? 49.025  47.166 35.541  1.00 148.67 ? 335 GLY A O     1 
ATOM   2501 N N     . GLN A 1 336 ? 50.545  46.669 37.134  1.00 148.07 ? 336 GLN A N     1 
ATOM   2502 C CA    . GLN A 1 336 ? 51.110  45.522 36.425  1.00 145.35 ? 336 GLN A CA    1 
ATOM   2503 C C     . GLN A 1 336 ? 51.356  44.361 37.387  1.00 141.13 ? 336 GLN A C     1 
ATOM   2504 O O     . GLN A 1 336 ? 51.954  44.540 38.451  1.00 133.38 ? 336 GLN A O     1 
ATOM   2505 C CB    . GLN A 1 336 ? 52.407  45.917 35.712  1.00 146.63 ? 336 GLN A CB    1 
ATOM   2506 C CG    . GLN A 1 336 ? 52.904  44.899 34.694  1.00 154.02 ? 336 GLN A CG    1 
ATOM   2507 C CD    . GLN A 1 336 ? 54.154  45.353 33.959  1.00 144.51 ? 336 GLN A CD    1 
ATOM   2508 O OE1   . GLN A 1 336 ? 54.198  45.344 32.729  1.00 143.54 ? 336 GLN A OE1   1 
ATOM   2509 N NE2   . GLN A 1 336 ? 55.177  45.752 34.709  1.00 138.71 ? 336 GLN A NE2   1 
ATOM   2510 N N     . TRP A 1 337 ? 50.888  43.176 37.001  1.00 145.61 ? 337 TRP A N     1 
ATOM   2511 C CA    . TRP A 1 337 ? 51.017  41.977 37.830  1.00 142.49 ? 337 TRP A CA    1 
ATOM   2512 C C     . TRP A 1 337 ? 51.617  40.834 37.063  1.00 135.89 ? 337 TRP A C     1 
ATOM   2513 O O     . TRP A 1 337 ? 51.258  40.593 35.907  1.00 131.79 ? 337 TRP A O     1 
ATOM   2514 C CB    . TRP A 1 337 ? 49.661  41.568 38.397  1.00 146.61 ? 337 TRP A CB    1 
ATOM   2515 C CG    . TRP A 1 337 ? 48.978  42.655 39.195  1.00 155.60 ? 337 TRP A CG    1 
ATOM   2516 C CD1   . TRP A 1 337 ? 48.058  43.594 38.735  1.00 155.69 ? 337 TRP A CD1   1 
ATOM   2517 C CD2   . TRP A 1 337 ? 49.142  42.952 40.626  1.00 156.85 ? 337 TRP A CD2   1 
ATOM   2518 N NE1   . TRP A 1 337 ? 47.655  44.424 39.751  1.00 152.80 ? 337 TRP A NE1   1 
ATOM   2519 C CE2   . TRP A 1 337 ? 48.264  44.095 40.910  1.00 153.57 ? 337 TRP A CE2   1 
ATOM   2520 C CE3   . TRP A 1 337 ? 49.897  42.408 41.660  1.00 154.62 ? 337 TRP A CE3   1 
ATOM   2521 C CZ2   . TRP A 1 337 ? 48.165  44.649 42.179  1.00 151.33 ? 337 TRP A CZ2   1 
ATOM   2522 C CZ3   . TRP A 1 337 ? 49.788  42.976 42.936  1.00 153.85 ? 337 TRP A CZ3   1 
ATOM   2523 C CH2   . TRP A 1 337 ? 48.942  44.070 43.186  1.00 151.23 ? 337 TRP A CH2   1 
ATOM   2524 N N     . THR A 1 338 ? 52.540  40.122 37.705  1.00 135.47 ? 338 THR A N     1 
ATOM   2525 C CA    . THR A 1 338 ? 53.176  38.943 37.113  1.00 144.94 ? 338 THR A CA    1 
ATOM   2526 C C     . THR A 1 338 ? 53.040  37.727 38.026  1.00 145.87 ? 338 THR A C     1 
ATOM   2527 O O     . THR A 1 338 ? 53.193  37.834 39.246  1.00 146.76 ? 338 THR A O     1 
ATOM   2528 C CB    . THR A 1 338 ? 54.668  39.183 36.798  1.00 145.13 ? 338 THR A CB    1 
ATOM   2529 O OG1   . THR A 1 338 ? 55.303  39.822 37.913  1.00 145.90 ? 338 THR A OG1   1 
ATOM   2530 C CG2   . THR A 1 338 ? 54.825  40.054 35.558  1.00 143.58 ? 338 THR A CG2   1 
ATOM   2531 N N     . TYR A 1 339 ? 52.753  36.576 37.423  1.00 146.90 ? 339 TYR A N     1 
ATOM   2532 C CA    . TYR A 1 339 ? 52.557  35.333 38.167  1.00 140.20 ? 339 TYR A CA    1 
ATOM   2533 C C     . TYR A 1 339 ? 53.330  34.163 37.561  1.00 138.59 ? 339 TYR A C     1 
ATOM   2534 O O     . TYR A 1 339 ? 53.586  34.135 36.354  1.00 134.24 ? 339 TYR A O     1 
ATOM   2535 C CB    . TYR A 1 339 ? 51.063  34.990 38.270  1.00 146.20 ? 339 TYR A CB    1 
ATOM   2536 C CG    . TYR A 1 339 ? 50.350  34.830 36.940  1.00 150.66 ? 339 TYR A CG    1 
ATOM   2537 C CD1   . TYR A 1 339 ? 50.314  33.596 36.287  1.00 152.76 ? 339 TYR A CD1   1 
ATOM   2538 C CD2   . TYR A 1 339 ? 49.700  35.910 36.341  1.00 154.68 ? 339 TYR A CD2   1 
ATOM   2539 C CE1   . TYR A 1 339 ? 49.661  33.446 35.072  1.00 150.39 ? 339 TYR A CE1   1 
ATOM   2540 C CE2   . TYR A 1 339 ? 49.043  35.769 35.128  1.00 154.53 ? 339 TYR A CE2   1 
ATOM   2541 C CZ    . TYR A 1 339 ? 49.026  34.534 34.499  1.00 148.93 ? 339 TYR A CZ    1 
ATOM   2542 O OH    . TYR A 1 339 ? 48.376  34.389 33.294  1.00 154.43 ? 339 TYR A OH    1 
ATOM   2543 N N     . GLN A 1 340 ? 53.698  33.205 38.409  1.00 139.96 ? 340 GLN A N     1 
ATOM   2544 C CA    . GLN A 1 340 ? 54.344  31.971 37.961  1.00 145.56 ? 340 GLN A CA    1 
ATOM   2545 C C     . GLN A 1 340 ? 53.673  30.734 38.556  1.00 147.01 ? 340 GLN A C     1 
ATOM   2546 O O     . GLN A 1 340 ? 53.358  30.696 39.749  1.00 143.40 ? 340 GLN A O     1 
ATOM   2547 C CB    . GLN A 1 340 ? 55.854  31.979 38.260  1.00 149.25 ? 340 GLN A CB    1 
ATOM   2548 C CG    . GLN A 1 340 ? 56.247  32.096 39.730  1.00 149.86 ? 340 GLN A CG    1 
ATOM   2549 C CD    . GLN A 1 340 ? 56.362  33.532 40.215  1.00 144.94 ? 340 GLN A CD    1 
ATOM   2550 O OE1   . GLN A 1 340 ? 56.087  34.481 39.479  1.00 142.12 ? 340 GLN A OE1   1 
ATOM   2551 N NE2   . GLN A 1 340 ? 56.775  33.695 41.467  1.00 146.82 ? 340 GLN A NE2   1 
ATOM   2552 N N     . ILE A 1 341 ? 53.449  29.733 37.709  1.00 140.26 ? 341 ILE A N     1 
ATOM   2553 C CA    . ILE A 1 341 ? 52.849  28.468 38.131  1.00 134.84 ? 341 ILE A CA    1 
ATOM   2554 C C     . ILE A 1 341 ? 53.939  27.403 38.229  1.00 141.42 ? 341 ILE A C     1 
ATOM   2555 O O     . ILE A 1 341 ? 54.704  27.199 37.284  1.00 145.90 ? 341 ILE A O     1 
ATOM   2556 C CB    . ILE A 1 341 ? 51.729  28.013 37.165  1.00 133.93 ? 341 ILE A CB    1 
ATOM   2557 C CG1   . ILE A 1 341 ? 50.698  29.133 36.971  1.00 144.75 ? 341 ILE A CG1   1 
ATOM   2558 C CG2   . ILE A 1 341 ? 51.053  26.745 37.678  1.00 154.03 ? 341 ILE A CG2   1 
ATOM   2559 C CD1   . ILE A 1 341 ? 49.865  29.010 35.711  1.00 156.89 ? 341 ILE A CD1   1 
ATOM   2560 N N     . TYR A 1 342 ? 54.011  26.739 39.382  1.00 141.23 ? 342 TYR A N     1 
ATOM   2561 C CA    . TYR A 1 342 ? 55.031  25.720 39.632  1.00 141.52 ? 342 TYR A CA    1 
ATOM   2562 C C     . TYR A 1 342 ? 54.542  24.620 40.572  1.00 137.45 ? 342 TYR A C     1 
ATOM   2563 O O     . TYR A 1 342 ? 53.769  24.878 41.497  1.00 138.62 ? 342 TYR A O     1 
ATOM   2564 C CB    . TYR A 1 342 ? 56.320  26.358 40.177  1.00 149.08 ? 342 TYR A CB    1 
ATOM   2565 C CG    . TYR A 1 342 ? 56.150  27.159 41.454  1.00 152.38 ? 342 TYR A CG    1 
ATOM   2566 C CD1   . TYR A 1 342 ? 55.817  28.514 41.412  1.00 156.50 ? 342 TYR A CD1   1 
ATOM   2567 C CD2   . TYR A 1 342 ? 56.337  26.566 42.704  1.00 149.30 ? 342 TYR A CD2   1 
ATOM   2568 C CE1   . TYR A 1 342 ? 55.665  29.251 42.577  1.00 152.90 ? 342 TYR A CE1   1 
ATOM   2569 C CE2   . TYR A 1 342 ? 56.187  27.296 43.873  1.00 145.09 ? 342 TYR A CE2   1 
ATOM   2570 C CZ    . TYR A 1 342 ? 55.851  28.638 43.803  1.00 148.08 ? 342 TYR A CZ    1 
ATOM   2571 O OH    . TYR A 1 342 ? 55.701  29.367 44.961  1.00 137.64 ? 342 TYR A OH    1 
ATOM   2572 N N     . GLN A 1 343 ? 54.996  23.394 40.321  1.00 139.64 ? 343 GLN A N     1 
ATOM   2573 C CA    . GLN A 1 343 ? 54.694  22.253 41.185  1.00 146.55 ? 343 GLN A CA    1 
ATOM   2574 C C     . GLN A 1 343 ? 55.798  22.061 42.223  1.00 152.85 ? 343 GLN A C     1 
ATOM   2575 O O     . GLN A 1 343 ? 55.522  21.786 43.393  1.00 146.53 ? 343 GLN A O     1 
ATOM   2576 C CB    . GLN A 1 343 ? 54.515  20.976 40.359  1.00 152.12 ? 343 GLN A CB    1 
ATOM   2577 C CG    . GLN A 1 343 ? 53.257  20.953 39.502  1.00 153.62 ? 343 GLN A CG    1 
ATOM   2578 C CD    . GLN A 1 343 ? 53.127  19.691 38.666  1.00 156.32 ? 343 GLN A CD    1 
ATOM   2579 O OE1   . GLN A 1 343 ? 54.122  19.094 38.251  1.00 153.69 ? 343 GLN A OE1   1 
ATOM   2580 N NE2   . GLN A 1 343 ? 51.890  19.284 38.406  1.00 155.21 ? 343 GLN A NE2   1 
ATOM   2581 N N     . GLU A 1 344 ? 57.044  22.211 41.779  1.00 161.99 ? 344 GLU A N     1 
ATOM   2582 C CA    . GLU A 1 344 ? 58.215  22.110 42.647  1.00 159.93 ? 344 GLU A CA    1 
ATOM   2583 C C     . GLU A 1 344 ? 58.895  23.477 42.779  1.00 157.71 ? 344 GLU A C     1 
ATOM   2584 O O     . GLU A 1 344 ? 58.814  24.294 41.858  1.00 155.92 ? 344 GLU A O     1 
ATOM   2585 C CB    . GLU A 1 344 ? 59.202  21.074 42.096  1.00 147.82 ? 344 GLU A CB    1 
ATOM   2586 C CG    . GLU A 1 344 ? 58.704  19.634 42.134  1.00 139.45 ? 344 GLU A CG    1 
ATOM   2587 C CD    . GLU A 1 344 ? 58.586  19.074 43.543  1.00 143.76 ? 344 GLU A CD    1 
ATOM   2588 O OE1   . GLU A 1 344 ? 59.501  19.303 44.364  1.00 151.95 ? 344 GLU A OE1   1 
ATOM   2589 O OE2   . GLU A 1 344 ? 57.578  18.394 43.827  1.00 136.52 ? 344 GLU A OE2   1 
ATOM   2590 N N     . PRO A 1 345 ? 59.560  23.734 43.926  1.00 150.93 ? 345 PRO A N     1 
ATOM   2591 C CA    . PRO A 1 345 ? 60.272  25.002 44.130  1.00 143.43 ? 345 PRO A CA    1 
ATOM   2592 C C     . PRO A 1 345 ? 61.403  25.218 43.123  1.00 144.29 ? 345 PRO A C     1 
ATOM   2593 O O     . PRO A 1 345 ? 62.035  24.252 42.685  1.00 138.93 ? 345 PRO A O     1 
ATOM   2594 C CB    . PRO A 1 345 ? 60.842  24.867 45.550  1.00 142.70 ? 345 PRO A CB    1 
ATOM   2595 C CG    . PRO A 1 345 ? 60.829  23.404 45.842  1.00 147.38 ? 345 PRO A CG    1 
ATOM   2596 C CD    . PRO A 1 345 ? 59.624  22.879 45.125  1.00 150.14 ? 345 PRO A CD    1 
ATOM   2597 N N     . PHE A 1 346 ? 61.632  26.483 42.765  1.00 148.54 ? 346 PHE A N     1 
ATOM   2598 C CA    . PHE A 1 346 ? 62.651  26.896 41.783  1.00 153.93 ? 346 PHE A CA    1 
ATOM   2599 C C     . PHE A 1 346 ? 62.334  26.509 40.335  1.00 152.23 ? 346 PHE A C     1 
ATOM   2600 O O     . PHE A 1 346 ? 62.622  27.272 39.408  1.00 158.07 ? 346 PHE A O     1 
ATOM   2601 C CB    . PHE A 1 346 ? 64.057  26.423 42.183  1.00 152.93 ? 346 PHE A CB    1 
ATOM   2602 C CG    . PHE A 1 346 ? 64.613  27.122 43.394  1.00 151.76 ? 346 PHE A CG    1 
ATOM   2603 C CD1   . PHE A 1 346 ? 65.327  28.309 43.261  1.00 147.13 ? 346 PHE A CD1   1 
ATOM   2604 C CD2   . PHE A 1 346 ? 64.425  26.594 44.668  1.00 151.83 ? 346 PHE A CD2   1 
ATOM   2605 C CE1   . PHE A 1 346 ? 65.841  28.956 44.375  1.00 146.16 ? 346 PHE A CE1   1 
ATOM   2606 C CE2   . PHE A 1 346 ? 64.937  27.237 45.785  1.00 148.84 ? 346 PHE A CE2   1 
ATOM   2607 C CZ    . PHE A 1 346 ? 65.646  28.420 45.639  1.00 149.46 ? 346 PHE A CZ    1 
ATOM   2608 N N     . LYS A 1 347 ? 61.745  25.327 40.150  1.00 144.52 ? 347 LYS A N     1 
ATOM   2609 C CA    . LYS A 1 347 ? 61.388  24.825 38.825  1.00 142.15 ? 347 LYS A CA    1 
ATOM   2610 C C     . LYS A 1 347 ? 59.988  25.286 38.415  1.00 140.17 ? 347 LYS A C     1 
ATOM   2611 O O     . LYS A 1 347 ? 58.983  24.780 38.919  1.00 143.44 ? 347 LYS A O     1 
ATOM   2612 C CB    . LYS A 1 347 ? 61.482  23.295 38.786  1.00 144.17 ? 347 LYS A CB    1 
ATOM   2613 C CG    . LYS A 1 347 ? 62.898  22.747 38.878  1.00 153.92 ? 347 LYS A CG    1 
ATOM   2614 C CD    . LYS A 1 347 ? 62.902  21.227 38.839  1.00 158.44 ? 347 LYS A CD    1 
ATOM   2615 C CE    . LYS A 1 347 ? 64.316  20.675 38.935  1.00 163.12 ? 347 LYS A CE    1 
ATOM   2616 N NZ    . LYS A 1 347 ? 64.334  19.186 38.899  1.00 158.64 ? 347 LYS A NZ    1 
ATOM   2617 N N     . ASN A 1 348 ? 59.938  26.250 37.497  1.00 148.13 ? 348 ASN A N     1 
ATOM   2618 C CA    . ASN A 1 348 ? 58.675  26.828 37.033  1.00 153.64 ? 348 ASN A CA    1 
ATOM   2619 C C     . ASN A 1 348 ? 58.096  26.109 35.816  1.00 155.84 ? 348 ASN A C     1 
ATOM   2620 O O     . ASN A 1 348 ? 58.837  25.555 35.000  1.00 151.27 ? 348 ASN A O     1 
ATOM   2621 C CB    . ASN A 1 348 ? 58.850  28.320 36.726  1.00 153.85 ? 348 ASN A CB    1 
ATOM   2622 C CG    . ASN A 1 348 ? 59.196  29.139 37.958  1.00 141.32 ? 348 ASN A CG    1 
ATOM   2623 O OD1   . ASN A 1 348 ? 58.624  28.946 39.033  1.00 142.32 ? 348 ASN A OD1   1 
ATOM   2624 N ND2   . ASN A 1 348 ? 60.132  30.069 37.803  1.00 146.34 ? 348 ASN A ND2   1 
ATOM   2625 N N     . LEU A 1 349 ? 56.769  26.126 35.705  1.00 157.08 ? 349 LEU A N     1 
ATOM   2626 C CA    . LEU A 1 349 ? 56.070  25.507 34.578  1.00 147.20 ? 349 LEU A CA    1 
ATOM   2627 C C     . LEU A 1 349 ? 55.751  26.544 33.501  1.00 144.96 ? 349 LEU A C     1 
ATOM   2628 O O     . LEU A 1 349 ? 56.231  26.439 32.371  1.00 137.27 ? 349 LEU A O     1 
ATOM   2629 C CB    . LEU A 1 349 ? 54.784  24.808 35.042  1.00 141.42 ? 349 LEU A CB    1 
ATOM   2630 C CG    . LEU A 1 349 ? 54.818  23.851 36.240  1.00 135.62 ? 349 LEU A CG    1 
ATOM   2631 C CD1   . LEU A 1 349 ? 53.416  23.660 36.800  1.00 143.87 ? 349 LEU A CD1   1 
ATOM   2632 C CD2   . LEU A 1 349 ? 55.441  22.509 35.885  1.00 136.10 ? 349 LEU A CD2   1 
ATOM   2633 N N     . LYS A 1 350 ? 54.943  27.541 33.862  1.00 144.07 ? 350 LYS A N     1 
ATOM   2634 C CA    . LYS A 1 350 ? 54.531  28.597 32.937  1.00 149.23 ? 350 LYS A CA    1 
ATOM   2635 C C     . LYS A 1 350 ? 54.306  29.917 33.675  1.00 145.58 ? 350 LYS A C     1 
ATOM   2636 O O     . LYS A 1 350 ? 53.689  29.944 34.743  1.00 142.36 ? 350 LYS A O     1 
ATOM   2637 C CB    . LYS A 1 350 ? 53.259  28.185 32.185  1.00 154.48 ? 350 LYS A CB    1 
ATOM   2638 C CG    . LYS A 1 350 ? 52.872  29.105 31.036  1.00 160.57 ? 350 LYS A CG    1 
ATOM   2639 C CD    . LYS A 1 350 ? 51.522  28.723 30.449  1.00 160.09 ? 350 LYS A CD    1 
ATOM   2640 C CE    . LYS A 1 350 ? 51.078  29.703 29.373  1.00 158.35 ? 350 LYS A CE    1 
ATOM   2641 N NZ    . LYS A 1 350 ? 50.717  31.039 29.926  1.00 152.68 ? 350 LYS A NZ    1 
ATOM   2642 N N     . THR A 1 351 ? 54.812  31.004 33.095  1.00 140.64 ? 351 THR A N     1 
ATOM   2643 C CA    . THR A 1 351 ? 54.637  32.345 33.656  1.00 138.03 ? 351 THR A CA    1 
ATOM   2644 C C     . THR A 1 351 ? 53.651  33.167 32.824  1.00 137.70 ? 351 THR A C     1 
ATOM   2645 O O     . THR A 1 351 ? 53.465  32.909 31.633  1.00 141.27 ? 351 THR A O     1 
ATOM   2646 C CB    . THR A 1 351 ? 55.977  33.106 33.763  1.00 141.65 ? 351 THR A CB    1 
ATOM   2647 O OG1   . THR A 1 351 ? 56.574  33.223 32.466  1.00 141.36 ? 351 THR A OG1   1 
ATOM   2648 C CG2   . THR A 1 351 ? 56.942  32.385 34.699  1.00 145.99 ? 351 THR A CG2   1 
ATOM   2649 N N     . GLY A 1 352 ? 53.021  34.152 33.461  1.00 137.38 ? 352 GLY A N     1 
ATOM   2650 C CA    . GLY A 1 352 ? 52.059  35.025 32.789  1.00 146.20 ? 352 GLY A CA    1 
ATOM   2651 C C     . GLY A 1 352 ? 52.124  36.467 33.255  1.00 145.12 ? 352 GLY A C     1 
ATOM   2652 O O     . GLY A 1 352 ? 52.982  36.830 34.064  1.00 140.89 ? 352 GLY A O     1 
ATOM   2653 N N     . LYS A 1 353 ? 51.208  37.288 32.743  1.00 143.98 ? 353 LYS A N     1 
ATOM   2654 C CA    . LYS A 1 353 ? 51.175  38.718 33.060  1.00 138.72 ? 353 LYS A CA    1 
ATOM   2655 C C     . LYS A 1 353 ? 49.766  39.316 32.984  1.00 139.42 ? 353 LYS A C     1 
ATOM   2656 O O     . LYS A 1 353 ? 48.882  38.775 32.315  1.00 144.53 ? 353 LYS A O     1 
ATOM   2657 C CB    . LYS A 1 353 ? 52.145  39.501 32.153  1.00 134.38 ? 353 LYS A CB    1 
ATOM   2658 C CG    . LYS A 1 353 ? 51.641  39.806 30.743  1.00 134.76 ? 353 LYS A CG    1 
ATOM   2659 C CD    . LYS A 1 353 ? 51.687  38.591 29.828  1.00 130.99 ? 353 LYS A CD    1 
ATOM   2660 C CE    . LYS A 1 353 ? 50.993  38.868 28.505  1.00 142.03 ? 353 LYS A CE    1 
ATOM   2661 N NZ    . LYS A 1 353 ? 50.868  37.635 27.680  1.00 145.18 ? 353 LYS A NZ    1 
ATOM   2662 N N     . TYR A 1 354 ? 49.576  40.432 33.686  1.00 134.64 ? 354 TYR A N     1 
ATOM   2663 C CA    . TYR A 1 354 ? 48.346  41.216 33.619  1.00 143.72 ? 354 TYR A CA    1 
ATOM   2664 C C     . TYR A 1 354 ? 48.721  42.696 33.633  1.00 148.33 ? 354 TYR A C     1 
ATOM   2665 O O     . TYR A 1 354 ? 48.993  43.270 34.692  1.00 149.71 ? 354 TYR A O     1 
ATOM   2666 C CB    . TYR A 1 354 ? 47.415  40.872 34.788  1.00 139.83 ? 354 TYR A CB    1 
ATOM   2667 C CG    . TYR A 1 354 ? 45.991  41.358 34.613  1.00 150.07 ? 354 TYR A CG    1 
ATOM   2668 C CD1   . TYR A 1 354 ? 45.038  40.566 33.973  1.00 154.12 ? 354 TYR A CD1   1 
ATOM   2669 C CD2   . TYR A 1 354 ? 45.594  42.607 35.093  1.00 150.74 ? 354 TYR A CD2   1 
ATOM   2670 C CE1   . TYR A 1 354 ? 43.732  41.004 33.812  1.00 162.57 ? 354 TYR A CE1   1 
ATOM   2671 C CE2   . TYR A 1 354 ? 44.290  43.054 34.935  1.00 146.38 ? 354 TYR A CE2   1 
ATOM   2672 C CZ    . TYR A 1 354 ? 43.364  42.249 34.295  1.00 155.66 ? 354 TYR A CZ    1 
ATOM   2673 O OH    . TYR A 1 354 ? 42.070  42.689 34.137  1.00 151.69 ? 354 TYR A OH    1 
ATOM   2674 N N     . ALA A 1 355 ? 48.740  43.305 32.449  1.00 150.59 ? 355 ALA A N     1 
ATOM   2675 C CA    . ALA A 1 355 ? 49.260  44.664 32.287  1.00 151.35 ? 355 ALA A CA    1 
ATOM   2676 C C     . ALA A 1 355 ? 48.251  45.670 31.728  1.00 141.53 ? 355 ALA A C     1 
ATOM   2677 O O     . ALA A 1 355 ? 48.450  46.882 31.856  1.00 145.74 ? 355 ALA A O     1 
ATOM   2678 C CB    . ALA A 1 355 ? 50.519  44.643 31.427  1.00 160.58 ? 355 ALA A CB    1 
ATOM   2679 N N     . ARG A 1 356 ? 47.176  45.173 31.116  1.00 132.51 ? 356 ARG A N     1 
ATOM   2680 C CA    . ARG A 1 356 ? 46.191  46.043 30.464  1.00 141.16 ? 356 ARG A CA    1 
ATOM   2681 C C     . ARG A 1 356 ? 45.403  46.926 31.437  1.00 145.39 ? 356 ARG A C     1 
ATOM   2682 O O     . ARG A 1 356 ? 44.807  46.439 32.401  1.00 137.48 ? 356 ARG A O     1 
ATOM   2683 C CB    . ARG A 1 356 ? 45.238  45.251 29.551  1.00 151.77 ? 356 ARG A CB    1 
ATOM   2684 C CG    . ARG A 1 356 ? 44.510  44.081 30.203  1.00 150.15 ? 356 ARG A CG    1 
ATOM   2685 C CD    . ARG A 1 356 ? 43.062  43.988 29.734  1.00 145.21 ? 356 ARG A CD    1 
ATOM   2686 N NE    . ARG A 1 356 ? 42.924  44.039 28.277  1.00 144.77 ? 356 ARG A NE    1 
ATOM   2687 C CZ    . ARG A 1 356 ? 42.783  42.976 27.488  1.00 149.87 ? 356 ARG A CZ    1 
ATOM   2688 N NH1   . ARG A 1 356 ? 42.759  41.751 28.001  1.00 153.40 ? 356 ARG A NH1   1 
ATOM   2689 N NH2   . ARG A 1 356 ? 42.667  43.138 26.177  1.00 148.57 ? 356 ARG A NH2   1 
ATOM   2690 N N     . MET A 1 357 ? 45.430  48.229 31.170  1.00 146.93 ? 357 MET A N     1 
ATOM   2691 C CA    . MET A 1 357 ? 44.650  49.210 31.918  1.00 145.04 ? 357 MET A CA    1 
ATOM   2692 C C     . MET A 1 357 ? 43.818  50.030 30.938  1.00 143.95 ? 357 MET A C     1 
ATOM   2693 O O     . MET A 1 357 ? 44.365  50.689 30.047  1.00 142.41 ? 357 MET A O     1 
ATOM   2694 C CB    . MET A 1 357 ? 45.563  50.120 32.746  1.00 149.82 ? 357 MET A CB    1 
ATOM   2695 C CG    . MET A 1 357 ? 46.247  49.435 33.923  1.00 150.25 ? 357 MET A CG    1 
ATOM   2696 S SD    . MET A 1 357 ? 45.131  49.014 35.279  1.00 133.90 ? 357 MET A SD    1 
ATOM   2697 C CE    . MET A 1 357 ? 44.812  50.630 35.986  1.00 140.51 ? 357 MET A CE    1 
ATOM   2698 N N     . ARG A 1 358 ? 42.498  49.977 31.105  1.00 139.81 ? 358 ARG A N     1 
ATOM   2699 C CA    . ARG A 1 358 ? 41.560  50.616 30.177  1.00 147.63 ? 358 ARG A CA    1 
ATOM   2700 C C     . ARG A 1 358 ? 41.566  52.144 30.254  1.00 157.17 ? 358 ARG A C     1 
ATOM   2701 O O     . ARG A 1 358 ? 41.210  52.819 29.284  1.00 163.60 ? 358 ARG A O     1 
ATOM   2702 C CB    . ARG A 1 358 ? 40.140  50.073 30.381  1.00 151.00 ? 358 ARG A CB    1 
ATOM   2703 C CG    . ARG A 1 358 ? 39.963  48.624 29.949  1.00 146.83 ? 358 ARG A CG    1 
ATOM   2704 C CD    . ARG A 1 358 ? 38.514  48.178 30.061  1.00 145.11 ? 358 ARG A CD    1 
ATOM   2705 N NE    . ARG A 1 358 ? 38.340  46.780 29.667  1.00 149.78 ? 358 ARG A NE    1 
ATOM   2706 C CZ    . ARG A 1 358 ? 38.061  46.368 28.432  1.00 151.83 ? 358 ARG A CZ    1 
ATOM   2707 N NH1   . ARG A 1 358 ? 37.921  47.243 27.443  1.00 154.62 ? 358 ARG A NH1   1 
ATOM   2708 N NH2   . ARG A 1 358 ? 37.923  45.073 28.183  1.00 148.21 ? 358 ARG A NH2   1 
ATOM   2709 N N     . GLY A 1 359 ? 41.972  52.681 31.405  1.00 158.54 ? 359 GLY A N     1 
ATOM   2710 C CA    . GLY A 1 359 ? 42.062  54.127 31.597  1.00 162.23 ? 359 GLY A CA    1 
ATOM   2711 C C     . GLY A 1 359 ? 41.822  54.559 33.030  1.00 166.62 ? 359 GLY A C     1 
ATOM   2712 O O     . GLY A 1 359 ? 42.648  55.260 33.622  1.00 160.19 ? 359 GLY A O     1 
ATOM   2713 N N     . ALA A 1 360 ? 40.687  54.138 33.585  1.00 167.44 ? 360 ALA A N     1 
ATOM   2714 C CA    . ALA A 1 360 ? 40.298  54.498 34.947  1.00 158.32 ? 360 ALA A CA    1 
ATOM   2715 C C     . ALA A 1 360 ? 40.950  53.591 35.992  1.00 151.30 ? 360 ALA A C     1 
ATOM   2716 O O     . ALA A 1 360 ? 41.658  52.640 35.647  1.00 144.98 ? 360 ALA A O     1 
ATOM   2717 C CB    . ALA A 1 360 ? 38.783  54.469 35.083  1.00 154.29 ? 360 ALA A CB    1 
ATOM   2718 N N     . HIS A 1 361 ? 40.708  53.899 37.266  1.00 147.80 ? 361 HIS A N     1 
ATOM   2719 C CA    . HIS A 1 361 ? 41.230  53.112 38.384  1.00 140.28 ? 361 HIS A CA    1 
ATOM   2720 C C     . HIS A 1 361 ? 40.572  51.764 38.471  1.00 150.20 ? 361 HIS A C     1 
ATOM   2721 O O     . HIS A 1 361 ? 39.366  51.637 38.250  1.00 160.15 ? 361 HIS A O     1 
ATOM   2722 C CB    . HIS A 1 361 ? 41.066  53.871 39.698  1.00 144.46 ? 361 HIS A CB    1 
ATOM   2723 C CG    . HIS A 1 361 ? 39.636  54.250 40.013  1.00 151.15 ? 361 HIS A CG    1 
ATOM   2724 N ND1   . HIS A 1 361 ? 39.078  55.394 39.578  1.00 153.17 ? 361 HIS A ND1   1 
ATOM   2725 C CD2   . HIS A 1 361 ? 38.654  53.588 40.748  1.00 151.93 ? 361 HIS A CD2   1 
ATOM   2726 C CE1   . HIS A 1 361 ? 37.804  55.464 40.009  1.00 154.55 ? 361 HIS A CE1   1 
ATOM   2727 N NE2   . HIS A 1 361 ? 37.546  54.358 40.725  1.00 157.31 ? 361 HIS A NE2   1 
ATOM   2728 N N     . THR A 1 362 ? 41.366  50.745 38.791  1.00 152.21 ? 362 THR A N     1 
ATOM   2729 C CA    . THR A 1 362 ? 40.870  49.371 38.879  1.00 164.94 ? 362 THR A CA    1 
ATOM   2730 C C     . THR A 1 362 ? 41.040  48.769 40.276  1.00 163.38 ? 362 THR A C     1 
ATOM   2731 O O     . THR A 1 362 ? 40.528  47.680 40.548  1.00 164.78 ? 362 THR A O     1 
ATOM   2732 C CB    . THR A 1 362 ? 41.550  48.448 37.844  1.00 165.85 ? 362 THR A CB    1 
ATOM   2733 O OG1   . THR A 1 362 ? 42.974  48.555 37.964  1.00 168.75 ? 362 THR A OG1   1 
ATOM   2734 C CG2   . THR A 1 362 ? 41.130  48.817 36.425  1.00 165.77 ? 362 THR A CG2   1 
ATOM   2735 N N     . ASN A 1 363 ? 41.750  49.489 41.149  1.00 156.21 ? 363 ASN A N     1 
ATOM   2736 C CA    . ASN A 1 363 ? 42.066  49.049 42.519  1.00 154.34 ? 363 ASN A CA    1 
ATOM   2737 C C     . ASN A 1 363 ? 43.057  47.884 42.568  1.00 151.73 ? 363 ASN A C     1 
ATOM   2738 O O     . ASN A 1 363 ? 42.879  46.877 41.882  1.00 148.55 ? 363 ASN A O     1 
ATOM   2739 C CB    . ASN A 1 363 ? 40.791  48.728 43.320  1.00 146.02 ? 363 ASN A CB    1 
ATOM   2740 C CG    . ASN A 1 363 ? 41.087  48.189 44.709  1.00 146.37 ? 363 ASN A CG    1 
ATOM   2741 O OD1   . ASN A 1 363 ? 40.729  47.057 45.033  1.00 144.72 ? 363 ASN A OD1   1 
ATOM   2742 N ND2   . ASN A 1 363 ? 41.749  48.994 45.534  1.00 144.29 ? 363 ASN A ND2   1 
ATOM   2743 N N     . ASP A 1 364 ? 44.094  48.032 43.391  1.00 149.06 ? 364 ASP A N     1 
ATOM   2744 C CA    . ASP A 1 364 ? 45.161  47.031 43.507  1.00 149.57 ? 364 ASP A CA    1 
ATOM   2745 C C     . ASP A 1 364 ? 44.686  45.681 44.049  1.00 146.28 ? 364 ASP A C     1 
ATOM   2746 O O     . ASP A 1 364 ? 45.204  44.635 43.652  1.00 146.05 ? 364 ASP A O     1 
ATOM   2747 C CB    . ASP A 1 364 ? 46.313  47.567 44.366  1.00 158.19 ? 364 ASP A CB    1 
ATOM   2748 C CG    . ASP A 1 364 ? 47.096  48.676 43.677  1.00 159.07 ? 364 ASP A CG    1 
ATOM   2749 O OD1   . ASP A 1 364 ? 47.179  48.678 42.429  1.00 160.92 ? 364 ASP A OD1   1 
ATOM   2750 O OD2   . ASP A 1 364 ? 47.640  49.544 44.390  1.00 160.29 ? 364 ASP A OD2   1 
ATOM   2751 N N     . VAL A 1 365 ? 43.708  45.711 44.951  1.00 143.21 ? 365 VAL A N     1 
ATOM   2752 C CA    . VAL A 1 365 ? 43.138  44.490 45.528  1.00 144.38 ? 365 VAL A CA    1 
ATOM   2753 C C     . VAL A 1 365 ? 42.195  43.813 44.527  1.00 142.07 ? 365 VAL A C     1 
ATOM   2754 O O     . VAL A 1 365 ? 42.169  42.584 44.421  1.00 139.14 ? 365 VAL A O     1 
ATOM   2755 C CB    . VAL A 1 365 ? 42.397  44.770 46.859  1.00 141.77 ? 365 VAL A CB    1 
ATOM   2756 C CG1   . VAL A 1 365 ? 42.040  43.469 47.566  1.00 146.65 ? 365 VAL A CG1   1 
ATOM   2757 C CG2   . VAL A 1 365 ? 43.241  45.647 47.774  1.00 148.39 ? 365 VAL A CG2   1 
ATOM   2758 N N     . LYS A 1 366 ? 41.435  44.626 43.794  1.00 147.35 ? 366 LYS A N     1 
ATOM   2759 C CA    . LYS A 1 366 ? 40.483  44.135 42.796  1.00 152.52 ? 366 LYS A CA    1 
ATOM   2760 C C     . LYS A 1 366 ? 41.186  43.608 41.540  1.00 147.40 ? 366 LYS A C     1 
ATOM   2761 O O     . LYS A 1 366 ? 40.786  42.579 40.990  1.00 146.61 ? 366 LYS A O     1 
ATOM   2762 C CB    . LYS A 1 366 ? 39.479  45.236 42.434  1.00 163.63 ? 366 LYS A CB    1 
ATOM   2763 C CG    . LYS A 1 366 ? 38.321  44.787 41.556  1.00 163.53 ? 366 LYS A CG    1 
ATOM   2764 C CD    . LYS A 1 366 ? 37.439  45.964 41.170  1.00 156.98 ? 366 LYS A CD    1 
ATOM   2765 C CE    . LYS A 1 366 ? 36.344  45.542 40.204  1.00 155.01 ? 366 LYS A CE    1 
ATOM   2766 N NZ    . LYS A 1 366 ? 35.477  46.687 39.812  1.00 145.17 ? 366 LYS A NZ    1 
ATOM   2767 N N     . GLN A 1 367 ? 42.228  44.314 41.101  1.00 144.00 ? 367 GLN A N     1 
ATOM   2768 C CA    . GLN A 1 367 ? 43.013  43.922 39.926  1.00 145.11 ? 367 GLN A CA    1 
ATOM   2769 C C     . GLN A 1 367 ? 43.795  42.632 40.179  1.00 152.56 ? 367 GLN A C     1 
ATOM   2770 O O     . GLN A 1 367 ? 44.053  41.862 39.251  1.00 151.50 ? 367 GLN A O     1 
ATOM   2771 C CB    . GLN A 1 367 ? 43.970  45.047 39.516  1.00 139.06 ? 367 GLN A CB    1 
ATOM   2772 C CG    . GLN A 1 367 ? 44.465  44.966 38.078  1.00 138.25 ? 367 GLN A CG    1 
ATOM   2773 C CD    . GLN A 1 367 ? 45.510  46.018 37.742  1.00 142.40 ? 367 GLN A CD    1 
ATOM   2774 O OE1   . GLN A 1 367 ? 46.428  45.763 36.961  1.00 141.46 ? 367 GLN A OE1   1 
ATOM   2775 N NE2   . GLN A 1 367 ? 45.377  47.205 38.326  1.00 146.36 ? 367 GLN A NE2   1 
ATOM   2776 N N     . LEU A 1 368 ? 44.167  42.412 41.440  1.00 151.13 ? 368 LEU A N     1 
ATOM   2777 C CA    . LEU A 1 368 ? 44.836  41.185 41.866  1.00 152.15 ? 368 LEU A CA    1 
ATOM   2778 C C     . LEU A 1 368 ? 43.901  39.986 41.710  1.00 149.13 ? 368 LEU A C     1 
ATOM   2779 O O     . LEU A 1 368 ? 44.330  38.909 41.294  1.00 152.97 ? 368 LEU A O     1 
ATOM   2780 C CB    . LEU A 1 368 ? 45.309  41.316 43.319  1.00 147.36 ? 368 LEU A CB    1 
ATOM   2781 C CG    . LEU A 1 368 ? 46.434  40.411 43.835  1.00 146.57 ? 368 LEU A CG    1 
ATOM   2782 C CD1   . LEU A 1 368 ? 47.230  41.125 44.916  1.00 146.29 ? 368 LEU A CD1   1 
ATOM   2783 C CD2   . LEU A 1 368 ? 45.905  39.080 44.351  1.00 153.28 ? 368 LEU A CD2   1 
ATOM   2784 N N     . THR A 1 369 ? 42.626  40.190 42.040  1.00 145.55 ? 369 THR A N     1 
ATOM   2785 C CA    . THR A 1 369 ? 41.593  39.163 41.895  1.00 143.33 ? 369 THR A CA    1 
ATOM   2786 C C     . THR A 1 369 ? 41.262  38.929 40.418  1.00 147.63 ? 369 THR A C     1 
ATOM   2787 O O     . THR A 1 369 ? 40.954  37.804 40.015  1.00 150.03 ? 369 THR A O     1 
ATOM   2788 C CB    . THR A 1 369 ? 40.310  39.539 42.667  1.00 146.34 ? 369 THR A CB    1 
ATOM   2789 O OG1   . THR A 1 369 ? 40.659  40.127 43.927  1.00 144.87 ? 369 THR A OG1   1 
ATOM   2790 C CG2   . THR A 1 369 ? 39.441  38.309 42.912  1.00 152.76 ? 369 THR A CG2   1 
ATOM   2791 N N     . GLU A 1 370 ? 41.331  39.997 39.624  1.00 151.09 ? 370 GLU A N     1 
ATOM   2792 C CA    . GLU A 1 370 ? 41.137  39.919 38.174  1.00 155.43 ? 370 GLU A CA    1 
ATOM   2793 C C     . GLU A 1 370 ? 42.277  39.157 37.500  1.00 150.17 ? 370 GLU A C     1 
ATOM   2794 O O     . GLU A 1 370 ? 42.073  38.500 36.476  1.00 156.86 ? 370 GLU A O     1 
ATOM   2795 C CB    . GLU A 1 370 ? 41.012  41.319 37.566  1.00 157.59 ? 370 GLU A CB    1 
ATOM   2796 C CG    . GLU A 1 370 ? 39.687  42.012 37.850  1.00 154.42 ? 370 GLU A CG    1 
ATOM   2797 C CD    . GLU A 1 370 ? 39.595  43.396 37.231  1.00 158.01 ? 370 GLU A CD    1 
ATOM   2798 O OE1   . GLU A 1 370 ? 40.011  43.567 36.064  1.00 161.96 ? 370 GLU A OE1   1 
ATOM   2799 O OE2   . GLU A 1 370 ? 39.094  44.316 37.911  1.00 161.31 ? 370 GLU A OE2   1 
ATOM   2800 N N     . ALA A 1 371 ? 43.472  39.256 38.081  1.00 140.75 ? 371 ALA A N     1 
ATOM   2801 C CA    . ALA A 1 371 ? 44.642  38.522 37.607  1.00 143.05 ? 371 ALA A CA    1 
ATOM   2802 C C     . ALA A 1 371 ? 44.530  37.031 37.924  1.00 145.56 ? 371 ALA A C     1 
ATOM   2803 O O     . ALA A 1 371 ? 44.959  36.193 37.131  1.00 146.41 ? 371 ALA A O     1 
ATOM   2804 C CB    . ALA A 1 371 ? 45.914  39.103 38.207  1.00 140.02 ? 371 ALA A CB    1 
ATOM   2805 N N     . VAL A 1 372 ? 43.950  36.718 39.083  1.00 142.21 ? 372 VAL A N     1 
ATOM   2806 C CA    . VAL A 1 372 ? 43.725  35.334 39.518  1.00 141.25 ? 372 VAL A CA    1 
ATOM   2807 C C     . VAL A 1 372 ? 42.731  34.620 38.597  1.00 144.22 ? 372 VAL A C     1 
ATOM   2808 O O     . VAL A 1 372 ? 42.927  33.453 38.248  1.00 157.52 ? 372 VAL A O     1 
ATOM   2809 C CB    . VAL A 1 372 ? 43.250  35.274 40.993  1.00 135.60 ? 372 VAL A CB    1 
ATOM   2810 C CG1   . VAL A 1 372 ? 42.766  33.880 41.371  1.00 144.11 ? 372 VAL A CG1   1 
ATOM   2811 C CG2   . VAL A 1 372 ? 44.367  35.710 41.931  1.00 141.33 ? 372 VAL A CG2   1 
ATOM   2812 N N     . GLN A 1 373 ? 41.680  35.337 38.199  1.00 140.34 ? 373 GLN A N     1 
ATOM   2813 C CA    . GLN A 1 373 ? 40.655  34.805 37.298  1.00 138.74 ? 373 GLN A CA    1 
ATOM   2814 C C     . GLN A 1 373 ? 41.220  34.486 35.910  1.00 136.12 ? 373 GLN A C     1 
ATOM   2815 O O     . GLN A 1 373 ? 40.744  33.568 35.238  1.00 139.87 ? 373 GLN A O     1 
ATOM   2816 C CB    . GLN A 1 373 ? 39.477  35.782 37.190  1.00 142.11 ? 373 GLN A CB    1 
ATOM   2817 C CG    . GLN A 1 373 ? 38.193  35.180 36.628  1.00 147.60 ? 373 GLN A CG    1 
ATOM   2818 C CD    . GLN A 1 373 ? 37.615  34.072 37.494  1.00 155.66 ? 373 GLN A CD    1 
ATOM   2819 O OE1   . GLN A 1 373 ? 37.260  33.004 36.995  1.00 161.38 ? 373 GLN A OE1   1 
ATOM   2820 N NE2   . GLN A 1 373 ? 37.517  34.320 38.797  1.00 153.33 ? 373 GLN A NE2   1 
ATOM   2821 N N     . LYS A 1 374 ? 42.233  35.247 35.497  1.00 134.51 ? 374 LYS A N     1 
ATOM   2822 C CA    . LYS A 1 374 ? 42.932  35.008 34.234  1.00 132.59 ? 374 LYS A CA    1 
ATOM   2823 C C     . LYS A 1 374 ? 43.736  33.706 34.286  1.00 144.00 ? 374 LYS A C     1 
ATOM   2824 O O     . LYS A 1 374 ? 43.828  32.989 33.288  1.00 142.37 ? 374 LYS A O     1 
ATOM   2825 C CB    . LYS A 1 374 ? 43.845  36.189 33.890  1.00 139.16 ? 374 LYS A CB    1 
ATOM   2826 C CG    . LYS A 1 374 ? 44.335  36.206 32.450  1.00 135.51 ? 374 LYS A CG    1 
ATOM   2827 C CD    . LYS A 1 374 ? 45.301  37.354 32.205  1.00 135.24 ? 374 LYS A CD    1 
ATOM   2828 C CE    . LYS A 1 374 ? 45.784  37.371 30.764  1.00 123.90 ? 374 LYS A CE    1 
ATOM   2829 N NZ    . LYS A 1 374 ? 46.730  38.493 30.508  1.00 118.90 ? 374 LYS A NZ    1 
ATOM   2830 N N     . ILE A 1 375 ? 44.311  33.413 35.453  1.00 151.12 ? 375 ILE A N     1 
ATOM   2831 C CA    . ILE A 1 375 ? 45.051  32.169 35.676  1.00 156.75 ? 375 ILE A CA    1 
ATOM   2832 C C     . ILE A 1 375 ? 44.088  30.984 35.747  1.00 147.85 ? 375 ILE A C     1 
ATOM   2833 O O     . ILE A 1 375 ? 44.350  29.930 35.163  1.00 138.05 ? 375 ILE A O     1 
ATOM   2834 C CB    . ILE A 1 375 ? 45.897  32.217 36.972  1.00 156.77 ? 375 ILE A CB    1 
ATOM   2835 C CG1   . ILE A 1 375 ? 46.691  33.524 37.058  1.00 144.68 ? 375 ILE A CG1   1 
ATOM   2836 C CG2   . ILE A 1 375 ? 46.835  31.016 37.049  1.00 157.59 ? 375 ILE A CG2   1 
ATOM   2837 C CD1   . ILE A 1 375 ? 47.156  33.882 38.455  1.00 138.87 ? 375 ILE A CD1   1 
ATOM   2838 N N     . THR A 1 376 ? 42.978  31.174 36.460  1.00 144.74 ? 376 THR A N     1 
ATOM   2839 C CA    . THR A 1 376 ? 41.966  30.133 36.656  1.00 139.76 ? 376 THR A CA    1 
ATOM   2840 C C     . THR A 1 376 ? 41.381  29.651 35.326  1.00 145.86 ? 376 THR A C     1 
ATOM   2841 O O     . THR A 1 376 ? 41.259  28.446 35.102  1.00 143.98 ? 376 THR A O     1 
ATOM   2842 C CB    . THR A 1 376 ? 40.830  30.613 37.589  1.00 142.88 ? 376 THR A CB    1 
ATOM   2843 O OG1   . THR A 1 376 ? 41.389  31.275 38.731  1.00 137.00 ? 376 THR A OG1   1 
ATOM   2844 C CG2   . THR A 1 376 ? 39.977  29.439 38.061  1.00 152.72 ? 376 THR A CG2   1 
ATOM   2845 N N     . THR A 1 377 ? 41.039  30.596 34.451  1.00 153.35 ? 377 THR A N     1 
ATOM   2846 C CA    . THR A 1 377 ? 40.471  30.289 33.136  1.00 159.64 ? 377 THR A CA    1 
ATOM   2847 C C     . THR A 1 377 ? 41.503  29.628 32.216  1.00 150.19 ? 377 THR A C     1 
ATOM   2848 O O     . THR A 1 377 ? 41.165  28.735 31.435  1.00 154.53 ? 377 THR A O     1 
ATOM   2849 C CB    . THR A 1 377 ? 39.895  31.553 32.459  1.00 164.23 ? 377 THR A CB    1 
ATOM   2850 O OG1   . THR A 1 377 ? 39.171  32.329 33.423  1.00 161.88 ? 377 THR A OG1   1 
ATOM   2851 C CG2   . THR A 1 377 ? 38.958  31.182 31.313  1.00 154.82 ? 377 THR A CG2   1 
ATOM   2852 N N     . GLU A 1 378 ? 42.756  30.068 32.323  1.00 141.93 ? 378 GLU A N     1 
ATOM   2853 C CA    . GLU A 1 378 ? 43.858  29.513 31.536  1.00 142.88 ? 378 GLU A CA    1 
ATOM   2854 C C     . GLU A 1 378 ? 44.232  28.106 32.006  1.00 140.67 ? 378 GLU A C     1 
ATOM   2855 O O     . GLU A 1 378 ? 44.684  27.278 31.210  1.00 142.82 ? 378 GLU A O     1 
ATOM   2856 C CB    . GLU A 1 378 ? 45.079  30.437 31.601  1.00 149.56 ? 378 GLU A CB    1 
ATOM   2857 C CG    . GLU A 1 378 ? 46.102  30.219 30.494  1.00 151.27 ? 378 GLU A CG    1 
ATOM   2858 C CD    . GLU A 1 378 ? 47.296  31.152 30.595  1.00 135.81 ? 378 GLU A CD    1 
ATOM   2859 O OE1   . GLU A 1 378 ? 47.808  31.361 31.717  1.00 127.94 ? 378 GLU A OE1   1 
ATOM   2860 O OE2   . GLU A 1 378 ? 47.726  31.678 29.548  1.00 125.34 ? 378 GLU A OE2   1 
ATOM   2861 N N     . SER A 1 379 ? 44.037  27.845 33.298  1.00 137.78 ? 379 SER A N     1 
ATOM   2862 C CA    . SER A 1 379 ? 44.326  26.539 33.892  1.00 147.28 ? 379 SER A CA    1 
ATOM   2863 C C     . SER A 1 379 ? 43.321  25.467 33.471  1.00 141.36 ? 379 SER A C     1 
ATOM   2864 O O     . SER A 1 379 ? 43.646  24.280 33.463  1.00 139.95 ? 379 SER A O     1 
ATOM   2865 C CB    . SER A 1 379 ? 44.377  26.639 35.418  1.00 151.24 ? 379 SER A CB    1 
ATOM   2866 O OG    . SER A 1 379 ? 45.413  27.509 35.839  1.00 143.74 ? 379 SER A OG    1 
ATOM   2867 N N     . ILE A 1 380 ? 42.106  25.893 33.130  1.00 137.15 ? 380 ILE A N     1 
ATOM   2868 C CA    . ILE A 1 380 ? 41.052  24.985 32.671  1.00 146.98 ? 380 ILE A CA    1 
ATOM   2869 C C     . ILE A 1 380 ? 41.360  24.455 31.267  1.00 149.22 ? 380 ILE A C     1 
ATOM   2870 O O     . ILE A 1 380 ? 41.146  23.273 30.981  1.00 153.02 ? 380 ILE A O     1 
ATOM   2871 C CB    . ILE A 1 380 ? 39.656  25.667 32.697  1.00 156.45 ? 380 ILE A CB    1 
ATOM   2872 C CG1   . ILE A 1 380 ? 39.324  26.223 34.093  1.00 154.82 ? 380 ILE A CG1   1 
ATOM   2873 C CG2   . ILE A 1 380 ? 38.562  24.721 32.215  1.00 157.93 ? 380 ILE A CG2   1 
ATOM   2874 C CD1   . ILE A 1 380 ? 39.352  25.216 35.229  1.00 146.39 ? 380 ILE A CD1   1 
ATOM   2875 N N     . VAL A 1 381 ? 41.877  25.333 30.408  1.00 149.79 ? 381 VAL A N     1 
ATOM   2876 C CA    . VAL A 1 381 ? 42.183  24.992 29.016  1.00 152.33 ? 381 VAL A CA    1 
ATOM   2877 C C     . VAL A 1 381 ? 43.402  24.070 28.908  1.00 144.80 ? 381 VAL A C     1 
ATOM   2878 O O     . VAL A 1 381 ? 43.348  23.040 28.232  1.00 150.03 ? 381 VAL A O     1 
ATOM   2879 C CB    . VAL A 1 381 ? 42.404  26.259 28.151  1.00 155.83 ? 381 VAL A CB    1 
ATOM   2880 C CG1   . VAL A 1 381 ? 42.544  25.894 26.679  1.00 156.59 ? 381 VAL A CG1   1 
ATOM   2881 C CG2   . VAL A 1 381 ? 41.263  27.249 28.337  1.00 162.65 ? 381 VAL A CG2   1 
ATOM   2882 N N     . ILE A 1 382 ? 44.488  24.440 29.585  1.00 138.94 ? 382 ILE A N     1 
ATOM   2883 C CA    . ILE A 1 382 ? 45.762  23.726 29.470  1.00 143.88 ? 382 ILE A CA    1 
ATOM   2884 C C     . ILE A 1 382 ? 45.871  22.558 30.458  1.00 145.63 ? 382 ILE A C     1 
ATOM   2885 O O     . ILE A 1 382 ? 46.004  21.404 30.045  1.00 142.34 ? 382 ILE A O     1 
ATOM   2886 C CB    . ILE A 1 382 ? 46.973  24.680 29.625  1.00 155.83 ? 382 ILE A CB    1 
ATOM   2887 C CG1   . ILE A 1 382 ? 46.846  25.873 28.667  1.00 159.49 ? 382 ILE A CG1   1 
ATOM   2888 C CG2   . ILE A 1 382 ? 48.280  23.934 29.383  1.00 156.07 ? 382 ILE A CG2   1 
ATOM   2889 C CD1   . ILE A 1 382 ? 47.707  27.065 29.032  1.00 164.70 ? 382 ILE A CD1   1 
ATOM   2890 N N     . TRP A 1 383 ? 45.813  22.863 31.753  1.00 146.28 ? 383 TRP A N     1 
ATOM   2891 C CA    . TRP A 1 383 ? 45.990  21.853 32.800  1.00 144.75 ? 383 TRP A CA    1 
ATOM   2892 C C     . TRP A 1 383 ? 44.750  21.040 33.057  1.00 136.83 ? 383 TRP A C     1 
ATOM   2893 O O     . TRP A 1 383 ? 44.824  19.819 33.209  1.00 141.13 ? 383 TRP A O     1 
ATOM   2894 C CB    . TRP A 1 383 ? 46.484  22.498 34.091  1.00 149.61 ? 383 TRP A CB    1 
ATOM   2895 C CG    . TRP A 1 383 ? 47.918  22.967 34.018  1.00 141.26 ? 383 TRP A CG    1 
ATOM   2896 C CD1   . TRP A 1 383 ? 49.066  22.240 34.323  1.00 138.45 ? 383 TRP A CD1   1 
ATOM   2897 C CD2   . TRP A 1 383 ? 48.408  24.293 33.608  1.00 144.61 ? 383 TRP A CD2   1 
ATOM   2898 N NE1   . TRP A 1 383 ? 50.193  22.999 34.137  1.00 149.06 ? 383 TRP A NE1   1 
ATOM   2899 C CE2   . TRP A 1 383 ? 49.872  24.238 33.710  1.00 154.88 ? 383 TRP A CE2   1 
ATOM   2900 C CE3   . TRP A 1 383 ? 47.805  25.473 33.184  1.00 151.10 ? 383 TRP A CE3   1 
ATOM   2901 C CZ2   . TRP A 1 383 ? 50.673  25.327 33.395  1.00 164.28 ? 383 TRP A CZ2   1 
ATOM   2902 C CZ3   . TRP A 1 383 ? 48.624  26.565 32.870  1.00 152.94 ? 383 TRP A CZ3   1 
ATOM   2903 C CH2   . TRP A 1 383 ? 50.023  26.491 32.974  1.00 156.09 ? 383 TRP A CH2   1 
ATOM   2904 N N     . GLY A 1 384 ? 43.601  21.711 33.110  1.00 128.17 ? 384 GLY A N     1 
ATOM   2905 C CA    . GLY A 1 384 ? 42.319  21.049 33.344  1.00 129.10 ? 384 GLY A CA    1 
ATOM   2906 C C     . GLY A 1 384 ? 41.834  21.104 34.783  1.00 135.50 ? 384 GLY A C     1 
ATOM   2907 O O     . GLY A 1 384 ? 40.742  20.624 35.090  1.00 151.14 ? 384 GLY A O     1 
ATOM   2908 N N     . LYS A 1 385 ? 42.645  21.686 35.664  1.00 121.66 ? 385 LYS A N     1 
ATOM   2909 C CA    . LYS A 1 385 ? 42.297  21.803 37.082  1.00 127.78 ? 385 LYS A CA    1 
ATOM   2910 C C     . LYS A 1 385 ? 42.690  23.157 37.673  1.00 131.29 ? 385 LYS A C     1 
ATOM   2911 O O     . LYS A 1 385 ? 43.626  23.806 37.198  1.00 140.37 ? 385 LYS A O     1 
ATOM   2912 C CB    . LYS A 1 385 ? 42.915  20.655 37.896  1.00 141.94 ? 385 LYS A CB    1 
ATOM   2913 C CG    . LYS A 1 385 ? 44.437  20.602 37.889  1.00 151.61 ? 385 LYS A CG    1 
ATOM   2914 C CD    . LYS A 1 385 ? 44.954  19.506 38.806  1.00 153.11 ? 385 LYS A CD    1 
ATOM   2915 C CE    . LYS A 1 385 ? 46.472  19.524 38.887  1.00 148.79 ? 385 LYS A CE    1 
ATOM   2916 N NZ    . LYS A 1 385 ? 46.993  18.455 39.783  1.00 136.97 ? 385 LYS A NZ    1 
ATOM   2917 N N     . THR A 1 386 ? 41.964  23.573 38.709  1.00 133.19 ? 386 THR A N     1 
ATOM   2918 C CA    . THR A 1 386 ? 42.221  24.844 39.387  1.00 142.22 ? 386 THR A CA    1 
ATOM   2919 C C     . THR A 1 386 ? 43.434  24.746 40.315  1.00 151.22 ? 386 THR A C     1 
ATOM   2920 O O     . THR A 1 386 ? 43.502  23.843 41.153  1.00 147.67 ? 386 THR A O     1 
ATOM   2921 C CB    . THR A 1 386 ? 40.993  25.331 40.186  1.00 150.79 ? 386 THR A CB    1 
ATOM   2922 O OG1   . THR A 1 386 ? 40.530  24.282 41.047  1.00 154.38 ? 386 THR A OG1   1 
ATOM   2923 C CG2   . THR A 1 386 ? 39.868  25.748 39.247  1.00 154.39 ? 386 THR A CG2   1 
ATOM   2924 N N     . PRO A 1 387 ? 44.399  25.674 40.162  1.00 160.08 ? 387 PRO A N     1 
ATOM   2925 C CA    . PRO A 1 387 ? 45.622  25.661 40.965  1.00 159.66 ? 387 PRO A CA    1 
ATOM   2926 C C     . PRO A 1 387 ? 45.454  26.328 42.332  1.00 158.28 ? 387 PRO A C     1 
ATOM   2927 O O     . PRO A 1 387 ? 44.521  27.110 42.532  1.00 160.04 ? 387 PRO A O     1 
ATOM   2928 C CB    . PRO A 1 387 ? 46.605  26.458 40.106  1.00 157.62 ? 387 PRO A CB    1 
ATOM   2929 C CG    . PRO A 1 387 ? 45.751  27.412 39.343  1.00 151.66 ? 387 PRO A CG    1 
ATOM   2930 C CD    . PRO A 1 387 ? 44.393  26.781 39.185  1.00 155.24 ? 387 PRO A CD    1 
ATOM   2931 N N     . LYS A 1 388 ? 46.356  26.008 43.257  1.00 150.58 ? 388 LYS A N     1 
ATOM   2932 C CA    . LYS A 1 388 ? 46.376  26.635 44.576  1.00 140.93 ? 388 LYS A CA    1 
ATOM   2933 C C     . LYS A 1 388 ? 47.092  27.981 44.501  1.00 144.17 ? 388 LYS A C     1 
ATOM   2934 O O     . LYS A 1 388 ? 48.264  28.051 44.122  1.00 147.34 ? 388 LYS A O     1 
ATOM   2935 C CB    . LYS A 1 388 ? 47.053  25.723 45.605  1.00 136.41 ? 388 LYS A CB    1 
ATOM   2936 C CG    . LYS A 1 388 ? 46.260  24.473 45.954  1.00 144.16 ? 388 LYS A CG    1 
ATOM   2937 C CD    . LYS A 1 388 ? 46.993  23.621 46.977  1.00 152.61 ? 388 LYS A CD    1 
ATOM   2938 C CE    . LYS A 1 388 ? 46.201  22.372 47.325  1.00 156.40 ? 388 LYS A CE    1 
ATOM   2939 N NZ    . LYS A 1 388 ? 46.908  21.527 48.327  1.00 141.92 ? 388 LYS A NZ    1 
ATOM   2940 N N     . PHE A 1 389 ? 46.376  29.045 44.857  1.00 141.92 ? 389 PHE A N     1 
ATOM   2941 C CA    . PHE A 1 389 ? 46.902  30.405 44.756  1.00 147.69 ? 389 PHE A CA    1 
ATOM   2942 C C     . PHE A 1 389 ? 47.550  30.881 46.054  1.00 150.60 ? 389 PHE A C     1 
ATOM   2943 O O     . PHE A 1 389 ? 47.155  30.470 47.146  1.00 152.43 ? 389 PHE A O     1 
ATOM   2944 C CB    . PHE A 1 389 ? 45.797  31.380 44.330  1.00 151.15 ? 389 PHE A CB    1 
ATOM   2945 C CG    . PHE A 1 389 ? 45.232  31.102 42.964  1.00 157.00 ? 389 PHE A CG    1 
ATOM   2946 C CD1   . PHE A 1 389 ? 45.879  31.561 41.820  1.00 152.65 ? 389 PHE A CD1   1 
ATOM   2947 C CD2   . PHE A 1 389 ? 44.049  30.383 42.819  1.00 161.49 ? 389 PHE A CD2   1 
ATOM   2948 C CE1   . PHE A 1 389 ? 45.359  31.306 40.559  1.00 153.12 ? 389 PHE A CE1   1 
ATOM   2949 C CE2   . PHE A 1 389 ? 43.524  30.125 41.561  1.00 160.39 ? 389 PHE A CE2   1 
ATOM   2950 C CZ    . PHE A 1 389 ? 44.180  30.587 40.430  1.00 153.99 ? 389 PHE A CZ    1 
ATOM   2951 N N     . LYS A 1 390 ? 48.553  31.745 45.915  1.00 148.56 ? 390 LYS A N     1 
ATOM   2952 C CA    . LYS A 1 390 ? 49.216  32.374 47.054  1.00 142.48 ? 390 LYS A CA    1 
ATOM   2953 C C     . LYS A 1 390 ? 49.247  33.888 46.861  1.00 136.29 ? 390 LYS A C     1 
ATOM   2954 O O     . LYS A 1 390 ? 50.011  34.408 46.042  1.00 133.93 ? 390 LYS A O     1 
ATOM   2955 C CB    . LYS A 1 390 ? 50.628  31.811 47.245  1.00 144.73 ? 390 LYS A CB    1 
ATOM   2956 C CG    . LYS A 1 390 ? 50.665  30.447 47.917  1.00 146.04 ? 390 LYS A CG    1 
ATOM   2957 C CD    . LYS A 1 390 ? 52.062  29.844 47.882  1.00 152.19 ? 390 LYS A CD    1 
ATOM   2958 C CE    . LYS A 1 390 ? 52.180  28.642 48.810  1.00 154.81 ? 390 LYS A CE    1 
ATOM   2959 N NZ    . LYS A 1 390 ? 51.318  27.498 48.400  1.00 159.83 ? 390 LYS A NZ    1 
ATOM   2960 N N     . LEU A 1 391 ? 48.403  34.584 47.619  1.00 141.06 ? 391 LEU A N     1 
ATOM   2961 C CA    . LEU A 1 391 ? 48.212  36.025 47.458  1.00 152.83 ? 391 LEU A CA    1 
ATOM   2962 C C     . LEU A 1 391 ? 49.068  36.830 48.438  1.00 150.69 ? 391 LEU A C     1 
ATOM   2963 O O     . LEU A 1 391 ? 49.240  36.422 49.589  1.00 141.69 ? 391 LEU A O     1 
ATOM   2964 C CB    . LEU A 1 391 ? 46.730  36.396 47.623  1.00 159.79 ? 391 LEU A CB    1 
ATOM   2965 C CG    . LEU A 1 391 ? 45.642  35.560 46.933  1.00 167.60 ? 391 LEU A CG    1 
ATOM   2966 C CD1   . LEU A 1 391 ? 44.265  36.127 47.247  1.00 169.83 ? 391 LEU A CD1   1 
ATOM   2967 C CD2   . LEU A 1 391 ? 45.845  35.462 45.426  1.00 163.80 ? 391 LEU A CD2   1 
ATOM   2968 N N     . PRO A 1 392 ? 49.607  37.981 47.983  1.00 161.14 ? 392 PRO A N     1 
ATOM   2969 C CA    . PRO A 1 392 ? 50.407  38.849 48.852  1.00 161.17 ? 392 PRO A CA    1 
ATOM   2970 C C     . PRO A 1 392 ? 49.560  39.762 49.748  1.00 157.68 ? 392 PRO A C     1 
ATOM   2971 O O     . PRO A 1 392 ? 50.107  40.640 50.428  1.00 156.39 ? 392 PRO A O     1 
ATOM   2972 C CB    . PRO A 1 392 ? 51.218  39.679 47.855  1.00 156.19 ? 392 PRO A CB    1 
ATOM   2973 C CG    . PRO A 1 392 ? 50.352  39.761 46.647  1.00 160.93 ? 392 PRO A CG    1 
ATOM   2974 C CD    . PRO A 1 392 ? 49.556  38.486 46.596  1.00 162.10 ? 392 PRO A CD    1 
ATOM   2975 N N     . ILE A 1 393 ? 48.243  39.548 49.748  1.00 149.03 ? 393 ILE A N     1 
ATOM   2976 C CA    . ILE A 1 393 ? 47.320  40.345 50.558  1.00 145.13 ? 393 ILE A CA    1 
ATOM   2977 C C     . ILE A 1 393 ? 46.916  39.607 51.841  1.00 134.61 ? 393 ILE A C     1 
ATOM   2978 O O     . ILE A 1 393 ? 46.814  38.377 51.856  1.00 127.46 ? 393 ILE A O     1 
ATOM   2979 C CB    . ILE A 1 393 ? 46.082  40.801 49.733  1.00 145.75 ? 393 ILE A CB    1 
ATOM   2980 C CG1   . ILE A 1 393 ? 45.324  41.938 50.434  1.00 149.35 ? 393 ILE A CG1   1 
ATOM   2981 C CG2   . ILE A 1 393 ? 45.157  39.634 49.404  1.00 146.57 ? 393 ILE A CG2   1 
ATOM   2982 C CD1   . ILE A 1 393 ? 45.958  43.305 50.275  1.00 136.88 ? 393 ILE A CD1   1 
ATOM   2983 N N     . GLN A 1 394 ? 46.706  40.368 52.914  1.00 137.99 ? 394 GLN A N     1 
ATOM   2984 C CA    . GLN A 1 394 ? 46.322  39.812 54.213  1.00 140.35 ? 394 GLN A CA    1 
ATOM   2985 C C     . GLN A 1 394 ? 44.868  39.339 54.229  1.00 147.98 ? 394 GLN A C     1 
ATOM   2986 O O     . GLN A 1 394 ? 44.052  39.780 53.416  1.00 148.04 ? 394 GLN A O     1 
ATOM   2987 C CB    . GLN A 1 394 ? 46.554  40.838 55.328  1.00 141.28 ? 394 GLN A CB    1 
ATOM   2988 C CG    . GLN A 1 394 ? 48.020  41.124 55.625  1.00 153.78 ? 394 GLN A CG    1 
ATOM   2989 C CD    . GLN A 1 394 ? 48.217  42.097 56.775  1.00 162.71 ? 394 GLN A CD    1 
ATOM   2990 O OE1   . GLN A 1 394 ? 47.400  42.991 57.002  1.00 153.39 ? 394 GLN A OE1   1 
ATOM   2991 N NE2   . GLN A 1 394 ? 49.315  41.930 57.505  1.00 172.43 ? 394 GLN A NE2   1 
ATOM   2992 N N     . LYS A 1 395 ? 44.560  38.437 55.161  1.00 152.77 ? 395 LYS A N     1 
ATOM   2993 C CA    . LYS A 1 395 ? 43.209  37.894 55.320  1.00 151.80 ? 395 LYS A CA    1 
ATOM   2994 C C     . LYS A 1 395 ? 42.234  38.927 55.886  1.00 151.15 ? 395 LYS A C     1 
ATOM   2995 O O     . LYS A 1 395 ? 41.035  38.879 55.601  1.00 146.65 ? 395 LYS A O     1 
ATOM   2996 C CB    . LYS A 1 395 ? 43.229  36.648 56.212  1.00 146.37 ? 395 LYS A CB    1 
ATOM   2997 C CG    . LYS A 1 395 ? 43.911  35.440 55.590  1.00 138.78 ? 395 LYS A CG    1 
ATOM   2998 C CD    . LYS A 1 395 ? 43.851  34.233 56.513  1.00 141.99 ? 395 LYS A CD    1 
ATOM   2999 C CE    . LYS A 1 395 ? 44.513  33.020 55.880  1.00 149.18 ? 395 LYS A CE    1 
ATOM   3000 N NZ    . LYS A 1 395 ? 44.456  31.828 56.770  1.00 168.52 ? 395 LYS A NZ    1 
ATOM   3001 N N     . GLU A 1 396 ? 42.759  39.852 56.689  1.00 160.53 ? 396 GLU A N     1 
ATOM   3002 C CA    . GLU A 1 396 ? 41.960  40.923 57.286  1.00 157.80 ? 396 GLU A CA    1 
ATOM   3003 C C     . GLU A 1 396 ? 41.568  41.983 56.256  1.00 151.19 ? 396 GLU A C     1 
ATOM   3004 O O     . GLU A 1 396 ? 40.462  42.523 56.305  1.00 138.05 ? 396 GLU A O     1 
ATOM   3005 C CB    . GLU A 1 396 ? 42.713  41.574 58.451  1.00 168.53 ? 396 GLU A CB    1 
ATOM   3006 C CG    . GLU A 1 396 ? 42.903  40.671 59.662  1.00 166.52 ? 396 GLU A CG    1 
ATOM   3007 C CD    . GLU A 1 396 ? 43.700  41.329 60.775  1.00 170.13 ? 396 GLU A CD    1 
ATOM   3008 O OE1   . GLU A 1 396 ? 43.435  42.509 61.093  1.00 178.82 ? 396 GLU A OE1   1 
ATOM   3009 O OE2   . GLU A 1 396 ? 44.589  40.659 61.342  1.00 163.32 ? 396 GLU A OE2   1 
ATOM   3010 N N     . THR A 1 397 ? 42.482  42.269 55.329  1.00 157.71 ? 397 THR A N     1 
ATOM   3011 C CA    . THR A 1 397 ? 42.255  43.259 54.275  1.00 159.91 ? 397 THR A CA    1 
ATOM   3012 C C     . THR A 1 397 ? 41.326  42.709 53.188  1.00 155.38 ? 397 THR A C     1 
ATOM   3013 O O     . THR A 1 397 ? 40.563  43.460 52.574  1.00 161.67 ? 397 THR A O     1 
ATOM   3014 C CB    . THR A 1 397 ? 43.586  43.720 53.638  1.00 153.17 ? 397 THR A CB    1 
ATOM   3015 O OG1   . THR A 1 397 ? 44.587  43.862 54.655  1.00 146.36 ? 397 THR A OG1   1 
ATOM   3016 C CG2   . THR A 1 397 ? 43.413  45.054 52.916  1.00 152.62 ? 397 THR A CG2   1 
ATOM   3017 N N     . TRP A 1 398 ? 41.397  41.397 52.965  1.00 144.62 ? 398 TRP A N     1 
ATOM   3018 C CA    . TRP A 1 398 ? 40.586  40.715 51.953  1.00 133.39 ? 398 TRP A CA    1 
ATOM   3019 C C     . TRP A 1 398 ? 39.120  40.706 52.301  1.00 138.53 ? 398 TRP A C     1 
ATOM   3020 O O     . TRP A 1 398 ? 38.269  40.864 51.423  1.00 140.04 ? 398 TRP A O     1 
ATOM   3021 C CB    . TRP A 1 398 ? 41.093  39.288 51.747  1.00 141.07 ? 398 TRP A CB    1 
ATOM   3022 C CG    . TRP A 1 398 ? 40.368  38.520 50.665  1.00 150.42 ? 398 TRP A CG    1 
ATOM   3023 C CD1   . TRP A 1 398 ? 39.286  37.655 50.816  1.00 157.16 ? 398 TRP A CD1   1 
ATOM   3024 C CD2   . TRP A 1 398 ? 40.657  38.517 49.222  1.00 152.52 ? 398 TRP A CD2   1 
ATOM   3025 N NE1   . TRP A 1 398 ? 38.897  37.138 49.605  1.00 156.92 ? 398 TRP A NE1   1 
ATOM   3026 C CE2   . TRP A 1 398 ? 39.676  37.612 48.609  1.00 156.36 ? 398 TRP A CE2   1 
ATOM   3027 C CE3   . TRP A 1 398 ? 41.592  39.149 48.408  1.00 151.07 ? 398 TRP A CE3   1 
ATOM   3028 C CZ2   . TRP A 1 398 ? 39.653  37.368 47.243  1.00 152.04 ? 398 TRP A CZ2   1 
ATOM   3029 C CZ3   . TRP A 1 398 ? 41.558  38.894 47.031  1.00 153.79 ? 398 TRP A CZ3   1 
ATOM   3030 C CH2   . TRP A 1 398 ? 40.611  38.024 46.465  1.00 152.72 ? 398 TRP A CH2   1 
ATOM   3031 N N     . GLU A 1 399 ? 38.819  40.524 53.585  1.00 137.37 ? 399 GLU A N     1 
ATOM   3032 C CA    . GLU A 1 399 ? 37.437  40.445 54.063  1.00 144.81 ? 399 GLU A CA    1 
ATOM   3033 C C     . GLU A 1 399 ? 36.753  41.811 54.149  1.00 152.27 ? 399 GLU A C     1 
ATOM   3034 O O     . GLU A 1 399 ? 35.532  41.905 54.017  1.00 152.67 ? 399 GLU A O     1 
ATOM   3035 C CB    . GLU A 1 399 ? 37.376  39.742 55.425  1.00 147.31 ? 399 GLU A CB    1 
ATOM   3036 C CG    . GLU A 1 399 ? 37.667  38.246 55.382  1.00 149.24 ? 399 GLU A CG    1 
ATOM   3037 C CD    . GLU A 1 399 ? 36.559  37.437 54.727  1.00 149.33 ? 399 GLU A CD    1 
ATOM   3038 O OE1   . GLU A 1 399 ? 35.369  37.700 55.008  1.00 145.72 ? 399 GLU A OE1   1 
ATOM   3039 O OE2   . GLU A 1 399 ? 36.881  36.528 53.933  1.00 149.72 ? 399 GLU A OE2   1 
ATOM   3040 N N     . THR A 1 400 ? 37.545  42.859 54.368  1.00 153.75 ? 400 THR A N     1 
ATOM   3041 C CA    . THR A 1 400 ? 37.020  44.218 54.527  1.00 151.57 ? 400 THR A CA    1 
ATOM   3042 C C     . THR A 1 400 ? 36.593  44.835 53.190  1.00 147.16 ? 400 THR A C     1 
ATOM   3043 O O     . THR A 1 400 ? 35.607  45.574 53.129  1.00 148.39 ? 400 THR A O     1 
ATOM   3044 C CB    . THR A 1 400 ? 38.045  45.141 55.226  1.00 154.24 ? 400 THR A CB    1 
ATOM   3045 O OG1   . THR A 1 400 ? 38.639  44.453 56.334  1.00 153.39 ? 400 THR A OG1   1 
ATOM   3046 C CG2   . THR A 1 400 ? 37.378  46.417 55.734  1.00 151.89 ? 400 THR A CG2   1 
ATOM   3047 N N     . TRP A 1 401 ? 37.332  44.517 52.127  1.00 144.45 ? 401 TRP A N     1 
ATOM   3048 C CA    . TRP A 1 401 ? 37.111  45.119 50.810  1.00 143.29 ? 401 TRP A CA    1 
ATOM   3049 C C     . TRP A 1 401 ? 35.865  44.642 50.111  1.00 144.02 ? 401 TRP A C     1 
ATOM   3050 O O     . TRP A 1 401 ? 35.077  45.454 49.623  1.00 146.56 ? 401 TRP A O     1 
ATOM   3051 C CB    . TRP A 1 401 ? 38.337  44.920 49.916  1.00 140.12 ? 401 TRP A CB    1 
ATOM   3052 C CG    . TRP A 1 401 ? 38.128  45.367 48.486  1.00 145.96 ? 401 TRP A CG    1 
ATOM   3053 C CD1   . TRP A 1 401 ? 37.989  44.563 47.356  1.00 148.49 ? 401 TRP A CD1   1 
ATOM   3054 C CD2   . TRP A 1 401 ? 38.013  46.746 47.985  1.00 159.17 ? 401 TRP A CD2   1 
ATOM   3055 N NE1   . TRP A 1 401 ? 37.809  45.325 46.230  1.00 153.70 ? 401 TRP A NE1   1 
ATOM   3056 C CE2   . TRP A 1 401 ? 37.813  46.640 46.534  1.00 160.60 ? 401 TRP A CE2   1 
ATOM   3057 C CE3   . TRP A 1 401 ? 38.058  48.008 48.570  1.00 164.33 ? 401 TRP A CE3   1 
ATOM   3058 C CZ2   . TRP A 1 401 ? 37.666  47.761 45.728  1.00 161.95 ? 401 TRP A CZ2   1 
ATOM   3059 C CZ3   . TRP A 1 401 ? 37.909  49.131 47.745  1.00 161.87 ? 401 TRP A CZ3   1 
ATOM   3060 C CH2   . TRP A 1 401 ? 37.718  49.008 46.359  1.00 161.56 ? 401 TRP A CH2   1 
ATOM   3061 N N     . TRP A 1 402 ? 35.676  43.324 50.060  1.00 143.99 ? 402 TRP A N     1 
ATOM   3062 C CA    . TRP A 1 402 ? 34.597  42.723 49.268  1.00 145.96 ? 402 TRP A CA    1 
ATOM   3063 C C     . TRP A 1 402 ? 33.236  42.774 49.912  1.00 147.70 ? 402 TRP A C     1 
ATOM   3064 O O     . TRP A 1 402 ? 32.218  42.686 49.220  1.00 150.69 ? 402 TRP A O     1 
ATOM   3065 C CB    . TRP A 1 402 ? 34.957  41.296 48.864  1.00 147.44 ? 402 TRP A CB    1 
ATOM   3066 C CG    . TRP A 1 402 ? 36.126  41.233 47.909  1.00 146.81 ? 402 TRP A CG    1 
ATOM   3067 C CD1   . TRP A 1 402 ? 37.417  40.778 48.171  1.00 149.55 ? 402 TRP A CD1   1 
ATOM   3068 C CD2   . TRP A 1 402 ? 36.154  41.660 46.500  1.00 143.98 ? 402 TRP A CD2   1 
ATOM   3069 N NE1   . TRP A 1 402 ? 38.210  40.882 47.056  1.00 149.45 ? 402 TRP A NE1   1 
ATOM   3070 C CE2   . TRP A 1 402 ? 37.518  41.403 46.021  1.00 149.20 ? 402 TRP A CE2   1 
ATOM   3071 C CE3   . TRP A 1 402 ? 35.221  42.203 45.622  1.00 143.38 ? 402 TRP A CE3   1 
ATOM   3072 C CZ2   . TRP A 1 402 ? 37.905  41.686 44.718  1.00 147.56 ? 402 TRP A CZ2   1 
ATOM   3073 C CZ3   . TRP A 1 402 ? 35.624  42.484 44.310  1.00 142.04 ? 402 TRP A CZ3   1 
ATOM   3074 C CH2   . TRP A 1 402 ? 36.934  42.230 43.871  1.00 137.85 ? 402 TRP A CH2   1 
ATOM   3075 N N     . THR A 1 403 ? 33.201  42.915 51.236  1.00 147.04 ? 403 THR A N     1 
ATOM   3076 C CA    . THR A 1 403 ? 31.937  42.994 51.977  1.00 145.21 ? 403 THR A CA    1 
ATOM   3077 C C     . THR A 1 403 ? 31.203  44.318 51.754  1.00 151.07 ? 403 THR A C     1 
ATOM   3078 O O     . THR A 1 403 ? 29.971  44.363 51.781  1.00 153.37 ? 403 THR A O     1 
ATOM   3079 C CB    . THR A 1 403 ? 32.132  42.765 53.491  1.00 140.80 ? 403 THR A CB    1 
ATOM   3080 O OG1   . THR A 1 403 ? 33.298  43.467 53.943  1.00 147.93 ? 403 THR A OG1   1 
ATOM   3081 C CG2   . THR A 1 403 ? 32.285  41.279 53.794  1.00 134.25 ? 403 THR A CG2   1 
ATOM   3082 N N     . GLU A 1 404 ? 31.966  45.388 51.535  1.00 150.54 ? 404 GLU A N     1 
ATOM   3083 C CA    . GLU A 1 404 ? 31.399  46.714 51.283  1.00 146.40 ? 404 GLU A CA    1 
ATOM   3084 C C     . GLU A 1 404 ? 31.237  47.013 49.789  1.00 148.14 ? 404 GLU A C     1 
ATOM   3085 O O     . GLU A 1 404 ? 30.464  47.897 49.408  1.00 154.28 ? 404 GLU A O     1 
ATOM   3086 C CB    . GLU A 1 404 ? 32.232  47.807 51.970  1.00 143.95 ? 404 GLU A CB    1 
ATOM   3087 C CG    . GLU A 1 404 ? 33.685  47.895 51.519  1.00 153.02 ? 404 GLU A CG    1 
ATOM   3088 C CD    . GLU A 1 404 ? 34.470  48.974 52.243  1.00 157.77 ? 404 GLU A CD    1 
ATOM   3089 O OE1   . GLU A 1 404 ? 33.932  50.085 52.442  1.00 160.04 ? 404 GLU A OE1   1 
ATOM   3090 O OE2   . GLU A 1 404 ? 35.633  48.710 52.616  1.00 157.23 ? 404 GLU A OE2   1 
ATOM   3091 N N     . TYR A 1 405 ? 31.964  46.272 48.955  1.00 147.51 ? 405 TYR A N     1 
ATOM   3092 C CA    . TYR A 1 405 ? 31.924  46.458 47.504  1.00 145.57 ? 405 TYR A CA    1 
ATOM   3093 C C     . TYR A 1 405 ? 30.710  45.766 46.884  1.00 148.66 ? 405 TYR A C     1 
ATOM   3094 O O     . TYR A 1 405 ? 30.221  44.761 47.407  1.00 142.00 ? 405 TYR A O     1 
ATOM   3095 C CB    . TYR A 1 405 ? 33.220  45.952 46.863  1.00 143.77 ? 405 TYR A CB    1 
ATOM   3096 C CG    . TYR A 1 405 ? 33.541  46.587 45.527  1.00 149.71 ? 405 TYR A CG    1 
ATOM   3097 C CD1   . TYR A 1 405 ? 34.088  47.870 45.455  1.00 146.10 ? 405 TYR A CD1   1 
ATOM   3098 C CD2   . TYR A 1 405 ? 33.309  45.904 44.334  1.00 157.53 ? 405 TYR A CD2   1 
ATOM   3099 C CE1   . TYR A 1 405 ? 34.386  48.455 44.234  1.00 150.25 ? 405 TYR A CE1   1 
ATOM   3100 C CE2   . TYR A 1 405 ? 33.604  46.481 43.108  1.00 157.68 ? 405 TYR A CE2   1 
ATOM   3101 C CZ    . TYR A 1 405 ? 34.141  47.755 43.063  1.00 151.91 ? 405 TYR A CZ    1 
ATOM   3102 O OH    . TYR A 1 405 ? 34.436  48.331 41.848  1.00 149.04 ? 405 TYR A OH    1 
ATOM   3103 N N     . TRP A 1 406 ? 30.236  46.312 45.765  1.00 150.45 ? 406 TRP A N     1 
ATOM   3104 C CA    . TRP A 1 406 ? 29.026  45.822 45.098  1.00 149.71 ? 406 TRP A CA    1 
ATOM   3105 C C     . TRP A 1 406 ? 29.225  44.539 44.333  1.00 143.76 ? 406 TRP A C     1 
ATOM   3106 O O     . TRP A 1 406 ? 28.313  43.714 44.255  1.00 142.23 ? 406 TRP A O     1 
ATOM   3107 C CB    . TRP A 1 406 ? 28.442  46.900 44.186  1.00 152.65 ? 406 TRP A CB    1 
ATOM   3108 C CG    . TRP A 1 406 ? 29.411  47.418 43.147  1.00 150.63 ? 406 TRP A CG    1 
ATOM   3109 C CD1   . TRP A 1 406 ? 30.303  48.480 43.273  1.00 154.70 ? 406 TRP A CD1   1 
ATOM   3110 C CD2   . TRP A 1 406 ? 29.616  46.909 41.782  1.00 147.81 ? 406 TRP A CD2   1 
ATOM   3111 N NE1   . TRP A 1 406 ? 31.023  48.656 42.118  1.00 163.06 ? 406 TRP A NE1   1 
ATOM   3112 C CE2   . TRP A 1 406 ? 30.662  47.750 41.185  1.00 154.41 ? 406 TRP A CE2   1 
ATOM   3113 C CE3   . TRP A 1 406 ? 29.061  45.882 41.025  1.00 147.31 ? 406 TRP A CE3   1 
ATOM   3114 C CZ2   . TRP A 1 406 ? 31.113  47.550 39.888  1.00 152.04 ? 406 TRP A CZ2   1 
ATOM   3115 C CZ3   . TRP A 1 406 ? 29.526  45.691 39.717  1.00 146.26 ? 406 TRP A CZ3   1 
ATOM   3116 C CH2   . TRP A 1 406 ? 30.526  46.507 39.165  1.00 146.54 ? 406 TRP A CH2   1 
ATOM   3117 N N     . GLN A 1 407 ? 30.414  44.361 43.760  1.00 145.00 ? 407 GLN A N     1 
ATOM   3118 C CA    . GLN A 1 407 ? 30.723  43.177 42.958  1.00 145.42 ? 407 GLN A CA    1 
ATOM   3119 C C     . GLN A 1 407 ? 31.147  42.002 43.836  1.00 151.02 ? 407 GLN A C     1 
ATOM   3120 O O     . GLN A 1 407 ? 31.908  42.172 44.793  1.00 159.61 ? 407 GLN A O     1 
ATOM   3121 C CB    . GLN A 1 407 ? 31.808  43.494 41.924  1.00 151.87 ? 407 GLN A CB    1 
ATOM   3122 C CG    . GLN A 1 407 ? 31.857  42.527 40.749  1.00 148.39 ? 407 GLN A CG    1 
ATOM   3123 C CD    . GLN A 1 407 ? 32.929  42.881 39.734  1.00 151.74 ? 407 GLN A CD    1 
ATOM   3124 O OE1   . GLN A 1 407 ? 34.106  43.006 40.072  1.00 149.72 ? 407 GLN A OE1   1 
ATOM   3125 N NE2   . GLN A 1 407 ? 32.525  43.033 38.479  1.00 151.85 ? 407 GLN A NE2   1 
ATOM   3126 N N     . ALA A 1 408 ? 30.649  40.814 43.500  1.00 147.10 ? 408 ALA A N     1 
ATOM   3127 C CA    . ALA A 1 408 ? 30.944  39.598 44.255  1.00 143.29 ? 408 ALA A CA    1 
ATOM   3128 C C     . ALA A 1 408 ? 31.909  38.681 43.509  1.00 147.35 ? 408 ALA A C     1 
ATOM   3129 O O     . ALA A 1 408 ? 31.772  38.465 42.302  1.00 143.96 ? 408 ALA A O     1 
ATOM   3130 C CB    . ALA A 1 408 ? 29.657  38.857 44.590  1.00 139.90 ? 408 ALA A CB    1 
ATOM   3131 N N     . THR A 1 409 ? 32.886  38.150 44.242  1.00 152.34 ? 409 THR A N     1 
ATOM   3132 C CA    . THR A 1 409 ? 33.859  37.200 43.698  1.00 144.92 ? 409 THR A CA    1 
ATOM   3133 C C     . THR A 1 409 ? 34.234  36.147 44.745  1.00 143.31 ? 409 THR A C     1 
ATOM   3134 O O     . THR A 1 409 ? 34.140  36.398 45.950  1.00 148.66 ? 409 THR A O     1 
ATOM   3135 C CB    . THR A 1 409 ? 35.125  37.909 43.155  1.00 138.70 ? 409 THR A CB    1 
ATOM   3136 O OG1   . THR A 1 409 ? 36.014  36.940 42.583  1.00 122.77 ? 409 THR A OG1   1 
ATOM   3137 C CG2   . THR A 1 409 ? 35.852  38.677 44.258  1.00 148.22 ? 409 THR A CG2   1 
ATOM   3138 N N     . TRP A 1 410 ? 34.655  34.973 44.280  1.00 133.63 ? 410 TRP A N     1 
ATOM   3139 C CA    . TRP A 1 410 ? 34.975  33.862 45.174  1.00 135.61 ? 410 TRP A CA    1 
ATOM   3140 C C     . TRP A 1 410 ? 36.233  33.140 44.781  1.00 146.30 ? 410 TRP A C     1 
ATOM   3141 O O     . TRP A 1 410 ? 36.389  32.711 43.635  1.00 145.11 ? 410 TRP A O     1 
ATOM   3142 C CB    . TRP A 1 410 ? 33.797  32.891 45.256  1.00 137.37 ? 410 TRP A CB    1 
ATOM   3143 C CG    . TRP A 1 410 ? 34.062  31.647 46.073  1.00 139.71 ? 410 TRP A CG    1 
ATOM   3144 C CD1   . TRP A 1 410 ? 34.345  31.566 47.435  1.00 139.39 ? 410 TRP A CD1   1 
ATOM   3145 C CD2   . TRP A 1 410 ? 34.061  30.252 45.602  1.00 150.04 ? 410 TRP A CD2   1 
ATOM   3146 N NE1   . TRP A 1 410 ? 34.520  30.262 47.824  1.00 147.62 ? 410 TRP A NE1   1 
ATOM   3147 C CE2   . TRP A 1 410 ? 34.364  29.423 46.777  1.00 151.47 ? 410 TRP A CE2   1 
ATOM   3148 C CE3   . TRP A 1 410 ? 33.852  29.631 44.374  1.00 152.55 ? 410 TRP A CE3   1 
ATOM   3149 C CZ2   . TRP A 1 410 ? 34.447  28.040 46.699  1.00 153.54 ? 410 TRP A CZ2   1 
ATOM   3150 C CZ3   . TRP A 1 410 ? 33.940  28.234 44.310  1.00 148.78 ? 410 TRP A CZ3   1 
ATOM   3151 C CH2   . TRP A 1 410 ? 34.231  27.460 45.445  1.00 147.85 ? 410 TRP A CH2   1 
ATOM   3152 N N     . VAL A 1 411 ? 37.144  33.013 45.744  1.00 154.59 ? 411 VAL A N     1 
ATOM   3153 C CA    . VAL A 1 411 ? 38.367  32.230 45.578  1.00 154.90 ? 411 VAL A CA    1 
ATOM   3154 C C     . VAL A 1 411 ? 38.283  31.009 46.498  1.00 158.78 ? 411 VAL A C     1 
ATOM   3155 O O     . VAL A 1 411 ? 38.195  31.160 47.721  1.00 162.38 ? 411 VAL A O     1 
ATOM   3156 C CB    . VAL A 1 411 ? 39.636  33.060 45.889  1.00 156.32 ? 411 VAL A CB    1 
ATOM   3157 C CG1   . VAL A 1 411 ? 40.893  32.232 45.656  1.00 140.08 ? 411 VAL A CG1   1 
ATOM   3158 C CG2   . VAL A 1 411 ? 39.676  34.325 45.043  1.00 163.18 ? 411 VAL A CG2   1 
ATOM   3159 N N     . PRO A 1 412 ? 38.299  29.795 45.912  1.00 159.88 ? 412 PRO A N     1 
ATOM   3160 C CA    . PRO A 1 412 ? 38.114  28.552 46.669  1.00 159.09 ? 412 PRO A CA    1 
ATOM   3161 C C     . PRO A 1 412 ? 39.270  28.238 47.620  1.00 152.32 ? 412 PRO A C     1 
ATOM   3162 O O     . PRO A 1 412 ? 39.044  28.052 48.818  1.00 149.20 ? 412 PRO A O     1 
ATOM   3163 C CB    . PRO A 1 412 ? 38.013  27.477 45.573  1.00 155.02 ? 412 PRO A CB    1 
ATOM   3164 C CG    . PRO A 1 412 ? 37.741  28.220 44.308  1.00 155.89 ? 412 PRO A CG    1 
ATOM   3165 C CD    . PRO A 1 412 ? 38.443  29.532 44.470  1.00 153.89 ? 412 PRO A CD    1 
ATOM   3166 N N     . GLU A 1 413 ? 40.489  28.181 47.087  1.00 151.39 ? 413 GLU A N     1 
ATOM   3167 C CA    . GLU A 1 413 ? 41.669  27.845 47.883  1.00 151.70 ? 413 GLU A CA    1 
ATOM   3168 C C     . GLU A 1 413 ? 42.798  28.853 47.679  1.00 159.57 ? 413 GLU A C     1 
ATOM   3169 O O     . GLU A 1 413 ? 43.344  28.976 46.579  1.00 164.46 ? 413 GLU A O     1 
ATOM   3170 C CB    . GLU A 1 413 ? 42.157  26.427 47.559  1.00 148.77 ? 413 GLU A CB    1 
ATOM   3171 C CG    . GLU A 1 413 ? 41.249  25.314 48.068  1.00 147.49 ? 413 GLU A CG    1 
ATOM   3172 C CD    . GLU A 1 413 ? 41.719  23.929 47.657  1.00 154.57 ? 413 GLU A CD    1 
ATOM   3173 O OE1   . GLU A 1 413 ? 42.932  23.646 47.760  1.00 157.45 ? 413 GLU A OE1   1 
ATOM   3174 O OE2   . GLU A 1 413 ? 40.868  23.116 47.239  1.00 159.23 ? 413 GLU A OE2   1 
ATOM   3175 N N     . TRP A 1 414 ? 43.132  29.574 48.747  1.00 157.48 ? 414 TRP A N     1 
ATOM   3176 C CA    . TRP A 1 414 ? 44.237  30.533 48.733  1.00 154.99 ? 414 TRP A CA    1 
ATOM   3177 C C     . TRP A 1 414 ? 44.920  30.621 50.070  1.00 156.18 ? 414 TRP A C     1 
ATOM   3178 O O     . TRP A 1 414 ? 44.265  30.618 51.116  1.00 155.29 ? 414 TRP A O     1 
ATOM   3179 C CB    . TRP A 1 414 ? 43.769  31.911 48.262  1.00 145.42 ? 414 TRP A CB    1 
ATOM   3180 C CG    . TRP A 1 414 ? 42.767  32.583 49.173  1.00 149.74 ? 414 TRP A CG    1 
ATOM   3181 C CD1   . TRP A 1 414 ? 41.404  32.319 49.281  1.00 155.84 ? 414 TRP A CD1   1 
ATOM   3182 C CD2   . TRP A 1 414 ? 43.020  33.670 50.132  1.00 147.74 ? 414 TRP A CD2   1 
ATOM   3183 N NE1   . TRP A 1 414 ? 40.817  33.137 50.214  1.00 162.52 ? 414 TRP A NE1   1 
ATOM   3184 C CE2   . TRP A 1 414 ? 41.728  33.970 50.762  1.00 154.39 ? 414 TRP A CE2   1 
ATOM   3185 C CE3   . TRP A 1 414 ? 44.144  34.393 50.520  1.00 142.93 ? 414 TRP A CE3   1 
ATOM   3186 C CZ2   . TRP A 1 414 ? 41.593  34.954 51.732  1.00 153.38 ? 414 TRP A CZ2   1 
ATOM   3187 C CZ3   . TRP A 1 414 ? 43.994  35.384 51.500  1.00 138.09 ? 414 TRP A CZ3   1 
ATOM   3188 C CH2   . TRP A 1 414 ? 42.748  35.656 52.089  1.00 143.73 ? 414 TRP A CH2   1 
ATOM   3189 N N     . GLU A 1 415 ? 46.249  30.695 50.040  1.00 156.31 ? 415 GLU A N     1 
ATOM   3190 C CA    . GLU A 1 415 ? 47.059  30.744 51.257  1.00 149.71 ? 415 GLU A CA    1 
ATOM   3191 C C     . GLU A 1 415 ? 47.820  32.062 51.384  1.00 154.51 ? 415 GLU A C     1 
ATOM   3192 O O     . GLU A 1 415 ? 48.205  32.668 50.381  1.00 149.73 ? 415 GLU A O     1 
ATOM   3193 C CB    . GLU A 1 415 ? 48.036  29.567 51.296  1.00 139.90 ? 415 GLU A CB    1 
ATOM   3194 N N     . PHE A 1 416 ? 48.032  32.493 52.626  1.00 160.80 ? 416 PHE A N     1 
ATOM   3195 C CA    . PHE A 1 416 ? 48.735  33.742 52.913  1.00 163.68 ? 416 PHE A CA    1 
ATOM   3196 C C     . PHE A 1 416 ? 50.250  33.542 52.956  1.00 159.94 ? 416 PHE A C     1 
ATOM   3197 O O     . PHE A 1 416 ? 50.779  32.894 53.864  1.00 159.38 ? 416 PHE A O     1 
ATOM   3198 C CB    . PHE A 1 416 ? 48.223  34.358 54.225  1.00 158.95 ? 416 PHE A CB    1 
ATOM   3199 C CG    . PHE A 1 416 ? 48.988  35.576 54.670  1.00 151.76 ? 416 PHE A CG    1 
ATOM   3200 C CD1   . PHE A 1 416 ? 48.810  36.801 54.033  1.00 137.14 ? 416 PHE A CD1   1 
ATOM   3201 C CD2   . PHE A 1 416 ? 49.879  35.502 55.737  1.00 153.08 ? 416 PHE A CD2   1 
ATOM   3202 C CE1   . PHE A 1 416 ? 49.514  37.924 54.444  1.00 133.38 ? 416 PHE A CE1   1 
ATOM   3203 C CE2   . PHE A 1 416 ? 50.584  36.621 56.153  1.00 153.58 ? 416 PHE A CE2   1 
ATOM   3204 C CZ    . PHE A 1 416 ? 50.401  37.834 55.506  1.00 146.33 ? 416 PHE A CZ    1 
ATOM   3205 N N     . VAL A 1 417 ? 50.936  34.097 51.958  1.00 151.79 ? 417 VAL A N     1 
ATOM   3206 C CA    . VAL A 1 417 ? 52.397  34.067 51.886  1.00 141.73 ? 417 VAL A CA    1 
ATOM   3207 C C     . VAL A 1 417 ? 52.920  35.477 51.610  1.00 147.83 ? 417 VAL A C     1 
ATOM   3208 O O     . VAL A 1 417 ? 52.552  36.101 50.611  1.00 149.76 ? 417 VAL A O     1 
ATOM   3209 C CB    . VAL A 1 417 ? 52.905  33.076 50.808  1.00 145.86 ? 417 VAL A CB    1 
ATOM   3210 C CG1   . VAL A 1 417 ? 54.414  33.187 50.627  1.00 146.36 ? 417 VAL A CG1   1 
ATOM   3211 C CG2   . VAL A 1 417 ? 52.527  31.645 51.167  1.00 150.89 ? 417 VAL A CG2   1 
ATOM   3212 N N     . ASN A 1 418 ? 53.772  35.971 52.507  1.00 150.05 ? 418 ASN A N     1 
ATOM   3213 C CA    . ASN A 1 418 ? 54.323  37.320 52.402  1.00 152.89 ? 418 ASN A CA    1 
ATOM   3214 C C     . ASN A 1 418 ? 55.427  37.420 51.351  1.00 154.57 ? 418 ASN A C     1 
ATOM   3215 O O     . ASN A 1 418 ? 56.324  36.574 51.293  1.00 160.19 ? 418 ASN A O     1 
ATOM   3216 C CB    . ASN A 1 418 ? 54.837  37.797 53.766  1.00 145.69 ? 418 ASN A CB    1 
ATOM   3217 C CG    . ASN A 1 418 ? 54.954  39.310 53.855  1.00 138.54 ? 418 ASN A CG    1 
ATOM   3218 O OD1   . ASN A 1 418 ? 55.687  39.940 53.091  1.00 128.50 ? 418 ASN A OD1   1 
ATOM   3219 N ND2   . ASN A 1 418 ? 54.236  39.899 54.805  1.00 145.12 ? 418 ASN A ND2   1 
ATOM   3220 N N     . THR A 1 419 ? 55.345  38.461 50.525  1.00 150.77 ? 419 THR A N     1 
ATOM   3221 C CA    . THR A 1 419 ? 56.328  38.719 49.472  1.00 151.65 ? 419 THR A CA    1 
ATOM   3222 C C     . THR A 1 419 ? 56.990  40.086 49.677  1.00 146.15 ? 419 THR A C     1 
ATOM   3223 O O     . THR A 1 419 ? 56.369  40.988 50.246  1.00 140.38 ? 419 THR A O     1 
ATOM   3224 C CB    . THR A 1 419 ? 55.684  38.668 48.068  1.00 152.06 ? 419 THR A CB    1 
ATOM   3225 O OG1   . THR A 1 419 ? 54.563  39.559 48.018  1.00 141.68 ? 419 THR A OG1   1 
ATOM   3226 C CG2   . THR A 1 419 ? 55.226  37.254 47.728  1.00 154.03 ? 419 THR A CG2   1 
ATOM   3227 N N     . PRO A 1 420 ? 58.256  40.240 49.224  1.00 156.53 ? 420 PRO A N     1 
ATOM   3228 C CA    . PRO A 1 420 ? 58.973  41.521 49.308  1.00 162.70 ? 420 PRO A CA    1 
ATOM   3229 C C     . PRO A 1 420 ? 58.192  42.755 48.811  1.00 156.77 ? 420 PRO A C     1 
ATOM   3230 O O     . PRO A 1 420 ? 58.207  43.781 49.496  1.00 155.12 ? 420 PRO A O     1 
ATOM   3231 C CB    . PRO A 1 420 ? 60.226  41.275 48.463  1.00 162.34 ? 420 PRO A CB    1 
ATOM   3232 C CG    . PRO A 1 420 ? 60.486  39.818 48.625  1.00 156.37 ? 420 PRO A CG    1 
ATOM   3233 C CD    . PRO A 1 420 ? 59.140  39.155 48.750  1.00 156.00 ? 420 PRO A CD    1 
ATOM   3234 N N     . PRO A 1 421 ? 57.517  42.673 47.639  1.00 153.57 ? 421 PRO A N     1 
ATOM   3235 C CA    . PRO A 1 421 ? 56.672  43.813 47.295  1.00 148.79 ? 421 PRO A CA    1 
ATOM   3236 C C     . PRO A 1 421 ? 55.249  43.643 47.838  1.00 153.97 ? 421 PRO A C     1 
ATOM   3237 O O     . PRO A 1 421 ? 54.357  43.167 47.129  1.00 150.46 ? 421 PRO A O     1 
ATOM   3238 C CB    . PRO A 1 421 ? 56.691  43.821 45.760  1.00 142.73 ? 421 PRO A CB    1 
ATOM   3239 C CG    . PRO A 1 421 ? 57.128  42.451 45.344  1.00 141.03 ? 421 PRO A CG    1 
ATOM   3240 C CD    . PRO A 1 421 ? 57.525  41.665 46.562  1.00 149.67 ? 421 PRO A CD    1 
ATOM   3241 N N     . LEU A 1 422 ? 55.058  44.034 49.096  1.00 158.90 ? 422 LEU A N     1 
ATOM   3242 C CA    . LEU A 1 422 ? 53.777  43.881 49.783  1.00 156.62 ? 422 LEU A CA    1 
ATOM   3243 C C     . LEU A 1 422 ? 52.799  44.994 49.408  1.00 151.35 ? 422 LEU A C     1 
ATOM   3244 O O     . LEU A 1 422 ? 53.187  46.159 49.285  1.00 150.93 ? 422 LEU A O     1 
ATOM   3245 C CB    . LEU A 1 422 ? 53.990  43.852 51.302  1.00 157.34 ? 422 LEU A CB    1 
ATOM   3246 C CG    . LEU A 1 422 ? 52.863  43.330 52.201  1.00 143.87 ? 422 LEU A CG    1 
ATOM   3247 C CD1   . LEU A 1 422 ? 52.805  41.808 52.187  1.00 134.26 ? 422 LEU A CD1   1 
ATOM   3248 C CD2   . LEU A 1 422 ? 53.049  43.838 53.623  1.00 142.35 ? 422 LEU A CD2   1 
ATOM   3249 N N     . VAL A 1 423 ? 51.534  44.621 49.231  1.00 153.64 ? 423 VAL A N     1 
ATOM   3250 C CA    . VAL A 1 423 ? 50.473  45.572 48.900  1.00 155.53 ? 423 VAL A CA    1 
ATOM   3251 C C     . VAL A 1 423 ? 49.579  45.797 50.120  1.00 157.87 ? 423 VAL A C     1 
ATOM   3252 O O     . VAL A 1 423 ? 49.033  44.846 50.686  1.00 155.34 ? 423 VAL A O     1 
ATOM   3253 C CB    . VAL A 1 423 ? 49.626  45.094 47.695  1.00 148.65 ? 423 VAL A CB    1 
ATOM   3254 C CG1   . VAL A 1 423 ? 48.595  46.145 47.304  1.00 147.77 ? 423 VAL A CG1   1 
ATOM   3255 C CG2   . VAL A 1 423 ? 50.519  44.770 46.505  1.00 148.71 ? 423 VAL A CG2   1 
ATOM   3256 N N     . LYS A 1 424 ? 49.443  47.060 50.520  1.00 166.25 ? 424 LYS A N     1 
ATOM   3257 C CA    . LYS A 1 424 ? 48.647  47.430 51.690  1.00 160.31 ? 424 LYS A CA    1 
ATOM   3258 C C     . LYS A 1 424 ? 47.624  48.518 51.368  1.00 163.12 ? 424 LYS A C     1 
ATOM   3259 O O     . LYS A 1 424 ? 47.835  49.337 50.470  1.00 160.06 ? 424 LYS A O     1 
ATOM   3260 C CB    . LYS A 1 424 ? 49.558  47.885 52.833  1.00 149.17 ? 424 LYS A CB    1 
ATOM   3261 N N     . LEU A 1 425 ? 46.519  48.515 52.112  1.00 165.42 ? 425 LEU A N     1 
ATOM   3262 C CA    . LEU A 1 425 ? 45.453  49.502 51.945  1.00 161.91 ? 425 LEU A CA    1 
ATOM   3263 C C     . LEU A 1 425 ? 45.863  50.852 52.535  1.00 162.39 ? 425 LEU A C     1 
ATOM   3264 O O     . LEU A 1 425 ? 46.460  50.912 53.612  1.00 162.14 ? 425 LEU A O     1 
ATOM   3265 C CB    . LEU A 1 425 ? 44.158  49.004 52.598  1.00 154.39 ? 425 LEU A CB    1 
ATOM   3266 C CG    . LEU A 1 425 ? 42.841  49.729 52.289  1.00 141.82 ? 425 LEU A CG    1 
ATOM   3267 C CD1   . LEU A 1 425 ? 42.335  49.392 50.893  1.00 147.72 ? 425 LEU A CD1   1 
ATOM   3268 C CD2   . LEU A 1 425 ? 41.790  49.380 53.332  1.00 140.30 ? 425 LEU A CD2   1 
ATOM   3269 N N     . TRP A 1 426 ? 45.534  51.926 51.820  1.00 166.11 ? 426 TRP A N     1 
ATOM   3270 C CA    . TRP A 1 426 ? 45.905  53.280 52.232  1.00 171.27 ? 426 TRP A CA    1 
ATOM   3271 C C     . TRP A 1 426 ? 45.015  53.832 53.312  1.00 164.74 ? 426 TRP A C     1 
ATOM   3272 O O     . TRP A 1 426 ? 45.495  54.206 54.384  1.00 158.77 ? 426 TRP A O     1 
ATOM   3273 C CB    . TRP A 1 426 ? 45.931  54.223 51.031  1.00 172.89 ? 426 TRP A CB    1 
ATOM   3274 C CG    . TRP A 1 426 ? 47.065  53.960 50.068  1.00 173.38 ? 426 TRP A CG    1 
ATOM   3275 C CD1   . TRP A 1 426 ? 48.411  54.281 50.233  1.00 164.56 ? 426 TRP A CD1   1 
ATOM   3276 C CD2   . TRP A 1 426 ? 46.987  53.318 48.747  1.00 176.08 ? 426 TRP A CD2   1 
ATOM   3277 N NE1   . TRP A 1 426 ? 49.146  53.889 49.142  1.00 161.90 ? 426 TRP A NE1   1 
ATOM   3278 C CE2   . TRP A 1 426 ? 48.357  53.306 48.215  1.00 170.83 ? 426 TRP A CE2   1 
ATOM   3279 C CE3   . TRP A 1 426 ? 45.962  52.770 47.981  1.00 166.09 ? 426 TRP A CE3   1 
ATOM   3280 C CZ2   . TRP A 1 426 ? 48.659  52.766 46.973  1.00 164.49 ? 426 TRP A CZ2   1 
ATOM   3281 C CZ3   . TRP A 1 426 ? 46.281  52.229 46.729  1.00 155.64 ? 426 TRP A CZ3   1 
ATOM   3282 C CH2   . TRP A 1 426 ? 47.597  52.228 46.240  1.00 162.14 ? 426 TRP A CH2   1 
ATOM   3283 N N     . TYR A 1 427 ? 43.711  53.885 53.041  1.00 162.93 ? 427 TYR A N     1 
ATOM   3284 C CA    . TYR A 1 427 ? 42.747  54.483 53.967  1.00 159.14 ? 427 TYR A CA    1 
ATOM   3285 C C     . TYR A 1 427 ? 41.372  53.814 53.915  1.00 161.93 ? 427 TYR A C     1 
ATOM   3286 O O     . TYR A 1 427 ? 41.015  53.179 52.919  1.00 161.52 ? 427 TYR A O     1 
ATOM   3287 C CB    . TYR A 1 427 ? 42.615  55.994 53.711  1.00 155.71 ? 427 TYR A CB    1 
ATOM   3288 C CG    . TYR A 1 427 ? 42.120  56.362 52.325  1.00 157.70 ? 427 TYR A CG    1 
ATOM   3289 C CD1   . TYR A 1 427 ? 43.013  56.537 51.267  1.00 154.01 ? 427 TYR A CD1   1 
ATOM   3290 C CD2   . TYR A 1 427 ? 40.760  56.546 52.074  1.00 163.36 ? 427 TYR A CD2   1 
ATOM   3291 C CE1   . TYR A 1 427 ? 42.565  56.875 49.999  1.00 153.64 ? 427 TYR A CE1   1 
ATOM   3292 C CE2   . TYR A 1 427 ? 40.302  56.884 50.809  1.00 165.16 ? 427 TYR A CE2   1 
ATOM   3293 C CZ    . TYR A 1 427 ? 41.208  57.046 49.776  1.00 159.83 ? 427 TYR A CZ    1 
ATOM   3294 O OH    . TYR A 1 427 ? 40.758  57.384 48.520  1.00 165.31 ? 427 TYR A OH    1 
ATOM   3295 N N     . GLN A 1 428 ? 40.611  53.969 54.997  1.00 163.79 ? 428 GLN A N     1 
ATOM   3296 C CA    . GLN A 1 428 ? 39.249  53.448 55.085  1.00 163.33 ? 428 GLN A CA    1 
ATOM   3297 C C     . GLN A 1 428 ? 38.310  54.512 55.653  1.00 160.33 ? 428 GLN A C     1 
ATOM   3298 O O     . GLN A 1 428 ? 38.619  55.150 56.663  1.00 153.81 ? 428 GLN A O     1 
ATOM   3299 C CB    . GLN A 1 428 ? 39.212  52.182 55.947  1.00 155.70 ? 428 GLN A CB    1 
ATOM   3300 C CG    . GLN A 1 428 ? 37.915  51.388 55.848  1.00 147.31 ? 428 GLN A CG    1 
ATOM   3301 C CD    . GLN A 1 428 ? 37.903  50.155 56.734  1.00 139.64 ? 428 GLN A CD    1 
ATOM   3302 O OE1   . GLN A 1 428 ? 38.918  49.476 56.897  1.00 132.84 ? 428 GLN A OE1   1 
ATOM   3303 N NE2   . GLN A 1 428 ? 36.743  49.853 57.307  1.00 141.89 ? 428 GLN A NE2   1 
ATOM   3304 N N     . LEU A 1 429 ? 37.166  54.695 54.995  1.00 164.45 ? 429 LEU A N     1 
ATOM   3305 C CA    . LEU A 1 429 ? 36.180  55.697 55.402  1.00 159.83 ? 429 LEU A CA    1 
ATOM   3306 C C     . LEU A 1 429 ? 35.376  55.257 56.623  1.00 160.53 ? 429 LEU A C     1 
ATOM   3307 O O     . LEU A 1 429 ? 35.059  54.075 56.778  1.00 159.24 ? 429 LEU A O     1 
ATOM   3308 C CB    . LEU A 1 429 ? 35.235  56.031 54.241  1.00 159.07 ? 429 LEU A CB    1 
ATOM   3309 C CG    . LEU A 1 429 ? 35.791  56.841 53.063  1.00 150.28 ? 429 LEU A CG    1 
ATOM   3310 C CD1   . LEU A 1 429 ? 34.888  56.702 51.847  1.00 150.93 ? 429 LEU A CD1   1 
ATOM   3311 C CD2   . LEU A 1 429 ? 35.977  58.308 53.429  1.00 142.64 ? 429 LEU A CD2   1 
ATOM   3312 N N     . GLU A 1 430 ? 35.052  56.221 57.482  1.00 162.44 ? 430 GLU A N     1 
ATOM   3313 C CA    . GLU A 1 430 ? 34.291  55.963 58.705  1.00 157.19 ? 430 GLU A CA    1 
ATOM   3314 C C     . GLU A 1 430 ? 32.797  55.829 58.423  1.00 151.44 ? 430 GLU A C     1 
ATOM   3315 O O     . GLU A 1 430 ? 32.246  56.547 57.585  1.00 144.32 ? 430 GLU A O     1 
ATOM   3316 C CB    . GLU A 1 430 ? 34.533  57.071 59.736  1.00 152.38 ? 430 GLU A CB    1 
ATOM   3317 C CG    . GLU A 1 430 ? 35.947  57.117 60.305  1.00 143.69 ? 430 GLU A CG    1 
ATOM   3318 C CD    . GLU A 1 430 ? 36.257  55.959 61.240  1.00 146.66 ? 430 GLU A CD    1 
ATOM   3319 O OE1   . GLU A 1 430 ? 35.393  55.604 62.071  1.00 141.89 ? 430 GLU A OE1   1 
ATOM   3320 O OE2   . GLU A 1 430 ? 37.375  55.409 61.150  1.00 148.09 ? 430 GLU A OE2   1 
ATOM   3321 N N     . LYS A 1 431 ? 32.153  54.905 59.133  1.00 149.28 ? 431 LYS A N     1 
ATOM   3322 C CA    . LYS A 1 431 ? 30.717  54.661 58.987  1.00 146.39 ? 431 LYS A CA    1 
ATOM   3323 C C     . LYS A 1 431 ? 29.886  55.629 59.830  1.00 145.62 ? 431 LYS A C     1 
ATOM   3324 O O     . LYS A 1 431 ? 28.806  56.054 59.413  1.00 141.12 ? 431 LYS A O     1 
ATOM   3325 C CB    . LYS A 1 431 ? 30.373  53.214 59.353  1.00 146.54 ? 431 LYS A CB    1 
ATOM   3326 C CG    . LYS A 1 431 ? 30.905  52.174 58.379  1.00 148.28 ? 431 LYS A CG    1 
ATOM   3327 C CD    . LYS A 1 431 ? 30.541  50.766 58.821  1.00 154.97 ? 431 LYS A CD    1 
ATOM   3328 C CE    . LYS A 1 431 ? 31.082  49.726 57.853  1.00 160.35 ? 431 LYS A CE    1 
ATOM   3329 N NZ    . LYS A 1 431 ? 30.734  48.341 58.275  1.00 163.35 ? 431 LYS A NZ    1 
ATOM   3330 N N     . GLU A 1 432 ? 30.397  55.965 61.013  1.00 148.73 ? 432 GLU A N     1 
ATOM   3331 C CA    . GLU A 1 432 ? 29.719  56.878 61.933  1.00 147.40 ? 432 GLU A CA    1 
ATOM   3332 C C     . GLU A 1 432 ? 30.371  58.263 61.929  1.00 154.58 ? 432 GLU A C     1 
ATOM   3333 O O     . GLU A 1 432 ? 31.597  58.366 61.833  1.00 151.33 ? 432 GLU A O     1 
ATOM   3334 C CB    . GLU A 1 432 ? 29.710  56.300 63.354  1.00 148.59 ? 432 GLU A CB    1 
ATOM   3335 C CG    . GLU A 1 432 ? 28.802  55.089 63.542  1.00 152.05 ? 432 GLU A CG    1 
ATOM   3336 C CD    . GLU A 1 432 ? 27.322  55.429 63.470  1.00 153.57 ? 432 GLU A CD    1 
ATOM   3337 O OE1   . GLU A 1 432 ? 26.909  56.461 64.042  1.00 154.87 ? 432 GLU A OE1   1 
ATOM   3338 O OE2   . GLU A 1 432 ? 26.569  54.660 62.836  1.00 162.01 ? 432 GLU A OE2   1 
ATOM   3339 N N     . PRO A 1 433 ? 29.553  59.332 62.031  1.00 161.95 ? 433 PRO A N     1 
ATOM   3340 C CA    . PRO A 1 433 ? 30.069  60.706 62.052  1.00 164.91 ? 433 PRO A CA    1 
ATOM   3341 C C     . PRO A 1 433 ? 30.900  61.012 63.298  1.00 165.08 ? 433 PRO A C     1 
ATOM   3342 O O     . PRO A 1 433 ? 30.616  60.489 64.380  1.00 169.37 ? 433 PRO A O     1 
ATOM   3343 C CB    . PRO A 1 433 ? 28.797  61.563 62.038  1.00 159.55 ? 433 PRO A CB    1 
ATOM   3344 C CG    . PRO A 1 433 ? 27.727  60.673 62.572  1.00 156.83 ? 433 PRO A CG    1 
ATOM   3345 C CD    . PRO A 1 433 ? 28.079  59.304 62.074  1.00 156.40 ? 433 PRO A CD    1 
ATOM   3346 N N     . ILE A 1 434 ? 31.917  61.854 63.133  1.00 158.24 ? 434 ILE A N     1 
ATOM   3347 C CA    . ILE A 1 434 ? 32.824  62.216 64.221  1.00 154.53 ? 434 ILE A CA    1 
ATOM   3348 C C     . ILE A 1 434 ? 32.232  63.350 65.059  1.00 150.52 ? 434 ILE A C     1 
ATOM   3349 O O     . ILE A 1 434 ? 31.768  64.357 64.518  1.00 146.84 ? 434 ILE A O     1 
ATOM   3350 C CB    . ILE A 1 434 ? 34.220  62.627 63.694  1.00 147.95 ? 434 ILE A CB    1 
ATOM   3351 C CG1   . ILE A 1 434 ? 34.704  61.648 62.616  1.00 145.68 ? 434 ILE A CG1   1 
ATOM   3352 C CG2   . ILE A 1 434 ? 35.224  62.709 64.838  1.00 142.92 ? 434 ILE A CG2   1 
ATOM   3353 C CD1   . ILE A 1 434 ? 35.731  62.225 61.664  1.00 149.28 ? 434 ILE A CD1   1 
ATOM   3354 N N     . VAL A 1 435 ? 32.253  63.172 66.378  1.00 153.55 ? 435 VAL A N     1 
ATOM   3355 C CA    . VAL A 1 435 ? 31.731  64.172 67.313  1.00 149.10 ? 435 VAL A CA    1 
ATOM   3356 C C     . VAL A 1 435 ? 32.761  65.260 67.627  1.00 146.34 ? 435 VAL A C     1 
ATOM   3357 O O     . VAL A 1 435 ? 33.939  64.971 67.850  1.00 147.60 ? 435 VAL A O     1 
ATOM   3358 C CB    . VAL A 1 435 ? 31.205  63.534 68.625  1.00 150.61 ? 435 VAL A CB    1 
ATOM   3359 C CG1   . VAL A 1 435 ? 29.877  62.830 68.383  1.00 146.36 ? 435 VAL A CG1   1 
ATOM   3360 C CG2   . VAL A 1 435 ? 32.225  62.573 69.227  1.00 155.63 ? 435 VAL A CG2   1 
ATOM   3361 N N     . GLY A 1 436 ? 32.303  66.511 67.629  1.00 144.81 ? 436 GLY A N     1 
ATOM   3362 C CA    . GLY A 1 436 ? 33.156  67.659 67.939  1.00 155.89 ? 436 GLY A CA    1 
ATOM   3363 C C     . GLY A 1 436 ? 34.094  68.080 66.820  1.00 166.38 ? 436 GLY A C     1 
ATOM   3364 O O     . GLY A 1 436 ? 34.998  68.897 67.035  1.00 174.43 ? 436 GLY A O     1 
ATOM   3365 N N     . ALA A 1 437 ? 33.878  67.525 65.626  1.00 162.06 ? 437 ALA A N     1 
ATOM   3366 C CA    . ALA A 1 437 ? 34.708  67.830 64.461  1.00 156.90 ? 437 ALA A CA    1 
ATOM   3367 C C     . ALA A 1 437 ? 34.065  68.896 63.574  1.00 154.24 ? 437 ALA A C     1 
ATOM   3368 O O     . ALA A 1 437 ? 32.841  69.047 63.558  1.00 151.71 ? 437 ALA A O     1 
ATOM   3369 C CB    . ALA A 1 437 ? 34.983  66.564 63.662  1.00 143.54 ? 437 ALA A CB    1 
ATOM   3370 N N     . GLU A 1 438 ? 34.902  69.628 62.841  1.00 154.96 ? 438 GLU A N     1 
ATOM   3371 C CA    . GLU A 1 438 ? 34.441  70.685 61.941  1.00 147.57 ? 438 GLU A CA    1 
ATOM   3372 C C     . GLU A 1 438 ? 33.786  70.098 60.691  1.00 146.10 ? 438 GLU A C     1 
ATOM   3373 O O     . GLU A 1 438 ? 34.333  69.190 60.058  1.00 144.29 ? 438 GLU A O     1 
ATOM   3374 C CB    . GLU A 1 438 ? 35.603  71.608 61.558  1.00 151.29 ? 438 GLU A CB    1 
ATOM   3375 C CG    . GLU A 1 438 ? 35.184  72.904 60.876  1.00 151.05 ? 438 GLU A CG    1 
ATOM   3376 C CD    . GLU A 1 438 ? 36.355  73.820 60.558  1.00 149.44 ? 438 GLU A CD    1 
ATOM   3377 O OE1   . GLU A 1 438 ? 37.487  73.321 60.377  1.00 151.77 ? 438 GLU A OE1   1 
ATOM   3378 O OE2   . GLU A 1 438 ? 36.139  75.048 60.481  1.00 142.59 ? 438 GLU A OE2   1 
ATOM   3379 N N     . THR A 1 439 ? 32.613  70.625 60.348  1.00 145.86 ? 439 THR A N     1 
ATOM   3380 C CA    . THR A 1 439 ? 31.845  70.153 59.197  1.00 144.19 ? 439 THR A CA    1 
ATOM   3381 C C     . THR A 1 439 ? 32.206  70.941 57.938  1.00 145.62 ? 439 THR A C     1 
ATOM   3382 O O     . THR A 1 439 ? 32.221  72.175 57.947  1.00 145.02 ? 439 THR A O     1 
ATOM   3383 C CB    . THR A 1 439 ? 30.325  70.241 59.460  1.00 146.29 ? 439 THR A CB    1 
ATOM   3384 O OG1   . THR A 1 439 ? 30.027  69.688 60.748  1.00 154.78 ? 439 THR A OG1   1 
ATOM   3385 C CG2   . THR A 1 439 ? 29.539  69.481 58.395  1.00 141.59 ? 439 THR A CG2   1 
ATOM   3386 N N     . PHE A 1 440 ? 32.500  70.214 56.862  1.00 150.61 ? 440 PHE A N     1 
ATOM   3387 C CA    . PHE A 1 440 ? 32.849  70.814 55.577  1.00 152.61 ? 440 PHE A CA    1 
ATOM   3388 C C     . PHE A 1 440 ? 31.827  70.453 54.502  1.00 151.87 ? 440 PHE A C     1 
ATOM   3389 O O     . PHE A 1 440 ? 31.532  69.275 54.283  1.00 155.58 ? 440 PHE A O     1 
ATOM   3390 C CB    . PHE A 1 440 ? 34.251  70.375 55.141  1.00 157.19 ? 440 PHE A CB    1 
ATOM   3391 C CG    . PHE A 1 440 ? 35.366  71.087 55.858  1.00 153.94 ? 440 PHE A CG    1 
ATOM   3392 C CD1   . PHE A 1 440 ? 35.800  70.655 57.108  1.00 152.21 ? 440 PHE A CD1   1 
ATOM   3393 C CD2   . PHE A 1 440 ? 35.990  72.187 55.278  1.00 149.45 ? 440 PHE A CD2   1 
ATOM   3394 C CE1   . PHE A 1 440 ? 36.830  71.310 57.768  1.00 150.13 ? 440 PHE A CE1   1 
ATOM   3395 C CE2   . PHE A 1 440 ? 37.022  72.845 55.932  1.00 147.96 ? 440 PHE A CE2   1 
ATOM   3396 C CZ    . PHE A 1 440 ? 37.441  72.407 57.179  1.00 148.86 ? 440 PHE A CZ    1 
ATOM   3397 N N     . TYR A 1 441 ? 31.289  71.476 53.841  1.00 153.58 ? 441 TYR A N     1 
ATOM   3398 C CA    . TYR A 1 441 ? 30.342  71.287 52.744  1.00 159.92 ? 441 TYR A CA    1 
ATOM   3399 C C     . TYR A 1 441 ? 31.035  71.477 51.398  1.00 159.62 ? 441 TYR A C     1 
ATOM   3400 O O     . TYR A 1 441 ? 31.682  72.501 51.160  1.00 154.67 ? 441 TYR A O     1 
ATOM   3401 C CB    . TYR A 1 441 ? 29.153  72.244 52.880  1.00 158.83 ? 441 TYR A CB    1 
ATOM   3402 C CG    . TYR A 1 441 ? 28.217  71.911 54.023  1.00 159.72 ? 441 TYR A CG    1 
ATOM   3403 C CD1   . TYR A 1 441 ? 27.148  71.034 53.841  1.00 151.73 ? 441 TYR A CD1   1 
ATOM   3404 C CD2   . TYR A 1 441 ? 28.398  72.475 55.287  1.00 160.39 ? 441 TYR A CD2   1 
ATOM   3405 C CE1   . TYR A 1 441 ? 26.287  70.726 54.884  1.00 149.85 ? 441 TYR A CE1   1 
ATOM   3406 C CE2   . TYR A 1 441 ? 27.542  72.173 56.335  1.00 154.92 ? 441 TYR A CE2   1 
ATOM   3407 C CZ    . TYR A 1 441 ? 26.488  71.297 56.128  1.00 146.64 ? 441 TYR A CZ    1 
ATOM   3408 O OH    . TYR A 1 441 ? 25.636  70.995 57.165  1.00 139.47 ? 441 TYR A OH    1 
ATOM   3409 N N     . VAL A 1 442 ? 30.895  70.482 50.525  1.00 163.39 ? 442 VAL A N     1 
ATOM   3410 C CA    . VAL A 1 442 ? 31.583  70.469 49.233  1.00 156.65 ? 442 VAL A CA    1 
ATOM   3411 C C     . VAL A 1 442 ? 30.595  70.563 48.066  1.00 160.63 ? 442 VAL A C     1 
ATOM   3412 O O     . VAL A 1 442 ? 29.727  69.701 47.902  1.00 164.98 ? 442 VAL A O     1 
ATOM   3413 C CB    . VAL A 1 442 ? 32.487  69.218 49.086  1.00 154.42 ? 442 VAL A CB    1 
ATOM   3414 C CG1   . VAL A 1 442 ? 33.069  69.120 47.682  1.00 152.18 ? 442 VAL A CG1   1 
ATOM   3415 C CG2   . VAL A 1 442 ? 33.605  69.242 50.119  1.00 148.15 ? 442 VAL A CG2   1 
ATOM   3416 N N     . ASP A 1 443 ? 30.738  71.623 47.271  1.00 157.25 ? 443 ASP A N     1 
ATOM   3417 C CA    . ASP A 1 443 ? 29.938  71.827 46.062  1.00 157.78 ? 443 ASP A CA    1 
ATOM   3418 C C     . ASP A 1 443 ? 30.669  72.745 45.083  1.00 145.95 ? 443 ASP A C     1 
ATOM   3419 O O     . ASP A 1 443 ? 31.227  73.772 45.479  1.00 138.42 ? 443 ASP A O     1 
ATOM   3420 C CB    . ASP A 1 443 ? 28.559  72.406 46.407  1.00 153.18 ? 443 ASP A CB    1 
ATOM   3421 C CG    . ASP A 1 443 ? 27.606  72.415 45.218  1.00 151.90 ? 443 ASP A CG    1 
ATOM   3422 O OD1   . ASP A 1 443 ? 27.776  71.593 44.291  1.00 165.02 ? 443 ASP A OD1   1 
ATOM   3423 O OD2   . ASP A 1 443 ? 26.678  73.251 45.213  1.00 145.30 ? 443 ASP A OD2   1 
ATOM   3424 N N     . GLY A 1 444 ? 30.658  72.367 43.807  1.00 147.48 ? 444 GLY A N     1 
ATOM   3425 C CA    . GLY A 1 444 ? 31.333  73.133 42.760  1.00 139.68 ? 444 GLY A CA    1 
ATOM   3426 C C     . GLY A 1 444 ? 30.593  73.137 41.435  1.00 142.48 ? 444 GLY A C     1 
ATOM   3427 O O     . GLY A 1 444 ? 29.878  72.186 41.109  1.00 146.42 ? 444 GLY A O     1 
ATOM   3428 N N     . ALA A 1 445 ? 30.773  74.214 40.672  1.00 147.05 ? 445 ALA A N     1 
ATOM   3429 C CA    . ALA A 1 445 ? 30.137  74.367 39.364  1.00 155.33 ? 445 ALA A CA    1 
ATOM   3430 C C     . ALA A 1 445 ? 31.114  74.909 38.323  1.00 156.79 ? 445 ALA A C     1 
ATOM   3431 O O     . ALA A 1 445 ? 32.009  75.694 38.647  1.00 151.11 ? 445 ALA A O     1 
ATOM   3432 C CB    . ALA A 1 445 ? 28.916  75.270 39.470  1.00 157.51 ? 445 ALA A CB    1 
ATOM   3433 N N     . ALA A 1 446 ? 30.933  74.484 37.074  1.00 159.70 ? 446 ALA A N     1 
ATOM   3434 C CA    . ALA A 1 446 ? 31.785  74.914 35.964  1.00 156.94 ? 446 ALA A CA    1 
ATOM   3435 C C     . ALA A 1 446 ? 30.983  75.135 34.681  1.00 158.52 ? 446 ALA A C     1 
ATOM   3436 O O     . ALA A 1 446 ? 29.897  74.575 34.511  1.00 157.25 ? 446 ALA A O     1 
ATOM   3437 C CB    . ALA A 1 446 ? 32.899  73.904 35.728  1.00 150.36 ? 446 ALA A CB    1 
ATOM   3438 N N     . SER A 1 447 ? 31.529  75.956 33.786  1.00 155.15 ? 447 SER A N     1 
ATOM   3439 C CA    . SER A 1 447 ? 30.889  76.260 32.507  1.00 152.12 ? 447 SER A CA    1 
ATOM   3440 C C     . SER A 1 447 ? 31.552  75.508 31.355  1.00 152.51 ? 447 SER A C     1 
ATOM   3441 O O     . SER A 1 447 ? 32.762  75.271 31.370  1.00 151.93 ? 447 SER A O     1 
ATOM   3442 C CB    . SER A 1 447 ? 30.920  77.767 32.239  1.00 151.75 ? 447 SER A CB    1 
ATOM   3443 O OG    . SER A 1 447 ? 30.203  78.094 31.060  1.00 150.64 ? 447 SER A OG    1 
ATOM   3444 N N     . ARG A 1 448 ? 30.747  75.141 30.360  1.00 151.95 ? 448 ARG A N     1 
ATOM   3445 C CA    . ARG A 1 448 ? 31.235  74.440 29.172  1.00 153.11 ? 448 ARG A CA    1 
ATOM   3446 C C     . ARG A 1 448 ? 31.986  75.380 28.230  1.00 151.46 ? 448 ARG A C     1 
ATOM   3447 O O     . ARG A 1 448 ? 33.004  75.001 27.646  1.00 148.24 ? 448 ARG A O     1 
ATOM   3448 C CB    . ARG A 1 448 ? 30.077  73.763 28.434  1.00 153.36 ? 448 ARG A CB    1 
ATOM   3449 N N     . GLU A 1 449 ? 31.476  76.603 28.089  1.00 152.86 ? 449 GLU A N     1 
ATOM   3450 C CA    . GLU A 1 449 ? 32.100  77.623 27.248  1.00 155.72 ? 449 GLU A CA    1 
ATOM   3451 C C     . GLU A 1 449 ? 33.299  78.251 27.954  1.00 159.89 ? 449 GLU A C     1 
ATOM   3452 O O     . GLU A 1 449 ? 33.235  78.549 29.150  1.00 158.21 ? 449 GLU A O     1 
ATOM   3453 C CB    . GLU A 1 449 ? 31.088  78.708 26.861  1.00 155.37 ? 449 GLU A CB    1 
ATOM   3454 C CG    . GLU A 1 449 ? 30.039  78.275 25.843  1.00 149.07 ? 449 GLU A CG    1 
ATOM   3455 C CD    . GLU A 1 449 ? 28.899  77.475 26.452  1.00 147.42 ? 449 GLU A CD    1 
ATOM   3456 O OE1   . GLU A 1 449 ? 28.427  77.836 27.553  1.00 145.58 ? 449 GLU A OE1   1 
ATOM   3457 O OE2   . GLU A 1 449 ? 28.466  76.487 25.823  1.00 142.47 ? 449 GLU A OE2   1 
ATOM   3458 N N     . THR A 1 450 ? 34.385  78.440 27.201  1.00 157.77 ? 450 THR A N     1 
ATOM   3459 C CA    . THR A 1 450 ? 35.648  79.022 27.699  1.00 147.91 ? 450 THR A CA    1 
ATOM   3460 C C     . THR A 1 450 ? 36.354  78.137 28.743  1.00 152.26 ? 450 THR A C     1 
ATOM   3461 O O     . THR A 1 450 ? 37.534  78.342 29.046  1.00 152.05 ? 450 THR A O     1 
ATOM   3462 C CB    . THR A 1 450 ? 35.462  80.467 28.234  1.00 146.53 ? 450 THR A CB    1 
ATOM   3463 O OG1   . THR A 1 450 ? 34.475  81.153 27.452  1.00 152.59 ? 450 THR A OG1   1 
ATOM   3464 C CG2   . THR A 1 450 ? 36.772  81.249 28.175  1.00 141.00 ? 450 THR A CG2   1 
ATOM   3465 N N     . LYS A 1 451 ? 35.625  77.150 29.268  1.00 153.94 ? 451 LYS A N     1 
ATOM   3466 C CA    . LYS A 1 451 ? 36.125  76.194 30.268  1.00 150.41 ? 451 LYS A CA    1 
ATOM   3467 C C     . LYS A 1 451 ? 36.619  76.863 31.554  1.00 151.07 ? 451 LYS A C     1 
ATOM   3468 O O     . LYS A 1 451 ? 37.823  76.913 31.825  1.00 151.87 ? 451 LYS A O     1 
ATOM   3469 C CB    . LYS A 1 451 ? 37.196  75.264 29.672  1.00 153.10 ? 451 LYS A CB    1 
ATOM   3470 C CG    . LYS A 1 451 ? 36.670  74.279 28.641  1.00 150.21 ? 451 LYS A CG    1 
ATOM   3471 C CD    . LYS A 1 451 ? 37.784  73.396 28.102  1.00 148.35 ? 451 LYS A CD    1 
ATOM   3472 C CE    . LYS A 1 451 ? 37.258  72.410 27.071  1.00 142.25 ? 451 LYS A CE    1 
ATOM   3473 N NZ    . LYS A 1 451 ? 38.339  71.538 26.534  1.00 136.87 ? 451 LYS A NZ    1 
ATOM   3474 N N     . LEU A 1 452 ? 35.673  77.382 32.333  1.00 147.89 ? 452 LEU A N     1 
ATOM   3475 C CA    . LEU A 1 452 ? 35.974  78.046 33.601  1.00 148.26 ? 452 LEU A CA    1 
ATOM   3476 C C     . LEU A 1 452 ? 35.099  77.503 34.728  1.00 149.66 ? 452 LEU A C     1 
ATOM   3477 O O     . LEU A 1 452 ? 33.905  77.260 34.537  1.00 149.74 ? 452 LEU A O     1 
ATOM   3478 C CB    . LEU A 1 452 ? 35.793  79.564 33.477  1.00 148.14 ? 452 LEU A CB    1 
ATOM   3479 C CG    . LEU A 1 452 ? 36.767  80.354 32.594  1.00 146.80 ? 452 LEU A CG    1 
ATOM   3480 C CD1   . LEU A 1 452 ? 36.193  81.722 32.258  1.00 145.77 ? 452 LEU A CD1   1 
ATOM   3481 C CD2   . LEU A 1 452 ? 38.137  80.489 33.247  1.00 151.39 ? 452 LEU A CD2   1 
ATOM   3482 N N     . GLY A 1 453 ? 35.704  77.318 35.900  1.00 146.71 ? 453 GLY A N     1 
ATOM   3483 C CA    . GLY A 1 453 ? 34.998  76.789 37.064  1.00 144.35 ? 453 GLY A CA    1 
ATOM   3484 C C     . GLY A 1 453 ? 35.487  77.353 38.385  1.00 146.54 ? 453 GLY A C     1 
ATOM   3485 O O     . GLY A 1 453 ? 36.610  77.855 38.481  1.00 148.86 ? 453 GLY A O     1 
ATOM   3486 N N     . LYS A 1 454 ? 34.635  77.266 39.403  1.00 144.84 ? 454 LYS A N     1 
ATOM   3487 C CA    . LYS A 1 454 ? 34.953  77.763 40.741  1.00 145.62 ? 454 LYS A CA    1 
ATOM   3488 C C     . LYS A 1 454 ? 34.801  76.671 41.799  1.00 146.92 ? 454 LYS A C     1 
ATOM   3489 O O     . LYS A 1 454 ? 33.962  75.777 41.666  1.00 142.83 ? 454 LYS A O     1 
ATOM   3490 C CB    . LYS A 1 454 ? 34.071  78.964 41.096  1.00 145.59 ? 454 LYS A CB    1 
ATOM   3491 C CG    . LYS A 1 454 ? 34.385  80.230 40.314  1.00 147.49 ? 454 LYS A CG    1 
ATOM   3492 C CD    . LYS A 1 454 ? 33.462  81.369 40.714  1.00 138.82 ? 454 LYS A CD    1 
ATOM   3493 C CE    . LYS A 1 454 ? 33.772  82.633 39.928  1.00 140.10 ? 454 LYS A CE    1 
ATOM   3494 N NZ    . LYS A 1 454 ? 32.873  83.758 40.309  1.00 143.49 ? 454 LYS A NZ    1 
ATOM   3495 N N     . ALA A 1 455 ? 35.620  76.756 42.845  1.00 150.17 ? 455 ALA A N     1 
ATOM   3496 C CA    . ALA A 1 455 ? 35.579  75.804 43.954  1.00 151.72 ? 455 ALA A CA    1 
ATOM   3497 C C     . ALA A 1 455 ? 35.596  76.525 45.299  1.00 153.30 ? 455 ALA A C     1 
ATOM   3498 O O     . ALA A 1 455 ? 36.380  77.456 45.505  1.00 152.15 ? 455 ALA A O     1 
ATOM   3499 C CB    . ALA A 1 455 ? 36.738  74.823 43.857  1.00 150.46 ? 455 ALA A CB    1 
ATOM   3500 N N     . GLY A 1 456 ? 34.727  76.089 46.208  1.00 155.72 ? 456 GLY A N     1 
ATOM   3501 C CA    . GLY A 1 456 ? 34.617  76.694 47.534  1.00 154.02 ? 456 GLY A CA    1 
ATOM   3502 C C     . GLY A 1 456 ? 33.988  75.786 48.574  1.00 161.65 ? 456 GLY A C     1 
ATOM   3503 O O     . GLY A 1 456 ? 33.431  74.736 48.243  1.00 165.18 ? 456 GLY A O     1 
ATOM   3504 N N     . TYR A 1 457 ? 34.083  76.197 49.837  1.00 162.91 ? 457 TYR A N     1 
ATOM   3505 C CA    . TYR A 1 457 ? 33.517  75.442 50.957  1.00 163.46 ? 457 TYR A CA    1 
ATOM   3506 C C     . TYR A 1 457 ? 33.051  76.358 52.088  1.00 162.19 ? 457 TYR A C     1 
ATOM   3507 O O     . TYR A 1 457 ? 33.719  77.341 52.419  1.00 161.72 ? 457 TYR A O     1 
ATOM   3508 C CB    . TYR A 1 457 ? 34.514  74.395 51.480  1.00 162.76 ? 457 TYR A CB    1 
ATOM   3509 C CG    . TYR A 1 457 ? 35.849  74.950 51.941  1.00 159.92 ? 457 TYR A CG    1 
ATOM   3510 C CD1   . TYR A 1 457 ? 36.897  75.145 51.039  1.00 161.82 ? 457 TYR A CD1   1 
ATOM   3511 C CD2   . TYR A 1 457 ? 36.071  75.264 53.283  1.00 151.97 ? 457 TYR A CD2   1 
ATOM   3512 C CE1   . TYR A 1 457 ? 38.120  75.648 51.457  1.00 159.44 ? 457 TYR A CE1   1 
ATOM   3513 C CE2   . TYR A 1 457 ? 37.290  75.768 53.710  1.00 149.64 ? 457 TYR A CE2   1 
ATOM   3514 C CZ    . TYR A 1 457 ? 38.311  75.957 52.792  1.00 157.26 ? 457 TYR A CZ    1 
ATOM   3515 O OH    . TYR A 1 457 ? 39.524  76.455 53.211  1.00 156.26 ? 457 TYR A OH    1 
ATOM   3516 N N     . VAL A 1 458 ? 31.898  76.029 52.668  1.00 158.86 ? 458 VAL A N     1 
ATOM   3517 C CA    . VAL A 1 458 ? 31.325  76.803 53.772  1.00 155.61 ? 458 VAL A CA    1 
ATOM   3518 C C     . VAL A 1 458 ? 31.263  75.949 55.039  1.00 153.49 ? 458 VAL A C     1 
ATOM   3519 O O     . VAL A 1 458 ? 30.698  74.852 55.034  1.00 149.30 ? 458 VAL A O     1 
ATOM   3520 C CB    . VAL A 1 458 ? 29.922  77.358 53.420  1.00 143.01 ? 458 VAL A CB    1 
ATOM   3521 C CG1   . VAL A 1 458 ? 29.309  78.093 54.605  1.00 141.71 ? 458 VAL A CG1   1 
ATOM   3522 C CG2   . VAL A 1 458 ? 29.996  78.285 52.214  1.00 142.03 ? 458 VAL A CG2   1 
ATOM   3523 N N     . THR A 1 459 ? 31.853  76.463 56.116  1.00 155.91 ? 459 THR A N     1 
ATOM   3524 C CA    . THR A 1 459 ? 31.885  75.768 57.404  1.00 148.77 ? 459 THR A CA    1 
ATOM   3525 C C     . THR A 1 459 ? 30.913  76.389 58.408  1.00 147.63 ? 459 THR A C     1 
ATOM   3526 O O     . THR A 1 459 ? 30.405  77.492 58.194  1.00 145.91 ? 459 THR A O     1 
ATOM   3527 C CB    . THR A 1 459 ? 33.305  75.760 58.011  1.00 149.31 ? 459 THR A CB    1 
ATOM   3528 O OG1   . THR A 1 459 ? 33.814  77.098 58.064  1.00 144.50 ? 459 THR A OG1   1 
ATOM   3529 C CG2   . THR A 1 459 ? 34.243  74.895 57.180  1.00 150.60 ? 459 THR A CG2   1 
ATOM   3530 N N     . ASN A 1 460 ? 30.664  75.669 59.501  1.00 146.53 ? 460 ASN A N     1 
ATOM   3531 C CA    . ASN A 1 460 ? 29.779  76.138 60.569  1.00 155.20 ? 460 ASN A CA    1 
ATOM   3532 C C     . ASN A 1 460 ? 30.383  77.263 61.413  1.00 156.42 ? 460 ASN A C     1 
ATOM   3533 O O     . ASN A 1 460 ? 29.654  78.026 62.052  1.00 162.10 ? 460 ASN A O     1 
ATOM   3534 C CB    . ASN A 1 460 ? 29.345  74.970 61.466  1.00 148.91 ? 460 ASN A CB    1 
ATOM   3535 C CG    . ASN A 1 460 ? 30.514  74.289 62.159  1.00 145.90 ? 460 ASN A CG    1 
ATOM   3536 O OD1   . ASN A 1 460 ? 31.544  74.006 61.543  1.00 141.82 ? 460 ASN A OD1   1 
ATOM   3537 N ND2   . ASN A 1 460 ? 30.355  74.014 63.448  1.00 145.01 ? 460 ASN A ND2   1 
ATOM   3538 N N     . LYS A 1 461 ? 31.712  77.356 61.409  1.00 150.21 ? 461 LYS A N     1 
ATOM   3539 C CA    . LYS A 1 461 ? 32.430  78.393 62.152  1.00 148.87 ? 461 LYS A CA    1 
ATOM   3540 C C     . LYS A 1 461 ? 32.302  79.767 61.494  1.00 159.44 ? 461 LYS A C     1 
ATOM   3541 O O     . LYS A 1 461 ? 32.011  80.757 62.169  1.00 167.66 ? 461 LYS A O     1 
ATOM   3542 C CB    . LYS A 1 461 ? 33.906  78.017 62.326  1.00 143.23 ? 461 LYS A CB    1 
ATOM   3543 C CG    . LYS A 1 461 ? 34.153  76.901 63.329  1.00 143.68 ? 461 LYS A CG    1 
ATOM   3544 C CD    . LYS A 1 461 ? 35.639  76.618 63.488  1.00 146.25 ? 461 LYS A CD    1 
ATOM   3545 C CE    . LYS A 1 461 ? 35.900  75.555 64.545  1.00 151.16 ? 461 LYS A CE    1 
ATOM   3546 N NZ    . LYS A 1 461 ? 35.443  74.200 64.125  1.00 152.07 ? 461 LYS A NZ    1 
ATOM   3547 N N     . GLY A 1 462 ? 32.521  79.821 60.181  1.00 159.48 ? 462 GLY A N     1 
ATOM   3548 C CA    . GLY A 1 462 ? 32.387  81.065 59.424  1.00 162.83 ? 462 GLY A CA    1 
ATOM   3549 C C     . GLY A 1 462 ? 33.431  81.286 58.343  1.00 157.63 ? 462 GLY A C     1 
ATOM   3550 O O     . GLY A 1 462 ? 33.255  82.145 57.476  1.00 154.80 ? 462 GLY A O     1 
ATOM   3551 N N     . ARG A 1 463 ? 34.516  80.514 58.393  1.00 155.29 ? 463 ARG A N     1 
ATOM   3552 C CA    . ARG A 1 463 ? 35.613  80.649 57.430  1.00 156.71 ? 463 ARG A CA    1 
ATOM   3553 C C     . ARG A 1 463 ? 35.268  80.068 56.057  1.00 151.75 ? 463 ARG A C     1 
ATOM   3554 O O     . ARG A 1 463 ? 34.657  79.000 55.959  1.00 144.76 ? 463 ARG A O     1 
ATOM   3555 C CB    . ARG A 1 463 ? 36.914  80.042 57.980  1.00 158.61 ? 463 ARG A CB    1 
ATOM   3556 C CG    . ARG A 1 463 ? 36.826  78.582 58.406  1.00 155.81 ? 463 ARG A CG    1 
ATOM   3557 C CD    . ARG A 1 463 ? 38.103  78.117 59.091  1.00 155.85 ? 463 ARG A CD    1 
ATOM   3558 N NE    . ARG A 1 463 ? 39.245  78.077 58.178  1.00 154.88 ? 463 ARG A NE    1 
ATOM   3559 C CZ    . ARG A 1 463 ? 40.484  77.737 58.528  1.00 152.00 ? 463 ARG A CZ    1 
ATOM   3560 N NH1   . ARG A 1 463 ? 40.763  77.400 59.781  1.00 149.93 ? 463 ARG A NH1   1 
ATOM   3561 N NH2   . ARG A 1 463 ? 41.449  77.734 57.619  1.00 154.92 ? 463 ARG A NH2   1 
ATOM   3562 N N     . GLN A 1 464 ? 35.661  80.784 55.005  1.00 154.09 ? 464 GLN A N     1 
ATOM   3563 C CA    . GLN A 1 464 ? 35.386  80.376 53.624  1.00 150.22 ? 464 GLN A CA    1 
ATOM   3564 C C     . GLN A 1 464 ? 36.463  80.858 52.650  1.00 154.76 ? 464 GLN A C     1 
ATOM   3565 O O     . GLN A 1 464 ? 37.108  81.884 52.881  1.00 164.06 ? 464 GLN A O     1 
ATOM   3566 C CB    . GLN A 1 464 ? 33.996  80.858 53.177  1.00 152.89 ? 464 GLN A CB    1 
ATOM   3567 C CG    . GLN A 1 464 ? 33.766  82.361 53.288  1.00 152.03 ? 464 GLN A CG    1 
ATOM   3568 C CD    . GLN A 1 464 ? 32.338  82.771 52.971  1.00 155.55 ? 464 GLN A CD    1 
ATOM   3569 O OE1   . GLN A 1 464 ? 31.712  83.509 53.734  1.00 157.94 ? 464 GLN A OE1   1 
ATOM   3570 N NE2   . GLN A 1 464 ? 31.815  82.295 51.843  1.00 161.76 ? 464 GLN A NE2   1 
ATOM   3571 N N     . LYS A 1 465 ? 36.649  80.108 51.564  1.00 149.16 ? 465 LYS A N     1 
ATOM   3572 C CA    . LYS A 1 465 ? 37.633  80.448 50.537  1.00 152.03 ? 465 LYS A CA    1 
ATOM   3573 C C     . LYS A 1 465 ? 37.098  80.128 49.140  1.00 154.45 ? 465 LYS A C     1 
ATOM   3574 O O     . LYS A 1 465 ? 36.690  78.997 48.866  1.00 145.97 ? 465 LYS A O     1 
ATOM   3575 C CB    . LYS A 1 465 ? 38.952  79.707 50.790  1.00 154.04 ? 465 LYS A CB    1 
ATOM   3576 C CG    . LYS A 1 465 ? 40.129  80.211 49.965  1.00 151.85 ? 465 LYS A CG    1 
ATOM   3577 C CD    . LYS A 1 465 ? 41.399  79.415 50.235  1.00 147.59 ? 465 LYS A CD    1 
ATOM   3578 C CE    . LYS A 1 465 ? 42.077  79.845 51.528  1.00 151.11 ? 465 LYS A CE    1 
ATOM   3579 N NZ    . LYS A 1 465 ? 43.316  79.061 51.792  1.00 144.51 ? 465 LYS A NZ    1 
ATOM   3580 N N     . VAL A 1 466 ? 37.102  81.135 48.269  1.00 161.78 ? 466 VAL A N     1 
ATOM   3581 C CA    . VAL A 1 466 ? 36.621  80.989 46.893  1.00 160.01 ? 466 VAL A CA    1 
ATOM   3582 C C     . VAL A 1 466 ? 37.759  81.254 45.904  1.00 157.11 ? 466 VAL A C     1 
ATOM   3583 O O     . VAL A 1 466 ? 38.397  82.310 45.947  1.00 151.22 ? 466 VAL A O     1 
ATOM   3584 C CB    . VAL A 1 466 ? 35.427  81.931 46.595  1.00 155.40 ? 466 VAL A CB    1 
ATOM   3585 C CG1   . VAL A 1 466 ? 34.902  81.715 45.182  1.00 146.76 ? 466 VAL A CG1   1 
ATOM   3586 C CG2   . VAL A 1 466 ? 34.306  81.724 47.606  1.00 152.48 ? 466 VAL A CG2   1 
ATOM   3587 N N     . VAL A 1 467 ? 38.007  80.286 45.024  1.00 155.10 ? 467 VAL A N     1 
ATOM   3588 C CA    . VAL A 1 467 ? 39.067  80.390 44.014  1.00 148.58 ? 467 VAL A CA    1 
ATOM   3589 C C     . VAL A 1 467 ? 38.539  80.177 42.593  1.00 148.24 ? 467 VAL A C     1 
ATOM   3590 O O     . VAL A 1 467 ? 37.486  79.565 42.397  1.00 151.26 ? 467 VAL A O     1 
ATOM   3591 C CB    . VAL A 1 467 ? 40.237  79.411 44.288  1.00 142.08 ? 467 VAL A CB    1 
ATOM   3592 C CG1   . VAL A 1 467 ? 41.055  79.868 45.489  1.00 139.78 ? 467 VAL A CG1   1 
ATOM   3593 C CG2   . VAL A 1 467 ? 39.732  77.986 44.479  1.00 138.37 ? 467 VAL A CG2   1 
ATOM   3594 N N     . THR A 1 468 ? 39.281  80.686 41.610  1.00 148.22 ? 468 THR A N     1 
ATOM   3595 C CA    . THR A 1 468 ? 38.931  80.528 40.197  1.00 151.15 ? 468 THR A CA    1 
ATOM   3596 C C     . THR A 1 468 ? 39.939  79.637 39.473  1.00 143.22 ? 468 THR A C     1 
ATOM   3597 O O     . THR A 1 468 ? 41.143  79.711 39.730  1.00 143.73 ? 468 THR A O     1 
ATOM   3598 C CB    . THR A 1 468 ? 38.838  81.887 39.471  1.00 159.61 ? 468 THR A CB    1 
ATOM   3599 O OG1   . THR A 1 468 ? 40.034  82.643 39.704  1.00 166.27 ? 468 THR A OG1   1 
ATOM   3600 C CG2   . THR A 1 468 ? 37.633  82.683 39.962  1.00 151.60 ? 468 THR A CG2   1 
ATOM   3601 N N     . LEU A 1 469 ? 39.435  78.800 38.568  1.00 141.06 ? 469 LEU A N     1 
ATOM   3602 C CA    . LEU A 1 469 ? 40.273  77.867 37.813  1.00 140.43 ? 469 LEU A CA    1 
ATOM   3603 C C     . LEU A 1 469 ? 40.105  78.035 36.304  1.00 140.49 ? 469 LEU A C     1 
ATOM   3604 O O     . LEU A 1 469 ? 39.006  78.318 35.820  1.00 137.98 ? 469 LEU A O     1 
ATOM   3605 C CB    . LEU A 1 469 ? 39.971  76.420 38.219  1.00 144.35 ? 469 LEU A CB    1 
ATOM   3606 C CG    . LEU A 1 469 ? 40.353  75.961 39.632  1.00 147.67 ? 469 LEU A CG    1 
ATOM   3607 C CD1   . LEU A 1 469 ? 39.556  74.726 40.026  1.00 157.34 ? 469 LEU A CD1   1 
ATOM   3608 C CD2   . LEU A 1 469 ? 41.848  75.699 39.753  1.00 145.47 ? 469 LEU A CD2   1 
ATOM   3609 N N     . THR A 1 470 ? 41.203  77.854 35.573  1.00 142.79 ? 470 THR A N     1 
ATOM   3610 C CA    . THR A 1 470 ? 41.204  77.962 34.112  1.00 148.95 ? 470 THR A CA    1 
ATOM   3611 C C     . THR A 1 470 ? 41.414  76.600 33.454  1.00 151.88 ? 470 THR A C     1 
ATOM   3612 O O     . THR A 1 470 ? 42.202  75.783 33.942  1.00 147.81 ? 470 THR A O     1 
ATOM   3613 C CB    . THR A 1 470 ? 42.284  78.942 33.608  1.00 153.48 ? 470 THR A CB    1 
ATOM   3614 O OG1   . THR A 1 470 ? 43.555  78.593 34.172  1.00 155.27 ? 470 THR A OG1   1 
ATOM   3615 C CG2   . THR A 1 470 ? 41.938  80.376 33.994  1.00 152.87 ? 470 THR A CG2   1 
ATOM   3616 N N     . ASP A 1 471 ? 40.706  76.375 32.346  1.00 152.58 ? 471 ASP A N     1 
ATOM   3617 C CA    . ASP A 1 471 ? 40.739  75.112 31.592  1.00 154.55 ? 471 ASP A CA    1 
ATOM   3618 C C     . ASP A 1 471 ? 40.428  73.902 32.481  1.00 153.13 ? 471 ASP A C     1 
ATOM   3619 O O     . ASP A 1 471 ? 41.320  73.125 32.835  1.00 150.74 ? 471 ASP A O     1 
ATOM   3620 C CB    . ASP A 1 471 ? 42.075  74.941 30.849  1.00 153.93 ? 471 ASP A CB    1 
ATOM   3621 C CG    . ASP A 1 471 ? 42.038  73.824 29.816  1.00 146.74 ? 471 ASP A CG    1 
ATOM   3622 O OD1   . ASP A 1 471 ? 41.074  73.766 29.021  1.00 145.19 ? 471 ASP A OD1   1 
ATOM   3623 O OD2   . ASP A 1 471 ? 42.978  73.001 29.800  1.00 143.12 ? 471 ASP A OD2   1 
ATOM   3624 N N     . THR A 1 472 ? 39.153  73.762 32.838  1.00 153.53 ? 472 THR A N     1 
ATOM   3625 C CA    . THR A 1 472 ? 38.697  72.689 33.726  1.00 150.07 ? 472 THR A CA    1 
ATOM   3626 C C     . THR A 1 472 ? 37.255  72.262 33.432  1.00 154.52 ? 472 THR A C     1 
ATOM   3627 O O     . THR A 1 472 ? 36.448  73.056 32.940  1.00 154.01 ? 472 THR A O     1 
ATOM   3628 C CB    . THR A 1 472 ? 38.852  73.072 35.220  1.00 150.95 ? 472 THR A CB    1 
ATOM   3629 O OG1   . THR A 1 472 ? 38.344  72.018 36.048  1.00 145.38 ? 472 THR A OG1   1 
ATOM   3630 C CG2   . THR A 1 472 ? 38.114  74.375 35.544  1.00 154.87 ? 472 THR A CG2   1 
ATOM   3631 N N     . THR A 1 473 ? 36.951  71.003 33.736  1.00 156.37 ? 473 THR A N     1 
ATOM   3632 C CA    . THR A 1 473 ? 35.607  70.450 33.557  1.00 154.60 ? 473 THR A CA    1 
ATOM   3633 C C     . THR A 1 473 ? 34.834  70.449 34.878  1.00 151.53 ? 473 THR A C     1 
ATOM   3634 O O     . THR A 1 473 ? 35.396  70.750 35.934  1.00 149.81 ? 473 THR A O     1 
ATOM   3635 C CB    . THR A 1 473 ? 35.650  69.018 32.980  1.00 156.01 ? 473 THR A CB    1 
ATOM   3636 O OG1   . THR A 1 473 ? 36.522  68.203 33.774  1.00 159.07 ? 473 THR A OG1   1 
ATOM   3637 C CG2   . THR A 1 473 ? 36.143  69.029 31.537  1.00 156.27 ? 473 THR A CG2   1 
ATOM   3638 N N     . ASN A 1 474 ? 33.546  70.111 34.808  1.00 152.41 ? 474 ASN A N     1 
ATOM   3639 C CA    . ASN A 1 474 ? 32.679  70.060 35.988  1.00 150.56 ? 474 ASN A CA    1 
ATOM   3640 C C     . ASN A 1 474 ? 33.039  68.941 36.964  1.00 148.77 ? 474 ASN A C     1 
ATOM   3641 O O     . ASN A 1 474 ? 32.795  69.056 38.168  1.00 145.29 ? 474 ASN A O     1 
ATOM   3642 C CB    . ASN A 1 474 ? 31.209  69.944 35.574  1.00 144.83 ? 474 ASN A CB    1 
ATOM   3643 C CG    . ASN A 1 474 ? 30.716  71.166 34.823  1.00 156.65 ? 474 ASN A CG    1 
ATOM   3644 O OD1   . ASN A 1 474 ? 31.073  71.386 33.665  1.00 160.38 ? 474 ASN A OD1   1 
ATOM   3645 N ND2   . ASN A 1 474 ? 29.887  71.966 35.480  1.00 156.63 ? 474 ASN A ND2   1 
ATOM   3646 N N     . GLN A 1 475 ? 33.617  67.865 36.435  1.00 153.11 ? 475 GLN A N     1 
ATOM   3647 C CA    . GLN A 1 475 ? 34.048  66.723 37.241  1.00 155.95 ? 475 GLN A CA    1 
ATOM   3648 C C     . GLN A 1 475 ? 35.317  67.027 38.039  1.00 146.84 ? 475 GLN A C     1 
ATOM   3649 O O     . GLN A 1 475 ? 35.546  66.439 39.098  1.00 147.68 ? 475 GLN A O     1 
ATOM   3650 C CB    . GLN A 1 475 ? 34.266  65.491 36.356  1.00 154.09 ? 475 GLN A CB    1 
ATOM   3651 C CG    . GLN A 1 475 ? 32.988  64.777 35.927  1.00 151.41 ? 475 GLN A CG    1 
ATOM   3652 C CD    . GLN A 1 475 ? 32.247  65.484 34.804  1.00 146.83 ? 475 GLN A CD    1 
ATOM   3653 O OE1   . GLN A 1 475 ? 32.857  66.067 33.905  1.00 140.92 ? 475 GLN A OE1   1 
ATOM   3654 N NE2   . GLN A 1 475 ? 30.921  65.428 34.847  1.00 146.41 ? 475 GLN A NE2   1 
ATOM   3655 N N     . LYS A 1 476 ? 36.132  67.946 37.522  1.00 147.15 ? 476 LYS A N     1 
ATOM   3656 C CA    . LYS A 1 476 ? 37.392  68.329 38.161  1.00 145.56 ? 476 LYS A CA    1 
ATOM   3657 C C     . LYS A 1 476 ? 37.209  69.414 39.223  1.00 147.25 ? 476 LYS A C     1 
ATOM   3658 O O     . LYS A 1 476 ? 37.958  69.461 40.202  1.00 147.94 ? 476 LYS A O     1 
ATOM   3659 C CB    . LYS A 1 476 ? 38.412  68.787 37.113  1.00 145.33 ? 476 LYS A CB    1 
ATOM   3660 C CG    . LYS A 1 476 ? 38.926  67.676 36.210  1.00 151.72 ? 476 LYS A CG    1 
ATOM   3661 C CD    . LYS A 1 476 ? 39.922  68.208 35.193  1.00 150.35 ? 476 LYS A CD    1 
ATOM   3662 C CE    . LYS A 1 476 ? 40.431  67.099 34.287  1.00 147.25 ? 476 LYS A CE    1 
ATOM   3663 N NZ    . LYS A 1 476 ? 41.407  67.606 33.282  1.00 131.00 ? 476 LYS A NZ    1 
ATOM   3664 N N     . THR A 1 477 ? 36.217  70.281 39.021  1.00 148.41 ? 477 THR A N     1 
ATOM   3665 C CA    . THR A 1 477 ? 35.923  71.376 39.954  1.00 149.72 ? 477 THR A CA    1 
ATOM   3666 C C     . THR A 1 477 ? 35.342  70.875 41.276  1.00 151.38 ? 477 THR A C     1 
ATOM   3667 O O     . THR A 1 477 ? 35.600  71.455 42.333  1.00 149.30 ? 477 THR A O     1 
ATOM   3668 C CB    . THR A 1 477 ? 34.965  72.419 39.340  1.00 145.74 ? 477 THR A CB    1 
ATOM   3669 O OG1   . THR A 1 477 ? 33.835  71.755 38.759  1.00 151.82 ? 477 THR A OG1   1 
ATOM   3670 C CG2   . THR A 1 477 ? 35.676  73.239 38.273  1.00 143.94 ? 477 THR A CG2   1 
ATOM   3671 N N     . GLU A 1 478 ? 34.557  69.801 41.202  1.00 154.08 ? 478 GLU A N     1 
ATOM   3672 C CA    . GLU A 1 478 ? 34.014  69.140 42.387  1.00 154.63 ? 478 GLU A CA    1 
ATOM   3673 C C     . GLU A 1 478 ? 35.119  68.375 43.117  1.00 152.99 ? 478 GLU A C     1 
ATOM   3674 O O     . GLU A 1 478 ? 35.100  68.257 44.344  1.00 156.28 ? 478 GLU A O     1 
ATOM   3675 C CB    . GLU A 1 478 ? 32.876  68.192 41.991  1.00 150.88 ? 478 GLU A CB    1 
ATOM   3676 C CG    . GLU A 1 478 ? 32.029  67.679 43.150  1.00 147.47 ? 478 GLU A CG    1 
ATOM   3677 C CD    . GLU A 1 478 ? 31.151  68.751 43.777  1.00 153.43 ? 478 GLU A CD    1 
ATOM   3678 O OE1   . GLU A 1 478 ? 30.640  69.624 43.043  1.00 166.67 ? 478 GLU A OE1   1 
ATOM   3679 O OE2   . GLU A 1 478 ? 30.965  68.712 45.012  1.00 151.50 ? 478 GLU A OE2   1 
ATOM   3680 N N     . LEU A 1 479 ? 36.079  67.865 42.346  1.00 150.39 ? 479 LEU A N     1 
ATOM   3681 C CA    . LEU A 1 479 ? 37.230  67.139 42.877  1.00 148.62 ? 479 LEU A CA    1 
ATOM   3682 C C     . LEU A 1 479 ? 38.221  68.079 43.568  1.00 146.95 ? 479 LEU A C     1 
ATOM   3683 O O     . LEU A 1 479 ? 38.850  67.706 44.562  1.00 139.28 ? 479 LEU A O     1 
ATOM   3684 C CB    . LEU A 1 479 ? 37.925  66.367 41.748  1.00 150.33 ? 479 LEU A CB    1 
ATOM   3685 C CG    . LEU A 1 479 ? 39.040  65.367 42.072  1.00 160.38 ? 479 LEU A CG    1 
ATOM   3686 C CD1   . LEU A 1 479 ? 38.486  64.088 42.685  1.00 154.55 ? 479 LEU A CD1   1 
ATOM   3687 C CD2   . LEU A 1 479 ? 39.829  65.053 40.810  1.00 163.58 ? 479 LEU A CD2   1 
ATOM   3688 N N     . GLN A 1 480 ? 38.351  69.293 43.035  1.00 150.32 ? 480 GLN A N     1 
ATOM   3689 C CA    . GLN A 1 480 ? 39.249  70.311 43.587  1.00 153.76 ? 480 GLN A CA    1 
ATOM   3690 C C     . GLN A 1 480 ? 38.761  70.883 44.918  1.00 156.02 ? 480 GLN A C     1 
ATOM   3691 O O     . GLN A 1 480 ? 39.568  71.316 45.745  1.00 159.86 ? 480 GLN A O     1 
ATOM   3692 C CB    . GLN A 1 480 ? 39.458  71.445 42.579  1.00 156.53 ? 480 GLN A CB    1 
ATOM   3693 C CG    . GLN A 1 480 ? 40.577  71.203 41.574  1.00 160.38 ? 480 GLN A CG    1 
ATOM   3694 C CD    . GLN A 1 480 ? 41.961  71.506 42.130  1.00 164.66 ? 480 GLN A CD    1 
ATOM   3695 O OE1   . GLN A 1 480 ? 42.104  72.114 43.193  1.00 162.40 ? 480 GLN A OE1   1 
ATOM   3696 N NE2   . GLN A 1 480 ? 42.990  71.088 41.403  1.00 165.77 ? 480 GLN A NE2   1 
ATOM   3697 N N     . ALA A 1 481 ? 37.444  70.882 45.115  1.00 153.97 ? 481 ALA A N     1 
ATOM   3698 C CA    . ALA A 1 481 ? 36.830  71.413 46.333  1.00 153.67 ? 481 ALA A CA    1 
ATOM   3699 C C     . ALA A 1 481 ? 37.068  70.522 47.554  1.00 149.73 ? 481 ALA A C     1 
ATOM   3700 O O     . ALA A 1 481 ? 37.100  71.009 48.686  1.00 150.47 ? 481 ALA A O     1 
ATOM   3701 C CB    . ALA A 1 481 ? 35.341  71.642 46.118  1.00 145.14 ? 481 ALA A CB    1 
ATOM   3702 N N     . ILE A 1 482 ? 37.232  69.221 47.312  1.00 146.26 ? 482 ILE A N     1 
ATOM   3703 C CA    . ILE A 1 482 ? 37.532  68.252 48.370  1.00 147.67 ? 482 ILE A CA    1 
ATOM   3704 C C     . ILE A 1 482 ? 38.975  68.424 48.855  1.00 148.49 ? 482 ILE A C     1 
ATOM   3705 O O     . ILE A 1 482 ? 39.258  68.285 50.048  1.00 146.72 ? 482 ILE A O     1 
ATOM   3706 C CB    . ILE A 1 482 ? 37.303  66.795 47.898  1.00 147.37 ? 482 ILE A CB    1 
ATOM   3707 C CG1   . ILE A 1 482 ? 35.946  66.658 47.195  1.00 152.58 ? 482 ILE A CG1   1 
ATOM   3708 C CG2   . ILE A 1 482 ? 37.395  65.823 49.070  1.00 152.50 ? 482 ILE A CG2   1 
ATOM   3709 C CD1   . ILE A 1 482 ? 35.834  65.458 46.275  1.00 152.37 ? 482 ILE A CD1   1 
ATOM   3710 N N     . HIS A 1 483 ? 39.872  68.733 47.919  1.00 150.91 ? 483 HIS A N     1 
ATOM   3711 C CA    . HIS A 1 483 ? 41.291  68.944 48.210  1.00 156.24 ? 483 HIS A CA    1 
ATOM   3712 C C     . HIS A 1 483 ? 41.526  70.156 49.073  1.00 163.13 ? 483 HIS A C     1 
ATOM   3713 O O     . HIS A 1 483 ? 42.367  70.129 49.974  1.00 164.46 ? 483 HIS A O     1 
ATOM   3714 C CB    . HIS A 1 483 ? 42.084  69.051 46.908  1.00 156.73 ? 483 HIS A CB    1 
ATOM   3715 C CG    . HIS A 1 483 ? 43.556  69.336 47.106  1.00 153.65 ? 483 HIS A CG    1 
ATOM   3716 N ND1   . HIS A 1 483 ? 44.448  68.371 47.390  1.00 154.73 ? 483 HIS A ND1   1 
ATOM   3717 C CD2   . HIS A 1 483 ? 44.273  70.530 47.045  1.00 145.93 ? 483 HIS A CD2   1 
ATOM   3718 C CE1   . HIS A 1 483 ? 45.674  68.915 47.508  1.00 151.80 ? 483 HIS A CE1   1 
ATOM   3719 N NE2   . HIS A 1 483 ? 45.565  70.237 47.297  1.00 147.03 ? 483 HIS A NE2   1 
ATOM   3720 N N     . LEU A 1 484 ? 40.779  71.226 48.803  1.00 161.52 ? 484 LEU A N     1 
ATOM   3721 C CA    . LEU A 1 484 ? 40.906  72.480 49.547  1.00 157.29 ? 484 LEU A CA    1 
ATOM   3722 C C     . LEU A 1 484 ? 40.267  72.403 50.934  1.00 156.06 ? 484 LEU A C     1 
ATOM   3723 O O     . LEU A 1 484 ? 40.684  73.110 51.854  1.00 154.21 ? 484 LEU A O     1 
ATOM   3724 C CB    . LEU A 1 484 ? 40.301  73.644 48.752  1.00 149.27 ? 484 LEU A CB    1 
ATOM   3725 C CG    . LEU A 1 484 ? 40.936  74.014 47.406  1.00 144.17 ? 484 LEU A CG    1 
ATOM   3726 C CD1   . LEU A 1 484 ? 39.979  74.863 46.585  1.00 140.45 ? 484 LEU A CD1   1 
ATOM   3727 C CD2   . LEU A 1 484 ? 42.272  74.723 47.586  1.00 155.72 ? 484 LEU A CD2   1 
ATOM   3728 N N     . ALA A 1 485 ? 39.257  71.546 51.070  1.00 158.08 ? 485 ALA A N     1 
ATOM   3729 C CA    . ALA A 1 485 ? 38.562  71.344 52.341  1.00 152.45 ? 485 ALA A CA    1 
ATOM   3730 C C     . ALA A 1 485 ? 39.419  70.577 53.348  1.00 157.03 ? 485 ALA A C     1 
ATOM   3731 O O     . ALA A 1 485 ? 39.335  70.817 54.554  1.00 155.13 ? 485 ALA A O     1 
ATOM   3732 C CB    . ALA A 1 485 ? 37.238  70.629 52.114  1.00 144.53 ? 485 ALA A CB    1 
ATOM   3733 N N     . LEU A 1 486 ? 40.239  69.657 52.841  1.00 159.64 ? 486 LEU A N     1 
ATOM   3734 C CA    . LEU A 1 486 ? 41.131  68.853 53.677  1.00 154.51 ? 486 LEU A CA    1 
ATOM   3735 C C     . LEU A 1 486 ? 42.470  69.547 53.939  1.00 152.49 ? 486 LEU A C     1 
ATOM   3736 O O     . LEU A 1 486 ? 43.211  69.156 54.845  1.00 145.39 ? 486 LEU A O     1 
ATOM   3737 C CB    . LEU A 1 486 ? 41.362  67.474 53.046  1.00 141.72 ? 486 LEU A CB    1 
ATOM   3738 C CG    . LEU A 1 486 ? 40.208  66.465 53.090  1.00 145.64 ? 486 LEU A CG    1 
ATOM   3739 C CD1   . LEU A 1 486 ? 40.362  65.426 51.990  1.00 146.44 ? 486 LEU A CD1   1 
ATOM   3740 C CD2   . LEU A 1 486 ? 40.105  65.793 54.453  1.00 148.90 ? 486 LEU A CD2   1 
ATOM   3741 N N     . GLN A 1 487 ? 42.767  70.574 53.144  1.00 155.90 ? 487 GLN A N     1 
ATOM   3742 C CA    . GLN A 1 487 ? 44.007  71.338 53.276  1.00 152.78 ? 487 GLN A CA    1 
ATOM   3743 C C     . GLN A 1 487 ? 43.972  72.269 54.490  1.00 155.80 ? 487 GLN A C     1 
ATOM   3744 O O     . GLN A 1 487 ? 44.924  72.312 55.273  1.00 155.38 ? 487 GLN A O     1 
ATOM   3745 C CB    . GLN A 1 487 ? 44.284  72.135 51.994  1.00 149.70 ? 487 GLN A CB    1 
ATOM   3746 C CG    . GLN A 1 487 ? 45.642  72.827 51.947  1.00 148.56 ? 487 GLN A CG    1 
ATOM   3747 C CD    . GLN A 1 487 ? 46.802  71.863 51.764  1.00 150.88 ? 487 GLN A CD    1 
ATOM   3748 O OE1   . GLN A 1 487 ? 46.751  70.957 50.930  1.00 159.03 ? 487 GLN A OE1   1 
ATOM   3749 N NE2   . GLN A 1 487 ? 47.862  72.061 52.539  1.00 163.71 ? 487 GLN A NE2   1 
ATOM   3750 N N     . ASP A 1 488 ? 42.872  73.006 54.637  1.00 156.85 ? 488 ASP A N     1 
ATOM   3751 C CA    . ASP A 1 488 ? 42.703  73.949 55.742  1.00 155.53 ? 488 ASP A CA    1 
ATOM   3752 C C     . ASP A 1 488 ? 41.806  73.365 56.836  1.00 153.26 ? 488 ASP A C     1 
ATOM   3753 O O     . ASP A 1 488 ? 40.784  73.956 57.207  1.00 154.95 ? 488 ASP A O     1 
ATOM   3754 C CB    . ASP A 1 488 ? 42.144  75.283 55.228  1.00 157.14 ? 488 ASP A CB    1 
ATOM   3755 C CG    . ASP A 1 488 ? 43.099  75.998 54.283  1.00 159.66 ? 488 ASP A CG    1 
ATOM   3756 O OD1   . ASP A 1 488 ? 43.593  75.362 53.326  1.00 164.37 ? 488 ASP A OD1   1 
ATOM   3757 O OD2   . ASP A 1 488 ? 43.346  77.204 54.493  1.00 155.70 ? 488 ASP A OD2   1 
ATOM   3758 N N     . SER A 1 489 ? 42.203  72.201 57.349  1.00 152.05 ? 489 SER A N     1 
ATOM   3759 C CA    . SER A 1 489 ? 41.443  71.497 58.382  1.00 155.57 ? 489 SER A CA    1 
ATOM   3760 C C     . SER A 1 489 ? 42.359  70.852 59.423  1.00 154.44 ? 489 SER A C     1 
ATOM   3761 O O     . SER A 1 489 ? 43.575  70.769 59.228  1.00 154.65 ? 489 SER A O     1 
ATOM   3762 C CB    . SER A 1 489 ? 40.534  70.441 57.747  1.00 153.82 ? 489 SER A CB    1 
ATOM   3763 O OG    . SER A 1 489 ? 41.289  69.483 57.026  1.00 150.07 ? 489 SER A OG    1 
ATOM   3764 N N     . GLY A 1 490 ? 41.765  70.398 60.526  1.00 150.89 ? 490 GLY A N     1 
ATOM   3765 C CA    . GLY A 1 490 ? 42.505  69.748 61.605  1.00 149.65 ? 490 GLY A CA    1 
ATOM   3766 C C     . GLY A 1 490 ? 42.794  68.285 61.326  1.00 151.79 ? 490 GLY A C     1 
ATOM   3767 O O     . GLY A 1 490 ? 43.292  67.936 60.253  1.00 155.99 ? 490 GLY A O     1 
ATOM   3768 N N     . LEU A 1 491 ? 42.478  67.430 62.296  1.00 153.21 ? 491 LEU A N     1 
ATOM   3769 C CA    . LEU A 1 491 ? 42.715  65.991 62.176  1.00 155.22 ? 491 LEU A CA    1 
ATOM   3770 C C     . LEU A 1 491 ? 41.458  65.238 61.740  1.00 148.06 ? 491 LEU A C     1 
ATOM   3771 O O     . LEU A 1 491 ? 41.497  64.454 60.790  1.00 140.62 ? 491 LEU A O     1 
ATOM   3772 C CB    . LEU A 1 491 ? 43.259  65.412 63.491  1.00 156.41 ? 491 LEU A CB    1 
ATOM   3773 C CG    . LEU A 1 491 ? 44.722  65.677 63.864  1.00 157.48 ? 491 LEU A CG    1 
ATOM   3774 C CD1   . LEU A 1 491 ? 44.896  67.022 64.556  1.00 152.37 ? 491 LEU A CD1   1 
ATOM   3775 C CD2   . LEU A 1 491 ? 45.244  64.559 64.754  1.00 157.82 ? 491 LEU A CD2   1 
ATOM   3776 N N     . GLU A 1 492 ? 40.351  65.482 62.439  1.00 157.86 ? 492 GLU A N     1 
ATOM   3777 C CA    . GLU A 1 492 ? 39.074  64.840 62.131  1.00 160.02 ? 492 GLU A CA    1 
ATOM   3778 C C     . GLU A 1 492 ? 38.227  65.732 61.226  1.00 162.40 ? 492 GLU A C     1 
ATOM   3779 O O     . GLU A 1 492 ? 37.816  66.826 61.622  1.00 162.99 ? 492 GLU A O     1 
ATOM   3780 C CB    . GLU A 1 492 ? 38.312  64.491 63.416  1.00 157.56 ? 492 GLU A CB    1 
ATOM   3781 C CG    . GLU A 1 492 ? 38.899  63.331 64.212  1.00 154.46 ? 492 GLU A CG    1 
ATOM   3782 C CD    . GLU A 1 492 ? 40.098  63.723 65.060  1.00 156.03 ? 492 GLU A CD    1 
ATOM   3783 O OE1   . GLU A 1 492 ? 40.066  64.801 65.692  1.00 167.49 ? 492 GLU A OE1   1 
ATOM   3784 O OE2   . GLU A 1 492 ? 41.074  62.945 65.101  1.00 147.67 ? 492 GLU A OE2   1 
ATOM   3785 N N     . VAL A 1 493 ? 37.980  65.255 60.007  1.00 164.07 ? 493 VAL A N     1 
ATOM   3786 C CA    . VAL A 1 493 ? 37.268  66.034 58.990  1.00 161.46 ? 493 VAL A CA    1 
ATOM   3787 C C     . VAL A 1 493 ? 35.987  65.327 58.545  1.00 157.80 ? 493 VAL A C     1 
ATOM   3788 O O     . VAL A 1 493 ? 36.000  64.132 58.237  1.00 159.96 ? 493 VAL A O     1 
ATOM   3789 C CB    . VAL A 1 493 ? 38.158  66.311 57.751  1.00 154.72 ? 493 VAL A CB    1 
ATOM   3790 C CG1   . VAL A 1 493 ? 37.513  67.350 56.843  1.00 149.40 ? 493 VAL A CG1   1 
ATOM   3791 C CG2   . VAL A 1 493 ? 39.548  66.774 58.166  1.00 143.43 ? 493 VAL A CG2   1 
ATOM   3792 N N     . ASN A 1 494 ? 34.886  66.076 58.522  1.00 152.02 ? 494 ASN A N     1 
ATOM   3793 C CA    . ASN A 1 494 ? 33.614  65.587 57.996  1.00 150.52 ? 494 ASN A CA    1 
ATOM   3794 C C     . ASN A 1 494 ? 33.295  66.233 56.650  1.00 154.23 ? 494 ASN A C     1 
ATOM   3795 O O     . ASN A 1 494 ? 33.128  67.452 56.559  1.00 156.92 ? 494 ASN A O     1 
ATOM   3796 C CB    . ASN A 1 494 ? 32.477  65.829 58.995  1.00 147.86 ? 494 ASN A CB    1 
ATOM   3797 C CG    . ASN A 1 494 ? 32.472  64.827 60.137  1.00 146.67 ? 494 ASN A CG    1 
ATOM   3798 O OD1   . ASN A 1 494 ? 31.552  64.018 60.260  1.00 148.78 ? 494 ASN A OD1   1 
ATOM   3799 N ND2   . ASN A 1 494 ? 33.501  64.874 60.978  1.00 142.65 ? 494 ASN A ND2   1 
ATOM   3800 N N     . ILE A 1 495 ? 33.221  65.407 55.609  1.00 156.61 ? 495 ILE A N     1 
ATOM   3801 C CA    . ILE A 1 495 ? 33.006  65.887 54.243  1.00 157.64 ? 495 ILE A CA    1 
ATOM   3802 C C     . ILE A 1 495 ? 31.598  65.547 53.754  1.00 156.30 ? 495 ILE A C     1 
ATOM   3803 O O     . ILE A 1 495 ? 31.192  64.382 53.759  1.00 156.72 ? 495 ILE A O     1 
ATOM   3804 C CB    . ILE A 1 495 ? 34.066  65.321 53.266  1.00 152.65 ? 495 ILE A CB    1 
ATOM   3805 C CG1   . ILE A 1 495 ? 35.482  65.643 53.762  1.00 154.66 ? 495 ILE A CG1   1 
ATOM   3806 C CG2   . ILE A 1 495 ? 33.853  65.869 51.858  1.00 148.76 ? 495 ILE A CG2   1 
ATOM   3807 C CD1   . ILE A 1 495 ? 36.574  64.797 53.138  1.00 158.97 ? 495 ILE A CD1   1 
ATOM   3808 N N     . VAL A 1 496 ? 30.860  66.576 53.342  1.00 153.73 ? 496 VAL A N     1 
ATOM   3809 C CA    . VAL A 1 496 ? 29.520  66.406 52.781  1.00 154.92 ? 496 VAL A CA    1 
ATOM   3810 C C     . VAL A 1 496 ? 29.522  66.834 51.312  1.00 158.76 ? 496 VAL A C     1 
ATOM   3811 O O     . VAL A 1 496 ? 29.694  68.015 50.998  1.00 161.22 ? 496 VAL A O     1 
ATOM   3812 C CB    . VAL A 1 496 ? 28.453  67.197 53.576  1.00 158.65 ? 496 VAL A CB    1 
ATOM   3813 C CG1   . VAL A 1 496 ? 27.067  66.986 52.981  1.00 161.21 ? 496 VAL A CG1   1 
ATOM   3814 C CG2   . VAL A 1 496 ? 28.461  66.792 55.044  1.00 150.91 ? 496 VAL A CG2   1 
ATOM   3815 N N     . THR A 1 497 ? 29.338  65.861 50.422  1.00 158.40 ? 497 THR A N     1 
ATOM   3816 C CA    . THR A 1 497 ? 29.338  66.109 48.978  1.00 158.91 ? 497 THR A CA    1 
ATOM   3817 C C     . THR A 1 497 ? 27.955  65.899 48.354  1.00 154.65 ? 497 THR A C     1 
ATOM   3818 O O     . THR A 1 497 ? 27.153  65.106 48.854  1.00 149.38 ? 497 THR A O     1 
ATOM   3819 C CB    . THR A 1 497 ? 30.407  65.260 48.244  1.00 157.22 ? 497 THR A CB    1 
ATOM   3820 O OG1   . THR A 1 497 ? 30.374  65.548 46.840  1.00 152.39 ? 497 THR A OG1   1 
ATOM   3821 C CG2   . THR A 1 497 ? 30.183  63.761 48.462  1.00 153.57 ? 497 THR A CG2   1 
ATOM   3822 N N     . ASN A 1 498 ? 27.687  66.616 47.264  1.00 154.65 ? 498 ASN A N     1 
ATOM   3823 C CA    . ASN A 1 498 ? 26.408  66.515 46.561  1.00 154.11 ? 498 ASN A CA    1 
ATOM   3824 C C     . ASN A 1 498 ? 26.463  65.636 45.309  1.00 158.75 ? 498 ASN A C     1 
ATOM   3825 O O     . ASN A 1 498 ? 25.454  65.050 44.911  1.00 161.89 ? 498 ASN A O     1 
ATOM   3826 C CB    . ASN A 1 498 ? 25.863  67.908 46.215  1.00 146.19 ? 498 ASN A CB    1 
ATOM   3827 C CG    . ASN A 1 498 ? 26.770  68.681 45.272  1.00 147.28 ? 498 ASN A CG    1 
ATOM   3828 O OD1   . ASN A 1 498 ? 27.986  68.739 45.462  1.00 154.40 ? 498 ASN A OD1   1 
ATOM   3829 N ND2   . ASN A 1 498 ? 26.176  69.288 44.251  1.00 144.31 ? 498 ASN A ND2   1 
ATOM   3830 N N     . SER A 1 499 ? 27.645  65.549 44.701  1.00 156.24 ? 499 SER A N     1 
ATOM   3831 C CA    . SER A 1 499 ? 27.840  64.782 43.472  1.00 153.37 ? 499 SER A CA    1 
ATOM   3832 C C     . SER A 1 499 ? 28.036  63.293 43.750  1.00 152.86 ? 499 SER A C     1 
ATOM   3833 O O     . SER A 1 499 ? 28.706  62.913 44.715  1.00 154.34 ? 499 SER A O     1 
ATOM   3834 C CB    . SER A 1 499 ? 29.030  65.332 42.681  1.00 148.77 ? 499 SER A CB    1 
ATOM   3835 O OG    . SER A 1 499 ? 29.165  64.677 41.432  1.00 144.82 ? 499 SER A OG    1 
ATOM   3836 N N     . GLN A 1 500 ? 27.446  62.461 42.894  1.00 149.49 ? 500 GLN A N     1 
ATOM   3837 C CA    . GLN A 1 500 ? 27.570  61.007 42.992  1.00 154.20 ? 500 GLN A CA    1 
ATOM   3838 C C     . GLN A 1 500 ? 28.920  60.532 42.451  1.00 155.64 ? 500 GLN A C     1 
ATOM   3839 O O     . GLN A 1 500 ? 29.457  59.519 42.907  1.00 156.57 ? 500 GLN A O     1 
ATOM   3840 C CB    . GLN A 1 500 ? 26.419  60.326 42.240  1.00 153.77 ? 500 GLN A CB    1 
ATOM   3841 C CG    . GLN A 1 500 ? 26.277  58.827 42.488  1.00 160.29 ? 500 GLN A CG    1 
ATOM   3842 C CD    . GLN A 1 500 ? 25.790  58.491 43.888  1.00 163.18 ? 500 GLN A CD    1 
ATOM   3843 O OE1   . GLN A 1 500 ? 24.906  59.155 44.431  1.00 166.31 ? 500 GLN A OE1   1 
ATOM   3844 N NE2   . GLN A 1 500 ? 26.362  57.446 44.475  1.00 155.65 ? 500 GLN A NE2   1 
ATOM   3845 N N     . TYR A 1 501 ? 29.456  61.274 41.483  1.00 156.54 ? 501 TYR A N     1 
ATOM   3846 C CA    . TYR A 1 501 ? 30.742  60.959 40.855  1.00 150.71 ? 501 TYR A CA    1 
ATOM   3847 C C     . TYR A 1 501 ? 31.911  61.034 41.841  1.00 149.08 ? 501 TYR A C     1 
ATOM   3848 O O     . TYR A 1 501 ? 32.797  60.177 41.825  1.00 141.11 ? 501 TYR A O     1 
ATOM   3849 C CB    . TYR A 1 501 ? 30.987  61.881 39.651  1.00 145.47 ? 501 TYR A CB    1 
ATOM   3850 C CG    . TYR A 1 501 ? 32.387  61.811 39.073  1.00 145.47 ? 501 TYR A CG    1 
ATOM   3851 C CD1   . TYR A 1 501 ? 32.795  60.718 38.307  1.00 144.36 ? 501 TYR A CD1   1 
ATOM   3852 C CD2   . TYR A 1 501 ? 33.301  62.843 39.287  1.00 148.82 ? 501 TYR A CD2   1 
ATOM   3853 C CE1   . TYR A 1 501 ? 34.075  60.653 37.778  1.00 144.46 ? 501 TYR A CE1   1 
ATOM   3854 C CE2   . TYR A 1 501 ? 34.583  62.787 38.761  1.00 155.22 ? 501 TYR A CE2   1 
ATOM   3855 C CZ    . TYR A 1 501 ? 34.964  61.691 38.007  1.00 156.05 ? 501 TYR A CZ    1 
ATOM   3856 O OH    . TYR A 1 501 ? 36.235  61.631 37.482  1.00 168.24 ? 501 TYR A OH    1 
ATOM   3857 N N     . ALA A 1 502 ? 31.900  62.058 42.693  1.00 152.65 ? 502 ALA A N     1 
ATOM   3858 C CA    . ALA A 1 502 ? 32.955  62.267 43.686  1.00 152.25 ? 502 ALA A CA    1 
ATOM   3859 C C     . ALA A 1 502 ? 32.885  61.262 44.837  1.00 147.06 ? 502 ALA A C     1 
ATOM   3860 O O     . ALA A 1 502 ? 33.891  60.998 45.499  1.00 146.75 ? 502 ALA A O     1 
ATOM   3861 C CB    . ALA A 1 502 ? 32.902  63.692 44.220  1.00 156.55 ? 502 ALA A CB    1 
ATOM   3862 N N     . LEU A 1 503 ? 31.695  60.706 45.061  1.00 149.84 ? 503 LEU A N     1 
ATOM   3863 C CA    . LEU A 1 503 ? 31.462  59.734 46.129  1.00 153.17 ? 503 LEU A CA    1 
ATOM   3864 C C     . LEU A 1 503 ? 32.125  58.385 45.840  1.00 151.41 ? 503 LEU A C     1 
ATOM   3865 O O     . LEU A 1 503 ? 32.605  57.715 46.756  1.00 148.93 ? 503 LEU A O     1 
ATOM   3866 C CB    . LEU A 1 503 ? 29.956  59.546 46.353  1.00 157.85 ? 503 LEU A CB    1 
ATOM   3867 C CG    . LEU A 1 503 ? 29.476  58.864 47.640  1.00 155.74 ? 503 LEU A CG    1 
ATOM   3868 C CD1   . LEU A 1 503 ? 29.478  59.835 48.812  1.00 145.43 ? 503 LEU A CD1   1 
ATOM   3869 C CD2   . LEU A 1 503 ? 28.086  58.280 47.441  1.00 153.63 ? 503 LEU A CD2   1 
ATOM   3870 N N     . GLY A 1 504 ? 32.151  58.001 44.565  1.00 146.32 ? 504 GLY A N     1 
ATOM   3871 C CA    . GLY A 1 504 ? 32.697  56.711 44.143  1.00 145.89 ? 504 GLY A CA    1 
ATOM   3872 C C     . GLY A 1 504 ? 34.213  56.622 44.140  1.00 141.62 ? 504 GLY A C     1 
ATOM   3873 O O     . GLY A 1 504 ? 34.774  55.535 44.295  1.00 143.58 ? 504 GLY A O     1 
ATOM   3874 N N     . ILE A 1 505 ? 34.875  57.764 43.960  1.00 134.38 ? 505 ILE A N     1 
ATOM   3875 C CA    . ILE A 1 505 ? 36.339  57.823 43.891  1.00 142.32 ? 505 ILE A CA    1 
ATOM   3876 C C     . ILE A 1 505 ? 36.978  57.646 45.272  1.00 151.31 ? 505 ILE A C     1 
ATOM   3877 O O     . ILE A 1 505 ? 37.973  56.931 45.413  1.00 155.54 ? 505 ILE A O     1 
ATOM   3878 C CB    . ILE A 1 505 ? 36.834  59.141 43.244  1.00 151.14 ? 505 ILE A CB    1 
ATOM   3879 C CG1   . ILE A 1 505 ? 36.096  59.408 41.926  1.00 146.32 ? 505 ILE A CG1   1 
ATOM   3880 C CG2   . ILE A 1 505 ? 38.341  59.097 43.011  1.00 154.01 ? 505 ILE A CG2   1 
ATOM   3881 C CD1   . ILE A 1 505 ? 36.156  60.848 41.458  1.00 157.41 ? 505 ILE A CD1   1 
ATOM   3882 N N     . ILE A 1 506 ? 36.396  58.293 46.280  1.00 150.83 ? 506 ILE A N     1 
ATOM   3883 C CA    . ILE A 1 506 ? 36.918  58.254 47.651  1.00 155.03 ? 506 ILE A CA    1 
ATOM   3884 C C     . ILE A 1 506 ? 36.709  56.880 48.298  1.00 150.69 ? 506 ILE A C     1 
ATOM   3885 O O     . ILE A 1 506 ? 37.549  56.422 49.078  1.00 154.65 ? 506 ILE A O     1 
ATOM   3886 C CB    . ILE A 1 506 ? 36.304  59.373 48.530  1.00 159.55 ? 506 ILE A CB    1 
ATOM   3887 C CG1   . ILE A 1 506 ? 36.394  60.728 47.813  1.00 161.48 ? 506 ILE A CG1   1 
ATOM   3888 C CG2   . ILE A 1 506 ? 37.000  59.445 49.885  1.00 155.60 ? 506 ILE A CG2   1 
ATOM   3889 C CD1   . ILE A 1 506 ? 35.504  61.810 48.391  1.00 157.63 ? 506 ILE A CD1   1 
ATOM   3890 N N     . GLN A 1 507 ? 35.598  56.227 47.960  1.00 146.28 ? 507 GLN A N     1 
ATOM   3891 C CA    . GLN A 1 507 ? 35.296  54.881 48.457  1.00 150.09 ? 507 GLN A CA    1 
ATOM   3892 C C     . GLN A 1 507 ? 36.266  53.832 47.910  1.00 148.28 ? 507 GLN A C     1 
ATOM   3893 O O     . GLN A 1 507 ? 36.636  52.892 48.617  1.00 141.28 ? 507 GLN A O     1 
ATOM   3894 C CB    . GLN A 1 507 ? 33.852  54.490 48.127  1.00 145.69 ? 507 GLN A CB    1 
ATOM   3895 C CG    . GLN A 1 507 ? 32.803  55.175 48.992  1.00 141.16 ? 507 GLN A CG    1 
ATOM   3896 C CD    . GLN A 1 507 ? 31.383  54.753 48.655  1.00 142.26 ? 507 GLN A CD    1 
ATOM   3897 O OE1   . GLN A 1 507 ? 31.133  53.613 48.258  1.00 148.13 ? 507 GLN A OE1   1 
ATOM   3898 N NE2   . GLN A 1 507 ? 30.440  55.674 48.823  1.00 143.31 ? 507 GLN A NE2   1 
ATOM   3899 N N     . ALA A 1 508 ? 36.670  54.004 46.653  1.00 146.72 ? 508 ALA A N     1 
ATOM   3900 C CA    . ALA A 1 508 ? 37.642  53.120 46.010  1.00 146.28 ? 508 ALA A CA    1 
ATOM   3901 C C     . ALA A 1 508 ? 39.071  53.629 46.220  1.00 149.74 ? 508 ALA A C     1 
ATOM   3902 O O     . ALA A 1 508 ? 39.278  54.693 46.809  1.00 154.35 ? 508 ALA A O     1 
ATOM   3903 C CB    . ALA A 1 508 ? 37.330  52.984 44.527  1.00 145.93 ? 508 ALA A CB    1 
ATOM   3904 N N     . GLN A 1 509 ? 40.049  52.861 45.744  1.00 149.71 ? 509 GLN A N     1 
ATOM   3905 C CA    . GLN A 1 509 ? 41.458  53.239 45.857  1.00 157.18 ? 509 GLN A CA    1 
ATOM   3906 C C     . GLN A 1 509 ? 42.081  53.470 44.476  1.00 154.50 ? 509 GLN A C     1 
ATOM   3907 O O     . GLN A 1 509 ? 42.390  52.509 43.764  1.00 152.69 ? 509 GLN A O     1 
ATOM   3908 C CB    . GLN A 1 509 ? 42.250  52.182 46.641  1.00 149.45 ? 509 GLN A CB    1 
ATOM   3909 C CG    . GLN A 1 509 ? 41.746  51.921 48.057  1.00 144.54 ? 509 GLN A CG    1 
ATOM   3910 C CD    . GLN A 1 509 ? 41.966  53.091 49.002  1.00 145.42 ? 509 GLN A CD    1 
ATOM   3911 O OE1   . GLN A 1 509 ? 42.978  53.790 48.925  1.00 146.47 ? 509 GLN A OE1   1 
ATOM   3912 N NE2   . GLN A 1 509 ? 41.018  53.302 49.907  1.00 154.98 ? 509 GLN A NE2   1 
ATOM   3913 N N     . PRO A 1 510 ? 42.256  54.749 44.090  1.00 153.30 ? 510 PRO A N     1 
ATOM   3914 C CA    . PRO A 1 510 ? 42.834  55.105 42.792  1.00 157.44 ? 510 PRO A CA    1 
ATOM   3915 C C     . PRO A 1 510 ? 44.346  54.884 42.742  1.00 152.65 ? 510 PRO A C     1 
ATOM   3916 O O     . PRO A 1 510 ? 45.077  55.396 43.594  1.00 143.15 ? 510 PRO A O     1 
ATOM   3917 C CB    . PRO A 1 510 ? 42.508  56.602 42.650  1.00 154.24 ? 510 PRO A CB    1 
ATOM   3918 C CG    . PRO A 1 510 ? 41.516  56.910 43.725  1.00 148.67 ? 510 PRO A CG    1 
ATOM   3919 C CD    . PRO A 1 510 ? 41.818  55.945 44.828  1.00 142.29 ? 510 PRO A CD    1 
ATOM   3920 N N     . ASP A 1 511 ? 44.796  54.121 41.747  1.00 152.96 ? 511 ASP A N     1 
ATOM   3921 C CA    . ASP A 1 511 ? 46.219  53.852 41.535  1.00 148.27 ? 511 ASP A CA    1 
ATOM   3922 C C     . ASP A 1 511 ? 46.500  53.534 40.064  1.00 154.58 ? 511 ASP A C     1 
ATOM   3923 O O     . ASP A 1 511 ? 46.563  52.366 39.668  1.00 156.61 ? 511 ASP A O     1 
ATOM   3924 C CB    . ASP A 1 511 ? 46.700  52.711 42.444  1.00 147.26 ? 511 ASP A CB    1 
ATOM   3925 C CG    . ASP A 1 511 ? 48.214  52.558 42.447  1.00 152.15 ? 511 ASP A CG    1 
ATOM   3926 O OD1   . ASP A 1 511 ? 48.923  53.570 42.643  1.00 151.34 ? 511 ASP A OD1   1 
ATOM   3927 O OD2   . ASP A 1 511 ? 48.695  51.421 42.263  1.00 152.24 ? 511 ASP A OD2   1 
ATOM   3928 N N     . GLN A 1 512 ? 46.659  54.586 39.263  1.00 148.14 ? 512 GLN A N     1 
ATOM   3929 C CA    . GLN A 1 512 ? 46.914  54.459 37.827  1.00 149.07 ? 512 GLN A CA    1 
ATOM   3930 C C     . GLN A 1 512 ? 47.609  55.704 37.270  1.00 138.43 ? 512 GLN A C     1 
ATOM   3931 O O     . GLN A 1 512 ? 47.999  56.597 38.027  1.00 128.38 ? 512 GLN A O     1 
ATOM   3932 C CB    . GLN A 1 512 ? 45.603  54.204 37.073  1.00 154.79 ? 512 GLN A CB    1 
ATOM   3933 N N     . SER A 1 513 ? 47.767  55.749 35.947  1.00 141.40 ? 513 SER A N     1 
ATOM   3934 C CA    . SER A 1 513 ? 48.316  56.918 35.257  1.00 154.37 ? 513 SER A CA    1 
ATOM   3935 C C     . SER A 1 513 ? 47.352  58.102 35.334  1.00 158.19 ? 513 SER A C     1 
ATOM   3936 O O     . SER A 1 513 ? 47.777  59.256 35.419  1.00 154.62 ? 513 SER A O     1 
ATOM   3937 C CB    . SER A 1 513 ? 48.631  56.583 33.796  1.00 156.02 ? 513 SER A CB    1 
ATOM   3938 O OG    . SER A 1 513 ? 47.471  56.150 33.106  1.00 148.18 ? 513 SER A OG    1 
ATOM   3939 N N     . GLU A 1 514 ? 46.055  57.798 35.303  1.00 160.61 ? 514 GLU A N     1 
ATOM   3940 C CA    . GLU A 1 514 ? 45.003  58.791 35.492  1.00 160.92 ? 514 GLU A CA    1 
ATOM   3941 C C     . GLU A 1 514 ? 44.831  59.061 36.990  1.00 162.00 ? 514 GLU A C     1 
ATOM   3942 O O     . GLU A 1 514 ? 45.384  58.335 37.822  1.00 157.35 ? 514 GLU A O     1 
ATOM   3943 C CB    . GLU A 1 514 ? 43.694  58.291 34.870  1.00 157.30 ? 514 GLU A CB    1 
ATOM   3944 C CG    . GLU A 1 514 ? 42.821  59.373 34.244  1.00 158.37 ? 514 GLU A CG    1 
ATOM   3945 C CD    . GLU A 1 514 ? 41.875  60.036 35.230  1.00 161.77 ? 514 GLU A CD    1 
ATOM   3946 O OE1   . GLU A 1 514 ? 41.281  59.325 36.071  1.00 159.17 ? 514 GLU A OE1   1 
ATOM   3947 O OE2   . GLU A 1 514 ? 41.716  61.273 35.159  1.00 168.28 ? 514 GLU A OE2   1 
ATOM   3948 N N     . SER A 1 515 ? 44.069  60.105 37.320  1.00 165.33 ? 515 SER A N     1 
ATOM   3949 C CA    . SER A 1 515 ? 43.811  60.521 38.705  1.00 156.41 ? 515 SER A CA    1 
ATOM   3950 C C     . SER A 1 515 ? 45.071  61.053 39.398  1.00 148.30 ? 515 SER A C     1 
ATOM   3951 O O     . SER A 1 515 ? 45.405  60.647 40.515  1.00 142.09 ? 515 SER A O     1 
ATOM   3952 C CB    . SER A 1 515 ? 43.152  59.394 39.517  1.00 153.12 ? 515 SER A CB    1 
ATOM   3953 N N     . GLU A 1 516 ? 45.759  61.967 38.716  1.00 134.81 ? 516 GLU A N     1 
ATOM   3954 C CA    . GLU A 1 516 ? 46.939  62.638 39.257  1.00 138.70 ? 516 GLU A CA    1 
ATOM   3955 C C     . GLU A 1 516 ? 46.527  63.689 40.288  1.00 144.64 ? 516 GLU A C     1 
ATOM   3956 O O     . GLU A 1 516 ? 47.252  63.943 41.254  1.00 142.19 ? 516 GLU A O     1 
ATOM   3957 C CB    . GLU A 1 516 ? 47.746  63.285 38.126  1.00 141.97 ? 516 GLU A CB    1 
ATOM   3958 C CG    . GLU A 1 516 ? 49.158  63.707 38.510  1.00 149.48 ? 516 GLU A CG    1 
ATOM   3959 C CD    . GLU A 1 516 ? 49.904  64.386 37.374  1.00 154.37 ? 516 GLU A CD    1 
ATOM   3960 O OE1   . GLU A 1 516 ? 49.860  63.878 36.233  1.00 154.09 ? 516 GLU A OE1   1 
ATOM   3961 O OE2   . GLU A 1 516 ? 50.545  65.428 37.626  1.00 157.52 ? 516 GLU A OE2   1 
ATOM   3962 N N     . LEU A 1 517 ? 45.358  64.289 40.070  1.00 144.97 ? 517 LEU A N     1 
ATOM   3963 C CA    . LEU A 1 517 ? 44.791  65.284 40.978  1.00 151.57 ? 517 LEU A CA    1 
ATOM   3964 C C     . LEU A 1 517 ? 44.288  64.624 42.263  1.00 145.88 ? 517 LEU A C     1 
ATOM   3965 O O     . LEU A 1 517 ? 44.338  65.226 43.338  1.00 145.68 ? 517 LEU A O     1 
ATOM   3966 C CB    . LEU A 1 517 ? 43.651  66.037 40.283  1.00 150.13 ? 517 LEU A CB    1 
ATOM   3967 C CG    . LEU A 1 517 ? 43.372  67.498 40.654  1.00 145.66 ? 517 LEU A CG    1 
ATOM   3968 C CD1   . LEU A 1 517 ? 42.763  68.229 39.467  1.00 145.86 ? 517 LEU A CD1   1 
ATOM   3969 C CD2   . LEU A 1 517 ? 42.477  67.627 41.881  1.00 140.55 ? 517 LEU A CD2   1 
ATOM   3970 N N     . VAL A 1 518 ? 43.810  63.386 42.138  1.00 146.89 ? 518 VAL A N     1 
ATOM   3971 C CA    . VAL A 1 518 ? 43.301  62.613 43.273  1.00 146.51 ? 518 VAL A CA    1 
ATOM   3972 C C     . VAL A 1 518 ? 44.440  62.158 44.192  1.00 137.18 ? 518 VAL A C     1 
ATOM   3973 O O     . VAL A 1 518 ? 44.257  62.051 45.406  1.00 134.43 ? 518 VAL A O     1 
ATOM   3974 C CB    . VAL A 1 518 ? 42.468  61.391 42.809  1.00 148.31 ? 518 VAL A CB    1 
ATOM   3975 C CG1   . VAL A 1 518 ? 41.768  60.727 43.988  1.00 158.25 ? 518 VAL A CG1   1 
ATOM   3976 C CG2   . VAL A 1 518 ? 41.439  61.805 41.768  1.00 154.12 ? 518 VAL A CG2   1 
ATOM   3977 N N     . ASN A 1 519 ? 45.612  61.908 43.607  1.00 132.65 ? 519 ASN A N     1 
ATOM   3978 C CA    . ASN A 1 519 ? 46.799  61.475 44.355  1.00 132.55 ? 519 ASN A CA    1 
ATOM   3979 C C     . ASN A 1 519 ? 47.243  62.447 45.451  1.00 143.36 ? 519 ASN A C     1 
ATOM   3980 O O     . ASN A 1 519 ? 47.855  62.036 46.441  1.00 141.94 ? 519 ASN A O     1 
ATOM   3981 C CB    . ASN A 1 519 ? 47.963  61.186 43.401  1.00 138.51 ? 519 ASN A CB    1 
ATOM   3982 C CG    . ASN A 1 519 ? 47.769  59.904 42.609  1.00 148.37 ? 519 ASN A CG    1 
ATOM   3983 O OD1   . ASN A 1 519 ? 47.336  58.882 43.146  1.00 156.65 ? 519 ASN A OD1   1 
ATOM   3984 N ND2   . ASN A 1 519 ? 48.101  59.950 41.324  1.00 148.78 ? 519 ASN A ND2   1 
ATOM   3985 N N     . GLN A 1 520 ? 46.933  63.729 45.264  1.00 156.00 ? 520 GLN A N     1 
ATOM   3986 C CA    . GLN A 1 520 ? 47.201  64.759 46.268  1.00 157.54 ? 520 GLN A CA    1 
ATOM   3987 C C     . GLN A 1 520 ? 46.253  64.629 47.462  1.00 155.42 ? 520 GLN A C     1 
ATOM   3988 O O     . GLN A 1 520 ? 46.630  64.927 48.598  1.00 156.47 ? 520 GLN A O     1 
ATOM   3989 C CB    . GLN A 1 520 ? 47.084  66.156 45.653  1.00 153.94 ? 520 GLN A CB    1 
ATOM   3990 C CG    . GLN A 1 520 ? 48.179  66.499 44.652  1.00 146.22 ? 520 GLN A CG    1 
ATOM   3991 C CD    . GLN A 1 520 ? 48.010  67.873 44.025  1.00 145.61 ? 520 GLN A CD    1 
ATOM   3992 O OE1   . GLN A 1 520 ? 47.209  68.691 44.484  1.00 150.15 ? 520 GLN A OE1   1 
ATOM   3993 N NE2   . GLN A 1 520 ? 48.771  68.134 42.968  1.00 144.07 ? 520 GLN A NE2   1 
ATOM   3994 N N     . ILE A 1 521 ? 45.027  64.185 47.190  1.00 156.01 ? 521 ILE A N     1 
ATOM   3995 C CA    . ILE A 1 521 ? 44.014  63.970 48.226  1.00 152.11 ? 521 ILE A CA    1 
ATOM   3996 C C     . ILE A 1 521 ? 44.301  62.680 49.001  1.00 145.42 ? 521 ILE A C     1 
ATOM   3997 O O     . ILE A 1 521 ? 44.170  62.647 50.227  1.00 146.37 ? 521 ILE A O     1 
ATOM   3998 C CB    . ILE A 1 521 ? 42.585  63.932 47.628  1.00 149.66 ? 521 ILE A CB    1 
ATOM   3999 C CG1   . ILE A 1 521 ? 42.342  65.151 46.728  1.00 148.23 ? 521 ILE A CG1   1 
ATOM   4000 C CG2   . ILE A 1 521 ? 41.535  63.862 48.732  1.00 150.47 ? 521 ILE A CG2   1 
ATOM   4001 C CD1   . ILE A 1 521 ? 41.217  64.978 45.727  1.00 149.83 ? 521 ILE A CD1   1 
ATOM   4002 N N     . ILE A 1 522 ? 44.702  61.634 48.278  1.00 134.71 ? 522 ILE A N     1 
ATOM   4003 C CA    . ILE A 1 522 ? 45.022  60.326 48.866  1.00 138.27 ? 522 ILE A CA    1 
ATOM   4004 C C     . ILE A 1 522 ? 46.158  60.426 49.891  1.00 144.21 ? 522 ILE A C     1 
ATOM   4005 O O     . ILE A 1 522 ? 46.084  59.826 50.966  1.00 142.74 ? 522 ILE A O     1 
ATOM   4006 C CB    . ILE A 1 522 ? 45.371  59.279 47.777  1.00 137.08 ? 522 ILE A CB    1 
ATOM   4007 C CG1   . ILE A 1 522 ? 44.191  59.089 46.815  1.00 147.08 ? 522 ILE A CG1   1 
ATOM   4008 C CG2   . ILE A 1 522 ? 45.756  57.942 48.402  1.00 142.13 ? 522 ILE A CG2   1 
ATOM   4009 C CD1   . ILE A 1 522 ? 44.571  58.513 45.466  1.00 149.52 ? 522 ILE A CD1   1 
ATOM   4010 N N     . GLU A 1 523 ? 47.191  61.198 49.553  1.00 150.72 ? 523 GLU A N     1 
ATOM   4011 C CA    . GLU A 1 523 ? 48.342  61.416 50.433  1.00 154.49 ? 523 GLU A CA    1 
ATOM   4012 C C     . GLU A 1 523 ? 47.943  62.109 51.740  1.00 152.44 ? 523 GLU A C     1 
ATOM   4013 O O     . GLU A 1 523 ? 48.507  61.823 52.799  1.00 150.30 ? 523 GLU A O     1 
ATOM   4014 C CB    . GLU A 1 523 ? 49.422  62.227 49.705  1.00 152.68 ? 523 GLU A CB    1 
ATOM   4015 C CG    . GLU A 1 523 ? 50.788  62.238 50.383  1.00 151.64 ? 523 GLU A CG    1 
ATOM   4016 C CD    . GLU A 1 523 ? 51.498  60.895 50.331  1.00 158.19 ? 523 GLU A CD    1 
ATOM   4017 O OE1   . GLU A 1 523 ? 51.474  60.238 49.267  1.00 158.36 ? 523 GLU A OE1   1 
ATOM   4018 O OE2   . GLU A 1 523 ? 52.090  60.498 51.357  1.00 164.50 ? 523 GLU A OE2   1 
ATOM   4019 N N     . GLN A 1 524 ? 46.968  63.012 51.653  1.00 155.49 ? 524 GLN A N     1 
ATOM   4020 C CA    . GLN A 1 524 ? 46.454  63.730 52.820  1.00 152.87 ? 524 GLN A CA    1 
ATOM   4021 C C     . GLN A 1 524 ? 45.583  62.844 53.710  1.00 151.52 ? 524 GLN A C     1 
ATOM   4022 O O     . GLN A 1 524 ? 45.569  63.010 54.930  1.00 147.27 ? 524 GLN A O     1 
ATOM   4023 C CB    . GLN A 1 524 ? 45.665  64.970 52.386  1.00 149.83 ? 524 GLN A CB    1 
ATOM   4024 C CG    . GLN A 1 524 ? 46.522  66.095 51.822  1.00 148.36 ? 524 GLN A CG    1 
ATOM   4025 C CD    . GLN A 1 524 ? 45.710  67.302 51.382  1.00 139.49 ? 524 GLN A CD    1 
ATOM   4026 O OE1   . GLN A 1 524 ? 44.521  67.418 51.684  1.00 126.98 ? 524 GLN A OE1   1 
ATOM   4027 N NE2   . GLN A 1 524 ? 46.357  68.214 50.665  1.00 145.71 ? 524 GLN A NE2   1 
ATOM   4028 N N     . LEU A 1 525 ? 44.867  61.906 53.090  1.00 150.18 ? 525 LEU A N     1 
ATOM   4029 C CA    . LEU A 1 525 ? 43.956  61.002 53.801  1.00 142.96 ? 525 LEU A CA    1 
ATOM   4030 C C     . LEU A 1 525 ? 44.679  60.005 54.711  1.00 146.46 ? 525 LEU A C     1 
ATOM   4031 O O     . LEU A 1 525 ? 44.117  59.555 55.713  1.00 144.06 ? 525 LEU A O     1 
ATOM   4032 C CB    . LEU A 1 525 ? 43.052  60.258 52.810  1.00 140.91 ? 525 LEU A CB    1 
ATOM   4033 C CG    . LEU A 1 525 ? 41.919  61.056 52.154  1.00 147.31 ? 525 LEU A CG    1 
ATOM   4034 C CD1   . LEU A 1 525 ? 41.551  60.465 50.801  1.00 153.69 ? 525 LEU A CD1   1 
ATOM   4035 C CD2   . LEU A 1 525 ? 40.696  61.143 53.057  1.00 154.66 ? 525 LEU A CD2   1 
ATOM   4036 N N     . ILE A 1 526 ? 45.916  59.665 54.354  1.00 150.77 ? 526 ILE A N     1 
ATOM   4037 C CA    . ILE A 1 526 ? 46.757  58.783 55.170  1.00 147.90 ? 526 ILE A CA    1 
ATOM   4038 C C     . ILE A 1 526 ? 47.225  59.517 56.431  1.00 152.11 ? 526 ILE A C     1 
ATOM   4039 O O     . ILE A 1 526 ? 47.325  58.919 57.506  1.00 154.09 ? 526 ILE A O     1 
ATOM   4040 C CB    . ILE A 1 526 ? 47.974  58.251 54.374  1.00 142.39 ? 526 ILE A CB    1 
ATOM   4041 C CG1   . ILE A 1 526 ? 47.524  57.637 53.042  1.00 136.48 ? 526 ILE A CG1   1 
ATOM   4042 C CG2   . ILE A 1 526 ? 48.752  57.225 55.192  1.00 140.95 ? 526 ILE A CG2   1 
ATOM   4043 C CD1   . ILE A 1 526 ? 48.612  57.553 51.991  1.00 133.78 ? 526 ILE A CD1   1 
ATOM   4044 N N     . LYS A 1 527 ? 47.494  60.814 56.287  1.00 154.13 ? 527 LYS A N     1 
ATOM   4045 C CA    . LYS A 1 527 ? 47.943  61.659 57.397  1.00 157.17 ? 527 LYS A CA    1 
ATOM   4046 C C     . LYS A 1 527 ? 46.850  61.881 58.444  1.00 154.35 ? 527 LYS A C     1 
ATOM   4047 O O     . LYS A 1 527 ? 47.137  61.940 59.642  1.00 155.75 ? 527 LYS A O     1 
ATOM   4048 C CB    . LYS A 1 527 ? 48.455  63.009 56.876  1.00 157.47 ? 527 LYS A CB    1 
ATOM   4049 C CG    . LYS A 1 527 ? 49.732  62.936 56.048  1.00 148.12 ? 527 LYS A CG    1 
ATOM   4050 C CD    . LYS A 1 527 ? 50.971  62.780 56.921  1.00 138.68 ? 527 LYS A CD    1 
ATOM   4051 C CE    . LYS A 1 527 ? 52.242  62.717 56.087  1.00 141.79 ? 527 LYS A CE    1 
ATOM   4052 N NZ    . LYS A 1 527 ? 52.574  64.022 55.447  1.00 139.69 ? 527 LYS A NZ    1 
ATOM   4053 N N     . LYS A 1 528 ? 45.605  62.002 57.986  1.00 146.79 ? 528 LYS A N     1 
ATOM   4054 C CA    . LYS A 1 528 ? 44.461  62.201 58.877  1.00 139.12 ? 528 LYS A CA    1 
ATOM   4055 C C     . LYS A 1 528 ? 44.024  60.883 59.511  1.00 142.04 ? 528 LYS A C     1 
ATOM   4056 O O     . LYS A 1 528 ? 44.103  59.825 58.880  1.00 142.79 ? 528 LYS A O     1 
ATOM   4057 C CB    . LYS A 1 528 ? 43.284  62.845 58.129  1.00 140.19 ? 528 LYS A CB    1 
ATOM   4058 C CG    . LYS A 1 528 ? 43.618  64.108 57.342  1.00 142.94 ? 528 LYS A CG    1 
ATOM   4059 C CD    . LYS A 1 528 ? 44.044  65.264 58.235  1.00 142.66 ? 528 LYS A CD    1 
ATOM   4060 C CE    . LYS A 1 528 ? 44.517  66.447 57.404  1.00 141.43 ? 528 LYS A CE    1 
ATOM   4061 N NZ    . LYS A 1 528 ? 45.111  67.523 58.243  1.00 147.97 ? 528 LYS A NZ    1 
ATOM   4062 N N     . GLU A 1 529 ? 43.560  60.957 60.756  1.00 146.36 ? 529 GLU A N     1 
ATOM   4063 C CA    . GLU A 1 529 ? 43.149  59.771 61.510  1.00 152.51 ? 529 GLU A CA    1 
ATOM   4064 C C     . GLU A 1 529 ? 41.771  59.260 61.089  1.00 154.16 ? 529 GLU A C     1 
ATOM   4065 O O     . GLU A 1 529 ? 41.631  58.103 60.686  1.00 151.31 ? 529 GLU A O     1 
ATOM   4066 C CB    . GLU A 1 529 ? 43.184  60.045 63.018  1.00 153.36 ? 529 GLU A CB    1 
ATOM   4067 C CG    . GLU A 1 529 ? 44.585  60.183 63.599  1.00 150.58 ? 529 GLU A CG    1 
ATOM   4068 C CD    . GLU A 1 529 ? 44.588  60.425 65.099  1.00 153.47 ? 529 GLU A CD    1 
ATOM   4069 O OE1   . GLU A 1 529 ? 43.749  59.831 65.811  1.00 157.89 ? 529 GLU A OE1   1 
ATOM   4070 O OE2   . GLU A 1 529 ? 45.435  61.213 65.569  1.00 152.68 ? 529 GLU A OE2   1 
ATOM   4071 N N     . LYS A 1 530 ? 40.761  60.125 61.183  1.00 153.93 ? 530 LYS A N     1 
ATOM   4072 C CA    . LYS A 1 530 ? 39.386  59.758 60.843  1.00 160.61 ? 530 LYS A CA    1 
ATOM   4073 C C     . LYS A 1 530 ? 38.760  60.745 59.860  1.00 161.62 ? 530 LYS A C     1 
ATOM   4074 O O     . LYS A 1 530 ? 38.779  61.958 60.086  1.00 158.99 ? 530 LYS A O     1 
ATOM   4075 C CB    . LYS A 1 530 ? 38.524  59.650 62.106  1.00 153.23 ? 530 LYS A CB    1 
ATOM   4076 C CG    . LYS A 1 530 ? 38.824  58.435 62.972  1.00 152.98 ? 530 LYS A CG    1 
ATOM   4077 C CD    . LYS A 1 530 ? 37.935  58.402 64.205  1.00 150.54 ? 530 LYS A CD    1 
ATOM   4078 C CE    . LYS A 1 530 ? 38.236  57.190 65.071  1.00 148.06 ? 530 LYS A CE    1 
ATOM   4079 N NZ    . LYS A 1 530 ? 37.373  57.145 66.283  1.00 154.09 ? 530 LYS A NZ    1 
ATOM   4080 N N     . VAL A 1 531 ? 38.214  60.211 58.769  1.00 163.02 ? 531 VAL A N     1 
ATOM   4081 C CA    . VAL A 1 531 ? 37.556  61.017 57.738  1.00 159.00 ? 531 VAL A CA    1 
ATOM   4082 C C     . VAL A 1 531 ? 36.170  60.443 57.432  1.00 155.52 ? 531 VAL A C     1 
ATOM   4083 O O     . VAL A 1 531 ? 36.036  59.263 57.098  1.00 150.84 ? 531 VAL A O     1 
ATOM   4084 C CB    . VAL A 1 531 ? 38.404  61.099 56.443  1.00 161.43 ? 531 VAL A CB    1 
ATOM   4085 C CG1   . VAL A 1 531 ? 37.656  61.845 55.344  1.00 155.81 ? 531 VAL A CG1   1 
ATOM   4086 C CG2   . VAL A 1 531 ? 39.743  61.772 56.712  1.00 156.46 ? 531 VAL A CG2   1 
ATOM   4087 N N     . TYR A 1 532 ? 35.147  61.287 57.555  1.00 153.67 ? 532 TYR A N     1 
ATOM   4088 C CA    . TYR A 1 532 ? 33.764  60.888 57.293  1.00 154.59 ? 532 TYR A CA    1 
ATOM   4089 C C     . TYR A 1 532 ? 33.258  61.458 55.968  1.00 152.67 ? 532 TYR A C     1 
ATOM   4090 O O     . TYR A 1 532 ? 33.591  62.587 55.599  1.00 152.69 ? 532 TYR A O     1 
ATOM   4091 C CB    . TYR A 1 532 ? 32.853  61.322 58.448  1.00 153.23 ? 532 TYR A CB    1 
ATOM   4092 C CG    . TYR A 1 532 ? 31.417  60.851 58.326  1.00 154.27 ? 532 TYR A CG    1 
ATOM   4093 C CD1   . TYR A 1 532 ? 31.063  59.539 58.641  1.00 148.98 ? 532 TYR A CD1   1 
ATOM   4094 C CD2   . TYR A 1 532 ? 30.412  61.720 57.901  1.00 156.35 ? 532 TYR A CD2   1 
ATOM   4095 C CE1   . TYR A 1 532 ? 29.750  59.105 58.531  1.00 146.26 ? 532 TYR A CE1   1 
ATOM   4096 C CE2   . TYR A 1 532 ? 29.097  61.295 57.788  1.00 154.95 ? 532 TYR A CE2   1 
ATOM   4097 C CZ    . TYR A 1 532 ? 28.771  59.988 58.105  1.00 152.25 ? 532 TYR A CZ    1 
ATOM   4098 O OH    . TYR A 1 532 ? 27.467  59.562 57.995  1.00 147.38 ? 532 TYR A OH    1 
ATOM   4099 N N     . LEU A 1 533 ? 32.451  60.667 55.263  1.00 152.49 ? 533 LEU A N     1 
ATOM   4100 C CA    . LEU A 1 533 ? 31.886  61.068 53.977  1.00 148.14 ? 533 LEU A CA    1 
ATOM   4101 C C     . LEU A 1 533 ? 30.379  60.815 53.922  1.00 149.53 ? 533 LEU A C     1 
ATOM   4102 O O     . LEU A 1 533 ? 29.905  59.746 54.317  1.00 147.62 ? 533 LEU A O     1 
ATOM   4103 C CB    . LEU A 1 533 ? 32.599  60.341 52.829  1.00 147.84 ? 533 LEU A CB    1 
ATOM   4104 C CG    . LEU A 1 533 ? 32.315  60.758 51.381  1.00 147.59 ? 533 LEU A CG    1 
ATOM   4105 C CD1   . LEU A 1 533 ? 32.817  62.166 51.089  1.00 150.14 ? 533 LEU A CD1   1 
ATOM   4106 C CD2   . LEU A 1 533 ? 32.941  59.760 50.418  1.00 149.28 ? 533 LEU A CD2   1 
ATOM   4107 N N     . ALA A 1 534 ? 29.638  61.806 53.429  1.00 153.23 ? 534 ALA A N     1 
ATOM   4108 C CA    . ALA A 1 534 ? 28.181  61.722 53.316  1.00 154.74 ? 534 ALA A CA    1 
ATOM   4109 C C     . ALA A 1 534 ? 27.684  62.296 51.989  1.00 156.20 ? 534 ALA A C     1 
ATOM   4110 O O     . ALA A 1 534 ? 28.303  63.201 51.423  1.00 154.33 ? 534 ALA A O     1 
ATOM   4111 C CB    . ALA A 1 534 ? 27.517  62.432 54.487  1.00 152.75 ? 534 ALA A CB    1 
ATOM   4112 N N     . TRP A 1 535 ? 26.562  61.766 51.505  1.00 158.60 ? 535 TRP A N     1 
ATOM   4113 C CA    . TRP A 1 535 ? 25.976  62.201 50.237  1.00 158.39 ? 535 TRP A CA    1 
ATOM   4114 C C     . TRP A 1 535 ? 24.642  62.869 50.428  1.00 147.90 ? 535 TRP A C     1 
ATOM   4115 O O     . TRP A 1 535 ? 23.803  62.397 51.201  1.00 144.61 ? 535 TRP A O     1 
ATOM   4116 C CB    . TRP A 1 535 ? 25.845  61.022 49.275  1.00 158.28 ? 535 TRP A CB    1 
ATOM   4117 C CG    . TRP A 1 535 ? 25.434  61.419 47.875  1.00 153.66 ? 535 TRP A CG    1 
ATOM   4118 C CD1   . TRP A 1 535 ? 26.262  61.804 46.823  1.00 150.90 ? 535 TRP A CD1   1 
ATOM   4119 C CD2   . TRP A 1 535 ? 24.070  61.482 47.326  1.00 153.42 ? 535 TRP A CD2   1 
ATOM   4120 N NE1   . TRP A 1 535 ? 25.528  62.092 45.700  1.00 146.57 ? 535 TRP A NE1   1 
ATOM   4121 C CE2   . TRP A 1 535 ? 24.209  61.920 45.931  1.00 146.06 ? 535 TRP A CE2   1 
ATOM   4122 C CE3   . TRP A 1 535 ? 22.797  61.230 47.830  1.00 155.03 ? 535 TRP A CE3   1 
ATOM   4123 C CZ2   . TRP A 1 535 ? 23.110  62.090 45.100  1.00 147.11 ? 535 TRP A CZ2   1 
ATOM   4124 C CZ3   . TRP A 1 535 ? 21.697  61.405 46.981  1.00 154.66 ? 535 TRP A CZ3   1 
ATOM   4125 C CH2   . TRP A 1 535 ? 21.852  61.825 45.650  1.00 153.28 ? 535 TRP A CH2   1 
ATOM   4126 N N     . VAL A 1 536 ? 24.443  63.979 49.720  1.00 143.61 ? 536 VAL A N     1 
ATOM   4127 C CA    . VAL A 1 536 ? 23.182  64.728 49.749  1.00 146.92 ? 536 VAL A CA    1 
ATOM   4128 C C     . VAL A 1 536 ? 22.667  65.002 48.330  1.00 149.65 ? 536 VAL A C     1 
ATOM   4129 O O     . VAL A 1 536 ? 23.467  65.156 47.404  1.00 148.35 ? 536 VAL A O     1 
ATOM   4130 C CB    . VAL A 1 536 ? 23.306  66.059 50.536  1.00 147.50 ? 536 VAL A CB    1 
ATOM   4131 C CG1   . VAL A 1 536 ? 23.348  65.799 52.035  1.00 145.44 ? 536 VAL A CG1   1 
ATOM   4132 C CG2   . VAL A 1 536 ? 24.522  66.864 50.086  1.00 148.36 ? 536 VAL A CG2   1 
ATOM   4133 N N     . PRO A 1 537 ? 21.329  65.050 48.151  1.00 154.72 ? 537 PRO A N     1 
ATOM   4134 C CA    . PRO A 1 537 ? 20.762  65.378 46.838  1.00 149.51 ? 537 PRO A CA    1 
ATOM   4135 C C     . PRO A 1 537 ? 21.015  66.832 46.435  1.00 137.98 ? 537 PRO A C     1 
ATOM   4136 O O     . PRO A 1 537 ? 20.912  67.736 47.269  1.00 137.65 ? 537 PRO A O     1 
ATOM   4137 C CB    . PRO A 1 537 ? 19.260  65.124 47.024  1.00 156.76 ? 537 PRO A CB    1 
ATOM   4138 C CG    . PRO A 1 537 ? 19.030  65.211 48.494  1.00 159.08 ? 537 PRO A CG    1 
ATOM   4139 C CD    . PRO A 1 537 ? 20.283  64.683 49.124  1.00 159.46 ? 537 PRO A CD    1 
ATOM   4140 N N     . ALA A 1 538 ? 21.347  67.041 45.163  1.00 131.13 ? 538 ALA A N     1 
ATOM   4141 C CA    . ALA A 1 538 ? 21.662  68.370 44.643  1.00 139.61 ? 538 ALA A CA    1 
ATOM   4142 C C     . ALA A 1 538 ? 20.408  69.139 44.234  1.00 150.48 ? 538 ALA A C     1 
ATOM   4143 O O     . ALA A 1 538 ? 19.476  68.563 43.665  1.00 156.90 ? 538 ALA A O     1 
ATOM   4144 C CB    . ALA A 1 538 ? 22.629  68.266 43.472  1.00 137.82 ? 538 ALA A CB    1 
ATOM   4145 N N     . HIS A 1 539 ? 20.407  70.440 44.531  1.00 154.20 ? 539 HIS A N     1 
ATOM   4146 C CA    . HIS A 1 539 ? 19.301  71.358 44.217  1.00 152.24 ? 539 HIS A CA    1 
ATOM   4147 C C     . HIS A 1 539 ? 17.975  70.913 44.779  1.00 156.30 ? 539 HIS A C     1 
ATOM   4148 O O     . HIS A 1 539 ? 17.145  70.334 44.071  1.00 164.80 ? 539 HIS A O     1 
ATOM   4149 C CB    . HIS A 1 539 ? 19.205  71.617 42.711  1.00 149.01 ? 539 HIS A CB    1 
ATOM   4150 C CG    . HIS A 1 539 ? 20.437  72.260 42.121  1.00 151.41 ? 539 HIS A CG    1 
ATOM   4151 N ND1   . HIS A 1 539 ? 20.584  73.594 42.030  1.00 155.13 ? 539 HIS A ND1   1 
ATOM   4152 C CD2   . HIS A 1 539 ? 21.596  71.699 41.586  1.00 149.92 ? 539 HIS A CD2   1 
ATOM   4153 C CE1   . HIS A 1 539 ? 21.774  73.876 41.466  1.00 152.96 ? 539 HIS A CE1   1 
ATOM   4154 N NE2   . HIS A 1 539 ? 22.392  72.716 41.195  1.00 150.44 ? 539 HIS A NE2   1 
ATOM   4155 N N     . LYS A 1 540 ? 17.772  71.180 46.068  1.00 153.81 ? 540 LYS A N     1 
ATOM   4156 C CA    . LYS A 1 540 ? 16.535  70.812 46.757  1.00 157.73 ? 540 LYS A CA    1 
ATOM   4157 C C     . LYS A 1 540 ? 16.166  71.826 47.841  1.00 158.99 ? 540 LYS A C     1 
ATOM   4158 O O     . LYS A 1 540 ? 15.004  72.220 47.958  1.00 164.45 ? 540 LYS A O     1 
ATOM   4159 C CB    . LYS A 1 540 ? 16.649  69.402 47.353  1.00 152.38 ? 540 LYS A CB    1 
ATOM   4160 C CG    . LYS A 1 540 ? 15.318  68.746 47.710  1.00 148.41 ? 540 LYS A CG    1 
ATOM   4161 C CD    . LYS A 1 540 ? 14.516  68.332 46.480  1.00 143.92 ? 540 LYS A CD    1 
ATOM   4162 C CE    . LYS A 1 540 ? 15.098  67.099 45.804  1.00 138.82 ? 540 LYS A CE    1 
ATOM   4163 N NZ    . LYS A 1 540 ? 14.321  66.707 44.596  1.00 138.52 ? 540 LYS A NZ    1 
ATOM   4164 N N     . GLY A 1 541 ? 17.160  72.239 48.626  1.00 157.31 ? 541 GLY A N     1 
ATOM   4165 C CA    . GLY A 1 541 ? 16.957  73.217 49.693  1.00 157.74 ? 541 GLY A CA    1 
ATOM   4166 C C     . GLY A 1 541 ? 17.447  72.741 51.048  1.00 162.31 ? 541 GLY A C     1 
ATOM   4167 O O     . GLY A 1 541 ? 16.764  72.919 52.060  1.00 159.74 ? 541 GLY A O     1 
ATOM   4168 N N     . ILE A 1 542 ? 18.633  72.138 51.064  1.00 157.75 ? 542 ILE A N     1 
ATOM   4169 C CA    . ILE A 1 542 ? 19.246  71.642 52.296  1.00 150.51 ? 542 ILE A CA    1 
ATOM   4170 C C     . ILE A 1 542 ? 20.163  72.714 52.887  1.00 151.69 ? 542 ILE A C     1 
ATOM   4171 O O     . ILE A 1 542 ? 20.940  73.344 52.165  1.00 149.75 ? 542 ILE A O     1 
ATOM   4172 C CB    . ILE A 1 542 ? 20.042  70.336 52.058  1.00 144.08 ? 542 ILE A CB    1 
ATOM   4173 C CG1   . ILE A 1 542 ? 19.219  69.342 51.227  1.00 142.49 ? 542 ILE A CG1   1 
ATOM   4174 C CG2   . ILE A 1 542 ? 20.460  69.708 53.384  1.00 140.36 ? 542 ILE A CG2   1 
ATOM   4175 C CD1   . ILE A 1 542 ? 20.039  68.264 50.550  1.00 138.58 ? 542 ILE A CD1   1 
ATOM   4176 N N     . GLY A 1 543 ? 20.058  72.914 54.200  1.00 149.44 ? 543 GLY A N     1 
ATOM   4177 C CA    . GLY A 1 543 ? 20.886  73.884 54.915  1.00 158.12 ? 543 GLY A CA    1 
ATOM   4178 C C     . GLY A 1 543 ? 22.349  73.482 54.948  1.00 150.48 ? 543 GLY A C     1 
ATOM   4179 O O     . GLY A 1 543 ? 22.704  72.448 55.518  1.00 147.58 ? 543 GLY A O     1 
ATOM   4180 N N     . GLY A 1 544 ? 23.193  74.308 54.335  1.00 149.15 ? 544 GLY A N     1 
ATOM   4181 C CA    . GLY A 1 544 ? 24.625  74.032 54.236  1.00 146.68 ? 544 GLY A CA    1 
ATOM   4182 C C     . GLY A 1 544 ? 25.073  73.767 52.810  1.00 147.12 ? 544 GLY A C     1 
ATOM   4183 O O     . GLY A 1 544 ? 26.232  74.006 52.463  1.00 153.78 ? 544 GLY A O     1 
ATOM   4184 N N     . ASN A 1 545 ? 24.150  73.271 51.988  1.00 146.06 ? 545 ASN A N     1 
ATOM   4185 C CA    . ASN A 1 545 ? 24.425  72.968 50.585  1.00 147.99 ? 545 ASN A CA    1 
ATOM   4186 C C     . ASN A 1 545 ? 24.084  74.133 49.654  1.00 150.38 ? 545 ASN A C     1 
ATOM   4187 O O     . ASN A 1 545 ? 24.731  74.319 48.620  1.00 154.22 ? 545 ASN A O     1 
ATOM   4188 C CB    . ASN A 1 545 ? 23.665  71.706 50.157  1.00 154.85 ? 545 ASN A CB    1 
ATOM   4189 C CG    . ASN A 1 545 ? 24.101  71.188 48.796  1.00 151.98 ? 545 ASN A CG    1 
ATOM   4190 O OD1   . ASN A 1 545 ? 23.284  71.051 47.884  1.00 163.09 ? 545 ASN A OD1   1 
ATOM   4191 N ND2   . ASN A 1 545 ? 25.391  70.898 48.652  1.00 134.84 ? 545 ASN A ND2   1 
ATOM   4192 N N     . GLU A 1 546 ? 23.070  74.910 50.033  1.00 146.43 ? 546 GLU A N     1 
ATOM   4193 C CA    . GLU A 1 546 ? 22.604  76.046 49.237  1.00 150.26 ? 546 GLU A CA    1 
ATOM   4194 C C     . GLU A 1 546 ? 23.577  77.227 49.287  1.00 155.81 ? 546 GLU A C     1 
ATOM   4195 O O     . GLU A 1 546 ? 23.703  77.975 48.314  1.00 156.99 ? 546 GLU A O     1 
ATOM   4196 C CB    . GLU A 1 546 ? 21.211  76.485 49.704  1.00 157.56 ? 546 GLU A CB    1 
ATOM   4197 C CG    . GLU A 1 546 ? 20.447  77.342 48.703  1.00 165.85 ? 546 GLU A CG    1 
ATOM   4198 C CD    . GLU A 1 546 ? 19.083  77.780 49.210  1.00 163.32 ? 546 GLU A CD    1 
ATOM   4199 O OE1   . GLU A 1 546 ? 18.420  76.997 49.926  1.00 160.43 ? 546 GLU A OE1   1 
ATOM   4200 O OE2   . GLU A 1 546 ? 18.672  78.917 48.889  1.00 155.19 ? 546 GLU A OE2   1 
ATOM   4201 N N     . GLN A 1 547 ? 24.259  77.383 50.421  1.00 156.67 ? 547 GLN A N     1 
ATOM   4202 C CA    . GLN A 1 547 ? 25.215  78.475 50.626  1.00 156.78 ? 547 GLN A CA    1 
ATOM   4203 C C     . GLN A 1 547 ? 26.457  78.348 49.742  1.00 156.89 ? 547 GLN A C     1 
ATOM   4204 O O     . GLN A 1 547 ? 27.001  79.353 49.279  1.00 157.36 ? 547 GLN A O     1 
ATOM   4205 C CB    . GLN A 1 547 ? 25.625  78.570 52.101  1.00 153.52 ? 547 GLN A CB    1 
ATOM   4206 C CG    . GLN A 1 547 ? 24.609  79.262 53.003  1.00 150.40 ? 547 GLN A CG    1 
ATOM   4207 C CD    . GLN A 1 547 ? 23.403  78.397 53.335  1.00 143.97 ? 547 GLN A CD    1 
ATOM   4208 O OE1   . GLN A 1 547 ? 23.511  77.177 53.466  1.00 145.12 ? 547 GLN A OE1   1 
ATOM   4209 N NE2   . GLN A 1 547 ? 22.246  79.032 53.481  1.00 141.34 ? 547 GLN A NE2   1 
ATOM   4210 N N     . VAL A 1 548 ? 26.897  77.111 49.515  1.00 158.78 ? 548 VAL A N     1 
ATOM   4211 C CA    . VAL A 1 548 ? 28.057  76.834 48.667  1.00 150.94 ? 548 VAL A CA    1 
ATOM   4212 C C     . VAL A 1 548 ? 27.679  76.940 47.187  1.00 153.92 ? 548 VAL A C     1 
ATOM   4213 O O     . VAL A 1 548 ? 28.498  77.343 46.357  1.00 147.99 ? 548 VAL A O     1 
ATOM   4214 C CB    . VAL A 1 548 ? 28.660  75.437 48.952  1.00 147.43 ? 548 VAL A CB    1 
ATOM   4215 C CG1   . VAL A 1 548 ? 30.054  75.317 48.350  1.00 147.39 ? 548 VAL A CG1   1 
ATOM   4216 C CG2   . VAL A 1 548 ? 28.720  75.166 50.449  1.00 146.94 ? 548 VAL A CG2   1 
ATOM   4217 N N     . ASP A 1 549 ? 26.433  76.586 46.874  1.00 162.34 ? 549 ASP A N     1 
ATOM   4218 C CA    . ASP A 1 549 ? 25.921  76.593 45.502  1.00 161.84 ? 549 ASP A CA    1 
ATOM   4219 C C     . ASP A 1 549 ? 25.811  78.002 44.915  1.00 156.08 ? 549 ASP A C     1 
ATOM   4220 O O     . ASP A 1 549 ? 26.000  78.194 43.712  1.00 152.36 ? 549 ASP A O     1 
ATOM   4221 C CB    . ASP A 1 549 ? 24.561  75.888 45.439  1.00 159.84 ? 549 ASP A CB    1 
ATOM   4222 C CG    . ASP A 1 549 ? 24.100  75.619 44.014  1.00 157.35 ? 549 ASP A CG    1 
ATOM   4223 O OD1   . ASP A 1 549 ? 24.897  75.088 43.210  1.00 150.44 ? 549 ASP A OD1   1 
ATOM   4224 O OD2   . ASP A 1 549 ? 22.932  75.932 43.701  1.00 149.32 ? 549 ASP A OD2   1 
ATOM   4225 N N     . LYS A 1 550 ? 25.504  78.977 45.768  1.00 155.79 ? 550 LYS A N     1 
ATOM   4226 C CA    . LYS A 1 550 ? 25.357  80.373 45.348  1.00 156.37 ? 550 LYS A CA    1 
ATOM   4227 C C     . LYS A 1 550 ? 26.698  81.037 45.029  1.00 158.46 ? 550 LYS A C     1 
ATOM   4228 O O     . LYS A 1 550 ? 26.761  81.956 44.210  1.00 162.65 ? 550 LYS A O     1 
ATOM   4229 C CB    . LYS A 1 550 ? 24.610  81.182 46.413  1.00 153.31 ? 550 LYS A CB    1 
ATOM   4230 C CG    . LYS A 1 550 ? 23.131  80.845 46.534  1.00 148.59 ? 550 LYS A CG    1 
ATOM   4231 C CD    . LYS A 1 550 ? 22.458  81.687 47.606  1.00 149.06 ? 550 LYS A CD    1 
ATOM   4232 C CE    . LYS A 1 550 ? 20.981  81.351 47.725  1.00 153.24 ? 550 LYS A CE    1 
ATOM   4233 N NZ    . LYS A 1 550 ? 20.307  82.168 48.771  1.00 159.91 ? 550 LYS A NZ    1 
ATOM   4234 N N     . LEU A 1 551 ? 27.760  80.565 45.679  1.00 157.48 ? 551 LEU A N     1 
ATOM   4235 C CA    . LEU A 1 551 ? 29.103  81.117 45.493  1.00 161.43 ? 551 LEU A CA    1 
ATOM   4236 C C     . LEU A 1 551 ? 29.745  80.674 44.178  1.00 159.17 ? 551 LEU A C     1 
ATOM   4237 O O     . LEU A 1 551 ? 30.377  81.479 43.490  1.00 159.42 ? 551 LEU A O     1 
ATOM   4238 C CB    . LEU A 1 551 ? 30.010  80.748 46.674  1.00 160.03 ? 551 LEU A CB    1 
ATOM   4239 C CG    . LEU A 1 551 ? 29.719  81.380 48.041  1.00 161.85 ? 551 LEU A CG    1 
ATOM   4240 C CD1   . LEU A 1 551 ? 30.363  80.562 49.150  1.00 156.41 ? 551 LEU A CD1   1 
ATOM   4241 C CD2   . LEU A 1 551 ? 30.182  82.829 48.101  1.00 158.03 ? 551 LEU A CD2   1 
ATOM   4242 N N     . VAL A 1 552 ? 29.580  79.397 43.838  1.00 155.01 ? 552 VAL A N     1 
ATOM   4243 C CA    . VAL A 1 552 ? 30.162  78.830 42.615  1.00 151.56 ? 552 VAL A CA    1 
ATOM   4244 C C     . VAL A 1 552 ? 29.419  79.259 41.345  1.00 150.47 ? 552 VAL A C     1 
ATOM   4245 O O     . VAL A 1 552 ? 30.016  79.340 40.269  1.00 146.43 ? 552 VAL A O     1 
ATOM   4246 C CB    . VAL A 1 552 ? 30.281  77.286 42.676  1.00 151.83 ? 552 VAL A CB    1 
ATOM   4247 C CG1   . VAL A 1 552 ? 31.385  76.872 43.639  1.00 152.54 ? 552 VAL A CG1   1 
ATOM   4248 C CG2   . VAL A 1 552 ? 28.955  76.637 43.060  1.00 150.33 ? 552 VAL A CG2   1 
ATOM   4249 N N     . SER A 1 553 ? 28.122  79.534 41.480  1.00 144.83 ? 553 SER A N     1 
ATOM   4250 C CA    . SER A 1 553 ? 27.287  79.941 40.350  1.00 143.08 ? 553 SER A CA    1 
ATOM   4251 C C     . SER A 1 553 ? 27.044  81.454 40.322  1.00 160.35 ? 553 SER A C     1 
ATOM   4252 O O     . SER A 1 553 ? 26.086  81.929 39.704  1.00 163.81 ? 553 SER A O     1 
ATOM   4253 C CB    . SER A 1 553 ? 25.956  79.179 40.366  1.00 131.20 ? 553 SER A CB    1 
ATOM   4254 O OG    . SER A 1 553 ? 25.196  79.496 41.520  1.00 136.62 ? 553 SER A OG    1 
ATOM   4255 N N     . ALA A 1 554 ? 27.922  82.202 40.989  1.00 165.14 ? 554 ALA A N     1 
ATOM   4256 C CA    . ALA A 1 554 ? 27.832  83.661 41.038  1.00 161.11 ? 554 ALA A CA    1 
ATOM   4257 C C     . ALA A 1 554 ? 28.274  84.301 39.722  1.00 156.22 ? 554 ALA A C     1 
ATOM   4258 O O     . ALA A 1 554 ? 27.651  85.254 39.248  1.00 155.24 ? 554 ALA A O     1 
ATOM   4259 C CB    . ALA A 1 554 ? 28.649  84.206 42.201  1.00 148.17 ? 554 ALA A CB    1 
ATOM   4260 N N     . GLY A 1 555 ? 29.349  83.771 39.141  1.00 154.67 ? 555 GLY A N     1 
ATOM   4261 C CA    . GLY A 1 555 ? 29.871  84.257 37.866  1.00 152.43 ? 555 GLY A CA    1 
ATOM   4262 C C     . GLY A 1 555 ? 29.554  83.342 36.696  1.00 158.78 ? 555 GLY A C     1 
ATOM   4263 O O     . GLY A 1 555 ? 29.808  83.691 35.541  1.00 160.69 ? 555 GLY A O     1 
ATOM   4264 N N     . ILE A 1 556 ? 28.999  82.170 37.000  1.00 162.33 ? 556 ILE A N     1 
ATOM   4265 C CA    . ILE A 1 556 ? 28.639  81.183 35.982  1.00 160.07 ? 556 ILE A CA    1 
ATOM   4266 C C     . ILE A 1 556 ? 27.121  81.081 35.841  1.00 159.69 ? 556 ILE A C     1 
ATOM   4267 O O     . ILE A 1 556 ? 26.393  81.039 36.835  1.00 159.18 ? 556 ILE A O     1 
ATOM   4268 C CB    . ILE A 1 556 ? 29.238  79.792 36.299  1.00 150.58 ? 556 ILE A CB    1 
ATOM   4269 C CG1   . ILE A 1 556 ? 30.767  79.876 36.403  1.00 145.44 ? 556 ILE A CG1   1 
ATOM   4270 C CG2   . ILE A 1 556 ? 28.825  78.774 35.241  1.00 154.14 ? 556 ILE A CG2   1 
ATOM   4271 C CD1   . ILE A 1 556 ? 31.408  78.736 37.167  1.00 149.82 ? 556 ILE A CD1   1 
ATOM   4272 N N     . THR B 2 21  ? 6.169   11.504 12.734  1.00 163.51 ? 7   THR B N     1 
ATOM   4273 C CA    . THR B 2 21  ? 7.213   12.571 12.800  1.00 160.09 ? 7   THR B CA    1 
ATOM   4274 C C     . THR B 2 21  ? 6.738   13.879 12.159  1.00 160.52 ? 7   THR B C     1 
ATOM   4275 O O     . THR B 2 21  ? 5.897   13.871 11.255  1.00 169.95 ? 7   THR B O     1 
ATOM   4276 C CB    . THR B 2 21  ? 8.553   12.109 12.173  1.00 142.81 ? 7   THR B CB    1 
ATOM   4277 O OG1   . THR B 2 21  ? 9.520   13.164 12.262  1.00 140.58 ? 7   THR B OG1   1 
ATOM   4278 C CG2   . THR B 2 21  ? 8.377   11.701 10.707  1.00 139.74 ? 7   THR B CG2   1 
ATOM   4279 N N     . VAL B 2 22  ? 7.281   14.995 12.641  1.00 152.92 ? 8   VAL B N     1 
ATOM   4280 C CA    . VAL B 2 22  ? 6.932   16.323 12.131  1.00 146.65 ? 8   VAL B CA    1 
ATOM   4281 C C     . VAL B 2 22  ? 8.190   17.102 11.715  1.00 142.17 ? 8   VAL B C     1 
ATOM   4282 O O     . VAL B 2 22  ? 9.142   17.207 12.494  1.00 144.82 ? 8   VAL B O     1 
ATOM   4283 C CB    . VAL B 2 22  ? 6.055   17.117 13.142  1.00 149.10 ? 8   VAL B CB    1 
ATOM   4284 C CG1   . VAL B 2 22  ? 6.766   17.307 14.479  1.00 143.49 ? 8   VAL B CG1   1 
ATOM   4285 C CG2   . VAL B 2 22  ? 5.611   18.455 12.562  1.00 145.26 ? 8   VAL B CG2   1 
ATOM   4286 N N     . PRO B 2 23  ? 8.206   17.626 10.471  1.00 135.74 ? 9   PRO B N     1 
ATOM   4287 C CA    . PRO B 2 23  ? 9.331   18.437 9.994   1.00 150.61 ? 9   PRO B CA    1 
ATOM   4288 C C     . PRO B 2 23  ? 9.426   19.788 10.705  1.00 154.00 ? 9   PRO B C     1 
ATOM   4289 O O     . PRO B 2 23  ? 8.412   20.468 10.889  1.00 157.86 ? 9   PRO B O     1 
ATOM   4290 C CB    . PRO B 2 23  ? 9.024   18.632 8.504   1.00 151.11 ? 9   PRO B CB    1 
ATOM   4291 C CG    . PRO B 2 23  ? 7.554   18.418 8.379   1.00 139.66 ? 9   PRO B CG    1 
ATOM   4292 C CD    . PRO B 2 23  ? 7.218   17.378 9.404   1.00 134.71 ? 9   PRO B CD    1 
ATOM   4293 N N     . VAL B 2 24  ? 10.642  20.159 11.102  1.00 150.08 ? 10  VAL B N     1 
ATOM   4294 C CA    . VAL B 2 24  ? 10.887  21.419 11.802  1.00 142.67 ? 10  VAL B CA    1 
ATOM   4295 C C     . VAL B 2 24  ? 11.648  22.385 10.893  1.00 138.63 ? 10  VAL B C     1 
ATOM   4296 O O     . VAL B 2 24  ? 12.729  22.062 10.393  1.00 147.72 ? 10  VAL B O     1 
ATOM   4297 C CB    . VAL B 2 24  ? 11.666  21.203 13.123  1.00 144.63 ? 10  VAL B CB    1 
ATOM   4298 C CG1   . VAL B 2 24  ? 11.807  22.511 13.891  1.00 143.97 ? 10  VAL B CG1   1 
ATOM   4299 C CG2   . VAL B 2 24  ? 10.980  20.157 13.992  1.00 141.78 ? 10  VAL B CG2   1 
ATOM   4300 N N     . LYS B 2 25  ? 11.068  23.565 10.681  1.00 134.90 ? 11  LYS B N     1 
ATOM   4301 C CA    . LYS B 2 25  ? 11.674  24.593 9.837   1.00 143.51 ? 11  LYS B CA    1 
ATOM   4302 C C     . LYS B 2 25  ? 12.090  25.815 10.652  1.00 149.14 ? 11  LYS B C     1 
ATOM   4303 O O     . LYS B 2 25  ? 11.357  26.263 11.538  1.00 150.48 ? 11  LYS B O     1 
ATOM   4304 C CB    . LYS B 2 25  ? 10.718  25.006 8.714   1.00 144.27 ? 11  LYS B CB    1 
ATOM   4305 C CG    . LYS B 2 25  ? 10.521  23.949 7.638   1.00 142.05 ? 11  LYS B CG    1 
ATOM   4306 C CD    . LYS B 2 25  ? 9.593   24.443 6.540   1.00 149.75 ? 11  LYS B CD    1 
ATOM   4307 C CE    . LYS B 2 25  ? 9.412   23.392 5.457   1.00 152.41 ? 11  LYS B CE    1 
ATOM   4308 N NZ    . LYS B 2 25  ? 8.512   23.866 4.369   1.00 147.86 ? 11  LYS B NZ    1 
ATOM   4309 N N     . LEU B 2 26  ? 13.270  26.345 10.340  1.00 147.98 ? 12  LEU B N     1 
ATOM   4310 C CA    . LEU B 2 26  ? 13.812  27.516 11.027  1.00 139.57 ? 12  LEU B CA    1 
ATOM   4311 C C     . LEU B 2 26  ? 13.234  28.818 10.472  1.00 139.81 ? 12  LEU B C     1 
ATOM   4312 O O     . LEU B 2 26  ? 12.549  28.816 9.445   1.00 144.27 ? 12  LEU B O     1 
ATOM   4313 C CB    . LEU B 2 26  ? 15.343  27.536 10.927  1.00 144.99 ? 12  LEU B CB    1 
ATOM   4314 C CG    . LEU B 2 26  ? 16.149  26.428 11.615  1.00 142.74 ? 12  LEU B CG    1 
ATOM   4315 C CD1   . LEU B 2 26  ? 17.558  26.375 11.045  1.00 142.45 ? 12  LEU B CD1   1 
ATOM   4316 C CD2   . LEU B 2 26  ? 16.188  26.613 13.126  1.00 146.85 ? 12  LEU B CD2   1 
ATOM   4317 N N     . LYS B 2 27  ? 13.515  29.922 11.163  1.00 134.72 ? 13  LYS B N     1 
ATOM   4318 C CA    . LYS B 2 27  ? 13.095  31.252 10.729  1.00 130.63 ? 13  LYS B CA    1 
ATOM   4319 C C     . LYS B 2 27  ? 13.894  31.682 9.494   1.00 135.57 ? 13  LYS B C     1 
ATOM   4320 O O     . LYS B 2 27  ? 15.127  31.620 9.506   1.00 139.34 ? 13  LYS B O     1 
ATOM   4321 C CB    . LYS B 2 27  ? 13.277  32.262 11.868  1.00 135.70 ? 13  LYS B CB    1 
ATOM   4322 C CG    . LYS B 2 27  ? 12.591  33.603 11.650  1.00 156.94 ? 13  LYS B CG    1 
ATOM   4323 C CD    . LYS B 2 27  ? 12.820  34.537 12.827  1.00 163.65 ? 13  LYS B CD    1 
ATOM   4324 C CE    . LYS B 2 27  ? 12.133  35.876 12.612  1.00 166.81 ? 13  LYS B CE    1 
ATOM   4325 N NZ    . LYS B 2 27  ? 12.348  36.800 13.760  1.00 162.03 ? 13  LYS B NZ    1 
ATOM   4326 N N     . PRO B 2 28  ? 13.192  32.104 8.421   1.00 137.99 ? 14  PRO B N     1 
ATOM   4327 C CA    . PRO B 2 28  ? 13.839  32.517 7.170   1.00 138.02 ? 14  PRO B CA    1 
ATOM   4328 C C     . PRO B 2 28  ? 14.776  33.711 7.349   1.00 137.03 ? 14  PRO B C     1 
ATOM   4329 O O     . PRO B 2 28  ? 14.428  34.680 8.027   1.00 145.14 ? 14  PRO B O     1 
ATOM   4330 C CB    . PRO B 2 28  ? 12.657  32.892 6.263   1.00 137.56 ? 14  PRO B CB    1 
ATOM   4331 C CG    . PRO B 2 28  ? 11.511  33.130 7.188   1.00 145.71 ? 14  PRO B CG    1 
ATOM   4332 C CD    . PRO B 2 28  ? 11.723  32.174 8.322   1.00 143.16 ? 14  PRO B CD    1 
ATOM   4333 N N     . GLY B 2 29  ? 15.959  33.624 6.743   1.00 137.71 ? 15  GLY B N     1 
ATOM   4334 C CA    . GLY B 2 29  ? 16.971  34.672 6.853   1.00 147.77 ? 15  GLY B CA    1 
ATOM   4335 C C     . GLY B 2 29  ? 18.042  34.352 7.879   1.00 152.23 ? 15  GLY B C     1 
ATOM   4336 O O     . GLY B 2 29  ? 19.233  34.550 7.626   1.00 158.32 ? 15  GLY B O     1 
ATOM   4337 N N     . MET B 2 30  ? 17.613  33.857 9.039   1.00 147.59 ? 16  MET B N     1 
ATOM   4338 C CA    . MET B 2 30  ? 18.523  33.513 10.130  1.00 151.85 ? 16  MET B CA    1 
ATOM   4339 C C     . MET B 2 30  ? 19.140  32.130 9.939   1.00 144.13 ? 16  MET B C     1 
ATOM   4340 O O     . MET B 2 30  ? 18.449  31.173 9.582   1.00 141.39 ? 16  MET B O     1 
ATOM   4341 C CB    . MET B 2 30  ? 17.801  33.587 11.481  1.00 150.20 ? 16  MET B CB    1 
ATOM   4342 C CG    . MET B 2 30  ? 17.418  34.994 11.921  1.00 150.79 ? 16  MET B CG    1 
ATOM   4343 S SD    . MET B 2 30  ? 18.824  36.043 12.348  1.00 148.34 ? 16  MET B SD    1 
ATOM   4344 C CE    . MET B 2 30  ? 19.329  35.338 13.917  1.00 156.22 ? 16  MET B CE    1 
ATOM   4345 N N     . ASP B 2 31  ? 20.446  32.041 10.182  1.00 145.93 ? 17  ASP B N     1 
ATOM   4346 C CA    . ASP B 2 31  ? 21.184  30.784 10.074  1.00 143.30 ? 17  ASP B CA    1 
ATOM   4347 C C     . ASP B 2 31  ? 21.262  30.092 11.438  1.00 142.56 ? 17  ASP B C     1 
ATOM   4348 O O     . ASP B 2 31  ? 20.856  30.662 12.454  1.00 137.01 ? 17  ASP B O     1 
ATOM   4349 C CB    . ASP B 2 31  ? 22.588  31.044 9.514   1.00 147.24 ? 17  ASP B CB    1 
ATOM   4350 C CG    . ASP B 2 31  ? 23.208  29.810 8.874   1.00 144.80 ? 17  ASP B CG    1 
ATOM   4351 O OD1   . ASP B 2 31  ? 22.521  29.130 8.081   1.00 141.20 ? 17  ASP B OD1   1 
ATOM   4352 O OD2   . ASP B 2 31  ? 24.390  29.526 9.159   1.00 140.62 ? 17  ASP B OD2   1 
ATOM   4353 N N     . GLY B 2 32  ? 21.779  28.863 11.451  1.00 146.20 ? 18  GLY B N     1 
ATOM   4354 C CA    . GLY B 2 32  ? 21.920  28.079 12.679  1.00 147.88 ? 18  GLY B CA    1 
ATOM   4355 C C     . GLY B 2 32  ? 22.912  28.658 13.676  1.00 140.99 ? 18  GLY B C     1 
ATOM   4356 O O     . GLY B 2 32  ? 23.743  29.495 13.311  1.00 144.10 ? 18  GLY B O     1 
ATOM   4357 N N     . PRO B 2 33  ? 22.834  28.211 14.946  1.00 143.66 ? 19  PRO B N     1 
ATOM   4358 C CA    . PRO B 2 33  ? 23.680  28.735 16.024  1.00 149.39 ? 19  PRO B CA    1 
ATOM   4359 C C     . PRO B 2 33  ? 25.156  28.355 15.881  1.00 144.44 ? 19  PRO B C     1 
ATOM   4360 O O     . PRO B 2 33  ? 25.477  27.205 15.570  1.00 128.26 ? 19  PRO B O     1 
ATOM   4361 C CB    . PRO B 2 33  ? 23.081  28.098 17.283  1.00 147.61 ? 19  PRO B CB    1 
ATOM   4362 C CG    . PRO B 2 33  ? 22.413  26.857 16.803  1.00 148.97 ? 19  PRO B CG    1 
ATOM   4363 C CD    . PRO B 2 33  ? 21.899  27.178 15.431  1.00 150.76 ? 19  PRO B CD    1 
ATOM   4364 N N     . LYS B 2 34  ? 26.034  29.331 16.103  1.00 154.06 ? 20  LYS B N     1 
ATOM   4365 C CA    . LYS B 2 34  ? 27.481  29.118 16.061  1.00 139.46 ? 20  LYS B CA    1 
ATOM   4366 C C     . LYS B 2 34  ? 28.159  29.799 17.251  1.00 126.46 ? 20  LYS B C     1 
ATOM   4367 O O     . LYS B 2 34  ? 28.611  30.944 17.156  1.00 134.59 ? 20  LYS B O     1 
ATOM   4368 C CB    . LYS B 2 34  ? 28.072  29.620 14.738  1.00 140.81 ? 20  LYS B CB    1 
ATOM   4369 C CG    . LYS B 2 34  ? 27.791  28.723 13.539  1.00 146.11 ? 20  LYS B CG    1 
ATOM   4370 C CD    . LYS B 2 34  ? 28.428  29.259 12.264  1.00 141.21 ? 20  LYS B CD    1 
ATOM   4371 C CE    . LYS B 2 34  ? 29.915  28.941 12.192  1.00 139.44 ? 20  LYS B CE    1 
ATOM   4372 N NZ    . LYS B 2 34  ? 30.537  29.468 10.946  1.00 144.65 ? 20  LYS B NZ    1 
ATOM   4373 N N     . VAL B 2 35  ? 28.213  29.084 18.373  1.00 121.95 ? 21  VAL B N     1 
ATOM   4374 C CA    . VAL B 2 35  ? 28.805  29.601 19.608  1.00 124.59 ? 21  VAL B CA    1 
ATOM   4375 C C     . VAL B 2 35  ? 30.073  28.817 19.951  1.00 128.05 ? 21  VAL B C     1 
ATOM   4376 O O     . VAL B 2 35  ? 30.104  27.589 19.828  1.00 137.28 ? 21  VAL B O     1 
ATOM   4377 C CB    . VAL B 2 35  ? 27.810  29.535 20.794  1.00 134.44 ? 21  VAL B CB    1 
ATOM   4378 C CG1   . VAL B 2 35  ? 28.356  30.277 22.007  1.00 138.78 ? 21  VAL B CG1   1 
ATOM   4379 C CG2   . VAL B 2 35  ? 26.456  30.111 20.400  1.00 145.63 ? 21  VAL B CG2   1 
ATOM   4380 N N     . LYS B 2 36  ? 31.111  29.537 20.372  1.00 137.83 ? 22  LYS B N     1 
ATOM   4381 C CA    . LYS B 2 36  ? 32.382  28.932 20.774  1.00 142.98 ? 22  LYS B CA    1 
ATOM   4382 C C     . LYS B 2 36  ? 32.231  28.111 22.053  1.00 134.57 ? 22  LYS B C     1 
ATOM   4383 O O     . LYS B 2 36  ? 31.530  28.517 22.984  1.00 128.56 ? 22  LYS B O     1 
ATOM   4384 C CB    . LYS B 2 36  ? 33.459  30.006 20.961  1.00 159.28 ? 22  LYS B CB    1 
ATOM   4385 C CG    . LYS B 2 36  ? 33.903  30.682 19.673  1.00 159.24 ? 22  LYS B CG    1 
ATOM   4386 C CD    . LYS B 2 36  ? 34.956  31.745 19.942  1.00 148.68 ? 22  LYS B CD    1 
ATOM   4387 C CE    . LYS B 2 36  ? 35.392  32.427 18.655  1.00 146.18 ? 22  LYS B CE    1 
ATOM   4388 N NZ    . LYS B 2 36  ? 36.420  33.475 18.904  1.00 149.96 ? 22  LYS B NZ    1 
ATOM   4389 N N     . GLN B 2 37  ? 32.895  26.957 22.086  1.00 132.30 ? 23  GLN B N     1 
ATOM   4390 C CA    . GLN B 2 37  ? 32.803  26.030 23.213  1.00 135.48 ? 23  GLN B CA    1 
ATOM   4391 C C     . GLN B 2 37  ? 33.602  26.517 24.422  1.00 138.08 ? 23  GLN B C     1 
ATOM   4392 O O     . GLN B 2 37  ? 34.779  26.867 24.303  1.00 144.63 ? 23  GLN B O     1 
ATOM   4393 C CB    . GLN B 2 37  ? 33.262  24.627 22.790  1.00 134.78 ? 23  GLN B CB    1 
ATOM   4394 C CG    . GLN B 2 37  ? 33.085  23.543 23.848  1.00 143.21 ? 23  GLN B CG    1 
ATOM   4395 C CD    . GLN B 2 37  ? 31.630  23.283 24.205  1.00 143.35 ? 23  GLN B CD    1 
ATOM   4396 O OE1   . GLN B 2 37  ? 30.760  23.228 23.334  1.00 147.32 ? 23  GLN B OE1   1 
ATOM   4397 N NE2   . GLN B 2 37  ? 31.362  23.112 25.495  1.00 139.80 ? 23  GLN B NE2   1 
ATOM   4398 N N     . TRP B 2 38  ? 32.943  26.536 25.579  1.00 136.36 ? 24  TRP B N     1 
ATOM   4399 C CA    . TRP B 2 38  ? 33.575  26.925 26.837  1.00 144.63 ? 24  TRP B CA    1 
ATOM   4400 C C     . TRP B 2 38  ? 34.256  25.739 27.467  1.00 145.84 ? 24  TRP B C     1 
ATOM   4401 O O     . TRP B 2 38  ? 33.648  24.672 27.595  1.00 143.10 ? 24  TRP B O     1 
ATOM   4402 C CB    . TRP B 2 38  ? 32.542  27.521 27.789  1.00 142.24 ? 24  TRP B CB    1 
ATOM   4403 C CG    . TRP B 2 38  ? 33.145  28.236 28.975  1.00 147.14 ? 24  TRP B CG    1 
ATOM   4404 C CD1   . TRP B 2 38  ? 33.392  27.718 30.245  1.00 150.70 ? 24  TRP B CD1   1 
ATOM   4405 C CD2   . TRP B 2 38  ? 33.602  29.633 29.041  1.00 159.16 ? 24  TRP B CD2   1 
ATOM   4406 N NE1   . TRP B 2 38  ? 33.951  28.667 31.063  1.00 156.74 ? 24  TRP B NE1   1 
ATOM   4407 C CE2   . TRP B 2 38  ? 34.104  29.836 30.406  1.00 163.40 ? 24  TRP B CE2   1 
ATOM   4408 C CE3   . TRP B 2 38  ? 33.644  30.694 28.141  1.00 160.70 ? 24  TRP B CE3   1 
ATOM   4409 C CZ2   . TRP B 2 38  ? 34.619  31.055 30.827  1.00 162.32 ? 24  TRP B CZ2   1 
ATOM   4410 C CZ3   . TRP B 2 38  ? 34.166  31.919 28.579  1.00 161.03 ? 24  TRP B CZ3   1 
ATOM   4411 C CH2   . TRP B 2 38  ? 34.641  32.092 29.889  1.00 158.42 ? 24  TRP B CH2   1 
ATOM   4412 N N     . PRO B 2 39  ? 35.535  25.902 27.864  1.00 144.42 ? 25  PRO B N     1 
ATOM   4413 C CA    . PRO B 2 39  ? 36.323  24.812 28.450  1.00 140.79 ? 25  PRO B CA    1 
ATOM   4414 C C     . PRO B 2 39  ? 35.815  24.363 29.822  1.00 144.45 ? 25  PRO B C     1 
ATOM   4415 O O     . PRO B 2 39  ? 35.331  25.183 30.606  1.00 150.36 ? 25  PRO B O     1 
ATOM   4416 C CB    . PRO B 2 39  ? 37.726  25.417 28.573  1.00 137.80 ? 25  PRO B CB    1 
ATOM   4417 C CG    . PRO B 2 39  ? 37.502  26.889 28.631  1.00 138.65 ? 25  PRO B CG    1 
ATOM   4418 C CD    . PRO B 2 39  ? 36.328  27.139 27.733  1.00 143.32 ? 25  PRO B CD    1 
ATOM   4419 N N     . LEU B 2 40  ? 35.933  23.065 30.095  1.00 133.02 ? 26  LEU B N     1 
ATOM   4420 C CA    . LEU B 2 40  ? 35.494  22.482 31.364  1.00 130.56 ? 26  LEU B CA    1 
ATOM   4421 C C     . LEU B 2 40  ? 36.638  21.767 32.084  1.00 128.04 ? 26  LEU B C     1 
ATOM   4422 O O     . LEU B 2 40  ? 37.684  21.496 31.487  1.00 135.37 ? 26  LEU B O     1 
ATOM   4423 C CB    . LEU B 2 40  ? 34.319  21.522 31.137  1.00 131.43 ? 26  LEU B CB    1 
ATOM   4424 C CG    . LEU B 2 40  ? 32.965  22.124 30.745  1.00 145.38 ? 26  LEU B CG    1 
ATOM   4425 C CD1   . LEU B 2 40  ? 32.085  21.075 30.082  1.00 159.99 ? 26  LEU B CD1   1 
ATOM   4426 C CD2   . LEU B 2 40  ? 32.256  22.741 31.945  1.00 144.84 ? 26  LEU B CD2   1 
ATOM   4427 N N     . THR B 2 41  ? 36.431  21.471 33.367  1.00 127.14 ? 27  THR B N     1 
ATOM   4428 C CA    . THR B 2 41  ? 37.447  20.823 34.204  1.00 141.80 ? 27  THR B CA    1 
ATOM   4429 C C     . THR B 2 41  ? 37.700  19.368 33.800  1.00 146.46 ? 27  THR B C     1 
ATOM   4430 O O     . THR B 2 41  ? 36.868  18.744 33.138  1.00 142.55 ? 27  THR B O     1 
ATOM   4431 C CB    . THR B 2 41  ? 37.079  20.881 35.703  1.00 141.53 ? 27  THR B CB    1 
ATOM   4432 O OG1   . THR B 2 41  ? 35.776  20.322 35.904  1.00 125.96 ? 27  THR B OG1   1 
ATOM   4433 C CG2   . THR B 2 41  ? 37.097  22.316 36.214  1.00 150.13 ? 27  THR B CG2   1 
ATOM   4434 N N     . GLU B 2 42  ? 38.854  18.844 34.213  1.00 157.28 ? 28  GLU B N     1 
ATOM   4435 C CA    . GLU B 2 42  ? 39.289  17.482 33.885  1.00 155.66 ? 28  GLU B CA    1 
ATOM   4436 C C     . GLU B 2 42  ? 38.311  16.414 34.384  1.00 150.42 ? 28  GLU B C     1 
ATOM   4437 O O     . GLU B 2 42  ? 38.105  15.396 33.718  1.00 151.49 ? 28  GLU B O     1 
ATOM   4438 C CB    . GLU B 2 42  ? 40.695  17.232 34.448  1.00 159.47 ? 28  GLU B CB    1 
ATOM   4439 C CG    . GLU B 2 42  ? 41.460  16.085 33.797  1.00 154.15 ? 28  GLU B CG    1 
ATOM   4440 C CD    . GLU B 2 42  ? 41.162  14.731 34.417  1.00 156.41 ? 28  GLU B CD    1 
ATOM   4441 O OE1   . GLU B 2 42  ? 41.068  14.641 35.661  1.00 158.83 ? 28  GLU B OE1   1 
ATOM   4442 O OE2   . GLU B 2 42  ? 41.031  13.748 33.658  1.00 158.65 ? 28  GLU B OE2   1 
ATOM   4443 N N     . GLU B 2 43  ? 37.716  16.656 35.551  1.00 147.80 ? 29  GLU B N     1 
ATOM   4444 C CA    . GLU B 2 43  ? 36.743  15.739 36.144  1.00 145.45 ? 29  GLU B CA    1 
ATOM   4445 C C     . GLU B 2 43  ? 35.422  15.737 35.370  1.00 141.77 ? 29  GLU B C     1 
ATOM   4446 O O     . GLU B 2 43  ? 34.756  14.703 35.270  1.00 138.83 ? 29  GLU B O     1 
ATOM   4447 C CB    . GLU B 2 43  ? 36.501  16.099 37.614  1.00 141.85 ? 29  GLU B CB    1 
ATOM   4448 C CG    . GLU B 2 43  ? 35.868  14.988 38.442  1.00 147.20 ? 29  GLU B CG    1 
ATOM   4449 C CD    . GLU B 2 43  ? 35.676  15.365 39.902  1.00 147.99 ? 29  GLU B CD    1 
ATOM   4450 O OE1   . GLU B 2 43  ? 36.477  16.165 40.434  1.00 142.23 ? 29  GLU B OE1   1 
ATOM   4451 O OE2   . GLU B 2 43  ? 34.723  14.851 40.524  1.00 154.82 ? 29  GLU B OE2   1 
ATOM   4452 N N     . LYS B 2 44  ? 35.056  16.895 34.824  1.00 143.12 ? 30  LYS B N     1 
ATOM   4453 C CA    . LYS B 2 44  ? 33.817  17.046 34.059  1.00 147.64 ? 30  LYS B CA    1 
ATOM   4454 C C     . LYS B 2 44  ? 33.913  16.460 32.649  1.00 146.21 ? 30  LYS B C     1 
ATOM   4455 O O     . LYS B 2 44  ? 32.927  15.936 32.128  1.00 150.03 ? 30  LYS B O     1 
ATOM   4456 C CB    . LYS B 2 44  ? 33.393  18.517 33.994  1.00 153.56 ? 30  LYS B CB    1 
ATOM   4457 C CG    . LYS B 2 44  ? 32.807  19.056 35.290  1.00 153.84 ? 30  LYS B CG    1 
ATOM   4458 C CD    . LYS B 2 44  ? 32.424  20.522 35.154  1.00 149.77 ? 30  LYS B CD    1 
ATOM   4459 C CE    . LYS B 2 44  ? 31.914  21.095 36.469  1.00 151.61 ? 30  LYS B CE    1 
ATOM   4460 N NZ    . LYS B 2 44  ? 30.592  20.535 36.868  1.00 163.25 ? 30  LYS B NZ    1 
ATOM   4461 N N     . ILE B 2 45  ? 35.097  16.556 32.044  1.00 139.20 ? 31  ILE B N     1 
ATOM   4462 C CA    . ILE B 2 45  ? 35.336  16.053 30.685  1.00 140.10 ? 31  ILE B CA    1 
ATOM   4463 C C     . ILE B 2 45  ? 35.152  14.535 30.599  1.00 149.72 ? 31  ILE B C     1 
ATOM   4464 O O     . ILE B 2 45  ? 34.442  14.042 29.718  1.00 156.09 ? 31  ILE B O     1 
ATOM   4465 C CB    . ILE B 2 45  ? 36.730  16.476 30.152  1.00 142.42 ? 31  ILE B CB    1 
ATOM   4466 C CG1   . ILE B 2 45  ? 36.769  17.990 29.910  1.00 142.66 ? 31  ILE B CG1   1 
ATOM   4467 C CG2   . ILE B 2 45  ? 37.078  15.729 28.868  1.00 143.32 ? 31  ILE B CG2   1 
ATOM   4468 C CD1   . ILE B 2 45  ? 38.163  18.575 29.810  1.00 155.18 ? 31  ILE B CD1   1 
ATOM   4469 N N     . LYS B 2 46  ? 35.779  13.807 31.523  1.00 150.79 ? 32  LYS B N     1 
ATOM   4470 C CA    . LYS B 2 46  ? 35.663  12.347 31.585  1.00 151.36 ? 32  LYS B CA    1 
ATOM   4471 C C     . LYS B 2 46  ? 34.261  11.885 31.988  1.00 149.02 ? 32  LYS B C     1 
ATOM   4472 O O     . LYS B 2 46  ? 33.857  10.763 31.673  1.00 137.76 ? 32  LYS B O     1 
ATOM   4473 C CB    . LYS B 2 46  ? 36.710  11.758 32.536  1.00 147.86 ? 32  LYS B CB    1 
ATOM   4474 C CG    . LYS B 2 46  ? 38.112  11.685 31.952  1.00 145.45 ? 32  LYS B CG    1 
ATOM   4475 C CD    . LYS B 2 46  ? 39.059  10.944 32.881  1.00 136.74 ? 32  LYS B CD    1 
ATOM   4476 C CE    . LYS B 2 46  ? 40.417  10.731 32.231  1.00 131.82 ? 32  LYS B CE    1 
ATOM   4477 N NZ    . LYS B 2 46  ? 41.356  10.005 33.130  1.00 129.91 ? 32  LYS B NZ    1 
ATOM   4478 N N     . ALA B 2 47  ? 33.530  12.756 32.682  1.00 153.07 ? 33  ALA B N     1 
ATOM   4479 C CA    . ALA B 2 47  ? 32.152  12.482 33.084  1.00 153.62 ? 33  ALA B CA    1 
ATOM   4480 C C     . ALA B 2 47  ? 31.187  12.566 31.900  1.00 150.87 ? 33  ALA B C     1 
ATOM   4481 O O     . ALA B 2 47  ? 30.188  11.845 31.857  1.00 147.82 ? 33  ALA B O     1 
ATOM   4482 C CB    . ALA B 2 47  ? 31.722  13.434 34.191  1.00 155.29 ? 33  ALA B CB    1 
ATOM   4483 N N     . LEU B 2 48  ? 31.494  13.447 30.949  1.00 152.05 ? 34  LEU B N     1 
ATOM   4484 C CA    . LEU B 2 48  ? 30.673  13.633 29.750  1.00 148.26 ? 34  LEU B CA    1 
ATOM   4485 C C     . LEU B 2 48  ? 30.792  12.463 28.773  1.00 144.70 ? 34  LEU B C     1 
ATOM   4486 O O     . LEU B 2 48  ? 29.818  12.104 28.108  1.00 148.33 ? 34  LEU B O     1 
ATOM   4487 C CB    . LEU B 2 48  ? 31.034  14.944 29.041  1.00 146.67 ? 34  LEU B CB    1 
ATOM   4488 C CG    . LEU B 2 48  ? 30.651  16.273 29.702  1.00 148.74 ? 34  LEU B CG    1 
ATOM   4489 C CD1   . LEU B 2 48  ? 31.466  17.413 29.109  1.00 168.34 ? 34  LEU B CD1   1 
ATOM   4490 C CD2   . LEU B 2 48  ? 29.160  16.558 29.582  1.00 141.53 ? 34  LEU B CD2   1 
ATOM   4491 N N     . VAL B 2 49  ? 31.988  11.879 28.695  1.00 142.25 ? 35  VAL B N     1 
ATOM   4492 C CA    . VAL B 2 49  ? 32.262  10.748 27.802  1.00 142.97 ? 35  VAL B CA    1 
ATOM   4493 C C     . VAL B 2 49  ? 31.486  9.500  28.235  1.00 149.37 ? 35  VAL B C     1 
ATOM   4494 O O     . VAL B 2 49  ? 30.975  8.757  27.393  1.00 150.53 ? 35  VAL B O     1 
ATOM   4495 C CB    . VAL B 2 49  ? 33.779  10.438 27.720  1.00 142.84 ? 35  VAL B CB    1 
ATOM   4496 C CG1   . VAL B 2 49  ? 34.057  9.313  26.730  1.00 145.94 ? 35  VAL B CG1   1 
ATOM   4497 C CG2   . VAL B 2 49  ? 34.562  11.682 27.323  1.00 147.95 ? 35  VAL B CG2   1 
ATOM   4498 N N     . GLU B 2 50  ? 31.390  9.291  29.548  1.00 150.62 ? 36  GLU B N     1 
ATOM   4499 C CA    . GLU B 2 50  ? 30.685  8.142  30.122  1.00 152.62 ? 36  GLU B CA    1 
ATOM   4500 C C     . GLU B 2 50  ? 29.190  8.148  29.784  1.00 145.45 ? 36  GLU B C     1 
ATOM   4501 O O     . GLU B 2 50  ? 28.598  7.092  29.551  1.00 145.57 ? 36  GLU B O     1 
ATOM   4502 C CB    . GLU B 2 50  ? 30.891  8.096  31.640  1.00 158.53 ? 36  GLU B CB    1 
ATOM   4503 C CG    . GLU B 2 50  ? 30.558  6.756  32.284  1.00 161.44 ? 36  GLU B CG    1 
ATOM   4504 C CD    . GLU B 2 50  ? 30.808  6.738  33.782  1.00 163.60 ? 36  GLU B CD    1 
ATOM   4505 O OE1   . GLU B 2 50  ? 31.857  7.251  34.228  1.00 162.82 ? 36  GLU B OE1   1 
ATOM   4506 O OE2   . GLU B 2 50  ? 29.954  6.199  34.518  1.00 163.17 ? 36  GLU B OE2   1 
ATOM   4507 N N     . ILE B 2 51  ? 28.594  9.339  29.759  1.00 140.46 ? 37  ILE B N     1 
ATOM   4508 C CA    . ILE B 2 51  ? 27.180  9.503  29.413  1.00 137.77 ? 37  ILE B CA    1 
ATOM   4509 C C     . ILE B 2 51  ? 26.968  9.354  27.902  1.00 140.26 ? 37  ILE B C     1 
ATOM   4510 O O     . ILE B 2 51  ? 26.013  8.708  27.465  1.00 142.25 ? 37  ILE B O     1 
ATOM   4511 C CB    . ILE B 2 51  ? 26.619  10.862 29.902  1.00 133.67 ? 37  ILE B CB    1 
ATOM   4512 C CG1   . ILE B 2 51  ? 26.925  11.069 31.391  1.00 135.02 ? 37  ILE B CG1   1 
ATOM   4513 C CG2   . ILE B 2 51  ? 25.117  10.951 29.650  1.00 142.67 ? 37  ILE B CG2   1 
ATOM   4514 C CD1   . ILE B 2 51  ? 26.829  12.509 31.856  1.00 142.53 ? 37  ILE B CD1   1 
ATOM   4515 N N     . CYS B 2 52  ? 27.872  9.944  27.119  1.00 141.89 ? 38  CYS B N     1 
ATOM   4516 C CA    . CYS B 2 52  ? 27.785  9.925  25.655  1.00 144.05 ? 38  CYS B CA    1 
ATOM   4517 C C     . CYS B 2 52  ? 27.969  8.533  25.044  1.00 140.78 ? 38  CYS B C     1 
ATOM   4518 O O     . CYS B 2 52  ? 27.403  8.238  23.989  1.00 140.46 ? 38  CYS B O     1 
ATOM   4519 C CB    . CYS B 2 52  ? 28.789  10.905 25.042  1.00 143.82 ? 38  CYS B CB    1 
ATOM   4520 S SG    . CYS B 2 52  ? 28.328  12.646 25.203  1.00 130.35 ? 38  CYS B SG    1 
ATOM   4521 N N     . THR B 2 53  ? 28.761  7.691  25.706  1.00 134.54 ? 39  THR B N     1 
ATOM   4522 C CA    . THR B 2 53  ? 28.998  6.318  25.253  1.00 137.58 ? 39  THR B CA    1 
ATOM   4523 C C     . THR B 2 53  ? 27.760  5.443  25.476  1.00 148.88 ? 39  THR B C     1 
ATOM   4524 O O     . THR B 2 53  ? 27.424  4.606  24.634  1.00 153.35 ? 39  THR B O     1 
ATOM   4525 C CB    . THR B 2 53  ? 30.226  5.692  25.954  1.00 132.11 ? 39  THR B CB    1 
ATOM   4526 O OG1   . THR B 2 53  ? 31.327  6.609  25.911  1.00 128.87 ? 39  THR B OG1   1 
ATOM   4527 C CG2   . THR B 2 53  ? 30.640  4.389  25.274  1.00 147.77 ? 39  THR B CG2   1 
ATOM   4528 N N     . GLU B 2 54  ? 27.087  5.652  26.607  1.00 154.23 ? 40  GLU B N     1 
ATOM   4529 C CA    . GLU B 2 54  ? 25.879  4.900  26.956  1.00 155.41 ? 40  GLU B CA    1 
ATOM   4530 C C     . GLU B 2 54  ? 24.676  5.298  26.099  1.00 145.25 ? 40  GLU B C     1 
ATOM   4531 O O     . GLU B 2 54  ? 23.831  4.458  25.782  1.00 140.50 ? 40  GLU B O     1 
ATOM   4532 C CB    . GLU B 2 54  ? 25.546  5.072  28.442  1.00 156.77 ? 40  GLU B CB    1 
ATOM   4533 C CG    . GLU B 2 54  ? 26.516  4.376  29.388  1.00 167.90 ? 40  GLU B CG    1 
ATOM   4534 C CD    . GLU B 2 54  ? 26.164  4.573  30.852  1.00 161.33 ? 40  GLU B CD    1 
ATOM   4535 O OE1   . GLU B 2 54  ? 24.970  4.464  31.208  1.00 146.81 ? 40  GLU B OE1   1 
ATOM   4536 O OE2   . GLU B 2 54  ? 27.087  4.829  31.653  1.00 166.71 ? 40  GLU B OE2   1 
ATOM   4537 N N     . MET B 2 55  ? 24.609  6.577  25.733  1.00 143.52 ? 41  MET B N     1 
ATOM   4538 C CA    . MET B 2 55  ? 23.522  7.100  24.903  1.00 144.29 ? 41  MET B CA    1 
ATOM   4539 C C     . MET B 2 55  ? 23.657  6.687  23.436  1.00 146.11 ? 41  MET B C     1 
ATOM   4540 O O     . MET B 2 55  ? 22.656  6.565  22.727  1.00 152.46 ? 41  MET B O     1 
ATOM   4541 C CB    . MET B 2 55  ? 23.443  8.626  25.015  1.00 144.29 ? 41  MET B CB    1 
ATOM   4542 C CG    . MET B 2 55  ? 22.867  9.131  26.330  1.00 149.29 ? 41  MET B CG    1 
ATOM   4543 S SD    . MET B 2 55  ? 22.902  10.928 26.488  1.00 165.76 ? 41  MET B SD    1 
ATOM   4544 C CE    . MET B 2 55  ? 21.603  11.413 25.352  1.00 148.17 ? 41  MET B CE    1 
ATOM   4545 N N     . GLU B 2 56  ? 24.896  6.476  22.995  1.00 142.02 ? 42  GLU B N     1 
ATOM   4546 C CA    . GLU B 2 56  ? 25.186  6.081  21.615  1.00 140.79 ? 42  GLU B CA    1 
ATOM   4547 C C     . GLU B 2 56  ? 24.770  4.635  21.337  1.00 145.08 ? 42  GLU B C     1 
ATOM   4548 O O     . GLU B 2 56  ? 24.280  4.324  20.248  1.00 148.17 ? 42  GLU B O     1 
ATOM   4549 C CB    . GLU B 2 56  ? 26.675  6.275  21.308  1.00 134.84 ? 42  GLU B CB    1 
ATOM   4550 C CG    . GLU B 2 56  ? 27.025  6.250  19.825  1.00 142.63 ? 42  GLU B CG    1 
ATOM   4551 C CD    . GLU B 2 56  ? 28.517  6.364  19.560  1.00 147.98 ? 42  GLU B CD    1 
ATOM   4552 O OE1   . GLU B 2 56  ? 29.256  6.858  20.440  1.00 153.89 ? 42  GLU B OE1   1 
ATOM   4553 O OE2   . GLU B 2 56  ? 28.953  5.962  18.461  1.00 145.80 ? 42  GLU B OE2   1 
ATOM   4554 N N     . LYS B 2 57  ? 24.968  3.765  22.325  1.00 146.46 ? 43  LYS B N     1 
ATOM   4555 C CA    . LYS B 2 57  ? 24.628  2.345  22.206  1.00 152.98 ? 43  LYS B CA    1 
ATOM   4556 C C     . LYS B 2 57  ? 23.117  2.106  22.226  1.00 150.89 ? 43  LYS B C     1 
ATOM   4557 O O     . LYS B 2 57  ? 22.620  1.191  21.566  1.00 151.78 ? 43  LYS B O     1 
ATOM   4558 C CB    . LYS B 2 57  ? 25.304  1.532  23.315  1.00 154.04 ? 43  LYS B CB    1 
ATOM   4559 C CG    . LYS B 2 57  ? 26.816  1.425  23.181  1.00 151.00 ? 43  LYS B CG    1 
ATOM   4560 C CD    . LYS B 2 57  ? 27.415  0.608  24.315  1.00 139.67 ? 43  LYS B CD    1 
ATOM   4561 C CE    . LYS B 2 57  ? 28.925  0.503  24.181  1.00 137.88 ? 43  LYS B CE    1 
ATOM   4562 N NZ    . LYS B 2 57  ? 29.526  -0.295 25.285  1.00 143.63 ? 43  LYS B NZ    1 
ATOM   4563 N N     . GLU B 2 58  ? 22.400  2.932  22.986  1.00 147.03 ? 44  GLU B N     1 
ATOM   4564 C CA    . GLU B 2 58  ? 20.943  2.835  23.092  1.00 145.59 ? 44  GLU B CA    1 
ATOM   4565 C C     . GLU B 2 58  ? 20.241  3.372  21.845  1.00 148.26 ? 44  GLU B C     1 
ATOM   4566 O O     . GLU B 2 58  ? 19.220  2.828  21.418  1.00 159.50 ? 44  GLU B O     1 
ATOM   4567 C CB    . GLU B 2 58  ? 20.441  3.572  24.338  1.00 146.66 ? 44  GLU B CB    1 
ATOM   4568 C CG    . GLU B 2 58  ? 20.794  2.894  25.655  1.00 153.56 ? 44  GLU B CG    1 
ATOM   4569 C CD    . GLU B 2 58  ? 20.312  3.668  26.870  1.00 157.82 ? 44  GLU B CD    1 
ATOM   4570 O OE1   . GLU B 2 58  ? 19.163  4.160  26.858  1.00 157.66 ? 44  GLU B OE1   1 
ATOM   4571 O OE2   . GLU B 2 58  ? 21.083  3.776  27.847  1.00 164.10 ? 44  GLU B OE2   1 
ATOM   4572 N N     . GLY B 2 59  ? 20.795  4.439  21.271  1.00 145.39 ? 45  GLY B N     1 
ATOM   4573 C CA    . GLY B 2 59  ? 20.232  5.066  20.078  1.00 149.59 ? 45  GLY B CA    1 
ATOM   4574 C C     . GLY B 2 59  ? 19.670  6.446  20.359  1.00 145.22 ? 45  GLY B C     1 
ATOM   4575 O O     . GLY B 2 59  ? 18.503  6.720  20.071  1.00 138.05 ? 45  GLY B O     1 
ATOM   4576 N N     . LYS B 2 60  ? 20.508  7.314  20.924  1.00 148.11 ? 46  LYS B N     1 
ATOM   4577 C CA    . LYS B 2 60  ? 20.111  8.680  21.263  1.00 154.04 ? 46  LYS B CA    1 
ATOM   4578 C C     . LYS B 2 60  ? 20.964  9.715  20.531  1.00 153.62 ? 46  LYS B C     1 
ATOM   4579 O O     . LYS B 2 60  ? 20.450  10.739 20.075  1.00 155.35 ? 46  LYS B O     1 
ATOM   4580 C CB    . LYS B 2 60  ? 20.183  8.905  22.778  1.00 156.90 ? 46  LYS B CB    1 
ATOM   4581 C CG    . LYS B 2 60  ? 19.160  8.113  23.578  1.00 156.27 ? 46  LYS B CG    1 
ATOM   4582 C CD    . LYS B 2 60  ? 19.349  8.313  25.073  1.00 166.07 ? 46  LYS B CD    1 
ATOM   4583 C CE    . LYS B 2 60  ? 18.327  7.520  25.870  1.00 157.75 ? 46  LYS B CE    1 
ATOM   4584 N NZ    . LYS B 2 60  ? 18.501  7.706  27.337  1.00 167.39 ? 46  LYS B NZ    1 
ATOM   4585 N N     . ILE B 2 61  ? 22.264  9.442  20.427  1.00 137.02 ? 47  ILE B N     1 
ATOM   4586 C CA    . ILE B 2 61  ? 23.201  10.326 19.725  1.00 136.42 ? 47  ILE B CA    1 
ATOM   4587 C C     . ILE B 2 61  ? 24.108  9.560  18.759  1.00 132.21 ? 47  ILE B C     1 
ATOM   4588 O O     . ILE B 2 61  ? 24.489  8.417  19.024  1.00 127.61 ? 47  ILE B O     1 
ATOM   4589 C CB    . ILE B 2 61  ? 24.062  11.172 20.698  1.00 147.21 ? 47  ILE B CB    1 
ATOM   4590 C CG1   . ILE B 2 61  ? 24.633  10.304 21.828  1.00 147.88 ? 47  ILE B CG1   1 
ATOM   4591 C CG2   . ILE B 2 61  ? 23.252  12.343 21.246  1.00 146.07 ? 47  ILE B CG2   1 
ATOM   4592 C CD1   . ILE B 2 61  ? 25.774  10.942 22.593  1.00 154.38 ? 47  ILE B CD1   1 
ATOM   4593 N N     . SER B 2 62  ? 24.444  10.203 17.642  1.00 135.97 ? 48  SER B N     1 
ATOM   4594 C CA    . SER B 2 62  ? 25.293  9.601  16.614  1.00 139.12 ? 48  SER B CA    1 
ATOM   4595 C C     . SER B 2 62  ? 26.437  10.528 16.206  1.00 158.30 ? 48  SER B C     1 
ATOM   4596 O O     . SER B 2 62  ? 26.299  11.753 16.246  1.00 159.88 ? 48  SER B O     1 
ATOM   4597 C CB    . SER B 2 62  ? 24.459  9.221  15.387  1.00 126.03 ? 48  SER B CB    1 
ATOM   4598 O OG    . SER B 2 62  ? 23.465  8.268  15.720  1.00 115.91 ? 48  SER B OG    1 
ATOM   4599 N N     . LYS B 2 63  ? 27.560  9.931  15.810  1.00 166.97 ? 49  LYS B N     1 
ATOM   4600 C CA    . LYS B 2 63  ? 28.750  10.681 15.407  1.00 162.94 ? 49  LYS B CA    1 
ATOM   4601 C C     . LYS B 2 63  ? 28.618  11.277 14.007  1.00 162.86 ? 49  LYS B C     1 
ATOM   4602 O O     . LYS B 2 63  ? 28.087  10.635 13.096  1.00 167.63 ? 49  LYS B O     1 
ATOM   4603 C CB    . LYS B 2 63  ? 29.998  9.795  15.476  1.00 154.87 ? 49  LYS B CB    1 
ATOM   4604 C CG    . LYS B 2 63  ? 30.501  9.517  16.884  1.00 146.55 ? 49  LYS B CG    1 
ATOM   4605 C CD    . LYS B 2 63  ? 31.803  8.730  16.854  1.00 138.63 ? 49  LYS B CD    1 
ATOM   4606 C CE    . LYS B 2 63  ? 32.375  8.529  18.249  1.00 133.00 ? 49  LYS B CE    1 
ATOM   4607 N NZ    . LYS B 2 63  ? 31.581  7.566  19.063  1.00 136.42 ? 49  LYS B NZ    1 
ATOM   4608 N N     . ILE B 2 64  ? 29.104  12.506 13.850  1.00 150.70 ? 50  ILE B N     1 
ATOM   4609 C CA    . ILE B 2 64  ? 29.131  13.186 12.551  1.00 146.99 ? 50  ILE B CA    1 
ATOM   4610 C C     . ILE B 2 64  ? 30.533  13.693 12.203  1.00 143.90 ? 50  ILE B C     1 
ATOM   4611 O O     . ILE B 2 64  ? 31.395  13.809 13.077  1.00 137.37 ? 50  ILE B O     1 
ATOM   4612 C CB    . ILE B 2 64  ? 28.089  14.332 12.455  1.00 152.37 ? 50  ILE B CB    1 
ATOM   4613 C CG1   . ILE B 2 64  ? 28.095  15.214 13.712  1.00 143.46 ? 50  ILE B CG1   1 
ATOM   4614 C CG2   . ILE B 2 64  ? 26.697  13.769 12.205  1.00 155.27 ? 50  ILE B CG2   1 
ATOM   4615 C CD1   . ILE B 2 64  ? 28.926  16.473 13.586  1.00 152.60 ? 50  ILE B CD1   1 
ATOM   4616 N N     . GLY B 2 65  ? 30.748  13.994 10.923  1.00 147.37 ? 51  GLY B N     1 
ATOM   4617 C CA    . GLY B 2 65  ? 32.046  14.458 10.435  1.00 150.29 ? 51  GLY B CA    1 
ATOM   4618 C C     . GLY B 2 65  ? 32.315  15.937 10.668  1.00 146.47 ? 51  GLY B C     1 
ATOM   4619 O O     . GLY B 2 65  ? 31.602  16.586 11.438  1.00 137.27 ? 51  GLY B O     1 
ATOM   4620 N N     . PRO B 2 66  ? 33.352  16.482 10.000  1.00 148.78 ? 52  PRO B N     1 
ATOM   4621 C CA    . PRO B 2 66  ? 33.746  17.883 10.153  1.00 153.43 ? 52  PRO B CA    1 
ATOM   4622 C C     . PRO B 2 66  ? 32.983  18.845 9.234   1.00 149.72 ? 52  PRO B C     1 
ATOM   4623 O O     . PRO B 2 66  ? 33.256  20.048 9.238   1.00 142.64 ? 52  PRO B O     1 
ATOM   4624 C CB    . PRO B 2 66  ? 35.229  17.859 9.780   1.00 160.52 ? 52  PRO B CB    1 
ATOM   4625 C CG    . PRO B 2 66  ? 35.342  16.753 8.785   1.00 147.84 ? 52  PRO B CG    1 
ATOM   4626 C CD    . PRO B 2 66  ? 34.250  15.758 9.078   1.00 145.11 ? 52  PRO B CD    1 
ATOM   4627 N N     . GLU B 2 67  ? 32.034  18.314 8.463   1.00 151.36 ? 53  GLU B N     1 
ATOM   4628 C CA    . GLU B 2 67  ? 31.241  19.112 7.524   1.00 149.71 ? 53  GLU B CA    1 
ATOM   4629 C C     . GLU B 2 67  ? 30.210  20.009 8.218   1.00 151.02 ? 53  GLU B C     1 
ATOM   4630 O O     . GLU B 2 67  ? 29.721  20.974 7.626   1.00 150.96 ? 53  GLU B O     1 
ATOM   4631 C CB    . GLU B 2 67  ? 30.564  18.216 6.473   1.00 142.36 ? 53  GLU B CB    1 
ATOM   4632 C CG    . GLU B 2 67  ? 29.495  17.263 7.005   1.00 143.80 ? 53  GLU B CG    1 
ATOM   4633 C CD    . GLU B 2 67  ? 30.064  16.019 7.668   1.00 147.84 ? 53  GLU B CD    1 
ATOM   4634 O OE1   . GLU B 2 67  ? 31.208  15.629 7.348   1.00 147.44 ? 53  GLU B OE1   1 
ATOM   4635 O OE2   . GLU B 2 67  ? 29.360  15.425 8.512   1.00 156.94 ? 53  GLU B OE2   1 
ATOM   4636 N N     . ASN B 2 68  ? 29.891  19.682 9.469   1.00 146.17 ? 54  ASN B N     1 
ATOM   4637 C CA    . ASN B 2 68  ? 28.917  20.431 10.257  1.00 137.99 ? 54  ASN B CA    1 
ATOM   4638 C C     . ASN B 2 68  ? 29.529  21.694 10.872  1.00 146.12 ? 54  ASN B C     1 
ATOM   4639 O O     . ASN B 2 68  ? 30.476  21.604 11.658  1.00 152.70 ? 54  ASN B O     1 
ATOM   4640 C CB    . ASN B 2 68  ? 28.322  19.535 11.349  1.00 137.05 ? 54  ASN B CB    1 
ATOM   4641 C CG    . ASN B 2 68  ? 27.000  20.055 11.886  1.00 138.63 ? 54  ASN B CG    1 
ATOM   4642 O OD1   . ASN B 2 68  ? 26.911  21.178 12.386  1.00 133.27 ? 54  ASN B OD1   1 
ATOM   4643 N ND2   . ASN B 2 68  ? 25.966  19.228 11.798  1.00 154.56 ? 54  ASN B ND2   1 
ATOM   4644 N N     . PRO B 2 69  ? 28.994  22.877 10.508  1.00 142.34 ? 55  PRO B N     1 
ATOM   4645 C CA    . PRO B 2 69  ? 29.491  24.144 11.046  1.00 148.07 ? 55  PRO B CA    1 
ATOM   4646 C C     . PRO B 2 69  ? 28.786  24.594 12.330  1.00 151.11 ? 55  PRO B C     1 
ATOM   4647 O O     . PRO B 2 69  ? 29.291  25.475 13.031  1.00 156.23 ? 55  PRO B O     1 
ATOM   4648 C CB    . PRO B 2 69  ? 29.203  25.132 9.914   1.00 146.72 ? 55  PRO B CB    1 
ATOM   4649 C CG    . PRO B 2 69  ? 28.015  24.568 9.206   1.00 143.92 ? 55  PRO B CG    1 
ATOM   4650 C CD    . PRO B 2 69  ? 27.953  23.088 9.482   1.00 133.65 ? 55  PRO B CD    1 
ATOM   4651 N N     . TYR B 2 70  ? 27.638  23.990 12.628  1.00 143.82 ? 56  TYR B N     1 
ATOM   4652 C CA    . TYR B 2 70  ? 26.818  24.386 13.771  1.00 148.08 ? 56  TYR B CA    1 
ATOM   4653 C C     . TYR B 2 70  ? 27.336  23.776 15.071  1.00 144.28 ? 56  TYR B C     1 
ATOM   4654 O O     . TYR B 2 70  ? 27.598  22.573 15.143  1.00 133.09 ? 56  TYR B O     1 
ATOM   4655 C CB    . TYR B 2 70  ? 25.351  23.998 13.544  1.00 152.82 ? 56  TYR B CB    1 
ATOM   4656 C CG    . TYR B 2 70  ? 24.832  24.318 12.156  1.00 151.53 ? 56  TYR B CG    1 
ATOM   4657 C CD1   . TYR B 2 70  ? 24.505  25.625 11.794  1.00 137.87 ? 56  TYR B CD1   1 
ATOM   4658 C CD2   . TYR B 2 70  ? 24.666  23.311 11.205  1.00 156.29 ? 56  TYR B CD2   1 
ATOM   4659 C CE1   . TYR B 2 70  ? 24.032  25.920 10.523  1.00 139.16 ? 56  TYR B CE1   1 
ATOM   4660 C CE2   . TYR B 2 70  ? 24.194  23.595 9.933   1.00 152.08 ? 56  TYR B CE2   1 
ATOM   4661 C CZ    . TYR B 2 70  ? 23.879  24.900 9.597   1.00 142.64 ? 56  TYR B CZ    1 
ATOM   4662 O OH    . TYR B 2 70  ? 23.408  25.187 8.337   1.00 134.05 ? 56  TYR B OH    1 
ATOM   4663 N N     . ASN B 2 71  ? 27.481  24.619 16.092  1.00 149.02 ? 57  ASN B N     1 
ATOM   4664 C CA    . ASN B 2 71  ? 27.977  24.188 17.397  1.00 143.53 ? 57  ASN B CA    1 
ATOM   4665 C C     . ASN B 2 71  ? 27.054  24.611 18.538  1.00 127.75 ? 57  ASN B C     1 
ATOM   4666 O O     . ASN B 2 71  ? 26.460  25.692 18.502  1.00 132.38 ? 57  ASN B O     1 
ATOM   4667 C CB    . ASN B 2 71  ? 29.394  24.723 17.636  1.00 158.25 ? 57  ASN B CB    1 
ATOM   4668 C CG    . ASN B 2 71  ? 30.080  24.063 18.821  1.00 158.48 ? 57  ASN B CG    1 
ATOM   4669 O OD1   . ASN B 2 71  ? 30.055  22.840 18.971  1.00 157.13 ? 57  ASN B OD1   1 
ATOM   4670 N ND2   . ASN B 2 71  ? 30.705  24.874 19.666  1.00 159.87 ? 57  ASN B ND2   1 
ATOM   4671 N N     . THR B 2 72  ? 26.945  23.749 19.546  1.00 118.06 ? 58  THR B N     1 
ATOM   4672 C CA    . THR B 2 72  ? 26.097  24.001 20.707  1.00 120.88 ? 58  THR B CA    1 
ATOM   4673 C C     . THR B 2 72  ? 26.915  23.842 21.995  1.00 118.94 ? 58  THR B C     1 
ATOM   4674 O O     . THR B 2 72  ? 27.587  22.823 22.176  1.00 127.30 ? 58  THR B O     1 
ATOM   4675 C CB    . THR B 2 72  ? 24.881  23.047 20.733  1.00 146.41 ? 58  THR B CB    1 
ATOM   4676 O OG1   . THR B 2 72  ? 24.431  22.799 19.395  1.00 155.11 ? 58  THR B OG1   1 
ATOM   4677 C CG2   . THR B 2 72  ? 23.739  23.646 21.539  1.00 161.67 ? 58  THR B CG2   1 
ATOM   4678 N N     . PRO B 2 73  ? 26.875  24.857 22.884  1.00 117.37 ? 59  PRO B N     1 
ATOM   4679 C CA    . PRO B 2 73  ? 27.609  24.807 24.155  1.00 133.24 ? 59  PRO B CA    1 
ATOM   4680 C C     . PRO B 2 73  ? 27.094  23.714 25.092  1.00 142.07 ? 59  PRO B C     1 
ATOM   4681 O O     . PRO B 2 73  ? 25.881  23.541 25.236  1.00 151.89 ? 59  PRO B O     1 
ATOM   4682 C CB    . PRO B 2 73  ? 27.354  26.191 24.767  1.00 138.36 ? 59  PRO B CB    1 
ATOM   4683 C CG    . PRO B 2 73  ? 26.975  27.060 23.617  1.00 140.39 ? 59  PRO B CG    1 
ATOM   4684 C CD    . PRO B 2 73  ? 26.215  26.161 22.690  1.00 130.72 ? 59  PRO B CD    1 
ATOM   4685 N N     . VAL B 2 74  ? 28.020  22.990 25.718  1.00 140.00 ? 60  VAL B N     1 
ATOM   4686 C CA    . VAL B 2 74  ? 27.675  21.891 26.623  1.00 139.12 ? 60  VAL B CA    1 
ATOM   4687 C C     . VAL B 2 74  ? 28.435  21.988 27.954  1.00 135.21 ? 60  VAL B C     1 
ATOM   4688 O O     . VAL B 2 74  ? 29.631  22.291 27.980  1.00 126.39 ? 60  VAL B O     1 
ATOM   4689 C CB    . VAL B 2 74  ? 27.864  20.505 25.944  1.00 137.64 ? 60  VAL B CB    1 
ATOM   4690 C CG1   . VAL B 2 74  ? 29.327  20.239 25.599  1.00 134.40 ? 60  VAL B CG1   1 
ATOM   4691 C CG2   . VAL B 2 74  ? 27.292  19.385 26.804  1.00 142.08 ? 60  VAL B CG2   1 
ATOM   4692 N N     . PHE B 2 75  ? 27.718  21.744 29.050  1.00 140.51 ? 61  PHE B N     1 
ATOM   4693 C CA    . PHE B 2 75  ? 28.282  21.811 30.398  1.00 138.97 ? 61  PHE B CA    1 
ATOM   4694 C C     . PHE B 2 75  ? 27.917  20.572 31.217  1.00 141.11 ? 61  PHE B C     1 
ATOM   4695 O O     . PHE B 2 75  ? 27.074  19.771 30.804  1.00 143.72 ? 61  PHE B O     1 
ATOM   4696 C CB    . PHE B 2 75  ? 27.805  23.080 31.116  1.00 150.07 ? 61  PHE B CB    1 
ATOM   4697 C CG    . PHE B 2 75  ? 28.228  24.359 30.445  1.00 157.41 ? 61  PHE B CG    1 
ATOM   4698 C CD1   . PHE B 2 75  ? 29.477  24.917 30.702  1.00 160.66 ? 61  PHE B CD1   1 
ATOM   4699 C CD2   . PHE B 2 75  ? 27.374  25.013 29.562  1.00 151.86 ? 61  PHE B CD2   1 
ATOM   4700 C CE1   . PHE B 2 75  ? 29.868  26.097 30.086  1.00 160.27 ? 61  PHE B CE1   1 
ATOM   4701 C CE2   . PHE B 2 75  ? 27.759  26.193 28.943  1.00 151.60 ? 61  PHE B CE2   1 
ATOM   4702 C CZ    . PHE B 2 75  ? 29.008  26.736 29.206  1.00 157.60 ? 61  PHE B CZ    1 
ATOM   4703 N N     . ALA B 2 76  ? 28.557  20.420 32.375  1.00 146.07 ? 62  ALA B N     1 
ATOM   4704 C CA    . ALA B 2 76  ? 28.289  19.298 33.272  1.00 152.67 ? 62  ALA B CA    1 
ATOM   4705 C C     . ALA B 2 76  ? 27.764  19.774 34.626  1.00 154.03 ? 62  ALA B C     1 
ATOM   4706 O O     . ALA B 2 76  ? 28.324  20.691 35.232  1.00 152.90 ? 62  ALA B O     1 
ATOM   4707 C CB    . ALA B 2 76  ? 29.538  18.447 33.449  1.00 153.76 ? 62  ALA B CB    1 
ATOM   4708 N N     . ILE B 2 77  ? 26.684  19.145 35.086  1.00 150.45 ? 63  ILE B N     1 
ATOM   4709 C CA    . ILE B 2 77  ? 26.051  19.494 36.362  1.00 141.77 ? 63  ILE B CA    1 
ATOM   4710 C C     . ILE B 2 77  ? 25.884  18.280 37.277  1.00 136.65 ? 63  ILE B C     1 
ATOM   4711 O O     . ILE B 2 77  ? 25.796  17.144 36.804  1.00 139.61 ? 63  ILE B O     1 
ATOM   4712 C CB    . ILE B 2 77  ? 24.682  20.191 36.166  1.00 144.35 ? 63  ILE B CB    1 
ATOM   4713 C CG1   . ILE B 2 77  ? 23.787  19.391 35.206  1.00 141.36 ? 63  ILE B CG1   1 
ATOM   4714 C CG2   . ILE B 2 77  ? 24.878  21.624 35.682  1.00 143.62 ? 63  ILE B CG2   1 
ATOM   4715 C CD1   . ILE B 2 77  ? 22.309  19.702 35.320  1.00 137.52 ? 63  ILE B CD1   1 
ATOM   4716 N N     . LYS B 2 78  ? 25.842  18.530 38.584  1.00 136.63 ? 64  LYS B N     1 
ATOM   4717 C CA    . LYS B 2 78  ? 25.677  17.468 39.579  1.00 140.23 ? 64  LYS B CA    1 
ATOM   4718 C C     . LYS B 2 78  ? 24.234  17.353 40.076  1.00 148.81 ? 64  LYS B C     1 
ATOM   4719 O O     . LYS B 2 78  ? 23.514  18.351 40.162  1.00 151.59 ? 64  LYS B O     1 
ATOM   4720 C CB    . LYS B 2 78  ? 26.646  17.659 40.755  1.00 142.29 ? 64  LYS B CB    1 
ATOM   4721 C CG    . LYS B 2 78  ? 26.557  19.009 41.458  1.00 145.43 ? 64  LYS B CG    1 
ATOM   4722 C CD    . LYS B 2 78  ? 27.521  19.104 42.633  1.00 151.72 ? 64  LYS B CD    1 
ATOM   4723 C CE    . LYS B 2 78  ? 28.953  19.354 42.180  1.00 153.16 ? 64  LYS B CE    1 
ATOM   4724 N NZ    . LYS B 2 78  ? 29.892  19.446 43.332  1.00 154.50 ? 64  LYS B NZ    1 
ATOM   4725 N N     . LYS B 2 79  ? 23.826  16.127 40.397  1.00 147.69 ? 65  LYS B N     1 
ATOM   4726 C CA    . LYS B 2 79  ? 22.476  15.850 40.888  1.00 149.43 ? 65  LYS B CA    1 
ATOM   4727 C C     . LYS B 2 79  ? 22.469  15.568 42.389  1.00 147.55 ? 65  LYS B C     1 
ATOM   4728 O O     . LYS B 2 79  ? 23.460  15.087 42.944  1.00 134.22 ? 65  LYS B O     1 
ATOM   4729 C CB    . LYS B 2 79  ? 21.862  14.673 40.126  1.00 145.05 ? 65  LYS B CB    1 
ATOM   4730 N N     . LYS B 2 80  ? 21.345  15.869 43.035  1.00 154.83 ? 66  LYS B N     1 
ATOM   4731 C CA    . LYS B 2 80  ? 21.190  15.665 44.475  1.00 152.63 ? 66  LYS B CA    1 
ATOM   4732 C C     . LYS B 2 80  ? 20.445  14.371 44.801  1.00 161.00 ? 66  LYS B C     1 
ATOM   4733 O O     . LYS B 2 80  ? 20.820  13.651 45.729  1.00 164.95 ? 66  LYS B O     1 
ATOM   4734 C CB    . LYS B 2 80  ? 20.479  16.861 45.114  1.00 154.97 ? 66  LYS B CB    1 
ATOM   4735 N N     . ASP B 2 81  ? 19.394  14.085 44.034  1.00 157.18 ? 67  ASP B N     1 
ATOM   4736 C CA    . ASP B 2 81  ? 18.575  12.891 44.241  1.00 150.48 ? 67  ASP B CA    1 
ATOM   4737 C C     . ASP B 2 81  ? 19.243  11.630 43.692  1.00 157.26 ? 67  ASP B C     1 
ATOM   4738 O O     . ASP B 2 81  ? 19.233  10.583 44.343  1.00 150.40 ? 67  ASP B O     1 
ATOM   4739 C CB    . ASP B 2 81  ? 17.191  13.074 43.613  1.00 142.65 ? 67  ASP B CB    1 
ATOM   4740 N N     . GLY B 2 82  ? 19.818  11.739 42.496  1.00 162.61 ? 68  GLY B N     1 
ATOM   4741 C CA    . GLY B 2 82  ? 20.477  10.610 41.840  1.00 165.64 ? 68  GLY B CA    1 
ATOM   4742 C C     . GLY B 2 82  ? 21.981  10.561 42.041  1.00 164.50 ? 68  GLY B C     1 
ATOM   4743 O O     . GLY B 2 82  ? 22.645  9.652  41.537  1.00 161.12 ? 68  GLY B O     1 
ATOM   4744 N N     . THR B 2 83  ? 22.508  11.538 42.784  1.00 163.01 ? 69  THR B N     1 
ATOM   4745 C CA    . THR B 2 83  ? 23.949  11.681 43.079  1.00 149.79 ? 69  THR B CA    1 
ATOM   4746 C C     . THR B 2 83  ? 24.896  11.217 41.951  1.00 146.76 ? 69  THR B C     1 
ATOM   4747 O O     . THR B 2 83  ? 25.823  10.431 42.171  1.00 143.32 ? 69  THR B O     1 
ATOM   4748 C CB    . THR B 2 83  ? 24.335  11.087 44.467  1.00 142.84 ? 69  THR B CB    1 
ATOM   4749 O OG1   . THR B 2 83  ? 25.736  11.273 44.705  1.00 148.44 ? 69  THR B OG1   1 
ATOM   4750 C CG2   . THR B 2 83  ? 23.990  9.597  44.578  1.00 144.88 ? 69  THR B CG2   1 
ATOM   4751 N N     . LYS B 2 84  ? 24.646  11.729 40.747  1.00 149.71 ? 70  LYS B N     1 
ATOM   4752 C CA    . LYS B 2 84  ? 25.442  11.396 39.567  1.00 149.08 ? 70  LYS B CA    1 
ATOM   4753 C C     . LYS B 2 84  ? 25.582  12.600 38.635  1.00 160.01 ? 70  LYS B C     1 
ATOM   4754 O O     . LYS B 2 84  ? 24.796  13.548 38.710  1.00 155.10 ? 70  LYS B O     1 
ATOM   4755 C CB    . LYS B 2 84  ? 24.817  10.216 38.816  1.00 140.57 ? 70  LYS B CB    1 
ATOM   4756 N N     . TRP B 2 85  ? 26.587  12.551 37.763  1.00 159.20 ? 71  TRP B N     1 
ATOM   4757 C CA    . TRP B 2 85  ? 26.847  13.627 36.806  1.00 158.76 ? 71  TRP B CA    1 
ATOM   4758 C C     . TRP B 2 85  ? 25.835  13.639 35.694  1.00 158.91 ? 71  TRP B C     1 
ATOM   4759 O O     . TRP B 2 85  ? 25.573  12.610 35.067  1.00 159.40 ? 71  TRP B O     1 
ATOM   4760 C CB    . TRP B 2 85  ? 28.258  13.513 36.237  1.00 153.19 ? 71  TRP B CB    1 
ATOM   4761 C CG    . TRP B 2 85  ? 29.346  13.722 37.265  1.00 149.79 ? 71  TRP B CG    1 
ATOM   4762 C CD1   . TRP B 2 85  ? 29.995  12.752 38.025  1.00 154.37 ? 71  TRP B CD1   1 
ATOM   4763 C CD2   . TRP B 2 85  ? 29.950  14.997 37.682  1.00 149.07 ? 71  TRP B CD2   1 
ATOM   4764 N NE1   . TRP B 2 85  ? 30.928  13.321 38.855  1.00 161.57 ? 71  TRP B NE1   1 
ATOM   4765 C CE2   . TRP B 2 85  ? 30.953  14.662 38.701  1.00 157.04 ? 71  TRP B CE2   1 
ATOM   4766 C CE3   . TRP B 2 85  ? 29.768  16.331 37.328  1.00 146.97 ? 71  TRP B CE3   1 
ATOM   4767 C CZ2   . TRP B 2 85  ? 31.726  15.634 39.321  1.00 154.81 ? 71  TRP B CZ2   1 
ATOM   4768 C CZ3   . TRP B 2 85  ? 30.554  17.303 37.962  1.00 147.90 ? 71  TRP B CZ3   1 
ATOM   4769 C CH2   . TRP B 2 85  ? 31.508  16.960 38.934  1.00 146.06 ? 71  TRP B CH2   1 
ATOM   4770 N N     . ARG B 2 86  ? 25.257  14.813 35.450  1.00 152.63 ? 72  ARG B N     1 
ATOM   4771 C CA    . ARG B 2 86  ? 24.249  14.991 34.407  1.00 140.03 ? 72  ARG B CA    1 
ATOM   4772 C C     . ARG B 2 86  ? 24.744  15.925 33.306  1.00 147.08 ? 72  ARG B C     1 
ATOM   4773 O O     . ARG B 2 86  ? 25.477  16.881 33.571  1.00 154.00 ? 72  ARG B O     1 
ATOM   4774 N N     . LYS B 2 87  ? 24.332  15.639 32.073  1.00 140.77 ? 73  LYS B N     1 
ATOM   4775 C CA    . LYS B 2 87  ? 24.736  16.427 30.911  1.00 144.84 ? 73  LYS B CA    1 
ATOM   4776 C C     . LYS B 2 87  ? 23.773  17.590 30.674  1.00 142.73 ? 73  LYS B C     1 
ATOM   4777 O O     . LYS B 2 87  ? 22.565  17.389 30.522  1.00 135.50 ? 73  LYS B O     1 
ATOM   4778 C CB    . LYS B 2 87  ? 24.830  15.535 29.668  1.00 136.74 ? 73  LYS B CB    1 
ATOM   4779 C CG    . LYS B 2 87  ? 25.545  16.170 28.483  1.00 141.78 ? 73  LYS B CG    1 
ATOM   4780 C CD    . LYS B 2 87  ? 25.907  15.139 27.420  1.00 134.88 ? 73  LYS B CD    1 
ATOM   4781 C CE    . LYS B 2 87  ? 24.723  14.779 26.532  1.00 133.85 ? 73  LYS B CE    1 
ATOM   4782 N NZ    . LYS B 2 87  ? 24.368  15.875 25.588  1.00 138.07 ? 73  LYS B NZ    1 
ATOM   4783 N N     . LEU B 2 88  ? 24.322  18.803 30.652  1.00 150.05 ? 74  LEU B N     1 
ATOM   4784 C CA    . LEU B 2 88  ? 23.539  20.015 30.425  1.00 145.51 ? 74  LEU B CA    1 
ATOM   4785 C C     . LEU B 2 88  ? 23.972  20.701 29.132  1.00 143.70 ? 74  LEU B C     1 
ATOM   4786 O O     . LEU B 2 88  ? 25.148  21.024 28.955  1.00 150.42 ? 74  LEU B O     1 
ATOM   4787 C CB    . LEU B 2 88  ? 23.677  20.976 31.613  1.00 144.37 ? 74  LEU B CB    1 
ATOM   4788 C CG    . LEU B 2 88  ? 22.830  22.254 31.621  1.00 142.16 ? 74  LEU B CG    1 
ATOM   4789 C CD1   . LEU B 2 88  ? 21.392  21.962 32.029  1.00 139.43 ? 74  LEU B CD1   1 
ATOM   4790 C CD2   . LEU B 2 88  ? 23.442  23.294 32.547  1.00 151.26 ? 74  LEU B CD2   1 
ATOM   4791 N N     . VAL B 2 89  ? 23.015  20.916 28.232  1.00 131.33 ? 75  VAL B N     1 
ATOM   4792 C CA    . VAL B 2 89  ? 23.286  21.570 26.952  1.00 133.55 ? 75  VAL B CA    1 
ATOM   4793 C C     . VAL B 2 89  ? 22.513  22.887 26.862  1.00 141.29 ? 75  VAL B C     1 
ATOM   4794 O O     . VAL B 2 89  ? 21.290  22.912 27.023  1.00 139.75 ? 75  VAL B O     1 
ATOM   4795 C CB    . VAL B 2 89  ? 22.941  20.659 25.749  1.00 133.64 ? 75  VAL B CB    1 
ATOM   4796 C CG1   . VAL B 2 89  ? 23.456  21.265 24.452  1.00 142.29 ? 75  VAL B CG1   1 
ATOM   4797 C CG2   . VAL B 2 89  ? 23.525  19.266 25.935  1.00 140.42 ? 75  VAL B CG2   1 
ATOM   4798 N N     . ASP B 2 90  ? 23.241  23.973 26.612  1.00 156.46 ? 76  ASP B N     1 
ATOM   4799 C CA    . ASP B 2 90  ? 22.653  25.308 26.526  1.00 156.83 ? 76  ASP B CA    1 
ATOM   4800 C C     . ASP B 2 90  ? 22.109  25.582 25.125  1.00 149.67 ? 76  ASP B C     1 
ATOM   4801 O O     . ASP B 2 90  ? 22.852  25.536 24.142  1.00 153.41 ? 76  ASP B O     1 
ATOM   4802 C CB    . ASP B 2 90  ? 23.685  26.372 26.919  1.00 158.73 ? 76  ASP B CB    1 
ATOM   4803 C CG    . ASP B 2 90  ? 23.067  27.746 27.120  1.00 151.87 ? 76  ASP B CG    1 
ATOM   4804 O OD1   . ASP B 2 90  ? 22.088  27.859 27.889  1.00 146.13 ? 76  ASP B OD1   1 
ATOM   4805 O OD2   . ASP B 2 90  ? 23.570  28.716 26.516  1.00 153.43 ? 76  ASP B OD2   1 
ATOM   4806 N N     . PHE B 2 91  ? 20.811  25.867 25.046  1.00 144.42 ? 77  PHE B N     1 
ATOM   4807 C CA    . PHE B 2 91  ? 20.142  26.127 23.770  1.00 142.74 ? 77  PHE B CA    1 
ATOM   4808 C C     . PHE B 2 91  ? 19.649  27.571 23.636  1.00 148.44 ? 77  PHE B C     1 
ATOM   4809 O O     . PHE B 2 91  ? 18.758  27.853 22.831  1.00 145.31 ? 77  PHE B O     1 
ATOM   4810 C CB    . PHE B 2 91  ? 18.973  25.153 23.569  1.00 144.91 ? 77  PHE B CB    1 
ATOM   4811 C CG    . PHE B 2 91  ? 19.397  23.736 23.300  1.00 144.88 ? 77  PHE B CG    1 
ATOM   4812 C CD1   . PHE B 2 91  ? 19.811  23.348 22.029  1.00 138.66 ? 77  PHE B CD1   1 
ATOM   4813 C CD2   . PHE B 2 91  ? 19.368  22.784 24.313  1.00 146.71 ? 77  PHE B CD2   1 
ATOM   4814 C CE1   . PHE B 2 91  ? 20.198  22.041 21.776  1.00 138.78 ? 77  PHE B CE1   1 
ATOM   4815 C CE2   . PHE B 2 91  ? 19.752  21.475 24.066  1.00 150.45 ? 77  PHE B CE2   1 
ATOM   4816 C CZ    . PHE B 2 91  ? 20.168  21.103 22.796  1.00 147.32 ? 77  PHE B CZ    1 
ATOM   4817 N N     . ARG B 2 92  ? 20.242  28.478 24.412  1.00 141.85 ? 78  ARG B N     1 
ATOM   4818 C CA    . ARG B 2 92  ? 19.832  29.888 24.438  1.00 147.86 ? 78  ARG B CA    1 
ATOM   4819 C C     . ARG B 2 92  ? 19.960  30.599 23.087  1.00 149.70 ? 78  ARG B C     1 
ATOM   4820 O O     . ARG B 2 92  ? 19.181  31.506 22.785  1.00 157.94 ? 78  ARG B O     1 
ATOM   4821 C CB    . ARG B 2 92  ? 20.602  30.659 25.515  1.00 135.28 ? 78  ARG B CB    1 
ATOM   4822 C CG    . ARG B 2 92  ? 20.111  30.404 26.932  1.00 139.19 ? 78  ARG B CG    1 
ATOM   4823 C CD    . ARG B 2 92  ? 20.859  31.253 27.950  1.00 148.65 ? 78  ARG B CD    1 
ATOM   4824 N NE    . ARG B 2 92  ? 22.246  30.823 28.124  1.00 151.92 ? 78  ARG B NE    1 
ATOM   4825 C CZ    . ARG B 2 92  ? 23.125  31.409 28.935  1.00 150.49 ? 78  ARG B CZ    1 
ATOM   4826 N NH1   . ARG B 2 92  ? 22.774  32.463 29.662  1.00 151.53 ? 78  ARG B NH1   1 
ATOM   4827 N NH2   . ARG B 2 92  ? 24.361  30.939 29.018  1.00 144.03 ? 78  ARG B NH2   1 
ATOM   4828 N N     . GLU B 2 93  ? 20.940  30.185 22.287  1.00 144.24 ? 79  GLU B N     1 
ATOM   4829 C CA    . GLU B 2 93  ? 21.141  30.742 20.950  1.00 151.35 ? 79  GLU B CA    1 
ATOM   4830 C C     . GLU B 2 93  ? 20.117  30.187 19.957  1.00 151.18 ? 79  GLU B C     1 
ATOM   4831 O O     . GLU B 2 93  ? 19.660  30.904 19.063  1.00 155.92 ? 79  GLU B O     1 
ATOM   4832 C CB    . GLU B 2 93  ? 22.568  30.466 20.461  1.00 142.08 ? 79  GLU B CB    1 
ATOM   4833 C CG    . GLU B 2 93  ? 23.016  31.325 19.283  1.00 146.47 ? 79  GLU B CG    1 
ATOM   4834 C CD    . GLU B 2 93  ? 23.254  32.779 19.656  1.00 144.76 ? 79  GLU B CD    1 
ATOM   4835 O OE1   . GLU B 2 93  ? 23.856  33.040 20.720  1.00 140.94 ? 79  GLU B OE1   1 
ATOM   4836 O OE2   . GLU B 2 93  ? 22.847  33.664 18.875  1.00 137.97 ? 79  GLU B OE2   1 
ATOM   4837 N N     . LEU B 2 94  ? 19.763  28.914 20.124  1.00 143.14 ? 80  LEU B N     1 
ATOM   4838 C CA    . LEU B 2 94  ? 18.786  28.248 19.261  1.00 137.44 ? 80  LEU B CA    1 
ATOM   4839 C C     . LEU B 2 94  ? 17.352  28.671 19.586  1.00 129.01 ? 80  LEU B C     1 
ATOM   4840 O O     . LEU B 2 94  ? 16.514  28.778 18.686  1.00 131.20 ? 80  LEU B O     1 
ATOM   4841 C CB    . LEU B 2 94  ? 18.933  26.723 19.359  1.00 137.64 ? 80  LEU B CB    1 
ATOM   4842 C CG    . LEU B 2 94  ? 18.138  25.827 18.399  1.00 146.66 ? 80  LEU B CG    1 
ATOM   4843 C CD1   . LEU B 2 94  ? 18.653  25.932 16.969  1.00 149.78 ? 80  LEU B CD1   1 
ATOM   4844 C CD2   . LEU B 2 94  ? 18.172  24.381 18.869  1.00 147.54 ? 80  LEU B CD2   1 
ATOM   4845 N N     . ASN B 2 95  ? 17.082  28.912 20.869  1.00 127.53 ? 81  ASN B N     1 
ATOM   4846 C CA    . ASN B 2 95  ? 15.751  29.308 21.342  1.00 140.57 ? 81  ASN B CA    1 
ATOM   4847 C C     . ASN B 2 95  ? 15.269  30.655 20.800  1.00 149.04 ? 81  ASN B C     1 
ATOM   4848 O O     . ASN B 2 95  ? 14.063  30.885 20.680  1.00 162.58 ? 81  ASN B O     1 
ATOM   4849 C CB    . ASN B 2 95  ? 15.702  29.310 22.875  1.00 140.69 ? 81  ASN B CB    1 
ATOM   4850 C CG    . ASN B 2 95  ? 15.698  27.910 23.467  1.00 145.90 ? 81  ASN B CG    1 
ATOM   4851 O OD1   . ASN B 2 95  ? 15.418  26.925 22.780  1.00 145.83 ? 81  ASN B OD1   1 
ATOM   4852 N ND2   . ASN B 2 95  ? 16.008  27.817 24.755  1.00 151.56 ? 81  ASN B ND2   1 
ATOM   4853 N N     . LYS B 2 96  ? 16.215  31.535 20.477  1.00 141.43 ? 82  LYS B N     1 
ATOM   4854 C CA    . LYS B 2 96  ? 15.907  32.841 19.893  1.00 142.48 ? 82  LYS B CA    1 
ATOM   4855 C C     . LYS B 2 96  ? 15.466  32.721 18.433  1.00 146.24 ? 82  LYS B C     1 
ATOM   4856 O O     . LYS B 2 96  ? 14.721  33.568 17.933  1.00 150.12 ? 82  LYS B O     1 
ATOM   4857 C CB    . LYS B 2 96  ? 17.115  33.774 20.002  1.00 140.42 ? 82  LYS B CB    1 
ATOM   4858 N N     . LYS B 2 97  ? 15.931  31.669 17.762  1.00 143.24 ? 83  LYS B N     1 
ATOM   4859 C CA    . LYS B 2 97  ? 15.588  31.413 16.364  1.00 147.41 ? 83  LYS B CA    1 
ATOM   4860 C C     . LYS B 2 97  ? 14.397  30.464 16.223  1.00 150.93 ? 83  LYS B C     1 
ATOM   4861 O O     . LYS B 2 97  ? 13.622  30.572 15.270  1.00 142.16 ? 83  LYS B O     1 
ATOM   4862 C CB    . LYS B 2 97  ? 16.797  30.853 15.610  1.00 139.13 ? 83  LYS B CB    1 
ATOM   4863 N N     . THR B 2 98  ? 14.260  29.541 17.174  1.00 154.18 ? 84  THR B N     1 
ATOM   4864 C CA    . THR B 2 98  ? 13.182  28.547 17.157  1.00 150.08 ? 84  THR B CA    1 
ATOM   4865 C C     . THR B 2 98  ? 11.974  28.976 18.000  1.00 153.11 ? 84  THR B C     1 
ATOM   4866 O O     . THR B 2 98  ? 11.198  28.135 18.466  1.00 150.17 ? 84  THR B O     1 
ATOM   4867 C CB    . THR B 2 98  ? 13.676  27.159 17.626  1.00 147.80 ? 84  THR B CB    1 
ATOM   4868 O OG1   . THR B 2 98  ? 14.283  27.274 18.920  1.00 152.39 ? 84  THR B OG1   1 
ATOM   4869 C CG2   . THR B 2 98  ? 14.685  26.579 16.642  1.00 147.33 ? 84  THR B CG2   1 
ATOM   4870 N N     . GLN B 2 99  ? 11.817  30.286 18.180  1.00 156.87 ? 85  GLN B N     1 
ATOM   4871 C CA    . GLN B 2 99  ? 10.710  30.842 18.963  1.00 148.27 ? 85  GLN B CA    1 
ATOM   4872 C C     . GLN B 2 99  ? 9.379   30.831 18.205  1.00 149.11 ? 85  GLN B C     1 
ATOM   4873 O O     . GLN B 2 99  ? 8.311   30.897 18.817  1.00 144.73 ? 85  GLN B O     1 
ATOM   4874 C CB    . GLN B 2 99  ? 11.045  32.259 19.453  1.00 142.53 ? 85  GLN B CB    1 
ATOM   4875 C CG    . GLN B 2 99  ? 11.337  33.273 18.352  1.00 152.42 ? 85  GLN B CG    1 
ATOM   4876 C CD    . GLN B 2 99  ? 11.661  34.657 18.888  1.00 158.98 ? 85  GLN B CD    1 
ATOM   4877 O OE1   . GLN B 2 99  ? 11.105  35.097 19.896  1.00 160.06 ? 85  GLN B OE1   1 
ATOM   4878 N NE2   . GLN B 2 99  ? 12.562  35.355 18.206  1.00 158.48 ? 85  GLN B NE2   1 
ATOM   4879 N N     . ASP B 2 100 ? 9.453   30.744 16.878  1.00 154.91 ? 86  ASP B N     1 
ATOM   4880 C CA    . ASP B 2 100 ? 8.265   30.709 16.024  1.00 151.75 ? 86  ASP B CA    1 
ATOM   4881 C C     . ASP B 2 100 ? 7.564   29.350 16.059  1.00 147.48 ? 86  ASP B C     1 
ATOM   4882 O O     . ASP B 2 100 ? 6.354   29.263 15.842  1.00 139.03 ? 86  ASP B O     1 
ATOM   4883 C CB    . ASP B 2 100 ? 8.629   31.074 14.580  1.00 160.26 ? 86  ASP B CB    1 
ATOM   4884 C CG    . ASP B 2 100 ? 9.111   32.509 14.439  1.00 160.91 ? 86  ASP B CG    1 
ATOM   4885 O OD1   . ASP B 2 100 ? 10.000  32.929 15.212  1.00 159.95 ? 86  ASP B OD1   1 
ATOM   4886 O OD2   . ASP B 2 100 ? 8.607   33.218 13.542  1.00 156.63 ? 86  ASP B OD2   1 
ATOM   4887 N N     . PHE B 2 101 ? 8.332   28.297 16.331  1.00 150.47 ? 87  PHE B N     1 
ATOM   4888 C CA    . PHE B 2 101 ? 7.807   26.933 16.375  1.00 141.58 ? 87  PHE B CA    1 
ATOM   4889 C C     . PHE B 2 101 ? 7.096   26.626 17.694  1.00 145.25 ? 87  PHE B C     1 
ATOM   4890 O O     . PHE B 2 101 ? 6.143   25.843 17.722  1.00 150.71 ? 87  PHE B O     1 
ATOM   4891 C CB    . PHE B 2 101 ? 8.937   25.923 16.130  1.00 146.63 ? 87  PHE B CB    1 
ATOM   4892 C CG    . PHE B 2 101 ? 8.466   24.503 15.962  1.00 149.52 ? 87  PHE B CG    1 
ATOM   4893 C CD1   . PHE B 2 101 ? 7.971   24.058 14.739  1.00 148.87 ? 87  PHE B CD1   1 
ATOM   4894 C CD2   . PHE B 2 101 ? 8.527   23.605 17.024  1.00 152.78 ? 87  PHE B CD2   1 
ATOM   4895 C CE1   . PHE B 2 101 ? 7.539   22.749 14.581  1.00 158.99 ? 87  PHE B CE1   1 
ATOM   4896 C CE2   . PHE B 2 101 ? 8.096   22.295 16.872  1.00 158.50 ? 87  PHE B CE2   1 
ATOM   4897 C CZ    . PHE B 2 101 ? 7.602   21.867 15.649  1.00 159.45 ? 87  PHE B CZ    1 
ATOM   4898 N N     . TRP B 2 102 ? 7.558   27.249 18.776  1.00 149.04 ? 88  TRP B N     1 
ATOM   4899 C CA    . TRP B 2 102 ? 7.056   26.957 20.120  1.00 153.71 ? 88  TRP B CA    1 
ATOM   4900 C C     . TRP B 2 102 ? 6.053   27.954 20.641  1.00 155.72 ? 88  TRP B C     1 
ATOM   4901 O O     . TRP B 2 102 ? 5.576   27.825 21.772  1.00 150.24 ? 88  TRP B O     1 
ATOM   4902 C CB    . TRP B 2 102 ? 8.221   26.819 21.097  1.00 157.27 ? 88  TRP B CB    1 
ATOM   4903 N N     . GLU B 2 103 ? 5.716   28.951 19.825  1.00 150.27 ? 89  GLU B N     1 
ATOM   4904 C CA    . GLU B 2 103 ? 4.764   29.988 20.228  1.00 145.13 ? 89  GLU B CA    1 
ATOM   4905 C C     . GLU B 2 103 ? 3.695   30.263 19.169  1.00 149.03 ? 89  GLU B C     1 
ATOM   4906 O O     . GLU B 2 103 ? 2.500   30.261 19.474  1.00 154.84 ? 89  GLU B O     1 
ATOM   4907 C CB    . GLU B 2 103 ? 5.497   31.282 20.596  1.00 137.78 ? 89  GLU B CB    1 
ATOM   4908 N N     . VAL B 2 104 ? 4.130   30.498 17.932  1.00 144.29 ? 90  VAL B N     1 
ATOM   4909 C CA    . VAL B 2 104 ? 3.219   30.823 16.832  1.00 149.69 ? 90  VAL B CA    1 
ATOM   4910 C C     . VAL B 2 104 ? 2.541   29.565 16.282  1.00 154.51 ? 90  VAL B C     1 
ATOM   4911 O O     . VAL B 2 104 ? 1.317   29.530 16.131  1.00 152.13 ? 90  VAL B O     1 
ATOM   4912 C CB    . VAL B 2 104 ? 3.936   31.595 15.695  1.00 145.72 ? 90  VAL B CB    1 
ATOM   4913 C CG1   . VAL B 2 104 ? 2.946   32.023 14.620  1.00 144.48 ? 90  VAL B CG1   1 
ATOM   4914 C CG2   . VAL B 2 104 ? 4.668   32.811 16.247  1.00 150.22 ? 90  VAL B CG2   1 
ATOM   4915 N N     . GLN B 2 105 ? 3.340   28.539 15.994  1.00 158.50 ? 91  GLN B N     1 
ATOM   4916 C CA    . GLN B 2 105 ? 2.831   27.282 15.440  1.00 154.56 ? 91  GLN B CA    1 
ATOM   4917 C C     . GLN B 2 105 ? 2.123   26.433 16.496  1.00 141.30 ? 91  GLN B C     1 
ATOM   4918 O O     . GLN B 2 105 ? 0.962   26.058 16.319  1.00 125.32 ? 91  GLN B O     1 
ATOM   4919 C CB    . GLN B 2 105 ? 3.958   26.484 14.772  1.00 158.82 ? 91  GLN B CB    1 
ATOM   4920 C CG    . GLN B 2 105 ? 4.491   27.106 13.488  1.00 155.81 ? 91  GLN B CG    1 
ATOM   4921 C CD    . GLN B 2 105 ? 5.570   26.268 12.825  1.00 147.57 ? 91  GLN B CD    1 
ATOM   4922 O OE1   . GLN B 2 105 ? 5.477   25.041 12.764  1.00 153.54 ? 91  GLN B OE1   1 
ATOM   4923 N NE2   . GLN B 2 105 ? 6.600   26.933 12.313  1.00 131.88 ? 91  GLN B NE2   1 
ATOM   4924 N N     . LEU B 2 106 ? 2.827   26.136 17.587  1.00 156.38 ? 92  LEU B N     1 
ATOM   4925 C CA    . LEU B 2 106 ? 2.271   25.348 18.687  1.00 156.56 ? 92  LEU B CA    1 
ATOM   4926 C C     . LEU B 2 106 ? 2.520   26.028 20.032  1.00 152.86 ? 92  LEU B C     1 
ATOM   4927 O O     . LEU B 2 106 ? 3.593   25.889 20.624  1.00 157.40 ? 92  LEU B O     1 
ATOM   4928 C CB    . LEU B 2 106 ? 2.844   23.923 18.683  1.00 165.72 ? 92  LEU B CB    1 
ATOM   4929 C CG    . LEU B 2 106 ? 2.463   22.975 17.540  1.00 159.53 ? 92  LEU B CG    1 
ATOM   4930 C CD1   . LEU B 2 106 ? 3.439   21.810 17.461  1.00 148.65 ? 92  LEU B CD1   1 
ATOM   4931 C CD2   . LEU B 2 106 ? 1.032   22.472 17.679  1.00 156.18 ? 92  LEU B CD2   1 
ATOM   4932 N N     . GLY B 2 107 ? 1.518   26.767 20.504  1.00 137.49 ? 93  GLY B N     1 
ATOM   4933 C CA    . GLY B 2 107 ? 1.617   27.511 21.757  1.00 148.93 ? 93  GLY B CA    1 
ATOM   4934 C C     . GLY B 2 107 ? 1.153   26.725 22.969  1.00 155.03 ? 93  GLY B C     1 
ATOM   4935 O O     . GLY B 2 107 ? 0.279   25.860 22.864  1.00 147.66 ? 93  GLY B O     1 
ATOM   4936 N N     . ILE B 2 108 ? 1.743   27.034 24.122  1.00 167.24 ? 94  ILE B N     1 
ATOM   4937 C CA    . ILE B 2 108 ? 1.396   26.379 25.382  1.00 166.32 ? 94  ILE B CA    1 
ATOM   4938 C C     . ILE B 2 108 ? 0.458   27.277 26.197  1.00 166.69 ? 94  ILE B C     1 
ATOM   4939 O O     . ILE B 2 108 ? 0.811   28.418 26.511  1.00 172.72 ? 94  ILE B O     1 
ATOM   4940 C CB    . ILE B 2 108 ? 2.653   26.028 26.215  1.00 160.91 ? 94  ILE B CB    1 
ATOM   4941 C CG1   . ILE B 2 108 ? 3.686   25.290 25.352  1.00 150.17 ? 94  ILE B CG1   1 
ATOM   4942 C CG2   . ILE B 2 108 ? 2.275   25.196 27.436  1.00 155.55 ? 94  ILE B CG2   1 
ATOM   4943 C CD1   . ILE B 2 108 ? 5.102   25.339 25.890  1.00 142.29 ? 94  ILE B CD1   1 
ATOM   4944 N N     . PRO B 2 109 ? -0.746  26.768 26.530  1.00 160.05 ? 95  PRO B N     1 
ATOM   4945 C CA    . PRO B 2 109 ? -1.722  27.522 27.322  1.00 149.77 ? 95  PRO B CA    1 
ATOM   4946 C C     . PRO B 2 109 ? -1.293  27.672 28.780  1.00 156.52 ? 95  PRO B C     1 
ATOM   4947 O O     . PRO B 2 109 ? -0.825  26.708 29.392  1.00 159.81 ? 95  PRO B O     1 
ATOM   4948 C CB    . PRO B 2 109 ? -2.996  26.667 27.229  1.00 136.31 ? 95  PRO B CB    1 
ATOM   4949 C CG    . PRO B 2 109 ? -2.765  25.719 26.099  1.00 140.80 ? 95  PRO B CG    1 
ATOM   4950 C CD    . PRO B 2 109 ? -1.290  25.469 26.098  1.00 150.08 ? 95  PRO B CD    1 
ATOM   4951 N N     . HIS B 2 110 ? -1.456  28.878 29.321  1.00 156.45 ? 96  HIS B N     1 
ATOM   4952 C CA    . HIS B 2 110 ? -1.089  29.172 30.705  1.00 155.25 ? 96  HIS B CA    1 
ATOM   4953 C C     . HIS B 2 110 ? -2.283  29.640 31.496  1.00 157.62 ? 96  HIS B C     1 
ATOM   4954 O O     . HIS B 2 110 ? -2.926  30.626 31.125  1.00 152.43 ? 96  HIS B O     1 
ATOM   4955 C CB    . HIS B 2 110 ? 0.033   30.206 30.752  1.00 146.67 ? 96  HIS B CB    1 
ATOM   4956 C CG    . HIS B 2 110 ? 0.524   30.514 32.148  1.00 149.74 ? 96  HIS B CG    1 
ATOM   4957 N ND1   . HIS B 2 110 ? 1.382   29.714 32.806  1.00 148.26 ? 96  HIS B ND1   1 
ATOM   4958 C CD2   . HIS B 2 110 ? 0.249   31.581 33.001  1.00 148.85 ? 96  HIS B CD2   1 
ATOM   4959 C CE1   . HIS B 2 110 ? 1.642   30.237 34.019  1.00 152.28 ? 96  HIS B CE1   1 
ATOM   4960 N NE2   . HIS B 2 110 ? 0.947   31.380 34.137  1.00 158.20 ? 96  HIS B NE2   1 
ATOM   4961 N N     . PRO B 2 111 ? -2.602  28.933 32.599  1.00 162.29 ? 97  PRO B N     1 
ATOM   4962 C CA    . PRO B 2 111 ? -3.743  29.290 33.445  1.00 160.59 ? 97  PRO B CA    1 
ATOM   4963 C C     . PRO B 2 111 ? -3.439  30.447 34.398  1.00 146.29 ? 97  PRO B C     1 
ATOM   4964 O O     . PRO B 2 111 ? -2.281  30.667 34.761  1.00 138.02 ? 97  PRO B O     1 
ATOM   4965 C CB    . PRO B 2 111 ? -4.005  28.006 34.233  1.00 161.33 ? 97  PRO B CB    1 
ATOM   4966 C CG    . PRO B 2 111 ? -2.674  27.344 34.322  1.00 154.82 ? 97  PRO B CG    1 
ATOM   4967 C CD    . PRO B 2 111 ? -1.919  27.714 33.076  1.00 159.05 ? 97  PRO B CD    1 
ATOM   4968 N N     . ALA B 2 112 ? -4.484  31.171 34.794  1.00 137.51 ? 98  ALA B N     1 
ATOM   4969 C CA    . ALA B 2 112 ? -4.353  32.304 35.708  1.00 135.04 ? 98  ALA B CA    1 
ATOM   4970 C C     . ALA B 2 112 ? -4.355  31.868 37.173  1.00 134.33 ? 98  ALA B C     1 
ATOM   4971 O O     . ALA B 2 112 ? -3.784  32.548 38.030  1.00 128.93 ? 98  ALA B O     1 
ATOM   4972 C CB    . ALA B 2 112 ? -5.458  33.320 35.453  1.00 141.65 ? 98  ALA B CB    1 
ATOM   4973 N N     . GLY B 2 113 ? -4.996  30.734 37.450  1.00 142.41 ? 99  GLY B N     1 
ATOM   4974 C CA    . GLY B 2 113 ? -5.093  30.201 38.809  1.00 151.67 ? 99  GLY B CA    1 
ATOM   4975 C C     . GLY B 2 113 ? -4.010  29.194 39.151  1.00 156.28 ? 99  GLY B C     1 
ATOM   4976 O O     . GLY B 2 113 ? -4.285  28.162 39.769  1.00 163.83 ? 99  GLY B O     1 
ATOM   4977 N N     . LEU B 2 114 ? -2.777  29.498 38.747  1.00 149.07 ? 100 LEU B N     1 
ATOM   4978 C CA    . LEU B 2 114 ? -1.623  28.650 39.039  1.00 146.97 ? 100 LEU B CA    1 
ATOM   4979 C C     . LEU B 2 114 ? -0.767  29.262 40.147  1.00 141.60 ? 100 LEU B C     1 
ATOM   4980 O O     . LEU B 2 114 ? -0.175  28.541 40.955  1.00 140.32 ? 100 LEU B O     1 
ATOM   4981 C CB    . LEU B 2 114 ? -0.784  28.431 37.773  1.00 145.89 ? 100 LEU B CB    1 
ATOM   4982 C CG    . LEU B 2 114 ? 0.317   27.364 37.785  1.00 144.50 ? 100 LEU B CG    1 
ATOM   4983 C CD1   . LEU B 2 114 ? -0.265  25.959 37.711  1.00 146.32 ? 100 LEU B CD1   1 
ATOM   4984 C CD2   . LEU B 2 114 ? 1.289   27.596 36.639  1.00 147.70 ? 100 LEU B CD2   1 
ATOM   4985 N N     . LYS B 2 115 ? -0.714  30.592 40.177  1.00 144.09 ? 101 LYS B N     1 
ATOM   4986 C CA    . LYS B 2 115 ? 0.061   31.333 41.175  1.00 148.24 ? 101 LYS B CA    1 
ATOM   4987 C C     . LYS B 2 115 ? -0.596  31.337 42.559  1.00 148.21 ? 101 LYS B C     1 
ATOM   4988 O O     . LYS B 2 115 ? 0.081   31.534 43.571  1.00 145.78 ? 101 LYS B O     1 
ATOM   4989 C CB    . LYS B 2 115 ? 0.326   32.769 40.701  1.00 157.21 ? 101 LYS B CB    1 
ATOM   4990 C CG    . LYS B 2 115 ? -0.920  33.576 40.361  1.00 155.11 ? 101 LYS B CG    1 
ATOM   4991 C CD    . LYS B 2 115 ? -0.563  34.977 39.888  1.00 157.66 ? 101 LYS B CD    1 
ATOM   4992 C CE    . LYS B 2 115 ? -1.801  35.776 39.510  1.00 147.83 ? 101 LYS B CE    1 
ATOM   4993 N NZ    . LYS B 2 115 ? -2.635  36.138 40.691  1.00 141.51 ? 101 LYS B NZ    1 
ATOM   4994 N N     . LYS B 2 116 ? -1.910  31.119 42.594  1.00 149.23 ? 102 LYS B N     1 
ATOM   4995 C CA    . LYS B 2 116 ? -2.664  31.088 43.846  1.00 151.32 ? 102 LYS B CA    1 
ATOM   4996 C C     . LYS B 2 116 ? -2.987  29.655 44.270  1.00 155.46 ? 102 LYS B C     1 
ATOM   4997 O O     . LYS B 2 116 ? -3.955  29.055 43.794  1.00 153.40 ? 102 LYS B O     1 
ATOM   4998 C CB    . LYS B 2 116 ? -3.944  31.925 43.733  1.00 150.41 ? 102 LYS B CB    1 
ATOM   4999 C CG    . LYS B 2 116 ? -3.707  33.425 43.641  1.00 146.74 ? 102 LYS B CG    1 
ATOM   5000 C CD    . LYS B 2 116 ? -5.018  34.186 43.534  1.00 149.22 ? 102 LYS B CD    1 
ATOM   5001 C CE    . LYS B 2 116 ? -4.780  35.685 43.444  1.00 146.62 ? 102 LYS B CE    1 
ATOM   5002 N NZ    . LYS B 2 116 ? -6.056  36.445 43.338  1.00 140.87 ? 102 LYS B NZ    1 
ATOM   5003 N N     . LYS B 2 117 ? -2.159  29.117 45.163  1.00 155.64 ? 103 LYS B N     1 
ATOM   5004 C CA    . LYS B 2 117 ? -2.321  27.758 45.681  1.00 144.64 ? 103 LYS B CA    1 
ATOM   5005 C C     . LYS B 2 117 ? -1.736  27.637 47.091  1.00 143.92 ? 103 LYS B C     1 
ATOM   5006 O O     . LYS B 2 117 ? -1.381  28.643 47.710  1.00 147.78 ? 103 LYS B O     1 
ATOM   5007 C CB    . LYS B 2 117 ? -1.667  26.743 44.737  1.00 139.87 ? 103 LYS B CB    1 
ATOM   5008 N N     . LYS B 2 118 ? -1.640  26.406 47.591  1.00 144.41 ? 104 LYS B N     1 
ATOM   5009 C CA    . LYS B 2 118 ? -1.071  26.145 48.914  1.00 151.98 ? 104 LYS B CA    1 
ATOM   5010 C C     . LYS B 2 118 ? 0.327   25.530 48.833  1.00 157.15 ? 104 LYS B C     1 
ATOM   5011 O O     . LYS B 2 118 ? 1.248   25.981 49.517  1.00 164.87 ? 104 LYS B O     1 
ATOM   5012 C CB    . LYS B 2 118 ? -2.001  25.255 49.745  1.00 151.41 ? 104 LYS B CB    1 
ATOM   5013 C CG    . LYS B 2 118 ? -3.257  25.954 50.242  1.00 146.02 ? 104 LYS B CG    1 
ATOM   5014 C CD    . LYS B 2 118 ? -4.057  25.058 51.172  1.00 137.97 ? 104 LYS B CD    1 
ATOM   5015 C CE    . LYS B 2 118 ? -5.313  25.756 51.668  1.00 137.16 ? 104 LYS B CE    1 
ATOM   5016 N NZ    . LYS B 2 118 ? -6.108  24.888 52.580  1.00 137.61 ? 104 LYS B NZ    1 
ATOM   5017 N N     . SER B 2 119 ? 0.475   24.502 47.998  1.00 154.33 ? 105 SER B N     1 
ATOM   5018 C CA    . SER B 2 119 ? 1.754   23.812 47.825  1.00 155.31 ? 105 SER B CA    1 
ATOM   5019 C C     . SER B 2 119 ? 1.990   23.406 46.372  1.00 154.92 ? 105 SER B C     1 
ATOM   5020 O O     . SER B 2 119 ? 1.096   22.868 45.714  1.00 155.57 ? 105 SER B O     1 
ATOM   5021 C CB    . SER B 2 119 ? 1.830   22.581 48.734  1.00 154.12 ? 105 SER B CB    1 
ATOM   5022 O OG    . SER B 2 119 ? 1.772   22.949 50.101  1.00 152.82 ? 105 SER B OG    1 
ATOM   5023 N N     . VAL B 2 120 ? 3.200   23.671 45.883  1.00 159.92 ? 106 VAL B N     1 
ATOM   5024 C CA    . VAL B 2 120 ? 3.592   23.319 44.517  1.00 161.48 ? 106 VAL B CA    1 
ATOM   5025 C C     . VAL B 2 120 ? 4.747   22.316 44.544  1.00 159.65 ? 106 VAL B C     1 
ATOM   5026 O O     . VAL B 2 120 ? 5.796   22.580 45.137  1.00 156.13 ? 106 VAL B O     1 
ATOM   5027 C CB    . VAL B 2 120 ? 3.983   24.568 43.687  1.00 160.10 ? 106 VAL B CB    1 
ATOM   5028 C CG1   . VAL B 2 120 ? 4.405   24.176 42.276  1.00 153.49 ? 106 VAL B CG1   1 
ATOM   5029 C CG2   . VAL B 2 120 ? 2.832   25.562 43.630  1.00 150.53 ? 106 VAL B CG2   1 
ATOM   5030 N N     . THR B 2 121 ? 4.538   21.168 43.904  1.00 160.53 ? 107 THR B N     1 
ATOM   5031 C CA    . THR B 2 121 ? 5.550   20.115 43.831  1.00 158.51 ? 107 THR B CA    1 
ATOM   5032 C C     . THR B 2 121 ? 6.191   20.086 42.443  1.00 155.09 ? 107 THR B C     1 
ATOM   5033 O O     . THR B 2 121 ? 5.492   20.091 41.425  1.00 156.54 ? 107 THR B O     1 
ATOM   5034 C CB    . THR B 2 121 ? 4.954   18.729 44.165  1.00 159.25 ? 107 THR B CB    1 
ATOM   5035 O OG1   . THR B 2 121 ? 4.091   18.836 45.305  1.00 159.97 ? 107 THR B OG1   1 
ATOM   5036 C CG2   . THR B 2 121 ? 6.057   17.718 44.465  1.00 157.59 ? 107 THR B CG2   1 
ATOM   5037 N N     . VAL B 2 122 ? 7.522   20.060 42.415  1.00 149.92 ? 108 VAL B N     1 
ATOM   5038 C CA    . VAL B 2 122 ? 8.280   20.059 41.163  1.00 144.65 ? 108 VAL B CA    1 
ATOM   5039 C C     . VAL B 2 122 ? 8.761   18.646 40.827  1.00 150.54 ? 108 VAL B C     1 
ATOM   5040 O O     . VAL B 2 122 ? 9.417   17.992 41.642  1.00 155.29 ? 108 VAL B O     1 
ATOM   5041 C CB    . VAL B 2 122 ? 9.483   21.032 41.220  1.00 140.87 ? 108 VAL B CB    1 
ATOM   5042 C CG1   . VAL B 2 122 ? 10.164  21.135 39.862  1.00 139.84 ? 108 VAL B CG1   1 
ATOM   5043 C CG2   . VAL B 2 122 ? 9.039   22.411 41.690  1.00 149.21 ? 108 VAL B CG2   1 
ATOM   5044 N N     . LEU B 2 123 ? 8.421   18.187 39.624  1.00 149.21 ? 109 LEU B N     1 
ATOM   5045 C CA    . LEU B 2 123 ? 8.826   16.866 39.143  1.00 149.62 ? 109 LEU B CA    1 
ATOM   5046 C C     . LEU B 2 123 ? 9.531   16.961 37.793  1.00 144.75 ? 109 LEU B C     1 
ATOM   5047 O O     . LEU B 2 123 ? 9.131   17.745 36.929  1.00 138.20 ? 109 LEU B O     1 
ATOM   5048 C CB    . LEU B 2 123 ? 7.615   15.932 39.036  1.00 150.05 ? 109 LEU B CB    1 
ATOM   5049 C CG    . LEU B 2 123 ? 6.884   15.514 40.318  1.00 144.51 ? 109 LEU B CG    1 
ATOM   5050 C CD1   . LEU B 2 123 ? 5.501   14.974 39.985  1.00 144.25 ? 109 LEU B CD1   1 
ATOM   5051 C CD2   . LEU B 2 123 ? 7.683   14.493 41.117  1.00 143.59 ? 109 LEU B CD2   1 
ATOM   5052 N N     . ASP B 2 124 ? 10.578  16.158 37.621  1.00 146.55 ? 110 ASP B N     1 
ATOM   5053 C CA    . ASP B 2 124 ? 11.348  16.138 36.379  1.00 146.92 ? 110 ASP B CA    1 
ATOM   5054 C C     . ASP B 2 124 ? 10.724  15.183 35.363  1.00 147.97 ? 110 ASP B C     1 
ATOM   5055 O O     . ASP B 2 124 ? 10.556  13.992 35.636  1.00 140.56 ? 110 ASP B O     1 
ATOM   5056 C CB    . ASP B 2 124 ? 12.807  15.752 36.657  1.00 150.57 ? 110 ASP B CB    1 
ATOM   5057 C CG    . ASP B 2 124 ? 13.701  15.907 35.435  1.00 150.68 ? 110 ASP B CG    1 
ATOM   5058 O OD1   . ASP B 2 124 ? 13.625  16.956 34.758  1.00 145.83 ? 110 ASP B OD1   1 
ATOM   5059 O OD2   . ASP B 2 124 ? 14.483  14.975 35.152  1.00 155.84 ? 110 ASP B OD2   1 
ATOM   5060 N N     . VAL B 2 125 ? 10.378  15.721 34.195  1.00 140.87 ? 111 VAL B N     1 
ATOM   5061 C CA    . VAL B 2 125 ? 9.783   14.931 33.110  1.00 145.64 ? 111 VAL B CA    1 
ATOM   5062 C C     . VAL B 2 125 ? 10.623  14.979 31.827  1.00 135.69 ? 111 VAL B C     1 
ATOM   5063 O O     . VAL B 2 125 ? 10.129  14.681 30.736  1.00 135.88 ? 111 VAL B O     1 
ATOM   5064 C CB    . VAL B 2 125 ? 8.317   15.347 32.817  1.00 160.26 ? 111 VAL B CB    1 
ATOM   5065 C CG1   . VAL B 2 125 ? 7.390   14.883 33.933  1.00 170.48 ? 111 VAL B CG1   1 
ATOM   5066 C CG2   . VAL B 2 125 ? 8.198   16.851 32.598  1.00 143.67 ? 111 VAL B CG2   1 
ATOM   5067 N N     . GLY B 2 126 ? 11.895  15.345 31.975  1.00 139.27 ? 112 GLY B N     1 
ATOM   5068 C CA    . GLY B 2 126 ? 12.816  15.476 30.846  1.00 148.69 ? 112 GLY B CA    1 
ATOM   5069 C C     . GLY B 2 126 ? 13.271  14.159 30.240  1.00 149.36 ? 112 GLY B C     1 
ATOM   5070 O O     . GLY B 2 126 ? 13.759  14.128 29.108  1.00 148.81 ? 112 GLY B O     1 
ATOM   5071 N N     . ASP B 2 127 ? 13.110  13.074 30.995  1.00 150.61 ? 113 ASP B N     1 
ATOM   5072 C CA    . ASP B 2 127 ? 13.505  11.737 30.546  1.00 150.55 ? 113 ASP B CA    1 
ATOM   5073 C C     . ASP B 2 127 ? 12.517  11.136 29.542  1.00 143.17 ? 113 ASP B C     1 
ATOM   5074 O O     . ASP B 2 127 ? 12.853  10.190 28.824  1.00 142.40 ? 113 ASP B O     1 
ATOM   5075 C CB    . ASP B 2 127 ? 13.676  10.798 31.746  1.00 156.00 ? 113 ASP B CB    1 
ATOM   5076 C CG    . ASP B 2 127 ? 14.823  11.209 32.657  1.00 154.77 ? 113 ASP B CG    1 
ATOM   5077 O OD1   . ASP B 2 127 ? 14.902  12.400 33.032  1.00 155.20 ? 113 ASP B OD1   1 
ATOM   5078 O OD2   . ASP B 2 127 ? 15.648  10.337 33.001  1.00 153.89 ? 113 ASP B OD2   1 
ATOM   5079 N N     . ALA B 2 128 ? 11.308  11.692 29.496  1.00 138.34 ? 114 ALA B N     1 
ATOM   5080 C CA    . ALA B 2 128 ? 10.247  11.205 28.612  1.00 148.68 ? 114 ALA B CA    1 
ATOM   5081 C C     . ALA B 2 128 ? 10.441  11.620 27.151  1.00 144.04 ? 114 ALA B C     1 
ATOM   5082 O O     . ALA B 2 128 ? 9.866   11.010 26.246  1.00 152.79 ? 114 ALA B O     1 
ATOM   5083 C CB    . ALA B 2 128 ? 8.887   11.663 29.120  1.00 154.97 ? 114 ALA B CB    1 
ATOM   5084 N N     . TYR B 2 129 ? 11.253  12.653 26.931  1.00 128.91 ? 115 TYR B N     1 
ATOM   5085 C CA    . TYR B 2 129 ? 11.485  13.205 25.593  1.00 141.16 ? 115 TYR B CA    1 
ATOM   5086 C C     . TYR B 2 129 ? 12.415  12.349 24.727  1.00 141.74 ? 115 TYR B C     1 
ATOM   5087 O O     . TYR B 2 129 ? 12.501  12.552 23.513  1.00 148.56 ? 115 TYR B O     1 
ATOM   5088 C CB    . TYR B 2 129 ? 12.021  14.638 25.691  1.00 141.29 ? 115 TYR B CB    1 
ATOM   5089 C CG    . TYR B 2 129 ? 11.035  15.627 26.278  1.00 154.75 ? 115 TYR B CG    1 
ATOM   5090 C CD1   . TYR B 2 129 ? 10.105  16.278 25.467  1.00 158.31 ? 115 TYR B CD1   1 
ATOM   5091 C CD2   . TYR B 2 129 ? 11.034  15.914 27.643  1.00 151.86 ? 115 TYR B CD2   1 
ATOM   5092 C CE1   . TYR B 2 129 ? 9.201   17.184 26.000  1.00 158.07 ? 115 TYR B CE1   1 
ATOM   5093 C CE2   . TYR B 2 129 ? 10.133  16.818 28.184  1.00 153.70 ? 115 TYR B CE2   1 
ATOM   5094 C CZ    . TYR B 2 129 ? 9.220   17.450 27.359  1.00 155.39 ? 115 TYR B CZ    1 
ATOM   5095 O OH    . TYR B 2 129 ? 8.324   18.349 27.893  1.00 153.33 ? 115 TYR B OH    1 
ATOM   5096 N N     . PHE B 2 130 ? 13.100  11.391 25.351  1.00 139.81 ? 116 PHE B N     1 
ATOM   5097 C CA    . PHE B 2 130 ? 14.042  10.515 24.650  1.00 152.32 ? 116 PHE B CA    1 
ATOM   5098 C C     . PHE B 2 130 ? 13.357  9.430  23.812  1.00 151.27 ? 116 PHE B C     1 
ATOM   5099 O O     . PHE B 2 130 ? 14.026  8.663  23.114  1.00 157.15 ? 116 PHE B O     1 
ATOM   5100 C CB    . PHE B 2 130 ? 15.026  9.881  25.643  1.00 157.50 ? 116 PHE B CB    1 
ATOM   5101 C CG    . PHE B 2 130 ? 15.964  10.867 26.284  1.00 157.70 ? 116 PHE B CG    1 
ATOM   5102 C CD1   . PHE B 2 130 ? 17.144  11.241 25.648  1.00 150.93 ? 116 PHE B CD1   1 
ATOM   5103 C CD2   . PHE B 2 130 ? 15.673  11.418 27.528  1.00 156.42 ? 116 PHE B CD2   1 
ATOM   5104 C CE1   . PHE B 2 130 ? 18.012  12.149 26.237  1.00 147.28 ? 116 PHE B CE1   1 
ATOM   5105 C CE2   . PHE B 2 130 ? 16.537  12.326 28.122  1.00 153.46 ? 116 PHE B CE2   1 
ATOM   5106 C CZ    . PHE B 2 130 ? 17.708  12.691 27.476  1.00 145.10 ? 116 PHE B CZ    1 
ATOM   5107 N N     . SER B 2 131 ? 12.028  9.374  23.881  1.00 138.09 ? 117 SER B N     1 
ATOM   5108 C CA    . SER B 2 131 ? 11.245  8.387  23.136  1.00 130.19 ? 117 SER B CA    1 
ATOM   5109 C C     . SER B 2 131 ? 10.891  8.865  21.726  1.00 126.13 ? 117 SER B C     1 
ATOM   5110 O O     . SER B 2 131 ? 11.002  8.103  20.762  1.00 125.05 ? 117 SER B O     1 
ATOM   5111 C CB    . SER B 2 131 ? 9.974   8.016  23.907  1.00 143.82 ? 117 SER B CB    1 
ATOM   5112 O OG    . SER B 2 131 ? 9.161   9.155  24.135  1.00 151.45 ? 117 SER B OG    1 
ATOM   5113 N N     . VAL B 2 132 ? 10.467  10.123 21.616  1.00 131.56 ? 118 VAL B N     1 
ATOM   5114 C CA    . VAL B 2 132 ? 10.063  10.708 20.336  1.00 139.79 ? 118 VAL B CA    1 
ATOM   5115 C C     . VAL B 2 132 ? 11.292  11.139 19.527  1.00 141.00 ? 118 VAL B C     1 
ATOM   5116 O O     . VAL B 2 132 ? 12.097  11.943 20.005  1.00 149.13 ? 118 VAL B O     1 
ATOM   5117 C CB    . VAL B 2 132 ? 9.098   11.904 20.532  1.00 143.08 ? 118 VAL B CB    1 
ATOM   5118 C CG1   . VAL B 2 132 ? 8.638   12.461 19.191  1.00 154.30 ? 118 VAL B CG1   1 
ATOM   5119 C CG2   . VAL B 2 132 ? 7.895   11.494 21.371  1.00 155.93 ? 118 VAL B CG2   1 
ATOM   5120 N N     . PRO B 2 133 ? 11.441  10.597 18.300  1.00 137.80 ? 119 PRO B N     1 
ATOM   5121 C CA    . PRO B 2 133 ? 12.576  10.928 17.431  1.00 141.20 ? 119 PRO B CA    1 
ATOM   5122 C C     . PRO B 2 133 ? 12.497  12.339 16.844  1.00 143.56 ? 119 PRO B C     1 
ATOM   5123 O O     . PRO B 2 133 ? 11.411  12.917 16.754  1.00 150.63 ? 119 PRO B O     1 
ATOM   5124 C CB    . PRO B 2 133 ? 12.477  9.883  16.315  1.00 141.41 ? 119 PRO B CB    1 
ATOM   5125 C CG    . PRO B 2 133 ? 11.034  9.518  16.268  1.00 148.52 ? 119 PRO B CG    1 
ATOM   5126 C CD    . PRO B 2 133 ? 10.562  9.580  17.692  1.00 147.53 ? 119 PRO B CD    1 
ATOM   5127 N N     . LEU B 2 134 ? 13.651  12.873 16.450  1.00 139.99 ? 120 LEU B N     1 
ATOM   5128 C CA    . LEU B 2 134 ? 13.749  14.209 15.864  1.00 133.41 ? 120 LEU B CA    1 
ATOM   5129 C C     . LEU B 2 134 ? 13.780  14.132 14.335  1.00 133.17 ? 120 LEU B C     1 
ATOM   5130 O O     . LEU B 2 134 ? 14.095  13.084 13.765  1.00 134.44 ? 120 LEU B O     1 
ATOM   5131 C CB    . LEU B 2 134 ? 14.999  14.926 16.394  1.00 138.85 ? 120 LEU B CB    1 
ATOM   5132 C CG    . LEU B 2 134 ? 15.117  16.450 16.273  1.00 148.38 ? 120 LEU B CG    1 
ATOM   5133 C CD1   . LEU B 2 134 ? 14.196  17.163 17.255  1.00 146.35 ? 120 LEU B CD1   1 
ATOM   5134 C CD2   . LEU B 2 134 ? 16.558  16.887 16.486  1.00 158.27 ? 120 LEU B CD2   1 
ATOM   5135 N N     . ASP B 2 135 ? 13.446  15.246 13.683  1.00 128.13 ? 121 ASP B N     1 
ATOM   5136 C CA    . ASP B 2 135 ? 13.442  15.345 12.222  1.00 133.24 ? 121 ASP B CA    1 
ATOM   5137 C C     . ASP B 2 135 ? 14.846  15.174 11.639  1.00 132.23 ? 121 ASP B C     1 
ATOM   5138 O O     . ASP B 2 135 ? 15.832  15.607 12.240  1.00 135.63 ? 121 ASP B O     1 
ATOM   5139 C CB    . ASP B 2 135 ? 12.845  16.688 11.783  1.00 140.68 ? 121 ASP B CB    1 
ATOM   5140 C CG    . ASP B 2 135 ? 12.572  16.753 10.287  1.00 145.90 ? 121 ASP B CG    1 
ATOM   5141 O OD1   . ASP B 2 135 ? 11.986  15.796 9.736   1.00 144.85 ? 121 ASP B OD1   1 
ATOM   5142 O OD2   . ASP B 2 135 ? 12.936  17.772 9.663   1.00 147.84 ? 121 ASP B OD2   1 
ATOM   5143 N N     . GLU B 2 136 ? 14.918  14.542 10.468  1.00 130.47 ? 122 GLU B N     1 
ATOM   5144 C CA    . GLU B 2 136 ? 16.185  14.229 9.800   1.00 126.64 ? 122 GLU B CA    1 
ATOM   5145 C C     . GLU B 2 136 ? 16.993  15.475 9.427   1.00 134.25 ? 122 GLU B C     1 
ATOM   5146 O O     . GLU B 2 136 ? 18.218  15.491 9.568   1.00 140.83 ? 122 GLU B O     1 
ATOM   5147 C CB    . GLU B 2 136 ? 15.929  13.367 8.556   1.00 138.16 ? 122 GLU B CB    1 
ATOM   5148 C CG    . GLU B 2 136 ? 17.168  12.695 7.972   1.00 146.31 ? 122 GLU B CG    1 
ATOM   5149 C CD    . GLU B 2 136 ? 17.701  11.563 8.834   1.00 153.36 ? 122 GLU B CD    1 
ATOM   5150 O OE1   . GLU B 2 136 ? 16.894  10.740 9.319   1.00 159.43 ? 122 GLU B OE1   1 
ATOM   5151 O OE2   . GLU B 2 136 ? 18.934  11.490 9.019   1.00 152.36 ? 122 GLU B OE2   1 
ATOM   5152 N N     . ASP B 2 137 ? 16.300  16.510 8.957   1.00 132.92 ? 123 ASP B N     1 
ATOM   5153 C CA    . ASP B 2 137 ? 16.941  17.762 8.550   1.00 142.72 ? 123 ASP B CA    1 
ATOM   5154 C C     . ASP B 2 137 ? 17.387  18.610 9.742   1.00 144.76 ? 123 ASP B C     1 
ATOM   5155 O O     . ASP B 2 137 ? 18.317  19.411 9.625   1.00 149.82 ? 123 ASP B O     1 
ATOM   5156 C CB    . ASP B 2 137 ? 16.008  18.574 7.645   1.00 151.93 ? 123 ASP B CB    1 
ATOM   5157 C CG    . ASP B 2 137 ? 15.736  17.890 6.313   1.00 157.16 ? 123 ASP B CG    1 
ATOM   5158 O OD1   . ASP B 2 137 ? 16.697  17.412 5.670   1.00 140.82 ? 123 ASP B OD1   1 
ATOM   5159 O OD2   . ASP B 2 137 ? 14.556  17.830 5.909   1.00 171.20 ? 123 ASP B OD2   1 
ATOM   5160 N N     . PHE B 2 138 ? 16.723  18.425 10.882  1.00 147.84 ? 124 PHE B N     1 
ATOM   5161 C CA    . PHE B 2 138 ? 17.004  19.205 12.088  1.00 148.02 ? 124 PHE B CA    1 
ATOM   5162 C C     . PHE B 2 138 ? 18.114  18.591 12.947  1.00 147.84 ? 124 PHE B C     1 
ATOM   5163 O O     . PHE B 2 138 ? 18.624  19.236 13.867  1.00 147.15 ? 124 PHE B O     1 
ATOM   5164 C CB    . PHE B 2 138 ? 15.723  19.392 12.911  1.00 152.89 ? 124 PHE B CB    1 
ATOM   5165 C CG    . PHE B 2 138 ? 15.750  20.591 13.819  1.00 151.88 ? 124 PHE B CG    1 
ATOM   5166 C CD1   . PHE B 2 138 ? 15.505  21.866 13.317  1.00 151.38 ? 124 PHE B CD1   1 
ATOM   5167 C CD2   . PHE B 2 138 ? 16.012  20.447 15.178  1.00 148.61 ? 124 PHE B CD2   1 
ATOM   5168 C CE1   . PHE B 2 138 ? 15.528  22.974 14.151  1.00 148.80 ? 124 PHE B CE1   1 
ATOM   5169 C CE2   . PHE B 2 138 ? 16.037  21.551 16.017  1.00 140.31 ? 124 PHE B CE2   1 
ATOM   5170 C CZ    . PHE B 2 138 ? 15.795  22.816 15.503  1.00 143.31 ? 124 PHE B CZ    1 
ATOM   5171 N N     . ARG B 2 139 ? 18.490  17.351 12.632  1.00 150.69 ? 125 ARG B N     1 
ATOM   5172 C CA    . ARG B 2 139 ? 19.526  16.620 13.372  1.00 148.77 ? 125 ARG B CA    1 
ATOM   5173 C C     . ARG B 2 139 ? 20.901  17.291 13.337  1.00 138.73 ? 125 ARG B C     1 
ATOM   5174 O O     . ARG B 2 139 ? 21.664  17.199 14.301  1.00 138.70 ? 125 ARG B O     1 
ATOM   5175 C CB    . ARG B 2 139 ? 19.643  15.180 12.859  1.00 150.23 ? 125 ARG B CB    1 
ATOM   5176 C CG    . ARG B 2 139 ? 18.610  14.220 13.426  1.00 141.27 ? 125 ARG B CG    1 
ATOM   5177 C CD    . ARG B 2 139 ? 18.905  12.788 13.009  1.00 137.61 ? 125 ARG B CD    1 
ATOM   5178 N NE    . ARG B 2 139 ? 18.060  11.824 13.713  1.00 137.11 ? 125 ARG B NE    1 
ATOM   5179 C CZ    . ARG B 2 139 ? 16.957  11.271 13.212  1.00 139.28 ? 125 ARG B CZ    1 
ATOM   5180 N NH1   . ARG B 2 139 ? 16.544  11.574 11.987  1.00 137.57 ? 125 ARG B NH1   1 
ATOM   5181 N NH2   . ARG B 2 139 ? 16.264  10.406 13.940  1.00 148.86 ? 125 ARG B NH2   1 
ATOM   5182 N N     . LYS B 2 140 ? 21.205  17.962 12.228  1.00 133.04 ? 126 LYS B N     1 
ATOM   5183 C CA    . LYS B 2 140 ? 22.503  18.614 12.034  1.00 129.56 ? 126 LYS B CA    1 
ATOM   5184 C C     . LYS B 2 140 ? 22.683  19.895 12.859  1.00 129.02 ? 126 LYS B C     1 
ATOM   5185 O O     . LYS B 2 140 ? 23.813  20.315 13.120  1.00 141.92 ? 126 LYS B O     1 
ATOM   5186 C CB    . LYS B 2 140 ? 22.757  18.890 10.543  1.00 134.65 ? 126 LYS B CB    1 
ATOM   5187 C CG    . LYS B 2 140 ? 21.718  19.770 9.861   1.00 140.07 ? 126 LYS B CG    1 
ATOM   5188 C CD    . LYS B 2 140 ? 22.050  19.974 8.392   1.00 144.88 ? 126 LYS B CD    1 
ATOM   5189 C CE    . LYS B 2 140 ? 21.006  20.837 7.703   1.00 146.66 ? 126 LYS B CE    1 
ATOM   5190 N NZ    . LYS B 2 140 ? 21.321  21.046 6.262   1.00 142.02 ? 126 LYS B NZ    1 
ATOM   5191 N N     . TYR B 2 141 ? 21.571  20.503 13.267  1.00 128.99 ? 127 TYR B N     1 
ATOM   5192 C CA    . TYR B 2 141 ? 21.600  21.757 14.024  1.00 139.63 ? 127 TYR B CA    1 
ATOM   5193 C C     . TYR B 2 141 ? 21.834  21.554 15.523  1.00 136.43 ? 127 TYR B C     1 
ATOM   5194 O O     . TYR B 2 141 ? 22.191  22.498 16.233  1.00 145.29 ? 127 TYR B O     1 
ATOM   5195 C CB    . TYR B 2 141 ? 20.313  22.556 13.793  1.00 145.43 ? 127 TYR B CB    1 
ATOM   5196 C CG    . TYR B 2 141 ? 20.073  22.942 12.348  1.00 149.36 ? 127 TYR B CG    1 
ATOM   5197 C CD1   . TYR B 2 141 ? 20.754  24.013 11.768  1.00 149.69 ? 127 TYR B CD1   1 
ATOM   5198 C CD2   . TYR B 2 141 ? 19.160  22.239 11.563  1.00 150.91 ? 127 TYR B CD2   1 
ATOM   5199 C CE1   . TYR B 2 141 ? 20.536  24.368 10.446  1.00 153.37 ? 127 TYR B CE1   1 
ATOM   5200 C CE2   . TYR B 2 141 ? 18.934  22.588 10.240  1.00 152.80 ? 127 TYR B CE2   1 
ATOM   5201 C CZ    . TYR B 2 141 ? 19.624  23.652 9.687   1.00 155.36 ? 127 TYR B CZ    1 
ATOM   5202 O OH    . TYR B 2 141 ? 19.404  24.002 8.374   1.00 162.76 ? 127 TYR B OH    1 
ATOM   5203 N N     . THR B 2 142 ? 21.638  20.324 15.994  1.00 126.05 ? 128 THR B N     1 
ATOM   5204 C CA    . THR B 2 142 ? 21.787  19.993 17.414  1.00 130.56 ? 128 THR B CA    1 
ATOM   5205 C C     . THR B 2 142 ? 23.147  19.361 17.739  1.00 146.30 ? 128 THR B C     1 
ATOM   5206 O O     . THR B 2 142 ? 23.292  18.657 18.743  1.00 159.24 ? 128 THR B O     1 
ATOM   5207 C CB    . THR B 2 142 ? 20.648  19.069 17.904  1.00 138.32 ? 128 THR B CB    1 
ATOM   5208 O OG1   . THR B 2 142 ? 20.537  17.936 17.034  1.00 132.84 ? 128 THR B OG1   1 
ATOM   5209 C CG2   . THR B 2 142 ? 19.319  19.816 17.936  1.00 158.48 ? 128 THR B CG2   1 
ATOM   5210 N N     . ALA B 2 143 ? 24.138  19.625 16.890  1.00 150.58 ? 129 ALA B N     1 
ATOM   5211 C CA    . ALA B 2 143 ? 25.488  19.091 17.071  1.00 156.93 ? 129 ALA B CA    1 
ATOM   5212 C C     . ALA B 2 143 ? 26.266  19.866 18.133  1.00 150.68 ? 129 ALA B C     1 
ATOM   5213 O O     . ALA B 2 143 ? 26.197  21.097 18.190  1.00 141.31 ? 129 ALA B O     1 
ATOM   5214 C CB    . ALA B 2 143 ? 26.241  19.092 15.749  1.00 153.23 ? 129 ALA B CB    1 
ATOM   5215 N N     . PHE B 2 144 ? 27.004  19.136 18.967  1.00 157.71 ? 130 PHE B N     1 
ATOM   5216 C CA    . PHE B 2 144 ? 27.793  19.736 20.045  1.00 157.15 ? 130 PHE B CA    1 
ATOM   5217 C C     . PHE B 2 144 ? 29.196  19.136 20.154  1.00 160.25 ? 130 PHE B C     1 
ATOM   5218 O O     . PHE B 2 144 ? 29.397  17.951 19.878  1.00 156.56 ? 130 PHE B O     1 
ATOM   5219 C CB    . PHE B 2 144 ? 27.050  19.644 21.389  1.00 143.59 ? 130 PHE B CB    1 
ATOM   5220 C CG    . PHE B 2 144 ? 26.755  18.236 21.838  1.00 129.87 ? 130 PHE B CG    1 
ATOM   5221 C CD1   . PHE B 2 144 ? 25.589  17.590 21.434  1.00 134.52 ? 130 PHE B CD1   1 
ATOM   5222 C CD2   . PHE B 2 144 ? 27.632  17.563 22.685  1.00 134.19 ? 130 PHE B CD2   1 
ATOM   5223 C CE1   . PHE B 2 144 ? 25.313  16.297 21.852  1.00 137.71 ? 130 PHE B CE1   1 
ATOM   5224 C CE2   . PHE B 2 144 ? 27.360  16.269 23.105  1.00 137.11 ? 130 PHE B CE2   1 
ATOM   5225 C CZ    . PHE B 2 144 ? 26.199  15.636 22.690  1.00 135.41 ? 130 PHE B CZ    1 
ATOM   5226 N N     . THR B 2 145 ? 30.155  19.966 20.561  1.00 155.94 ? 131 THR B N     1 
ATOM   5227 C CA    . THR B 2 145 ? 31.549  19.548 20.706  1.00 136.28 ? 131 THR B CA    1 
ATOM   5228 C C     . THR B 2 145 ? 31.933  19.436 22.182  1.00 133.39 ? 131 THR B C     1 
ATOM   5229 O O     . THR B 2 145 ? 31.585  20.300 22.991  1.00 142.21 ? 131 THR B O     1 
ATOM   5230 C CB    . THR B 2 145 ? 32.513  20.527 19.997  1.00 137.06 ? 131 THR B CB    1 
ATOM   5231 O OG1   . THR B 2 145 ? 31.956  20.933 18.741  1.00 130.29 ? 131 THR B OG1   1 
ATOM   5232 C CG2   . THR B 2 145 ? 33.873  19.877 19.755  1.00 152.28 ? 131 THR B CG2   1 
ATOM   5233 N N     . ILE B 2 146 ? 32.646  18.364 22.521  1.00 127.62 ? 132 ILE B N     1 
ATOM   5234 C CA    . ILE B 2 146 ? 33.121  18.136 23.886  1.00 138.18 ? 132 ILE B CA    1 
ATOM   5235 C C     . ILE B 2 146 ? 34.550  18.672 24.039  1.00 151.62 ? 132 ILE B C     1 
ATOM   5236 O O     . ILE B 2 146 ? 35.442  18.277 23.282  1.00 149.61 ? 132 ILE B O     1 
ATOM   5237 C CB    . ILE B 2 146 ? 33.064  16.637 24.270  1.00 133.77 ? 132 ILE B CB    1 
ATOM   5238 C CG1   . ILE B 2 146 ? 31.662  16.067 24.015  1.00 141.06 ? 132 ILE B CG1   1 
ATOM   5239 C CG2   . ILE B 2 146 ? 33.469  16.435 25.727  1.00 142.48 ? 132 ILE B CG2   1 
ATOM   5240 C CD1   . ILE B 2 146 ? 31.610  14.557 23.898  1.00 147.04 ? 132 ILE B CD1   1 
ATOM   5241 N N     . PRO B 2 147 ? 34.767  19.582 25.011  1.00 157.90 ? 133 PRO B N     1 
ATOM   5242 C CA    . PRO B 2 147 ? 36.098  20.140 25.276  1.00 156.94 ? 133 PRO B CA    1 
ATOM   5243 C C     . PRO B 2 147 ? 37.072  19.104 25.837  1.00 146.13 ? 133 PRO B C     1 
ATOM   5244 O O     . PRO B 2 147 ? 36.649  18.139 26.479  1.00 135.23 ? 133 PRO B O     1 
ATOM   5245 C CB    . PRO B 2 147 ? 35.824  21.230 26.319  1.00 160.02 ? 133 PRO B CB    1 
ATOM   5246 C CG    . PRO B 2 147 ? 34.547  20.823 26.971  1.00 152.02 ? 133 PRO B CG    1 
ATOM   5247 C CD    . PRO B 2 147 ? 33.739  20.184 25.882  1.00 160.88 ? 133 PRO B CD    1 
ATOM   5248 N N     . SER B 2 148 ? 38.364  19.314 25.593  1.00 152.74 ? 134 SER B N     1 
ATOM   5249 C CA    . SER B 2 148 ? 39.404  18.379 26.023  1.00 150.46 ? 134 SER B CA    1 
ATOM   5250 C C     . SER B 2 148 ? 40.556  19.079 26.746  1.00 140.14 ? 134 SER B C     1 
ATOM   5251 O O     . SER B 2 148 ? 40.719  20.297 26.643  1.00 130.95 ? 134 SER B O     1 
ATOM   5252 C CB    . SER B 2 148 ? 39.935  17.587 24.825  1.00 149.93 ? 134 SER B CB    1 
ATOM   5253 O OG    . SER B 2 148 ? 40.477  18.449 23.838  1.00 153.06 ? 134 SER B OG    1 
ATOM   5254 N N     . ILE B 2 149 ? 41.350  18.294 27.475  1.00 134.04 ? 135 ILE B N     1 
ATOM   5255 C CA    . ILE B 2 149 ? 42.501  18.808 28.218  1.00 137.79 ? 135 ILE B CA    1 
ATOM   5256 C C     . ILE B 2 149 ? 43.663  19.092 27.266  1.00 143.30 ? 135 ILE B C     1 
ATOM   5257 O O     . ILE B 2 149 ? 44.136  18.193 26.565  1.00 142.74 ? 135 ILE B O     1 
ATOM   5258 C CB    . ILE B 2 149 ? 42.959  17.836 29.336  1.00 148.95 ? 135 ILE B CB    1 
ATOM   5259 C CG1   . ILE B 2 149 ? 41.796  17.454 30.261  1.00 140.92 ? 135 ILE B CG1   1 
ATOM   5260 C CG2   . ILE B 2 149 ? 44.091  18.442 30.156  1.00 155.61 ? 135 ILE B CG2   1 
ATOM   5261 C CD1   . ILE B 2 149 ? 41.136  16.133 29.923  1.00 140.25 ? 135 ILE B CD1   1 
ATOM   5262 N N     . ASN B 2 150 ? 44.102  20.352 27.248  1.00 148.40 ? 136 ASN B N     1 
ATOM   5263 C CA    . ASN B 2 150 ? 45.220  20.824 26.414  1.00 148.15 ? 136 ASN B CA    1 
ATOM   5264 C C     . ASN B 2 150 ? 45.043  20.581 24.906  1.00 150.40 ? 136 ASN B C     1 
ATOM   5265 O O     . ASN B 2 150 ? 46.018  20.581 24.147  1.00 153.17 ? 136 ASN B O     1 
ATOM   5266 C CB    . ASN B 2 150 ? 46.558  20.255 26.919  1.00 144.85 ? 136 ASN B CB    1 
ATOM   5267 C CG    . ASN B 2 150 ? 47.742  21.153 26.594  1.00 137.88 ? 136 ASN B CG    1 
ATOM   5268 O OD1   . ASN B 2 150 ? 47.594  22.362 26.406  1.00 124.38 ? 136 ASN B OD1   1 
ATOM   5269 N ND2   . ASN B 2 150 ? 48.929  20.561 26.536  1.00 150.62 ? 136 ASN B ND2   1 
ATOM   5270 N N     . ASN B 2 151 ? 43.790  20.389 24.490  1.00 144.09 ? 137 ASN B N     1 
ATOM   5271 C CA    . ASN B 2 151 ? 43.424  20.112 23.093  1.00 140.04 ? 137 ASN B CA    1 
ATOM   5272 C C     . ASN B 2 151 ? 44.185  18.937 22.461  1.00 137.58 ? 137 ASN B C     1 
ATOM   5273 O O     . ASN B 2 151 ? 44.687  19.040 21.338  1.00 141.03 ? 137 ASN B O     1 
ATOM   5274 C CB    . ASN B 2 151 ? 43.543  21.378 22.233  1.00 138.65 ? 137 ASN B CB    1 
ATOM   5275 N N     . GLU B 2 152 ? 44.259  17.827 23.194  1.00 130.77 ? 138 GLU B N     1 
ATOM   5276 C CA    . GLU B 2 152 ? 44.934  16.618 22.718  1.00 137.47 ? 138 GLU B CA    1 
ATOM   5277 C C     . GLU B 2 152 ? 44.116  15.908 21.640  1.00 142.74 ? 138 GLU B C     1 
ATOM   5278 O O     . GLU B 2 152 ? 44.655  15.501 20.609  1.00 149.06 ? 138 GLU B O     1 
ATOM   5279 C CB    . GLU B 2 152 ? 45.231  15.663 23.881  1.00 143.63 ? 138 GLU B CB    1 
ATOM   5280 C CG    . GLU B 2 152 ? 46.281  16.165 24.866  1.00 151.89 ? 138 GLU B CG    1 
ATOM   5281 C CD    . GLU B 2 152 ? 47.676  16.239 24.268  1.00 155.24 ? 138 GLU B CD    1 
ATOM   5282 O OE1   . GLU B 2 152 ? 48.134  15.238 23.676  1.00 152.21 ? 138 GLU B OE1   1 
ATOM   5283 O OE2   . GLU B 2 152 ? 48.320  17.301 24.400  1.00 159.71 ? 138 GLU B OE2   1 
ATOM   5284 N N     . THR B 2 153 ? 42.816  15.764 21.891  1.00 139.62 ? 139 THR B N     1 
ATOM   5285 C CA    . THR B 2 153 ? 41.889  15.188 20.919  1.00 136.80 ? 139 THR B CA    1 
ATOM   5286 C C     . THR B 2 153 ? 41.212  16.300 20.113  1.00 141.84 ? 139 THR B C     1 
ATOM   5287 O O     . THR B 2 153 ? 40.896  17.356 20.669  1.00 154.40 ? 139 THR B O     1 
ATOM   5288 C CB    . THR B 2 153 ? 40.815  14.310 21.597  1.00 136.41 ? 139 THR B CB    1 
ATOM   5289 O OG1   . THR B 2 153 ? 40.177  15.049 22.647  1.00 138.51 ? 139 THR B OG1   1 
ATOM   5290 C CG2   . THR B 2 153 ? 41.435  13.042 22.174  1.00 139.17 ? 139 THR B CG2   1 
ATOM   5291 N N     . PRO B 2 154 ? 40.994  16.070 18.800  1.00 131.69 ? 140 PRO B N     1 
ATOM   5292 C CA    . PRO B 2 154 ? 40.352  17.058 17.922  1.00 140.49 ? 140 PRO B CA    1 
ATOM   5293 C C     . PRO B 2 154 ? 38.953  17.475 18.381  1.00 142.13 ? 140 PRO B C     1 
ATOM   5294 O O     . PRO B 2 154 ? 38.540  18.611 18.140  1.00 133.32 ? 140 PRO B O     1 
ATOM   5295 C CB    . PRO B 2 154 ? 40.268  16.328 16.577  1.00 142.05 ? 140 PRO B CB    1 
ATOM   5296 C CG    . PRO B 2 154 ? 41.376  15.335 16.621  1.00 136.18 ? 140 PRO B CG    1 
ATOM   5297 C CD    . PRO B 2 154 ? 41.426  14.876 18.048  1.00 127.77 ? 140 PRO B CD    1 
ATOM   5298 N N     . GLY B 2 155 ? 38.239  16.560 19.035  1.00 147.57 ? 141 GLY B N     1 
ATOM   5299 C CA    . GLY B 2 155 ? 36.901  16.834 19.549  1.00 153.85 ? 141 GLY B CA    1 
ATOM   5300 C C     . GLY B 2 155 ? 35.874  15.848 19.033  1.00 152.46 ? 141 GLY B C     1 
ATOM   5301 O O     . GLY B 2 155 ? 35.582  15.813 17.835  1.00 156.24 ? 141 GLY B O     1 
ATOM   5302 N N     . ILE B 2 156 ? 35.327  15.044 19.943  1.00 137.81 ? 142 ILE B N     1 
ATOM   5303 C CA    . ILE B 2 156 ? 34.315  14.047 19.596  1.00 129.16 ? 142 ILE B CA    1 
ATOM   5304 C C     . ILE B 2 156 ? 32.960  14.731 19.409  1.00 134.57 ? 142 ILE B C     1 
ATOM   5305 O O     . ILE B 2 156 ? 32.490  15.453 20.292  1.00 128.58 ? 142 ILE B O     1 
ATOM   5306 C CB    . ILE B 2 156 ? 34.208  12.930 20.660  1.00 138.45 ? 142 ILE B CB    1 
ATOM   5307 C CG1   . ILE B 2 156 ? 35.596  12.545 21.189  1.00 145.37 ? 142 ILE B CG1   1 
ATOM   5308 C CG2   . ILE B 2 156 ? 33.495  11.714 20.081  1.00 149.13 ? 142 ILE B CG2   1 
ATOM   5309 C CD1   . ILE B 2 156 ? 35.584  11.855 22.538  1.00 152.91 ? 142 ILE B CD1   1 
ATOM   5310 N N     . ARG B 2 157 ? 32.346  14.497 18.252  1.00 147.31 ? 143 ARG B N     1 
ATOM   5311 C CA    . ARG B 2 157 ? 31.099  15.164 17.877  1.00 154.92 ? 143 ARG B CA    1 
ATOM   5312 C C     . ARG B 2 157 ? 29.894  14.229 17.951  1.00 151.32 ? 143 ARG B C     1 
ATOM   5313 O O     . ARG B 2 157 ? 29.977  13.062 17.561  1.00 153.19 ? 143 ARG B O     1 
ATOM   5314 C CB    . ARG B 2 157 ? 31.216  15.759 16.469  1.00 153.21 ? 143 ARG B CB    1 
ATOM   5315 C CG    . ARG B 2 157 ? 32.210  16.906 16.339  1.00 149.54 ? 143 ARG B CG    1 
ATOM   5316 C CD    . ARG B 2 157 ? 31.582  18.251 16.677  1.00 146.56 ? 143 ARG B CD    1 
ATOM   5317 N NE    . ARG B 2 157 ? 30.735  18.752 15.595  1.00 154.50 ? 143 ARG B NE    1 
ATOM   5318 C CZ    . ARG B 2 157 ? 30.072  19.906 15.622  1.00 158.11 ? 143 ARG B CZ    1 
ATOM   5319 N NH1   . ARG B 2 157 ? 30.144  20.703 16.681  1.00 150.32 ? 143 ARG B NH1   1 
ATOM   5320 N NH2   . ARG B 2 157 ? 29.332  20.266 14.583  1.00 151.22 ? 143 ARG B NH2   1 
ATOM   5321 N N     . TYR B 2 158 ? 28.780  14.755 18.455  1.00 138.55 ? 144 TYR B N     1 
ATOM   5322 C CA    . TYR B 2 158 ? 27.523  14.010 18.539  1.00 134.06 ? 144 TYR B CA    1 
ATOM   5323 C C     . TYR B 2 158 ? 26.330  14.883 18.157  1.00 133.57 ? 144 TYR B C     1 
ATOM   5324 O O     . TYR B 2 158 ? 26.292  16.073 18.479  1.00 134.18 ? 144 TYR B O     1 
ATOM   5325 C CB    . TYR B 2 158 ? 27.311  13.450 19.950  1.00 137.44 ? 144 TYR B CB    1 
ATOM   5326 C CG    . TYR B 2 158 ? 28.336  12.428 20.391  1.00 135.47 ? 144 TYR B CG    1 
ATOM   5327 C CD1   . TYR B 2 158 ? 28.308  11.122 19.900  1.00 141.54 ? 144 TYR B CD1   1 
ATOM   5328 C CD2   . TYR B 2 158 ? 29.325  12.763 21.315  1.00 141.71 ? 144 TYR B CD2   1 
ATOM   5329 C CE1   . TYR B 2 158 ? 29.243  10.183 20.308  1.00 145.90 ? 144 TYR B CE1   1 
ATOM   5330 C CE2   . TYR B 2 158 ? 30.263  11.830 21.731  1.00 142.50 ? 144 TYR B CE2   1 
ATOM   5331 C CZ    . TYR B 2 158 ? 30.218  10.543 21.224  1.00 142.44 ? 144 TYR B CZ    1 
ATOM   5332 O OH    . TYR B 2 158 ? 31.148  9.615  21.633  1.00 148.42 ? 144 TYR B OH    1 
ATOM   5333 N N     . GLN B 2 159 ? 25.360  14.279 17.472  1.00 148.87 ? 145 GLN B N     1 
ATOM   5334 C CA    . GLN B 2 159 ? 24.113  14.959 17.119  1.00 160.47 ? 145 GLN B CA    1 
ATOM   5335 C C     . GLN B 2 159 ? 22.904  14.260 17.742  1.00 149.44 ? 145 GLN B C     1 
ATOM   5336 O O     . GLN B 2 159 ? 22.887  13.035 17.878  1.00 149.73 ? 145 GLN B O     1 
ATOM   5337 C CB    . GLN B 2 159 ? 23.951  15.070 15.595  1.00 152.56 ? 145 GLN B CB    1 
ATOM   5338 C CG    . GLN B 2 159 ? 23.883  13.744 14.847  1.00 140.58 ? 145 GLN B CG    1 
ATOM   5339 C CD    . GLN B 2 159 ? 23.329  13.881 13.439  1.00 139.92 ? 145 GLN B CD    1 
ATOM   5340 O OE1   . GLN B 2 159 ? 23.496  14.912 12.785  1.00 140.83 ? 145 GLN B OE1   1 
ATOM   5341 N NE2   . GLN B 2 159 ? 22.669  12.832 12.962  1.00 132.94 ? 145 GLN B NE2   1 
ATOM   5342 N N     . TYR B 2 160 ? 21.899  15.048 18.119  1.00 137.72 ? 146 TYR B N     1 
ATOM   5343 C CA    . TYR B 2 160 ? 20.686  14.516 18.740  1.00 132.05 ? 146 TYR B CA    1 
ATOM   5344 C C     . TYR B 2 160 ? 19.764  13.840 17.729  1.00 139.49 ? 146 TYR B C     1 
ATOM   5345 O O     . TYR B 2 160 ? 19.350  14.454 16.742  1.00 135.55 ? 146 TYR B O     1 
ATOM   5346 C CB    . TYR B 2 160 ? 19.930  15.618 19.490  1.00 140.03 ? 146 TYR B CB    1 
ATOM   5347 C CG    . TYR B 2 160 ? 20.433  15.871 20.895  1.00 141.52 ? 146 TYR B CG    1 
ATOM   5348 C CD1   . TYR B 2 160 ? 19.965  15.113 21.969  1.00 141.55 ? 146 TYR B CD1   1 
ATOM   5349 C CD2   . TYR B 2 160 ? 21.371  16.870 21.152  1.00 146.26 ? 146 TYR B CD2   1 
ATOM   5350 C CE1   . TYR B 2 160 ? 20.419  15.340 23.259  1.00 141.24 ? 146 TYR B CE1   1 
ATOM   5351 C CE2   . TYR B 2 160 ? 21.831  17.105 22.440  1.00 157.62 ? 146 TYR B CE2   1 
ATOM   5352 C CZ    . TYR B 2 160 ? 21.351  16.336 23.488  1.00 153.62 ? 146 TYR B CZ    1 
ATOM   5353 O OH    . TYR B 2 160 ? 21.802  16.563 24.768  1.00 160.75 ? 146 TYR B OH    1 
ATOM   5354 N N     . ASN B 2 161 ? 19.457  12.571 17.985  1.00 143.44 ? 147 ASN B N     1 
ATOM   5355 C CA    . ASN B 2 161 ? 18.518  11.808 17.163  1.00 144.92 ? 147 ASN B CA    1 
ATOM   5356 C C     . ASN B 2 161 ? 17.087  11.918 17.685  1.00 142.00 ? 147 ASN B C     1 
ATOM   5357 O O     . ASN B 2 161 ? 16.127  11.743 16.931  1.00 143.80 ? 147 ASN B O     1 
ATOM   5358 C CB    . ASN B 2 161 ? 18.941  10.337 17.080  1.00 154.82 ? 147 ASN B CB    1 
ATOM   5359 C CG    . ASN B 2 161 ? 20.278  10.148 16.383  1.00 160.70 ? 147 ASN B CG    1 
ATOM   5360 O OD1   . ASN B 2 161 ? 20.564  10.784 15.367  1.00 168.62 ? 147 ASN B OD1   1 
ATOM   5361 N ND2   . ASN B 2 161 ? 21.103  9.259  16.925  1.00 156.98 ? 147 ASN B ND2   1 
ATOM   5362 N N     . VAL B 2 162 ? 16.961  12.205 18.979  1.00 141.23 ? 148 VAL B N     1 
ATOM   5363 C CA    . VAL B 2 162 ? 15.663  12.410 19.626  1.00 141.32 ? 148 VAL B CA    1 
ATOM   5364 C C     . VAL B 2 162 ? 15.541  13.843 20.156  1.00 137.07 ? 148 VAL B C     1 
ATOM   5365 O O     . VAL B 2 162 ? 16.393  14.688 19.867  1.00 143.82 ? 148 VAL B O     1 
ATOM   5366 C CB    . VAL B 2 162 ? 15.410  11.382 20.759  1.00 145.65 ? 148 VAL B CB    1 
ATOM   5367 C CG1   . VAL B 2 162 ? 15.147  10.000 20.179  1.00 151.63 ? 148 VAL B CG1   1 
ATOM   5368 C CG2   . VAL B 2 162 ? 16.573  11.347 21.745  1.00 134.06 ? 148 VAL B CG2   1 
ATOM   5369 N N     . LEU B 2 163 ? 14.482  14.111 20.920  1.00 136.66 ? 149 LEU B N     1 
ATOM   5370 C CA    . LEU B 2 163 ? 14.254  15.436 21.500  1.00 137.06 ? 149 LEU B CA    1 
ATOM   5371 C C     . LEU B 2 163 ? 15.255  15.739 22.619  1.00 144.68 ? 149 LEU B C     1 
ATOM   5372 O O     . LEU B 2 163 ? 15.316  15.009 23.612  1.00 150.45 ? 149 LEU B O     1 
ATOM   5373 C CB    . LEU B 2 163 ? 12.815  15.570 22.016  1.00 136.22 ? 149 LEU B CB    1 
ATOM   5374 C CG    . LEU B 2 163 ? 11.656  15.501 21.013  1.00 147.88 ? 149 LEU B CG    1 
ATOM   5375 C CD1   . LEU B 2 163 ? 10.332  15.340 21.744  1.00 153.58 ? 149 LEU B CD1   1 
ATOM   5376 C CD2   . LEU B 2 163 ? 11.621  16.721 20.102  1.00 152.41 ? 149 LEU B CD2   1 
ATOM   5377 N N     . PRO B 2 164 ? 16.048  16.816 22.455  1.00 144.38 ? 150 PRO B N     1 
ATOM   5378 C CA    . PRO B 2 164 ? 17.083  17.183 23.422  1.00 140.73 ? 150 PRO B CA    1 
ATOM   5379 C C     . PRO B 2 164 ? 16.517  17.872 24.662  1.00 133.40 ? 150 PRO B C     1 
ATOM   5380 O O     . PRO B 2 164 ? 15.438  18.468 24.605  1.00 131.78 ? 150 PRO B O     1 
ATOM   5381 C CB    . PRO B 2 164 ? 17.974  18.164 22.640  1.00 150.29 ? 150 PRO B CB    1 
ATOM   5382 C CG    . PRO B 2 164 ? 17.459  18.178 21.234  1.00 156.36 ? 150 PRO B CG    1 
ATOM   5383 C CD    . PRO B 2 164 ? 16.031  17.744 21.313  1.00 145.08 ? 150 PRO B CD    1 
ATOM   5384 N N     . GLN B 2 165 ? 17.251  17.783 25.769  1.00 128.12 ? 151 GLN B N     1 
ATOM   5385 C CA    . GLN B 2 165 ? 16.865  18.433 27.019  1.00 125.97 ? 151 GLN B CA    1 
ATOM   5386 C C     . GLN B 2 165 ? 17.358  19.877 27.049  1.00 134.14 ? 151 GLN B C     1 
ATOM   5387 O O     . GLN B 2 165 ? 18.550  20.140 26.871  1.00 154.76 ? 151 GLN B O     1 
ATOM   5388 C CB    . GLN B 2 165 ? 17.412  17.660 28.224  1.00 131.40 ? 151 GLN B CB    1 
ATOM   5389 C CG    . GLN B 2 165 ? 16.767  16.299 28.448  1.00 134.19 ? 151 GLN B CG    1 
ATOM   5390 C CD    . GLN B 2 165 ? 17.372  15.541 29.617  1.00 131.24 ? 151 GLN B CD    1 
ATOM   5391 O OE1   . GLN B 2 165 ? 18.588  15.541 29.816  1.00 138.08 ? 151 GLN B OE1   1 
ATOM   5392 N NE2   . GLN B 2 165 ? 16.521  14.880 30.393  1.00 129.47 ? 151 GLN B NE2   1 
ATOM   5393 N N     . GLY B 2 166 ? 16.431  20.806 27.272  1.00 129.68 ? 152 GLY B N     1 
ATOM   5394 C CA    . GLY B 2 166 ? 16.751  22.232 27.320  1.00 133.98 ? 152 GLY B CA    1 
ATOM   5395 C C     . GLY B 2 166 ? 16.296  23.008 26.097  1.00 140.13 ? 152 GLY B C     1 
ATOM   5396 O O     . GLY B 2 166 ? 16.575  24.203 25.975  1.00 141.84 ? 152 GLY B O     1 
ATOM   5397 N N     . TRP B 2 167 ? 15.595  22.327 25.191  1.00 139.52 ? 153 TRP B N     1 
ATOM   5398 C CA    . TRP B 2 167 ? 15.071  22.949 23.977  1.00 143.10 ? 153 TRP B CA    1 
ATOM   5399 C C     . TRP B 2 167 ? 13.589  23.176 24.087  1.00 150.94 ? 153 TRP B C     1 
ATOM   5400 O O     . TRP B 2 167 ? 12.847  22.296 24.532  1.00 158.91 ? 153 TRP B O     1 
ATOM   5401 C CB    . TRP B 2 167 ? 15.407  22.098 22.752  1.00 138.11 ? 153 TRP B CB    1 
ATOM   5402 C CG    . TRP B 2 167 ? 14.960  22.692 21.434  1.00 137.55 ? 153 TRP B CG    1 
ATOM   5403 C CD1   . TRP B 2 167 ? 15.188  23.982 20.958  1.00 146.97 ? 153 TRP B CD1   1 
ATOM   5404 C CD2   . TRP B 2 167 ? 14.205  22.022 20.362  1.00 128.47 ? 153 TRP B CD2   1 
ATOM   5405 N NE1   . TRP B 2 167 ? 14.634  24.153 19.715  1.00 146.56 ? 153 TRP B NE1   1 
ATOM   5406 C CE2   . TRP B 2 167 ? 14.032  23.019 19.297  1.00 133.39 ? 153 TRP B CE2   1 
ATOM   5407 C CE3   . TRP B 2 167 ? 13.673  20.748 20.186  1.00 137.03 ? 153 TRP B CE3   1 
ATOM   5408 C CZ2   . TRP B 2 167 ? 13.352  22.729 18.122  1.00 136.64 ? 153 TRP B CZ2   1 
ATOM   5409 C CZ3   . TRP B 2 167 ? 12.990  20.468 18.995  1.00 143.04 ? 153 TRP B CZ3   1 
ATOM   5410 C CH2   . TRP B 2 167 ? 12.835  21.436 17.990  1.00 133.93 ? 153 TRP B CH2   1 
ATOM   5411 N N     . LYS B 2 168 ? 13.148  24.365 23.678  1.00 148.08 ? 154 LYS B N     1 
ATOM   5412 C CA    . LYS B 2 168 ? 11.744  24.771 23.804  1.00 145.69 ? 154 LYS B CA    1 
ATOM   5413 C C     . LYS B 2 168 ? 10.824  24.156 22.742  1.00 144.02 ? 154 LYS B C     1 
ATOM   5414 O O     . LYS B 2 168 ? 9.599   24.258 22.842  1.00 147.34 ? 154 LYS B O     1 
ATOM   5415 C CB    . LYS B 2 168 ? 11.619  26.303 23.817  1.00 144.28 ? 154 LYS B CB    1 
ATOM   5416 C CG    . LYS B 2 168 ? 12.015  26.997 22.518  1.00 144.13 ? 154 LYS B CG    1 
ATOM   5417 C CD    . LYS B 2 168 ? 12.067  28.512 22.674  1.00 149.89 ? 154 LYS B CD    1 
ATOM   5418 C CE    . LYS B 2 168 ? 10.681  29.140 22.701  1.00 142.47 ? 154 LYS B CE    1 
ATOM   5419 N NZ    . LYS B 2 168 ? 10.744  30.619 22.854  1.00 133.25 ? 154 LYS B NZ    1 
ATOM   5420 N N     . GLY B 2 169 ? 11.419  23.522 21.734  1.00 145.58 ? 155 GLY B N     1 
ATOM   5421 C CA    . GLY B 2 169 ? 10.662  22.854 20.677  1.00 144.94 ? 155 GLY B CA    1 
ATOM   5422 C C     . GLY B 2 169 ? 10.256  21.433 21.025  1.00 140.80 ? 155 GLY B C     1 
ATOM   5423 O O     . GLY B 2 169 ? 9.414   20.839 20.346  1.00 138.33 ? 155 GLY B O     1 
ATOM   5424 N N     . SER B 2 170 ? 10.858  20.889 22.081  1.00 144.52 ? 156 SER B N     1 
ATOM   5425 C CA    . SER B 2 170 ? 10.573  19.526 22.539  1.00 141.83 ? 156 SER B CA    1 
ATOM   5426 C C     . SER B 2 170 ? 9.188   19.358 23.189  1.00 137.21 ? 156 SER B C     1 
ATOM   5427 O O     . SER B 2 170 ? 8.497   18.379 22.896  1.00 146.37 ? 156 SER B O     1 
ATOM   5428 C CB    . SER B 2 170 ? 11.676  19.020 23.478  1.00 149.78 ? 156 SER B CB    1 
ATOM   5429 O OG    . SER B 2 170 ? 12.922  18.938 22.808  1.00 157.59 ? 156 SER B OG    1 
ATOM   5430 N N     . PRO B 2 171 ? 8.778   20.299 24.072  1.00 131.16 ? 157 PRO B N     1 
ATOM   5431 C CA    . PRO B 2 171 ? 7.445   20.190 24.678  1.00 143.60 ? 157 PRO B CA    1 
ATOM   5432 C C     . PRO B 2 171 ? 6.305   20.488 23.704  1.00 151.98 ? 157 PRO B C     1 
ATOM   5433 O O     . PRO B 2 171 ? 5.178   20.046 23.931  1.00 153.81 ? 157 PRO B O     1 
ATOM   5434 C CB    . PRO B 2 171 ? 7.466   21.249 25.790  1.00 142.88 ? 157 PRO B CB    1 
ATOM   5435 C CG    . PRO B 2 171 ? 8.903   21.584 25.997  1.00 136.31 ? 157 PRO B CG    1 
ATOM   5436 C CD    . PRO B 2 171 ? 9.534   21.424 24.652  1.00 137.43 ? 157 PRO B CD    1 
ATOM   5437 N N     . ALA B 2 172 ? 6.601   21.233 22.639  1.00 150.18 ? 158 ALA B N     1 
ATOM   5438 C CA    . ALA B 2 172 ? 5.604   21.599 21.630  1.00 146.37 ? 158 ALA B CA    1 
ATOM   5439 C C     . ALA B 2 172 ? 5.123   20.392 20.823  1.00 142.52 ? 158 ALA B C     1 
ATOM   5440 O O     . ALA B 2 172 ? 3.934   20.278 20.516  1.00 139.11 ? 158 ALA B O     1 
ATOM   5441 C CB    . ALA B 2 172 ? 6.155   22.675 20.705  1.00 145.87 ? 158 ALA B CB    1 
ATOM   5442 N N     . ILE B 2 173 ? 6.053   19.500 20.487  1.00 141.68 ? 159 ILE B N     1 
ATOM   5443 C CA    . ILE B 2 173 ? 5.739   18.274 19.750  1.00 146.39 ? 159 ILE B CA    1 
ATOM   5444 C C     . ILE B 2 173 ? 5.128   17.229 20.689  1.00 144.56 ? 159 ILE B C     1 
ATOM   5445 O O     . ILE B 2 173 ? 4.201   16.508 20.310  1.00 149.17 ? 159 ILE B O     1 
ATOM   5446 C CB    . ILE B 2 173 ? 6.991   17.699 19.042  1.00 146.97 ? 159 ILE B CB    1 
ATOM   5447 C CG1   . ILE B 2 173 ? 7.653   18.772 18.166  1.00 149.34 ? 159 ILE B CG1   1 
ATOM   5448 C CG2   . ILE B 2 173 ? 6.630   16.475 18.206  1.00 142.67 ? 159 ILE B CG2   1 
ATOM   5449 C CD1   . ILE B 2 173 ? 9.096   18.486 17.804  1.00 149.54 ? 159 ILE B CD1   1 
ATOM   5450 N N     . PHE B 2 174 ? 5.645   17.171 21.915  1.00 144.90 ? 160 PHE B N     1 
ATOM   5451 C CA    . PHE B 2 174 ? 5.186   16.215 22.924  1.00 137.11 ? 160 PHE B CA    1 
ATOM   5452 C C     . PHE B 2 174 ? 3.835   16.605 23.533  1.00 132.50 ? 160 PHE B C     1 
ATOM   5453 O O     . PHE B 2 174 ? 3.196   15.794 24.208  1.00 128.95 ? 160 PHE B O     1 
ATOM   5454 C CB    . PHE B 2 174 ? 6.248   16.061 24.022  1.00 143.13 ? 160 PHE B CB    1 
ATOM   5455 C CG    . PHE B 2 174 ? 6.140   14.780 24.803  1.00 132.13 ? 160 PHE B CG    1 
ATOM   5456 C CD1   . PHE B 2 174 ? 6.618   13.583 24.276  1.00 140.91 ? 160 PHE B CD1   1 
ATOM   5457 C CD2   . PHE B 2 174 ? 5.575   14.770 26.075  1.00 134.74 ? 160 PHE B CD2   1 
ATOM   5458 C CE1   . PHE B 2 174 ? 6.523   12.401 24.996  1.00 150.02 ? 160 PHE B CE1   1 
ATOM   5459 C CE2   . PHE B 2 174 ? 5.477   13.591 26.799  1.00 138.73 ? 160 PHE B CE2   1 
ATOM   5460 C CZ    . PHE B 2 174 ? 5.952   12.405 26.260  1.00 143.83 ? 160 PHE B CZ    1 
ATOM   5461 N N     . GLN B 2 175 ? 3.404   17.841 23.276  1.00 134.00 ? 161 GLN B N     1 
ATOM   5462 C CA    . GLN B 2 175 ? 2.144   18.381 23.803  1.00 133.19 ? 161 GLN B CA    1 
ATOM   5463 C C     . GLN B 2 175 ? 0.918   17.565 23.385  1.00 140.84 ? 161 GLN B C     1 
ATOM   5464 O O     . GLN B 2 175 ? -0.036  17.432 24.156  1.00 145.07 ? 161 GLN B O     1 
ATOM   5465 C CB    . GLN B 2 175 ? 1.972   19.843 23.373  1.00 135.35 ? 161 GLN B CB    1 
ATOM   5466 C CG    . GLN B 2 175 ? 0.967   20.634 24.201  1.00 136.09 ? 161 GLN B CG    1 
ATOM   5467 C CD    . GLN B 2 175 ? 0.826   22.076 23.746  1.00 141.64 ? 161 GLN B CD    1 
ATOM   5468 O OE1   . GLN B 2 175 ? -0.283  22.553 23.500  1.00 138.29 ? 161 GLN B OE1   1 
ATOM   5469 N NE2   . GLN B 2 175 ? 1.949   22.779 23.630  1.00 149.34 ? 161 GLN B NE2   1 
ATOM   5470 N N     . SER B 2 176 ? 0.953   17.024 22.168  1.00 140.63 ? 162 SER B N     1 
ATOM   5471 C CA    . SER B 2 176 ? -0.134  16.198 21.639  1.00 142.67 ? 162 SER B CA    1 
ATOM   5472 C C     . SER B 2 176 ? -0.271  14.871 22.390  1.00 147.63 ? 162 SER B C     1 
ATOM   5473 O O     . SER B 2 176 ? -1.370  14.322 22.496  1.00 143.74 ? 162 SER B O     1 
ATOM   5474 C CB    . SER B 2 176 ? 0.071   15.939 20.144  1.00 135.66 ? 162 SER B CB    1 
ATOM   5475 O OG    . SER B 2 176 ? -1.030  15.240 19.587  1.00 142.84 ? 162 SER B OG    1 
ATOM   5476 N N     . SER B 2 177 ? 0.849   14.368 22.905  1.00 145.01 ? 163 SER B N     1 
ATOM   5477 C CA    . SER B 2 177 ? 0.872   13.120 23.665  1.00 149.14 ? 163 SER B CA    1 
ATOM   5478 C C     . SER B 2 177 ? 0.714   13.356 25.168  1.00 146.39 ? 163 SER B C     1 
ATOM   5479 O O     . SER B 2 177 ? 0.213   12.487 25.886  1.00 138.87 ? 163 SER B O     1 
ATOM   5480 C CB    . SER B 2 177 ? 2.166   12.349 23.386  1.00 152.71 ? 163 SER B CB    1 
ATOM   5481 O OG    . SER B 2 177 ? 2.156   11.081 24.021  1.00 153.19 ? 163 SER B OG    1 
ATOM   5482 N N     . MET B 2 178 ? 1.140   14.530 25.632  1.00 147.64 ? 164 MET B N     1 
ATOM   5483 C CA    . MET B 2 178 ? 1.087   14.887 27.052  1.00 149.75 ? 164 MET B CA    1 
ATOM   5484 C C     . MET B 2 178 ? -0.339  15.179 27.525  1.00 153.10 ? 164 MET B C     1 
ATOM   5485 O O     . MET B 2 178 ? -0.689  14.889 28.671  1.00 151.50 ? 164 MET B O     1 
ATOM   5486 C CB    . MET B 2 178 ? 2.001   16.085 27.338  1.00 141.95 ? 164 MET B CB    1 
ATOM   5487 C CG    . MET B 2 178 ? 2.342   16.293 28.808  1.00 138.49 ? 164 MET B CG    1 
ATOM   5488 S SD    . MET B 2 178 ? 3.407   15.005 29.488  1.00 132.30 ? 164 MET B SD    1 
ATOM   5489 C CE    . MET B 2 178 ? 3.559   15.551 31.187  1.00 136.62 ? 164 MET B CE    1 
ATOM   5490 N N     . THR B 2 179 ? -1.151  15.754 26.638  1.00 145.08 ? 165 THR B N     1 
ATOM   5491 C CA    . THR B 2 179 ? -2.548  16.073 26.941  1.00 137.82 ? 165 THR B CA    1 
ATOM   5492 C C     . THR B 2 179 ? -3.398  14.801 27.033  1.00 144.97 ? 165 THR B C     1 
ATOM   5493 O O     . THR B 2 179 ? -4.356  14.740 27.808  1.00 145.78 ? 165 THR B O     1 
ATOM   5494 C CB    . THR B 2 179 ? -3.151  17.033 25.890  1.00 144.32 ? 165 THR B CB    1 
ATOM   5495 O OG1   . THR B 2 179 ? -2.207  18.066 25.580  1.00 148.88 ? 165 THR B OG1   1 
ATOM   5496 C CG2   . THR B 2 179 ? -4.437  17.674 26.407  1.00 150.31 ? 165 THR B CG2   1 
ATOM   5497 N N     . LYS B 2 180 ? -3.030  13.791 26.246  1.00 149.19 ? 166 LYS B N     1 
ATOM   5498 C CA    . LYS B 2 180 ? -3.747  12.516 26.211  1.00 154.89 ? 166 LYS B CA    1 
ATOM   5499 C C     . LYS B 2 180 ? -3.536  11.679 27.474  1.00 156.41 ? 166 LYS B C     1 
ATOM   5500 O O     . LYS B 2 180 ? -4.466  11.023 27.948  1.00 160.31 ? 166 LYS B O     1 
ATOM   5501 C CB    . LYS B 2 180 ? -3.343  11.710 24.973  1.00 147.19 ? 166 LYS B CB    1 
ATOM   5502 N N     . ILE B 2 181 ? -2.317  11.707 28.012  1.00 147.25 ? 167 ILE B N     1 
ATOM   5503 C CA    . ILE B 2 181 ? -1.976  10.922 29.206  1.00 143.70 ? 167 ILE B CA    1 
ATOM   5504 C C     . ILE B 2 181 ? -2.408  11.590 30.515  1.00 149.02 ? 167 ILE B C     1 
ATOM   5505 O O     . ILE B 2 181 ? -2.608  10.916 31.528  1.00 150.60 ? 167 ILE B O     1 
ATOM   5506 C CB    . ILE B 2 181 ? -0.475  10.522 29.250  1.00 128.51 ? 167 ILE B CB    1 
ATOM   5507 C CG1   . ILE B 2 181 ? 0.448   11.745 29.154  1.00 132.77 ? 167 ILE B CG1   1 
ATOM   5508 C CG2   . ILE B 2 181 ? -0.151  9.523  28.148  1.00 136.03 ? 167 ILE B CG2   1 
ATOM   5509 C CD1   . ILE B 2 181 ? 0.992   12.223 30.484  1.00 143.25 ? 167 ILE B CD1   1 
ATOM   5510 N N     . LEU B 2 182 ? -2.549  12.915 30.479  1.00 151.53 ? 168 LEU B N     1 
ATOM   5511 C CA    . LEU B 2 182 ? -3.011  13.691 31.632  1.00 151.67 ? 168 LEU B CA    1 
ATOM   5512 C C     . LEU B 2 182 ? -4.529  13.892 31.624  1.00 146.27 ? 168 LEU B C     1 
ATOM   5513 O O     . LEU B 2 182 ? -5.083  14.528 32.525  1.00 138.78 ? 168 LEU B O     1 
ATOM   5514 C CB    . LEU B 2 182 ? -2.297  15.049 31.690  1.00 152.57 ? 168 LEU B CB    1 
ATOM   5515 C CG    . LEU B 2 182 ? -0.834  15.091 32.147  1.00 166.44 ? 168 LEU B CG    1 
ATOM   5516 C CD1   . LEU B 2 182 ? -0.175  16.391 31.710  1.00 162.51 ? 168 LEU B CD1   1 
ATOM   5517 C CD2   . LEU B 2 182 ? -0.709  14.905 33.653  1.00 165.60 ? 168 LEU B CD2   1 
ATOM   5518 N N     . GLU B 2 183 ? -5.190  13.342 30.605  1.00 150.99 ? 169 GLU B N     1 
ATOM   5519 C CA    . GLU B 2 183 ? -6.645  13.437 30.457  1.00 146.18 ? 169 GLU B CA    1 
ATOM   5520 C C     . GLU B 2 183 ? -7.420  12.704 31.569  1.00 137.50 ? 169 GLU B C     1 
ATOM   5521 O O     . GLU B 2 183 ? -8.397  13.251 32.086  1.00 134.60 ? 169 GLU B O     1 
ATOM   5522 C CB    . GLU B 2 183 ? -7.082  12.958 29.063  1.00 144.75 ? 169 GLU B CB    1 
ATOM   5523 C CG    . GLU B 2 183 ? -8.442  13.472 28.602  1.00 145.68 ? 169 GLU B CG    1 
ATOM   5524 C CD    . GLU B 2 183 ? -9.609  12.653 29.127  1.00 154.47 ? 169 GLU B CD    1 
ATOM   5525 O OE1   . GLU B 2 183 ? -9.517  11.406 29.138  1.00 163.13 ? 169 GLU B OE1   1 
ATOM   5526 O OE2   . GLU B 2 183 ? -10.623 13.259 29.532  1.00 155.16 ? 169 GLU B OE2   1 
ATOM   5527 N N     . PRO B 2 184 ? -6.996  11.472 31.938  1.00 136.78 ? 170 PRO B N     1 
ATOM   5528 C CA    . PRO B 2 184 ? -7.670  10.813 33.065  1.00 144.47 ? 170 PRO B CA    1 
ATOM   5529 C C     . PRO B 2 184 ? -7.304  11.415 34.424  1.00 146.15 ? 170 PRO B C     1 
ATOM   5530 O O     . PRO B 2 184 ? -8.062  11.268 35.386  1.00 144.19 ? 170 PRO B O     1 
ATOM   5531 C CB    . PRO B 2 184 ? -7.176  9.365  32.973  1.00 143.73 ? 170 PRO B CB    1 
ATOM   5532 C CG    . PRO B 2 184 ? -5.862  9.456  32.280  1.00 143.44 ? 170 PRO B CG    1 
ATOM   5533 C CD    . PRO B 2 184 ? -6.012  10.578 31.295  1.00 140.77 ? 170 PRO B CD    1 
ATOM   5534 N N     . PHE B 2 185 ? -6.152  12.081 34.494  1.00 148.91 ? 171 PHE B N     1 
ATOM   5535 C CA    . PHE B 2 185 ? -5.698  12.739 35.718  1.00 147.62 ? 171 PHE B CA    1 
ATOM   5536 C C     . PHE B 2 185 ? -6.453  14.043 35.972  1.00 142.61 ? 171 PHE B C     1 
ATOM   5537 O O     . PHE B 2 185 ? -6.755  14.378 37.120  1.00 139.90 ? 171 PHE B O     1 
ATOM   5538 C CB    . PHE B 2 185 ? -4.191  13.004 35.657  1.00 149.45 ? 171 PHE B CB    1 
ATOM   5539 N N     . ARG B 2 186 ? -6.751  14.770 34.896  1.00 139.45 ? 172 ARG B N     1 
ATOM   5540 C CA    . ARG B 2 186 ? -7.491  16.030 34.977  1.00 140.74 ? 172 ARG B CA    1 
ATOM   5541 C C     . ARG B 2 186 ? -8.981  15.802 35.230  1.00 144.96 ? 172 ARG B C     1 
ATOM   5542 O O     . ARG B 2 186 ? -9.643  16.630 35.858  1.00 150.53 ? 172 ARG B O     1 
ATOM   5543 C CB    . ARG B 2 186 ? -7.294  16.851 33.701  1.00 143.37 ? 172 ARG B CB    1 
ATOM   5544 N N     . LYS B 2 187 ? -9.496  14.677 34.733  1.00 145.04 ? 173 LYS B N     1 
ATOM   5545 C CA    . LYS B 2 187 ? -10.899 14.306 34.915  1.00 148.69 ? 173 LYS B CA    1 
ATOM   5546 C C     . LYS B 2 187 ? -11.192 13.861 36.347  1.00 152.64 ? 173 LYS B C     1 
ATOM   5547 O O     . LYS B 2 187 ? -12.295 14.073 36.856  1.00 157.16 ? 173 LYS B O     1 
ATOM   5548 C CB    . LYS B 2 187 ? -11.293 13.202 33.930  1.00 146.44 ? 173 LYS B CB    1 
ATOM   5549 N N     . GLN B 2 188 ? -10.198 13.244 36.985  1.00 151.07 ? 174 GLN B N     1 
ATOM   5550 C CA    . GLN B 2 188 ? -10.312 12.795 38.372  1.00 149.84 ? 174 GLN B CA    1 
ATOM   5551 C C     . GLN B 2 188 ? -10.243 13.975 39.342  1.00 145.14 ? 174 GLN B C     1 
ATOM   5552 O O     . GLN B 2 188 ? -10.993 14.028 40.320  1.00 146.26 ? 174 GLN B O     1 
ATOM   5553 C CB    . GLN B 2 188 ? -9.217  11.769 38.693  1.00 143.22 ? 174 GLN B CB    1 
ATOM   5554 C CG    . GLN B 2 188 ? -9.402  11.023 40.010  1.00 141.01 ? 174 GLN B CG    1 
ATOM   5555 C CD    . GLN B 2 188 ? -10.549 10.025 39.981  1.00 148.36 ? 174 GLN B CD    1 
ATOM   5556 O OE1   . GLN B 2 188 ? -10.798 9.370  38.968  1.00 154.42 ? 174 GLN B OE1   1 
ATOM   5557 N NE2   . GLN B 2 188 ? -11.248 9.900  41.103  1.00 148.69 ? 174 GLN B NE2   1 
ATOM   5558 N N     . ASN B 2 189 ? -9.342  14.916 39.062  1.00 141.39 ? 175 ASN B N     1 
ATOM   5559 C CA    . ASN B 2 189 ? -9.170  16.107 39.890  1.00 140.88 ? 175 ASN B CA    1 
ATOM   5560 C C     . ASN B 2 189 ? -9.375  17.401 39.094  1.00 145.94 ? 175 ASN B C     1 
ATOM   5561 O O     . ASN B 2 189 ? -8.436  17.904 38.470  1.00 140.06 ? 175 ASN B O     1 
ATOM   5562 C CB    . ASN B 2 189 ? -7.795  16.097 40.571  1.00 135.98 ? 175 ASN B CB    1 
ATOM   5563 C CG    . ASN B 2 189 ? -7.639  14.959 41.565  1.00 139.38 ? 175 ASN B CG    1 
ATOM   5564 O OD1   . ASN B 2 189 ? -6.727  14.141 41.448  1.00 147.47 ? 175 ASN B OD1   1 
ATOM   5565 N ND2   . ASN B 2 189 ? -8.531  14.901 42.551  1.00 137.17 ? 175 ASN B ND2   1 
ATOM   5566 N N     . PRO B 2 190 ? -10.613 17.935 39.105  1.00 153.96 ? 176 PRO B N     1 
ATOM   5567 C CA    . PRO B 2 190 ? -10.941 19.169 38.386  1.00 152.84 ? 176 PRO B CA    1 
ATOM   5568 C C     . PRO B 2 190 ? -10.392 20.426 39.063  1.00 143.48 ? 176 PRO B C     1 
ATOM   5569 O O     . PRO B 2 190 ? -10.033 21.385 38.376  1.00 134.72 ? 176 PRO B O     1 
ATOM   5570 C CB    . PRO B 2 190 ? -12.480 19.193 38.398  1.00 151.97 ? 176 PRO B CB    1 
ATOM   5571 C CG    . PRO B 2 190 ? -12.908 17.832 38.841  1.00 153.45 ? 176 PRO B CG    1 
ATOM   5572 C CD    . PRO B 2 190 ? -11.808 17.341 39.727  1.00 157.40 ? 176 PRO B CD    1 
ATOM   5573 N N     . ASP B 2 191 ? -10.332 20.413 40.394  1.00 148.08 ? 177 ASP B N     1 
ATOM   5574 C CA    . ASP B 2 191 ? -9.879  21.571 41.170  1.00 144.01 ? 177 ASP B CA    1 
ATOM   5575 C C     . ASP B 2 191 ? -8.363  21.782 41.116  1.00 153.92 ? 177 ASP B C     1 
ATOM   5576 O O     . ASP B 2 191 ? -7.890  22.920 41.176  1.00 154.77 ? 177 ASP B O     1 
ATOM   5577 C CB    . ASP B 2 191 ? -10.365 21.483 42.624  1.00 146.05 ? 177 ASP B CB    1 
ATOM   5578 C CG    . ASP B 2 191 ? -9.897  20.220 43.333  1.00 150.11 ? 177 ASP B CG    1 
ATOM   5579 O OD1   . ASP B 2 191 ? -10.075 19.112 42.781  1.00 153.04 ? 177 ASP B OD1   1 
ATOM   5580 O OD2   . ASP B 2 191 ? -9.360  20.337 44.455  1.00 153.63 ? 177 ASP B OD2   1 
ATOM   5581 N N     . ILE B 2 192 ? -7.612  20.688 41.006  1.00 158.54 ? 178 ILE B N     1 
ATOM   5582 C CA    . ILE B 2 192 ? -6.153  20.750 40.892  1.00 159.35 ? 178 ILE B CA    1 
ATOM   5583 C C     . ILE B 2 192 ? -5.755  21.142 39.467  1.00 157.47 ? 178 ILE B C     1 
ATOM   5584 O O     . ILE B 2 192 ? -6.142  20.482 38.498  1.00 155.50 ? 178 ILE B O     1 
ATOM   5585 C CB    . ILE B 2 192 ? -5.478  19.419 41.319  1.00 156.11 ? 178 ILE B CB    1 
ATOM   5586 C CG1   . ILE B 2 192 ? -5.546  19.233 42.840  1.00 154.22 ? 178 ILE B CG1   1 
ATOM   5587 C CG2   . ILE B 2 192 ? -4.019  19.369 40.884  1.00 153.89 ? 178 ILE B CG2   1 
ATOM   5588 C CD1   . ILE B 2 192 ? -6.737  18.435 43.328  1.00 148.84 ? 178 ILE B CD1   1 
ATOM   5589 N N     . VAL B 2 193 ? -4.991  22.227 39.354  1.00 161.30 ? 179 VAL B N     1 
ATOM   5590 C CA    . VAL B 2 193 ? -4.555  22.751 38.059  1.00 157.78 ? 179 VAL B CA    1 
ATOM   5591 C C     . VAL B 2 193 ? -3.123  22.306 37.756  1.00 158.58 ? 179 VAL B C     1 
ATOM   5592 O O     . VAL B 2 193 ? -2.221  22.473 38.582  1.00 161.37 ? 179 VAL B O     1 
ATOM   5593 C CB    . VAL B 2 193 ? -4.657  24.295 38.002  1.00 151.66 ? 179 VAL B CB    1 
ATOM   5594 C CG1   . VAL B 2 193 ? -4.385  24.805 36.593  1.00 140.94 ? 179 VAL B CG1   1 
ATOM   5595 C CG2   . VAL B 2 193 ? -6.028  24.764 38.472  1.00 149.93 ? 179 VAL B CG2   1 
ATOM   5596 N N     . ILE B 2 194 ? -2.929  21.737 36.567  1.00 157.29 ? 180 ILE B N     1 
ATOM   5597 C CA    . ILE B 2 194 ? -1.618  21.249 36.130  1.00 154.05 ? 180 ILE B CA    1 
ATOM   5598 C C     . ILE B 2 194 ? -1.031  22.099 35.000  1.00 156.13 ? 180 ILE B C     1 
ATOM   5599 O O     . ILE B 2 194 ? -1.765  22.632 34.165  1.00 159.40 ? 180 ILE B O     1 
ATOM   5600 C CB    . ILE B 2 194 ? -1.662  19.761 35.705  1.00 151.76 ? 180 ILE B CB    1 
ATOM   5601 C CG1   . ILE B 2 194 ? -2.827  19.499 34.738  1.00 157.73 ? 180 ILE B CG1   1 
ATOM   5602 C CG2   . ILE B 2 194 ? -1.751  18.862 36.933  1.00 153.38 ? 180 ILE B CG2   1 
ATOM   5603 C CD1   . ILE B 2 194 ? -2.705  18.219 33.936  1.00 156.42 ? 180 ILE B CD1   1 
ATOM   5604 N N     . TYR B 2 195 ? 0.296   22.218 34.988  1.00 151.38 ? 181 TYR B N     1 
ATOM   5605 C CA    . TYR B 2 195 ? 1.007   23.001 33.977  1.00 150.70 ? 181 TYR B CA    1 
ATOM   5606 C C     . TYR B 2 195 ? 2.369   22.389 33.647  1.00 148.46 ? 181 TYR B C     1 
ATOM   5607 O O     . TYR B 2 195 ? 3.091   21.938 34.540  1.00 145.69 ? 181 TYR B O     1 
ATOM   5608 C CB    . TYR B 2 195 ? 1.168   24.455 34.439  1.00 147.55 ? 181 TYR B CB    1 
ATOM   5609 C CG    . TYR B 2 195 ? 1.854   25.365 33.438  1.00 139.34 ? 181 TYR B CG    1 
ATOM   5610 C CD1   . TYR B 2 195 ? 1.179   25.827 32.307  1.00 143.21 ? 181 TYR B CD1   1 
ATOM   5611 C CD2   . TYR B 2 195 ? 3.174   25.773 33.629  1.00 139.44 ? 181 TYR B CD2   1 
ATOM   5612 C CE1   . TYR B 2 195 ? 1.803   26.661 31.391  1.00 134.24 ? 181 TYR B CE1   1 
ATOM   5613 C CE2   . TYR B 2 195 ? 3.806   26.607 32.719  1.00 146.59 ? 181 TYR B CE2   1 
ATOM   5614 C CZ    . TYR B 2 195 ? 3.117   27.048 31.603  1.00 132.85 ? 181 TYR B CZ    1 
ATOM   5615 O OH    . TYR B 2 195 ? 3.739   27.876 30.698  1.00 131.81 ? 181 TYR B OH    1 
ATOM   5616 N N     . GLN B 2 196 ? 2.707   22.381 32.359  1.00 151.28 ? 182 GLN B N     1 
ATOM   5617 C CA    . GLN B 2 196 ? 3.981   21.847 31.882  1.00 148.31 ? 182 GLN B CA    1 
ATOM   5618 C C     . GLN B 2 196 ? 4.849   22.957 31.290  1.00 138.57 ? 182 GLN B C     1 
ATOM   5619 O O     . GLN B 2 196 ? 4.367   23.788 30.515  1.00 135.02 ? 182 GLN B O     1 
ATOM   5620 C CB    . GLN B 2 196 ? 3.743   20.745 30.844  1.00 159.79 ? 182 GLN B CB    1 
ATOM   5621 C CG    . GLN B 2 196 ? 4.983   19.937 30.483  1.00 159.19 ? 182 GLN B CG    1 
ATOM   5622 C CD    . GLN B 2 196 ? 4.760   18.991 29.315  1.00 169.52 ? 182 GLN B CD    1 
ATOM   5623 O OE1   . GLN B 2 196 ? 3.979   19.275 28.405  1.00 168.08 ? 182 GLN B OE1   1 
ATOM   5624 N NE2   . GLN B 2 196 ? 5.458   17.862 29.331  1.00 167.92 ? 182 GLN B NE2   1 
ATOM   5625 N N     . TYR B 2 197 ? 6.128   22.963 31.663  1.00 135.52 ? 183 TYR B N     1 
ATOM   5626 C CA    . TYR B 2 197 ? 7.082   23.955 31.170  1.00 146.79 ? 183 TYR B CA    1 
ATOM   5627 C C     . TYR B 2 197 ? 8.465   23.337 30.967  1.00 154.30 ? 183 TYR B C     1 
ATOM   5628 O O     . TYR B 2 197 ? 9.068   22.819 31.911  1.00 151.64 ? 183 TYR B O     1 
ATOM   5629 C CB    . TYR B 2 197 ? 7.158   25.149 32.129  1.00 149.30 ? 183 TYR B CB    1 
ATOM   5630 C CG    . TYR B 2 197 ? 7.922   26.342 31.591  1.00 148.92 ? 183 TYR B CG    1 
ATOM   5631 C CD1   . TYR B 2 197 ? 7.325   27.235 30.701  1.00 147.62 ? 183 TYR B CD1   1 
ATOM   5632 C CD2   . TYR B 2 197 ? 9.239   26.585 31.983  1.00 144.57 ? 183 TYR B CD2   1 
ATOM   5633 C CE1   . TYR B 2 197 ? 8.020   28.330 30.209  1.00 144.81 ? 183 TYR B CE1   1 
ATOM   5634 C CE2   . TYR B 2 197 ? 9.941   27.679 31.498  1.00 150.69 ? 183 TYR B CE2   1 
ATOM   5635 C CZ    . TYR B 2 197 ? 9.328   28.546 30.612  1.00 147.92 ? 183 TYR B CZ    1 
ATOM   5636 O OH    . TYR B 2 197 ? 10.022  29.632 30.128  1.00 147.98 ? 183 TYR B OH    1 
ATOM   5637 N N     . MET B 2 198 ? 8.947   23.400 29.725  1.00 158.40 ? 184 MET B N     1 
ATOM   5638 C CA    . MET B 2 198 ? 10.256  22.862 29.323  1.00 149.12 ? 184 MET B CA    1 
ATOM   5639 C C     . MET B 2 198 ? 10.444  21.384 29.690  1.00 149.35 ? 184 MET B C     1 
ATOM   5640 O O     . MET B 2 198 ? 10.023  20.498 28.944  1.00 145.62 ? 184 MET B O     1 
ATOM   5641 C CB    . MET B 2 198 ? 11.409  23.725 29.865  1.00 145.12 ? 184 MET B CB    1 
ATOM   5642 C CG    . MET B 2 198 ? 11.443  25.149 29.325  1.00 151.87 ? 184 MET B CG    1 
ATOM   5643 S SD    . MET B 2 198 ? 11.865  25.270 27.575  1.00 135.04 ? 184 MET B SD    1 
ATOM   5644 C CE    . MET B 2 198 ? 13.630  24.962 27.617  1.00 140.63 ? 184 MET B CE    1 
ATOM   5645 N N     . ASP B 2 199 ? 11.070  21.130 30.838  1.00 153.28 ? 185 ASP B N     1 
ATOM   5646 C CA    . ASP B 2 199 ? 11.327  19.767 31.305  1.00 156.75 ? 185 ASP B CA    1 
ATOM   5647 C C     . ASP B 2 199 ? 10.881  19.561 32.755  1.00 156.50 ? 185 ASP B C     1 
ATOM   5648 O O     . ASP B 2 199 ? 11.069  18.482 33.324  1.00 151.74 ? 185 ASP B O     1 
ATOM   5649 C CB    . ASP B 2 199 ? 12.813  19.416 31.149  1.00 159.60 ? 185 ASP B CB    1 
ATOM   5650 C CG    . ASP B 2 199 ? 13.285  19.464 29.703  1.00 163.81 ? 185 ASP B CG    1 
ATOM   5651 O OD1   . ASP B 2 199 ? 12.592  18.913 28.820  1.00 165.00 ? 185 ASP B OD1   1 
ATOM   5652 O OD2   . ASP B 2 199 ? 14.360  20.048 29.452  1.00 162.39 ? 185 ASP B OD2   1 
ATOM   5653 N N     . ASP B 2 200 ? 10.291  20.600 33.343  1.00 161.83 ? 186 ASP B N     1 
ATOM   5654 C CA    . ASP B 2 200 ? 9.812   20.551 34.724  1.00 156.67 ? 186 ASP B CA    1 
ATOM   5655 C C     . ASP B 2 200 ? 8.288   20.585 34.793  1.00 151.64 ? 186 ASP B C     1 
ATOM   5656 O O     . ASP B 2 200 ? 7.641   21.366 34.091  1.00 151.90 ? 186 ASP B O     1 
ATOM   5657 C CB    . ASP B 2 200 ? 10.402  21.706 35.542  1.00 152.10 ? 186 ASP B CB    1 
ATOM   5658 C CG    . ASP B 2 200 ? 11.913  21.616 35.684  1.00 149.53 ? 186 ASP B CG    1 
ATOM   5659 O OD1   . ASP B 2 200 ? 12.612  21.530 34.651  1.00 148.77 ? 186 ASP B OD1   1 
ATOM   5660 O OD2   . ASP B 2 200 ? 12.403  21.645 36.833  1.00 150.19 ? 186 ASP B OD2   1 
ATOM   5661 N N     . LEU B 2 201 ? 7.725   19.732 35.645  1.00 146.33 ? 187 LEU B N     1 
ATOM   5662 C CA    . LEU B 2 201 ? 6.280   19.662 35.843  1.00 145.27 ? 187 LEU B CA    1 
ATOM   5663 C C     . LEU B 2 201 ? 5.877   20.386 37.126  1.00 152.64 ? 187 LEU B C     1 
ATOM   5664 O O     . LEU B 2 201 ? 6.460   20.156 38.189  1.00 151.85 ? 187 LEU B O     1 
ATOM   5665 C CB    . LEU B 2 201 ? 5.812   18.201 35.879  1.00 147.05 ? 187 LEU B CB    1 
ATOM   5666 C CG    . LEU B 2 201 ? 4.308   17.903 35.839  1.00 156.67 ? 187 LEU B CG    1 
ATOM   5667 C CD1   . LEU B 2 201 ? 3.729   18.134 34.450  1.00 156.62 ? 187 LEU B CD1   1 
ATOM   5668 C CD2   . LEU B 2 201 ? 4.041   16.476 36.294  1.00 160.32 ? 187 LEU B CD2   1 
ATOM   5669 N N     . TYR B 2 202 ? 4.880   21.261 37.014  1.00 153.68 ? 188 TYR B N     1 
ATOM   5670 C CA    . TYR B 2 202 ? 4.394   22.040 38.150  1.00 150.55 ? 188 TYR B CA    1 
ATOM   5671 C C     . TYR B 2 202 ? 2.929   21.734 38.454  1.00 142.47 ? 188 TYR B C     1 
ATOM   5672 O O     . TYR B 2 202 ? 2.041   22.024 37.648  1.00 135.01 ? 188 TYR B O     1 
ATOM   5673 C CB    . TYR B 2 202 ? 4.591   23.541 37.902  1.00 150.35 ? 188 TYR B CB    1 
ATOM   5674 C CG    . TYR B 2 202 ? 6.042   23.973 37.837  1.00 158.40 ? 188 TYR B CG    1 
ATOM   5675 C CD1   . TYR B 2 202 ? 6.735   24.331 38.993  1.00 158.27 ? 188 TYR B CD1   1 
ATOM   5676 C CD2   . TYR B 2 202 ? 6.721   24.026 36.619  1.00 159.28 ? 188 TYR B CD2   1 
ATOM   5677 C CE1   . TYR B 2 202 ? 8.062   24.728 38.940  1.00 159.18 ? 188 TYR B CE1   1 
ATOM   5678 C CE2   . TYR B 2 202 ? 8.049   24.421 36.556  1.00 156.12 ? 188 TYR B CE2   1 
ATOM   5679 C CZ    . TYR B 2 202 ? 8.714   24.771 37.720  1.00 155.79 ? 188 TYR B CZ    1 
ATOM   5680 O OH    . TYR B 2 202 ? 10.032  25.164 37.664  1.00 143.56 ? 188 TYR B OH    1 
ATOM   5681 N N     . VAL B 2 203 ? 2.692   21.137 39.620  1.00 141.95 ? 189 VAL B N     1 
ATOM   5682 C CA    . VAL B 2 203 ? 1.345   20.771 40.059  1.00 141.12 ? 189 VAL B CA    1 
ATOM   5683 C C     . VAL B 2 203 ? 0.986   21.533 41.335  1.00 147.72 ? 189 VAL B C     1 
ATOM   5684 O O     . VAL B 2 203 ? 1.688   21.438 42.345  1.00 149.79 ? 189 VAL B O     1 
ATOM   5685 C CB    . VAL B 2 203 ? 1.209   19.245 40.290  1.00 140.65 ? 189 VAL B CB    1 
ATOM   5686 C CG1   . VAL B 2 203 ? -0.207  18.883 40.720  1.00 150.56 ? 189 VAL B CG1   1 
ATOM   5687 C CG2   . VAL B 2 203 ? 1.589   18.470 39.035  1.00 141.13 ? 189 VAL B CG2   1 
ATOM   5688 N N     . GLY B 2 204 ? -0.107  22.291 41.275  1.00 152.99 ? 190 GLY B N     1 
ATOM   5689 C CA    . GLY B 2 204 ? -0.585  23.066 42.417  1.00 159.31 ? 190 GLY B CA    1 
ATOM   5690 C C     . GLY B 2 204 ? -1.798  22.435 43.073  1.00 160.75 ? 190 GLY B C     1 
ATOM   5691 O O     . GLY B 2 204 ? -2.817  22.206 42.418  1.00 158.73 ? 190 GLY B O     1 
ATOM   5692 N N     . SER B 2 205 ? -1.683  22.157 44.370  1.00 161.26 ? 191 SER B N     1 
ATOM   5693 C CA    . SER B 2 205 ? -2.759  21.524 45.132  1.00 152.45 ? 191 SER B CA    1 
ATOM   5694 C C     . SER B 2 205 ? -3.255  22.411 46.271  1.00 146.74 ? 191 SER B C     1 
ATOM   5695 O O     . SER B 2 205 ? -2.464  23.086 46.935  1.00 150.51 ? 191 SER B O     1 
ATOM   5696 C CB    . SER B 2 205 ? -2.304  20.168 45.679  1.00 153.84 ? 191 SER B CB    1 
ATOM   5697 O OG    . SER B 2 205 ? -1.173  20.307 46.522  1.00 156.62 ? 191 SER B OG    1 
ATOM   5698 N N     . ASP B 2 206 ? -4.568  22.399 46.488  1.00 142.98 ? 192 ASP B N     1 
ATOM   5699 C CA    . ASP B 2 206 ? -5.199  23.185 47.549  1.00 144.89 ? 192 ASP B CA    1 
ATOM   5700 C C     . ASP B 2 206 ? -5.495  22.342 48.793  1.00 146.52 ? 192 ASP B C     1 
ATOM   5701 O O     . ASP B 2 206 ? -6.148  22.810 49.731  1.00 144.60 ? 192 ASP B O     1 
ATOM   5702 C CB    . ASP B 2 206 ? -6.482  23.849 47.033  1.00 148.95 ? 192 ASP B CB    1 
ATOM   5703 C CG    . ASP B 2 206 ? -6.216  24.876 45.943  1.00 147.78 ? 192 ASP B CG    1 
ATOM   5704 O OD1   . ASP B 2 206 ? -5.307  25.718 46.113  1.00 142.35 ? 192 ASP B OD1   1 
ATOM   5705 O OD2   . ASP B 2 206 ? -6.928  24.848 44.917  1.00 150.53 ? 192 ASP B OD2   1 
ATOM   5706 N N     . LEU B 2 207 ? -5.006  21.104 48.794  1.00 148.44 ? 193 LEU B N     1 
ATOM   5707 C CA    . LEU B 2 207 ? -5.211  20.177 49.907  1.00 149.85 ? 193 LEU B CA    1 
ATOM   5708 C C     . LEU B 2 207 ? -4.184  20.386 51.023  1.00 147.85 ? 193 LEU B C     1 
ATOM   5709 O O     . LEU B 2 207 ? -3.269  21.204 50.892  1.00 145.80 ? 193 LEU B O     1 
ATOM   5710 C CB    . LEU B 2 207 ? -5.178  18.723 49.414  1.00 148.15 ? 193 LEU B CB    1 
ATOM   5711 C CG    . LEU B 2 207 ? -6.397  18.168 48.668  1.00 149.96 ? 193 LEU B CG    1 
ATOM   5712 C CD1   . LEU B 2 207 ? -6.355  18.508 47.184  1.00 148.04 ? 193 LEU B CD1   1 
ATOM   5713 C CD2   . LEU B 2 207 ? -6.484  16.662 48.858  1.00 145.44 ? 193 LEU B CD2   1 
ATOM   5714 N N     . GLU B 2 208 ? -4.350  19.642 52.116  1.00 149.50 ? 194 GLU B N     1 
ATOM   5715 C CA    . GLU B 2 208 ? -3.450  19.709 53.268  1.00 151.68 ? 194 GLU B CA    1 
ATOM   5716 C C     . GLU B 2 208 ? -2.083  19.102 52.938  1.00 153.24 ? 194 GLU B C     1 
ATOM   5717 O O     . GLU B 2 208 ? -1.964  18.292 52.015  1.00 152.06 ? 194 GLU B O     1 
ATOM   5718 C CB    . GLU B 2 208 ? -4.081  18.990 54.468  1.00 151.31 ? 194 GLU B CB    1 
ATOM   5719 C CG    . GLU B 2 208 ? -3.569  19.439 55.832  1.00 154.52 ? 194 GLU B CG    1 
ATOM   5720 C CD    . GLU B 2 208 ? -4.044  20.828 56.225  1.00 162.93 ? 194 GLU B CD    1 
ATOM   5721 O OE1   . GLU B 2 208 ? -5.237  21.142 56.016  1.00 169.76 ? 194 GLU B OE1   1 
ATOM   5722 O OE2   . GLU B 2 208 ? -3.224  21.606 56.755  1.00 162.38 ? 194 GLU B OE2   1 
ATOM   5723 N N     . ILE B 2 209 ? -1.063  19.502 53.697  1.00 154.67 ? 195 ILE B N     1 
ATOM   5724 C CA    . ILE B 2 209 ? 0.316   19.032 53.502  1.00 158.31 ? 195 ILE B CA    1 
ATOM   5725 C C     . ILE B 2 209 ? 0.462   17.509 53.657  1.00 153.33 ? 195 ILE B C     1 
ATOM   5726 O O     . ILE B 2 209 ? 1.298   16.889 52.993  1.00 146.77 ? 195 ILE B O     1 
ATOM   5727 C CB    . ILE B 2 209 ? 1.320   19.806 54.407  1.00 160.10 ? 195 ILE B CB    1 
ATOM   5728 C CG1   . ILE B 2 209 ? 2.778   19.458 54.071  1.00 164.12 ? 195 ILE B CG1   1 
ATOM   5729 C CG2   . ILE B 2 209 ? 1.022   19.600 55.890  1.00 154.72 ? 195 ILE B CG2   1 
ATOM   5730 C CD1   . ILE B 2 209 ? 3.320   20.158 52.841  1.00 156.08 ? 195 ILE B CD1   1 
ATOM   5731 N N     . GLY B 2 210 ? -0.362  16.917 54.521  1.00 151.10 ? 196 GLY B N     1 
ATOM   5732 C CA    . GLY B 2 210 ? -0.387  15.467 54.710  1.00 147.77 ? 196 GLY B CA    1 
ATOM   5733 C C     . GLY B 2 210 ? -1.033  14.733 53.547  1.00 150.91 ? 196 GLY B C     1 
ATOM   5734 O O     . GLY B 2 210 ? -0.698  13.579 53.270  1.00 148.30 ? 196 GLY B O     1 
ATOM   5735 N N     . GLN B 2 211 ? -1.960  15.408 52.869  1.00 155.18 ? 197 GLN B N     1 
ATOM   5736 C CA    . GLN B 2 211 ? -2.664  14.845 51.716  1.00 156.53 ? 197 GLN B CA    1 
ATOM   5737 C C     . GLN B 2 211 ? -1.984  15.196 50.391  1.00 147.15 ? 197 GLN B C     1 
ATOM   5738 O O     . GLN B 2 211 ? -2.275  14.588 49.357  1.00 145.85 ? 197 GLN B O     1 
ATOM   5739 C CB    . GLN B 2 211 ? -4.125  15.311 51.698  1.00 157.58 ? 197 GLN B CB    1 
ATOM   5740 C CG    . GLN B 2 211 ? -4.995  14.727 52.806  1.00 158.54 ? 197 GLN B CG    1 
ATOM   5741 C CD    . GLN B 2 211 ? -5.312  13.254 52.607  1.00 163.49 ? 197 GLN B CD    1 
ATOM   5742 O OE1   . GLN B 2 211 ? -5.521  12.793 51.483  1.00 168.56 ? 197 GLN B OE1   1 
ATOM   5743 N NE2   . GLN B 2 211 ? -5.359  12.509 53.705  1.00 162.17 ? 197 GLN B NE2   1 
ATOM   5744 N N     . HIS B 2 212 ? -1.081  16.176 50.432  1.00 140.76 ? 198 HIS B N     1 
ATOM   5745 C CA    . HIS B 2 212 ? -0.367  16.645 49.243  1.00 134.21 ? 198 HIS B CA    1 
ATOM   5746 C C     . HIS B 2 212 ? 0.637   15.648 48.736  1.00 138.74 ? 198 HIS B C     1 
ATOM   5747 O O     . HIS B 2 212 ? 0.843   15.531 47.526  1.00 137.98 ? 198 HIS B O     1 
ATOM   5748 C CB    . HIS B 2 212 ? 0.316   17.980 49.522  1.00 136.87 ? 198 HIS B CB    1 
ATOM   5749 N N     . ARG B 2 213 ? 1.268   14.922 49.657  1.00 142.47 ? 199 ARG B N     1 
ATOM   5750 C CA    . ARG B 2 213 ? 2.269   13.910 49.314  1.00 148.99 ? 199 ARG B CA    1 
ATOM   5751 C C     . ARG B 2 213 ? 1.643   12.661 48.691  1.00 145.95 ? 199 ARG B C     1 
ATOM   5752 O O     . ARG B 2 213 ? 2.290   11.960 47.909  1.00 145.16 ? 199 ARG B O     1 
ATOM   5753 C CB    . ARG B 2 213 ? 3.088   13.527 50.549  1.00 144.66 ? 199 ARG B CB    1 
ATOM   5754 N N     . THR B 2 214 ? 0.388   12.393 49.046  1.00 158.50 ? 200 THR B N     1 
ATOM   5755 C CA    . THR B 2 214 ? -0.347  11.236 48.534  1.00 163.62 ? 200 THR B CA    1 
ATOM   5756 C C     . THR B 2 214 ? -0.804  11.457 47.089  1.00 161.15 ? 200 THR B C     1 
ATOM   5757 O O     . THR B 2 214 ? -0.802  10.524 46.282  1.00 167.19 ? 200 THR B O     1 
ATOM   5758 C CB    . THR B 2 214 ? -1.568  10.904 49.423  1.00 160.68 ? 200 THR B CB    1 
ATOM   5759 O OG1   . THR B 2 214 ? -1.213  11.038 50.805  1.00 157.44 ? 200 THR B OG1   1 
ATOM   5760 C CG2   . THR B 2 214 ? -2.059  9.481  49.169  1.00 161.51 ? 200 THR B CG2   1 
ATOM   5761 N N     . LYS B 2 215 ? -1.185  12.695 46.773  1.00 154.27 ? 201 LYS B N     1 
ATOM   5762 C CA    . LYS B 2 215 ? -1.668  13.058 45.437  1.00 152.09 ? 201 LYS B CA    1 
ATOM   5763 C C     . LYS B 2 215 ? -0.569  13.010 44.374  1.00 149.42 ? 201 LYS B C     1 
ATOM   5764 O O     . LYS B 2 215 ? -0.822  12.627 43.230  1.00 152.89 ? 201 LYS B O     1 
ATOM   5765 C CB    . LYS B 2 215 ? -2.327  14.444 45.456  1.00 154.62 ? 201 LYS B CB    1 
ATOM   5766 C CG    . LYS B 2 215 ? -3.658  14.509 46.195  1.00 154.28 ? 201 LYS B CG    1 
ATOM   5767 C CD    . LYS B 2 215 ? -4.797  13.928 45.369  1.00 147.49 ? 201 LYS B CD    1 
ATOM   5768 C CE    . LYS B 2 215 ? -6.112  13.974 46.130  1.00 140.96 ? 201 LYS B CE    1 
ATOM   5769 N NZ    . LYS B 2 215 ? -7.235  13.403 45.336  1.00 138.22 ? 201 LYS B NZ    1 
ATOM   5770 N N     . ILE B 2 216 ? 0.644   13.404 44.762  1.00 141.16 ? 202 ILE B N     1 
ATOM   5771 C CA    . ILE B 2 216 ? 1.803   13.389 43.866  1.00 140.75 ? 202 ILE B CA    1 
ATOM   5772 C C     . ILE B 2 216 ? 2.278   11.955 43.608  1.00 135.05 ? 202 ILE B C     1 
ATOM   5773 O O     . ILE B 2 216 ? 2.694   11.622 42.494  1.00 130.47 ? 202 ILE B O     1 
ATOM   5774 C CB    . ILE B 2 216 ? 2.962   14.264 44.416  1.00 149.77 ? 202 ILE B CB    1 
ATOM   5775 C CG1   . ILE B 2 216 ? 2.505   15.718 44.644  1.00 151.36 ? 202 ILE B CG1   1 
ATOM   5776 C CG2   . ILE B 2 216 ? 4.190   14.207 43.510  1.00 154.45 ? 202 ILE B CG2   1 
ATOM   5777 C CD1   . ILE B 2 216 ? 1.960   16.435 43.422  1.00 144.11 ? 202 ILE B CD1   1 
ATOM   5778 N N     . GLU B 2 217 ? 2.196   11.115 44.639  1.00 133.71 ? 203 GLU B N     1 
ATOM   5779 C CA    . GLU B 2 217 ? 2.588   9.706  44.549  1.00 139.30 ? 203 GLU B CA    1 
ATOM   5780 C C     . GLU B 2 217 ? 1.694   8.923  43.583  1.00 148.23 ? 203 GLU B C     1 
ATOM   5781 O O     . GLU B 2 217 ? 2.164   8.017  42.889  1.00 146.17 ? 203 GLU B O     1 
ATOM   5782 C CB    . GLU B 2 217 ? 2.574   9.058  45.939  1.00 140.06 ? 203 GLU B CB    1 
ATOM   5783 C CG    . GLU B 2 217 ? 3.321   7.732  46.037  1.00 146.06 ? 203 GLU B CG    1 
ATOM   5784 C CD    . GLU B 2 217 ? 4.829   7.880  45.916  1.00 155.56 ? 203 GLU B CD    1 
ATOM   5785 O OE1   . GLU B 2 217 ? 5.396   8.814  46.524  1.00 158.17 ? 203 GLU B OE1   1 
ATOM   5786 O OE2   . GLU B 2 217 ? 5.450   7.053  45.217  1.00 164.66 ? 203 GLU B OE2   1 
ATOM   5787 N N     . GLU B 2 218 ? 0.411   9.279  43.546  1.00 156.33 ? 204 GLU B N     1 
ATOM   5788 C CA    . GLU B 2 218 ? -0.551  8.668  42.626  1.00 158.26 ? 204 GLU B CA    1 
ATOM   5789 C C     . GLU B 2 218 ? -0.317  9.118  41.183  1.00 152.76 ? 204 GLU B C     1 
ATOM   5790 O O     . GLU B 2 218 ? -0.550  8.354  40.244  1.00 155.98 ? 204 GLU B O     1 
ATOM   5791 C CB    . GLU B 2 218 ? -1.987  8.988  43.052  1.00 153.95 ? 204 GLU B CB    1 
ATOM   5792 C CG    . GLU B 2 218 ? -2.443  8.270  44.314  1.00 159.34 ? 204 GLU B CG    1 
ATOM   5793 C CD    . GLU B 2 218 ? -3.865  8.620  44.717  1.00 163.06 ? 204 GLU B CD    1 
ATOM   5794 O OE1   . GLU B 2 218 ? -4.751  8.666  43.835  1.00 174.66 ? 204 GLU B OE1   1 
ATOM   5795 O OE2   . GLU B 2 218 ? -4.101  8.841  45.924  1.00 161.85 ? 204 GLU B OE2   1 
ATOM   5796 N N     . LEU B 2 219 ? 0.140   10.358 41.022  1.00 147.28 ? 205 LEU B N     1 
ATOM   5797 C CA    . LEU B 2 219 ? 0.459   10.917 39.708  1.00 145.28 ? 205 LEU B CA    1 
ATOM   5798 C C     . LEU B 2 219 ? 1.769   10.337 39.174  1.00 133.88 ? 205 LEU B C     1 
ATOM   5799 O O     . LEU B 2 219 ? 1.907   10.105 37.970  1.00 128.90 ? 205 LEU B O     1 
ATOM   5800 C CB    . LEU B 2 219 ? 0.536   12.448 39.785  1.00 148.61 ? 205 LEU B CB    1 
ATOM   5801 C CG    . LEU B 2 219 ? 0.349   13.277 38.507  1.00 151.86 ? 205 LEU B CG    1 
ATOM   5802 C CD1   . LEU B 2 219 ? -0.281  14.623 38.834  1.00 150.75 ? 205 LEU B CD1   1 
ATOM   5803 C CD2   . LEU B 2 219 ? 1.656   13.467 37.746  1.00 156.26 ? 205 LEU B CD2   1 
ATOM   5804 N N     . ARG B 2 220 ? 2.720   10.104 40.078  1.00 134.11 ? 206 ARG B N     1 
ATOM   5805 C CA    . ARG B 2 220 ? 4.019   9.525  39.728  1.00 134.19 ? 206 ARG B CA    1 
ATOM   5806 C C     . ARG B 2 220 ? 3.911   8.045  39.364  1.00 140.01 ? 206 ARG B C     1 
ATOM   5807 O O     . ARG B 2 220 ? 4.701   7.539  38.564  1.00 142.90 ? 206 ARG B O     1 
ATOM   5808 C CB    . ARG B 2 220 ? 5.015   9.712  40.875  1.00 143.10 ? 206 ARG B CB    1 
ATOM   5809 N N     . GLN B 2 221 ? 2.933   7.362  39.957  1.00 142.76 ? 207 GLN B N     1 
ATOM   5810 C CA    . GLN B 2 221 ? 2.676   5.948  39.680  1.00 145.39 ? 207 GLN B CA    1 
ATOM   5811 C C     . GLN B 2 221 ? 2.051   5.738  38.299  1.00 148.84 ? 207 GLN B C     1 
ATOM   5812 O O     . GLN B 2 221 ? 2.179   4.661  37.711  1.00 152.89 ? 207 GLN B O     1 
ATOM   5813 C CB    . GLN B 2 221 ? 1.776   5.346  40.762  1.00 141.53 ? 207 GLN B CB    1 
ATOM   5814 N N     . HIS B 2 222 ? 1.379   6.772  37.796  1.00 147.65 ? 208 HIS B N     1 
ATOM   5815 C CA    . HIS B 2 222 ? 0.759   6.746  36.471  1.00 144.94 ? 208 HIS B CA    1 
ATOM   5816 C C     . HIS B 2 222 ? 1.785   6.838  35.373  1.00 138.19 ? 208 HIS B C     1 
ATOM   5817 O O     . HIS B 2 222 ? 1.575   6.319  34.274  1.00 132.04 ? 208 HIS B O     1 
ATOM   5818 C CB    . HIS B 2 222 ? -0.260  7.875  36.342  1.00 143.46 ? 208 HIS B CB    1 
ATOM   5819 C CG    . HIS B 2 222 ? -1.123  7.783  35.105  1.00 146.08 ? 208 HIS B CG    1 
ATOM   5820 N ND1   . HIS B 2 222 ? -0.801  8.394  33.951  1.00 147.67 ? 208 HIS B ND1   1 
ATOM   5821 C CD2   . HIS B 2 222 ? -2.328  7.121  34.877  1.00 150.29 ? 208 HIS B CD2   1 
ATOM   5822 C CE1   . HIS B 2 222 ? -1.748  8.138  33.029  1.00 149.78 ? 208 HIS B CE1   1 
ATOM   5823 N NE2   . HIS B 2 222 ? -2.683  7.359  33.597  1.00 153.76 ? 208 HIS B NE2   1 
ATOM   5824 N N     . LEU B 2 223 ? 2.903   7.501  35.667  1.00 132.82 ? 209 LEU B N     1 
ATOM   5825 C CA    . LEU B 2 223 ? 4.002   7.663  34.713  1.00 135.42 ? 209 LEU B CA    1 
ATOM   5826 C C     . LEU B 2 223 ? 4.727   6.345  34.434  1.00 144.66 ? 209 LEU B C     1 
ATOM   5827 O O     . LEU B 2 223 ? 5.157   6.096  33.306  1.00 147.36 ? 209 LEU B O     1 
ATOM   5828 C CB    . LEU B 2 223 ? 4.999   8.718  35.210  1.00 134.52 ? 209 LEU B CB    1 
ATOM   5829 C CG    . LEU B 2 223 ? 4.538   10.179 35.292  1.00 134.11 ? 209 LEU B CG    1 
ATOM   5830 C CD1   . LEU B 2 223 ? 5.440   10.971 36.227  1.00 146.19 ? 209 LEU B CD1   1 
ATOM   5831 C CD2   . LEU B 2 223 ? 4.483   10.831 33.916  1.00 136.98 ? 209 LEU B CD2   1 
ATOM   5832 N N     . LEU B 2 224 ? 4.854   5.512  35.466  1.00 150.11 ? 210 LEU B N     1 
ATOM   5833 C CA    . LEU B 2 224 ? 5.496   4.200  35.348  1.00 159.03 ? 210 LEU B CA    1 
ATOM   5834 C C     . LEU B 2 224 ? 4.659   3.209  34.537  1.00 159.03 ? 210 LEU B C     1 
ATOM   5835 O O     . LEU B 2 224 ? 5.201   2.282  33.931  1.00 156.62 ? 210 LEU B O     1 
ATOM   5836 C CB    . LEU B 2 224 ? 5.805   3.616  36.736  1.00 162.77 ? 210 LEU B CB    1 
ATOM   5837 C CG    . LEU B 2 224 ? 7.123   3.934  37.466  1.00 162.67 ? 210 LEU B CG    1 
ATOM   5838 C CD1   . LEU B 2 224 ? 8.337   3.443  36.685  1.00 158.57 ? 210 LEU B CD1   1 
ATOM   5839 C CD2   . LEU B 2 224 ? 7.266   5.410  37.817  1.00 155.00 ? 210 LEU B CD2   1 
ATOM   5840 N N     . ARG B 2 225 ? 3.343   3.414  34.535  1.00 154.27 ? 211 ARG B N     1 
ATOM   5841 C CA    . ARG B 2 225 ? 2.416   2.574  33.776  1.00 153.79 ? 211 ARG B CA    1 
ATOM   5842 C C     . ARG B 2 225 ? 2.508   2.831  32.272  1.00 155.53 ? 211 ARG B C     1 
ATOM   5843 O O     . ARG B 2 225 ? 2.263   1.930  31.467  1.00 161.66 ? 211 ARG B O     1 
ATOM   5844 C CB    . ARG B 2 225 ? 0.980   2.791  34.259  1.00 155.28 ? 211 ARG B CB    1 
ATOM   5845 N N     . TRP B 2 226 ? 2.860   4.063  31.905  1.00 151.80 ? 212 TRP B N     1 
ATOM   5846 C CA    . TRP B 2 226 ? 3.002   4.453  30.503  1.00 151.13 ? 212 TRP B CA    1 
ATOM   5847 C C     . TRP B 2 226 ? 4.283   3.936  29.906  1.00 152.38 ? 212 TRP B C     1 
ATOM   5848 O O     . TRP B 2 226 ? 4.275   3.358  28.817  1.00 148.70 ? 212 TRP B O     1 
ATOM   5849 C CB    . TRP B 2 226 ? 2.911   5.970  30.355  1.00 147.28 ? 212 TRP B CB    1 
ATOM   5850 C CG    . TRP B 2 226 ? 2.889   6.442  28.919  1.00 154.66 ? 212 TRP B CG    1 
ATOM   5851 C CD1   . TRP B 2 226 ? 3.921   7.047  28.207  1.00 161.62 ? 212 TRP B CD1   1 
ATOM   5852 C CD2   . TRP B 2 226 ? 1.771   6.354  27.966  1.00 150.32 ? 212 TRP B CD2   1 
ATOM   5853 N NE1   . TRP B 2 226 ? 3.530   7.334  26.923  1.00 163.22 ? 212 TRP B NE1   1 
ATOM   5854 C CE2   . TRP B 2 226 ? 2.255   6.945  26.712  1.00 157.74 ? 212 TRP B CE2   1 
ATOM   5855 C CE3   . TRP B 2 226 ? 0.469   5.866  28.024  1.00 142.02 ? 212 TRP B CE3   1 
ATOM   5856 C CZ2   . TRP B 2 226 ? 1.452   7.032  25.582  1.00 153.83 ? 212 TRP B CZ2   1 
ATOM   5857 C CZ3   . TRP B 2 226 ? -0.331  5.960  26.877  1.00 142.55 ? 212 TRP B CZ3   1 
ATOM   5858 C CH2   . TRP B 2 226 ? 0.151   6.529  25.687  1.00 147.11 ? 212 TRP B CH2   1 
ATOM   5859 N N     . GLY B 2 227 ? 5.393   4.141  30.614  1.00 153.25 ? 213 GLY B N     1 
ATOM   5860 C CA    . GLY B 2 227 ? 6.700   3.676  30.157  1.00 152.63 ? 213 GLY B CA    1 
ATOM   5861 C C     . GLY B 2 227 ? 7.867   4.405  30.795  1.00 152.33 ? 213 GLY B C     1 
ATOM   5862 O O     . GLY B 2 227 ? 8.628   3.816  31.567  1.00 159.07 ? 213 GLY B O     1 
ATOM   5863 N N     . LEU B 2 228 ? 8.005   5.690  30.471  1.00 142.39 ? 214 LEU B N     1 
ATOM   5864 C CA    . LEU B 2 228 ? 9.131   6.496  30.946  1.00 143.25 ? 214 LEU B CA    1 
ATOM   5865 C C     . LEU B 2 228 ? 8.871   7.080  32.333  1.00 146.59 ? 214 LEU B C     1 
ATOM   5866 O O     . LEU B 2 228 ? 7.735   7.419  32.672  1.00 140.25 ? 214 LEU B O     1 
ATOM   5867 C CB    . LEU B 2 228 ? 9.467   7.625  29.957  1.00 151.81 ? 214 LEU B CB    1 
ATOM   5868 C CG    . LEU B 2 228 ? 9.679   7.402  28.447  1.00 149.65 ? 214 LEU B CG    1 
ATOM   5869 C CD1   . LEU B 2 228 ? 10.389  6.094  28.114  1.00 142.92 ? 214 LEU B CD1   1 
ATOM   5870 C CD2   . LEU B 2 228 ? 8.369   7.529  27.677  1.00 145.52 ? 214 LEU B CD2   1 
ATOM   5871 N N     . THR B 2 229 ? 9.937   7.198  33.124  1.00 147.15 ? 215 THR B N     1 
ATOM   5872 C CA    . THR B 2 229 ? 9.856   7.745  34.479  1.00 145.76 ? 215 THR B CA    1 
ATOM   5873 C C     . THR B 2 229 ? 9.697   9.262  34.459  1.00 142.53 ? 215 THR B C     1 
ATOM   5874 O O     . THR B 2 229 ? 9.022   9.837  35.313  1.00 132.98 ? 215 THR B O     1 
ATOM   5875 C CB    . THR B 2 229 ? 11.097  7.381  35.321  1.00 146.03 ? 215 THR B CB    1 
ATOM   5876 O OG1   . THR B 2 229 ? 12.287  7.750  34.611  1.00 149.31 ? 215 THR B OG1   1 
ATOM   5877 C CG2   . THR B 2 229 ? 11.130  5.887  35.621  1.00 145.64 ? 215 THR B CG2   1 
ATOM   5878 N N     . GLY B 2 245 ? 12.902  16.237 50.216  1.00 148.20 ? 231 GLY B N     1 
ATOM   5879 C CA    . GLY B 2 245 ? 11.619  16.802 49.815  1.00 151.63 ? 231 GLY B CA    1 
ATOM   5880 C C     . GLY B 2 245 ? 11.759  18.178 49.195  1.00 155.09 ? 231 GLY B C     1 
ATOM   5881 O O     . GLY B 2 245 ? 12.340  19.083 49.799  1.00 158.61 ? 231 GLY B O     1 
ATOM   5882 N N     . TYR B 2 246 ? 11.222  18.331 47.987  1.00 154.75 ? 232 TYR B N     1 
ATOM   5883 C CA    . TYR B 2 246 ? 11.276  19.597 47.261  1.00 150.85 ? 232 TYR B CA    1 
ATOM   5884 C C     . TYR B 2 246 ? 9.873   20.181 47.100  1.00 138.23 ? 232 TYR B C     1 
ATOM   5885 O O     . TYR B 2 246 ? 9.054   19.658 46.340  1.00 138.55 ? 232 TYR B O     1 
ATOM   5886 C CB    . TYR B 2 246 ? 11.946  19.403 45.896  1.00 152.35 ? 232 TYR B CB    1 
ATOM   5887 C CG    . TYR B 2 246 ? 12.458  20.679 45.263  1.00 156.43 ? 232 TYR B CG    1 
ATOM   5888 C CD1   . TYR B 2 246 ? 13.721  21.180 45.581  1.00 161.94 ? 232 TYR B CD1   1 
ATOM   5889 C CD2   . TYR B 2 246 ? 11.685  21.382 44.339  1.00 146.85 ? 232 TYR B CD2   1 
ATOM   5890 C CE1   . TYR B 2 246 ? 14.197  22.347 45.002  1.00 160.83 ? 232 TYR B CE1   1 
ATOM   5891 C CE2   . TYR B 2 246 ? 12.152  22.550 43.755  1.00 148.29 ? 232 TYR B CE2   1 
ATOM   5892 C CZ    . TYR B 2 246 ? 13.409  23.027 44.091  1.00 153.62 ? 232 TYR B CZ    1 
ATOM   5893 O OH    . TYR B 2 246 ? 13.877  24.186 43.514  1.00 143.70 ? 232 TYR B OH    1 
ATOM   5894 N N     . GLU B 2 247 ? 9.605   21.262 47.830  1.00 141.20 ? 233 GLU B N     1 
ATOM   5895 C CA    . GLU B 2 247 ? 8.293   21.915 47.815  1.00 141.55 ? 233 GLU B CA    1 
ATOM   5896 C C     . GLU B 2 247 ? 8.395   23.436 47.933  1.00 150.55 ? 233 GLU B C     1 
ATOM   5897 O O     . GLU B 2 247 ? 9.325   23.962 48.552  1.00 160.66 ? 233 GLU B O     1 
ATOM   5898 C CB    . GLU B 2 247 ? 7.386   21.346 48.917  1.00 145.45 ? 233 GLU B CB    1 
ATOM   5899 C CG    . GLU B 2 247 ? 7.944   21.450 50.332  1.00 150.86 ? 233 GLU B CG    1 
ATOM   5900 C CD    . GLU B 2 247 ? 7.006   20.884 51.385  1.00 151.95 ? 233 GLU B CD    1 
ATOM   5901 O OE1   . GLU B 2 247 ? 6.429   19.797 51.161  1.00 150.16 ? 233 GLU B OE1   1 
ATOM   5902 O OE2   . GLU B 2 247 ? 6.854   21.523 52.447  1.00 151.99 ? 233 GLU B OE2   1 
ATOM   5903 N N     . LEU B 2 248 ? 7.432   24.131 47.332  1.00 157.46 ? 234 LEU B N     1 
ATOM   5904 C CA    . LEU B 2 248 ? 7.374   25.592 47.370  1.00 157.93 ? 234 LEU B CA    1 
ATOM   5905 C C     . LEU B 2 248 ? 6.006   26.081 47.841  1.00 147.98 ? 234 LEU B C     1 
ATOM   5906 O O     . LEU B 2 248 ? 4.992   25.412 47.631  1.00 143.35 ? 234 LEU B O     1 
ATOM   5907 C CB    . LEU B 2 248 ? 7.701   26.191 45.996  1.00 154.35 ? 234 LEU B CB    1 
ATOM   5908 C CG    . LEU B 2 248 ? 9.143   26.126 45.481  1.00 157.71 ? 234 LEU B CG    1 
ATOM   5909 C CD1   . LEU B 2 248 ? 9.402   24.838 44.714  1.00 157.24 ? 234 LEU B CD1   1 
ATOM   5910 C CD2   . LEU B 2 248 ? 9.439   27.328 44.598  1.00 150.24 ? 234 LEU B CD2   1 
ATOM   5911 N N     . HIS B 2 249 ? 5.991   27.251 48.479  1.00 150.12 ? 235 HIS B N     1 
ATOM   5912 C CA    . HIS B 2 249 ? 4.755   27.855 48.972  1.00 148.94 ? 235 HIS B CA    1 
ATOM   5913 C C     . HIS B 2 249 ? 4.408   29.096 48.190  1.00 151.04 ? 235 HIS B C     1 
ATOM   5914 O O     . HIS B 2 249 ? 5.036   30.142 48.375  1.00 152.86 ? 235 HIS B O     1 
ATOM   5915 C CB    . HIS B 2 249 ? 4.864   28.170 50.461  1.00 148.48 ? 235 HIS B CB    1 
ATOM   5916 C CG    . HIS B 2 249 ? 5.104   26.955 51.326  1.00 153.22 ? 235 HIS B CG    1 
ATOM   5917 N ND1   . HIS B 2 249 ? 4.100   26.238 51.861  1.00 143.10 ? 235 HIS B ND1   1 
ATOM   5918 C CD2   . HIS B 2 249 ? 6.288   26.345 51.739  1.00 147.37 ? 235 HIS B CD2   1 
ATOM   5919 C CE1   . HIS B 2 249 ? 4.610   25.219 52.580  1.00 132.44 ? 235 HIS B CE1   1 
ATOM   5920 N NE2   . HIS B 2 249 ? 5.949   25.286 52.504  1.00 138.11 ? 235 HIS B NE2   1 
ATOM   5921 N N     . PRO B 2 250 ? 3.405   28.996 47.295  1.00 150.26 ? 236 PRO B N     1 
ATOM   5922 C CA    . PRO B 2 250 ? 2.982   30.137 46.476  1.00 149.98 ? 236 PRO B CA    1 
ATOM   5923 C C     . PRO B 2 250 ? 2.187   31.187 47.256  1.00 146.12 ? 236 PRO B C     1 
ATOM   5924 O O     . PRO B 2 250 ? 2.160   32.355 46.860  1.00 143.86 ? 236 PRO B O     1 
ATOM   5925 C CB    . PRO B 2 250 ? 2.107   29.493 45.398  1.00 145.33 ? 236 PRO B CB    1 
ATOM   5926 C CG    . PRO B 2 250 ? 1.587   28.248 46.025  1.00 147.00 ? 236 PRO B CG    1 
ATOM   5927 C CD    . PRO B 2 250 ? 2.660   27.767 46.958  1.00 149.86 ? 236 PRO B CD    1 
ATOM   5928 N N     . ASP B 2 251 ? 1.551   30.769 48.348  1.00 144.73 ? 237 ASP B N     1 
ATOM   5929 C CA    . ASP B 2 251 ? 0.777   31.673 49.200  1.00 149.53 ? 237 ASP B CA    1 
ATOM   5930 C C     . ASP B 2 251 ? 1.672   32.509 50.118  1.00 150.33 ? 237 ASP B C     1 
ATOM   5931 O O     . ASP B 2 251 ? 1.251   33.552 50.624  1.00 153.12 ? 237 ASP B O     1 
ATOM   5932 C CB    . ASP B 2 251 ? -0.253  30.890 50.026  1.00 150.08 ? 237 ASP B CB    1 
ATOM   5933 C CG    . ASP B 2 251 ? 0.386   29.873 50.962  1.00 148.48 ? 237 ASP B CG    1 
ATOM   5934 O OD1   . ASP B 2 251 ? 1.214   29.059 50.498  1.00 146.87 ? 237 ASP B OD1   1 
ATOM   5935 O OD2   . ASP B 2 251 ? 0.049   29.883 52.165  1.00 147.43 ? 237 ASP B OD2   1 
ATOM   5936 N N     . LYS B 2 252 ? 2.904   32.045 50.321  1.00 148.94 ? 238 LYS B N     1 
ATOM   5937 C CA    . LYS B 2 252 ? 3.865   32.720 51.194  1.00 151.12 ? 238 LYS B CA    1 
ATOM   5938 C C     . LYS B 2 252 ? 4.765   33.711 50.448  1.00 155.85 ? 238 LYS B C     1 
ATOM   5939 O O     . LYS B 2 252 ? 5.726   34.236 51.020  1.00 156.55 ? 238 LYS B O     1 
ATOM   5940 C CB    . LYS B 2 252 ? 4.712   31.693 51.957  1.00 149.46 ? 238 LYS B CB    1 
ATOM   5941 C CG    . LYS B 2 252 ? 3.957   30.943 53.043  1.00 144.38 ? 238 LYS B CG    1 
ATOM   5942 C CD    . LYS B 2 252 ? 4.876   30.003 53.808  1.00 146.40 ? 238 LYS B CD    1 
ATOM   5943 C CE    . LYS B 2 252 ? 4.121   29.256 54.895  1.00 145.08 ? 238 LYS B CE    1 
ATOM   5944 N NZ    . LYS B 2 252 ? 5.008   28.332 55.653  1.00 144.41 ? 238 LYS B NZ    1 
ATOM   5945 N N     . TRP B 2 253 ? 4.448   33.971 49.180  1.00 156.16 ? 239 TRP B N     1 
ATOM   5946 C CA    . TRP B 2 253 ? 5.179   34.964 48.388  1.00 144.17 ? 239 TRP B CA    1 
ATOM   5947 C C     . TRP B 2 253 ? 4.526   36.320 48.460  1.00 146.92 ? 239 TRP B C     1 
ATOM   5948 O O     . TRP B 2 253 ? 4.364   37.002 47.443  1.00 141.01 ? 239 TRP B O     1 
ATOM   5949 C CB    . TRP B 2 253 ? 5.325   34.515 46.932  1.00 146.53 ? 239 TRP B CB    1 
ATOM   5950 C CG    . TRP B 2 253 ? 6.042   33.197 46.737  1.00 156.02 ? 239 TRP B CG    1 
ATOM   5951 C CD1   . TRP B 2 253 ? 7.010   32.619 47.558  1.00 159.94 ? 239 TRP B CD1   1 
ATOM   5952 C CD2   . TRP B 2 253 ? 5.889   32.258 45.614  1.00 161.77 ? 239 TRP B CD2   1 
ATOM   5953 N NE1   . TRP B 2 253 ? 7.437   31.420 47.045  1.00 160.05 ? 239 TRP B NE1   1 
ATOM   5954 C CE2   . TRP B 2 253 ? 6.808   31.144 45.882  1.00 162.05 ? 239 TRP B CE2   1 
ATOM   5955 C CE3   . TRP B 2 253 ? 5.108   32.227 44.462  1.00 157.42 ? 239 TRP B CE3   1 
ATOM   5956 C CZ2   . TRP B 2 253 ? 6.921   30.061 45.021  1.00 160.42 ? 239 TRP B CZ2   1 
ATOM   5957 C CZ3   . TRP B 2 253 ? 5.231   31.127 43.603  1.00 160.63 ? 239 TRP B CZ3   1 
ATOM   5958 C CH2   . TRP B 2 253 ? 6.117   30.072 43.877  1.00 164.15 ? 239 TRP B CH2   1 
ATOM   5959 N N     . THR B 2 254 ? 4.147   36.723 49.672  1.00 150.23 ? 240 THR B N     1 
ATOM   5960 C CA    . THR B 2 254 ? 3.522   38.024 49.908  1.00 149.95 ? 240 THR B CA    1 
ATOM   5961 C C     . THR B 2 254 ? 4.551   39.148 49.830  1.00 153.80 ? 240 THR B C     1 
ATOM   5962 O O     . THR B 2 254 ? 5.699   38.981 50.252  1.00 154.96 ? 240 THR B O     1 
ATOM   5963 C CB    . THR B 2 254 ? 2.807   38.081 51.274  1.00 149.97 ? 240 THR B CB    1 
ATOM   5964 O OG1   . THR B 2 254 ? 3.698   37.638 52.306  1.00 150.76 ? 240 THR B OG1   1 
ATOM   5965 C CG2   . THR B 2 254 ? 1.561   37.202 51.270  1.00 148.56 ? 240 THR B CG2   1 
ATOM   5966 N N     . VAL B 2 255 ? 4.130   40.288 49.286  1.00 158.55 ? 241 VAL B N     1 
ATOM   5967 C CA    . VAL B 2 255 ? 5.004   41.450 49.121  1.00 154.83 ? 241 VAL B CA    1 
ATOM   5968 C C     . VAL B 2 255 ? 5.308   42.091 50.476  1.00 158.38 ? 241 VAL B C     1 
ATOM   5969 O O     . VAL B 2 255 ? 4.418   42.640 51.132  1.00 160.53 ? 241 VAL B O     1 
ATOM   5970 C CB    . VAL B 2 255 ? 4.396   42.495 48.153  1.00 144.26 ? 241 VAL B CB    1 
ATOM   5971 C CG1   . VAL B 2 255 ? 5.334   43.682 47.977  1.00 140.45 ? 241 VAL B CG1   1 
ATOM   5972 C CG2   . VAL B 2 255 ? 4.086   41.864 46.803  1.00 140.75 ? 241 VAL B CG2   1 
ATOM   5973 N N     . GLN B 2 256 ? 6.571   42.003 50.887  1.00 153.66 ? 242 GLN B N     1 
ATOM   5974 C CA    . GLN B 2 256 ? 7.022   42.582 52.150  1.00 154.80 ? 242 GLN B CA    1 
ATOM   5975 C C     . GLN B 2 256 ? 7.256   44.086 52.001  1.00 157.33 ? 242 GLN B C     1 
ATOM   5976 O O     . GLN B 2 256 ? 8.048   44.508 51.154  1.00 148.09 ? 242 GLN B O     1 
ATOM   5977 C CB    . GLN B 2 256 ? 8.293   41.885 52.648  1.00 152.28 ? 242 GLN B CB    1 
ATOM   5978 C CG    . GLN B 2 256 ? 8.078   40.455 53.126  1.00 154.42 ? 242 GLN B CG    1 
ATOM   5979 C CD    . GLN B 2 256 ? 9.348   39.803 53.646  1.00 149.18 ? 242 GLN B CD    1 
ATOM   5980 O OE1   . GLN B 2 256 ? 10.438  40.012 53.109  1.00 145.60 ? 242 GLN B OE1   1 
ATOM   5981 N NE2   . GLN B 2 256 ? 9.210   38.998 54.693  1.00 145.05 ? 242 GLN B NE2   1 
ATOM   5982 N N     . PRO B 2 257 ? 6.557   44.898 52.819  1.00 163.77 ? 243 PRO B N     1 
ATOM   5983 C CA    . PRO B 2 257 ? 6.671   46.357 52.747  1.00 162.92 ? 243 PRO B CA    1 
ATOM   5984 C C     . PRO B 2 257 ? 8.008   46.879 53.271  1.00 162.42 ? 243 PRO B C     1 
ATOM   5985 O O     . PRO B 2 257 ? 8.554   46.337 54.236  1.00 160.08 ? 243 PRO B O     1 
ATOM   5986 C CB    . PRO B 2 257 ? 5.523   46.843 53.637  1.00 157.72 ? 243 PRO B CB    1 
ATOM   5987 C CG    . PRO B 2 257 ? 5.285   45.728 54.596  1.00 156.37 ? 243 PRO B CG    1 
ATOM   5988 C CD    . PRO B 2 257 ? 5.577   44.468 53.835  1.00 158.89 ? 243 PRO B CD    1 
ATOM   5989 N N     . ILE B 2 258 ? 8.524   47.923 52.626  1.00 161.64 ? 244 ILE B N     1 
ATOM   5990 C CA    . ILE B 2 258 ? 9.767   48.565 53.046  1.00 155.55 ? 244 ILE B CA    1 
ATOM   5991 C C     . ILE B 2 258 ? 9.466   49.558 54.169  1.00 156.82 ? 244 ILE B C     1 
ATOM   5992 O O     . ILE B 2 258 ? 8.739   50.534 53.969  1.00 151.86 ? 244 ILE B O     1 
ATOM   5993 C CB    . ILE B 2 258 ? 10.487  49.276 51.871  1.00 147.18 ? 244 ILE B CB    1 
ATOM   5994 C CG1   . ILE B 2 258 ? 10.851  48.284 50.758  1.00 141.41 ? 244 ILE B CG1   1 
ATOM   5995 C CG2   . ILE B 2 258 ? 11.746  49.987 52.351  1.00 144.46 ? 244 ILE B CG2   1 
ATOM   5996 C CD1   . ILE B 2 258 ? 9.833   48.193 49.639  1.00 139.43 ? 244 ILE B CD1   1 
ATOM   5997 N N     . VAL B 2 259 ? 10.024  49.292 55.347  1.00 162.38 ? 245 VAL B N     1 
ATOM   5998 C CA    . VAL B 2 259 ? 9.794   50.130 56.526  1.00 161.23 ? 245 VAL B CA    1 
ATOM   5999 C C     . VAL B 2 259 ? 10.972  51.058 56.821  1.00 162.69 ? 245 VAL B C     1 
ATOM   6000 O O     . VAL B 2 259 ? 12.135  50.674 56.667  1.00 161.33 ? 245 VAL B O     1 
ATOM   6001 C CB    . VAL B 2 259 ? 9.448   49.294 57.785  1.00 156.89 ? 245 VAL B CB    1 
ATOM   6002 C CG1   . VAL B 2 259 ? 8.020   48.771 57.704  1.00 155.17 ? 245 VAL B CG1   1 
ATOM   6003 C CG2   . VAL B 2 259 ? 10.436  48.150 57.984  1.00 150.78 ? 245 VAL B CG2   1 
ATOM   6004 N N     . LEU B 2 260 ? 10.655  52.282 57.238  1.00 160.75 ? 246 LEU B N     1 
ATOM   6005 C CA    . LEU B 2 260 ? 11.665  53.276 57.594  1.00 154.81 ? 246 LEU B CA    1 
ATOM   6006 C C     . LEU B 2 260 ? 12.127  53.084 59.040  1.00 160.78 ? 246 LEU B C     1 
ATOM   6007 O O     . LEU B 2 260 ? 11.309  52.776 59.911  1.00 156.35 ? 246 LEU B O     1 
ATOM   6008 C CB    . LEU B 2 260 ? 11.123  54.697 57.390  1.00 143.24 ? 246 LEU B CB    1 
ATOM   6009 C CG    . LEU B 2 260 ? 10.734  55.143 55.973  1.00 138.48 ? 246 LEU B CG    1 
ATOM   6010 C CD1   . LEU B 2 260 ? 10.006  56.479 56.019  1.00 130.09 ? 246 LEU B CD1   1 
ATOM   6011 C CD2   . LEU B 2 260 ? 11.944  55.222 55.051  1.00 140.11 ? 246 LEU B CD2   1 
ATOM   6012 N N     . PRO B 2 261 ? 13.441  53.260 59.298  1.00 162.49 ? 247 PRO B N     1 
ATOM   6013 C CA    . PRO B 2 261 ? 14.000  53.095 60.644  1.00 160.64 ? 247 PRO B CA    1 
ATOM   6014 C C     . PRO B 2 261 ? 13.422  54.090 61.649  1.00 160.42 ? 247 PRO B C     1 
ATOM   6015 O O     . PRO B 2 261 ? 13.358  55.291 61.370  1.00 155.90 ? 247 PRO B O     1 
ATOM   6016 C CB    . PRO B 2 261 ? 15.498  53.357 60.442  1.00 151.68 ? 247 PRO B CB    1 
ATOM   6017 C CG    . PRO B 2 261 ? 15.741  53.104 58.995  1.00 154.41 ? 247 PRO B CG    1 
ATOM   6018 C CD    . PRO B 2 261 ? 14.491  53.563 58.308  1.00 160.72 ? 247 PRO B CD    1 
ATOM   6019 N N     . GLU B 2 262 ? 13.001  53.580 62.805  1.00 163.11 ? 248 GLU B N     1 
ATOM   6020 C CA    . GLU B 2 262 ? 12.430  54.407 63.864  1.00 159.79 ? 248 GLU B CA    1 
ATOM   6021 C C     . GLU B 2 262 ? 13.520  54.889 64.818  1.00 158.45 ? 248 GLU B C     1 
ATOM   6022 O O     . GLU B 2 262 ? 14.330  54.094 65.304  1.00 157.65 ? 248 GLU B O     1 
ATOM   6023 C CB    . GLU B 2 262 ? 11.350  53.631 64.627  1.00 150.48 ? 248 GLU B CB    1 
ATOM   6024 C CG    . GLU B 2 262 ? 10.468  54.483 65.533  1.00 149.77 ? 248 GLU B CG    1 
ATOM   6025 C CD    . GLU B 2 262 ? 9.506   55.377 64.767  1.00 156.09 ? 248 GLU B CD    1 
ATOM   6026 O OE1   . GLU B 2 262 ? 8.902   54.909 63.777  1.00 146.36 ? 248 GLU B OE1   1 
ATOM   6027 O OE2   . GLU B 2 262 ? 9.347   56.551 65.163  1.00 167.02 ? 248 GLU B OE2   1 
ATOM   6028 N N     . LYS B 2 263 ? 13.533  56.194 65.075  1.00 154.59 ? 249 LYS B N     1 
ATOM   6029 C CA    . LYS B 2 263 ? 14.524  56.808 65.955  1.00 148.84 ? 249 LYS B CA    1 
ATOM   6030 C C     . LYS B 2 263 ? 13.874  57.841 66.874  1.00 151.34 ? 249 LYS B C     1 
ATOM   6031 O O     . LYS B 2 263 ? 13.030  58.628 66.438  1.00 150.52 ? 249 LYS B O     1 
ATOM   6032 C CB    . LYS B 2 263 ? 15.643  57.455 65.129  1.00 139.25 ? 249 LYS B CB    1 
ATOM   6033 C CG    . LYS B 2 263 ? 16.928  57.744 65.900  1.00 137.39 ? 249 LYS B CG    1 
ATOM   6034 C CD    . LYS B 2 263 ? 17.781  56.497 66.110  1.00 140.45 ? 249 LYS B CD    1 
ATOM   6035 C CE    . LYS B 2 263 ? 18.568  56.116 64.863  1.00 147.40 ? 249 LYS B CE    1 
ATOM   6036 N NZ    . LYS B 2 263 ? 19.650  57.091 64.547  1.00 140.11 ? 249 LYS B NZ    1 
ATOM   6037 N N     . ASP B 2 264 ? 14.275  57.826 68.144  1.00 153.04 ? 250 ASP B N     1 
ATOM   6038 C CA    . ASP B 2 264 ? 13.745  58.751 69.145  1.00 157.77 ? 250 ASP B CA    1 
ATOM   6039 C C     . ASP B 2 264 ? 14.312  60.160 68.968  1.00 157.31 ? 250 ASP B C     1 
ATOM   6040 O O     . ASP B 2 264 ? 13.566  61.142 68.987  1.00 160.51 ? 250 ASP B O     1 
ATOM   6041 C CB    . ASP B 2 264 ? 14.028  58.230 70.561  1.00 159.89 ? 250 ASP B CB    1 
ATOM   6042 C CG    . ASP B 2 264 ? 13.325  59.041 71.639  1.00 155.59 ? 250 ASP B CG    1 
ATOM   6043 O OD1   . ASP B 2 264 ? 12.114  59.320 71.495  1.00 143.68 ? 250 ASP B OD1   1 
ATOM   6044 O OD2   . ASP B 2 264 ? 13.984  59.391 72.641  1.00 158.39 ? 250 ASP B OD2   1 
ATOM   6045 N N     . SER B 2 265 ? 15.630  60.248 68.798  1.00 153.64 ? 251 SER B N     1 
ATOM   6046 C CA    . SER B 2 265 ? 16.308  61.525 68.585  1.00 149.76 ? 251 SER B CA    1 
ATOM   6047 C C     . SER B 2 265 ? 16.965  61.571 67.207  1.00 148.86 ? 251 SER B C     1 
ATOM   6048 O O     . SER B 2 265 ? 17.912  60.829 66.933  1.00 159.90 ? 251 SER B O     1 
ATOM   6049 C CB    . SER B 2 265 ? 17.343  61.780 69.687  1.00 149.47 ? 251 SER B CB    1 
ATOM   6050 O OG    . SER B 2 265 ? 18.317  60.751 69.724  1.00 162.93 ? 251 SER B OG    1 
ATOM   6051 N N     . TRP B 2 266 ? 16.449  62.445 66.346  1.00 143.26 ? 252 TRP B N     1 
ATOM   6052 C CA    . TRP B 2 266 ? 16.943  62.578 64.977  1.00 145.16 ? 252 TRP B CA    1 
ATOM   6053 C C     . TRP B 2 266 ? 18.024  63.614 64.870  1.00 151.75 ? 252 TRP B C     1 
ATOM   6054 O O     . TRP B 2 266 ? 17.846  64.759 65.294  1.00 151.70 ? 252 TRP B O     1 
ATOM   6055 C CB    . TRP B 2 266 ? 15.799  62.905 64.021  1.00 138.22 ? 252 TRP B CB    1 
ATOM   6056 C CG    . TRP B 2 266 ? 14.785  61.794 63.882  1.00 151.70 ? 252 TRP B CG    1 
ATOM   6057 C CD1   . TRP B 2 266 ? 13.703  61.521 64.717  1.00 157.84 ? 252 TRP B CD1   1 
ATOM   6058 C CD2   . TRP B 2 266 ? 14.721  60.766 62.831  1.00 153.22 ? 252 TRP B CD2   1 
ATOM   6059 N NE1   . TRP B 2 266 ? 13.000  60.430 64.270  1.00 158.97 ? 252 TRP B NE1   1 
ATOM   6060 C CE2   . TRP B 2 266 ? 13.555  59.930 63.145  1.00 154.66 ? 252 TRP B CE2   1 
ATOM   6061 C CE3   . TRP B 2 266 ? 15.484  60.466 61.706  1.00 153.05 ? 252 TRP B CE3   1 
ATOM   6062 C CZ2   . TRP B 2 266 ? 13.190  58.849 62.354  1.00 151.39 ? 252 TRP B CZ2   1 
ATOM   6063 C CZ3   . TRP B 2 266 ? 15.105  59.372 60.916  1.00 152.51 ? 252 TRP B CZ3   1 
ATOM   6064 C CH2   . TRP B 2 266 ? 13.986  58.585 61.234  1.00 150.11 ? 252 TRP B CH2   1 
ATOM   6065 N N     . THR B 2 267 ? 19.158  63.212 64.302  1.00 158.22 ? 253 THR B N     1 
ATOM   6066 C CA    . THR B 2 267 ? 20.291  64.112 64.080  1.00 153.57 ? 253 THR B CA    1 
ATOM   6067 C C     . THR B 2 267 ? 20.380  64.520 62.609  1.00 154.74 ? 253 THR B C     1 
ATOM   6068 O O     . THR B 2 267 ? 19.725  63.921 61.753  1.00 154.52 ? 253 THR B O     1 
ATOM   6069 C CB    . THR B 2 267 ? 21.626  63.475 64.524  1.00 147.31 ? 253 THR B CB    1 
ATOM   6070 O OG1   . THR B 2 267 ? 21.777  62.190 63.909  1.00 148.21 ? 253 THR B OG1   1 
ATOM   6071 C CG2   . THR B 2 267 ? 21.675  63.320 66.040  1.00 137.75 ? 253 THR B CG2   1 
ATOM   6072 N N     . VAL B 2 268 ? 21.195  65.537 62.329  1.00 154.96 ? 254 VAL B N     1 
ATOM   6073 C CA    . VAL B 2 268 ? 21.385  66.060 60.969  1.00 154.55 ? 254 VAL B CA    1 
ATOM   6074 C C     . VAL B 2 268 ? 21.900  64.981 60.010  1.00 150.55 ? 254 VAL B C     1 
ATOM   6075 O O     . VAL B 2 268 ? 21.463  64.906 58.859  1.00 149.62 ? 254 VAL B O     1 
ATOM   6076 C CB    . VAL B 2 268 ? 22.327  67.290 60.959  1.00 151.57 ? 254 VAL B CB    1 
ATOM   6077 C CG1   . VAL B 2 268 ? 22.468  67.865 59.555  1.00 146.16 ? 254 VAL B CG1   1 
ATOM   6078 C CG2   . VAL B 2 268 ? 21.817  68.364 61.910  1.00 145.26 ? 254 VAL B CG2   1 
ATOM   6079 N N     . ASN B 2 269 ? 22.816  64.144 60.499  1.00 149.85 ? 255 ASN B N     1 
ATOM   6080 C CA    . ASN B 2 269 ? 23.373  63.037 59.720  1.00 151.55 ? 255 ASN B CA    1 
ATOM   6081 C C     . ASN B 2 269 ? 22.326  61.985 59.344  1.00 146.90 ? 255 ASN B C     1 
ATOM   6082 O O     . ASN B 2 269 ? 22.409  61.371 58.278  1.00 147.07 ? 255 ASN B O     1 
ATOM   6083 C CB    . ASN B 2 269 ? 24.535  62.384 60.476  1.00 157.20 ? 255 ASN B CB    1 
ATOM   6084 C CG    . ASN B 2 269 ? 25.354  61.447 59.604  1.00 160.93 ? 255 ASN B CG    1 
ATOM   6085 O OD1   . ASN B 2 269 ? 25.561  60.284 59.951  1.00 161.07 ? 255 ASN B OD1   1 
ATOM   6086 N ND2   . ASN B 2 269 ? 25.825  61.949 58.466  1.00 160.91 ? 255 ASN B ND2   1 
ATOM   6087 N N     . ASP B 2 270 ? 21.348  61.786 60.227  1.00 143.50 ? 256 ASP B N     1 
ATOM   6088 C CA    . ASP B 2 270 ? 20.254  60.844 59.990  1.00 143.36 ? 256 ASP B CA    1 
ATOM   6089 C C     . ASP B 2 270 ? 19.246  61.375 58.970  1.00 148.67 ? 256 ASP B C     1 
ATOM   6090 O O     . ASP B 2 270 ? 18.658  60.601 58.212  1.00 153.92 ? 256 ASP B O     1 
ATOM   6091 C CB    . ASP B 2 270 ? 19.542  60.499 61.303  1.00 146.92 ? 256 ASP B CB    1 
ATOM   6092 C CG    . ASP B 2 270 ? 20.423  59.712 62.263  1.00 140.69 ? 256 ASP B CG    1 
ATOM   6093 O OD1   . ASP B 2 270 ? 21.213  58.859 61.803  1.00 134.85 ? 256 ASP B OD1   1 
ATOM   6094 O OD2   . ASP B 2 270 ? 20.316  59.942 63.486  1.00 141.56 ? 256 ASP B OD2   1 
ATOM   6095 N N     . ILE B 2 271 ? 19.053  62.694 58.961  1.00 147.66 ? 257 ILE B N     1 
ATOM   6096 C CA    . ILE B 2 271 ? 18.135  63.350 58.026  1.00 152.70 ? 257 ILE B CA    1 
ATOM   6097 C C     . ILE B 2 271 ? 18.721  63.380 56.610  1.00 150.62 ? 257 ILE B C     1 
ATOM   6098 O O     . ILE B 2 271 ? 18.021  63.079 55.640  1.00 152.61 ? 257 ILE B O     1 
ATOM   6099 C CB    . ILE B 2 271 ? 17.758  64.783 58.492  1.00 151.05 ? 257 ILE B CB    1 
ATOM   6100 C CG1   . ILE B 2 271 ? 17.137  64.769 59.902  1.00 154.42 ? 257 ILE B CG1   1 
ATOM   6101 C CG2   . ILE B 2 271 ? 16.836  65.472 57.490  1.00 149.12 ? 257 ILE B CG2   1 
ATOM   6102 C CD1   . ILE B 2 271 ? 15.851  63.973 60.047  1.00 154.74 ? 257 ILE B CD1   1 
ATOM   6103 N N     . GLN B 2 272 ? 20.004  63.730 56.507  1.00 148.59 ? 258 GLN B N     1 
ATOM   6104 C CA    . GLN B 2 272 ? 20.704  63.820 55.219  1.00 153.38 ? 258 GLN B CA    1 
ATOM   6105 C C     . GLN B 2 272 ? 20.689  62.508 54.433  1.00 151.94 ? 258 GLN B C     1 
ATOM   6106 O O     . GLN B 2 272 ? 20.605  62.517 53.203  1.00 150.12 ? 258 GLN B O     1 
ATOM   6107 C CB    . GLN B 2 272 ? 22.145  64.301 55.417  1.00 153.03 ? 258 GLN B CB    1 
ATOM   6108 C CG    . GLN B 2 272 ? 22.274  65.788 55.716  1.00 155.41 ? 258 GLN B CG    1 
ATOM   6109 C CD    . GLN B 2 272 ? 23.714  66.246 55.878  1.00 152.13 ? 258 GLN B CD    1 
ATOM   6110 O OE1   . GLN B 2 272 ? 24.657  65.507 55.584  1.00 150.93 ? 258 GLN B OE1   1 
ATOM   6111 N NE2   . GLN B 2 272 ? 23.890  67.476 56.345  1.00 154.69 ? 258 GLN B NE2   1 
ATOM   6112 N N     . LYS B 2 273 ? 20.773  61.388 55.149  1.00 147.43 ? 259 LYS B N     1 
ATOM   6113 C CA    . LYS B 2 273 ? 20.686  60.062 54.537  1.00 147.20 ? 259 LYS B CA    1 
ATOM   6114 C C     . LYS B 2 273 ? 19.244  59.711 54.172  1.00 147.83 ? 259 LYS B C     1 
ATOM   6115 O O     . LYS B 2 273 ? 19.003  59.005 53.192  1.00 150.43 ? 259 LYS B O     1 
ATOM   6116 C CB    . LYS B 2 273 ? 21.264  58.991 55.467  1.00 155.36 ? 259 LYS B CB    1 
ATOM   6117 C CG    . LYS B 2 273 ? 22.763  59.101 55.711  1.00 158.85 ? 259 LYS B CG    1 
ATOM   6118 C CD    . LYS B 2 273 ? 23.322  57.861 56.400  1.00 159.61 ? 259 LYS B CD    1 
ATOM   6119 C CE    . LYS B 2 273 ? 22.909  57.766 57.863  1.00 155.89 ? 259 LYS B CE    1 
ATOM   6120 N NZ    . LYS B 2 273 ? 23.532  58.822 58.709  1.00 159.64 ? 259 LYS B NZ    1 
ATOM   6121 N N     . LEU B 2 274 ? 18.297  60.210 54.966  1.00 151.54 ? 260 LEU B N     1 
ATOM   6122 C CA    . LEU B 2 274 ? 16.873  59.936 54.765  1.00 147.74 ? 260 LEU B CA    1 
ATOM   6123 C C     . LEU B 2 274 ? 16.304  60.672 53.551  1.00 152.47 ? 260 LEU B C     1 
ATOM   6124 O O     . LEU B 2 274 ? 15.493  60.115 52.809  1.00 150.71 ? 260 LEU B O     1 
ATOM   6125 C CB    . LEU B 2 274 ? 16.075  60.289 56.028  1.00 150.11 ? 260 LEU B CB    1 
ATOM   6126 C CG    . LEU B 2 274 ? 14.618  59.822 56.140  1.00 144.89 ? 260 LEU B CG    1 
ATOM   6127 C CD1   . LEU B 2 274 ? 14.529  58.326 56.407  1.00 141.00 ? 260 LEU B CD1   1 
ATOM   6128 C CD2   . LEU B 2 274 ? 13.898  60.599 57.232  1.00 149.66 ? 260 LEU B CD2   1 
ATOM   6129 N N     . VAL B 2 275 ? 16.731  61.919 53.357  1.00 154.80 ? 261 VAL B N     1 
ATOM   6130 C CA    . VAL B 2 275 ? 16.278  62.738 52.228  1.00 148.78 ? 261 VAL B CA    1 
ATOM   6131 C C     . VAL B 2 275 ? 16.797  62.179 50.899  1.00 149.12 ? 261 VAL B C     1 
ATOM   6132 O O     . VAL B 2 275 ? 16.049  62.095 49.922  1.00 147.67 ? 261 VAL B O     1 
ATOM   6133 C CB    . VAL B 2 275 ? 16.682  64.225 52.396  1.00 142.37 ? 261 VAL B CB    1 
ATOM   6134 C CG1   . VAL B 2 275 ? 16.288  65.046 51.175  1.00 143.75 ? 261 VAL B CG1   1 
ATOM   6135 C CG2   . VAL B 2 275 ? 16.045  64.817 53.645  1.00 144.06 ? 261 VAL B CG2   1 
ATOM   6136 N N     . GLY B 2 276 ? 18.069  61.783 50.881  1.00 146.26 ? 262 GLY B N     1 
ATOM   6137 C CA    . GLY B 2 276 ? 18.716  61.250 49.680  1.00 146.01 ? 262 GLY B CA    1 
ATOM   6138 C C     . GLY B 2 276 ? 18.141  59.938 49.173  1.00 151.15 ? 262 GLY B C     1 
ATOM   6139 O O     . GLY B 2 276 ? 18.084  59.708 47.962  1.00 153.92 ? 262 GLY B O     1 
ATOM   6140 N N     . LYS B 2 277 ? 17.718  59.080 50.099  1.00 157.58 ? 263 LYS B N     1 
ATOM   6141 C CA    . LYS B 2 277 ? 17.145  57.776 49.756  1.00 158.36 ? 263 LYS B CA    1 
ATOM   6142 C C     . LYS B 2 277 ? 15.714  57.888 49.229  1.00 158.93 ? 263 LYS B C     1 
ATOM   6143 O O     . LYS B 2 277 ? 15.340  57.189 48.285  1.00 160.23 ? 263 LYS B O     1 
ATOM   6144 C CB    . LYS B 2 277 ? 17.193  56.828 50.959  1.00 151.23 ? 263 LYS B CB    1 
ATOM   6145 C CG    . LYS B 2 277 ? 18.585  56.318 51.300  1.00 146.70 ? 263 LYS B CG    1 
ATOM   6146 C CD    . LYS B 2 277 ? 18.577  55.516 52.592  1.00 147.17 ? 263 LYS B CD    1 
ATOM   6147 C CE    . LYS B 2 277 ? 19.987  55.146 53.021  1.00 145.13 ? 263 LYS B CE    1 
ATOM   6148 N NZ    . LYS B 2 277 ? 19.994  54.358 54.284  1.00 138.33 ? 263 LYS B NZ    1 
ATOM   6149 N N     . LEU B 2 278 ? 14.924  58.767 49.843  1.00 153.62 ? 264 LEU B N     1 
ATOM   6150 C CA    . LEU B 2 278 ? 13.526  58.967 49.454  1.00 148.18 ? 264 LEU B CA    1 
ATOM   6151 C C     . LEU B 2 278 ? 13.373  59.813 48.187  1.00 151.45 ? 264 LEU B C     1 
ATOM   6152 O O     . LEU B 2 278 ? 12.351  59.729 47.501  1.00 150.13 ? 264 LEU B O     1 
ATOM   6153 C CB    . LEU B 2 278 ? 12.714  59.571 50.612  1.00 146.29 ? 264 LEU B CB    1 
ATOM   6154 C CG    . LEU B 2 278 ? 12.073  58.669 51.685  1.00 144.15 ? 264 LEU B CG    1 
ATOM   6155 C CD1   . LEU B 2 278 ? 11.042  57.717 51.090  1.00 151.84 ? 264 LEU B CD1   1 
ATOM   6156 C CD2   . LEU B 2 278 ? 13.098  57.897 52.509  1.00 141.04 ? 264 LEU B CD2   1 
ATOM   6157 N N     . ASN B 2 279 ? 14.388  60.622 47.884  1.00 154.96 ? 265 ASN B N     1 
ATOM   6158 C CA    . ASN B 2 279 ? 14.417  61.417 46.654  1.00 155.39 ? 265 ASN B CA    1 
ATOM   6159 C C     . ASN B 2 279 ? 14.658  60.547 45.421  1.00 157.06 ? 265 ASN B C     1 
ATOM   6160 O O     . ASN B 2 279 ? 14.189  60.863 44.326  1.00 155.26 ? 265 ASN B O     1 
ATOM   6161 C CB    . ASN B 2 279 ? 15.481  62.517 46.744  1.00 145.03 ? 265 ASN B CB    1 
ATOM   6162 C CG    . ASN B 2 279 ? 15.424  63.490 45.577  1.00 146.12 ? 265 ASN B CG    1 
ATOM   6163 O OD1   . ASN B 2 279 ? 14.347  63.852 45.101  1.00 147.39 ? 265 ASN B OD1   1 
ATOM   6164 N ND2   . ASN B 2 279 ? 16.591  63.924 45.115  1.00 142.83 ? 265 ASN B ND2   1 
ATOM   6165 N N     . TRP B 2 280 ? 15.396  59.455 45.614  1.00 158.64 ? 266 TRP B N     1 
ATOM   6166 C CA    . TRP B 2 280 ? 15.643  58.473 44.562  1.00 153.81 ? 266 TRP B CA    1 
ATOM   6167 C C     . TRP B 2 280 ? 14.415  57.643 44.297  1.00 145.41 ? 266 TRP B C     1 
ATOM   6168 O O     . TRP B 2 280 ? 14.211  57.159 43.181  1.00 141.97 ? 266 TRP B O     1 
ATOM   6169 C CB    . TRP B 2 280 ? 16.822  57.582 44.943  1.00 156.34 ? 266 TRP B CB    1 
ATOM   6170 C CG    . TRP B 2 280 ? 17.212  56.580 43.881  1.00 155.65 ? 266 TRP B CG    1 
ATOM   6171 C CD1   . TRP B 2 280 ? 18.064  56.778 42.797  1.00 155.43 ? 266 TRP B CD1   1 
ATOM   6172 C CD2   . TRP B 2 280 ? 16.774  55.181 43.770  1.00 151.94 ? 266 TRP B CD2   1 
ATOM   6173 N NE1   . TRP B 2 280 ? 18.177  55.635 42.047  1.00 153.84 ? 266 TRP B NE1   1 
ATOM   6174 C CE2   . TRP B 2 280 ? 17.431  54.640 42.573  1.00 155.39 ? 266 TRP B CE2   1 
ATOM   6175 C CE3   . TRP B 2 280 ? 15.935  54.354 44.511  1.00 148.57 ? 266 TRP B CE3   1 
ATOM   6176 C CZ2   . TRP B 2 280 ? 17.242  53.328 42.159  1.00 154.97 ? 266 TRP B CZ2   1 
ATOM   6177 C CZ3   . TRP B 2 280 ? 15.752  53.033 44.083  1.00 146.33 ? 266 TRP B CZ3   1 
ATOM   6178 C CH2   . TRP B 2 280 ? 16.390  52.536 42.935  1.00 153.82 ? 266 TRP B CH2   1 
ATOM   6179 N N     . ALA B 2 281 ? 13.584  57.483 45.326  1.00 148.57 ? 267 ALA B N     1 
ATOM   6180 C CA    . ALA B 2 281 ? 12.348  56.708 45.230  1.00 150.16 ? 267 ALA B CA    1 
ATOM   6181 C C     . ALA B 2 281 ? 11.133  57.569 44.865  1.00 155.27 ? 267 ALA B C     1 
ATOM   6182 O O     . ALA B 2 281 ? 10.002  57.074 44.828  1.00 161.68 ? 267 ALA B O     1 
ATOM   6183 C CB    . ALA B 2 281 ? 12.099  55.953 46.529  1.00 150.73 ? 267 ALA B CB    1 
ATOM   6184 N N     . SER B 2 282 ? 11.373  58.852 44.591  1.00 151.97 ? 268 SER B N     1 
ATOM   6185 C CA    . SER B 2 282 ? 10.310  59.786 44.209  1.00 148.78 ? 268 SER B CA    1 
ATOM   6186 C C     . SER B 2 282 ? 9.775   59.503 42.804  1.00 150.41 ? 268 SER B C     1 
ATOM   6187 O O     . SER B 2 282 ? 8.601   59.750 42.518  1.00 148.93 ? 268 SER B O     1 
ATOM   6188 C CB    . SER B 2 282 ? 10.799  61.234 44.307  1.00 141.01 ? 268 SER B CB    1 
ATOM   6189 O OG    . SER B 2 282 ? 11.817  61.500 43.358  1.00 139.91 ? 268 SER B OG    1 
ATOM   6190 N N     . GLN B 2 283 ? 10.646  58.993 41.935  1.00 148.80 ? 269 GLN B N     1 
ATOM   6191 C CA    . GLN B 2 283 ? 10.263  58.604 40.577  1.00 150.01 ? 269 GLN B CA    1 
ATOM   6192 C C     . GLN B 2 283 ? 9.475   57.293 40.557  1.00 155.93 ? 269 GLN B C     1 
ATOM   6193 O O     . GLN B 2 283 ? 8.683   57.050 39.643  1.00 155.72 ? 269 GLN B O     1 
ATOM   6194 C CB    . GLN B 2 283 ? 11.493  58.519 39.661  1.00 146.92 ? 269 GLN B CB    1 
ATOM   6195 C CG    . GLN B 2 283 ? 12.628  57.643 40.179  1.00 144.07 ? 269 GLN B CG    1 
ATOM   6196 C CD    . GLN B 2 283 ? 13.883  57.736 39.329  1.00 140.57 ? 269 GLN B CD    1 
ATOM   6197 O OE1   . GLN B 2 283 ? 13.824  57.700 38.098  1.00 140.68 ? 269 GLN B OE1   1 
ATOM   6198 N NE2   . GLN B 2 283 ? 15.032  57.847 39.986  1.00 139.85 ? 269 GLN B NE2   1 
ATOM   6199 N N     . ILE B 2 284 ? 9.699   56.457 41.570  1.00 157.06 ? 270 ILE B N     1 
ATOM   6200 C CA    . ILE B 2 284 ? 8.973   55.196 41.727  1.00 151.37 ? 270 ILE B CA    1 
ATOM   6201 C C     . ILE B 2 284 ? 7.634   55.449 42.424  1.00 151.20 ? 270 ILE B C     1 
ATOM   6202 O O     . ILE B 2 284 ? 6.586   55.003 41.951  1.00 148.45 ? 270 ILE B O     1 
ATOM   6203 C CB    . ILE B 2 284 ? 9.794   54.150 42.519  1.00 147.73 ? 270 ILE B CB    1 
ATOM   6204 C CG1   . ILE B 2 284 ? 11.222  54.049 41.966  1.00 147.67 ? 270 ILE B CG1   1 
ATOM   6205 C CG2   . ILE B 2 284 ? 9.104   52.790 42.487  1.00 147.87 ? 270 ILE B CG2   1 
ATOM   6206 C CD1   . ILE B 2 284 ? 12.226  53.449 42.930  1.00 146.68 ? 270 ILE B CD1   1 
ATOM   6207 N N     . TYR B 2 285 ? 7.682   56.169 43.545  1.00 155.19 ? 271 TYR B N     1 
ATOM   6208 C CA    . TYR B 2 285 ? 6.486   56.512 44.310  1.00 153.41 ? 271 TYR B CA    1 
ATOM   6209 C C     . TYR B 2 285 ? 6.246   58.025 44.287  1.00 156.75 ? 271 TYR B C     1 
ATOM   6210 O O     . TYR B 2 285 ? 7.032   58.786 44.858  1.00 161.45 ? 271 TYR B O     1 
ATOM   6211 C CB    . TYR B 2 285 ? 6.602   56.010 45.754  1.00 149.51 ? 271 TYR B CB    1 
ATOM   6212 C CG    . TYR B 2 285 ? 6.791   54.513 45.889  1.00 146.80 ? 271 TYR B CG    1 
ATOM   6213 C CD1   . TYR B 2 285 ? 5.695   53.650 45.911  1.00 155.73 ? 271 TYR B CD1   1 
ATOM   6214 C CD2   . TYR B 2 285 ? 8.067   53.960 46.003  1.00 141.45 ? 271 TYR B CD2   1 
ATOM   6215 C CE1   . TYR B 2 285 ? 5.864   52.279 46.038  1.00 156.28 ? 271 TYR B CE1   1 
ATOM   6216 C CE2   . TYR B 2 285 ? 8.246   52.591 46.130  1.00 145.80 ? 271 TYR B CE2   1 
ATOM   6217 C CZ    . TYR B 2 285 ? 7.140   51.755 46.146  1.00 151.36 ? 271 TYR B CZ    1 
ATOM   6218 O OH    . TYR B 2 285 ? 7.312   50.396 46.272  1.00 146.81 ? 271 TYR B OH    1 
ATOM   6219 N N     . PRO B 2 286 ? 5.159   58.464 43.622  1.00 152.64 ? 272 PRO B N     1 
ATOM   6220 C CA    . PRO B 2 286 ? 4.838   59.888 43.481  1.00 152.61 ? 272 PRO B CA    1 
ATOM   6221 C C     . PRO B 2 286 ? 4.307   60.531 44.765  1.00 154.65 ? 272 PRO B C     1 
ATOM   6222 O O     . PRO B 2 286 ? 4.327   61.758 44.890  1.00 145.84 ? 272 PRO B O     1 
ATOM   6223 C CB    . PRO B 2 286 ? 3.744   59.904 42.399  1.00 151.46 ? 272 PRO B CB    1 
ATOM   6224 C CG    . PRO B 2 286 ? 3.732   58.533 41.803  1.00 145.15 ? 272 PRO B CG    1 
ATOM   6225 C CD    . PRO B 2 286 ? 4.193   57.622 42.897  1.00 146.67 ? 272 PRO B CD    1 
ATOM   6226 N N     . GLY B 2 287 ? 3.839   59.707 45.701  1.00 161.39 ? 273 GLY B N     1 
ATOM   6227 C CA    . GLY B 2 287 ? 3.249   60.189 46.950  1.00 161.15 ? 273 GLY B CA    1 
ATOM   6228 C C     . GLY B 2 287 ? 4.230   60.817 47.925  1.00 158.06 ? 273 GLY B C     1 
ATOM   6229 O O     . GLY B 2 287 ? 3.876   61.744 48.657  1.00 158.20 ? 273 GLY B O     1 
ATOM   6230 N N     . ILE B 2 288 ? 5.462   60.310 47.934  1.00 154.39 ? 274 ILE B N     1 
ATOM   6231 C CA    . ILE B 2 288 ? 6.500   60.785 48.852  1.00 147.86 ? 274 ILE B CA    1 
ATOM   6232 C C     . ILE B 2 288 ? 7.059   62.141 48.414  1.00 150.98 ? 274 ILE B C     1 
ATOM   6233 O O     . ILE B 2 288 ? 7.470   62.316 47.264  1.00 145.53 ? 274 ILE B O     1 
ATOM   6234 C CB    . ILE B 2 288 ? 7.638   59.742 49.022  1.00 154.04 ? 274 ILE B CB    1 
ATOM   6235 C CG1   . ILE B 2 288 ? 7.191   58.587 49.927  1.00 152.97 ? 274 ILE B CG1   1 
ATOM   6236 C CG2   . ILE B 2 288 ? 8.890   60.374 49.616  1.00 153.58 ? 274 ILE B CG2   1 
ATOM   6237 C CD1   . ILE B 2 288 ? 6.511   57.441 49.207  1.00 147.35 ? 274 ILE B CD1   1 
ATOM   6238 N N     . LYS B 2 289 ? 7.054   63.094 49.345  1.00 152.43 ? 275 LYS B N     1 
ATOM   6239 C CA    . LYS B 2 289 ? 7.608   64.428 49.116  1.00 156.98 ? 275 LYS B CA    1 
ATOM   6240 C C     . LYS B 2 289 ? 8.672   64.758 50.160  1.00 156.98 ? 275 LYS B C     1 
ATOM   6241 O O     . LYS B 2 289 ? 8.513   64.445 51.342  1.00 149.18 ? 275 LYS B O     1 
ATOM   6242 C CB    . LYS B 2 289 ? 6.501   65.486 49.139  1.00 154.52 ? 275 LYS B CB    1 
ATOM   6243 C CG    . LYS B 2 289 ? 5.547   65.427 47.956  1.00 148.00 ? 275 LYS B CG    1 
ATOM   6244 C CD    . LYS B 2 289 ? 4.468   66.493 48.063  1.00 138.26 ? 275 LYS B CD    1 
ATOM   6245 C CE    . LYS B 2 289 ? 3.504   66.440 46.887  1.00 140.94 ? 275 LYS B CE    1 
ATOM   6246 N NZ    . LYS B 2 289 ? 4.133   66.880 45.610  1.00 148.38 ? 275 LYS B NZ    1 
ATOM   6247 N N     . VAL B 2 290 ? 9.754   65.392 49.712  1.00 157.90 ? 276 VAL B N     1 
ATOM   6248 C CA    . VAL B 2 290 ? 10.867  65.762 50.593  1.00 152.30 ? 276 VAL B CA    1 
ATOM   6249 C C     . VAL B 2 290 ? 10.966  67.278 50.803  1.00 152.75 ? 276 VAL B C     1 
ATOM   6250 O O     . VAL B 2 290 ? 12.047  67.814 51.067  1.00 154.26 ? 276 VAL B O     1 
ATOM   6251 C CB    . VAL B 2 290 ? 12.219  65.191 50.092  1.00 151.61 ? 276 VAL B CB    1 
ATOM   6252 C CG1   . VAL B 2 290 ? 12.292  63.690 50.338  1.00 148.14 ? 276 VAL B CG1   1 
ATOM   6253 C CG2   . VAL B 2 290 ? 12.446  65.514 48.619  1.00 152.75 ? 276 VAL B CG2   1 
ATOM   6254 N N     . ARG B 2 291 ? 9.825   67.958 50.697  1.00 151.70 ? 277 ARG B N     1 
ATOM   6255 C CA    . ARG B 2 291 ? 9.763   69.414 50.823  1.00 150.99 ? 277 ARG B CA    1 
ATOM   6256 C C     . ARG B 2 291 ? 9.849   69.875 52.280  1.00 150.95 ? 277 ARG B C     1 
ATOM   6257 O O     . ARG B 2 291 ? 10.564  70.831 52.591  1.00 149.85 ? 277 ARG B O     1 
ATOM   6258 C CB    . ARG B 2 291 ? 8.486   69.951 50.167  1.00 153.87 ? 277 ARG B CB    1 
ATOM   6259 C CG    . ARG B 2 291 ? 8.482   71.456 49.930  1.00 155.71 ? 277 ARG B CG    1 
ATOM   6260 C CD    . ARG B 2 291 ? 7.168   71.935 49.329  1.00 163.54 ? 277 ARG B CD    1 
ATOM   6261 N NE    . ARG B 2 291 ? 7.025   71.567 47.920  1.00 174.70 ? 277 ARG B NE    1 
ATOM   6262 C CZ    . ARG B 2 291 ? 6.259   70.577 47.467  1.00 166.95 ? 277 ARG B CZ    1 
ATOM   6263 N NH1   . ARG B 2 291 ? 5.546   69.834 48.306  1.00 155.82 ? 277 ARG B NH1   1 
ATOM   6264 N NH2   . ARG B 2 291 ? 6.203   70.328 46.166  1.00 166.81 ? 277 ARG B NH2   1 
ATOM   6265 N N     . GLN B 2 292 ? 9.122   69.192 53.162  1.00 153.61 ? 278 GLN B N     1 
ATOM   6266 C CA    . GLN B 2 292 ? 9.060   69.557 54.580  1.00 154.03 ? 278 GLN B CA    1 
ATOM   6267 C C     . GLN B 2 292 ? 10.321  69.163 55.350  1.00 154.61 ? 278 GLN B C     1 
ATOM   6268 O O     . GLN B 2 292 ? 10.673  69.805 56.342  1.00 159.56 ? 278 GLN B O     1 
ATOM   6269 C CB    . GLN B 2 292 ? 7.825   68.938 55.248  1.00 151.31 ? 278 GLN B CB    1 
ATOM   6270 C CG    . GLN B 2 292 ? 6.486   69.400 54.681  1.00 151.99 ? 278 GLN B CG    1 
ATOM   6271 C CD    . GLN B 2 292 ? 6.142   70.840 55.031  1.00 154.81 ? 278 GLN B CD    1 
ATOM   6272 O OE1   . GLN B 2 292 ? 6.585   71.374 56.049  1.00 154.64 ? 278 GLN B OE1   1 
ATOM   6273 N NE2   . GLN B 2 292 ? 5.336   71.472 54.186  1.00 155.59 ? 278 GLN B NE2   1 
ATOM   6274 N N     . LEU B 2 293 ? 10.990  68.108 54.888  1.00 151.50 ? 279 LEU B N     1 
ATOM   6275 C CA    . LEU B 2 293 ? 12.198  67.593 55.538  1.00 148.92 ? 279 LEU B CA    1 
ATOM   6276 C C     . LEU B 2 293 ? 13.410  68.503 55.340  1.00 147.76 ? 279 LEU B C     1 
ATOM   6277 O O     . LEU B 2 293 ? 14.256  68.621 56.230  1.00 144.03 ? 279 LEU B O     1 
ATOM   6278 C CB    . LEU B 2 293 ? 12.516  66.177 55.042  1.00 149.00 ? 279 LEU B CB    1 
ATOM   6279 C CG    . LEU B 2 293 ? 11.557  65.039 55.414  1.00 145.10 ? 279 LEU B CG    1 
ATOM   6280 C CD1   . LEU B 2 293 ? 11.733  63.862 54.466  1.00 146.40 ? 279 LEU B CD1   1 
ATOM   6281 C CD2   . LEU B 2 293 ? 11.740  64.598 56.860  1.00 146.29 ? 279 LEU B CD2   1 
ATOM   6282 N N     . CYS B 2 294 ? 13.486  69.140 54.173  1.00 143.16 ? 280 CYS B N     1 
ATOM   6283 C CA    . CYS B 2 294 ? 14.591  70.040 53.841  1.00 141.13 ? 280 CYS B CA    1 
ATOM   6284 C C     . CYS B 2 294 ? 14.455  71.413 54.503  1.00 147.02 ? 280 CYS B C     1 
ATOM   6285 O O     . CYS B 2 294 ? 15.450  72.119 54.685  1.00 149.59 ? 280 CYS B O     1 
ATOM   6286 C CB    . CYS B 2 294 ? 14.719  70.195 52.323  1.00 140.67 ? 280 CYS B CB    1 
ATOM   6287 S SG    . CYS B 2 294 ? 15.259  68.697 51.467  1.00 163.67 ? 280 CYS B SG    1 
ATOM   6288 N N     . LYS B 2 295 ? 13.225  71.780 54.860  1.00 154.26 ? 281 LYS B N     1 
ATOM   6289 C CA    . LYS B 2 295 ? 12.947  73.064 55.507  1.00 155.53 ? 281 LYS B CA    1 
ATOM   6290 C C     . LYS B 2 295 ? 13.344  73.086 56.986  1.00 156.76 ? 281 LYS B C     1 
ATOM   6291 O O     . LYS B 2 295 ? 13.431  74.155 57.595  1.00 148.79 ? 281 LYS B O     1 
ATOM   6292 C CB    . LYS B 2 295 ? 11.471  73.445 55.348  1.00 151.15 ? 281 LYS B CB    1 
ATOM   6293 C CG    . LYS B 2 295 ? 11.096  73.917 53.949  1.00 147.23 ? 281 LYS B CG    1 
ATOM   6294 C CD    . LYS B 2 295 ? 9.684   74.484 53.896  1.00 146.38 ? 281 LYS B CD    1 
ATOM   6295 C CE    . LYS B 2 295 ? 8.628   73.391 53.830  1.00 144.33 ? 281 LYS B CE    1 
ATOM   6296 N NZ    . LYS B 2 295 ? 7.252   73.957 53.762  1.00 143.54 ? 281 LYS B NZ    1 
ATOM   6297 N N     . LEU B 2 296 ? 13.583  71.903 57.551  1.00 161.14 ? 282 LEU B N     1 
ATOM   6298 C CA    . LEU B 2 296 ? 14.010  71.764 58.945  1.00 159.00 ? 282 LEU B CA    1 
ATOM   6299 C C     . LEU B 2 296 ? 15.433  72.280 59.163  1.00 160.80 ? 282 LEU B C     1 
ATOM   6300 O O     . LEU B 2 296 ? 15.744  72.829 60.222  1.00 165.98 ? 282 LEU B O     1 
ATOM   6301 C CB    . LEU B 2 296 ? 13.904  70.303 59.401  1.00 152.43 ? 282 LEU B CB    1 
ATOM   6302 C CG    . LEU B 2 296 ? 12.511  69.674 59.527  1.00 158.39 ? 282 LEU B CG    1 
ATOM   6303 C CD1   . LEU B 2 296 ? 12.608  68.155 59.497  1.00 149.93 ? 282 LEU B CD1   1 
ATOM   6304 C CD2   . LEU B 2 296 ? 11.792  70.143 60.784  1.00 155.46 ? 282 LEU B CD2   1 
ATOM   6305 N N     . LEU B 2 297 ? 16.285  72.098 58.156  1.00 161.86 ? 283 LEU B N     1 
ATOM   6306 C CA    . LEU B 2 297 ? 17.668  72.567 58.208  1.00 160.60 ? 283 LEU B CA    1 
ATOM   6307 C C     . LEU B 2 297 ? 17.799  73.958 57.591  1.00 160.48 ? 283 LEU B C     1 
ATOM   6308 O O     . LEU B 2 297 ? 17.522  74.151 56.404  1.00 160.91 ? 283 LEU B O     1 
ATOM   6309 C CB    . LEU B 2 297 ? 18.612  71.577 57.505  1.00 153.40 ? 283 LEU B CB    1 
ATOM   6310 C CG    . LEU B 2 297 ? 19.030  70.251 58.165  1.00 147.40 ? 283 LEU B CG    1 
ATOM   6311 C CD1   . LEU B 2 297 ? 19.610  70.463 59.559  1.00 148.26 ? 283 LEU B CD1   1 
ATOM   6312 C CD2   . LEU B 2 297 ? 17.897  69.230 58.200  1.00 139.11 ? 283 LEU B CD2   1 
ATOM   6313 N N     . ARG B 2 298 ? 18.215  74.920 58.411  1.00 152.83 ? 284 ARG B N     1 
ATOM   6314 C CA    . ARG B 2 298 ? 18.398  76.302 57.969  1.00 146.01 ? 284 ARG B CA    1 
ATOM   6315 C C     . ARG B 2 298 ? 19.821  76.777 58.255  1.00 151.67 ? 284 ARG B C     1 
ATOM   6316 O O     . ARG B 2 298 ? 20.208  76.951 59.414  1.00 149.23 ? 284 ARG B O     1 
ATOM   6317 C CB    . ARG B 2 298 ? 17.375  77.228 58.640  1.00 142.01 ? 284 ARG B CB    1 
ATOM   6318 C CG    . ARG B 2 298 ? 15.935  76.993 58.208  1.00 144.69 ? 284 ARG B CG    1 
ATOM   6319 C CD    . ARG B 2 298 ? 14.970  77.855 59.007  1.00 144.69 ? 284 ARG B CD    1 
ATOM   6320 N NE    . ARG B 2 298 ? 13.577  77.587 58.653  1.00 148.33 ? 284 ARG B NE    1 
ATOM   6321 C CZ    . ARG B 2 298 ? 12.525  78.169 59.223  1.00 149.49 ? 284 ARG B CZ    1 
ATOM   6322 N NH1   . ARG B 2 298 ? 12.689  79.067 60.188  1.00 149.49 ? 284 ARG B NH1   1 
ATOM   6323 N NH2   . ARG B 2 298 ? 11.300  77.853 58.826  1.00 150.92 ? 284 ARG B NH2   1 
ATOM   6324 N N     . GLY B 2 299 ? 20.593  76.977 57.190  1.00 155.24 ? 285 GLY B N     1 
ATOM   6325 C CA    . GLY B 2 299 ? 21.992  77.385 57.307  1.00 163.37 ? 285 GLY B CA    1 
ATOM   6326 C C     . GLY B 2 299 ? 22.921  76.220 57.593  1.00 158.29 ? 285 GLY B C     1 
ATOM   6327 O O     . GLY B 2 299 ? 22.478  75.074 57.708  1.00 164.28 ? 285 GLY B O     1 
ATOM   6328 N N     . THR B 2 300 ? 24.214  76.518 57.711  1.00 150.13 ? 286 THR B N     1 
ATOM   6329 C CA    . THR B 2 300 ? 25.233  75.497 57.970  1.00 150.06 ? 286 THR B CA    1 
ATOM   6330 C C     . THR B 2 300 ? 25.166  74.962 59.406  1.00 150.73 ? 286 THR B C     1 
ATOM   6331 O O     . THR B 2 300 ? 25.168  75.732 60.371  1.00 146.91 ? 286 THR B O     1 
ATOM   6332 C CB    . THR B 2 300 ? 26.660  75.993 57.620  1.00 144.93 ? 286 THR B CB    1 
ATOM   6333 O OG1   . THR B 2 300 ? 27.631  75.033 58.057  1.00 144.87 ? 286 THR B OG1   1 
ATOM   6334 C CG2   . THR B 2 300 ? 26.960  77.351 58.262  1.00 145.64 ? 286 THR B CG2   1 
ATOM   6335 N N     . LYS B 2 301 ? 25.093  73.638 59.528  1.00 151.91 ? 287 LYS B N     1 
ATOM   6336 C CA    . LYS B 2 301 ? 24.998  72.967 60.826  1.00 150.67 ? 287 LYS B CA    1 
ATOM   6337 C C     . LYS B 2 301 ? 25.856  71.705 60.883  1.00 150.55 ? 287 LYS B C     1 
ATOM   6338 O O     . LYS B 2 301 ? 26.110  71.067 59.858  1.00 147.39 ? 287 LYS B O     1 
ATOM   6339 C CB    . LYS B 2 301 ? 23.541  72.616 61.148  1.00 150.44 ? 287 LYS B CB    1 
ATOM   6340 C CG    . LYS B 2 301 ? 22.714  73.771 61.691  1.00 151.38 ? 287 LYS B CG    1 
ATOM   6341 C CD    . LYS B 2 301 ? 21.312  73.314 62.063  1.00 141.69 ? 287 LYS B CD    1 
ATOM   6342 C CE    . LYS B 2 301 ? 20.514  74.424 62.731  1.00 138.60 ? 287 LYS B CE    1 
ATOM   6343 N NZ    . LYS B 2 301 ? 20.141  75.514 61.786  1.00 135.82 ? 287 LYS B NZ    1 
ATOM   6344 N N     . ALA B 2 302 ? 26.296  71.356 62.090  1.00 152.82 ? 288 ALA B N     1 
ATOM   6345 C CA    . ALA B 2 302 ? 27.074  70.140 62.321  1.00 155.43 ? 288 ALA B CA    1 
ATOM   6346 C C     . ALA B 2 302 ? 26.162  68.921 62.446  1.00 152.90 ? 288 ALA B C     1 
ATOM   6347 O O     . ALA B 2 302 ? 24.994  69.048 62.821  1.00 144.12 ? 288 ALA B O     1 
ATOM   6348 C CB    . ALA B 2 302 ? 27.936  70.292 63.566  1.00 154.17 ? 288 ALA B CB    1 
ATOM   6349 N N     . LEU B 2 303 ? 26.704  67.744 62.134  1.00 158.89 ? 289 LEU B N     1 
ATOM   6350 C CA    . LEU B 2 303 ? 25.942  66.492 62.179  1.00 159.60 ? 289 LEU B CA    1 
ATOM   6351 C C     . LEU B 2 303 ? 25.642  66.034 63.609  1.00 162.24 ? 289 LEU B C     1 
ATOM   6352 O O     . LEU B 2 303 ? 24.704  65.265 63.836  1.00 162.68 ? 289 LEU B O     1 
ATOM   6353 C CB    . LEU B 2 303 ? 26.666  65.373 61.413  1.00 156.36 ? 289 LEU B CB    1 
ATOM   6354 C CG    . LEU B 2 303 ? 27.025  65.472 59.920  1.00 152.97 ? 289 LEU B CG    1 
ATOM   6355 C CD1   . LEU B 2 303 ? 25.993  66.241 59.100  1.00 156.42 ? 289 LEU B CD1   1 
ATOM   6356 C CD2   . LEU B 2 303 ? 28.419  66.053 59.722  1.00 145.88 ? 289 LEU B CD2   1 
ATOM   6357 N N     . THR B 2 304 ? 26.444  66.510 64.561  1.00 163.70 ? 290 THR B N     1 
ATOM   6358 C CA    . THR B 2 304 ? 26.286  66.173 65.977  1.00 165.23 ? 290 THR B CA    1 
ATOM   6359 C C     . THR B 2 304 ? 25.042  66.836 66.580  1.00 164.18 ? 290 THR B C     1 
ATOM   6360 O O     . THR B 2 304 ? 24.417  66.283 67.490  1.00 165.80 ? 290 THR B O     1 
ATOM   6361 C CB    . THR B 2 304 ? 27.536  66.576 66.792  1.00 162.68 ? 290 THR B CB    1 
ATOM   6362 O OG1   . THR B 2 304 ? 28.721  66.239 66.059  1.00 156.82 ? 290 THR B OG1   1 
ATOM   6363 C CG2   . THR B 2 304 ? 27.564  65.865 68.142  1.00 161.29 ? 290 THR B CG2   1 
ATOM   6364 N N     . GLU B 2 305 ? 24.693  68.013 66.062  1.00 159.11 ? 291 GLU B N     1 
ATOM   6365 C CA    . GLU B 2 305 ? 23.547  68.785 66.543  1.00 156.98 ? 291 GLU B CA    1 
ATOM   6366 C C     . GLU B 2 305 ? 22.225  68.056 66.297  1.00 155.01 ? 291 GLU B C     1 
ATOM   6367 O O     . GLU B 2 305 ? 21.986  67.532 65.207  1.00 150.85 ? 291 GLU B O     1 
ATOM   6368 C CB    . GLU B 2 305 ? 23.524  70.168 65.882  1.00 152.04 ? 291 GLU B CB    1 
ATOM   6369 C CG    . GLU B 2 305 ? 22.608  71.180 66.557  1.00 156.89 ? 291 GLU B CG    1 
ATOM   6370 C CD    . GLU B 2 305 ? 22.604  72.533 65.867  1.00 152.32 ? 291 GLU B CD    1 
ATOM   6371 O OE1   . GLU B 2 305 ? 23.684  73.001 65.445  1.00 154.35 ? 291 GLU B OE1   1 
ATOM   6372 O OE2   . GLU B 2 305 ? 21.517  73.137 65.755  1.00 148.66 ? 291 GLU B OE2   1 
ATOM   6373 N N     . VAL B 2 306 ? 21.378  68.027 67.325  1.00 158.68 ? 292 VAL B N     1 
ATOM   6374 C CA    . VAL B 2 306 ? 20.078  67.360 67.254  1.00 158.60 ? 292 VAL B CA    1 
ATOM   6375 C C     . VAL B 2 306 ? 18.989  68.366 66.880  1.00 161.47 ? 292 VAL B C     1 
ATOM   6376 O O     . VAL B 2 306 ? 18.816  69.387 67.552  1.00 159.65 ? 292 VAL B O     1 
ATOM   6377 C CB    . VAL B 2 306 ? 19.724  66.655 68.587  1.00 152.76 ? 292 VAL B CB    1 
ATOM   6378 C CG1   . VAL B 2 306 ? 18.398  65.913 68.476  1.00 154.60 ? 292 VAL B CG1   1 
ATOM   6379 C CG2   . VAL B 2 306 ? 20.830  65.693 68.999  1.00 142.58 ? 292 VAL B CG2   1 
ATOM   6380 N N     . ILE B 2 307 ? 18.266  68.069 65.802  1.00 163.01 ? 293 ILE B N     1 
ATOM   6381 C CA    . ILE B 2 307 ? 17.184  68.930 65.324  1.00 154.79 ? 293 ILE B CA    1 
ATOM   6382 C C     . ILE B 2 307 ? 15.824  68.260 65.549  1.00 156.62 ? 293 ILE B C     1 
ATOM   6383 O O     . ILE B 2 307 ? 15.566  67.181 65.007  1.00 161.12 ? 293 ILE B O     1 
ATOM   6384 C CB    . ILE B 2 307 ? 17.362  69.306 63.829  1.00 146.75 ? 293 ILE B CB    1 
ATOM   6385 C CG1   . ILE B 2 307 ? 18.733  69.962 63.575  1.00 149.83 ? 293 ILE B CG1   1 
ATOM   6386 C CG2   . ILE B 2 307 ? 16.213  70.184 63.340  1.00 141.53 ? 293 ILE B CG2   1 
ATOM   6387 C CD1   . ILE B 2 307 ? 18.992  71.255 64.327  1.00 153.01 ? 293 ILE B CD1   1 
ATOM   6388 N N     . PRO B 2 308 ? 14.954  68.895 66.360  1.00 156.29 ? 294 PRO B N     1 
ATOM   6389 C CA    . PRO B 2 308 ? 13.611  68.377 66.626  1.00 158.84 ? 294 PRO B CA    1 
ATOM   6390 C C     . PRO B 2 308 ? 12.676  68.569 65.434  1.00 159.87 ? 294 PRO B C     1 
ATOM   6391 O O     . PRO B 2 308 ? 12.772  69.575 64.726  1.00 159.26 ? 294 PRO B O     1 
ATOM   6392 C CB    . PRO B 2 308 ? 13.127  69.224 67.815  1.00 155.26 ? 294 PRO B CB    1 
ATOM   6393 C CG    . PRO B 2 308 ? 14.335  69.938 68.330  1.00 149.48 ? 294 PRO B CG    1 
ATOM   6394 C CD    . PRO B 2 308 ? 15.225  70.114 67.140  1.00 148.06 ? 294 PRO B CD    1 
ATOM   6395 N N     . LEU B 2 309 ? 11.783  67.605 65.223  1.00 158.50 ? 295 LEU B N     1 
ATOM   6396 C CA    . LEU B 2 309 ? 10.824  67.657 64.121  1.00 151.18 ? 295 LEU B CA    1 
ATOM   6397 C C     . LEU B 2 309 ? 9.575   68.450 64.496  1.00 152.37 ? 295 LEU B C     1 
ATOM   6398 O O     . LEU B 2 309 ? 9.081   68.356 65.622  1.00 152.38 ? 295 LEU B O     1 
ATOM   6399 C CB    . LEU B 2 309 ? 10.435  66.245 63.666  1.00 143.32 ? 295 LEU B CB    1 
ATOM   6400 C CG    . LEU B 2 309 ? 11.407  65.467 62.770  1.00 143.03 ? 295 LEU B CG    1 
ATOM   6401 C CD1   . LEU B 2 309 ? 12.504  64.790 63.579  1.00 151.31 ? 295 LEU B CD1   1 
ATOM   6402 C CD2   . LEU B 2 309 ? 10.651  64.436 61.947  1.00 146.10 ? 295 LEU B CD2   1 
ATOM   6403 N N     . THR B 2 310 ? 9.074   69.228 63.539  1.00 158.80 ? 296 THR B N     1 
ATOM   6404 C CA    . THR B 2 310 ? 7.873   70.043 63.733  1.00 161.27 ? 296 THR B CA    1 
ATOM   6405 C C     . THR B 2 310 ? 6.598   69.229 63.496  1.00 157.61 ? 296 THR B C     1 
ATOM   6406 O O     . THR B 2 310 ? 6.661   68.027 63.223  1.00 157.55 ? 296 THR B O     1 
ATOM   6407 C CB    . THR B 2 310 ? 7.877   71.288 62.818  1.00 160.69 ? 296 THR B CB    1 
ATOM   6408 O OG1   . THR B 2 310 ? 8.107   70.889 61.460  1.00 158.68 ? 296 THR B OG1   1 
ATOM   6409 C CG2   . THR B 2 310 ? 8.959   72.273 63.247  1.00 153.65 ? 296 THR B CG2   1 
ATOM   6410 N N     . GLU B 2 311 ? 5.447   69.892 63.607  1.00 154.00 ? 297 GLU B N     1 
ATOM   6411 C CA    . GLU B 2 311 ? 4.143   69.257 63.393  1.00 145.42 ? 297 GLU B CA    1 
ATOM   6412 C C     . GLU B 2 311 ? 3.941   68.820 61.942  1.00 150.21 ? 297 GLU B C     1 
ATOM   6413 O O     . GLU B 2 311 ? 3.313   67.792 61.679  1.00 152.88 ? 297 GLU B O     1 
ATOM   6414 C CB    . GLU B 2 311 ? 3.008   70.193 63.825  1.00 145.77 ? 297 GLU B CB    1 
ATOM   6415 C CG    . GLU B 2 311 ? 2.916   70.434 65.328  1.00 146.63 ? 297 GLU B CG    1 
ATOM   6416 C CD    . GLU B 2 311 ? 2.433   69.219 66.103  1.00 144.12 ? 297 GLU B CD    1 
ATOM   6417 O OE1   . GLU B 2 311 ? 1.483   68.547 65.646  1.00 145.99 ? 297 GLU B OE1   1 
ATOM   6418 O OE2   . GLU B 2 311 ? 3.000   68.942 67.181  1.00 142.55 ? 297 GLU B OE2   1 
ATOM   6419 N N     . GLU B 2 312 ? 4.475   69.608 61.010  1.00 149.43 ? 298 GLU B N     1 
ATOM   6420 C CA    . GLU B 2 312 ? 4.399   69.300 59.582  1.00 148.46 ? 298 GLU B CA    1 
ATOM   6421 C C     . GLU B 2 312 ? 5.380   68.197 59.185  1.00 150.10 ? 298 GLU B C     1 
ATOM   6422 O O     . GLU B 2 312 ? 5.114   67.425 58.260  1.00 148.12 ? 298 GLU B O     1 
ATOM   6423 C CB    . GLU B 2 312 ? 4.654   70.557 58.743  1.00 149.20 ? 298 GLU B CB    1 
ATOM   6424 C CG    . GLU B 2 312 ? 3.550   71.606 58.814  1.00 156.94 ? 298 GLU B CG    1 
ATOM   6425 C CD    . GLU B 2 312 ? 2.278   71.190 58.093  1.00 163.79 ? 298 GLU B CD    1 
ATOM   6426 O OE1   . GLU B 2 312 ? 2.369   70.631 56.978  1.00 160.94 ? 298 GLU B OE1   1 
ATOM   6427 O OE2   . GLU B 2 312 ? 1.182   71.425 58.644  1.00 171.67 ? 298 GLU B OE2   1 
ATOM   6428 N N     . ALA B 2 313 ? 6.510   68.133 59.888  1.00 151.96 ? 299 ALA B N     1 
ATOM   6429 C CA    . ALA B 2 313 ? 7.545   67.132 59.629  1.00 151.83 ? 299 ALA B CA    1 
ATOM   6430 C C     . ALA B 2 313 ? 7.139   65.742 60.121  1.00 151.34 ? 299 ALA B C     1 
ATOM   6431 O O     . ALA B 2 313 ? 7.452   64.737 59.480  1.00 149.92 ? 299 ALA B O     1 
ATOM   6432 C CB    . ALA B 2 313 ? 8.865   67.557 60.257  1.00 148.84 ? 299 ALA B CB    1 
ATOM   6433 N N     . GLU B 2 314 ? 6.447   65.698 61.258  1.00 153.26 ? 300 GLU B N     1 
ATOM   6434 C CA    . GLU B 2 314 ? 5.970   64.442 61.841  1.00 148.55 ? 300 GLU B CA    1 
ATOM   6435 C C     . GLU B 2 314 ? 4.778   63.867 61.076  1.00 147.15 ? 300 GLU B C     1 
ATOM   6436 O O     . GLU B 2 314 ? 4.599   62.649 61.022  1.00 144.89 ? 300 GLU B O     1 
ATOM   6437 C CB    . GLU B 2 314 ? 5.601   64.637 63.316  1.00 145.21 ? 300 GLU B CB    1 
ATOM   6438 C CG    . GLU B 2 314 ? 6.792   64.753 64.260  1.00 151.55 ? 300 GLU B CG    1 
ATOM   6439 C CD    . GLU B 2 314 ? 7.494   63.428 64.507  1.00 157.07 ? 300 GLU B CD    1 
ATOM   6440 O OE1   . GLU B 2 314 ? 6.810   62.384 64.587  1.00 153.54 ? 300 GLU B OE1   1 
ATOM   6441 O OE2   . GLU B 2 314 ? 8.737   63.431 64.632  1.00 159.39 ? 300 GLU B OE2   1 
ATOM   6442 N N     . LEU B 2 315 ? 3.973   64.752 60.491  1.00 155.58 ? 301 LEU B N     1 
ATOM   6443 C CA    . LEU B 2 315 ? 2.789   64.355 59.730  1.00 156.27 ? 301 LEU B CA    1 
ATOM   6444 C C     . LEU B 2 315 ? 3.154   63.788 58.357  1.00 153.67 ? 301 LEU B C     1 
ATOM   6445 O O     . LEU B 2 315 ? 2.520   62.843 57.883  1.00 152.58 ? 301 LEU B O     1 
ATOM   6446 C CB    . LEU B 2 315 ? 1.826   65.541 59.581  1.00 154.20 ? 301 LEU B CB    1 
ATOM   6447 C CG    . LEU B 2 315 ? 0.407   65.288 59.056  1.00 150.98 ? 301 LEU B CG    1 
ATOM   6448 C CD1   . LEU B 2 315 ? -0.465  64.609 60.103  1.00 151.15 ? 301 LEU B CD1   1 
ATOM   6449 C CD2   . LEU B 2 315 ? -0.228  66.593 58.603  1.00 146.85 ? 301 LEU B CD2   1 
ATOM   6450 N N     . GLU B 2 316 ? 4.175   64.370 57.730  1.00 152.45 ? 302 GLU B N     1 
ATOM   6451 C CA    . GLU B 2 316 ? 4.618   63.956 56.398  1.00 148.24 ? 302 GLU B CA    1 
ATOM   6452 C C     . GLU B 2 316 ? 5.392   62.637 56.431  1.00 148.47 ? 302 GLU B C     1 
ATOM   6453 O O     . GLU B 2 316 ? 5.212   61.786 55.558  1.00 150.08 ? 302 GLU B O     1 
ATOM   6454 C CB    . GLU B 2 316 ? 5.468   65.053 55.748  1.00 145.17 ? 302 GLU B CB    1 
ATOM   6455 C CG    . GLU B 2 316 ? 5.651   64.897 54.244  1.00 146.74 ? 302 GLU B CG    1 
ATOM   6456 C CD    . GLU B 2 316 ? 6.727   65.807 53.680  1.00 152.66 ? 302 GLU B CD    1 
ATOM   6457 O OE1   . GLU B 2 316 ? 7.880   65.744 54.159  1.00 151.44 ? 302 GLU B OE1   1 
ATOM   6458 O OE2   . GLU B 2 316 ? 6.423   66.576 52.745  1.00 157.10 ? 302 GLU B OE2   1 
ATOM   6459 N N     . LEU B 2 317 ? 6.248   62.478 57.441  1.00 145.18 ? 303 LEU B N     1 
ATOM   6460 C CA    . LEU B 2 317 ? 7.093   61.290 57.584  1.00 149.29 ? 303 LEU B CA    1 
ATOM   6461 C C     . LEU B 2 317 ? 6.271   60.039 57.901  1.00 154.24 ? 303 LEU B C     1 
ATOM   6462 O O     . LEU B 2 317 ? 6.600   58.942 57.444  1.00 153.09 ? 303 LEU B O     1 
ATOM   6463 C CB    . LEU B 2 317 ? 8.161   61.522 58.660  1.00 149.32 ? 303 LEU B CB    1 
ATOM   6464 C CG    . LEU B 2 317 ? 9.503   60.789 58.538  1.00 155.72 ? 303 LEU B CG    1 
ATOM   6465 C CD1   . LEU B 2 317 ? 10.627  61.639 59.113  1.00 150.68 ? 303 LEU B CD1   1 
ATOM   6466 C CD2   . LEU B 2 317 ? 9.473   59.419 59.202  1.00 150.41 ? 303 LEU B CD2   1 
ATOM   6467 N N     . ALA B 2 318 ? 5.204   60.215 58.679  1.00 156.50 ? 304 ALA B N     1 
ATOM   6468 C CA    . ALA B 2 318 ? 4.293   59.123 59.023  1.00 154.53 ? 304 ALA B CA    1 
ATOM   6469 C C     . ALA B 2 318 ? 3.392   58.744 57.846  1.00 150.52 ? 304 ALA B C     1 
ATOM   6470 O O     . ALA B 2 318 ? 2.966   57.593 57.729  1.00 144.80 ? 304 ALA B O     1 
ATOM   6471 C CB    . ALA B 2 318 ? 3.454   59.495 60.237  1.00 151.22 ? 304 ALA B CB    1 
ATOM   6472 N N     . GLU B 2 319 ? 3.111   59.720 56.984  1.00 150.01 ? 305 GLU B N     1 
ATOM   6473 C CA    . GLU B 2 319 ? 2.284   59.511 55.795  1.00 144.93 ? 305 GLU B CA    1 
ATOM   6474 C C     . GLU B 2 319 ? 3.048   58.740 54.717  1.00 150.43 ? 305 GLU B C     1 
ATOM   6475 O O     . GLU B 2 319 ? 2.452   57.974 53.956  1.00 150.18 ? 305 GLU B O     1 
ATOM   6476 C CB    . GLU B 2 319 ? 1.789   60.856 55.249  1.00 138.68 ? 305 GLU B CB    1 
ATOM   6477 C CG    . GLU B 2 319 ? 0.535   60.779 54.386  1.00 141.43 ? 305 GLU B CG    1 
ATOM   6478 C CD    . GLU B 2 319 ? 0.827   60.500 52.921  1.00 144.36 ? 305 GLU B CD    1 
ATOM   6479 O OE1   . GLU B 2 319 ? 1.732   61.147 52.351  1.00 138.53 ? 305 GLU B OE1   1 
ATOM   6480 O OE2   . GLU B 2 319 ? 0.141   59.636 52.335  1.00 148.97 ? 305 GLU B OE2   1 
ATOM   6481 N N     . ASN B 2 320 ? 4.364   58.945 54.665  1.00 153.64 ? 306 ASN B N     1 
ATOM   6482 C CA    . ASN B 2 320 ? 5.234   58.272 53.697  1.00 153.73 ? 306 ASN B CA    1 
ATOM   6483 C C     . ASN B 2 320 ? 5.348   56.763 53.916  1.00 155.42 ? 306 ASN B C     1 
ATOM   6484 O O     . ASN B 2 320 ? 5.574   56.010 52.966  1.00 162.17 ? 306 ASN B O     1 
ATOM   6485 C CB    . ASN B 2 320 ? 6.628   58.909 53.689  1.00 152.27 ? 306 ASN B CB    1 
ATOM   6486 C CG    . ASN B 2 320 ? 6.630   60.318 53.119  1.00 144.41 ? 306 ASN B CG    1 
ATOM   6487 O OD1   . ASN B 2 320 ? 5.813   60.662 52.262  1.00 141.11 ? 306 ASN B OD1   1 
ATOM   6488 N ND2   . ASN B 2 320 ? 7.559   61.142 53.591  1.00 144.25 ? 306 ASN B ND2   1 
ATOM   6489 N N     . ARG B 2 321 ? 5.192   56.333 55.167  1.00 154.08 ? 307 ARG B N     1 
ATOM   6490 C CA    . ARG B 2 321 ? 5.228   54.911 55.521  1.00 157.72 ? 307 ARG B CA    1 
ATOM   6491 C C     . ARG B 2 321 ? 3.988   54.162 55.032  1.00 149.79 ? 307 ARG B C     1 
ATOM   6492 O O     . ARG B 2 321 ? 4.054   52.966 54.742  1.00 160.50 ? 307 ARG B O     1 
ATOM   6493 C CB    . ARG B 2 321 ? 5.384   54.731 57.034  1.00 156.13 ? 307 ARG B CB    1 
ATOM   6494 C CG    . ARG B 2 321 ? 6.773   55.046 57.570  1.00 157.67 ? 307 ARG B CG    1 
ATOM   6495 C CD    . ARG B 2 321 ? 6.931   54.587 59.012  1.00 160.19 ? 307 ARG B CD    1 
ATOM   6496 N NE    . ARG B 2 321 ? 6.172   55.414 59.949  1.00 161.05 ? 307 ARG B NE    1 
ATOM   6497 C CZ    . ARG B 2 321 ? 6.696   56.371 60.712  1.00 156.50 ? 307 ARG B CZ    1 
ATOM   6498 N NH1   . ARG B 2 321 ? 7.996   56.636 60.665  1.00 149.23 ? 307 ARG B NH1   1 
ATOM   6499 N NH2   . ARG B 2 321 ? 5.916   57.065 61.530  1.00 155.00 ? 307 ARG B NH2   1 
ATOM   6500 N N     . GLU B 2 322 ? 2.865   54.874 54.948  1.00 149.80 ? 308 GLU B N     1 
ATOM   6501 C CA    . GLU B 2 322 ? 1.600   54.303 54.481  1.00 151.17 ? 308 GLU B CA    1 
ATOM   6502 C C     . GLU B 2 322 ? 1.611   54.033 52.976  1.00 146.91 ? 308 GLU B C     1 
ATOM   6503 O O     . GLU B 2 322 ? 0.957   53.101 52.502  1.00 140.79 ? 308 GLU B O     1 
ATOM   6504 C CB    . GLU B 2 322 ? 0.426   55.222 54.841  1.00 159.01 ? 308 GLU B CB    1 
ATOM   6505 C CG    . GLU B 2 322 ? 0.152   55.353 56.335  1.00 160.27 ? 308 GLU B CG    1 
ATOM   6506 C CD    . GLU B 2 322 ? -0.412  54.086 56.958  1.00 156.30 ? 308 GLU B CD    1 
ATOM   6507 O OE1   . GLU B 2 322 ? -1.292  53.447 56.340  1.00 159.10 ? 308 GLU B OE1   1 
ATOM   6508 O OE2   . GLU B 2 322 ? 0.020   53.733 58.076  1.00 152.25 ? 308 GLU B OE2   1 
ATOM   6509 N N     . ILE B 2 323 ? 2.355   54.855 52.238  1.00 149.93 ? 309 ILE B N     1 
ATOM   6510 C CA    . ILE B 2 323 ? 2.494   54.709 50.787  1.00 149.38 ? 309 ILE B CA    1 
ATOM   6511 C C     . ILE B 2 323 ? 3.408   53.528 50.445  1.00 153.38 ? 309 ILE B C     1 
ATOM   6512 O O     . ILE B 2 323 ? 3.228   52.872 49.417  1.00 152.20 ? 309 ILE B O     1 
ATOM   6513 C CB    . ILE B 2 323 ? 3.030   56.005 50.129  1.00 143.52 ? 309 ILE B CB    1 
ATOM   6514 C CG1   . ILE B 2 323 ? 2.275   57.232 50.657  1.00 143.48 ? 309 ILE B CG1   1 
ATOM   6515 C CG2   . ILE B 2 323 ? 2.922   55.928 48.610  1.00 140.25 ? 309 ILE B CG2   1 
ATOM   6516 C CD1   . ILE B 2 323 ? 3.027   58.539 50.512  1.00 139.29 ? 309 ILE B CD1   1 
ATOM   6517 N N     . LEU B 2 324 ? 4.379   53.263 51.317  1.00 160.06 ? 310 LEU B N     1 
ATOM   6518 C CA    . LEU B 2 324 ? 5.316   52.153 51.137  1.00 158.31 ? 310 LEU B CA    1 
ATOM   6519 C C     . LEU B 2 324 ? 4.665   50.793 51.396  1.00 159.38 ? 310 LEU B C     1 
ATOM   6520 O O     . LEU B 2 324 ? 5.017   49.799 50.756  1.00 156.96 ? 310 LEU B O     1 
ATOM   6521 C CB    . LEU B 2 324 ? 6.545   52.330 52.037  1.00 151.56 ? 310 LEU B CB    1 
ATOM   6522 C CG    . LEU B 2 324 ? 7.516   53.475 51.722  1.00 139.68 ? 310 LEU B CG    1 
ATOM   6523 C CD1   . LEU B 2 324 ? 8.377   53.797 52.934  1.00 140.86 ? 310 LEU B CD1   1 
ATOM   6524 C CD2   . LEU B 2 324 ? 8.385   53.158 50.512  1.00 134.81 ? 310 LEU B CD2   1 
ATOM   6525 N N     . LYS B 2 325 ? 3.720   50.759 52.335  1.00 159.01 ? 311 LYS B N     1 
ATOM   6526 C CA    . LYS B 2 325 ? 3.005   49.530 52.685  1.00 154.21 ? 311 LYS B CA    1 
ATOM   6527 C C     . LYS B 2 325 ? 1.948   49.164 51.642  1.00 157.20 ? 311 LYS B C     1 
ATOM   6528 O O     . LYS B 2 325 ? 1.831   48.001 51.251  1.00 155.98 ? 311 LYS B O     1 
ATOM   6529 C CB    . LYS B 2 325 ? 2.365   49.650 54.073  1.00 148.42 ? 311 LYS B CB    1 
ATOM   6530 C CG    . LYS B 2 325 ? 3.358   49.647 55.224  1.00 149.78 ? 311 LYS B CG    1 
ATOM   6531 C CD    . LYS B 2 325 ? 2.651   49.770 56.564  1.00 145.85 ? 311 LYS B CD    1 
ATOM   6532 C CE    . LYS B 2 325 ? 3.644   49.767 57.715  1.00 143.77 ? 311 LYS B CE    1 
ATOM   6533 N NZ    . LYS B 2 325 ? 2.965   49.886 59.035  1.00 148.40 ? 311 LYS B NZ    1 
ATOM   6534 N N     . GLU B 2 326 ? 1.187   50.164 51.202  1.00 154.86 ? 312 GLU B N     1 
ATOM   6535 C CA    . GLU B 2 326 ? 0.149   49.978 50.189  1.00 156.11 ? 312 GLU B CA    1 
ATOM   6536 C C     . GLU B 2 326 ? 0.775   49.861 48.796  1.00 156.53 ? 312 GLU B C     1 
ATOM   6537 O O     . GLU B 2 326 ? 1.635   50.669 48.438  1.00 150.71 ? 312 GLU B O     1 
ATOM   6538 C CB    . GLU B 2 326 ? -0.847  51.144 50.235  1.00 146.56 ? 312 GLU B CB    1 
ATOM   6539 C CG    . GLU B 2 326 ? -2.115  50.949 49.409  1.00 151.61 ? 312 GLU B CG    1 
ATOM   6540 C CD    . GLU B 2 326 ? -3.059  49.911 49.993  1.00 155.39 ? 312 GLU B CD    1 
ATOM   6541 O OE1   . GLU B 2 326 ? -3.261  49.902 51.227  1.00 154.74 ? 312 GLU B OE1   1 
ATOM   6542 O OE2   . GLU B 2 326 ? -3.611  49.107 49.213  1.00 162.86 ? 312 GLU B OE2   1 
ATOM   6543 N N     . PRO B 2 327 ? 0.354   48.845 48.012  1.00 161.88 ? 313 PRO B N     1 
ATOM   6544 C CA    . PRO B 2 327 ? 0.850   48.655 46.644  1.00 159.71 ? 313 PRO B CA    1 
ATOM   6545 C C     . PRO B 2 327 ? 0.603   49.874 45.755  1.00 150.00 ? 313 PRO B C     1 
ATOM   6546 O O     . PRO B 2 327 ? -0.484  50.459 45.791  1.00 143.48 ? 313 PRO B O     1 
ATOM   6547 C CB    . PRO B 2 327 ? 0.039   47.457 46.141  1.00 160.31 ? 313 PRO B CB    1 
ATOM   6548 C CG    . PRO B 2 327 ? -0.312  46.702 47.375  1.00 157.43 ? 313 PRO B CG    1 
ATOM   6549 C CD    . PRO B 2 327 ? -0.549  47.752 48.421  1.00 158.55 ? 313 PRO B CD    1 
ATOM   6550 N N     . VAL B 2 328 ? 1.614   50.245 44.973  1.00 149.50 ? 314 VAL B N     1 
ATOM   6551 C CA    . VAL B 2 328 ? 1.550   51.424 44.107  1.00 148.57 ? 314 VAL B CA    1 
ATOM   6552 C C     . VAL B 2 328 ? 0.661   51.180 42.880  1.00 153.14 ? 314 VAL B C     1 
ATOM   6553 O O     . VAL B 2 328 ? 0.668   50.091 42.301  1.00 155.35 ? 314 VAL B O     1 
ATOM   6554 C CB    . VAL B 2 328 ? 2.969   51.920 43.709  1.00 151.51 ? 314 VAL B CB    1 
ATOM   6555 C CG1   . VAL B 2 328 ? 3.691   50.913 42.820  1.00 144.24 ? 314 VAL B CG1   1 
ATOM   6556 C CG2   . VAL B 2 328 ? 2.912   53.294 43.051  1.00 153.88 ? 314 VAL B CG2   1 
ATOM   6557 N N     . HIS B 2 329 ? -0.113  52.198 42.508  1.00 154.70 ? 315 HIS B N     1 
ATOM   6558 C CA    . HIS B 2 329 ? -1.012  52.120 41.359  1.00 157.32 ? 315 HIS B CA    1 
ATOM   6559 C C     . HIS B 2 329 ? -0.267  52.282 40.065  1.00 145.69 ? 315 HIS B C     1 
ATOM   6560 O O     . HIS B 2 329 ? 0.575   53.173 39.928  1.00 141.44 ? 315 HIS B O     1 
ATOM   6561 C CB    . HIS B 2 329 ? -2.117  53.165 41.469  1.00 157.06 ? 315 HIS B CB    1 
ATOM   6562 C CG    . HIS B 2 329 ? -3.008  52.986 42.676  1.00 160.47 ? 315 HIS B CG    1 
ATOM   6563 N ND1   . HIS B 2 329 ? -4.121  52.232 42.648  1.00 153.67 ? 315 HIS B ND1   1 
ATOM   6564 C CD2   . HIS B 2 329 ? -2.911  53.496 43.970  1.00 163.81 ? 315 HIS B CD2   1 
ATOM   6565 C CE1   . HIS B 2 329 ? -4.710  52.255 43.859  1.00 154.99 ? 315 HIS B CE1   1 
ATOM   6566 N NE2   . HIS B 2 329 ? -3.968  53.029 44.667  1.00 162.49 ? 315 HIS B NE2   1 
ATOM   6567 N N     . GLY B 2 330 ? -0.575  51.414 39.105  1.00 150.78 ? 316 GLY B N     1 
ATOM   6568 C CA    . GLY B 2 330 ? 0.073   51.433 37.795  1.00 139.40 ? 316 GLY B CA    1 
ATOM   6569 C C     . GLY B 2 330 ? 0.889   50.187 37.503  1.00 143.66 ? 316 GLY B C     1 
ATOM   6570 O O     . GLY B 2 330 ? 1.688   50.167 36.564  1.00 141.23 ? 316 GLY B O     1 
ATOM   6571 N N     . VAL B 2 331 ? 0.686   49.147 38.311  1.00 151.62 ? 317 VAL B N     1 
ATOM   6572 C CA    . VAL B 2 331 ? 1.387   47.875 38.142  1.00 156.34 ? 317 VAL B CA    1 
ATOM   6573 C C     . VAL B 2 331 ? 0.525   46.907 37.330  1.00 155.28 ? 317 VAL B C     1 
ATOM   6574 O O     . VAL B 2 331 ? -0.573  46.532 37.752  1.00 155.70 ? 317 VAL B O     1 
ATOM   6575 C CB    . VAL B 2 331 ? 1.776   47.247 39.502  1.00 152.89 ? 317 VAL B CB    1 
ATOM   6576 C CG1   . VAL B 2 331 ? 2.461   45.901 39.305  1.00 152.63 ? 317 VAL B CG1   1 
ATOM   6577 C CG2   . VAL B 2 331 ? 2.680   48.187 40.288  1.00 154.49 ? 317 VAL B CG2   1 
ATOM   6578 N N     . TYR B 2 332 ? 1.032   46.518 36.162  1.00 151.34 ? 318 TYR B N     1 
ATOM   6579 C CA    . TYR B 2 332 ? 0.323   45.609 35.262  1.00 147.40 ? 318 TYR B CA    1 
ATOM   6580 C C     . TYR B 2 332 ? 1.284   44.700 34.496  1.00 148.53 ? 318 TYR B C     1 
ATOM   6581 O O     . TYR B 2 332 ? 2.416   45.089 34.197  1.00 152.50 ? 318 TYR B O     1 
ATOM   6582 C CB    . TYR B 2 332 ? -0.573  46.388 34.287  1.00 145.03 ? 318 TYR B CB    1 
ATOM   6583 C CG    . TYR B 2 332 ? 0.149   47.420 33.442  1.00 147.27 ? 318 TYR B CG    1 
ATOM   6584 C CD1   . TYR B 2 332 ? 0.297   48.735 33.886  1.00 153.03 ? 318 TYR B CD1   1 
ATOM   6585 C CD2   . TYR B 2 332 ? 0.672   47.086 32.192  1.00 140.31 ? 318 TYR B CD2   1 
ATOM   6586 C CE1   . TYR B 2 332 ? 0.954   49.683 33.116  1.00 154.88 ? 318 TYR B CE1   1 
ATOM   6587 C CE2   . TYR B 2 332 ? 1.331   48.027 31.415  1.00 148.39 ? 318 TYR B CE2   1 
ATOM   6588 C CZ    . TYR B 2 332 ? 1.468   49.324 31.882  1.00 158.06 ? 318 TYR B CZ    1 
ATOM   6589 O OH    . TYR B 2 332 ? 2.120   50.262 31.114  1.00 163.48 ? 318 TYR B OH    1 
ATOM   6590 N N     . TYR B 2 333 ? 0.821   43.491 34.185  1.00 152.32 ? 319 TYR B N     1 
ATOM   6591 C CA    . TYR B 2 333 ? 1.614   42.523 33.432  1.00 156.02 ? 319 TYR B CA    1 
ATOM   6592 C C     . TYR B 2 333 ? 1.343   42.625 31.932  1.00 152.73 ? 319 TYR B C     1 
ATOM   6593 O O     . TYR B 2 333 ? 0.188   42.669 31.500  1.00 153.82 ? 319 TYR B O     1 
ATOM   6594 C CB    . TYR B 2 333 ? 1.351   41.098 33.939  1.00 157.93 ? 319 TYR B CB    1 
ATOM   6595 C CG    . TYR B 2 333 ? 1.938   40.000 33.073  1.00 156.61 ? 319 TYR B CG    1 
ATOM   6596 C CD1   . TYR B 2 333 ? 3.319   39.827 32.967  1.00 146.38 ? 319 TYR B CD1   1 
ATOM   6597 C CD2   . TYR B 2 333 ? 1.109   39.129 32.366  1.00 159.70 ? 319 TYR B CD2   1 
ATOM   6598 C CE1   . TYR B 2 333 ? 3.857   38.822 32.177  1.00 143.40 ? 319 TYR B CE1   1 
ATOM   6599 C CE2   . TYR B 2 333 ? 1.638   38.121 31.575  1.00 161.60 ? 319 TYR B CE2   1 
ATOM   6600 C CZ    . TYR B 2 333 ? 3.010   37.972 31.483  1.00 150.63 ? 319 TYR B CZ    1 
ATOM   6601 O OH    . TYR B 2 333 ? 3.537   36.972 30.699  1.00 145.87 ? 319 TYR B OH    1 
ATOM   6602 N N     . ASP B 2 334 ? 2.420   42.663 31.151  1.00 147.91 ? 320 ASP B N     1 
ATOM   6603 C CA    . ASP B 2 334 ? 2.334   42.737 29.696  1.00 142.67 ? 320 ASP B CA    1 
ATOM   6604 C C     . ASP B 2 334 ? 3.230   41.671 29.060  1.00 135.29 ? 320 ASP B C     1 
ATOM   6605 O O     . ASP B 2 334 ? 4.456   41.728 29.196  1.00 128.28 ? 320 ASP B O     1 
ATOM   6606 C CB    . ASP B 2 334 ? 2.717   44.140 29.208  1.00 141.35 ? 320 ASP B CB    1 
ATOM   6607 C CG    . ASP B 2 334 ? 2.402   44.363 27.736  1.00 145.94 ? 320 ASP B CG    1 
ATOM   6608 O OD1   . ASP B 2 334 ? 1.417   43.785 27.229  1.00 150.27 ? 320 ASP B OD1   1 
ATOM   6609 O OD2   . ASP B 2 334 ? 3.141   45.132 27.087  1.00 146.90 ? 320 ASP B OD2   1 
ATOM   6610 N N     . PRO B 2 335 ? 2.618   40.687 28.369  1.00 136.28 ? 321 PRO B N     1 
ATOM   6611 C CA    . PRO B 2 335 ? 3.348   39.558 27.780  1.00 140.20 ? 321 PRO B CA    1 
ATOM   6612 C C     . PRO B 2 335 ? 4.204   39.929 26.565  1.00 143.49 ? 321 PRO B C     1 
ATOM   6613 O O     . PRO B 2 335 ? 5.121   39.182 26.214  1.00 146.67 ? 321 PRO B O     1 
ATOM   6614 C CB    . PRO B 2 335 ? 2.231   38.590 27.358  1.00 143.85 ? 321 PRO B CB    1 
ATOM   6615 C CG    . PRO B 2 335 ? 0.994   39.070 28.044  1.00 147.03 ? 321 PRO B CG    1 
ATOM   6616 C CD    . PRO B 2 335 ? 1.166   40.551 28.168  1.00 142.82 ? 321 PRO B CD    1 
ATOM   6617 N N     . SER B 2 336 ? 3.903   41.063 25.935  1.00 138.49 ? 322 SER B N     1 
ATOM   6618 C CA    . SER B 2 336 ? 4.647   41.523 24.759  1.00 146.72 ? 322 SER B CA    1 
ATOM   6619 C C     . SER B 2 336 ? 6.052   42.013 25.115  1.00 151.23 ? 322 SER B C     1 
ATOM   6620 O O     . SER B 2 336 ? 6.993   41.832 24.338  1.00 152.61 ? 322 SER B O     1 
ATOM   6621 C CB    . SER B 2 336 ? 3.871   42.619 24.022  1.00 152.66 ? 322 SER B CB    1 
ATOM   6622 O OG    . SER B 2 336 ? 3.683   43.758 24.843  1.00 152.19 ? 322 SER B OG    1 
ATOM   6623 N N     . LYS B 2 337 ? 6.182   42.630 26.288  1.00 149.40 ? 323 LYS B N     1 
ATOM   6624 C CA    . LYS B 2 337 ? 7.464   43.149 26.765  1.00 145.63 ? 323 LYS B CA    1 
ATOM   6625 C C     . LYS B 2 337 ? 8.244   42.097 27.551  1.00 141.56 ? 323 LYS B C     1 
ATOM   6626 O O     . LYS B 2 337 ? 7.655   41.262 28.243  1.00 145.03 ? 323 LYS B O     1 
ATOM   6627 C CB    . LYS B 2 337 ? 7.255   44.401 27.622  1.00 148.57 ? 323 LYS B CB    1 
ATOM   6628 C CG    . LYS B 2 337 ? 6.790   45.624 26.845  1.00 149.83 ? 323 LYS B CG    1 
ATOM   6629 C CD    . LYS B 2 337 ? 6.611   46.825 27.760  1.00 140.64 ? 323 LYS B CD    1 
ATOM   6630 C CE    . LYS B 2 337 ? 6.152   48.055 26.991  1.00 139.57 ? 323 LYS B CE    1 
ATOM   6631 N NZ    . LYS B 2 337 ? 4.752   47.933 26.496  1.00 141.87 ? 323 LYS B NZ    1 
ATOM   6632 N N     . ASP B 2 338 ? 9.569   42.151 27.440  1.00 136.74 ? 324 ASP B N     1 
ATOM   6633 C CA    . ASP B 2 338 ? 10.455  41.208 28.123  1.00 138.95 ? 324 ASP B CA    1 
ATOM   6634 C C     . ASP B 2 338 ? 10.600  41.534 29.608  1.00 138.09 ? 324 ASP B C     1 
ATOM   6635 O O     . ASP B 2 338 ? 10.596  42.703 30.001  1.00 137.92 ? 324 ASP B O     1 
ATOM   6636 C CB    . ASP B 2 338 ? 11.833  41.182 27.452  1.00 140.89 ? 324 ASP B CB    1 
ATOM   6637 C CG    . ASP B 2 338 ? 11.785  40.650 26.028  1.00 137.96 ? 324 ASP B CG    1 
ATOM   6638 O OD1   . ASP B 2 338 ? 11.153  39.596 25.796  1.00 143.05 ? 324 ASP B OD1   1 
ATOM   6639 O OD2   . ASP B 2 338 ? 12.392  41.284 25.139  1.00 137.12 ? 324 ASP B OD2   1 
ATOM   6640 N N     . LEU B 2 339 ? 10.732  40.489 30.423  1.00 139.87 ? 325 LEU B N     1 
ATOM   6641 C CA    . LEU B 2 339 ? 10.869  40.633 31.871  1.00 141.34 ? 325 LEU B CA    1 
ATOM   6642 C C     . LEU B 2 339 ? 12.332  40.833 32.266  1.00 155.52 ? 325 LEU B C     1 
ATOM   6643 O O     . LEU B 2 339 ? 13.217  40.123 31.782  1.00 161.69 ? 325 LEU B O     1 
ATOM   6644 C CB    . LEU B 2 339 ? 10.279  39.411 32.586  1.00 135.00 ? 325 LEU B CB    1 
ATOM   6645 C CG    . LEU B 2 339 ? 9.920   39.514 34.073  1.00 140.01 ? 325 LEU B CG    1 
ATOM   6646 C CD1   . LEU B 2 339 ? 8.714   40.416 34.295  1.00 153.71 ? 325 LEU B CD1   1 
ATOM   6647 C CD2   . LEU B 2 339 ? 9.655   38.130 34.646  1.00 142.08 ? 325 LEU B CD2   1 
ATOM   6648 N N     . ILE B 2 340 ? 12.575  41.808 33.141  1.00 156.26 ? 326 ILE B N     1 
ATOM   6649 C CA    . ILE B 2 340 ? 13.929  42.146 33.588  1.00 154.55 ? 326 ILE B CA    1 
ATOM   6650 C C     . ILE B 2 340 ? 14.062  41.959 35.102  1.00 153.18 ? 326 ILE B C     1 
ATOM   6651 O O     . ILE B 2 340 ? 13.210  42.413 35.870  1.00 152.80 ? 326 ILE B O     1 
ATOM   6652 C CB    . ILE B 2 340 ? 14.320  43.599 33.200  1.00 152.32 ? 326 ILE B CB    1 
ATOM   6653 C CG1   . ILE B 2 340 ? 13.974  43.913 31.731  1.00 151.16 ? 326 ILE B CG1   1 
ATOM   6654 C CG2   . ILE B 2 340 ? 15.790  43.878 33.506  1.00 148.46 ? 326 ILE B CG2   1 
ATOM   6655 C CD1   . ILE B 2 340 ? 14.731  43.109 30.688  1.00 150.18 ? 326 ILE B CD1   1 
ATOM   6656 N N     . ALA B 2 341 ? 15.132  41.286 35.518  1.00 150.13 ? 327 ALA B N     1 
ATOM   6657 C CA    . ALA B 2 341 ? 15.421  41.070 36.935  1.00 151.70 ? 327 ALA B CA    1 
ATOM   6658 C C     . ALA B 2 341 ? 16.819  41.568 37.295  1.00 152.30 ? 327 ALA B C     1 
ATOM   6659 O O     . ALA B 2 341 ? 17.776  41.341 36.552  1.00 150.15 ? 327 ALA B O     1 
ATOM   6660 C CB    . ALA B 2 341 ? 15.269  39.598 37.290  1.00 147.17 ? 327 ALA B CB    1 
ATOM   6661 N N     . GLU B 2 342 ? 16.926  42.247 38.435  1.00 156.31 ? 328 GLU B N     1 
ATOM   6662 C CA    . GLU B 2 342 ? 18.201  42.794 38.897  1.00 152.13 ? 328 GLU B CA    1 
ATOM   6663 C C     . GLU B 2 342 ? 18.490  42.382 40.340  1.00 150.94 ? 328 GLU B C     1 
ATOM   6664 O O     . GLU B 2 342 ? 17.705  42.671 41.246  1.00 154.33 ? 328 GLU B O     1 
ATOM   6665 C CB    . GLU B 2 342 ? 18.210  44.321 38.758  1.00 155.20 ? 328 GLU B CB    1 
ATOM   6666 C CG    . GLU B 2 342 ? 19.581  44.963 38.930  1.00 150.12 ? 328 GLU B CG    1 
ATOM   6667 C CD    . GLU B 2 342 ? 19.554  46.474 38.777  1.00 152.67 ? 328 GLU B CD    1 
ATOM   6668 O OE1   . GLU B 2 342 ? 18.880  46.978 37.853  1.00 157.88 ? 328 GLU B OE1   1 
ATOM   6669 O OE2   . GLU B 2 342 ? 20.211  47.163 39.587  1.00 151.28 ? 328 GLU B OE2   1 
ATOM   6670 N N     . ILE B 2 343 ? 19.619  41.706 40.538  1.00 150.05 ? 329 ILE B N     1 
ATOM   6671 C CA    . ILE B 2 343 ? 20.037  41.238 41.861  1.00 150.44 ? 329 ILE B CA    1 
ATOM   6672 C C     . ILE B 2 343 ? 21.191  42.098 42.381  1.00 158.74 ? 329 ILE B C     1 
ATOM   6673 O O     . ILE B 2 343 ? 22.169  42.338 41.668  1.00 165.32 ? 329 ILE B O     1 
ATOM   6674 C CB    . ILE B 2 343 ? 20.448  39.745 41.839  1.00 144.12 ? 329 ILE B CB    1 
ATOM   6675 C CG1   . ILE B 2 343 ? 19.375  38.900 41.138  1.00 148.54 ? 329 ILE B CG1   1 
ATOM   6676 C CG2   . ILE B 2 343 ? 20.695  39.231 43.254  1.00 148.92 ? 329 ILE B CG2   1 
ATOM   6677 C CD1   . ILE B 2 343 ? 19.864  37.557 40.635  1.00 149.06 ? 329 ILE B CD1   1 
ATOM   6678 N N     . GLN B 2 344 ? 21.064  42.558 43.625  1.00 157.51 ? 330 GLN B N     1 
ATOM   6679 C CA    . GLN B 2 344 ? 22.063  43.430 44.242  1.00 156.60 ? 330 GLN B CA    1 
ATOM   6680 C C     . GLN B 2 344 ? 22.709  42.789 45.468  1.00 150.43 ? 330 GLN B C     1 
ATOM   6681 O O     . GLN B 2 344 ? 22.042  42.100 46.244  1.00 148.42 ? 330 GLN B O     1 
ATOM   6682 C CB    . GLN B 2 344 ? 21.442  44.777 44.632  1.00 156.95 ? 330 GLN B CB    1 
ATOM   6683 C CG    . GLN B 2 344 ? 20.982  45.638 43.461  1.00 156.20 ? 330 GLN B CG    1 
ATOM   6684 C CD    . GLN B 2 344 ? 19.560  45.342 43.009  1.00 158.77 ? 330 GLN B CD    1 
ATOM   6685 O OE1   . GLN B 2 344 ? 18.946  44.360 43.430  1.00 156.27 ? 330 GLN B OE1   1 
ATOM   6686 N NE2   . GLN B 2 344 ? 19.030  46.199 42.144  1.00 157.44 ? 330 GLN B NE2   1 
ATOM   6687 N N     . LYS B 2 345 ? 24.009  43.025 45.631  1.00 147.56 ? 331 LYS B N     1 
ATOM   6688 C CA    . LYS B 2 345 ? 24.749  42.558 46.801  1.00 149.04 ? 331 LYS B CA    1 
ATOM   6689 C C     . LYS B 2 345 ? 24.693  43.611 47.905  1.00 147.11 ? 331 LYS B C     1 
ATOM   6690 O O     . LYS B 2 345 ? 24.983  44.786 47.670  1.00 149.60 ? 331 LYS B O     1 
ATOM   6691 C CB    . LYS B 2 345 ? 26.204  42.250 46.431  1.00 155.09 ? 331 LYS B CB    1 
ATOM   6692 C CG    . LYS B 2 345 ? 27.008  41.580 47.536  1.00 154.02 ? 331 LYS B CG    1 
ATOM   6693 C CD    . LYS B 2 345 ? 28.467  41.425 47.142  1.00 146.35 ? 331 LYS B CD    1 
ATOM   6694 C CE    . LYS B 2 345 ? 29.269  40.752 48.245  1.00 139.88 ? 331 LYS B CE    1 
ATOM   6695 N NZ    . LYS B 2 345 ? 30.701  40.593 47.872  1.00 145.23 ? 331 LYS B NZ    1 
ATOM   6696 N N     . GLN B 2 346 ? 24.319  43.177 49.107  1.00 154.83 ? 332 GLN B N     1 
ATOM   6697 C CA    . GLN B 2 346 ? 24.187  44.077 50.252  1.00 148.16 ? 332 GLN B CA    1 
ATOM   6698 C C     . GLN B 2 346 ? 25.355  43.942 51.229  1.00 148.84 ? 332 GLN B C     1 
ATOM   6699 O O     . GLN B 2 346 ? 25.854  44.942 51.749  1.00 148.18 ? 332 GLN B O     1 
ATOM   6700 C CB    . GLN B 2 346 ? 22.857  43.842 50.979  1.00 146.87 ? 332 GLN B CB    1 
ATOM   6701 C CG    . GLN B 2 346 ? 21.611  44.082 50.132  1.00 146.45 ? 332 GLN B CG    1 
ATOM   6702 C CD    . GLN B 2 346 ? 21.433  45.533 49.714  1.00 158.73 ? 332 GLN B CD    1 
ATOM   6703 O OE1   . GLN B 2 346 ? 21.084  45.820 48.569  1.00 164.67 ? 332 GLN B OE1   1 
ATOM   6704 N NE2   . GLN B 2 346 ? 21.672  46.455 50.641  1.00 158.16 ? 332 GLN B NE2   1 
ATOM   6705 N N     . GLY B 2 347 ? 25.781  42.704 51.470  1.00 148.79 ? 333 GLY B N     1 
ATOM   6706 C CA    . GLY B 2 347 ? 26.878  42.422 52.392  1.00 147.34 ? 333 GLY B CA    1 
ATOM   6707 C C     . GLY B 2 347 ? 26.432  41.641 53.614  1.00 152.65 ? 333 GLY B C     1 
ATOM   6708 O O     . GLY B 2 347 ? 25.267  41.715 54.016  1.00 155.35 ? 333 GLY B O     1 
ATOM   6709 N N     . GLN B 2 348 ? 27.371  40.896 54.199  1.00 155.05 ? 334 GLN B N     1 
ATOM   6710 C CA    . GLN B 2 348 ? 27.136  40.064 55.391  1.00 158.11 ? 334 GLN B CA    1 
ATOM   6711 C C     . GLN B 2 348 ? 26.022  39.026 55.196  1.00 155.88 ? 334 GLN B C     1 
ATOM   6712 O O     . GLN B 2 348 ? 25.236  38.759 56.110  1.00 154.90 ? 334 GLN B O     1 
ATOM   6713 C CB    . GLN B 2 348 ? 26.873  40.934 56.634  1.00 159.86 ? 334 GLN B CB    1 
ATOM   6714 C CG    . GLN B 2 348 ? 28.045  41.811 57.061  1.00 155.55 ? 334 GLN B CG    1 
ATOM   6715 C CD    . GLN B 2 348 ? 29.206  41.023 57.646  1.00 156.11 ? 334 GLN B CD    1 
ATOM   6716 O OE1   . GLN B 2 348 ? 29.012  40.033 58.354  1.00 160.97 ? 334 GLN B OE1   1 
ATOM   6717 N NE2   . GLN B 2 348 ? 30.424  41.469 57.358  1.00 148.94 ? 334 GLN B NE2   1 
ATOM   6718 N N     . GLY B 2 349 ? 25.973  38.442 54.000  1.00 154.74 ? 335 GLY B N     1 
ATOM   6719 C CA    . GLY B 2 349 ? 24.991  37.412 53.667  1.00 151.85 ? 335 GLY B CA    1 
ATOM   6720 C C     . GLY B 2 349 ? 23.586  37.947 53.465  1.00 147.20 ? 335 GLY B C     1 
ATOM   6721 O O     . GLY B 2 349 ? 22.631  37.437 54.056  1.00 143.40 ? 335 GLY B O     1 
ATOM   6722 N N     . GLN B 2 350 ? 23.464  38.979 52.633  1.00 150.22 ? 336 GLN B N     1 
ATOM   6723 C CA    . GLN B 2 350 ? 22.170  39.578 52.308  1.00 153.64 ? 336 GLN B CA    1 
ATOM   6724 C C     . GLN B 2 350 ? 22.056  39.859 50.812  1.00 156.03 ? 336 GLN B C     1 
ATOM   6725 O O     . GLN B 2 350 ? 22.922  40.515 50.226  1.00 150.06 ? 336 GLN B O     1 
ATOM   6726 C CB    . GLN B 2 350 ? 21.945  40.865 53.110  1.00 155.07 ? 336 GLN B CB    1 
ATOM   6727 C CG    . GLN B 2 350 ? 21.590  40.646 54.574  1.00 152.81 ? 336 GLN B CG    1 
ATOM   6728 C CD    . GLN B 2 350 ? 21.367  41.942 55.333  1.00 149.14 ? 336 GLN B CD    1 
ATOM   6729 O OE1   . GLN B 2 350 ? 20.803  42.902 54.804  1.00 144.37 ? 336 GLN B OE1   1 
ATOM   6730 N NE2   . GLN B 2 350 ? 21.803  41.973 56.587  1.00 146.64 ? 336 GLN B NE2   1 
ATOM   6731 N N     . TRP B 2 351 ? 20.987  39.351 50.202  1.00 153.97 ? 337 TRP B N     1 
ATOM   6732 C CA    . TRP B 2 351 ? 20.738  39.536 48.773  1.00 151.51 ? 337 TRP B CA    1 
ATOM   6733 C C     . TRP B 2 351 ? 19.311  39.921 48.507  1.00 151.14 ? 337 TRP B C     1 
ATOM   6734 O O     . TRP B 2 351 ? 18.384  39.352 49.091  1.00 152.54 ? 337 TRP B O     1 
ATOM   6735 C CB    . TRP B 2 351 ? 21.094  38.272 47.995  1.00 148.98 ? 337 TRP B CB    1 
ATOM   6736 C CG    . TRP B 2 351 ? 22.567  37.938 48.009  1.00 142.33 ? 337 TRP B CG    1 
ATOM   6737 C CD1   . TRP B 2 351 ? 23.265  37.213 48.972  1.00 140.09 ? 337 TRP B CD1   1 
ATOM   6738 C CD2   . TRP B 2 351 ? 23.578  38.303 47.003  1.00 140.04 ? 337 TRP B CD2   1 
ATOM   6739 N NE1   . TRP B 2 351 ? 24.594  37.111 48.644  1.00 147.31 ? 337 TRP B NE1   1 
ATOM   6740 C CE2   . TRP B 2 351 ? 24.849  37.741 47.477  1.00 146.89 ? 337 TRP B CE2   1 
ATOM   6741 C CE3   . TRP B 2 351 ? 23.558  39.012 45.806  1.00 141.02 ? 337 TRP B CE3   1 
ATOM   6742 C CZ2   . TRP B 2 351 ? 26.033  37.895 46.768  1.00 159.23 ? 337 TRP B CZ2   1 
ATOM   6743 C CZ3   . TRP B 2 351 ? 24.759  39.161 45.100  1.00 144.63 ? 337 TRP B CZ3   1 
ATOM   6744 C CH2   . TRP B 2 351 ? 25.965  38.615 45.570  1.00 154.40 ? 337 TRP B CH2   1 
ATOM   6745 N N     . THR B 2 352 ? 19.127  40.894 47.618  1.00 146.30 ? 338 THR B N     1 
ATOM   6746 C CA    . THR B 2 352 ? 17.795  41.365 47.232  1.00 147.01 ? 338 THR B CA    1 
ATOM   6747 C C     . THR B 2 352 ? 17.639  41.434 45.709  1.00 146.47 ? 338 THR B C     1 
ATOM   6748 O O     . THR B 2 352 ? 18.612  41.666 44.986  1.00 142.13 ? 338 THR B O     1 
ATOM   6749 C CB    . THR B 2 352 ? 17.449  42.729 47.883  1.00 144.58 ? 338 THR B CB    1 
ATOM   6750 O OG1   . THR B 2 352 ? 16.146  43.152 47.461  1.00 141.13 ? 338 THR B OG1   1 
ATOM   6751 C CG2   . THR B 2 352 ? 18.477  43.804 47.518  1.00 146.10 ? 338 THR B CG2   1 
ATOM   6752 N N     . TYR B 2 353 ? 16.412  41.224 45.235  1.00 152.05 ? 339 TYR B N     1 
ATOM   6753 C CA    . TYR B 2 353 ? 16.117  41.259 43.803  1.00 153.64 ? 339 TYR B CA    1 
ATOM   6754 C C     . TYR B 2 353 ? 14.830  42.024 43.487  1.00 152.49 ? 339 TYR B C     1 
ATOM   6755 O O     . TYR B 2 353 ? 13.895  42.044 44.291  1.00 146.78 ? 339 TYR B O     1 
ATOM   6756 C CB    . TYR B 2 353 ? 16.063  39.840 43.218  1.00 155.95 ? 339 TYR B CB    1 
ATOM   6757 C CG    . TYR B 2 353 ? 14.946  38.966 43.756  1.00 152.92 ? 339 TYR B CG    1 
ATOM   6758 C CD1   . TYR B 2 353 ? 15.130  38.192 44.902  1.00 155.85 ? 339 TYR B CD1   1 
ATOM   6759 C CD2   . TYR B 2 353 ? 13.711  38.900 43.108  1.00 146.34 ? 339 TYR B CD2   1 
ATOM   6760 C CE1   . TYR B 2 353 ? 14.113  37.388 45.394  1.00 155.83 ? 339 TYR B CE1   1 
ATOM   6761 C CE2   . TYR B 2 353 ? 12.689  38.099 43.593  1.00 148.89 ? 339 TYR B CE2   1 
ATOM   6762 C CZ    . TYR B 2 353 ? 12.896  37.345 44.737  1.00 152.54 ? 339 TYR B CZ    1 
ATOM   6763 O OH    . TYR B 2 353 ? 11.885  36.548 45.222  1.00 153.10 ? 339 TYR B OH    1 
ATOM   6764 N N     . GLN B 2 354 ? 14.797  42.647 42.311  1.00 154.97 ? 340 GLN B N     1 
ATOM   6765 C CA    . GLN B 2 354 ? 13.617  43.371 41.841  1.00 152.99 ? 340 GLN B CA    1 
ATOM   6766 C C     . GLN B 2 354 ? 13.197  42.889 40.455  1.00 151.10 ? 340 GLN B C     1 
ATOM   6767 O O     . GLN B 2 354 ? 14.001  42.885 39.518  1.00 149.40 ? 340 GLN B O     1 
ATOM   6768 C CB    . GLN B 2 354 ? 13.868  44.884 41.821  1.00 152.38 ? 340 GLN B CB    1 
ATOM   6769 C CG    . GLN B 2 354 ? 13.977  45.533 43.194  1.00 156.58 ? 340 GLN B CG    1 
ATOM   6770 C CD    . GLN B 2 354 ? 15.377  45.462 43.777  1.00 153.04 ? 340 GLN B CD    1 
ATOM   6771 O OE1   . GLN B 2 354 ? 16.355  45.833 43.126  1.00 147.41 ? 340 GLN B OE1   1 
ATOM   6772 N NE2   . GLN B 2 354 ? 15.478  44.994 45.016  1.00 152.73 ? 340 GLN B NE2   1 
ATOM   6773 N N     . ILE B 2 355 ? 11.936  42.480 40.338  1.00 154.72 ? 341 ILE B N     1 
ATOM   6774 C CA    . ILE B 2 355 ? 11.375  42.031 39.065  1.00 153.09 ? 341 ILE B CA    1 
ATOM   6775 C C     . ILE B 2 355 ? 10.531  43.151 38.459  1.00 152.24 ? 341 ILE B C     1 
ATOM   6776 O O     . ILE B 2 355 ? 9.543   43.590 39.055  1.00 149.87 ? 341 ILE B O     1 
ATOM   6777 C CB    . ILE B 2 355 ? 10.534  40.743 39.227  1.00 160.83 ? 341 ILE B CB    1 
ATOM   6778 C CG1   . ILE B 2 355 ? 11.345  39.655 39.946  1.00 160.39 ? 341 ILE B CG1   1 
ATOM   6779 C CG2   . ILE B 2 355 ? 10.051  40.244 37.870  1.00 159.57 ? 341 ILE B CG2   1 
ATOM   6780 C CD1   . ILE B 2 355 ? 10.509  38.555 40.567  1.00 158.12 ? 341 ILE B CD1   1 
ATOM   6781 N N     . TYR B 2 356 ? 10.933  43.612 37.276  1.00 151.94 ? 342 TYR B N     1 
ATOM   6782 C CA    . TYR B 2 356 ? 10.281  44.744 36.616  1.00 151.91 ? 342 TYR B CA    1 
ATOM   6783 C C     . TYR B 2 356 ? 10.297  44.635 35.092  1.00 151.82 ? 342 TYR B C     1 
ATOM   6784 O O     . TYR B 2 356 ? 11.239  44.096 34.508  1.00 149.67 ? 342 TYR B O     1 
ATOM   6785 C CB    . TYR B 2 356 ? 10.918  46.071 37.062  1.00 149.66 ? 342 TYR B CB    1 
ATOM   6786 C CG    . TYR B 2 356 ? 12.412  46.178 36.817  1.00 151.78 ? 342 TYR B CG    1 
ATOM   6787 C CD1   . TYR B 2 356 ? 13.329  45.741 37.774  1.00 149.27 ? 342 TYR B CD1   1 
ATOM   6788 C CD2   . TYR B 2 356 ? 12.908  46.731 35.635  1.00 151.64 ? 342 TYR B CD2   1 
ATOM   6789 C CE1   . TYR B 2 356 ? 14.696  45.840 37.556  1.00 152.44 ? 342 TYR B CE1   1 
ATOM   6790 C CE2   . TYR B 2 356 ? 14.273  46.834 35.409  1.00 158.93 ? 342 TYR B CE2   1 
ATOM   6791 C CZ    . TYR B 2 356 ? 15.161  46.388 36.372  1.00 160.26 ? 342 TYR B CZ    1 
ATOM   6792 O OH    . TYR B 2 356 ? 16.516  46.490 36.152  1.00 165.71 ? 342 TYR B OH    1 
ATOM   6793 N N     . GLN B 2 357 ? 9.245   45.151 34.461  1.00 150.44 ? 343 GLN B N     1 
ATOM   6794 C CA    . GLN B 2 357 ? 9.169   45.230 33.002  1.00 148.80 ? 343 GLN B CA    1 
ATOM   6795 C C     . GLN B 2 357 ? 9.648   46.597 32.519  1.00 144.20 ? 343 GLN B C     1 
ATOM   6796 O O     . GLN B 2 357 ? 10.364  46.697 31.520  1.00 144.33 ? 343 GLN B O     1 
ATOM   6797 C CB    . GLN B 2 357 ? 7.742   44.964 32.514  1.00 152.51 ? 343 GLN B CB    1 
ATOM   6798 C CG    . GLN B 2 357 ? 7.275   43.526 32.691  1.00 153.56 ? 343 GLN B CG    1 
ATOM   6799 C CD    . GLN B 2 357 ? 5.905   43.269 32.091  1.00 154.55 ? 343 GLN B CD    1 
ATOM   6800 O OE1   . GLN B 2 357 ? 5.004   42.772 32.767  1.00 149.36 ? 343 GLN B OE1   1 
ATOM   6801 N NE2   . GLN B 2 357 ? 5.741   43.606 30.815  1.00 149.96 ? 343 GLN B NE2   1 
ATOM   6802 N N     . GLU B 2 358 ? 9.242   47.641 33.238  1.00 148.75 ? 344 GLU B N     1 
ATOM   6803 C CA    . GLU B 2 358 ? 9.660   49.012 32.953  1.00 146.96 ? 344 GLU B CA    1 
ATOM   6804 C C     . GLU B 2 358 ? 10.527  49.548 34.094  1.00 147.91 ? 344 GLU B C     1 
ATOM   6805 O O     . GLU B 2 358 ? 10.274  49.227 35.259  1.00 146.43 ? 344 GLU B O     1 
ATOM   6806 C CB    . GLU B 2 358 ? 8.439   49.913 32.745  1.00 151.36 ? 344 GLU B CB    1 
ATOM   6807 C CG    . GLU B 2 358 ? 7.665   49.637 31.463  1.00 153.55 ? 344 GLU B CG    1 
ATOM   6808 C CD    . GLU B 2 358 ? 6.458   50.542 31.290  1.00 155.02 ? 344 GLU B CD    1 
ATOM   6809 O OE1   . GLU B 2 358 ? 6.570   51.760 31.553  1.00 156.85 ? 344 GLU B OE1   1 
ATOM   6810 O OE2   . GLU B 2 358 ? 5.390   50.034 30.888  1.00 155.52 ? 344 GLU B OE2   1 
ATOM   6811 N N     . PRO B 2 359 ? 11.556  50.358 33.764  1.00 152.50 ? 345 PRO B N     1 
ATOM   6812 C CA    . PRO B 2 359 ? 12.454  50.929 34.774  1.00 156.06 ? 345 PRO B CA    1 
ATOM   6813 C C     . PRO B 2 359 ? 11.717  51.741 35.839  1.00 155.60 ? 345 PRO B C     1 
ATOM   6814 O O     . PRO B 2 359 ? 10.810  52.514 35.514  1.00 151.31 ? 345 PRO B O     1 
ATOM   6815 C CB    . PRO B 2 359 ? 13.370  51.842 33.952  1.00 150.72 ? 345 PRO B CB    1 
ATOM   6816 C CG    . PRO B 2 359 ? 13.369  51.239 32.591  1.00 149.02 ? 345 PRO B CG    1 
ATOM   6817 C CD    . PRO B 2 359 ? 11.974  50.722 32.397  1.00 148.23 ? 345 PRO B CD    1 
ATOM   6818 N N     . PHE B 2 360 ? 12.112  51.543 37.098  1.00 154.88 ? 346 PHE B N     1 
ATOM   6819 C CA    . PHE B 2 360 ? 11.522  52.220 38.265  1.00 153.88 ? 346 PHE B CA    1 
ATOM   6820 C C     . PHE B 2 360 ? 10.031  51.918 38.473  1.00 158.46 ? 346 PHE B C     1 
ATOM   6821 O O     . PHE B 2 360 ? 9.296   52.724 39.052  1.00 161.55 ? 346 PHE B O     1 
ATOM   6822 C CB    . PHE B 2 360 ? 11.782  53.737 38.220  1.00 152.05 ? 346 PHE B CB    1 
ATOM   6823 C CG    . PHE B 2 360 ? 13.240  54.104 38.201  1.00 152.69 ? 346 PHE B CG    1 
ATOM   6824 C CD1   . PHE B 2 360 ? 13.972  54.171 39.384  1.00 154.73 ? 346 PHE B CD1   1 
ATOM   6825 C CD2   . PHE B 2 360 ? 13.884  54.390 37.001  1.00 150.84 ? 346 PHE B CD2   1 
ATOM   6826 C CE1   . PHE B 2 360 ? 15.317  54.511 39.368  1.00 153.07 ? 346 PHE B CE1   1 
ATOM   6827 C CE2   . PHE B 2 360 ? 15.228  54.731 36.979  1.00 149.86 ? 346 PHE B CE2   1 
ATOM   6828 C CZ    . PHE B 2 360 ? 15.946  54.792 38.164  1.00 150.83 ? 346 PHE B CZ    1 
ATOM   6829 N N     . LYS B 2 361 ? 9.601   50.749 38.001  1.00 154.34 ? 347 LYS B N     1 
ATOM   6830 C CA    . LYS B 2 361 ? 8.227   50.276 38.179  1.00 146.30 ? 347 LYS B CA    1 
ATOM   6831 C C     . LYS B 2 361 ? 8.225   48.798 38.569  1.00 137.00 ? 347 LYS B C     1 
ATOM   6832 O O     . LYS B 2 361 ? 8.202   47.916 37.706  1.00 127.25 ? 347 LYS B O     1 
ATOM   6833 C CB    . LYS B 2 361 ? 7.400   50.503 36.908  1.00 147.60 ? 347 LYS B CB    1 
ATOM   6834 C CG    . LYS B 2 361 ? 6.985   51.947 36.669  1.00 149.14 ? 347 LYS B CG    1 
ATOM   6835 C CD    . LYS B 2 361 ? 6.170   52.083 35.392  1.00 149.37 ? 347 LYS B CD    1 
ATOM   6836 C CE    . LYS B 2 361 ? 5.748   53.524 35.145  1.00 150.52 ? 347 LYS B CE    1 
ATOM   6837 N NZ    . LYS B 2 361 ? 4.725   53.998 36.120  1.00 152.24 ? 347 LYS B NZ    1 
ATOM   6838 N N     . ASN B 2 362 ? 8.252   48.540 39.874  1.00 137.12 ? 348 ASN B N     1 
ATOM   6839 C CA    . ASN B 2 362 ? 8.338   47.179 40.405  1.00 138.28 ? 348 ASN B CA    1 
ATOM   6840 C C     . ASN B 2 362 ? 7.021   46.410 40.333  1.00 145.89 ? 348 ASN B C     1 
ATOM   6841 O O     . ASN B 2 362 ? 5.948   46.972 40.565  1.00 152.60 ? 348 ASN B O     1 
ATOM   6842 C CB    . ASN B 2 362 ? 8.857   47.197 41.848  1.00 137.96 ? 348 ASN B CB    1 
ATOM   6843 C CG    . ASN B 2 362 ? 10.283  47.714 41.957  1.00 149.33 ? 348 ASN B CG    1 
ATOM   6844 O OD1   . ASN B 2 362 ? 10.864  48.201 40.985  1.00 154.91 ? 348 ASN B OD1   1 
ATOM   6845 N ND2   . ASN B 2 362 ? 10.854  47.613 43.152  1.00 152.87 ? 348 ASN B ND2   1 
ATOM   6846 N N     . LEU B 2 363 ? 7.120   45.122 40.009  1.00 150.16 ? 349 LEU B N     1 
ATOM   6847 C CA    . LEU B 2 363 ? 5.960   44.234 39.946  1.00 153.89 ? 349 LEU B CA    1 
ATOM   6848 C C     . LEU B 2 363 ? 5.979   43.213 41.084  1.00 156.95 ? 349 LEU B C     1 
ATOM   6849 O O     . LEU B 2 363 ? 4.962   42.993 41.746  1.00 160.05 ? 349 LEU B O     1 
ATOM   6850 C CB    . LEU B 2 363 ? 5.889   43.517 38.590  1.00 139.82 ? 349 LEU B CB    1 
ATOM   6851 C CG    . LEU B 2 363 ? 5.362   44.282 37.370  1.00 137.28 ? 349 LEU B CG    1 
ATOM   6852 C CD1   . LEU B 2 363 ? 6.444   45.135 36.722  1.00 136.10 ? 349 LEU B CD1   1 
ATOM   6853 C CD2   . LEU B 2 363 ? 4.785   43.308 36.355  1.00 135.62 ? 349 LEU B CD2   1 
ATOM   6854 N N     . LYS B 2 364 ? 7.140   42.597 41.300  1.00 151.91 ? 350 LYS B N     1 
ATOM   6855 C CA    . LYS B 2 364 ? 7.321   41.610 42.362  1.00 146.95 ? 350 LYS B CA    1 
ATOM   6856 C C     . LYS B 2 364 ? 8.650   41.838 43.080  1.00 149.36 ? 350 LYS B C     1 
ATOM   6857 O O     . LYS B 2 364 ? 9.705   41.910 42.444  1.00 152.96 ? 350 LYS B O     1 
ATOM   6858 C CB    . LYS B 2 364 ? 7.254   40.188 41.789  1.00 143.75 ? 350 LYS B CB    1 
ATOM   6859 C CG    . LYS B 2 364 ? 7.090   39.083 42.827  1.00 145.06 ? 350 LYS B CG    1 
ATOM   6860 C CD    . LYS B 2 364 ? 5.647   38.949 43.290  1.00 153.33 ? 350 LYS B CD    1 
ATOM   6861 C CE    . LYS B 2 364 ? 5.492   37.819 44.296  1.00 155.19 ? 350 LYS B CE    1 
ATOM   6862 N NZ    . LYS B 2 364 ? 4.078   37.657 44.732  1.00 153.98 ? 350 LYS B NZ    1 
ATOM   6863 N N     . THR B 2 365 ? 8.586   41.954 44.404  1.00 147.91 ? 351 THR B N     1 
ATOM   6864 C CA    . THR B 2 365 ? 9.774   42.195 45.226  1.00 142.91 ? 351 THR B CA    1 
ATOM   6865 C C     . THR B 2 365 ? 9.969   41.110 46.283  1.00 149.84 ? 351 THR B C     1 
ATOM   6866 O O     . THR B 2 365 ? 9.004   40.636 46.889  1.00 153.98 ? 351 THR B O     1 
ATOM   6867 C CB    . THR B 2 365 ? 9.726   43.574 45.921  1.00 133.20 ? 351 THR B CB    1 
ATOM   6868 O OG1   . THR B 2 365 ? 8.469   43.735 46.590  1.00 140.80 ? 351 THR B OG1   1 
ATOM   6869 C CG2   . THR B 2 365 ? 9.907   44.699 44.907  1.00 123.66 ? 351 THR B CG2   1 
ATOM   6870 N N     . GLY B 2 366 ? 11.226  40.725 46.493  1.00 147.27 ? 352 GLY B N     1 
ATOM   6871 C CA    . GLY B 2 366 ? 11.586  39.708 47.479  1.00 147.19 ? 352 GLY B CA    1 
ATOM   6872 C C     . GLY B 2 366 ? 13.072  39.707 47.790  1.00 149.36 ? 352 GLY B C     1 
ATOM   6873 O O     . GLY B 2 366 ? 13.861  40.348 47.091  1.00 150.97 ? 352 GLY B O     1 
ATOM   6874 N N     . LYS B 2 367 ? 13.452  38.983 48.842  1.00 153.93 ? 353 LYS B N     1 
ATOM   6875 C CA    . LYS B 2 367 ? 14.853  38.898 49.263  1.00 158.11 ? 353 LYS B CA    1 
ATOM   6876 C C     . LYS B 2 367 ? 15.205  37.556 49.906  1.00 157.51 ? 353 LYS B C     1 
ATOM   6877 O O     . LYS B 2 367 ? 14.393  36.964 50.623  1.00 160.00 ? 353 LYS B O     1 
ATOM   6878 C CB    . LYS B 2 367 ? 15.218  40.058 50.203  1.00 158.98 ? 353 LYS B CB    1 
ATOM   6879 C CG    . LYS B 2 367 ? 14.342  40.189 51.445  1.00 155.91 ? 353 LYS B CG    1 
ATOM   6880 C CD    . LYS B 2 367 ? 14.792  41.334 52.342  1.00 149.44 ? 353 LYS B CD    1 
ATOM   6881 C CE    . LYS B 2 367 ? 15.993  40.953 53.196  1.00 150.02 ? 353 LYS B CE    1 
ATOM   6882 N NZ    . LYS B 2 367 ? 16.429  42.073 54.074  1.00 143.43 ? 353 LYS B NZ    1 
ATOM   6883 N N     . TYR B 2 368 ? 16.421  37.087 49.634  1.00 157.17 ? 354 TYR B N     1 
ATOM   6884 C CA    . TYR B 2 368 ? 16.956  35.874 50.247  1.00 157.81 ? 354 TYR B CA    1 
ATOM   6885 C C     . TYR B 2 368 ? 18.267  36.185 50.964  1.00 158.69 ? 354 TYR B C     1 
ATOM   6886 O O     . TYR B 2 368 ? 19.202  36.721 50.362  1.00 160.18 ? 354 TYR B O     1 
ATOM   6887 C CB    . TYR B 2 368 ? 17.165  34.777 49.197  1.00 160.31 ? 354 TYR B CB    1 
ATOM   6888 C CG    . TYR B 2 368 ? 15.882  34.190 48.648  1.00 162.45 ? 354 TYR B CG    1 
ATOM   6889 C CD1   . TYR B 2 368 ? 15.251  33.123 49.288  1.00 158.52 ? 354 TYR B CD1   1 
ATOM   6890 C CD2   . TYR B 2 368 ? 15.302  34.696 47.485  1.00 159.85 ? 354 TYR B CD2   1 
ATOM   6891 C CE1   . TYR B 2 368 ? 14.076  32.580 48.788  1.00 158.91 ? 354 TYR B CE1   1 
ATOM   6892 C CE2   . TYR B 2 368 ? 14.128  34.160 46.977  1.00 152.65 ? 354 TYR B CE2   1 
ATOM   6893 C CZ    . TYR B 2 368 ? 13.520  33.104 47.631  1.00 154.04 ? 354 TYR B CZ    1 
ATOM   6894 O OH    . TYR B 2 368 ? 12.355  32.569 47.130  1.00 143.99 ? 354 TYR B OH    1 
ATOM   6895 N N     . ALA B 2 369 ? 18.325  35.850 52.250  1.00 158.18 ? 355 ALA B N     1 
ATOM   6896 C CA    . ALA B 2 369 ? 19.482  36.168 53.086  1.00 155.50 ? 355 ALA B CA    1 
ATOM   6897 C C     . ALA B 2 369 ? 20.649  35.199 52.868  1.00 150.54 ? 355 ALA B C     1 
ATOM   6898 O O     . ALA B 2 369 ? 21.525  35.456 52.039  1.00 148.38 ? 355 ALA B O     1 
ATOM   6899 C CB    . ALA B 2 369 ? 19.081  36.222 54.555  1.00 153.17 ? 355 ALA B CB    1 
ATOM   6900 N N     . ARG B 2 370 ? 20.651  34.094 53.612  1.00 147.18 ? 356 ARG B N     1 
ATOM   6901 C CA    . ARG B 2 370 ? 21.734  33.113 53.557  1.00 147.48 ? 356 ARG B CA    1 
ATOM   6902 C C     . ARG B 2 370 ? 21.209  31.706 53.835  1.00 152.92 ? 356 ARG B C     1 
ATOM   6903 O O     . ARG B 2 370 ? 20.353  31.514 54.703  1.00 151.08 ? 356 ARG B O     1 
ATOM   6904 C CB    . ARG B 2 370 ? 22.829  33.473 54.568  1.00 147.44 ? 356 ARG B CB    1 
ATOM   6905 C CG    . ARG B 2 370 ? 24.167  32.788 54.327  1.00 146.14 ? 356 ARG B CG    1 
ATOM   6906 C CD    . ARG B 2 370 ? 25.038  32.795 55.575  1.00 144.77 ? 356 ARG B CD    1 
ATOM   6907 N NE    . ARG B 2 370 ? 25.546  34.127 55.905  1.00 155.57 ? 356 ARG B NE    1 
ATOM   6908 C CZ    . ARG B 2 370 ? 26.737  34.596 55.539  1.00 157.06 ? 356 ARG B CZ    1 
ATOM   6909 N NH1   . ARG B 2 370 ? 27.566  33.849 54.820  1.00 152.46 ? 356 ARG B NH1   1 
ATOM   6910 N NH2   . ARG B 2 370 ? 27.101  35.821 55.894  1.00 153.59 ? 356 ARG B NH2   1 
ATOM   6911 N N     . MET B 2 371 ? 21.728  30.730 53.093  1.00 158.81 ? 357 MET B N     1 
ATOM   6912 C CA    . MET B 2 371 ? 21.371  29.328 53.291  1.00 159.50 ? 357 MET B CA    1 
ATOM   6913 C C     . MET B 2 371 ? 22.212  28.730 54.422  1.00 159.07 ? 357 MET B C     1 
ATOM   6914 O O     . MET B 2 371 ? 23.193  28.020 54.180  1.00 154.60 ? 357 MET B O     1 
ATOM   6915 C CB    . MET B 2 371 ? 21.548  28.538 51.987  1.00 155.30 ? 357 MET B CB    1 
ATOM   6916 C CG    . MET B 2 371 ? 20.851  27.184 51.948  1.00 157.57 ? 357 MET B CG    1 
ATOM   6917 S SD    . MET B 2 371 ? 19.090  27.268 51.556  1.00 176.20 ? 357 MET B SD    1 
ATOM   6918 C CE    . MET B 2 371 ? 18.358  27.394 53.186  1.00 151.39 ? 357 MET B CE    1 
ATOM   6919 N N     . ARG B 2 372 ? 21.817  29.033 55.657  1.00 159.70 ? 358 ARG B N     1 
ATOM   6920 C CA    . ARG B 2 372 ? 22.542  28.586 56.846  1.00 156.62 ? 358 ARG B CA    1 
ATOM   6921 C C     . ARG B 2 372 ? 22.350  27.093 57.098  1.00 160.93 ? 358 ARG B C     1 
ATOM   6922 O O     . ARG B 2 372 ? 21.221  26.597 57.119  1.00 159.03 ? 358 ARG B O     1 
ATOM   6923 C CB    . ARG B 2 372 ? 22.109  29.392 58.074  1.00 149.00 ? 358 ARG B CB    1 
ATOM   6924 N N     . GLY B 2 373 ? 23.463  26.387 57.284  1.00 164.56 ? 359 GLY B N     1 
ATOM   6925 C CA    . GLY B 2 373 ? 23.441  24.948 57.529  1.00 157.35 ? 359 GLY B CA    1 
ATOM   6926 C C     . GLY B 2 373 ? 24.788  24.288 57.303  1.00 145.97 ? 359 GLY B C     1 
ATOM   6927 O O     . GLY B 2 373 ? 25.358  23.697 58.223  1.00 138.01 ? 359 GLY B O     1 
ATOM   6928 N N     . ALA B 2 374 ? 25.295  24.393 56.076  1.00 143.45 ? 360 ALA B N     1 
ATOM   6929 C CA    . ALA B 2 374 ? 26.564  23.769 55.704  1.00 143.80 ? 360 ALA B CA    1 
ATOM   6930 C C     . ALA B 2 374 ? 27.615  24.794 55.265  1.00 154.45 ? 360 ALA B C     1 
ATOM   6931 O O     . ALA B 2 374 ? 28.410  25.260 56.085  1.00 157.86 ? 360 ALA B O     1 
ATOM   6932 C CB    . ALA B 2 374 ? 26.344  22.714 54.626  1.00 145.13 ? 360 ALA B CB    1 
ATOM   6933 N N     . HIS B 2 375 ? 27.613  25.140 53.978  1.00 156.75 ? 361 HIS B N     1 
ATOM   6934 C CA    . HIS B 2 375 ? 28.606  26.055 53.411  1.00 154.11 ? 361 HIS B CA    1 
ATOM   6935 C C     . HIS B 2 375 ? 27.975  27.083 52.515  1.00 153.58 ? 361 HIS B C     1 
ATOM   6936 O O     . HIS B 2 375 ? 27.074  26.768 51.733  1.00 151.86 ? 361 HIS B O     1 
ATOM   6937 C CB    . HIS B 2 375 ? 29.672  25.281 52.641  1.00 156.70 ? 361 HIS B CB    1 
ATOM   6938 C CG    . HIS B 2 375 ? 30.407  24.257 53.474  1.00 155.58 ? 361 HIS B CG    1 
ATOM   6939 N ND1   . HIS B 2 375 ? 31.530  24.549 54.155  1.00 151.00 ? 361 HIS B ND1   1 
ATOM   6940 C CD2   . HIS B 2 375 ? 30.137  22.912 53.719  1.00 155.58 ? 361 HIS B CD2   1 
ATOM   6941 C CE1   . HIS B 2 375 ? 31.960  23.450 54.803  1.00 145.84 ? 361 HIS B CE1   1 
ATOM   6942 N NE2   . HIS B 2 375 ? 31.106  22.448 54.535  1.00 149.66 ? 361 HIS B NE2   1 
ATOM   6943 N N     . THR B 2 376 ? 28.450  28.322 52.624  1.00 151.59 ? 362 THR B N     1 
ATOM   6944 C CA    . THR B 2 376 ? 27.966  29.430 51.797  1.00 151.45 ? 362 THR B CA    1 
ATOM   6945 C C     . THR B 2 376 ? 29.109  30.303 51.284  1.00 148.09 ? 362 THR B C     1 
ATOM   6946 O O     . THR B 2 376 ? 30.065  30.584 52.011  1.00 148.90 ? 362 THR B O     1 
ATOM   6947 C CB    . THR B 2 376 ? 26.960  30.326 52.553  1.00 150.66 ? 362 THR B CB    1 
ATOM   6948 O OG1   . THR B 2 376 ? 27.401  30.521 53.903  1.00 143.37 ? 362 THR B OG1   1 
ATOM   6949 C CG2   . THR B 2 376 ? 25.573  29.698 52.560  1.00 150.58 ? 362 THR B CG2   1 
ATOM   6950 N N     . ASN B 2 377 ? 28.998  30.723 50.025  1.00 144.36 ? 363 ASN B N     1 
ATOM   6951 C CA    . ASN B 2 377 ? 29.965  31.632 49.409  1.00 137.06 ? 363 ASN B CA    1 
ATOM   6952 C C     . ASN B 2 377 ? 29.293  32.657 48.488  1.00 133.90 ? 363 ASN B C     1 
ATOM   6953 O O     . ASN B 2 377 ? 28.075  32.620 48.296  1.00 137.74 ? 363 ASN B O     1 
ATOM   6954 C CB    . ASN B 2 377 ? 31.066  30.850 48.675  1.00 141.46 ? 363 ASN B CB    1 
ATOM   6955 C CG    . ASN B 2 377 ? 30.522  29.950 47.581  1.00 148.18 ? 363 ASN B CG    1 
ATOM   6956 O OD1   . ASN B 2 377 ? 30.164  30.413 46.498  1.00 148.08 ? 363 ASN B OD1   1 
ATOM   6957 N ND2   . ASN B 2 377 ? 30.476  28.651 47.853  1.00 150.19 ? 363 ASN B ND2   1 
ATOM   6958 N N     . ASP B 2 378 ? 30.092  33.563 47.926  1.00 135.32 ? 364 ASP B N     1 
ATOM   6959 C CA    . ASP B 2 378 ? 29.587  34.648 47.076  1.00 139.21 ? 364 ASP B CA    1 
ATOM   6960 C C     . ASP B 2 378 ? 28.913  34.165 45.788  1.00 140.45 ? 364 ASP B C     1 
ATOM   6961 O O     . ASP B 2 378 ? 27.970  34.795 45.305  1.00 148.00 ? 364 ASP B O     1 
ATOM   6962 C CB    . ASP B 2 378 ? 30.708  35.640 46.750  1.00 143.30 ? 364 ASP B CB    1 
ATOM   6963 C CG    . ASP B 2 378 ? 31.138  36.456 47.958  1.00 142.03 ? 364 ASP B CG    1 
ATOM   6964 O OD1   . ASP B 2 378 ? 30.284  37.151 48.550  1.00 126.41 ? 364 ASP B OD1   1 
ATOM   6965 O OD2   . ASP B 2 378 ? 32.335  36.410 48.311  1.00 156.21 ? 364 ASP B OD2   1 
ATOM   6966 N N     . VAL B 2 379 ? 29.402  33.053 45.241  1.00 136.32 ? 365 VAL B N     1 
ATOM   6967 C CA    . VAL B 2 379 ? 28.825  32.459 44.033  1.00 139.59 ? 365 VAL B CA    1 
ATOM   6968 C C     . VAL B 2 379 ? 27.581  31.631 44.371  1.00 144.78 ? 365 VAL B C     1 
ATOM   6969 O O     . VAL B 2 379 ? 26.548  31.759 43.710  1.00 153.35 ? 365 VAL B O     1 
ATOM   6970 C CB    . VAL B 2 379 ? 29.861  31.605 43.259  1.00 139.63 ? 365 VAL B CB    1 
ATOM   6971 C CG1   . VAL B 2 379 ? 29.222  30.915 42.060  1.00 143.17 ? 365 VAL B CG1   1 
ATOM   6972 C CG2   . VAL B 2 379 ? 31.029  32.466 42.801  1.00 148.11 ? 365 VAL B CG2   1 
ATOM   6973 N N     . LYS B 2 380 ? 27.688  30.801 45.410  1.00 144.25 ? 366 LYS B N     1 
ATOM   6974 C CA    . LYS B 2 380 ? 26.612  29.895 45.826  1.00 149.92 ? 366 LYS B CA    1 
ATOM   6975 C C     . LYS B 2 380 ? 25.338  30.633 46.246  1.00 155.54 ? 366 LYS B C     1 
ATOM   6976 O O     . LYS B 2 380 ? 24.229  30.177 45.956  1.00 164.53 ? 366 LYS B O     1 
ATOM   6977 C CB    . LYS B 2 380 ? 27.094  28.980 46.958  1.00 147.16 ? 366 LYS B CB    1 
ATOM   6978 C CG    . LYS B 2 380 ? 26.219  27.760 47.203  1.00 147.11 ? 366 LYS B CG    1 
ATOM   6979 C CD    . LYS B 2 380 ? 26.746  26.927 48.359  1.00 145.36 ? 366 LYS B CD    1 
ATOM   6980 C CE    . LYS B 2 380 ? 25.892  25.690 48.584  1.00 147.37 ? 366 LYS B CE    1 
ATOM   6981 N NZ    . LYS B 2 380 ? 26.399  24.863 49.714  1.00 150.41 ? 366 LYS B NZ    1 
ATOM   6982 N N     . GLN B 2 381 ? 25.505  31.767 46.924  1.00 156.11 ? 367 GLN B N     1 
ATOM   6983 C CA    . GLN B 2 381 ? 24.377  32.599 47.350  1.00 155.90 ? 367 GLN B CA    1 
ATOM   6984 C C     . GLN B 2 381 ? 23.692  33.293 46.172  1.00 149.04 ? 367 GLN B C     1 
ATOM   6985 O O     . GLN B 2 381 ? 22.508  33.629 46.246  1.00 143.39 ? 367 GLN B O     1 
ATOM   6986 C CB    . GLN B 2 381 ? 24.826  33.635 48.385  1.00 155.86 ? 367 GLN B CB    1 
ATOM   6987 C CG    . GLN B 2 381 ? 25.086  33.064 49.772  1.00 158.47 ? 367 GLN B CG    1 
ATOM   6988 C CD    . GLN B 2 381 ? 25.578  34.106 50.763  1.00 160.31 ? 367 GLN B CD    1 
ATOM   6989 O OE1   . GLN B 2 381 ? 25.104  35.244 50.778  1.00 165.22 ? 367 GLN B OE1   1 
ATOM   6990 N NE2   . GLN B 2 381 ? 26.528  33.716 51.605  1.00 155.69 ? 367 GLN B NE2   1 
ATOM   6991 N N     . LEU B 2 382 ? 24.445  33.503 45.093  1.00 147.49 ? 368 LEU B N     1 
ATOM   6992 C CA    . LEU B 2 382 ? 23.918  34.118 43.876  1.00 144.28 ? 368 LEU B CA    1 
ATOM   6993 C C     . LEU B 2 382 ? 23.308  33.077 42.934  1.00 143.49 ? 368 LEU B C     1 
ATOM   6994 O O     . LEU B 2 382 ? 22.301  33.348 42.276  1.00 139.36 ? 368 LEU B O     1 
ATOM   6995 C CB    . LEU B 2 382 ? 25.014  34.920 43.161  1.00 146.46 ? 368 LEU B CB    1 
ATOM   6996 C CG    . LEU B 2 382 ? 24.638  35.814 41.970  1.00 143.18 ? 368 LEU B CG    1 
ATOM   6997 C CD1   . LEU B 2 382 ? 23.709  36.948 42.382  1.00 143.99 ? 368 LEU B CD1   1 
ATOM   6998 C CD2   . LEU B 2 382 ? 25.891  36.367 41.309  1.00 144.02 ? 368 LEU B CD2   1 
ATOM   6999 N N     . THR B 2 383 ? 23.922  31.895 42.877  1.00 145.71 ? 369 THR B N     1 
ATOM   7000 C CA    . THR B 2 383 ? 23.446  30.793 42.035  1.00 141.65 ? 369 THR B CA    1 
ATOM   7001 C C     . THR B 2 383 ? 22.092  30.268 42.522  1.00 145.88 ? 369 THR B C     1 
ATOM   7002 O O     . THR B 2 383 ? 21.212  29.956 41.714  1.00 148.87 ? 369 THR B O     1 
ATOM   7003 C CB    . THR B 2 383 ? 24.472  29.638 41.976  1.00 146.58 ? 369 THR B CB    1 
ATOM   7004 O OG1   . THR B 2 383 ? 25.782  30.166 41.732  1.00 150.13 ? 369 THR B OG1   1 
ATOM   7005 C CG2   . THR B 2 383 ? 24.121  28.649 40.867  1.00 142.76 ? 369 THR B CG2   1 
ATOM   7006 N N     . GLU B 2 384 ? 21.933  30.183 43.842  1.00 147.77 ? 370 GLU B N     1 
ATOM   7007 C CA    . GLU B 2 384 ? 20.674  29.759 44.457  1.00 150.85 ? 370 GLU B CA    1 
ATOM   7008 C C     . GLU B 2 384 ? 19.595  30.838 44.355  1.00 150.89 ? 370 GLU B C     1 
ATOM   7009 O O     . GLU B 2 384 ? 18.401  30.534 44.389  1.00 158.36 ? 370 GLU B O     1 
ATOM   7010 C CB    . GLU B 2 384 ? 20.890  29.365 45.921  1.00 146.25 ? 370 GLU B CB    1 
ATOM   7011 C CG    . GLU B 2 384 ? 21.599  28.032 46.114  1.00 142.40 ? 370 GLU B CG    1 
ATOM   7012 C CD    . GLU B 2 384 ? 21.781  27.661 47.576  1.00 144.26 ? 370 GLU B CD    1 
ATOM   7013 O OE1   . GLU B 2 384 ? 20.833  27.846 48.371  1.00 154.15 ? 370 GLU B OE1   1 
ATOM   7014 O OE2   . GLU B 2 384 ? 22.878  27.183 47.933  1.00 135.49 ? 370 GLU B OE2   1 
ATOM   7015 N N     . ALA B 2 385 ? 20.026  32.093 44.232  1.00 147.17 ? 371 ALA B N     1 
ATOM   7016 C CA    . ALA B 2 385 ? 19.115  33.228 44.090  1.00 146.36 ? 371 ALA B CA    1 
ATOM   7017 C C     . ALA B 2 385 ? 18.457  33.264 42.710  1.00 144.36 ? 371 ALA B C     1 
ATOM   7018 O O     . ALA B 2 385 ? 17.258  33.523 42.600  1.00 143.32 ? 371 ALA B O     1 
ATOM   7019 C CB    . ALA B 2 385 ? 19.841  34.536 44.371  1.00 149.48 ? 371 ALA B CB    1 
ATOM   7020 N N     . VAL B 2 386 ? 19.249  33.002 41.669  1.00 141.20 ? 372 VAL B N     1 
ATOM   7021 C CA    . VAL B 2 386 ? 18.757  32.967 40.287  1.00 144.16 ? 372 VAL B CA    1 
ATOM   7022 C C     . VAL B 2 386 ? 17.750  31.829 40.097  1.00 149.57 ? 372 VAL B C     1 
ATOM   7023 O O     . VAL B 2 386 ? 16.707  32.015 39.465  1.00 155.47 ? 372 VAL B O     1 
ATOM   7024 C CB    . VAL B 2 386 ? 19.918  32.845 39.267  1.00 147.14 ? 372 VAL B CB    1 
ATOM   7025 C CG1   . VAL B 2 386 ? 19.392  32.723 37.842  1.00 147.34 ? 372 VAL B CG1   1 
ATOM   7026 C CG2   . VAL B 2 386 ? 20.855  34.040 39.374  1.00 156.59 ? 372 VAL B CG2   1 
ATOM   7027 N N     . GLN B 2 387 ? 18.065  30.665 40.664  1.00 147.22 ? 373 GLN B N     1 
ATOM   7028 C CA    . GLN B 2 387 ? 17.190  29.491 40.601  1.00 153.42 ? 373 GLN B CA    1 
ATOM   7029 C C     . GLN B 2 387 ? 15.881  29.694 41.369  1.00 155.29 ? 373 GLN B C     1 
ATOM   7030 O O     . GLN B 2 387 ? 14.862  29.084 41.039  1.00 162.18 ? 373 GLN B O     1 
ATOM   7031 C CB    . GLN B 2 387 ? 17.917  28.247 41.122  1.00 152.44 ? 373 GLN B CB    1 
ATOM   7032 C CG    . GLN B 2 387 ? 19.035  27.747 40.217  1.00 155.80 ? 373 GLN B CG    1 
ATOM   7033 C CD    . GLN B 2 387 ? 19.725  26.505 40.755  1.00 154.30 ? 373 GLN B CD    1 
ATOM   7034 O OE1   . GLN B 2 387 ? 20.945  26.482 40.911  1.00 162.31 ? 373 GLN B OE1   1 
ATOM   7035 N NE2   . GLN B 2 387 ? 18.945  25.466 41.040  1.00 140.41 ? 373 GLN B NE2   1 
ATOM   7036 N N     . LYS B 2 388 ? 15.921  30.550 42.390  1.00 154.64 ? 374 LYS B N     1 
ATOM   7037 C CA    . LYS B 2 388 ? 14.741  30.874 43.191  1.00 150.76 ? 374 LYS B CA    1 
ATOM   7038 C C     . LYS B 2 388 ? 13.760  31.768 42.431  1.00 144.77 ? 374 LYS B C     1 
ATOM   7039 O O     . LYS B 2 388 ? 12.545  31.588 42.533  1.00 143.94 ? 374 LYS B O     1 
ATOM   7040 C CB    . LYS B 2 388 ? 15.151  31.540 44.507  1.00 152.41 ? 374 LYS B CB    1 
ATOM   7041 N N     . ILE B 2 389 ? 14.295  32.725 41.674  1.00 145.64 ? 375 ILE B N     1 
ATOM   7042 C CA    . ILE B 2 389 ? 13.481  33.648 40.877  1.00 148.97 ? 375 ILE B CA    1 
ATOM   7043 C C     . ILE B 2 389 ? 12.905  32.947 39.643  1.00 150.02 ? 375 ILE B C     1 
ATOM   7044 O O     . ILE B 2 389 ? 11.740  33.158 39.293  1.00 151.66 ? 375 ILE B O     1 
ATOM   7045 C CB    . ILE B 2 389 ? 14.281  34.907 40.457  1.00 145.15 ? 375 ILE B CB    1 
ATOM   7046 C CG1   . ILE B 2 389 ? 14.881  35.601 41.686  1.00 147.11 ? 375 ILE B CG1   1 
ATOM   7047 C CG2   . ILE B 2 389 ? 13.397  35.882 39.685  1.00 145.54 ? 375 ILE B CG2   1 
ATOM   7048 C CD1   . ILE B 2 389 ? 16.075  36.483 41.382  1.00 145.25 ? 375 ILE B CD1   1 
ATOM   7049 N N     . THR B 2 390 ? 13.722  32.112 39.001  1.00 150.77 ? 376 THR B N     1 
ATOM   7050 C CA    . THR B 2 390 ? 13.326  31.379 37.793  1.00 149.05 ? 376 THR B CA    1 
ATOM   7051 C C     . THR B 2 390 ? 12.120  30.467 38.044  1.00 151.30 ? 376 THR B C     1 
ATOM   7052 O O     . THR B 2 390 ? 11.193  30.423 37.232  1.00 154.09 ? 376 THR B O     1 
ATOM   7053 C CB    . THR B 2 390 ? 14.502  30.555 37.215  1.00 152.63 ? 376 THR B CB    1 
ATOM   7054 O OG1   . THR B 2 390 ? 15.672  31.378 37.131  1.00 160.15 ? 376 THR B OG1   1 
ATOM   7055 C CG2   . THR B 2 390 ? 14.168  30.024 35.823  1.00 145.03 ? 376 THR B CG2   1 
ATOM   7056 N N     . THR B 2 391 ? 12.138  29.757 39.172  1.00 152.72 ? 377 THR B N     1 
ATOM   7057 C CA    . THR B 2 391 ? 11.045  28.859 39.558  1.00 155.65 ? 377 THR B CA    1 
ATOM   7058 C C     . THR B 2 391 ? 9.761   29.640 39.858  1.00 154.13 ? 377 THR B C     1 
ATOM   7059 O O     . THR B 2 391 ? 8.662   29.190 39.528  1.00 152.16 ? 377 THR B O     1 
ATOM   7060 C CB    . THR B 2 391 ? 11.429  27.986 40.774  1.00 158.33 ? 377 THR B CB    1 
ATOM   7061 O OG1   . THR B 2 391 ? 12.764  27.490 40.611  1.00 158.68 ? 377 THR B OG1   1 
ATOM   7062 C CG2   . THR B 2 391 ? 10.475  26.804 40.922  1.00 152.52 ? 377 THR B CG2   1 
ATOM   7063 N N     . GLU B 2 392 ? 9.914   30.811 40.475  1.00 150.47 ? 378 GLU B N     1 
ATOM   7064 C CA    . GLU B 2 392 ? 8.787   31.694 40.780  1.00 143.82 ? 378 GLU B CA    1 
ATOM   7065 C C     . GLU B 2 392 ? 8.228   32.371 39.528  1.00 140.80 ? 378 GLU B C     1 
ATOM   7066 O O     . GLU B 2 392 ? 7.039   32.690 39.469  1.00 144.01 ? 378 GLU B O     1 
ATOM   7067 C CB    . GLU B 2 392 ? 9.192   32.753 41.810  1.00 141.33 ? 378 GLU B CB    1 
ATOM   7068 C CG    . GLU B 2 392 ? 9.335   32.227 43.231  1.00 150.08 ? 378 GLU B CG    1 
ATOM   7069 C CD    . GLU B 2 392 ? 9.801   33.288 44.214  1.00 150.78 ? 378 GLU B CD    1 
ATOM   7070 O OE1   . GLU B 2 392 ? 10.711  34.073 43.871  1.00 147.94 ? 378 GLU B OE1   1 
ATOM   7071 O OE2   . GLU B 2 392 ? 9.260   33.330 45.339  1.00 156.94 ? 378 GLU B OE2   1 
ATOM   7072 N N     . SER B 2 393 ? 9.092   32.586 38.537  1.00 138.82 ? 379 SER B N     1 
ATOM   7073 C CA    . SER B 2 393 ? 8.708   33.234 37.282  1.00 139.92 ? 379 SER B CA    1 
ATOM   7074 C C     . SER B 2 393 ? 7.808   32.354 36.413  1.00 137.04 ? 379 SER B C     1 
ATOM   7075 O O     . SER B 2 393 ? 6.948   32.863 35.692  1.00 131.74 ? 379 SER B O     1 
ATOM   7076 C CB    . SER B 2 393 ? 9.949   33.654 36.490  1.00 141.71 ? 379 SER B CB    1 
ATOM   7077 O OG    . SER B 2 393 ? 10.719  34.600 37.212  1.00 146.01 ? 379 SER B OG    1 
ATOM   7078 N N     . ILE B 2 394 ? 8.015   31.040 36.490  1.00 139.65 ? 380 ILE B N     1 
ATOM   7079 C CA    . ILE B 2 394 ? 7.243   30.070 35.708  1.00 147.01 ? 380 ILE B CA    1 
ATOM   7080 C C     . ILE B 2 394 ? 5.810   29.934 36.235  1.00 149.18 ? 380 ILE B C     1 
ATOM   7081 O O     . ILE B 2 394 ? 4.854   29.929 35.454  1.00 147.96 ? 380 ILE B O     1 
ATOM   7082 C CB    . ILE B 2 394 ? 7.942   28.688 35.668  1.00 153.41 ? 380 ILE B CB    1 
ATOM   7083 C CG1   . ILE B 2 394 ? 9.324   28.805 35.012  1.00 152.58 ? 380 ILE B CG1   1 
ATOM   7084 C CG2   . ILE B 2 394 ? 7.091   27.666 34.922  1.00 158.08 ? 380 ILE B CG2   1 
ATOM   7085 C CD1   . ILE B 2 394 ? 10.286  27.692 35.372  1.00 148.36 ? 380 ILE B CD1   1 
ATOM   7086 N N     . VAL B 2 395 ? 5.674   29.838 37.557  1.00 153.68 ? 381 VAL B N     1 
ATOM   7087 C CA    . VAL B 2 395 ? 4.375   29.648 38.211  1.00 161.34 ? 381 VAL B CA    1 
ATOM   7088 C C     . VAL B 2 395 ? 3.462   30.867 38.040  1.00 158.88 ? 381 VAL B C     1 
ATOM   7089 O O     . VAL B 2 395 ? 2.288   30.725 37.686  1.00 164.01 ? 381 VAL B O     1 
ATOM   7090 C CB    . VAL B 2 395 ? 4.536   29.302 39.713  1.00 165.26 ? 381 VAL B CB    1 
ATOM   7091 C CG1   . VAL B 2 395 ? 3.184   29.045 40.365  1.00 165.71 ? 381 VAL B CG1   1 
ATOM   7092 C CG2   . VAL B 2 395 ? 5.440   28.090 39.893  1.00 160.57 ? 381 VAL B CG2   1 
ATOM   7093 N N     . ILE B 2 396 ? 4.010   32.058 38.279  1.00 153.35 ? 382 ILE B N     1 
ATOM   7094 C CA    . ILE B 2 396 ? 3.241   33.302 38.198  1.00 148.27 ? 382 ILE B CA    1 
ATOM   7095 C C     . ILE B 2 396 ? 3.003   33.735 36.747  1.00 147.66 ? 382 ILE B C     1 
ATOM   7096 O O     . ILE B 2 396 ? 1.860   33.975 36.348  1.00 149.53 ? 382 ILE B O     1 
ATOM   7097 C CB    . ILE B 2 396 ? 3.905   34.445 39.008  1.00 144.65 ? 382 ILE B CB    1 
ATOM   7098 C CG1   . ILE B 2 396 ? 4.094   34.027 40.473  1.00 143.38 ? 382 ILE B CG1   1 
ATOM   7099 C CG2   . ILE B 2 396 ? 3.074   35.721 38.923  1.00 142.79 ? 382 ILE B CG2   1 
ATOM   7100 C CD1   . ILE B 2 396 ? 5.090   34.869 41.244  1.00 147.07 ? 382 ILE B CD1   1 
ATOM   7101 N N     . TRP B 2 397 ? 4.078   33.821 35.964  1.00 142.81 ? 383 TRP B N     1 
ATOM   7102 C CA    . TRP B 2 397 ? 3.993   34.302 34.584  1.00 138.17 ? 383 TRP B CA    1 
ATOM   7103 C C     . TRP B 2 397 ? 4.209   33.206 33.574  1.00 137.80 ? 383 TRP B C     1 
ATOM   7104 O O     . TRP B 2 397 ? 3.272   32.804 32.881  1.00 148.40 ? 383 TRP B O     1 
ATOM   7105 C CB    . TRP B 2 397 ? 4.963   35.460 34.354  1.00 137.93 ? 383 TRP B CB    1 
ATOM   7106 C CG    . TRP B 2 397 ? 4.809   36.589 35.348  1.00 145.16 ? 383 TRP B CG    1 
ATOM   7107 C CD1   . TRP B 2 397 ? 3.755   37.494 35.450  1.00 149.91 ? 383 TRP B CD1   1 
ATOM   7108 C CD2   . TRP B 2 397 ? 5.741   36.972 36.420  1.00 149.28 ? 383 TRP B CD2   1 
ATOM   7109 N NE1   . TRP B 2 397 ? 3.964   38.380 36.477  1.00 147.00 ? 383 TRP B NE1   1 
ATOM   7110 C CE2   . TRP B 2 397 ? 5.135   38.124 37.099  1.00 146.41 ? 383 TRP B CE2   1 
ATOM   7111 C CE3   . TRP B 2 397 ? 6.969   36.495 36.868  1.00 152.83 ? 383 TRP B CE3   1 
ATOM   7112 C CZ2   . TRP B 2 397 ? 5.749   38.752 38.175  1.00 151.84 ? 383 TRP B CZ2   1 
ATOM   7113 C CZ3   . TRP B 2 397 ? 7.579   37.137 37.955  1.00 154.84 ? 383 TRP B CZ3   1 
ATOM   7114 C CH2   . TRP B 2 397 ? 6.981   38.238 38.590  1.00 158.00 ? 383 TRP B CH2   1 
ATOM   7115 N N     . GLY B 2 398 ? 5.445   32.717 33.480  1.00 128.24 ? 384 GLY B N     1 
ATOM   7116 C CA    . GLY B 2 398 ? 5.790   31.636 32.557  1.00 137.27 ? 384 GLY B CA    1 
ATOM   7117 C C     . GLY B 2 398 ? 6.836   32.007 31.520  1.00 147.14 ? 384 GLY B C     1 
ATOM   7118 O O     . GLY B 2 398 ? 6.846   31.453 30.419  1.00 154.04 ? 384 GLY B O     1 
ATOM   7119 N N     . LYS B 2 399 ? 7.715   32.943 31.874  1.00 151.03 ? 385 LYS B N     1 
ATOM   7120 C CA    . LYS B 2 399 ? 8.793   33.384 30.986  1.00 162.42 ? 385 LYS B CA    1 
ATOM   7121 C C     . LYS B 2 399 ? 10.120  33.520 31.729  1.00 157.55 ? 385 LYS B C     1 
ATOM   7122 O O     . LYS B 2 399 ? 10.145  33.841 32.920  1.00 154.65 ? 385 LYS B O     1 
ATOM   7123 C CB    . LYS B 2 399 ? 8.438   34.714 30.314  1.00 157.25 ? 385 LYS B CB    1 
ATOM   7124 C CG    . LYS B 2 399 ? 7.413   34.610 29.193  1.00 138.45 ? 385 LYS B CG    1 
ATOM   7125 C CD    . LYS B 2 399 ? 7.314   35.903 28.394  1.00 135.99 ? 385 LYS B CD    1 
ATOM   7126 C CE    . LYS B 2 399 ? 6.570   36.992 29.154  1.00 143.04 ? 385 LYS B CE    1 
ATOM   7127 N NZ    . LYS B 2 399 ? 6.578   38.286 28.419  1.00 159.72 ? 385 LYS B NZ    1 
ATOM   7128 N N     . THR B 2 400 ? 11.217  33.276 31.014  1.00 149.82 ? 386 THR B N     1 
ATOM   7129 C CA    . THR B 2 400 ? 12.561  33.426 31.570  1.00 150.08 ? 386 THR B CA    1 
ATOM   7130 C C     . THR B 2 400 ? 13.002  34.891 31.522  1.00 151.15 ? 386 THR B C     1 
ATOM   7131 O O     . THR B 2 400 ? 13.080  35.480 30.441  1.00 145.25 ? 386 THR B O     1 
ATOM   7132 C CB    . THR B 2 400 ? 13.595  32.545 30.835  1.00 154.46 ? 386 THR B CB    1 
ATOM   7133 O OG1   . THR B 2 400 ? 13.515  32.783 29.423  1.00 154.66 ? 386 THR B OG1   1 
ATOM   7134 C CG2   . THR B 2 400 ? 13.345  31.068 31.114  1.00 144.56 ? 386 THR B CG2   1 
ATOM   7135 N N     . PRO B 2 401 ? 13.282  35.486 32.699  1.00 149.45 ? 387 PRO B N     1 
ATOM   7136 C CA    . PRO B 2 401 ? 13.662  36.897 32.774  1.00 147.48 ? 387 PRO B CA    1 
ATOM   7137 C C     . PRO B 2 401 ? 15.151  37.143 32.523  1.00 148.95 ? 387 PRO B C     1 
ATOM   7138 O O     . PRO B 2 401 ? 15.967  36.229 32.665  1.00 157.98 ? 387 PRO B O     1 
ATOM   7139 C CB    . PRO B 2 401 ? 13.298  37.275 34.210  1.00 147.37 ? 387 PRO B CB    1 
ATOM   7140 C CG    . PRO B 2 401 ? 13.439  36.008 34.983  1.00 145.15 ? 387 PRO B CG    1 
ATOM   7141 C CD    . PRO B 2 401 ? 13.212  34.861 34.034  1.00 145.45 ? 387 PRO B CD    1 
ATOM   7142 N N     . LYS B 2 402 ? 15.485  38.377 32.149  1.00 140.38 ? 388 LYS B N     1 
ATOM   7143 C CA    . LYS B 2 402 ? 16.873  38.790 31.957  1.00 138.24 ? 388 LYS B CA    1 
ATOM   7144 C C     . LYS B 2 402 ? 17.503  39.119 33.308  1.00 140.19 ? 388 LYS B C     1 
ATOM   7145 O O     . LYS B 2 402 ? 17.142  40.113 33.945  1.00 134.99 ? 388 LYS B O     1 
ATOM   7146 C CB    . LYS B 2 402 ? 16.955  40.002 31.021  1.00 139.20 ? 388 LYS B CB    1 
ATOM   7147 C CG    . LYS B 2 402 ? 16.511  39.744 29.587  1.00 144.62 ? 388 LYS B CG    1 
ATOM   7148 C CD    . LYS B 2 402 ? 17.645  39.204 28.727  1.00 153.79 ? 388 LYS B CD    1 
ATOM   7149 C CE    . LYS B 2 402 ? 17.221  39.087 27.272  1.00 154.55 ? 388 LYS B CE    1 
ATOM   7150 N NZ    . LYS B 2 402 ? 18.354  38.699 26.388  1.00 154.56 ? 388 LYS B NZ    1 
ATOM   7151 N N     . PHE B 2 403 ? 18.437  38.276 33.741  1.00 149.63 ? 389 PHE B N     1 
ATOM   7152 C CA    . PHE B 2 403 ? 19.085  38.435 35.043  1.00 156.74 ? 389 PHE B CA    1 
ATOM   7153 C C     . PHE B 2 403 ? 20.277  39.385 34.987  1.00 161.97 ? 389 PHE B C     1 
ATOM   7154 O O     . PHE B 2 403 ? 21.210  39.183 34.207  1.00 154.48 ? 389 PHE B O     1 
ATOM   7155 C CB    . PHE B 2 403 ? 19.522  37.075 35.600  1.00 159.64 ? 389 PHE B CB    1 
ATOM   7156 C CG    . PHE B 2 403 ? 18.385  36.226 36.094  1.00 156.91 ? 389 PHE B CG    1 
ATOM   7157 C CD1   . PHE B 2 403 ? 17.916  36.358 37.398  1.00 147.96 ? 389 PHE B CD1   1 
ATOM   7158 C CD2   . PHE B 2 403 ? 17.785  35.288 35.261  1.00 159.73 ? 389 PHE B CD2   1 
ATOM   7159 C CE1   . PHE B 2 403 ? 16.869  35.575 37.858  1.00 145.67 ? 389 PHE B CE1   1 
ATOM   7160 C CE2   . PHE B 2 403 ? 16.737  34.501 35.716  1.00 156.75 ? 389 PHE B CE2   1 
ATOM   7161 C CZ    . PHE B 2 403 ? 16.278  34.645 37.016  1.00 149.88 ? 389 PHE B CZ    1 
ATOM   7162 N N     . LYS B 2 404 ? 20.230  40.424 35.817  1.00 162.04 ? 390 LYS B N     1 
ATOM   7163 C CA    . LYS B 2 404 ? 21.337  41.365 35.958  1.00 156.05 ? 390 LYS B CA    1 
ATOM   7164 C C     . LYS B 2 404 ? 22.172  40.986 37.177  1.00 157.51 ? 390 LYS B C     1 
ATOM   7165 O O     . LYS B 2 404 ? 21.694  41.045 38.313  1.00 162.73 ? 390 LYS B O     1 
ATOM   7166 C CB    . LYS B 2 404 ? 20.821  42.803 36.077  1.00 147.76 ? 390 LYS B CB    1 
ATOM   7167 C CG    . LYS B 2 404 ? 20.203  43.357 34.802  1.00 141.40 ? 390 LYS B CG    1 
ATOM   7168 C CD    . LYS B 2 404 ? 19.684  44.772 35.010  1.00 140.69 ? 390 LYS B CD    1 
ATOM   7169 C CE    . LYS B 2 404 ? 19.259  45.414 33.698  1.00 140.85 ? 390 LYS B CE    1 
ATOM   7170 N NZ    . LYS B 2 404 ? 20.414  45.721 32.808  1.00 139.31 ? 390 LYS B NZ    1 
ATOM   7171 N N     . LEU B 2 405 ? 23.418  40.591 36.929  1.00 150.73 ? 391 LEU B N     1 
ATOM   7172 C CA    . LEU B 2 405 ? 24.293  40.071 37.978  1.00 147.08 ? 391 LEU B CA    1 
ATOM   7173 C C     . LEU B 2 405 ? 25.474  41.000 38.267  1.00 148.32 ? 391 LEU B C     1 
ATOM   7174 O O     . LEU B 2 405 ? 26.087  41.529 37.336  1.00 146.83 ? 391 LEU B O     1 
ATOM   7175 C CB    . LEU B 2 405 ? 24.804  38.672 37.604  1.00 142.80 ? 391 LEU B CB    1 
ATOM   7176 C CG    . LEU B 2 405 ? 23.784  37.558 37.332  1.00 147.72 ? 391 LEU B CG    1 
ATOM   7177 C CD1   . LEU B 2 405 ? 24.439  36.404 36.589  1.00 149.90 ? 391 LEU B CD1   1 
ATOM   7178 C CD2   . LEU B 2 405 ? 23.126  37.068 38.615  1.00 148.22 ? 391 LEU B CD2   1 
ATOM   7179 N N     . PRO B 2 406 ? 25.796  41.201 39.561  1.00 152.17 ? 392 PRO B N     1 
ATOM   7180 C CA    . PRO B 2 406 ? 26.959  41.996 39.951  1.00 152.28 ? 392 PRO B CA    1 
ATOM   7181 C C     . PRO B 2 406 ? 28.236  41.149 39.992  1.00 156.34 ? 392 PRO B C     1 
ATOM   7182 O O     . PRO B 2 406 ? 28.857  40.997 41.048  1.00 154.56 ? 392 PRO B O     1 
ATOM   7183 C CB    . PRO B 2 406 ? 26.580  42.504 41.345  1.00 150.72 ? 392 PRO B CB    1 
ATOM   7184 C CG    . PRO B 2 406 ? 25.634  41.483 41.887  1.00 152.29 ? 392 PRO B CG    1 
ATOM   7185 C CD    . PRO B 2 406 ? 25.044  40.714 40.735  1.00 155.10 ? 392 PRO B CD    1 
ATOM   7186 N N     . ILE B 2 407 ? 28.611  40.609 38.834  1.00 158.35 ? 393 ILE B N     1 
ATOM   7187 C CA    . ILE B 2 407 ? 29.772  39.726 38.703  1.00 151.76 ? 393 ILE B CA    1 
ATOM   7188 C C     . ILE B 2 407 ? 30.356  39.820 37.287  1.00 145.65 ? 393 ILE B C     1 
ATOM   7189 O O     . ILE B 2 407 ? 29.660  40.209 36.345  1.00 148.13 ? 393 ILE B O     1 
ATOM   7190 C CB    . ILE B 2 407 ? 29.410  38.260 39.077  1.00 156.70 ? 393 ILE B CB    1 
ATOM   7191 C CG1   . ILE B 2 407 ? 30.674  37.410 39.281  1.00 146.84 ? 393 ILE B CG1   1 
ATOM   7192 C CG2   . ILE B 2 407 ? 28.455  37.648 38.055  1.00 161.58 ? 393 ILE B CG2   1 
ATOM   7193 C CD1   . ILE B 2 407 ? 30.457  36.148 40.092  1.00 150.47 ? 393 ILE B CD1   1 
ATOM   7194 N N     . GLN B 2 408 ? 31.637  39.482 37.150  1.00 135.30 ? 394 GLN B N     1 
ATOM   7195 C CA    . GLN B 2 408 ? 32.312  39.475 35.852  1.00 140.06 ? 394 GLN B CA    1 
ATOM   7196 C C     . GLN B 2 408 ? 31.873  38.284 35.000  1.00 145.91 ? 394 GLN B C     1 
ATOM   7197 O O     . GLN B 2 408 ? 31.437  37.259 35.531  1.00 149.15 ? 394 GLN B O     1 
ATOM   7198 C CB    . GLN B 2 408 ? 33.833  39.463 36.035  1.00 147.39 ? 394 GLN B CB    1 
ATOM   7199 C CG    . GLN B 2 408 ? 34.406  40.750 36.612  1.00 157.13 ? 394 GLN B CG    1 
ATOM   7200 C CD    . GLN B 2 408 ? 35.899  40.669 36.879  1.00 151.45 ? 394 GLN B CD    1 
ATOM   7201 O OE1   . GLN B 2 408 ? 36.667  40.171 36.054  1.00 148.58 ? 394 GLN B OE1   1 
ATOM   7202 N NE2   . GLN B 2 408 ? 36.318  41.169 38.035  1.00 142.30 ? 394 GLN B NE2   1 
ATOM   7203 N N     . LYS B 2 409 ? 31.990  38.432 33.681  1.00 145.57 ? 395 LYS B N     1 
ATOM   7204 C CA    . LYS B 2 409 ? 31.614  37.383 32.730  1.00 151.19 ? 395 LYS B CA    1 
ATOM   7205 C C     . LYS B 2 409 ? 32.556  36.180 32.813  1.00 145.66 ? 395 LYS B C     1 
ATOM   7206 O O     . LYS B 2 409 ? 32.121  35.034 32.676  1.00 144.71 ? 395 LYS B O     1 
ATOM   7207 C CB    . LYS B 2 409 ? 31.585  37.943 31.303  1.00 147.88 ? 395 LYS B CB    1 
ATOM   7208 C CG    . LYS B 2 409 ? 30.923  37.034 30.277  1.00 140.93 ? 395 LYS B CG    1 
ATOM   7209 C CD    . LYS B 2 409 ? 30.936  37.661 28.892  1.00 131.77 ? 395 LYS B CD    1 
ATOM   7210 C CE    . LYS B 2 409 ? 30.275  36.752 27.869  1.00 134.15 ? 395 LYS B CE    1 
ATOM   7211 N NZ    . LYS B 2 409 ? 30.276  37.355 26.507  1.00 141.97 ? 395 LYS B NZ    1 
ATOM   7212 N N     . GLU B 2 410 ? 33.839  36.452 33.041  1.00 137.63 ? 396 GLU B N     1 
ATOM   7213 C CA    . GLU B 2 410 ? 34.859  35.410 33.153  1.00 139.95 ? 396 GLU B CA    1 
ATOM   7214 C C     . GLU B 2 410 ? 34.737  34.639 34.470  1.00 142.39 ? 396 GLU B C     1 
ATOM   7215 O O     . GLU B 2 410 ? 35.072  33.454 34.537  1.00 140.49 ? 396 GLU B O     1 
ATOM   7216 C CB    . GLU B 2 410 ? 36.256  36.024 33.022  1.00 143.93 ? 396 GLU B CB    1 
ATOM   7217 C CG    . GLU B 2 410 ? 37.344  35.040 32.616  1.00 153.98 ? 396 GLU B CG    1 
ATOM   7218 C CD    . GLU B 2 410 ? 38.702  35.696 32.432  1.00 156.94 ? 396 GLU B CD    1 
ATOM   7219 O OE1   . GLU B 2 410 ? 38.764  36.820 31.887  1.00 153.89 ? 396 GLU B OE1   1 
ATOM   7220 O OE2   . GLU B 2 410 ? 39.714  35.083 32.834  1.00 155.93 ? 396 GLU B OE2   1 
ATOM   7221 N N     . THR B 2 411 ? 34.253  35.320 35.507  1.00 143.28 ? 397 THR B N     1 
ATOM   7222 C CA    . THR B 2 411 ? 34.084  34.727 36.834  1.00 146.69 ? 397 THR B CA    1 
ATOM   7223 C C     . THR B 2 411 ? 32.828  33.853 36.907  1.00 141.62 ? 397 THR B C     1 
ATOM   7224 O O     . THR B 2 411 ? 32.855  32.766 37.490  1.00 135.76 ? 397 THR B O     1 
ATOM   7225 C CB    . THR B 2 411 ? 34.033  35.812 37.934  1.00 145.61 ? 397 THR B CB    1 
ATOM   7226 O OG1   . THR B 2 411 ? 35.088  36.760 37.728  1.00 140.23 ? 397 THR B OG1   1 
ATOM   7227 C CG2   . THR B 2 411 ? 34.179  35.195 39.323  1.00 145.68 ? 397 THR B CG2   1 
ATOM   7228 N N     . TRP B 2 412 ? 31.739  34.332 36.308  1.00 142.78 ? 398 TRP B N     1 
ATOM   7229 C CA    . TRP B 2 412 ? 30.443  33.651 36.370  1.00 146.72 ? 398 TRP B CA    1 
ATOM   7230 C C     . TRP B 2 412 ? 30.374  32.412 35.519  1.00 151.79 ? 398 TRP B C     1 
ATOM   7231 O O     . TRP B 2 412 ? 29.845  31.389 35.956  1.00 155.33 ? 398 TRP B O     1 
ATOM   7232 C CB    . TRP B 2 412 ? 29.315  34.613 36.001  1.00 150.50 ? 398 TRP B CB    1 
ATOM   7233 C CG    . TRP B 2 412 ? 27.936  33.996 36.071  1.00 147.02 ? 398 TRP B CG    1 
ATOM   7234 C CD1   . TRP B 2 412 ? 27.097  33.669 35.009  1.00 144.16 ? 398 TRP B CD1   1 
ATOM   7235 C CD2   . TRP B 2 412 ? 27.192  33.599 37.278  1.00 147.98 ? 398 TRP B CD2   1 
ATOM   7236 N NE1   . TRP B 2 412 ? 25.923  33.121 35.461  1.00 145.05 ? 398 TRP B NE1   1 
ATOM   7237 C CE2   . TRP B 2 412 ? 25.914  33.049 36.808  1.00 148.01 ? 398 TRP B CE2   1 
ATOM   7238 C CE3   . TRP B 2 412 ? 27.446  33.644 38.645  1.00 153.16 ? 398 TRP B CE3   1 
ATOM   7239 C CZ2   . TRP B 2 412 ? 24.950  32.573 37.688  1.00 150.71 ? 398 TRP B CZ2   1 
ATOM   7240 C CZ3   . TRP B 2 412 ? 26.466  33.159 39.522  1.00 151.24 ? 398 TRP B CZ3   1 
ATOM   7241 C CH2   . TRP B 2 412 ? 25.249  32.638 39.052  1.00 146.89 ? 398 TRP B CH2   1 
ATOM   7242 N N     . GLU B 2 413 ? 30.914  32.488 34.304  1.00 144.04 ? 399 GLU B N     1 
ATOM   7243 C CA    . GLU B 2 413 ? 30.837  31.385 33.338  1.00 150.55 ? 399 GLU B CA    1 
ATOM   7244 C C     . GLU B 2 413 ? 31.759  30.201 33.664  1.00 158.07 ? 399 GLU B C     1 
ATOM   7245 O O     . GLU B 2 413 ? 31.905  29.280 32.855  1.00 162.54 ? 399 GLU B O     1 
ATOM   7246 C CB    . GLU B 2 413 ? 31.108  31.896 31.916  1.00 143.42 ? 399 GLU B CB    1 
ATOM   7247 C CG    . GLU B 2 413 ? 29.988  32.740 31.319  1.00 149.52 ? 399 GLU B CG    1 
ATOM   7248 C CD    . GLU B 2 413 ? 28.749  31.933 30.967  1.00 163.08 ? 399 GLU B CD    1 
ATOM   7249 O OE1   . GLU B 2 413 ? 28.888  30.821 30.411  1.00 162.86 ? 399 GLU B OE1   1 
ATOM   7250 O OE2   . GLU B 2 413 ? 27.631  32.417 31.240  1.00 166.06 ? 399 GLU B OE2   1 
ATOM   7251 N N     . THR B 2 414 ? 32.362  30.223 34.851  1.00 160.36 ? 400 THR B N     1 
ATOM   7252 C CA    . THR B 2 414 ? 33.289  29.175 35.275  1.00 156.17 ? 400 THR B CA    1 
ATOM   7253 C C     . THR B 2 414 ? 32.779  28.422 36.508  1.00 162.07 ? 400 THR B C     1 
ATOM   7254 O O     . THR B 2 414 ? 32.947  27.204 36.611  1.00 165.63 ? 400 THR B O     1 
ATOM   7255 C CB    . THR B 2 414 ? 34.697  29.747 35.561  1.00 139.55 ? 400 THR B CB    1 
ATOM   7256 O OG1   . THR B 2 414 ? 35.038  30.717 34.561  1.00 131.08 ? 400 THR B OG1   1 
ATOM   7257 C CG2   . THR B 2 414 ? 35.748  28.640 35.562  1.00 136.35 ? 400 THR B CG2   1 
ATOM   7258 N N     . TRP B 2 415 ? 32.148  29.148 37.430  1.00 161.24 ? 401 TRP B N     1 
ATOM   7259 C CA    . TRP B 2 415 ? 31.733  28.581 38.717  1.00 162.37 ? 401 TRP B CA    1 
ATOM   7260 C C     . TRP B 2 415 ? 30.243  28.414 38.882  1.00 147.61 ? 401 TRP B C     1 
ATOM   7261 O O     . TRP B 2 415 ? 29.776  28.026 39.957  1.00 137.27 ? 401 TRP B O     1 
ATOM   7262 C CB    . TRP B 2 415 ? 32.305  29.408 39.867  1.00 163.49 ? 401 TRP B CB    1 
ATOM   7263 C CG    . TRP B 2 415 ? 33.812  29.361 39.949  1.00 149.25 ? 401 TRP B CG    1 
ATOM   7264 C CD1   . TRP B 2 415 ? 34.715  30.359 39.591  1.00 133.41 ? 401 TRP B CD1   1 
ATOM   7265 C CD2   . TRP B 2 415 ? 34.646  28.243 40.417  1.00 149.58 ? 401 TRP B CD2   1 
ATOM   7266 N NE1   . TRP B 2 415 ? 36.008  29.950 39.804  1.00 137.28 ? 401 TRP B NE1   1 
ATOM   7267 C CE2   . TRP B 2 415 ? 36.039  28.693 40.296  1.00 143.59 ? 401 TRP B CE2   1 
ATOM   7268 C CE3   . TRP B 2 415 ? 34.389  26.966 40.906  1.00 152.11 ? 401 TRP B CE3   1 
ATOM   7269 C CZ2   . TRP B 2 415 ? 37.107  27.883 40.656  1.00 150.48 ? 401 TRP B CZ2   1 
ATOM   7270 C CZ3   . TRP B 2 415 ? 35.476  26.158 41.265  1.00 145.59 ? 401 TRP B CZ3   1 
ATOM   7271 C CH2   . TRP B 2 415 ? 36.801  26.607 41.142  1.00 140.87 ? 401 TRP B CH2   1 
ATOM   7272 N N     . TRP B 2 416 ? 29.481  28.690 37.825  1.00 144.15 ? 402 TRP B N     1 
ATOM   7273 C CA    . TRP B 2 416 ? 28.023  28.554 37.874  1.00 142.43 ? 402 TRP B CA    1 
ATOM   7274 C C     . TRP B 2 416 ? 27.572  27.125 37.732  1.00 147.53 ? 402 TRP B C     1 
ATOM   7275 O O     . TRP B 2 416 ? 26.498  26.759 38.213  1.00 154.62 ? 402 TRP B O     1 
ATOM   7276 C CB    . TRP B 2 416 ? 27.350  29.444 36.828  1.00 144.48 ? 402 TRP B CB    1 
ATOM   7277 C CG    . TRP B 2 416 ? 27.381  28.895 35.419  1.00 143.97 ? 402 TRP B CG    1 
ATOM   7278 C CD1   . TRP B 2 416 ? 28.451  28.899 34.527  1.00 142.95 ? 402 TRP B CD1   1 
ATOM   7279 C CD2   . TRP B 2 416 ? 26.281  28.245 34.689  1.00 150.03 ? 402 TRP B CD2   1 
ATOM   7280 N NE1   . TRP B 2 416 ? 28.100  28.313 33.336  1.00 139.66 ? 402 TRP B NE1   1 
ATOM   7281 C CE2   . TRP B 2 416 ? 26.815  27.899 33.365  1.00 144.43 ? 402 TRP B CE2   1 
ATOM   7282 C CE3   . TRP B 2 416 ? 24.960  27.925 34.988  1.00 156.57 ? 402 TRP B CE3   1 
ATOM   7283 C CZ2   . TRP B 2 416 ? 26.042  27.263 32.403  1.00 145.71 ? 402 TRP B CZ2   1 
ATOM   7284 C CZ3   . TRP B 2 416 ? 24.190  27.283 34.008  1.00 153.70 ? 402 TRP B CZ3   1 
ATOM   7285 C CH2   . TRP B 2 416 ? 24.721  26.962 32.748  1.00 155.47 ? 402 TRP B CH2   1 
ATOM   7286 N N     . THR B 2 417 ? 28.396  26.307 37.079  1.00 145.21 ? 403 THR B N     1 
ATOM   7287 C CA    . THR B 2 417 ? 28.082  24.897 36.826  1.00 145.08 ? 403 THR B CA    1 
ATOM   7288 C C     . THR B 2 417 ? 28.220  24.019 38.072  1.00 147.21 ? 403 THR B C     1 
ATOM   7289 O O     . THR B 2 417 ? 27.634  22.935 38.141  1.00 144.31 ? 403 THR B O     1 
ATOM   7290 C CB    . THR B 2 417 ? 28.965  24.309 35.705  1.00 142.09 ? 403 THR B CB    1 
ATOM   7291 O OG1   . THR B 2 417 ? 30.347  24.555 35.998  1.00 136.42 ? 403 THR B OG1   1 
ATOM   7292 C CG2   . THR B 2 417 ? 28.617  24.928 34.357  1.00 145.00 ? 403 THR B CG2   1 
ATOM   7293 N N     . GLU B 2 418 ? 28.992  24.496 39.047  1.00 148.48 ? 404 GLU B N     1 
ATOM   7294 C CA    . GLU B 2 418 ? 29.269  23.747 40.276  1.00 148.83 ? 404 GLU B CA    1 
ATOM   7295 C C     . GLU B 2 418 ? 28.047  23.598 41.185  1.00 155.17 ? 404 GLU B C     1 
ATOM   7296 O O     . GLU B 2 418 ? 27.916  22.598 41.895  1.00 154.16 ? 404 GLU B O     1 
ATOM   7297 C CB    . GLU B 2 418 ? 30.420  24.396 41.054  1.00 144.27 ? 404 GLU B CB    1 
ATOM   7298 C CG    . GLU B 2 418 ? 31.785  24.291 40.382  1.00 148.51 ? 404 GLU B CG    1 
ATOM   7299 C CD    . GLU B 2 418 ? 32.359  22.883 40.399  1.00 152.57 ? 404 GLU B CD    1 
ATOM   7300 O OE1   . GLU B 2 418 ? 32.178  22.167 41.408  1.00 155.34 ? 404 GLU B OE1   1 
ATOM   7301 O OE2   . GLU B 2 418 ? 33.003  22.495 39.402  1.00 158.24 ? 404 GLU B OE2   1 
ATOM   7302 N N     . TYR B 2 419 ? 27.160  24.591 41.158  1.00 157.93 ? 405 TYR B N     1 
ATOM   7303 C CA    . TYR B 2 419 ? 25.979  24.604 42.023  1.00 153.65 ? 405 TYR B CA    1 
ATOM   7304 C C     . TYR B 2 419 ? 24.663  24.645 41.236  1.00 147.77 ? 405 TYR B C     1 
ATOM   7305 O O     . TYR B 2 419 ? 23.592  24.858 41.811  1.00 143.92 ? 405 TYR B O     1 
ATOM   7306 C CB    . TYR B 2 419 ? 26.052  25.777 43.010  1.00 149.53 ? 405 TYR B CB    1 
ATOM   7307 C CG    . TYR B 2 419 ? 27.306  25.797 43.859  1.00 152.58 ? 405 TYR B CG    1 
ATOM   7308 C CD1   . TYR B 2 419 ? 27.416  24.996 44.997  1.00 152.46 ? 405 TYR B CD1   1 
ATOM   7309 C CD2   . TYR B 2 419 ? 28.382  26.620 43.527  1.00 146.80 ? 405 TYR B CD2   1 
ATOM   7310 C CE1   . TYR B 2 419 ? 28.564  25.012 45.776  1.00 155.07 ? 405 TYR B CE1   1 
ATOM   7311 C CE2   . TYR B 2 419 ? 29.533  26.644 44.301  1.00 148.77 ? 405 TYR B CE2   1 
ATOM   7312 C CZ    . TYR B 2 419 ? 29.619  25.839 45.423  1.00 150.27 ? 405 TYR B CZ    1 
ATOM   7313 O OH    . TYR B 2 419 ? 30.759  25.860 46.193  1.00 148.17 ? 405 TYR B OH    1 
ATOM   7314 N N     . TRP B 2 420 ? 24.752  24.428 39.925  1.00 148.40 ? 406 TRP B N     1 
ATOM   7315 C CA    . TRP B 2 420 ? 23.582  24.433 39.049  1.00 148.70 ? 406 TRP B CA    1 
ATOM   7316 C C     . TRP B 2 420 ? 22.888  23.100 39.076  1.00 151.94 ? 406 TRP B C     1 
ATOM   7317 O O     . TRP B 2 420 ? 23.525  22.055 38.910  1.00 154.54 ? 406 TRP B O     1 
ATOM   7318 C CB    . TRP B 2 420 ? 23.987  24.796 37.625  1.00 147.89 ? 406 TRP B CB    1 
ATOM   7319 C CG    . TRP B 2 420 ? 22.852  25.317 36.777  1.00 147.36 ? 406 TRP B CG    1 
ATOM   7320 C CD1   . TRP B 2 420 ? 22.225  24.677 35.712  1.00 149.03 ? 406 TRP B CD1   1 
ATOM   7321 C CD2   . TRP B 2 420 ? 22.168  26.615 36.895  1.00 143.91 ? 406 TRP B CD2   1 
ATOM   7322 N NE1   . TRP B 2 420 ? 21.233  25.463 35.180  1.00 146.04 ? 406 TRP B NE1   1 
ATOM   7323 C CE2   . TRP B 2 420 ? 21.145  26.637 35.841  1.00 142.86 ? 406 TRP B CE2   1 
ATOM   7324 C CE3   . TRP B 2 420 ? 22.296  27.718 37.734  1.00 142.90 ? 406 TRP B CE3   1 
ATOM   7325 C CZ2   . TRP B 2 420 ? 20.301  27.723 35.658  1.00 145.74 ? 406 TRP B CZ2   1 
ATOM   7326 C CZ3   . TRP B 2 420 ? 21.438  28.808 37.538  1.00 143.80 ? 406 TRP B CZ3   1 
ATOM   7327 C CH2   . TRP B 2 420 ? 20.466  28.808 36.525  1.00 146.56 ? 406 TRP B CH2   1 
ATOM   7328 N N     . GLN B 2 421 ? 21.574  23.127 39.290  1.00 148.94 ? 407 GLN B N     1 
ATOM   7329 C CA    . GLN B 2 421 ? 20.775  21.905 39.405  1.00 148.21 ? 407 GLN B CA    1 
ATOM   7330 C C     . GLN B 2 421 ? 19.650  21.831 38.372  1.00 154.87 ? 407 GLN B C     1 
ATOM   7331 O O     . GLN B 2 421 ? 19.363  20.756 37.839  1.00 159.23 ? 407 GLN B O     1 
ATOM   7332 C CB    . GLN B 2 421 ? 20.198  21.768 40.819  1.00 150.69 ? 407 GLN B CB    1 
ATOM   7333 C CG    . GLN B 2 421 ? 21.233  21.462 41.894  1.00 146.44 ? 407 GLN B CG    1 
ATOM   7334 C CD    . GLN B 2 421 ? 20.627  21.331 43.281  1.00 146.68 ? 407 GLN B CD    1 
ATOM   7335 O OE1   . GLN B 2 421 ? 21.045  22.013 44.217  1.00 146.70 ? 407 GLN B OE1   1 
ATOM   7336 N NE2   . GLN B 2 421 ? 19.637  20.455 43.419  1.00 147.84 ? 407 GLN B NE2   1 
ATOM   7337 N N     . ALA B 2 422 ? 19.020  22.972 38.100  1.00 152.23 ? 408 ALA B N     1 
ATOM   7338 C CA    . ALA B 2 422 ? 17.904  23.050 37.156  1.00 150.82 ? 408 ALA B CA    1 
ATOM   7339 C C     . ALA B 2 422 ? 18.362  22.875 35.710  1.00 156.55 ? 408 ALA B C     1 
ATOM   7340 O O     . ALA B 2 422 ? 19.418  23.374 35.319  1.00 156.27 ? 408 ALA B O     1 
ATOM   7341 C CB    . ALA B 2 422 ? 17.158  24.365 37.324  1.00 140.48 ? 408 ALA B CB    1 
ATOM   7342 N N     . THR B 2 423 ? 17.556  22.164 34.924  1.00 159.04 ? 409 THR B N     1 
ATOM   7343 C CA    . THR B 2 423 ? 17.869  21.899 33.517  1.00 152.18 ? 409 THR B CA    1 
ATOM   7344 C C     . THR B 2 423 ? 17.623  23.115 32.613  1.00 147.54 ? 409 THR B C     1 
ATOM   7345 O O     . THR B 2 423 ? 18.231  23.234 31.546  1.00 142.21 ? 409 THR B O     1 
ATOM   7346 C CB    . THR B 2 423 ? 17.116  20.656 32.980  1.00 154.88 ? 409 THR B CB    1 
ATOM   7347 O OG1   . THR B 2 423 ? 17.411  20.472 31.589  1.00 151.01 ? 409 THR B OG1   1 
ATOM   7348 C CG2   . THR B 2 423 ? 15.606  20.794 33.167  1.00 152.09 ? 409 THR B CG2   1 
ATOM   7349 N N     . TRP B 2 424 ? 16.735  24.008 33.047  1.00 145.36 ? 410 TRP B N     1 
ATOM   7350 C CA    . TRP B 2 424 ? 16.418  25.221 32.297  1.00 145.92 ? 410 TRP B CA    1 
ATOM   7351 C C     . TRP B 2 424 ? 17.408  26.311 32.589  1.00 150.06 ? 410 TRP B C     1 
ATOM   7352 O O     . TRP B 2 424 ? 17.638  26.660 33.751  1.00 149.11 ? 410 TRP B O     1 
ATOM   7353 C CB    . TRP B 2 424 ? 15.001  25.691 32.610  1.00 140.16 ? 410 TRP B CB    1 
ATOM   7354 N N     . VAL B 2 425 ? 18.009  26.852 31.532  1.00 154.03 ? 411 VAL B N     1 
ATOM   7355 C CA    . VAL B 2 425 ? 19.005  27.916 31.659  1.00 149.35 ? 411 VAL B CA    1 
ATOM   7356 C C     . VAL B 2 425 ? 18.453  29.237 31.111  1.00 157.01 ? 411 VAL B C     1 
ATOM   7357 O O     . VAL B 2 425 ? 18.199  29.353 29.909  1.00 161.46 ? 411 VAL B O     1 
ATOM   7358 C CB    . VAL B 2 425 ? 20.334  27.553 30.953  1.00 135.53 ? 411 VAL B CB    1 
ATOM   7359 C CG1   . VAL B 2 425 ? 21.366  28.657 31.143  1.00 140.23 ? 411 VAL B CG1   1 
ATOM   7360 C CG2   . VAL B 2 425 ? 20.879  26.230 31.474  1.00 141.45 ? 411 VAL B CG2   1 
ATOM   7361 N N     . PRO B 2 426 ? 18.259  30.234 31.997  1.00 155.61 ? 412 PRO B N     1 
ATOM   7362 C CA    . PRO B 2 426 ? 17.771  31.552 31.593  1.00 144.95 ? 412 PRO B CA    1 
ATOM   7363 C C     . PRO B 2 426 ? 18.884  32.429 31.021  1.00 139.79 ? 412 PRO B C     1 
ATOM   7364 O O     . PRO B 2 426 ? 20.067  32.123 31.194  1.00 149.33 ? 412 PRO B O     1 
ATOM   7365 C CB    . PRO B 2 426 ? 17.242  32.158 32.906  1.00 146.66 ? 412 PRO B CB    1 
ATOM   7366 C CG    . PRO B 2 426 ? 17.371  31.091 33.949  1.00 154.89 ? 412 PRO B CG    1 
ATOM   7367 C CD    . PRO B 2 426 ? 18.422  30.149 33.457  1.00 158.06 ? 412 PRO B CD    1 
ATOM   7368 N N     . GLU B 2 427 ? 18.498  33.509 30.344  1.00 142.18 ? 413 GLU B N     1 
ATOM   7369 C CA    . GLU B 2 427 ? 19.452  34.457 29.774  1.00 149.89 ? 413 GLU B CA    1 
ATOM   7370 C C     . GLU B 2 427 ? 19.832  35.518 30.805  1.00 150.00 ? 413 GLU B C     1 
ATOM   7371 O O     . GLU B 2 427 ? 18.962  36.084 31.473  1.00 152.99 ? 413 GLU B O     1 
ATOM   7372 C CB    . GLU B 2 427 ? 18.867  35.115 28.519  1.00 142.60 ? 413 GLU B CB    1 
ATOM   7373 C CG    . GLU B 2 427 ? 19.879  35.861 27.658  1.00 141.45 ? 413 GLU B CG    1 
ATOM   7374 C CD    . GLU B 2 427 ? 20.759  34.937 26.834  1.00 150.27 ? 413 GLU B CD    1 
ATOM   7375 O OE1   . GLU B 2 427 ? 20.217  34.062 26.125  1.00 152.38 ? 413 GLU B OE1   1 
ATOM   7376 O OE2   . GLU B 2 427 ? 21.997  35.095 26.887  1.00 147.12 ? 413 GLU B OE2   1 
ATOM   7377 N N     . TRP B 2 428 ? 21.132  35.779 30.930  1.00 145.71 ? 414 TRP B N     1 
ATOM   7378 C CA    . TRP B 2 428 ? 21.638  36.765 31.887  1.00 141.82 ? 414 TRP B CA    1 
ATOM   7379 C C     . TRP B 2 428 ? 22.596  37.751 31.277  1.00 144.29 ? 414 TRP B C     1 
ATOM   7380 O O     . TRP B 2 428 ? 23.303  37.439 30.316  1.00 147.26 ? 414 TRP B O     1 
ATOM   7381 C CB    . TRP B 2 428 ? 22.273  36.080 33.099  1.00 151.61 ? 414 TRP B CB    1 
ATOM   7382 C CG    . TRP B 2 428 ? 23.275  34.996 32.764  1.00 150.63 ? 414 TRP B CG    1 
ATOM   7383 C CD1   . TRP B 2 428 ? 24.520  35.143 32.154  1.00 147.44 ? 414 TRP B CD1   1 
ATOM   7384 C CD2   . TRP B 2 428 ? 23.155  33.554 33.033  1.00 152.16 ? 414 TRP B CD2   1 
ATOM   7385 N NE1   . TRP B 2 428 ? 25.150  33.931 32.022  1.00 134.84 ? 414 TRP B NE1   1 
ATOM   7386 C CE2   . TRP B 2 428 ? 24.389  32.938 32.528  1.00 142.13 ? 414 TRP B CE2   1 
ATOM   7387 C CE3   . TRP B 2 428 ? 22.184  32.743 33.615  1.00 161.41 ? 414 TRP B CE3   1 
ATOM   7388 C CZ2   . TRP B 2 428 ? 24.617  31.571 32.613  1.00 142.86 ? 414 TRP B CZ2   1 
ATOM   7389 C CZ3   . TRP B 2 428 ? 22.427  31.365 33.694  1.00 164.15 ? 414 TRP B CZ3   1 
ATOM   7390 C CH2   . TRP B 2 428 ? 23.614  30.796 33.205  1.00 159.10 ? 414 TRP B CH2   1 
ATOM   7391 N N     . GLU B 2 429 ? 22.616  38.957 31.842  1.00 144.80 ? 415 GLU B N     1 
ATOM   7392 C CA    . GLU B 2 429 ? 23.525  40.023 31.418  1.00 146.38 ? 415 GLU B CA    1 
ATOM   7393 C C     . GLU B 2 429 ? 24.289  40.599 32.612  1.00 144.22 ? 415 GLU B C     1 
ATOM   7394 O O     . GLU B 2 429 ? 23.840  40.492 33.756  1.00 138.06 ? 415 GLU B O     1 
ATOM   7395 C CB    . GLU B 2 429 ? 22.764  41.128 30.672  1.00 140.09 ? 415 GLU B CB    1 
ATOM   7396 C CG    . GLU B 2 429 ? 21.646  41.792 31.468  1.00 145.95 ? 415 GLU B CG    1 
ATOM   7397 C CD    . GLU B 2 429 ? 20.931  42.884 30.692  1.00 150.39 ? 415 GLU B CD    1 
ATOM   7398 O OE1   . GLU B 2 429 ? 21.607  43.691 30.018  1.00 146.29 ? 415 GLU B OE1   1 
ATOM   7399 O OE2   . GLU B 2 429 ? 19.684  42.936 30.756  1.00 156.40 ? 415 GLU B OE2   1 
ATOM   7400 N N     . PHE B 2 430 ? 25.441  41.210 32.339  1.00 150.70 ? 416 PHE B N     1 
ATOM   7401 C CA    . PHE B 2 430 ? 26.295  41.757 33.392  1.00 156.81 ? 416 PHE B CA    1 
ATOM   7402 C C     . PHE B 2 430 ? 26.426  43.275 33.276  1.00 156.43 ? 416 PHE B C     1 
ATOM   7403 O O     . PHE B 2 430 ? 26.983  43.789 32.302  1.00 153.47 ? 416 PHE B O     1 
ATOM   7404 C CB    . PHE B 2 430 ? 27.676  41.088 33.373  1.00 159.83 ? 416 PHE B CB    1 
ATOM   7405 C CG    . PHE B 2 430 ? 27.624  39.583 33.346  1.00 148.23 ? 416 PHE B CG    1 
ATOM   7406 C CD1   . PHE B 2 430 ? 27.390  38.857 34.510  1.00 147.77 ? 416 PHE B CD1   1 
ATOM   7407 C CD2   . PHE B 2 430 ? 27.813  38.891 32.154  1.00 135.38 ? 416 PHE B CD2   1 
ATOM   7408 C CE1   . PHE B 2 430 ? 27.343  37.471 34.485  1.00 145.97 ? 416 PHE B CE1   1 
ATOM   7409 C CE2   . PHE B 2 430 ? 27.766  37.504 32.123  1.00 131.75 ? 416 PHE B CE2   1 
ATOM   7410 C CZ    . PHE B 2 430 ? 27.531  36.794 33.290  1.00 143.94 ? 416 PHE B CZ    1 
ATOM   7411 N N     . VAL B 2 431 ? 25.900  43.982 34.276  1.00 153.84 ? 417 VAL B N     1 
ATOM   7412 C CA    . VAL B 2 431 ? 25.907  45.451 34.296  1.00 154.13 ? 417 VAL B CA    1 
ATOM   7413 C C     . VAL B 2 431 ? 26.362  46.019 35.646  1.00 145.38 ? 417 VAL B C     1 
ATOM   7414 O O     . VAL B 2 431 ? 26.632  45.269 36.588  1.00 131.46 ? 417 VAL B O     1 
ATOM   7415 C CB    . VAL B 2 431 ? 24.526  46.047 33.917  1.00 166.18 ? 417 VAL B CB    1 
ATOM   7416 C CG1   . VAL B 2 431 ? 24.267  45.916 32.422  1.00 160.34 ? 417 VAL B CG1   1 
ATOM   7417 C CG2   . VAL B 2 431 ? 23.406  45.405 34.728  1.00 170.09 ? 417 VAL B CG2   1 
ATOM   7418 N N     . ASN B 2 432 ? 26.441  47.346 35.722  1.00 147.60 ? 418 ASN B N     1 
ATOM   7419 C CA    . ASN B 2 432 ? 26.863  48.051 36.932  1.00 152.80 ? 418 ASN B CA    1 
ATOM   7420 C C     . ASN B 2 432 ? 25.779  48.082 38.008  1.00 153.10 ? 418 ASN B C     1 
ATOM   7421 O O     . ASN B 2 432 ? 24.590  48.202 37.702  1.00 158.64 ? 418 ASN B O     1 
ATOM   7422 C CB    . ASN B 2 432 ? 27.296  49.481 36.584  1.00 158.13 ? 418 ASN B CB    1 
ATOM   7423 C CG    . ASN B 2 432 ? 27.890  50.225 37.769  1.00 159.13 ? 418 ASN B CG    1 
ATOM   7424 O OD1   . ASN B 2 432 ? 27.462  51.333 38.095  1.00 158.74 ? 418 ASN B OD1   1 
ATOM   7425 N ND2   . ASN B 2 432 ? 28.880  49.621 38.419  1.00 156.13 ? 418 ASN B ND2   1 
ATOM   7426 N N     . THR B 2 433 ? 26.203  47.973 39.265  1.00 155.59 ? 419 THR B N     1 
ATOM   7427 C CA    . THR B 2 433 ? 25.301  48.076 40.409  1.00 153.51 ? 419 THR B CA    1 
ATOM   7428 C C     . THR B 2 433 ? 25.496  49.426 41.110  1.00 154.04 ? 419 THR B C     1 
ATOM   7429 O O     . THR B 2 433 ? 26.549  49.669 41.708  1.00 150.49 ? 419 THR B O     1 
ATOM   7430 C CB    . THR B 2 433 ? 25.510  46.916 41.408  1.00 150.26 ? 419 THR B CB    1 
ATOM   7431 O OG1   . THR B 2 433 ? 25.485  45.666 40.707  1.00 145.95 ? 419 THR B OG1   1 
ATOM   7432 C CG2   . THR B 2 433 ? 24.420  46.913 42.475  1.00 136.94 ? 419 THR B CG2   1 
ATOM   7433 N N     . PRO B 2 434 ? 24.484  50.313 41.023  1.00 156.05 ? 420 PRO B N     1 
ATOM   7434 C CA    . PRO B 2 434 ? 24.528  51.639 41.648  1.00 151.74 ? 420 PRO B CA    1 
ATOM   7435 C C     . PRO B 2 434 ? 24.499  51.576 43.179  1.00 151.40 ? 420 PRO B C     1 
ATOM   7436 O O     . PRO B 2 434 ? 23.921  50.642 43.740  1.00 152.22 ? 420 PRO B O     1 
ATOM   7437 C CB    . PRO B 2 434 ? 23.251  52.318 41.129  1.00 154.34 ? 420 PRO B CB    1 
ATOM   7438 C CG    . PRO B 2 434 ? 22.850  51.537 39.923  1.00 156.84 ? 420 PRO B CG    1 
ATOM   7439 C CD    . PRO B 2 434 ? 23.256  50.129 40.231  1.00 156.33 ? 420 PRO B CD    1 
ATOM   7440 N N     . PRO B 2 435 ? 25.128  52.561 43.852  1.00 149.93 ? 421 PRO B N     1 
ATOM   7441 C CA    . PRO B 2 435 ? 25.101  52.635 45.316  1.00 154.52 ? 421 PRO B CA    1 
ATOM   7442 C C     . PRO B 2 435 ? 23.746  53.087 45.864  1.00 153.87 ? 421 PRO B C     1 
ATOM   7443 O O     . PRO B 2 435 ? 23.437  52.828 47.030  1.00 153.70 ? 421 PRO B O     1 
ATOM   7444 C CB    . PRO B 2 435 ? 26.173  53.687 45.641  1.00 151.71 ? 421 PRO B CB    1 
ATOM   7445 C CG    . PRO B 2 435 ? 26.969  53.857 44.389  1.00 153.80 ? 421 PRO B CG    1 
ATOM   7446 C CD    . PRO B 2 435 ? 26.003  53.596 43.277  1.00 150.38 ? 421 PRO B CD    1 
ATOM   7447 N N     . LEU B 2 436 ? 22.955  53.755 45.025  1.00 153.95 ? 422 LEU B N     1 
ATOM   7448 C CA    . LEU B 2 436 ? 21.644  54.274 45.419  1.00 154.15 ? 422 LEU B CA    1 
ATOM   7449 C C     . LEU B 2 436 ? 20.593  53.174 45.575  1.00 152.13 ? 422 LEU B C     1 
ATOM   7450 O O     . LEU B 2 436 ? 19.735  53.251 46.458  1.00 147.55 ? 422 LEU B O     1 
ATOM   7451 C CB    . LEU B 2 436 ? 21.159  55.331 44.417  1.00 150.61 ? 422 LEU B CB    1 
ATOM   7452 C CG    . LEU B 2 436 ? 21.918  56.662 44.346  1.00 147.14 ? 422 LEU B CG    1 
ATOM   7453 C CD1   . LEU B 2 436 ? 21.671  57.350 43.012  1.00 144.10 ? 422 LEU B CD1   1 
ATOM   7454 C CD2   . LEU B 2 436 ? 21.550  57.582 45.503  1.00 148.44 ? 422 LEU B CD2   1 
ATOM   7455 N N     . VAL B 2 437 ? 20.666  52.158 44.716  1.00 154.62 ? 423 VAL B N     1 
ATOM   7456 C CA    . VAL B 2 437 ? 19.733  51.028 44.758  1.00 150.47 ? 423 VAL B CA    1 
ATOM   7457 C C     . VAL B 2 437 ? 20.077  50.052 45.895  1.00 151.18 ? 423 VAL B C     1 
ATOM   7458 O O     . VAL B 2 437 ? 19.218  49.302 46.364  1.00 150.92 ? 423 VAL B O     1 
ATOM   7459 C CB    . VAL B 2 437 ? 19.645  50.307 43.384  1.00 155.18 ? 423 VAL B CB    1 
ATOM   7460 C CG1   . VAL B 2 437 ? 20.871  49.439 43.123  1.00 158.69 ? 423 VAL B CG1   1 
ATOM   7461 C CG2   . VAL B 2 437 ? 18.367  49.487 43.276  1.00 152.33 ? 423 VAL B CG2   1 
ATOM   7462 N N     . LYS B 2 438 ? 21.334  50.085 46.337  1.00 149.18 ? 424 LYS B N     1 
ATOM   7463 C CA    . LYS B 2 438 ? 21.818  49.217 47.408  1.00 149.58 ? 424 LYS B CA    1 
ATOM   7464 C C     . LYS B 2 438 ? 21.367  49.715 48.782  1.00 146.25 ? 424 LYS B C     1 
ATOM   7465 O O     . LYS B 2 438 ? 21.014  48.916 49.652  1.00 142.43 ? 424 LYS B O     1 
ATOM   7466 C CB    . LYS B 2 438 ? 23.348  49.105 47.346  1.00 151.39 ? 424 LYS B CB    1 
ATOM   7467 C CG    . LYS B 2 438 ? 23.949  47.947 48.136  1.00 151.58 ? 424 LYS B CG    1 
ATOM   7468 C CD    . LYS B 2 438 ? 24.395  48.354 49.537  1.00 150.40 ? 424 LYS B CD    1 
ATOM   7469 C CE    . LYS B 2 438 ? 25.729  49.089 49.530  1.00 140.94 ? 424 LYS B CE    1 
ATOM   7470 N NZ    . LYS B 2 438 ? 26.871  48.202 49.170  1.00 133.45 ? 424 LYS B NZ    1 
ATOM   7471 N N     . LEU B 2 439 ? 21.377  51.034 48.965  1.00 150.96 ? 425 LEU B N     1 
ATOM   7472 C CA    . LEU B 2 439 ? 21.046  51.652 50.251  1.00 157.38 ? 425 LEU B CA    1 
ATOM   7473 C C     . LEU B 2 439 ? 19.540  51.810 50.488  1.00 161.64 ? 425 LEU B C     1 
ATOM   7474 O O     . LEU B 2 439 ? 19.117  52.184 51.585  1.00 168.22 ? 425 LEU B O     1 
ATOM   7475 C CB    . LEU B 2 439 ? 21.748  53.011 50.386  1.00 156.11 ? 425 LEU B CB    1 
ATOM   7476 C CG    . LEU B 2 439 ? 23.277  53.034 50.507  1.00 149.26 ? 425 LEU B CG    1 
ATOM   7477 C CD1   . LEU B 2 439 ? 23.820  54.408 50.144  1.00 149.07 ? 425 LEU B CD1   1 
ATOM   7478 C CD2   . LEU B 2 439 ? 23.738  52.623 51.899  1.00 151.14 ? 425 LEU B CD2   1 
ATOM   7479 N N     . TRP B 2 440 ? 18.740  51.518 49.464  1.00 160.25 ? 426 TRP B N     1 
ATOM   7480 C CA    . TRP B 2 440 ? 17.285  51.659 49.550  1.00 158.65 ? 426 TRP B CA    1 
ATOM   7481 C C     . TRP B 2 440 ? 16.588  50.383 49.944  1.00 151.65 ? 426 TRP B C     1 
ATOM   7482 O O     . TRP B 2 440 ? 15.700  50.398 50.801  1.00 147.28 ? 426 TRP B O     1 
ATOM   7483 C CB    . TRP B 2 440 ? 16.718  52.202 48.238  1.00 154.11 ? 426 TRP B CB    1 
ATOM   7484 C CG    . TRP B 2 440 ? 15.206  52.216 48.186  1.00 148.42 ? 426 TRP B CG    1 
ATOM   7485 C CD1   . TRP B 2 440 ? 14.376  51.413 47.409  1.00 146.08 ? 426 TRP B CD1   1 
ATOM   7486 C CD2   . TRP B 2 440 ? 14.291  53.072 48.958  1.00 147.02 ? 426 TRP B CD2   1 
ATOM   7487 N NE1   . TRP B 2 440 ? 13.055  51.708 47.634  1.00 141.91 ? 426 TRP B NE1   1 
ATOM   7488 C CE2   . TRP B 2 440 ? 12.932  52.691 48.550  1.00 146.06 ? 426 TRP B CE2   1 
ATOM   7489 C CE3   . TRP B 2 440 ? 14.454  54.078 49.906  1.00 149.75 ? 426 TRP B CE3   1 
ATOM   7490 C CZ2   . TRP B 2 440 ? 11.806  53.303 49.081  1.00 149.83 ? 426 TRP B CZ2   1 
ATOM   7491 C CZ3   . TRP B 2 440 ? 13.308  54.688 50.434  1.00 156.95 ? 426 TRP B CZ3   1 
ATOM   7492 C CH2   . TRP B 2 440 ? 12.018  54.308 50.029  1.00 154.21 ? 426 TRP B CH2   1 
ATOM   7493 N N     . TYR B 2 441 ? 16.984  49.271 49.329  1.00 145.53 ? 427 TYR B N     1 
ATOM   7494 C CA    . TYR B 2 441 ? 16.327  47.979 49.551  1.00 143.84 ? 427 TYR B CA    1 
ATOM   7495 C C     . TYR B 2 441 ? 16.878  47.194 50.749  1.00 141.12 ? 427 TYR B C     1 
ATOM   7496 O O     . TYR B 2 441 ? 16.511  46.034 50.959  1.00 143.94 ? 427 TYR B O     1 
ATOM   7497 C CB    . TYR B 2 441 ? 16.375  47.126 48.277  1.00 141.63 ? 427 TYR B CB    1 
ATOM   7498 C CG    . TYR B 2 441 ? 15.495  47.643 47.159  1.00 144.82 ? 427 TYR B CG    1 
ATOM   7499 C CD1   . TYR B 2 441 ? 14.137  47.326 47.109  1.00 153.84 ? 427 TYR B CD1   1 
ATOM   7500 C CD2   . TYR B 2 441 ? 16.020  48.448 46.148  1.00 146.90 ? 427 TYR B CD2   1 
ATOM   7501 C CE1   . TYR B 2 441 ? 13.327  47.797 46.087  1.00 156.94 ? 427 TYR B CE1   1 
ATOM   7502 C CE2   . TYR B 2 441 ? 15.218  48.923 45.121  1.00 147.83 ? 427 TYR B CE2   1 
ATOM   7503 C CZ    . TYR B 2 441 ? 13.874  48.596 45.095  1.00 153.66 ? 427 TYR B CZ    1 
ATOM   7504 O OH    . TYR B 2 441 ? 13.075  49.065 44.078  1.00 156.43 ? 427 TYR B OH    1 
ATOM   7505 N N     . GLN B 2 442 ? 17.746  47.832 51.533  1.00 134.25 ? 428 GLN B N     1 
ATOM   7506 C CA    . GLN B 2 442 ? 18.309  47.214 52.736  1.00 141.76 ? 428 GLN B CA    1 
ATOM   7507 C C     . GLN B 2 442 ? 17.377  47.328 53.947  1.00 141.02 ? 428 GLN B C     1 
ATOM   7508 O O     . GLN B 2 442 ? 17.527  46.592 54.925  1.00 138.83 ? 428 GLN B O     1 
ATOM   7509 C CB    . GLN B 2 442 ? 19.694  47.794 53.059  1.00 146.32 ? 428 GLN B CB    1 
ATOM   7510 C CG    . GLN B 2 442 ? 19.731  49.300 53.285  1.00 152.18 ? 428 GLN B CG    1 
ATOM   7511 C CD    . GLN B 2 442 ? 21.125  49.823 53.587  1.00 153.30 ? 428 GLN B CD    1 
ATOM   7512 O OE1   . GLN B 2 442 ? 22.117  49.352 53.028  1.00 152.58 ? 428 GLN B OE1   1 
ATOM   7513 N NE2   . GLN B 2 442 ? 21.204  50.811 54.471  1.00 152.02 ? 428 GLN B NE2   1 
ATOM   7514 N N     . LEU B 2 443 ? 16.418  48.250 53.868  1.00 144.78 ? 429 LEU B N     1 
ATOM   7515 C CA    . LEU B 2 443 ? 15.461  48.485 54.952  1.00 153.64 ? 429 LEU B CA    1 
ATOM   7516 C C     . LEU B 2 443 ? 14.208  47.611 54.831  1.00 161.02 ? 429 LEU B C     1 
ATOM   7517 O O     . LEU B 2 443 ? 13.315  47.676 55.681  1.00 162.59 ? 429 LEU B O     1 
ATOM   7518 C CB    . LEU B 2 443 ? 15.064  49.970 55.022  1.00 151.78 ? 429 LEU B CB    1 
ATOM   7519 C CG    . LEU B 2 443 ? 16.083  51.087 55.310  1.00 155.73 ? 429 LEU B CG    1 
ATOM   7520 C CD1   . LEU B 2 443 ? 17.090  50.696 56.386  1.00 152.74 ? 429 LEU B CD1   1 
ATOM   7521 C CD2   . LEU B 2 443 ? 16.798  51.538 54.042  1.00 156.97 ? 429 LEU B CD2   1 
ATOM   7522 N N     . GLU B 2 444 ? 14.154  46.797 53.778  1.00 161.80 ? 430 GLU B N     1 
ATOM   7523 C CA    . GLU B 2 444 ? 13.020  45.908 53.526  1.00 158.66 ? 430 GLU B CA    1 
ATOM   7524 C C     . GLU B 2 444 ? 12.991  44.748 54.522  1.00 155.98 ? 430 GLU B C     1 
ATOM   7525 O O     . GLU B 2 444 ? 14.004  44.077 54.739  1.00 156.13 ? 430 GLU B O     1 
ATOM   7526 C CB    . GLU B 2 444 ? 13.066  45.378 52.088  1.00 157.17 ? 430 GLU B CB    1 
ATOM   7527 C CG    . GLU B 2 444 ? 11.794  44.678 51.629  1.00 153.53 ? 430 GLU B CG    1 
ATOM   7528 C CD    . GLU B 2 444 ? 11.891  44.134 50.214  1.00 152.18 ? 430 GLU B CD    1 
ATOM   7529 O OE1   . GLU B 2 444 ? 12.407  44.847 49.326  1.00 156.85 ? 430 GLU B OE1   1 
ATOM   7530 O OE2   . GLU B 2 444 ? 11.440  42.991 49.988  1.00 147.43 ? 430 GLU B OE2   1 
ATOM   7531 N N     . LYS B 2 445 ? 11.824  44.527 55.123  1.00 146.14 ? 431 LYS B N     1 
ATOM   7532 C CA    . LYS B 2 445 ? 11.637  43.459 56.102  1.00 146.54 ? 431 LYS B CA    1 
ATOM   7533 C C     . LYS B 2 445 ? 11.389  42.119 55.418  1.00 153.07 ? 431 LYS B C     1 
ATOM   7534 O O     . LYS B 2 445 ? 12.330  41.419 55.042  1.00 153.30 ? 431 LYS B O     1 
ATOM   7535 C CB    . LYS B 2 445 ? 10.478  43.792 57.044  1.00 142.03 ? 431 LYS B CB    1 
ATOM   7536 P P     . DA  C 3 5   ? 13.404  61.567 25.583  1.00 180.75 ? 3   DA  D P     1 
ATOM   7537 O OP1   . DA  C 3 5   ? 13.310  60.143 25.172  1.00 169.25 ? 3   DA  D OP1   1 
ATOM   7538 O OP2   . DA  C 3 5   ? 13.978  61.910 26.910  1.00 168.67 ? 3   DA  D OP2   1 
ATOM   7539 O "O5'" . DA  C 3 5   ? 14.224  62.354 24.467  1.00 166.65 ? 3   DA  D "O5'" 1 
ATOM   7540 C "C5'" . DA  C 3 5   ? 13.707  62.503 23.129  1.00 160.00 ? 3   DA  D "C5'" 1 
ATOM   7541 C "C4'" . DA  C 3 5   ? 14.383  63.662 22.433  1.00 159.05 ? 3   DA  D "C4'" 1 
ATOM   7542 O "O4'" . DA  C 3 5   ? 14.217  64.852 23.231  1.00 156.13 ? 3   DA  D "O4'" 1 
ATOM   7543 C "C3'" . DA  C 3 5   ? 15.888  63.494 22.237  1.00 164.42 ? 3   DA  D "C3'" 1 
ATOM   7544 O "O3'" . DA  C 3 5   ? 16.133  63.004 20.914  1.00 170.38 ? 3   DA  D "O3'" 1 
ATOM   7545 C "C2'" . DA  C 3 5   ? 16.439  64.903 22.389  1.00 156.93 ? 3   DA  D "C2'" 1 
ATOM   7546 C "C1'" . DA  C 3 5   ? 15.362  65.686 23.136  1.00 156.45 ? 3   DA  D "C1'" 1 
ATOM   7547 N N9    . DA  C 3 5   ? 15.726  66.100 24.491  1.00 155.97 ? 3   DA  D N9    1 
ATOM   7548 C C8    . DA  C 3 5   ? 15.252  65.585 25.673  1.00 157.66 ? 3   DA  D C8    1 
ATOM   7549 N N7    . DA  C 3 5   ? 15.747  66.164 26.739  1.00 163.57 ? 3   DA  D N7    1 
ATOM   7550 C C5    . DA  C 3 5   ? 16.601  67.131 26.227  1.00 158.20 ? 3   DA  D C5    1 
ATOM   7551 C C6    . DA  C 3 5   ? 17.429  68.085 26.846  1.00 156.42 ? 3   DA  D C6    1 
ATOM   7552 N N6    . DA  C 3 5   ? 17.539  68.225 28.169  1.00 154.28 ? 3   DA  D N6    1 
ATOM   7553 N N1    . DA  C 3 5   ? 18.154  68.899 26.047  1.00 153.78 ? 3   DA  D N1    1 
ATOM   7554 C C2    . DA  C 3 5   ? 18.045  68.758 24.719  1.00 150.66 ? 3   DA  D C2    1 
ATOM   7555 N N3    . DA  C 3 5   ? 17.302  67.900 24.021  1.00 148.92 ? 3   DA  D N3    1 
ATOM   7556 C C4    . DA  C 3 5   ? 16.596  67.105 24.844  1.00 153.74 ? 3   DA  D C4    1 
ATOM   7557 P P     . DT  C 3 6   ? 17.413  62.114 20.546  1.00 178.27 ? 4   DT  D P     1 
ATOM   7558 O OP1   . DT  C 3 6   ? 17.195  61.549 19.189  1.00 168.37 ? 4   DT  D OP1   1 
ATOM   7559 O OP2   . DT  C 3 6   ? 17.705  61.199 21.680  1.00 162.96 ? 4   DT  D OP2   1 
ATOM   7560 O "O5'" . DT  C 3 6   ? 18.588  63.188 20.465  1.00 157.85 ? 4   DT  D "O5'" 1 
ATOM   7561 C "C5'" . DT  C 3 6   ? 18.613  64.191 19.429  1.00 156.42 ? 4   DT  D "C5'" 1 
ATOM   7562 C "C4'" . DT  C 3 6   ? 19.806  65.102 19.610  1.00 152.57 ? 4   DT  D "C4'" 1 
ATOM   7563 O "O4'" . DT  C 3 6   ? 19.682  65.824 20.858  1.00 148.53 ? 4   DT  D "O4'" 1 
ATOM   7564 C "C3'" . DT  C 3 6   ? 21.161  64.387 19.653  1.00 156.52 ? 4   DT  D "C3'" 1 
ATOM   7565 O "O3'" . DT  C 3 6   ? 22.083  64.998 18.743  1.00 156.86 ? 4   DT  D "O3'" 1 
ATOM   7566 C "C2'" . DT  C 3 6   ? 21.616  64.538 21.095  1.00 156.46 ? 4   DT  D "C2'" 1 
ATOM   7567 C "C1'" . DT  C 3 6   ? 20.923  65.813 21.539  1.00 148.20 ? 4   DT  D "C1'" 1 
ATOM   7568 N N1    . DT  C 3 6   ? 20.648  65.889 22.988  1.00 148.46 ? 4   DT  D N1    1 
ATOM   7569 C C2    . DT  C 3 6   ? 21.120  66.978 23.687  1.00 146.20 ? 4   DT  D C2    1 
ATOM   7570 O O2    . DT  C 3 6   ? 21.754  67.882 23.167  1.00 141.36 ? 4   DT  D O2    1 
ATOM   7571 N N3    . DT  C 3 6   ? 20.825  66.968 25.029  1.00 149.95 ? 4   DT  D N3    1 
ATOM   7572 C C4    . DT  C 3 6   ? 20.118  66.002 25.722  1.00 151.80 ? 4   DT  D C4    1 
ATOM   7573 O O4    . DT  C 3 6   ? 19.930  66.131 26.929  1.00 150.65 ? 4   DT  D O4    1 
ATOM   7574 C C5    . DT  C 3 6   ? 19.652  64.889 24.925  1.00 150.31 ? 4   DT  D C5    1 
ATOM   7575 C C7    . DT  C 3 6   ? 18.879  63.793 25.589  1.00 142.42 ? 4   DT  D C7    1 
ATOM   7576 C C6    . DT  C 3 6   ? 19.937  64.889 23.616  1.00 149.61 ? 4   DT  D C6    1 
ATOM   7577 P P     . DG  C 3 7   ? 23.499  64.329 18.387  1.00 175.48 ? 5   DG  D P     1 
ATOM   7578 O OP1   . DG  C 3 7   ? 23.779  64.603 16.954  1.00 162.13 ? 5   DG  D OP1   1 
ATOM   7579 O OP2   . DG  C 3 7   ? 23.527  62.927 18.880  1.00 170.23 ? 5   DG  D OP2   1 
ATOM   7580 O "O5'" . DG  C 3 7   ? 24.512  65.184 19.270  1.00 160.95 ? 5   DG  D "O5'" 1 
ATOM   7581 C "C5'" . DG  C 3 7   ? 24.743  66.580 18.993  1.00 152.94 ? 5   DG  D "C5'" 1 
ATOM   7582 C "C4'" . DG  C 3 7   ? 25.712  67.171 19.991  1.00 152.36 ? 5   DG  D "C4'" 1 
ATOM   7583 O "O4'" . DG  C 3 7   ? 25.062  67.324 21.275  1.00 146.67 ? 5   DG  D "O4'" 1 
ATOM   7584 C "C3'" . DG  C 3 7   ? 26.979  66.345 20.241  1.00 156.60 ? 5   DG  D "C3'" 1 
ATOM   7585 O "O3'" . DG  C 3 7   ? 28.137  67.182 20.134  1.00 158.50 ? 5   DG  D "O3'" 1 
ATOM   7586 C "C2'" . DG  C 3 7   ? 26.795  65.803 21.649  1.00 151.29 ? 5   DG  D "C2'" 1 
ATOM   7587 C "C1'" . DG  C 3 7   ? 25.912  66.849 22.304  1.00 148.79 ? 5   DG  D "C1'" 1 
ATOM   7588 N N9    . DG  C 3 7   ? 25.067  66.337 23.378  1.00 147.12 ? 5   DG  D N9    1 
ATOM   7589 C C8    . DG  C 3 7   ? 24.137  65.329 23.288  1.00 149.63 ? 5   DG  D C8    1 
ATOM   7590 N N7    . DG  C 3 7   ? 23.528  65.091 24.417  1.00 151.88 ? 5   DG  D N7    1 
ATOM   7591 C C5    . DG  C 3 7   ? 24.085  65.999 25.307  1.00 148.41 ? 5   DG  D C5    1 
ATOM   7592 C C6    . DG  C 3 7   ? 23.823  66.214 26.686  1.00 150.08 ? 5   DG  D C6    1 
ATOM   7593 O O6    . DG  C 3 7   ? 23.018  65.628 27.419  1.00 148.55 ? 5   DG  D O6    1 
ATOM   7594 N N1    . DG  C 3 7   ? 24.618  67.233 27.204  1.00 150.68 ? 5   DG  D N1    1 
ATOM   7595 C C2    . DG  C 3 7   ? 25.545  67.952 26.490  1.00 149.94 ? 5   DG  D C2    1 
ATOM   7596 N N2    . DG  C 3 7   ? 26.211  68.897 27.170  1.00 149.69 ? 5   DG  D N2    1 
ATOM   7597 N N3    . DG  C 3 7   ? 25.799  67.761 25.205  1.00 146.14 ? 5   DG  D N3    1 
ATOM   7598 C C4    . DG  C 3 7   ? 25.038  66.776 24.681  1.00 145.87 ? 5   DG  D C4    1 
ATOM   7599 P P     . DC  C 3 8   ? 29.632  66.599 20.184  1.00 160.75 ? 6   DC  D P     1 
ATOM   7600 O OP1   . DC  C 3 8   ? 30.504  67.530 19.424  1.00 162.58 ? 6   DC  D OP1   1 
ATOM   7601 O OP2   . DC  C 3 8   ? 29.611  65.157 19.823  1.00 159.17 ? 6   DC  D OP2   1 
ATOM   7602 O "O5'" . DC  C 3 8   ? 30.004  66.716 21.728  1.00 150.07 ? 6   DC  D "O5'" 1 
ATOM   7603 C "C5'" . DC  C 3 8   ? 29.816  67.953 22.445  1.00 148.96 ? 6   DC  D "C5'" 1 
ATOM   7604 C "C4'" . DC  C 3 8   ? 30.135  67.776 23.912  1.00 148.92 ? 6   DC  D "C4'" 1 
ATOM   7605 O "O4'" . DC  C 3 8   ? 28.978  67.262 24.610  1.00 149.49 ? 6   DC  D "O4'" 1 
ATOM   7606 C "C3'" . DC  C 3 8   ? 31.288  66.812 24.220  1.00 150.21 ? 6   DC  D "C3'" 1 
ATOM   7607 O "O3'" . DC  C 3 8   ? 32.349  67.511 24.883  1.00 158.03 ? 6   DC  D "O3'" 1 
ATOM   7608 C "C2'" . DC  C 3 8   ? 30.668  65.753 25.121  1.00 145.23 ? 6   DC  D "C2'" 1 
ATOM   7609 C "C1'" . DC  C 3 8   ? 29.431  66.440 25.664  1.00 148.78 ? 6   DC  D "C1'" 1 
ATOM   7610 N N1    . DC  C 3 8   ? 28.332  65.535 26.044  1.00 151.17 ? 6   DC  D N1    1 
ATOM   7611 C C2    . DC  C 3 8   ? 27.852  65.575 27.358  1.00 150.07 ? 6   DC  D C2    1 
ATOM   7612 O O2    . DC  C 3 8   ? 28.361  66.374 28.159  1.00 146.72 ? 6   DC  D O2    1 
ATOM   7613 N N3    . DC  C 3 8   ? 26.844  64.746 27.719  1.00 151.12 ? 6   DC  D N3    1 
ATOM   7614 C C4    . DC  C 3 8   ? 26.324  63.900 26.826  1.00 151.30 ? 6   DC  D C4    1 
ATOM   7615 N N4    . DC  C 3 8   ? 25.332  63.101 27.226  1.00 147.36 ? 6   DC  D N4    1 
ATOM   7616 C C5    . DC  C 3 8   ? 26.796  63.837 25.482  1.00 152.97 ? 6   DC  D C5    1 
ATOM   7617 C C6    . DC  C 3 8   ? 27.792  64.665 25.138  1.00 151.35 ? 6   DC  D C6    1 
ATOM   7618 P P     . DC  C 3 9   ? 33.746  66.814 25.256  1.00 177.00 ? 7   DC  D P     1 
ATOM   7619 O OP1   . DC  C 3 9   ? 34.783  67.876 25.284  1.00 173.60 ? 7   DC  D OP1   1 
ATOM   7620 O OP2   . DC  C 3 9   ? 33.945  65.619 24.393  1.00 161.36 ? 7   DC  D OP2   1 
ATOM   7621 O "O5'" . DC  C 3 9   ? 33.490  66.348 26.758  1.00 156.57 ? 7   DC  D "O5'" 1 
ATOM   7622 C "C5'" . DC  C 3 9   ? 33.979  65.085 27.250  1.00 145.32 ? 7   DC  D "C5'" 1 
ATOM   7623 C "C4'" . DC  C 3 9   ? 33.754  64.989 28.741  1.00 142.89 ? 7   DC  D "C4'" 1 
ATOM   7624 O "O4'" . DC  C 3 9   ? 32.352  65.184 29.031  1.00 134.90 ? 7   DC  D "O4'" 1 
ATOM   7625 C "C3'" . DC  C 3 9   ? 34.094  63.638 29.358  1.00 150.09 ? 7   DC  D "C3'" 1 
ATOM   7626 O "O3'" . DC  C 3 9   ? 35.478  63.577 29.721  1.00 156.81 ? 7   DC  D "O3'" 1 
ATOM   7627 C "C2'" . DC  C 3 9   ? 33.209  63.604 30.590  1.00 148.09 ? 7   DC  D "C2'" 1 
ATOM   7628 C "C1'" . DC  C 3 9   ? 31.993  64.441 30.194  1.00 138.25 ? 7   DC  D "C1'" 1 
ATOM   7629 N N1    . DC  C 3 9   ? 30.790  63.651 29.879  1.00 146.05 ? 7   DC  D N1    1 
ATOM   7630 C C2    . DC  C 3 9   ? 29.977  63.216 30.932  1.00 150.29 ? 7   DC  D C2    1 
ATOM   7631 O O2    . DC  C 3 9   ? 30.289  63.516 32.095  1.00 146.06 ? 7   DC  D O2    1 
ATOM   7632 N N3    . DC  C 3 9   ? 28.871  62.486 30.656  1.00 156.78 ? 7   DC  D N3    1 
ATOM   7633 C C4    . DC  C 3 9   ? 28.569  62.186 29.390  1.00 155.46 ? 7   DC  D C4    1 
ATOM   7634 N N4    . DC  C 3 9   ? 27.469  61.463 29.164  1.00 151.71 ? 7   DC  D N4    1 
ATOM   7635 C C5    . DC  C 3 9   ? 29.381  62.613 28.299  1.00 156.35 ? 7   DC  D C5    1 
ATOM   7636 C C6    . DC  C 3 9   ? 30.472  63.336 28.587  1.00 150.26 ? 7   DC  D C6    1 
ATOM   7637 P P     . DT  C 3 10  ? 36.245  62.171 29.823  1.00 171.80 ? 8   DT  D P     1 
ATOM   7638 O OP1   . DT  C 3 10  ? 37.686  62.460 30.040  1.00 153.74 ? 8   DT  D OP1   1 
ATOM   7639 O OP2   . DT  C 3 10  ? 35.837  61.324 28.672  1.00 168.80 ? 8   DT  D OP2   1 
ATOM   7640 O "O5'" . DT  C 3 10  ? 35.657  61.517 31.152  1.00 166.03 ? 8   DT  D "O5'" 1 
ATOM   7641 C "C5'" . DT  C 3 10  ? 35.943  62.082 32.446  1.00 156.81 ? 8   DT  D "C5'" 1 
ATOM   7642 C "C4'" . DT  C 3 10  ? 35.126  61.406 33.523  1.00 157.01 ? 8   DT  D "C4'" 1 
ATOM   7643 O "O4'" . DT  C 3 10  ? 33.717  61.643 33.314  1.00 153.95 ? 8   DT  D "O4'" 1 
ATOM   7644 C "C3'" . DT  C 3 10  ? 35.243  59.888 33.582  1.00 155.41 ? 8   DT  D "C3'" 1 
ATOM   7645 O "O3'" . DT  C 3 10  ? 36.410  59.469 34.298  1.00 159.69 ? 8   DT  D "O3'" 1 
ATOM   7646 C "C2'" . DT  C 3 10  ? 33.975  59.498 34.319  1.00 150.14 ? 8   DT  D "C2'" 1 
ATOM   7647 C "C1'" . DT  C 3 10  ? 32.976  60.590 33.930  1.00 147.97 ? 8   DT  D "C1'" 1 
ATOM   7648 N N1    . DT  C 3 10  ? 31.936  60.140 32.982  1.00 146.87 ? 8   DT  D N1    1 
ATOM   7649 C C2    . DT  C 3 10  ? 30.753  59.662 33.501  1.00 150.55 ? 8   DT  D C2    1 
ATOM   7650 O O2    . DT  C 3 10  ? 30.521  59.610 34.698  1.00 150.77 ? 8   DT  D O2    1 
ATOM   7651 N N3    . DT  C 3 10  ? 29.841  59.251 32.559  1.00 154.78 ? 8   DT  D N3    1 
ATOM   7652 C C4    . DT  C 3 10  ? 29.993  59.265 31.185  1.00 156.40 ? 8   DT  D C4    1 
ATOM   7653 O O4    . DT  C 3 10  ? 29.083  58.863 30.465  1.00 160.98 ? 8   DT  D O4    1 
ATOM   7654 C C5    . DT  C 3 10  ? 31.263  59.772 30.712  1.00 149.72 ? 8   DT  D C5    1 
ATOM   7655 C C7    . DT  C 3 10  ? 31.521  59.823 29.239  1.00 147.58 ? 8   DT  D C7    1 
ATOM   7656 C C6    . DT  C 3 10  ? 32.159  60.175 31.622  1.00 148.43 ? 8   DT  D C6    1 
ATOM   7657 P P     . DA  C 3 11  ? 37.061  58.033 33.994  1.00 169.57 ? 9   DA  D P     1 
ATOM   7658 O OP1   . DA  C 3 11  ? 38.328  57.946 34.766  1.00 156.52 ? 9   DA  D OP1   1 
ATOM   7659 O OP2   . DA  C 3 11  ? 37.090  57.831 32.522  1.00 171.63 ? 9   DA  D OP2   1 
ATOM   7660 O "O5'" . DA  C 3 11  ? 36.011  57.004 34.610  1.00 167.65 ? 9   DA  D "O5'" 1 
ATOM   7661 C "C5'" . DA  C 3 11  ? 36.067  56.632 36.002  1.00 157.68 ? 9   DA  D "C5'" 1 
ATOM   7662 C "C4'" . DA  C 3 11  ? 34.780  55.973 36.442  1.00 156.48 ? 9   DA  D "C4'" 1 
ATOM   7663 O "O4'" . DA  C 3 11  ? 33.635  56.654 35.886  1.00 158.39 ? 9   DA  D "O4'" 1 
ATOM   7664 C "C3'" . DA  C 3 11  ? 34.601  54.524 36.006  1.00 147.42 ? 9   DA  D "C3'" 1 
ATOM   7665 O "O3'" . DA  C 3 11  ? 35.293  53.622 36.877  1.00 134.96 ? 9   DA  D "O3'" 1 
ATOM   7666 C "C2'" . DA  C 3 11  ? 33.098  54.346 36.114  1.00 151.11 ? 9   DA  D "C2'" 1 
ATOM   7667 C "C1'" . DA  C 3 11  ? 32.548  55.734 35.780  1.00 155.11 ? 9   DA  D "C1'" 1 
ATOM   7668 N N9    . DA  C 3 11  ? 31.991  55.840 34.431  1.00 151.39 ? 9   DA  D N9    1 
ATOM   7669 C C8    . DA  C 3 11  ? 32.529  56.470 33.336  1.00 149.03 ? 9   DA  D C8    1 
ATOM   7670 N N7    . DA  C 3 11  ? 31.789  56.382 32.257  1.00 148.93 ? 9   DA  D N7    1 
ATOM   7671 C C5    . DA  C 3 11  ? 30.691  55.638 32.667  1.00 155.50 ? 9   DA  D C5    1 
ATOM   7672 C C6    . DA  C 3 11  ? 29.540  55.196 31.989  1.00 161.45 ? 9   DA  D C6    1 
ATOM   7673 N N6    . DA  C 3 11  ? 29.296  55.450 30.702  1.00 162.96 ? 9   DA  D N6    1 
ATOM   7674 N N1    . DA  C 3 11  ? 28.638  54.472 32.689  1.00 154.13 ? 9   DA  D N1    1 
ATOM   7675 C C2    . DA  C 3 11  ? 28.884  54.219 33.981  1.00 154.67 ? 9   DA  D C2    1 
ATOM   7676 N N3    . DA  C 3 11  ? 29.926  54.579 34.728  1.00 151.04 ? 9   DA  D N3    1 
ATOM   7677 C C4    . DA  C 3 11  ? 30.804  55.296 34.003  1.00 152.97 ? 9   DA  D C4    1 
ATOM   7678 P P     . DT  C 3 12  ? 35.767  52.185 36.342  1.00 146.43 ? 10  DT  D P     1 
ATOM   7679 O OP1   . DT  C 3 12  ? 36.668  51.601 37.368  1.00 153.38 ? 10  DT  D OP1   1 
ATOM   7680 O OP2   . DT  C 3 12  ? 36.254  52.335 34.946  1.00 151.15 ? 10  DT  D OP2   1 
ATOM   7681 O "O5'" . DT  C 3 12  ? 34.418  51.336 36.302  1.00 158.86 ? 10  DT  D "O5'" 1 
ATOM   7682 C "C5'" . DT  C 3 12  ? 33.912  50.689 37.487  1.00 153.83 ? 10  DT  D "C5'" 1 
ATOM   7683 C "C4'" . DT  C 3 12  ? 32.525  50.137 37.247  1.00 153.70 ? 10  DT  D "C4'" 1 
ATOM   7684 O "O4'" . DT  C 3 12  ? 31.700  51.126 36.592  1.00 152.22 ? 10  DT  D "O4'" 1 
ATOM   7685 C "C3'" . DT  C 3 12  ? 32.458  48.916 36.337  1.00 147.49 ? 10  DT  D "C3'" 1 
ATOM   7686 O "O3'" . DT  C 3 12  ? 32.691  47.707 37.069  1.00 146.37 ? 10  DT  D "O3'" 1 
ATOM   7687 C "C2'" . DT  C 3 12  ? 31.034  48.978 35.819  1.00 150.68 ? 10  DT  D "C2'" 1 
ATOM   7688 C "C1'" . DT  C 3 12  ? 30.747  50.478 35.751  1.00 150.93 ? 10  DT  D "C1'" 1 
ATOM   7689 N N1    . DT  C 3 12  ? 30.862  51.054 34.396  1.00 149.06 ? 10  DT  D N1    1 
ATOM   7690 C C2    . DT  C 3 12  ? 29.788  50.931 33.541  1.00 151.30 ? 10  DT  D C2    1 
ATOM   7691 O O2    . DT  C 3 12  ? 28.746  50.378 33.854  1.00 151.33 ? 10  DT  D O2    1 
ATOM   7692 N N3    . DT  C 3 12  ? 29.978  51.487 32.300  1.00 152.07 ? 10  DT  D N3    1 
ATOM   7693 C C4    . DT  C 3 12  ? 31.109  52.135 31.838  1.00 150.47 ? 10  DT  D C4    1 
ATOM   7694 O O4    . DT  C 3 12  ? 31.133  52.585 30.696  1.00 148.78 ? 10  DT  D O4    1 
ATOM   7695 C C5    . DT  C 3 12  ? 32.198  52.224 32.786  1.00 149.69 ? 10  DT  D C5    1 
ATOM   7696 C C7    . DT  C 3 12  ? 33.464  52.908 32.377  1.00 148.07 ? 10  DT  D C7    1 
ATOM   7697 C C6    . DT  C 3 12  ? 32.023  51.684 33.999  1.00 148.96 ? 10  DT  D C6    1 
ATOM   7698 P P     . DA  C 3 13  ? 33.305  46.420 36.333  1.00 151.28 ? 11  DA  D P     1 
ATOM   7699 O OP1   . DA  C 3 13  ? 33.452  45.348 37.350  1.00 154.78 ? 11  DA  D OP1   1 
ATOM   7700 O OP2   . DA  C 3 13  ? 34.491  46.851 35.548  1.00 149.37 ? 11  DA  D OP2   1 
ATOM   7701 O "O5'" . DA  C 3 13  ? 32.146  45.979 35.331  1.00 157.38 ? 11  DA  D "O5'" 1 
ATOM   7702 C "C5'" . DA  C 3 13  ? 32.445  45.366 34.062  1.00 151.03 ? 11  DA  D "C5'" 1 
ATOM   7703 C "C4'" . DA  C 3 13  ? 31.168  44.967 33.360  1.00 149.32 ? 11  DA  D "C4'" 1 
ATOM   7704 O "O4'" . DA  C 3 13  ? 30.318  46.128 33.200  1.00 157.86 ? 11  DA  D "O4'" 1 
ATOM   7705 C "C3'" . DA  C 3 13  ? 31.362  44.410 31.953  1.00 140.80 ? 11  DA  D "C3'" 1 
ATOM   7706 O "O3'" . DA  C 3 13  ? 31.527  42.988 31.985  1.00 134.86 ? 11  DA  D "O3'" 1 
ATOM   7707 C "C2'" . DA  C 3 13  ? 30.079  44.817 31.254  1.00 144.00 ? 11  DA  D "C2'" 1 
ATOM   7708 C "C1'" . DA  C 3 13  ? 29.791  46.175 31.877  1.00 153.52 ? 11  DA  D "C1'" 1 
ATOM   7709 N N9    . DA  C 3 13  ? 30.418  47.301 31.182  1.00 152.41 ? 11  DA  D N9    1 
ATOM   7710 C C8    . DA  C 3 13  ? 31.499  48.043 31.592  1.00 148.26 ? 11  DA  D C8    1 
ATOM   7711 N N7    . DA  C 3 13  ? 31.838  48.992 30.754  1.00 146.93 ? 11  DA  D N7    1 
ATOM   7712 C C5    . DA  C 3 13  ? 30.920  48.867 29.720  1.00 150.40 ? 11  DA  D C5    1 
ATOM   7713 C C6    . DA  C 3 13  ? 30.741  49.582 28.522  1.00 149.93 ? 11  DA  D C6    1 
ATOM   7714 N N6    . DA  C 3 13  ? 31.511  50.606 28.148  1.00 150.31 ? 11  DA  D N6    1 
ATOM   7715 N N1    . DA  C 3 13  ? 29.730  49.202 27.709  1.00 154.27 ? 11  DA  D N1    1 
ATOM   7716 C C2    . DA  C 3 13  ? 28.957  48.175 28.085  1.00 154.68 ? 11  DA  D C2    1 
ATOM   7717 N N3    . DA  C 3 13  ? 29.025  47.426 29.185  1.00 158.98 ? 11  DA  D N3    1 
ATOM   7718 C C4    . DA  C 3 13  ? 30.040  47.829 29.970  1.00 154.39 ? 11  DA  D C4    1 
ATOM   7719 P P     . DG  C 3 14  ? 32.751  42.310 31.203  1.00 138.08 ? 12  DG  D P     1 
ATOM   7720 O OP1   . DG  C 3 14  ? 32.807  40.880 31.601  1.00 145.50 ? 12  DG  D OP1   1 
ATOM   7721 O OP2   . DG  C 3 14  ? 33.958  43.161 31.370  1.00 145.49 ? 12  DG  D OP2   1 
ATOM   7722 O "O5'" . DG  C 3 14  ? 32.291  42.397 29.679  1.00 144.96 ? 12  DG  D "O5'" 1 
ATOM   7723 C "C5'" . DG  C 3 14  ? 31.179  41.618 29.197  1.00 153.01 ? 12  DG  D "C5'" 1 
ATOM   7724 C "C4'" . DG  C 3 14  ? 30.508  42.308 28.031  1.00 144.54 ? 12  DG  D "C4'" 1 
ATOM   7725 O "O4'" . DG  C 3 14  ? 30.356  43.718 28.301  1.00 136.76 ? 12  DG  D "O4'" 1 
ATOM   7726 C "C3'" . DG  C 3 14  ? 31.275  42.249 26.716  1.00 141.21 ? 12  DG  D "C3'" 1 
ATOM   7727 O "O3'" . DG  C 3 14  ? 31.004  41.027 26.022  1.00 139.09 ? 12  DG  D "O3'" 1 
ATOM   7728 C "C2'" . DG  C 3 14  ? 30.720  43.447 25.967  1.00 136.90 ? 12  DG  D "C2'" 1 
ATOM   7729 C "C1'" . DG  C 3 14  ? 30.401  44.449 27.077  1.00 138.52 ? 12  DG  D "C1'" 1 
ATOM   7730 N N9    . DG  C 3 14  ? 31.386  45.517 27.224  1.00 137.84 ? 12  DG  D N9    1 
ATOM   7731 C C8    . DG  C 3 14  ? 32.284  45.683 28.252  1.00 136.03 ? 12  DG  D C8    1 
ATOM   7732 N N7    . DG  C 3 14  ? 33.042  46.736 28.106  1.00 134.30 ? 12  DG  D N7    1 
ATOM   7733 C C5    . DG  C 3 14  ? 32.620  47.300 26.909  1.00 135.75 ? 12  DG  D C5    1 
ATOM   7734 C C6    . DG  C 3 14  ? 33.072  48.463 26.230  1.00 141.82 ? 12  DG  D C6    1 
ATOM   7735 O O6    . DG  C 3 14  ? 33.965  49.252 26.561  1.00 146.73 ? 12  DG  D O6    1 
ATOM   7736 N N1    . DG  C 3 14  ? 32.367  48.671 25.048  1.00 142.95 ? 12  DG  D N1    1 
ATOM   7737 C C2    . DG  C 3 14  ? 31.357  47.867 24.578  1.00 145.61 ? 12  DG  D C2    1 
ATOM   7738 N N2    . DG  C 3 14  ? 30.800  48.235 23.415  1.00 149.14 ? 12  DG  D N2    1 
ATOM   7739 N N3    . DG  C 3 14  ? 30.927  46.781 25.201  1.00 148.55 ? 12  DG  D N3    1 
ATOM   7740 C C4    . DG  C 3 14  ? 31.598  46.560 26.353  1.00 140.34 ? 12  DG  D C4    1 
ATOM   7741 P P     . DT  C 3 15  ? 32.111  40.369 25.066  1.00 124.03 ? 13  DT  D P     1 
ATOM   7742 O OP1   . DT  C 3 15  ? 31.658  38.995 24.730  1.00 144.16 ? 13  DT  D OP1   1 
ATOM   7743 O OP2   . DT  C 3 15  ? 33.451  40.567 25.676  1.00 136.07 ? 13  DT  D OP2   1 
ATOM   7744 O "O5'" . DT  C 3 15  ? 32.028  41.264 23.750  1.00 123.81 ? 13  DT  D "O5'" 1 
ATOM   7745 C "C5'" . DT  C 3 15  ? 30.862  41.232 22.904  1.00 128.12 ? 13  DT  D "C5'" 1 
ATOM   7746 C "C4'" . DT  C 3 15  ? 30.858  42.409 21.955  1.00 135.19 ? 13  DT  D "C4'" 1 
ATOM   7747 O "O4'" . DT  C 3 15  ? 31.000  43.643 22.691  1.00 140.19 ? 13  DT  D "O4'" 1 
ATOM   7748 C "C3'" . DT  C 3 15  ? 31.997  42.431 20.944  1.00 128.17 ? 13  DT  D "C3'" 1 
ATOM   7749 O "O3'" . DT  C 3 15  ? 31.668  41.654 19.787  1.00 130.21 ? 13  DT  D "O3'" 1 
ATOM   7750 C "C2'" . DT  C 3 15  ? 32.099  43.905 20.597  1.00 132.25 ? 13  DT  D "C2'" 1 
ATOM   7751 C "C1'" . DT  C 3 15  ? 31.638  44.618 21.869  1.00 138.68 ? 13  DT  D "C1'" 1 
ATOM   7752 N N1    . DT  C 3 15  ? 32.731  45.235 22.649  1.00 135.93 ? 13  DT  D N1    1 
ATOM   7753 C C2    . DT  C 3 15  ? 33.272  46.417 22.192  1.00 139.85 ? 13  DT  D C2    1 
ATOM   7754 O O2    . DT  C 3 15  ? 32.888  46.980 21.180  1.00 138.05 ? 13  DT  D O2    1 
ATOM   7755 N N3    . DT  C 3 15  ? 34.284  46.921 22.973  1.00 146.06 ? 13  DT  D N3    1 
ATOM   7756 C C4    . DT  C 3 15  ? 34.798  46.373 24.133  1.00 146.77 ? 13  DT  D C4    1 
ATOM   7757 O O4    . DT  C 3 15  ? 35.710  46.943 24.727  1.00 150.61 ? 13  DT  D O4    1 
ATOM   7758 C C5    . DT  C 3 15  ? 34.184  45.133 24.553  1.00 143.70 ? 13  DT  D C5    1 
ATOM   7759 C C7    . DT  C 3 15  ? 34.674  44.464 25.799  1.00 145.53 ? 13  DT  D C7    1 
ATOM   7760 C C6    . DT  C 3 15  ? 33.197  44.632 23.798  1.00 140.51 ? 13  DT  D C6    1 
ATOM   7761 P P     . DT  C 3 16  ? 32.813  41.038 18.845  1.00 132.67 ? 14  DT  D P     1 
ATOM   7762 O OP1   . DT  C 3 16  ? 32.159  40.100 17.897  1.00 151.77 ? 14  DT  D OP1   1 
ATOM   7763 O OP2   . DT  C 3 16  ? 33.924  40.551 19.703  1.00 134.42 ? 14  DT  D OP2   1 
ATOM   7764 O "O5'" . DT  C 3 16  ? 33.343  42.293 18.017  1.00 137.50 ? 14  DT  D "O5'" 1 
ATOM   7765 C "C5'" . DT  C 3 16  ? 32.465  43.037 17.148  1.00 138.27 ? 14  DT  D "C5'" 1 
ATOM   7766 C "C4'" . DT  C 3 16  ? 33.078  44.372 16.790  1.00 131.45 ? 14  DT  D "C4'" 1 
ATOM   7767 O "O4'" . DT  C 3 16  ? 33.635  44.998 17.971  1.00 129.45 ? 14  DT  D "O4'" 1 
ATOM   7768 C "C3'" . DT  C 3 16  ? 34.211  44.303 15.761  1.00 134.68 ? 14  DT  D "C3'" 1 
ATOM   7769 O "O3'" . DT  C 3 16  ? 33.969  45.218 14.686  1.00 136.60 ? 14  DT  D "O3'" 1 
ATOM   7770 C "C2'" . DT  C 3 16  ? 35.452  44.697 16.546  1.00 140.94 ? 14  DT  D "C2'" 1 
ATOM   7771 C "C1'" . DT  C 3 16  ? 34.885  45.575 17.644  1.00 139.99 ? 14  DT  D "C1'" 1 
ATOM   7772 N N1    . DT  C 3 16  ? 35.704  45.625 18.873  1.00 145.13 ? 14  DT  D N1    1 
ATOM   7773 C C2    . DT  C 3 16  ? 36.576  46.680 19.031  1.00 146.63 ? 14  DT  D C2    1 
ATOM   7774 O O2    . DT  C 3 16  ? 36.698  47.574 18.209  1.00 148.82 ? 14  DT  D O2    1 
ATOM   7775 N N3    . DT  C 3 16  ? 37.304  46.650 20.196  1.00 144.99 ? 14  DT  D N3    1 
ATOM   7776 C C4    . DT  C 3 16  ? 37.249  45.693 21.192  1.00 141.34 ? 14  DT  D C4    1 
ATOM   7777 O O4    . DT  C 3 16  ? 37.965  45.802 22.185  1.00 136.63 ? 14  DT  D O4    1 
ATOM   7778 C C5    . DT  C 3 16  ? 36.314  44.615 20.959  1.00 144.64 ? 14  DT  D C5    1 
ATOM   7779 C C7    . DT  C 3 16  ? 36.186  43.530 21.982  1.00 147.08 ? 14  DT  D C7    1 
ATOM   7780 C C6    . DT  C 3 16  ? 35.601  44.633 19.826  1.00 145.18 ? 14  DT  D C6    1 
ATOM   7781 P P     . DA  C 3 17  ? 34.641  45.016 13.244  1.00 145.77 ? 15  DA  D P     1 
ATOM   7782 O OP1   . DA  C 3 17  ? 33.810  45.765 12.265  1.00 152.15 ? 15  DA  D OP1   1 
ATOM   7783 O OP2   . DA  C 3 17  ? 34.895  43.568 13.027  1.00 144.05 ? 15  DA  D OP2   1 
ATOM   7784 O "O5'" . DA  C 3 17  ? 36.049  45.746 13.401  1.00 151.38 ? 15  DA  D "O5'" 1 
ATOM   7785 C "C5'" . DA  C 3 17  ? 36.401  46.874 12.575  1.00 150.79 ? 15  DA  D "C5'" 1 
ATOM   7786 C "C4'" . DA  C 3 17  ? 37.746  47.434 12.979  1.00 143.35 ? 15  DA  D "C4'" 1 
ATOM   7787 O "O4'" . DA  C 3 17  ? 37.933  47.304 14.406  1.00 142.05 ? 15  DA  D "O4'" 1 
ATOM   7788 C "C3'" . DA  C 3 17  ? 38.953  46.752 12.324  1.00 138.75 ? 15  DA  D "C3'" 1 
ATOM   7789 O "O3'" . DA  C 3 17  ? 39.629  47.676 11.462  1.00 133.35 ? 15  DA  D "O3'" 1 
ATOM   7790 C "C2'" . DA  C 3 17  ? 39.839  46.335 13.489  1.00 138.21 ? 15  DA  D "C2'" 1 
ATOM   7791 C "C1'" . DA  C 3 17  ? 39.315  47.152 14.655  1.00 138.26 ? 15  DA  D "C1'" 1 
ATOM   7792 N N9    . DA  C 3 17  ? 39.471  46.505 15.959  1.00 141.76 ? 15  DA  D N9    1 
ATOM   7793 C C8    . DA  C 3 17  ? 38.736  45.468 16.477  1.00 142.83 ? 15  DA  D C8    1 
ATOM   7794 N N7    . DA  C 3 17  ? 39.119  45.095 17.674  1.00 141.26 ? 15  DA  D N7    1 
ATOM   7795 C C5    . DA  C 3 17  ? 40.179  45.943 17.964  1.00 149.36 ? 15  DA  D C5    1 
ATOM   7796 C C6    . DA  C 3 17  ? 41.017  46.060 19.088  1.00 151.23 ? 15  DA  D C6    1 
ATOM   7797 N N6    . DA  C 3 17  ? 40.915  45.289 20.172  1.00 154.66 ? 15  DA  D N6    1 
ATOM   7798 N N1    . DA  C 3 17  ? 41.979  47.009 19.057  1.00 151.43 ? 15  DA  D N1    1 
ATOM   7799 C C2    . DA  C 3 17  ? 42.079  47.785 17.970  1.00 151.06 ? 15  DA  D C2    1 
ATOM   7800 N N3    . DA  C 3 17  ? 41.353  47.770 16.853  1.00 146.04 ? 15  DA  D N3    1 
ATOM   7801 C C4    . DA  C 3 17  ? 40.407  46.817 16.916  1.00 147.11 ? 15  DA  D C4    1 
ATOM   7802 P P     . DT  C 3 18  ? 40.753  47.210 10.415  1.00 140.31 ? 16  DT  D P     1 
ATOM   7803 O OP1   . DT  C 3 18  ? 40.810  48.226 9.333   1.00 140.24 ? 16  DT  D OP1   1 
ATOM   7804 O OP2   . DT  C 3 18  ? 40.532  45.782 10.066  1.00 150.30 ? 16  DT  D OP2   1 
ATOM   7805 O "O5'" . DT  C 3 18  ? 42.099  47.312 11.261  1.00 142.48 ? 16  DT  D "O5'" 1 
ATOM   7806 C "C5'" . DT  C 3 18  ? 42.467  48.539 11.923  1.00 138.62 ? 16  DT  D "C5'" 1 
ATOM   7807 C "C4'" . DT  C 3 18  ? 43.663  48.327 12.824  1.00 140.14 ? 16  DT  D "C4'" 1 
ATOM   7808 O "O4'" . DT  C 3 18  ? 43.234  47.834 14.110  1.00 139.15 ? 16  DT  D "O4'" 1 
ATOM   7809 C "C3'" . DT  C 3 18  ? 44.677  47.295 12.340  1.00 141.82 ? 16  DT  D "C3'" 1 
ATOM   7810 O "O3'" . DT  C 3 18  ? 45.672  47.887 11.496  1.00 139.74 ? 16  DT  D "O3'" 1 
ATOM   7811 C "C2'" . DT  C 3 18  ? 45.310  46.800 13.631  1.00 144.38 ? 16  DT  D "C2'" 1 
ATOM   7812 C "C1'" . DT  C 3 18  ? 44.360  47.244 14.743  1.00 144.48 ? 16  DT  D "C1'" 1 
ATOM   7813 N N1    . DT  C 3 18  ? 43.884  46.143 15.605  1.00 148.94 ? 16  DT  D N1    1 
ATOM   7814 C C2    . DT  C 3 18  ? 44.495  45.972 16.828  1.00 149.40 ? 16  DT  D C2    1 
ATOM   7815 O O2    . DT  C 3 18  ? 45.388  46.697 17.236  1.00 154.56 ? 16  DT  D O2    1 
ATOM   7816 N N3    . DT  C 3 18  ? 44.006  44.924 17.569  1.00 148.22 ? 16  DT  D N3    1 
ATOM   7817 C C4    . DT  C 3 18  ? 43.001  44.044 17.212  1.00 149.41 ? 16  DT  D C4    1 
ATOM   7818 O O4    . DT  C 3 18  ? 42.670  43.147 17.983  1.00 148.36 ? 16  DT  D O4    1 
ATOM   7819 C C5    . DT  C 3 18  ? 42.413  44.276 15.910  1.00 151.54 ? 16  DT  D C5    1 
ATOM   7820 C C7    . DT  C 3 18  ? 41.319  43.373 15.436  1.00 151.93 ? 16  DT  D C7    1 
ATOM   7821 C C6    . DT  C 3 18  ? 42.881  45.297 15.181  1.00 149.44 ? 16  DT  D C6    1 
ATOM   7822 P P     . DT  C 3 19  ? 46.735  46.977 10.704  1.00 128.43 ? 17  DT  D P     1 
ATOM   7823 O OP1   . DT  C 3 19  ? 47.424  47.850 9.718   1.00 145.54 ? 17  DT  D OP1   1 
ATOM   7824 O OP2   . DT  C 3 19  ? 46.047  45.747 10.232  1.00 127.45 ? 17  DT  D OP2   1 
ATOM   7825 O "O5'" . DT  C 3 19  ? 47.788  46.551 11.823  1.00 135.49 ? 17  DT  D "O5'" 1 
ATOM   7826 C "C5'" . DT  C 3 19  ? 48.723  47.505 12.363  1.00 143.24 ? 17  DT  D "C5'" 1 
ATOM   7827 C "C4'" . DT  C 3 19  ? 49.349  46.989 13.639  1.00 141.55 ? 17  DT  D "C4'" 1 
ATOM   7828 O "O4'" . DT  C 3 19  ? 48.335  46.678 14.619  1.00 139.33 ? 17  DT  D "O4'" 1 
ATOM   7829 C "C3'" . DT  C 3 19  ? 50.150  45.700 13.511  1.00 135.39 ? 17  DT  D "C3'" 1 
ATOM   7830 O "O3'" . DT  C 3 19  ? 51.476  45.936 13.025  1.00 138.78 ? 17  DT  D "O3'" 1 
ATOM   7831 C "C2'" . DT  C 3 19  ? 50.173  45.199 14.944  1.00 131.69 ? 17  DT  D "C2'" 1 
ATOM   7832 C "C1'" . DT  C 3 19  ? 48.857  45.711 15.531  1.00 137.03 ? 17  DT  D "C1'" 1 
ATOM   7833 N N1    . DT  C 3 19  ? 47.838  44.658 15.724  1.00 145.92 ? 17  DT  D N1    1 
ATOM   7834 C C2    . DT  C 3 19  ? 47.805  44.007 16.938  1.00 144.27 ? 17  DT  D C2    1 
ATOM   7835 O O2    . DT  C 3 19  ? 48.565  44.269 17.856  1.00 132.42 ? 17  DT  D O2    1 
ATOM   7836 N N3    . DT  C 3 19  ? 46.841  43.033 17.039  1.00 152.86 ? 17  DT  D N3    1 
ATOM   7837 C C4    . DT  C 3 19  ? 45.934  42.651 16.068  1.00 159.32 ? 17  DT  D C4    1 
ATOM   7838 O O4    . DT  C 3 19  ? 45.124  41.759 16.304  1.00 162.23 ? 17  DT  D O4    1 
ATOM   7839 C C5    . DT  C 3 19  ? 46.030  43.372 14.817  1.00 159.42 ? 17  DT  D C5    1 
ATOM   7840 C C7    . DT  C 3 19  ? 45.092  43.025 13.705  1.00 156.61 ? 17  DT  D C7    1 
ATOM   7841 C C6    . DT  C 3 19  ? 46.971  44.319 14.708  1.00 155.48 ? 17  DT  D C6    1 
ATOM   7842 P P     . DG  C 3 20  ? 52.319  44.736 12.367  1.00 137.21 ? 18  DG  D P     1 
ATOM   7843 O OP1   . DG  C 3 20  ? 53.570  45.317 11.816  1.00 154.61 ? 18  DG  D OP1   1 
ATOM   7844 O OP2   . DG  C 3 20  ? 51.419  43.962 11.474  1.00 137.19 ? 18  DG  D OP2   1 
ATOM   7845 O "O5'" . DG  C 3 20  ? 52.699  43.808 13.607  1.00 146.97 ? 18  DG  D "O5'" 1 
ATOM   7846 C "C5'" . DG  C 3 20  ? 53.604  44.272 14.629  1.00 150.90 ? 18  DG  D "C5'" 1 
ATOM   7847 C "C4'" . DG  C 3 20  ? 53.596  43.343 15.822  1.00 145.94 ? 18  DG  D "C4'" 1 
ATOM   7848 O "O4'" . DG  C 3 20  ? 52.287  43.298 16.430  1.00 148.44 ? 18  DG  D "O4'" 1 
ATOM   7849 C "C3'" . DG  C 3 20  ? 53.923  41.886 15.526  1.00 142.94 ? 18  DG  D "C3'" 1 
ATOM   7850 O "O3'" . DG  C 3 20  ? 55.338  41.683 15.438  1.00 131.23 ? 18  DG  D "O3'" 1 
ATOM   7851 C "C2'" . DG  C 3 20  ? 53.326  41.176 16.727  1.00 145.74 ? 18  DG  D "C2'" 1 
ATOM   7852 C "C1'" . DG  C 3 20  ? 52.118  42.043 17.090  1.00 151.87 ? 18  DG  D "C1'" 1 
ATOM   7853 N N9    . DG  C 3 20  ? 50.835  41.481 16.675  1.00 153.17 ? 18  DG  D N9    1 
ATOM   7854 C C8    . DG  C 3 20  ? 50.053  41.886 15.620  1.00 152.09 ? 18  DG  D C8    1 
ATOM   7855 N N7    . DG  C 3 20  ? 48.959  41.185 15.494  1.00 150.15 ? 18  DG  D N7    1 
ATOM   7856 C C5    . DG  C 3 20  ? 49.026  40.255 16.523  1.00 148.79 ? 18  DG  D C5    1 
ATOM   7857 C C6    . DG  C 3 20  ? 48.121  39.224 16.891  1.00 150.81 ? 18  DG  D C6    1 
ATOM   7858 O O6    . DG  C 3 20  ? 47.046  38.915 16.363  1.00 160.69 ? 18  DG  D O6    1 
ATOM   7859 N N1    . DG  C 3 20  ? 48.578  38.514 17.998  1.00 149.15 ? 18  DG  D N1    1 
ATOM   7860 C C2    . DG  C 3 20  ? 49.753  38.762 18.665  1.00 146.43 ? 18  DG  D C2    1 
ATOM   7861 N N2    . DG  C 3 20  ? 50.018  37.967 19.713  1.00 146.86 ? 18  DG  D N2    1 
ATOM   7862 N N3    . DG  C 3 20  ? 50.603  39.721 18.334  1.00 145.96 ? 18  DG  D N3    1 
ATOM   7863 C C4    . DG  C 3 20  ? 50.178  40.424 17.261  1.00 148.88 ? 18  DG  D C4    1 
ATOM   7864 P P     . DT  C 3 21  ? 55.931  40.479 14.560  1.00 120.15 ? 19  DT  D P     1 
ATOM   7865 O OP1   . DT  C 3 21  ? 57.380  40.736 14.360  1.00 145.20 ? 19  DT  D OP1   1 
ATOM   7866 O OP2   . DT  C 3 21  ? 55.056  40.267 13.378  1.00 131.57 ? 19  DT  D OP2   1 
ATOM   7867 O "O5'" . DT  C 3 21  ? 55.772  39.221 15.526  1.00 140.70 ? 19  DT  D "O5'" 1 
ATOM   7868 C "C5'" . DT  C 3 21  ? 56.479  39.157 16.780  1.00 144.94 ? 19  DT  D "C5'" 1 
ATOM   7869 C "C4'" . DT  C 3 21  ? 56.034  37.957 17.585  1.00 145.42 ? 19  DT  D "C4'" 1 
ATOM   7870 O "O4'" . DT  C 3 21  ? 54.669  38.132 18.027  1.00 148.58 ? 19  DT  D "O4'" 1 
ATOM   7871 C "C3'" . DT  C 3 21  ? 56.023  36.633 16.831  1.00 147.39 ? 19  DT  D "C3'" 1 
ATOM   7872 O "O3'" . DT  C 3 21  ? 57.322  36.032 16.798  1.00 147.16 ? 19  DT  D "O3'" 1 
ATOM   7873 C "C2'" . DT  C 3 21  ? 55.036  35.815 17.641  1.00 148.31 ? 19  DT  D "C2'" 1 
ATOM   7874 C "C1'" . DT  C 3 21  ? 54.023  36.861 18.105  1.00 150.01 ? 19  DT  D "C1'" 1 
ATOM   7875 N N1    . DT  C 3 21  ? 52.797  36.917 17.280  1.00 155.79 ? 19  DT  D N1    1 
ATOM   7876 C C2    . DT  C 3 21  ? 51.760  36.068 17.600  1.00 152.94 ? 19  DT  D C2    1 
ATOM   7877 O O2    . DT  C 3 21  ? 51.803  35.283 18.534  1.00 149.79 ? 19  DT  D O2    1 
ATOM   7878 N N3    . DT  C 3 21  ? 50.662  36.174 16.782  1.00 154.03 ? 19  DT  D N3    1 
ATOM   7879 C C4    . DT  C 3 21  ? 50.502  37.022 15.702  1.00 155.19 ? 19  DT  D C4    1 
ATOM   7880 O O4    . DT  C 3 21  ? 49.455  37.004 15.059  1.00 156.30 ? 19  DT  D O4    1 
ATOM   7881 C C5    . DT  C 3 21  ? 51.632  37.881 15.421  1.00 155.19 ? 19  DT  D C5    1 
ATOM   7882 C C7    . DT  C 3 21  ? 51.553  38.832 14.269  1.00 160.70 ? 19  DT  D C7    1 
ATOM   7883 C C6    . DT  C 3 21  ? 52.708  37.783 16.212  1.00 156.18 ? 19  DT  D C6    1 
ATOM   7884 P P     . DG  C 3 22  ? 57.760  35.166 15.521  1.00 140.80 ? 20  DG  D P     1 
ATOM   7885 O OP1   . DG  C 3 22  ? 59.182  34.777 15.705  1.00 153.56 ? 20  DG  D OP1   1 
ATOM   7886 O OP2   . DG  C 3 22  ? 57.356  35.893 14.290  1.00 151.41 ? 20  DG  D OP2   1 
ATOM   7887 O "O5'" . DG  C 3 22  ? 56.859  33.857 15.642  1.00 136.94 ? 20  DG  D "O5'" 1 
ATOM   7888 C "C5'" . DG  C 3 22  ? 57.044  32.935 16.734  1.00 139.35 ? 20  DG  D "C5'" 1 
ATOM   7889 C "C4'" . DG  C 3 22  ? 55.967  31.873 16.739  1.00 143.97 ? 20  DG  D "C4'" 1 
ATOM   7890 O "O4'" . DG  C 3 22  ? 54.693  32.433 17.127  1.00 151.77 ? 20  DG  D "O4'" 1 
ATOM   7891 C "C3'" . DG  C 3 22  ? 55.683  31.206 15.401  1.00 147.04 ? 20  DG  D "C3'" 1 
ATOM   7892 O "O3'" . DG  C 3 22  ? 56.656  30.212 15.069  1.00 148.36 ? 20  DG  D "O3'" 1 
ATOM   7893 C "C2'" . DG  C 3 22  ? 54.307  30.615 15.641  1.00 153.67 ? 20  DG  D "C2'" 1 
ATOM   7894 C "C1'" . DG  C 3 22  ? 53.644  31.663 16.535  1.00 154.53 ? 20  DG  D "C1'" 1 
ATOM   7895 N N9    . DG  C 3 22  ? 52.771  32.572 15.800  1.00 149.26 ? 20  DG  D N9    1 
ATOM   7896 C C8    . DG  C 3 22  ? 53.073  33.836 15.354  1.00 143.72 ? 20  DG  D C8    1 
ATOM   7897 N N7    . DG  C 3 22  ? 52.089  34.399 14.705  1.00 136.10 ? 20  DG  D N7    1 
ATOM   7898 C C5    . DG  C 3 22  ? 51.081  33.444 14.713  1.00 140.16 ? 20  DG  D C5    1 
ATOM   7899 C C6    . DG  C 3 22  ? 49.774  33.482 14.160  1.00 149.35 ? 20  DG  D C6    1 
ATOM   7900 O O6    . DG  C 3 22  ? 49.227  34.399 13.535  1.00 150.28 ? 20  DG  D O6    1 
ATOM   7901 N N1    . DG  C 3 22  ? 49.084  32.298 14.399  1.00 151.03 ? 20  DG  D N1    1 
ATOM   7902 C C2    . DG  C 3 22  ? 49.584  31.215 15.080  1.00 157.60 ? 20  DG  D C2    1 
ATOM   7903 N N2    . DG  C 3 22  ? 48.761  30.163 15.206  1.00 158.79 ? 20  DG  D N2    1 
ATOM   7904 N N3    . DG  C 3 22  ? 50.801  31.167 15.599  1.00 153.60 ? 20  DG  D N3    1 
ATOM   7905 C C4    . DG  C 3 22  ? 51.489  32.308 15.380  1.00 147.50 ? 20  DG  D C4    1 
ATOM   7906 P P     . DG  C 3 23  ? 57.002  29.992 13.520  1.00 161.32 ? 21  DG  D P     1 
ATOM   7907 O OP1   . DG  C 3 23  ? 57.877  28.795 13.424  1.00 164.70 ? 21  DG  D OP1   1 
ATOM   7908 O OP2   . DG  C 3 23  ? 57.470  31.286 12.959  1.00 143.20 ? 21  DG  D OP2   1 
ATOM   7909 O "O5'" . DG  C 3 23  ? 55.578  29.663 12.881  1.00 160.03 ? 21  DG  D "O5'" 1 
ATOM   7910 C "C5'" . DG  C 3 23  ? 55.348  28.423 12.188  1.00 152.90 ? 21  DG  D "C5'" 1 
ATOM   7911 C "C4'" . DG  C 3 23  ? 53.883  28.050 12.199  1.00 141.33 ? 21  DG  D "C4'" 1 
ATOM   7912 O "O4'" . DG  C 3 23  ? 53.076  29.075 12.820  1.00 144.41 ? 21  DG  D "O4'" 1 
ATOM   7913 C "C3'" . DG  C 3 23  ? 53.268  27.875 10.818  1.00 140.39 ? 21  DG  D "C3'" 1 
ATOM   7914 O "O3'" . DG  C 3 23  ? 53.599  26.594 10.275  1.00 142.75 ? 21  DG  D "O3'" 1 
ATOM   7915 C "C2'" . DG  C 3 23  ? 51.787  28.039 11.105  1.00 139.79 ? 21  DG  D "C2'" 1 
ATOM   7916 C "C1'" . DG  C 3 23  ? 51.758  29.036 12.266  1.00 141.87 ? 21  DG  D "C1'" 1 
ATOM   7917 N N9    . DG  C 3 23  ? 51.391  30.395 11.875  1.00 152.12 ? 21  DG  D N9    1 
ATOM   7918 C C8    . DG  C 3 23  ? 52.183  31.517 11.945  1.00 159.06 ? 21  DG  D C8    1 
ATOM   7919 N N7    . DG  C 3 23  ? 51.582  32.595 11.521  1.00 152.00 ? 21  DG  D N7    1 
ATOM   7920 C C5    . DG  C 3 23  ? 50.318  32.161 11.147  1.00 149.74 ? 21  DG  D C5    1 
ATOM   7921 C C6    . DG  C 3 23  ? 49.217  32.883 10.613  1.00 150.08 ? 21  DG  D C6    1 
ATOM   7922 O O6    . DG  C 3 23  ? 49.140  34.090 10.353  1.00 156.08 ? 21  DG  D O6    1 
ATOM   7923 N N1    . DG  C 3 23  ? 48.126  32.052 10.378  1.00 149.09 ? 21  DG  D N1    1 
ATOM   7924 C C2    . DG  C 3 23  ? 48.094  30.701 10.626  1.00 145.37 ? 21  DG  D C2    1 
ATOM   7925 N N2    . DG  C 3 23  ? 46.945  30.074 10.333  1.00 146.47 ? 21  DG  D N2    1 
ATOM   7926 N N3    . DG  C 3 23  ? 49.111  30.017 11.125  1.00 143.22 ? 21  DG  D N3    1 
ATOM   7927 C C4    . DG  C 3 23  ? 50.183  30.805 11.361  1.00 150.07 ? 21  DG  D C4    1 
ATOM   7928 P P     . DC  C 3 24  ? 54.088  26.490 8.752   1.00 142.66 ? 22  DC  D P     1 
ATOM   7929 O OP1   . DC  C 3 24  ? 54.713  25.156 8.562   1.00 141.43 ? 22  DC  D OP1   1 
ATOM   7930 O OP2   . DC  C 3 24  ? 54.852  27.714 8.396   1.00 144.82 ? 22  DC  D OP2   1 
ATOM   7931 O "O5'" . DC  C 3 24  ? 52.707  26.514 7.958   1.00 153.97 ? 22  DC  D "O5'" 1 
ATOM   7932 C "C5'" . DC  C 3 24  ? 51.654  25.587 8.288   1.00 148.93 ? 22  DC  D "C5'" 1 
ATOM   7933 C "C4'" . DC  C 3 24  ? 50.326  26.078 7.758   1.00 143.17 ? 22  DC  D "C4'" 1 
ATOM   7934 O "O4'" . DC  C 3 24  ? 49.988  27.351 8.345   1.00 148.19 ? 22  DC  D "O4'" 1 
ATOM   7935 C "C3'" . DC  C 3 24  ? 50.284  26.328 6.256   1.00 145.41 ? 22  DC  D "C3'" 1 
ATOM   7936 O "O3'" . DC  C 3 24  ? 50.000  25.109 5.560   1.00 136.52 ? 22  DC  D "O3'" 1 
ATOM   7937 C "C2'" . DC  C 3 24  ? 49.154  27.334 6.115   1.00 148.85 ? 22  DC  D "C2'" 1 
ATOM   7938 C "C1'" . DC  C 3 24  ? 49.080  28.027 7.480   1.00 148.53 ? 22  DC  D "C1'" 1 
ATOM   7939 N N1    . DC  C 3 24  ? 49.445  29.454 7.457   1.00 147.23 ? 22  DC  D N1    1 
ATOM   7940 C C2    . DC  C 3 24  ? 48.464  30.396 7.125   1.00 147.77 ? 22  DC  D C2    1 
ATOM   7941 O O2    . DC  C 3 24  ? 47.317  30.002 6.865   1.00 144.48 ? 22  DC  D O2    1 
ATOM   7942 N N3    . DC  C 3 24  ? 48.791  31.709 7.099   1.00 150.32 ? 22  DC  D N3    1 
ATOM   7943 C C4    . DC  C 3 24  ? 50.038  32.093 7.385   1.00 153.89 ? 22  DC  D C4    1 
ATOM   7944 N N4    . DC  C 3 24  ? 50.315  33.398 7.347   1.00 153.14 ? 22  DC  D N4    1 
ATOM   7945 C C5    . DC  C 3 24  ? 51.056  31.154 7.725   1.00 154.48 ? 22  DC  D C5    1 
ATOM   7946 C C6    . DC  C 3 24  ? 50.719  29.857 7.747   1.00 149.22 ? 22  DC  D C6    1 
ATOM   7947 P P     . DC  C 3 25  ? 50.548  24.866 4.074   1.00 151.28 ? 23  DC  D P     1 
ATOM   7948 O OP1   . DC  C 3 25  ? 50.386  23.423 3.760   1.00 154.00 ? 23  DC  D OP1   1 
ATOM   7949 O OP2   . DC  C 3 25  ? 51.886  25.498 3.939   1.00 158.12 ? 23  DC  D OP2   1 
ATOM   7950 O "O5'" . DC  C 3 25  ? 49.515  25.690 3.183   1.00 152.32 ? 23  DC  D "O5'" 1 
ATOM   7951 C "C5'" . DC  C 3 25  ? 48.101  25.419 3.244   1.00 159.60 ? 23  DC  D "C5'" 1 
ATOM   7952 C "C4'" . DC  C 3 25  ? 47.334  26.396 2.382   1.00 162.24 ? 23  DC  D "C4'" 1 
ATOM   7953 O "O4'" . DC  C 3 25  ? 47.113  27.628 3.102   1.00 164.50 ? 23  DC  D "O4'" 1 
ATOM   7954 C "C3'" . DC  C 3 25  ? 48.039  26.825 1.101   1.00 161.47 ? 23  DC  D "C3'" 1 
ATOM   7955 O "O3'" . DC  C 3 25  ? 47.845  25.869 0.055   1.00 166.57 ? 23  DC  D "O3'" 1 
ATOM   7956 C "C2'" . DC  C 3 25  ? 47.364  28.148 0.792   1.00 165.40 ? 23  DC  D "C2'" 1 
ATOM   7957 C "C1'" . DC  C 3 25  ? 47.048  28.714 2.178   1.00 160.85 ? 23  DC  D "C1'" 1 
ATOM   7958 N N1    . DC  C 3 25  ? 47.985  29.758 2.630   1.00 156.38 ? 23  DC  D N1    1 
ATOM   7959 C C2    . DC  C 3 25  ? 47.593  31.098 2.547   1.00 147.71 ? 23  DC  D C2    1 
ATOM   7960 O O2    . DC  C 3 25  ? 46.464  31.367 2.108   1.00 142.64 ? 23  DC  D O2    1 
ATOM   7961 N N3    . DC  C 3 25  ? 48.451  32.065 2.950   1.00 146.26 ? 23  DC  D N3    1 
ATOM   7962 C C4    . DC  C 3 25  ? 49.658  31.734 3.415   1.00 151.01 ? 23  DC  D C4    1 
ATOM   7963 N N4    . DC  C 3 25  ? 50.471  32.720 3.803   1.00 151.61 ? 23  DC  D N4    1 
ATOM   7964 C C5    . DC  C 3 25  ? 50.085  30.377 3.506   1.00 152.49 ? 23  DC  D C5    1 
ATOM   7965 C C6    . DC  C 3 25  ? 49.226  29.430 3.104   1.00 152.00 ? 23  DC  D C6    1 
ATOM   7966 P P     . G   D 4 6   ? 48.615  43.368 1.315   1.00 180.05 ? 6   G   R P     1 
ATOM   7967 O OP1   . G   D 4 6   ? 48.773  44.656 2.037   1.00 172.81 ? 6   G   R OP1   1 
ATOM   7968 O OP2   . G   D 4 6   ? 49.816  42.559 0.986   1.00 165.65 ? 6   G   R OP2   1 
ATOM   7969 O "O5'" . G   D 4 6   ? 47.608  42.453 2.145   1.00 152.57 ? 6   G   R "O5'" 1 
ATOM   7970 C "C5'" . G   D 4 6   ? 46.219  42.813 2.277   1.00 146.42 ? 6   G   R "C5'" 1 
ATOM   7971 C "C4'" . G   D 4 6   ? 45.329  41.671 1.841   1.00 142.95 ? 6   G   R "C4'" 1 
ATOM   7972 O "O4'" . G   D 4 6   ? 46.060  40.794 0.940   1.00 144.88 ? 6   G   R "O4'" 1 
ATOM   7973 C "C3'" . G   D 4 6   ? 44.827  40.762 2.954   1.00 156.54 ? 6   G   R "C3'" 1 
ATOM   7974 O "O3'" . G   D 4 6   ? 43.639  41.274 3.550   1.00 167.66 ? 6   G   R "O3'" 1 
ATOM   7975 C "C2'" . G   D 4 6   ? 44.572  39.455 2.212   1.00 157.44 ? 6   G   R "C2'" 1 
ATOM   7976 O "O2'" . G   D 4 6   ? 43.326  39.404 1.545   1.00 159.72 ? 6   G   R "O2'" 1 
ATOM   7977 C "C1'" . G   D 4 6   ? 45.727  39.442 1.209   1.00 152.84 ? 6   G   R "C1'" 1 
ATOM   7978 N N9    . G   D 4 6   ? 46.922  38.762 1.702   1.00 161.67 ? 6   G   R N9    1 
ATOM   7979 C C8    . G   D 4 6   ? 48.094  39.347 2.118   1.00 156.01 ? 6   G   R C8    1 
ATOM   7980 N N7    . G   D 4 6   ? 48.990  38.482 2.507   1.00 156.17 ? 6   G   R N7    1 
ATOM   7981 C C5    . G   D 4 6   ? 48.373  37.249 2.340   1.00 157.19 ? 6   G   R C5    1 
ATOM   7982 C C6    . G   D 4 6   ? 48.854  35.938 2.596   1.00 152.99 ? 6   G   R C6    1 
ATOM   7983 O O6    . G   D 4 6   ? 49.957  35.593 3.036   1.00 142.25 ? 6   G   R O6    1 
ATOM   7984 N N1    . G   D 4 6   ? 47.899  34.974 2.284   1.00 140.47 ? 6   G   R N1    1 
ATOM   7985 C C2    . G   D 4 6   ? 46.644  35.235 1.791   1.00 138.06 ? 6   G   R C2    1 
ATOM   7986 N N2    . G   D 4 6   ? 45.868  34.167 1.553   1.00 136.35 ? 6   G   R N2    1 
ATOM   7987 N N3    . G   D 4 6   ? 46.184  36.452 1.548   1.00 140.41 ? 6   G   R N3    1 
ATOM   7988 C C4    . G   D 4 6   ? 47.095  37.405 1.843   1.00 154.92 ? 6   G   R C4    1 
ATOM   7989 P P     . G   D 4 7   ? 43.286  40.967 5.085   1.00 183.21 ? 7   G   R P     1 
ATOM   7990 O OP1   . G   D 4 7   ? 42.202  41.899 5.492   1.00 160.23 ? 7   G   R OP1   1 
ATOM   7991 O OP2   . G   D 4 7   ? 44.548  40.931 5.868   1.00 170.27 ? 7   G   R OP2   1 
ATOM   7992 O "O5'" . G   D 4 7   ? 42.693  39.489 5.037   1.00 163.16 ? 7   G   R "O5'" 1 
ATOM   7993 C "C5'" . G   D 4 7   ? 41.387  39.228 4.484   1.00 156.87 ? 7   G   R "C5'" 1 
ATOM   7994 C "C4'" . G   D 4 7   ? 41.193  37.748 4.251   1.00 151.64 ? 7   G   R "C4'" 1 
ATOM   7995 O "O4'" . G   D 4 7   ? 42.299  37.230 3.462   1.00 140.84 ? 7   G   R "O4'" 1 
ATOM   7996 C "C3'" . G   D 4 7   ? 41.164  36.875 5.498   1.00 152.34 ? 7   G   R "C3'" 1 
ATOM   7997 O "O3'" . G   D 4 7   ? 39.862  36.824 6.073   1.00 151.01 ? 7   G   R "O3'" 1 
ATOM   7998 C "C2'" . G   D 4 7   ? 41.593  35.518 4.951   1.00 148.01 ? 7   G   R "C2'" 1 
ATOM   7999 O "O2'" . G   D 4 7   ? 40.545  34.777 4.358   1.00 150.04 ? 7   G   R "O2'" 1 
ATOM   8000 C "C1'" . G   D 4 7   ? 42.631  35.924 3.903   1.00 142.77 ? 7   G   R "C1'" 1 
ATOM   8001 N N9    . G   D 4 7   ? 43.998  35.943 4.418   1.00 139.94 ? 7   G   R N9    1 
ATOM   8002 C C8    . G   D 4 7   ? 44.775  37.050 4.662   1.00 144.43 ? 7   G   R C8    1 
ATOM   8003 N N7    . G   D 4 7   ? 45.960  36.754 5.123   1.00 149.99 ? 7   G   R N7    1 
ATOM   8004 C C5    . G   D 4 7   ? 45.965  35.367 5.191   1.00 146.84 ? 7   G   R C5    1 
ATOM   8005 C C6    . G   D 4 7   ? 46.981  34.471 5.617   1.00 147.30 ? 7   G   R C6    1 
ATOM   8006 O O6    . G   D 4 7   ? 48.115  34.733 6.035   1.00 150.11 ? 7   G   R O6    1 
ATOM   8007 N N1    . G   D 4 7   ? 46.565  33.146 5.524   1.00 142.92 ? 7   G   R N1    1 
ATOM   8008 C C2    . G   D 4 7   ? 45.333  32.734 5.077   1.00 144.37 ? 7   G   R C2    1 
ATOM   8009 N N2    . G   D 4 7   ? 45.123  31.409 5.060   1.00 142.30 ? 7   G   R N2    1 
ATOM   8010 N N3    . G   D 4 7   ? 44.379  33.558 4.676   1.00 148.34 ? 7   G   R N3    1 
ATOM   8011 C C4    . G   D 4 7   ? 44.761  34.851 4.759   1.00 144.68 ? 7   G   R C4    1 
ATOM   8012 P P     . C   D 4 8   ? 39.673  36.683 7.659   1.00 150.05 ? 8   C   R P     1 
ATOM   8013 O OP1   . C   D 4 8   ? 38.223  36.819 7.953   1.00 144.54 ? 8   C   R OP1   1 
ATOM   8014 O OP2   . C   D 4 8   ? 40.641  37.586 8.333   1.00 148.99 ? 8   C   R OP2   1 
ATOM   8015 O "O5'" . C   D 4 8   ? 40.112  35.180 7.957   1.00 141.07 ? 8   C   R "O5'" 1 
ATOM   8016 C "C5'" . C   D 4 8   ? 39.271  34.071 7.580   1.00 143.91 ? 8   C   R "C5'" 1 
ATOM   8017 C "C4'" . C   D 4 8   ? 39.964  32.757 7.859   1.00 145.62 ? 8   C   R "C4'" 1 
ATOM   8018 O "O4'" . C   D 4 8   ? 41.237  32.718 7.163   1.00 149.15 ? 8   C   R "O4'" 1 
ATOM   8019 C "C3'" . C   D 4 8   ? 40.331  32.491 9.311   1.00 139.80 ? 8   C   R "C3'" 1 
ATOM   8020 O "O3'" . C   D 4 8   ? 39.227  31.987 10.056  1.00 146.53 ? 8   C   R "O3'" 1 
ATOM   8021 C "C2'" . C   D 4 8   ? 41.450  31.462 9.177   1.00 143.47 ? 8   C   R "C2'" 1 
ATOM   8022 O "O2'" . C   D 4 8   ? 40.995  30.131 9.033   1.00 150.20 ? 8   C   R "O2'" 1 
ATOM   8023 C "C1'" . C   D 4 8   ? 42.159  31.933 7.903   1.00 157.69 ? 8   C   R "C1'" 1 
ATOM   8024 N N1    . C   D 4 8   ? 43.363  32.743 8.166   1.00 151.07 ? 8   C   R N1    1 
ATOM   8025 C C2    . C   D 4 8   ? 44.561  32.089 8.479   1.00 152.82 ? 8   C   R C2    1 
ATOM   8026 O O2    . C   D 4 8   ? 44.576  30.849 8.521   1.00 149.80 ? 8   C   R O2    1 
ATOM   8027 N N3    . C   D 4 8   ? 45.670  32.825 8.727   1.00 151.51 ? 8   C   R N3    1 
ATOM   8028 C C4    . C   D 4 8   ? 45.613  34.158 8.672   1.00 149.88 ? 8   C   R C4    1 
ATOM   8029 N N4    . C   D 4 8   ? 46.732  34.843 8.922   1.00 154.49 ? 8   C   R N4    1 
ATOM   8030 C C5    . C   D 4 8   ? 44.406  34.848 8.356   1.00 145.63 ? 8   C   R C5    1 
ATOM   8031 C C6    . C   D 4 8   ? 43.316  34.109 8.113   1.00 150.87 ? 8   C   R C6    1 
ATOM   8032 P P     . C   D 4 9   ? 39.070  32.343 11.613  1.00 130.47 ? 9   C   R P     1 
ATOM   8033 O OP1   . C   D 4 9   ? 37.752  31.825 12.062  1.00 163.90 ? 9   C   R OP1   1 
ATOM   8034 O OP2   . C   D 4 9   ? 39.393  33.780 11.807  1.00 115.96 ? 9   C   R OP2   1 
ATOM   8035 O "O5'" . C   D 4 9   ? 40.218  31.486 12.310  1.00 124.48 ? 9   C   R "O5'" 1 
ATOM   8036 C "C5'" . C   D 4 9   ? 40.130  30.049 12.386  1.00 152.51 ? 9   C   R "C5'" 1 
ATOM   8037 C "C4'" . C   D 4 9   ? 41.301  29.479 13.153  1.00 156.43 ? 9   C   R "C4'" 1 
ATOM   8038 O "O4'" . C   D 4 9   ? 42.523  29.663 12.392  1.00 157.91 ? 9   C   R "O4'" 1 
ATOM   8039 C "C3'" . C   D 4 9   ? 41.610  30.131 14.492  1.00 153.59 ? 9   C   R "C3'" 1 
ATOM   8040 O "O3'" . C   D 4 9   ? 40.757  29.647 15.526  1.00 157.91 ? 9   C   R "O3'" 1 
ATOM   8041 C "C2'" . C   D 4 9   ? 43.068  29.738 14.711  1.00 154.92 ? 9   C   R "C2'" 1 
ATOM   8042 O "O2'" . C   D 4 9   ? 43.240  28.457 15.286  1.00 148.95 ? 9   C   R "O2'" 1 
ATOM   8043 C "C1'" . C   D 4 9   ? 43.623  29.767 13.283  1.00 158.78 ? 9   C   R "C1'" 1 
ATOM   8044 N N1    . C   D 4 9   ? 44.376  30.994 12.964  1.00 155.82 ? 9   C   R N1    1 
ATOM   8045 C C2    . C   D 4 9   ? 45.721  31.079 13.343  1.00 155.95 ? 9   C   R C2    1 
ATOM   8046 O O2    . C   D 4 9   ? 46.240  30.120 13.934  1.00 157.50 ? 9   C   R O2    1 
ATOM   8047 N N3    . C   D 4 9   ? 46.419  32.203 13.057  1.00 149.89 ? 9   C   R N3    1 
ATOM   8048 C C4    . C   D 4 9   ? 45.823  33.214 12.418  1.00 143.09 ? 9   C   R C4    1 
ATOM   8049 N N4    . C   D 4 9   ? 46.550  34.302 12.155  1.00 143.24 ? 9   C   R N4    1 
ATOM   8050 C C5    . C   D 4 9   ? 44.455  33.153 12.021  1.00 142.46 ? 9   C   R C5    1 
ATOM   8051 C C6    . C   D 4 9   ? 43.776  32.035 12.311  1.00 148.73 ? 9   C   R C6    1 
ATOM   8052 P P     . A   D 4 10  ? 40.381  30.584 16.772  1.00 140.06 ? 10  A   R P     1 
ATOM   8053 O OP1   . A   D 4 10  ? 39.261  29.938 17.503  1.00 162.32 ? 10  A   R OP1   1 
ATOM   8054 O OP2   . A   D 4 10  ? 40.230  31.983 16.294  1.00 127.51 ? 10  A   R OP2   1 
ATOM   8055 O "O5'" . A   D 4 10  ? 41.686  30.513 17.684  1.00 136.20 ? 10  A   R "O5'" 1 
ATOM   8056 C "C5'" . A   D 4 10  ? 42.047  29.296 18.367  1.00 142.32 ? 10  A   R "C5'" 1 
ATOM   8057 C "C4'" . A   D 4 10  ? 43.396  29.434 19.033  1.00 145.38 ? 10  A   R "C4'" 1 
ATOM   8058 O "O4'" . A   D 4 10  ? 44.431  29.576 18.025  1.00 148.17 ? 10  A   R "O4'" 1 
ATOM   8059 C "C3'" . A   D 4 10  ? 43.584  30.651 19.933  1.00 142.59 ? 10  A   R "C3'" 1 
ATOM   8060 O "O3'" . A   D 4 10  ? 43.044  30.434 21.233  1.00 140.50 ? 10  A   R "O3'" 1 
ATOM   8061 C "C2'" . A   D 4 10  ? 45.102  30.795 19.958  1.00 148.55 ? 10  A   R "C2'" 1 
ATOM   8062 O "O2'" . A   D 4 10  ? 45.745  29.957 20.898  1.00 155.72 ? 10  A   R "O2'" 1 
ATOM   8063 C "C1'" . A   D 4 10  ? 45.474  30.397 18.527  1.00 150.21 ? 10  A   R "C1'" 1 
ATOM   8064 N N9    . A   D 4 10  ? 45.632  31.544 17.633  1.00 150.49 ? 10  A   R N9    1 
ATOM   8065 C C8    . A   D 4 10  ? 44.734  32.019 16.708  1.00 150.42 ? 10  A   R C8    1 
ATOM   8066 N N7    . A   D 4 10  ? 45.157  33.074 16.054  1.00 141.95 ? 10  A   R N7    1 
ATOM   8067 C C5    . A   D 4 10  ? 46.416  33.314 16.586  1.00 144.30 ? 10  A   R C5    1 
ATOM   8068 C C6    . A   D 4 10  ? 47.386  34.296 16.317  1.00 144.67 ? 10  A   R C6    1 
ATOM   8069 N N6    . A   D 4 10  ? 47.232  35.259 15.405  1.00 142.96 ? 10  A   R N6    1 
ATOM   8070 N N1    . A   D 4 10  ? 48.535  34.255 17.027  1.00 145.74 ? 10  A   R N1    1 
ATOM   8071 C C2    . A   D 4 10  ? 48.690  33.287 17.940  1.00 146.26 ? 10  A   R C2    1 
ATOM   8072 N N3    . A   D 4 10  ? 47.852  32.311 18.284  1.00 150.91 ? 10  A   R N3    1 
ATOM   8073 C C4    . A   D 4 10  ? 46.721  32.380 17.561  1.00 149.50 ? 10  A   R C4    1 
ATOM   8074 P P     . C   D 4 11  ? 42.367  31.642 22.041  1.00 139.26 ? 11  C   R P     1 
ATOM   8075 O OP1   . C   D 4 11  ? 41.695  31.066 23.235  1.00 152.16 ? 11  C   R OP1   1 
ATOM   8076 O OP2   . C   D 4 11  ? 41.581  32.472 21.092  1.00 147.78 ? 11  C   R OP2   1 
ATOM   8077 O "O5'" . C   D 4 11  ? 43.619  32.500 22.528  1.00 131.04 ? 11  C   R "O5'" 1 
ATOM   8078 C "C5'" . C   D 4 11  ? 44.484  32.021 23.577  1.00 141.14 ? 11  C   R "C5'" 1 
ATOM   8079 C "C4'" . C   D 4 11  ? 45.795  32.773 23.575  1.00 149.20 ? 11  C   R "C4'" 1 
ATOM   8080 O "O4'" . C   D 4 11  ? 46.346  32.795 22.233  1.00 147.74 ? 11  C   R "O4'" 1 
ATOM   8081 C "C3'" . C   D 4 11  ? 45.725  34.240 23.967  1.00 151.67 ? 11  C   R "C3'" 1 
ATOM   8082 O "O3'" . C   D 4 11  ? 45.717  34.404 25.382  1.00 155.86 ? 11  C   R "O3'" 1 
ATOM   8083 C "C2'" . C   D 4 11  ? 47.000  34.801 23.341  1.00 151.76 ? 11  C   R "C2'" 1 
ATOM   8084 O "O2'" . C   D 4 11  ? 48.154  34.642 24.142  1.00 150.10 ? 11  C   R "O2'" 1 
ATOM   8085 C "C1'" . C   D 4 11  ? 47.113  33.975 22.056  1.00 151.11 ? 11  C   R "C1'" 1 
ATOM   8086 N N1    . C   D 4 11  ? 46.626  34.680 20.855  1.00 147.56 ? 11  C   R N1    1 
ATOM   8087 C C2    . C   D 4 11  ? 47.465  35.612 20.233  1.00 150.75 ? 11  C   R C2    1 
ATOM   8088 O O2    . C   D 4 11  ? 48.594  35.814 20.707  1.00 159.51 ? 11  C   R O2    1 
ATOM   8089 N N3    . C   D 4 11  ? 47.026  36.265 19.132  1.00 152.79 ? 11  C   R N3    1 
ATOM   8090 C C4    . C   D 4 11  ? 45.804  36.019 18.653  1.00 147.16 ? 11  C   R C4    1 
ATOM   8091 N N4    . C   D 4 11  ? 45.412  36.686 17.564  1.00 148.03 ? 11  C   R N4    1 
ATOM   8092 C C5    . C   D 4 11  ? 44.929  35.075 19.267  1.00 137.94 ? 11  C   R C5    1 
ATOM   8093 C C6    . C   D 4 11  ? 45.376  34.435 20.356  1.00 138.59 ? 11  C   R C6    1 
ATOM   8094 P P     . A   D 4 12  ? 45.006  35.672 26.061  1.00 157.84 ? 12  A   R P     1 
ATOM   8095 O OP1   . A   D 4 12  ? 45.169  35.532 27.532  1.00 150.74 ? 12  A   R OP1   1 
ATOM   8096 O OP2   . A   D 4 12  ? 43.643  35.810 25.487  1.00 160.29 ? 12  A   R OP2   1 
ATOM   8097 O "O5'" . A   D 4 12  ? 45.878  36.906 25.552  1.00 141.44 ? 12  A   R "O5'" 1 
ATOM   8098 C "C5'" . A   D 4 12  ? 46.504  37.815 26.479  1.00 131.00 ? 12  A   R "C5'" 1 
ATOM   8099 C "C4'" . A   D 4 12  ? 47.721  38.461 25.856  1.00 137.12 ? 12  A   R "C4'" 1 
ATOM   8100 O "O4'" . A   D 4 12  ? 47.992  37.864 24.559  1.00 138.69 ? 12  A   R "O4'" 1 
ATOM   8101 C "C3'" . A   D 4 12  ? 47.605  39.959 25.587  1.00 141.07 ? 12  A   R "C3'" 1 
ATOM   8102 O "O3'" . A   D 4 12  ? 47.983  40.712 26.736  1.00 148.62 ? 12  A   R "O3'" 1 
ATOM   8103 C "C2'" . A   D 4 12  ? 48.587  40.162 24.438  1.00 140.31 ? 12  A   R "C2'" 1 
ATOM   8104 O "O2'" . A   D 4 12  ? 49.928  40.338 24.850  1.00 142.00 ? 12  A   R "O2'" 1 
ATOM   8105 C "C1'" . A   D 4 12  ? 48.412  38.864 23.646  1.00 139.41 ? 12  A   R "C1'" 1 
ATOM   8106 N N9    . A   D 4 12  ? 47.417  38.958 22.576  1.00 137.73 ? 12  A   R N9    1 
ATOM   8107 C C8    . A   D 4 12  ? 46.259  38.230 22.446  1.00 147.16 ? 12  A   R C8    1 
ATOM   8108 N N7    . A   D 4 12  ? 45.561  38.533 21.379  1.00 154.77 ? 12  A   R N7    1 
ATOM   8109 C C5    . A   D 4 12  ? 46.308  39.527 20.762  1.00 150.24 ? 12  A   R C5    1 
ATOM   8110 C C6    . A   D 4 12  ? 46.108  40.269 19.584  1.00 157.27 ? 12  A   R C6    1 
ATOM   8111 N N6    . A   D 4 12  ? 45.050  40.117 18.783  1.00 161.60 ? 12  A   R N6    1 
ATOM   8112 N N1    . A   D 4 12  ? 47.044  41.186 19.252  1.00 149.66 ? 12  A   R N1    1 
ATOM   8113 C C2    . A   D 4 12  ? 48.104  41.339 20.056  1.00 140.46 ? 12  A   R C2    1 
ATOM   8114 N N3    . A   D 4 12  ? 48.405  40.701 21.186  1.00 136.31 ? 12  A   R N3    1 
ATOM   8115 C C4    . A   D 4 12  ? 47.455  39.798 21.488  1.00 142.54 ? 12  A   R C4    1 
ATOM   8116 P P     . A   D 4 13  ? 47.014  41.824 27.365  1.00 154.43 ? 13  A   R P     1 
ATOM   8117 O OP1   . A   D 4 13  ? 47.288  41.886 28.824  1.00 154.51 ? 13  A   R OP1   1 
ATOM   8118 O OP2   . A   D 4 13  ? 45.626  41.582 26.893  1.00 153.68 ? 13  A   R OP2   1 
ATOM   8119 O "O5'" . A   D 4 13  ? 47.523  43.176 26.692  1.00 150.30 ? 13  A   R "O5'" 1 
ATOM   8120 C "C5'" . A   D 4 13  ? 48.753  43.803 27.108  1.00 134.56 ? 13  A   R "C5'" 1 
ATOM   8121 C "C4'" . A   D 4 13  ? 49.307  44.674 26.005  1.00 139.29 ? 13  A   R "C4'" 1 
ATOM   8122 O "O4'" . A   D 4 13  ? 49.394  43.901 24.777  1.00 133.63 ? 13  A   R "O4'" 1 
ATOM   8123 C "C3'" . A   D 4 13  ? 48.476  45.904 25.644  1.00 140.99 ? 13  A   R "C3'" 1 
ATOM   8124 O "O3'" . A   D 4 13  ? 48.820  47.026 26.452  1.00 138.23 ? 13  A   R "O3'" 1 
ATOM   8125 C "C2'" . A   D 4 13  ? 48.817  46.127 24.188  1.00 143.59 ? 13  A   R "C2'" 1 
ATOM   8126 O "O2'" . A   D 4 13  ? 50.012  46.859 23.997  1.00 148.90 ? 13  A   R "O2'" 1 
ATOM   8127 C "C1'" . A   D 4 13  ? 48.976  44.693 23.678  1.00 144.02 ? 13  A   R "C1'" 1 
ATOM   8128 N N9    . A   D 4 13  ? 47.737  44.125 23.144  1.00 149.36 ? 13  A   R N9    1 
ATOM   8129 C C8    . A   D 4 13  ? 46.987  43.100 23.667  1.00 152.02 ? 13  A   R C8    1 
ATOM   8130 N N7    . A   D 4 13  ? 45.920  42.811 22.961  1.00 158.95 ? 13  A   R N7    1 
ATOM   8131 C C5    . A   D 4 13  ? 45.968  43.708 21.903  1.00 156.19 ? 13  A   R C5    1 
ATOM   8132 C C6    . A   D 4 13  ? 45.121  43.917 20.800  1.00 147.16 ? 13  A   R C6    1 
ATOM   8133 N N6    . A   D 4 13  ? 44.013  43.209 20.573  1.00 144.01 ? 13  A   R N6    1 
ATOM   8134 N N1    . A   D 4 13  ? 45.455  44.894 19.928  1.00 147.88 ? 13  A   R N1    1 
ATOM   8135 C C2    . A   D 4 13  ? 46.567  45.605 20.157  1.00 152.33 ? 13  A   R C2    1 
ATOM   8136 N N3    . A   D 4 13  ? 47.444  45.501 21.154  1.00 150.70 ? 13  A   R N3    1 
ATOM   8137 C C4    . A   D 4 13  ? 47.083  44.523 22.003  1.00 151.25 ? 13  A   R C4    1 
ATOM   8138 P P     . U   D 4 14  ? 47.719  48.117 26.866  1.00 111.22 ? 14  U   R P     1 
ATOM   8139 O OP1   . U   D 4 14  ? 48.381  49.097 27.766  1.00 115.82 ? 14  U   R OP1   1 
ATOM   8140 O OP2   . U   D 4 14  ? 46.505  47.401 27.336  1.00 137.14 ? 14  U   R OP2   1 
ATOM   8141 O "O5'" . U   D 4 14  ? 47.358  48.842 25.492  1.00 125.88 ? 14  U   R "O5'" 1 
ATOM   8142 C "C5'" . U   D 4 14  ? 48.063  50.024 25.061  1.00 136.92 ? 14  U   R "C5'" 1 
ATOM   8143 C "C4'" . U   D 4 14  ? 47.725  50.356 23.626  1.00 138.86 ? 14  U   R "C4'" 1 
ATOM   8144 O "O4'" . U   D 4 14  ? 47.593  49.132 22.854  1.00 142.88 ? 14  U   R "O4'" 1 
ATOM   8145 C "C3'" . U   D 4 14  ? 46.407  51.082 23.401  1.00 146.87 ? 14  U   R "C3'" 1 
ATOM   8146 O "O3'" . U   D 4 14  ? 46.530  52.485 23.610  1.00 148.05 ? 14  U   R "O3'" 1 
ATOM   8147 C "C2'" . U   D 4 14  ? 46.104  50.750 21.944  1.00 146.43 ? 14  U   R "C2'" 1 
ATOM   8148 O "O2'" . U   D 4 14  ? 46.762  51.586 21.012  1.00 136.09 ? 14  U   R "O2'" 1 
ATOM   8149 C "C1'" . U   D 4 14  ? 46.618  49.311 21.839  1.00 148.64 ? 14  U   R "C1'" 1 
ATOM   8150 N N1    . U   D 4 14  ? 45.566  48.297 22.013  1.00 151.67 ? 14  U   R N1    1 
ATOM   8151 C C2    . U   D 4 14  ? 44.717  48.055 20.948  1.00 152.78 ? 14  U   R C2    1 
ATOM   8152 O O2    . U   D 4 14  ? 44.807  48.639 19.881  1.00 155.29 ? 14  U   R O2    1 
ATOM   8153 N N3    . U   D 4 14  ? 43.759  47.099 21.180  1.00 146.51 ? 14  U   R N3    1 
ATOM   8154 C C4    . U   D 4 14  ? 43.561  46.376 22.338  1.00 135.43 ? 14  U   R C4    1 
ATOM   8155 O O4    . U   D 4 14  ? 42.651  45.548 22.388  1.00 136.94 ? 14  U   R O4    1 
ATOM   8156 C C5    . U   D 4 14  ? 44.479  46.684 23.393  1.00 135.67 ? 14  U   R C5    1 
ATOM   8157 C C6    . U   D 4 14  ? 45.426  47.610 23.200  1.00 145.65 ? 14  U   R C6    1 
ATOM   8158 P P     . A   D 4 15  ? 45.285  53.350 24.137  1.00 145.89 ? 15  A   R P     1 
ATOM   8159 O OP1   . A   D 4 15  ? 45.805  54.695 24.497  1.00 136.91 ? 15  A   R OP1   1 
ATOM   8160 O OP2   . A   D 4 15  ? 44.551  52.556 25.155  1.00 148.58 ? 15  A   R OP2   1 
ATOM   8161 O "O5'" . A   D 4 15  ? 44.353  53.478 22.849  1.00 146.75 ? 15  A   R "O5'" 1 
ATOM   8162 C "C5'" . A   D 4 15  ? 44.062  54.762 22.260  1.00 146.18 ? 15  A   R "C5'" 1 
ATOM   8163 C "C4'" . A   D 4 15  ? 43.393  54.596 20.914  1.00 152.06 ? 15  A   R "C4'" 1 
ATOM   8164 O "O4'" . A   D 4 15  ? 43.699  53.283 20.368  1.00 146.92 ? 15  A   R "O4'" 1 
ATOM   8165 C "C3'" . A   D 4 15  ? 41.868  54.673 20.915  1.00 142.29 ? 15  A   R "C3'" 1 
ATOM   8166 O "O3'" . A   D 4 15  ? 41.402  56.016 20.824  1.00 142.56 ? 15  A   R "O3'" 1 
ATOM   8167 C "C2'" . A   D 4 15  ? 41.506  53.868 19.673  1.00 139.33 ? 15  A   R "C2'" 1 
ATOM   8168 O "O2'" . A   D 4 15  ? 41.600  54.596 18.464  1.00 136.34 ? 15  A   R "O2'" 1 
ATOM   8169 C "C1'" . A   D 4 15  ? 42.554  52.753 19.719  1.00 146.14 ? 15  A   R "C1'" 1 
ATOM   8170 N N9    . A   D 4 15  ? 42.108  51.572 20.459  1.00 151.80 ? 15  A   R N9    1 
ATOM   8171 C C8    . A   D 4 15  ? 42.615  51.081 21.637  1.00 154.80 ? 15  A   R C8    1 
ATOM   8172 N N7    . A   D 4 15  ? 42.006  50.002 22.067  1.00 156.04 ? 15  A   R N7    1 
ATOM   8173 C C5    . A   D 4 15  ? 41.029  49.768 21.110  1.00 152.20 ? 15  A   R C5    1 
ATOM   8174 C C6    . A   D 4 15  ? 40.044  48.771 20.986  1.00 148.93 ? 15  A   R C6    1 
ATOM   8175 N N6    . A   D 4 15  ? 39.877  47.782 21.868  1.00 145.37 ? 15  A   R N6    1 
ATOM   8176 N N1    . A   D 4 15  ? 39.227  48.824 19.911  1.00 145.08 ? 15  A   R N1    1 
ATOM   8177 C C2    . A   D 4 15  ? 39.396  49.817 19.027  1.00 146.86 ? 15  A   R C2    1 
ATOM   8178 N N3    . A   D 4 15  ? 40.284  50.810 19.033  1.00 152.19 ? 15  A   R N3    1 
ATOM   8179 C C4    . A   D 4 15  ? 41.080  50.727 20.113  1.00 152.79 ? 15  A   R C4    1 
ATOM   8180 P P     . A   D 4 16  ? 40.032  56.459 21.534  1.00 133.84 ? 16  A   R P     1 
ATOM   8181 O OP1   . A   D 4 16  ? 39.923  57.935 21.405  1.00 147.03 ? 16  A   R OP1   1 
ATOM   8182 O OP2   . A   D 4 16  ? 39.981  55.840 22.884  1.00 129.15 ? 16  A   R OP2   1 
ATOM   8183 O "O5'" . A   D 4 16  ? 38.903  55.775 20.639  1.00 143.26 ? 16  A   R "O5'" 1 
ATOM   8184 C "C5'" . A   D 4 16  ? 38.222  56.510 19.601  1.00 147.11 ? 16  A   R "C5'" 1 
ATOM   8185 C "C4'" . A   D 4 16  ? 37.386  55.582 18.748  1.00 148.72 ? 16  A   R "C4'" 1 
ATOM   8186 O "O4'" . A   D 4 16  ? 38.000  54.265 18.708  1.00 149.31 ? 16  A   R "O4'" 1 
ATOM   8187 C "C3'" . A   D 4 16  ? 35.959  55.337 19.232  1.00 149.94 ? 16  A   R "C3'" 1 
ATOM   8188 O "O3'" . A   D 4 16  ? 35.069  56.336 18.742  1.00 155.05 ? 16  A   R "O3'" 1 
ATOM   8189 C "C2'" . A   D 4 16  ? 35.642  53.973 18.630  1.00 150.15 ? 16  A   R "C2'" 1 
ATOM   8190 O "O2'" . A   D 4 16  ? 35.208  54.020 17.285  1.00 151.52 ? 16  A   R "O2'" 1 
ATOM   8191 C "C1'" . A   D 4 16  ? 36.995  53.265 18.737  1.00 151.81 ? 16  A   R "C1'" 1 
ATOM   8192 N N9    . A   D 4 16  ? 37.156  52.485 19.966  1.00 152.13 ? 16  A   R N9    1 
ATOM   8193 C C8    . A   D 4 16  ? 38.038  52.714 20.994  1.00 152.91 ? 16  A   R C8    1 
ATOM   8194 N N7    . A   D 4 16  ? 37.952  51.842 21.969  1.00 153.92 ? 16  A   R N7    1 
ATOM   8195 C C5    . A   D 4 16  ? 36.946  50.979 21.556  1.00 151.32 ? 16  A   R C5    1 
ATOM   8196 C C6    . A   D 4 16  ? 36.377  49.837 22.149  1.00 151.58 ? 16  A   R C6    1 
ATOM   8197 N N6    . A   D 4 16  ? 36.756  49.350 23.332  1.00 148.28 ? 16  A   R N6    1 
ATOM   8198 N N1    . A   D 4 16  ? 35.391  49.205 21.474  1.00 155.09 ? 16  A   R N1    1 
ATOM   8199 C C2    . A   D 4 16  ? 35.012  49.694 20.286  1.00 153.97 ? 16  A   R C2    1 
ATOM   8200 N N3    . A   D 4 16  ? 35.470  50.757 19.627  1.00 150.59 ? 16  A   R N3    1 
ATOM   8201 C C4    . A   D 4 16  ? 36.448  51.363 20.324  1.00 151.05 ? 16  A   R C4    1 
ATOM   8202 P P     . C   D 4 17  ? 33.769  56.780 19.573  1.00 165.85 ? 17  C   R P     1 
ATOM   8203 O OP1   . C   D 4 17  ? 33.165  57.942 18.872  1.00 154.10 ? 17  C   R OP1   1 
ATOM   8204 O OP2   . C   D 4 17  ? 34.148  56.910 21.004  1.00 149.59 ? 17  C   R OP2   1 
ATOM   8205 O "O5'" . C   D 4 17  ? 32.782  55.535 19.440  1.00 164.19 ? 17  C   R "O5'" 1 
ATOM   8206 C "C5'" . C   D 4 17  ? 31.997  55.323 18.248  1.00 161.45 ? 17  C   R "C5'" 1 
ATOM   8207 C "C4'" . C   D 4 17  ? 31.247  54.013 18.332  1.00 148.34 ? 17  C   R "C4'" 1 
ATOM   8208 O "O4'" . C   D 4 17  ? 32.174  52.948 18.673  1.00 145.13 ? 17  C   R "O4'" 1 
ATOM   8209 C "C3'" . C   D 4 17  ? 30.158  53.938 19.393  1.00 149.85 ? 17  C   R "C3'" 1 
ATOM   8210 O "O3'" . C   D 4 17  ? 28.924  54.443 18.889  1.00 147.38 ? 17  C   R "O3'" 1 
ATOM   8211 C "C2'" . C   D 4 17  ? 30.072  52.441 19.676  1.00 147.08 ? 17  C   R "C2'" 1 
ATOM   8212 O "O2'" . C   D 4 17  ? 29.230  51.733 18.787  1.00 148.42 ? 17  C   R "O2'" 1 
ATOM   8213 C "C1'" . C   D 4 17  ? 31.528  51.999 19.506  1.00 146.05 ? 17  C   R "C1'" 1 
ATOM   8214 N N1    . C   D 4 17  ? 32.279  51.899 20.772  1.00 147.54 ? 17  C   R N1    1 
ATOM   8215 C C2    . C   D 4 17  ? 32.049  50.802 21.612  1.00 150.80 ? 17  C   R C2    1 
ATOM   8216 O O2    . C   D 4 17  ? 31.220  49.946 21.269  1.00 151.46 ? 17  C   R O2    1 
ATOM   8217 N N3    . C   D 4 17  ? 32.738  50.703 22.773  1.00 154.79 ? 17  C   R N3    1 
ATOM   8218 C C4    . C   D 4 17  ? 33.625  51.645 23.106  1.00 149.96 ? 17  C   R C4    1 
ATOM   8219 N N4    . C   D 4 17  ? 34.281  51.507 24.260  1.00 150.73 ? 17  C   R N4    1 
ATOM   8220 C C5    . C   D 4 17  ? 33.879  52.771 22.268  1.00 146.10 ? 17  C   R C5    1 
ATOM   8221 C C6    . C   D 4 17  ? 33.192  52.856 21.121  1.00 145.34 ? 17  C   R C6    1 
ATOM   8222 P P     . U   D 4 18  ? 27.707  54.846 19.856  1.00 143.19 ? 18  U   R P     1 
ATOM   8223 O OP1   . U   D 4 18  ? 26.819  55.762 19.097  1.00 144.02 ? 18  U   R OP1   1 
ATOM   8224 O OP2   . U   D 4 18  ? 28.253  55.278 21.169  1.00 138.78 ? 18  U   R OP2   1 
ATOM   8225 O "O5'" . U   D 4 18  ? 26.926  53.472 20.065  1.00 150.91 ? 18  U   R "O5'" 1 
ATOM   8226 C "C5'" . U   D 4 18  ? 25.747  53.408 20.893  1.00 152.31 ? 18  U   R "C5'" 1 
ATOM   8227 C "C4'" . U   D 4 18  ? 25.474  51.985 21.325  1.00 151.97 ? 18  U   R "C4'" 1 
ATOM   8228 O "O4'" . U   D 4 18  ? 26.714  51.225 21.304  1.00 149.38 ? 18  U   R "O4'" 1 
ATOM   8229 C "C3'" . U   D 4 18  ? 24.925  51.827 22.737  1.00 148.81 ? 18  U   R "C3'" 1 
ATOM   8230 O "O3'" . U   D 4 18  ? 23.503  51.897 22.745  1.00 141.43 ? 18  U   R "O3'" 1 
ATOM   8231 C "C2'" . U   D 4 18  ? 25.423  50.442 23.134  1.00 149.15 ? 18  U   R "C2'" 1 
ATOM   8232 O "O2'" . U   D 4 18  ? 24.604  49.382 22.682  1.00 165.78 ? 18  U   R "O2'" 1 
ATOM   8233 C "C1'" . U   D 4 18  ? 26.792  50.396 22.451  1.00 146.67 ? 18  U   R "C1'" 1 
ATOM   8234 N N1    . U   D 4 18  ? 27.902  50.869 23.294  1.00 144.80 ? 18  U   R N1    1 
ATOM   8235 C C2    . U   D 4 18  ? 28.295  50.074 24.357  1.00 145.02 ? 18  U   R C2    1 
ATOM   8236 O O2    . U   D 4 18  ? 27.763  49.010 24.623  1.00 145.64 ? 18  U   R O2    1 
ATOM   8237 N N3    . U   D 4 18  ? 29.337  50.577 25.097  1.00 147.71 ? 18  U   R N3    1 
ATOM   8238 C C4    . U   D 4 18  ? 30.015  51.760 24.892  1.00 145.37 ? 18  U   R C4    1 
ATOM   8239 O O4    . U   D 4 18  ? 30.934  52.072 25.651  1.00 145.35 ? 18  U   R O4    1 
ATOM   8240 C C5    . U   D 4 18  ? 29.552  52.524 23.773  1.00 148.21 ? 18  U   R C5    1 
ATOM   8241 C C6    . U   D 4 18  ? 28.538  52.063 23.030  1.00 148.16 ? 18  U   R C6    1 
ATOM   8242 P P     . A   D 4 19  ? 22.704  52.493 24.001  1.00 134.11 ? 19  A   R P     1 
ATOM   8243 O OP1   . A   D 4 19  ? 21.331  52.817 23.534  1.00 159.27 ? 19  A   R OP1   1 
ATOM   8244 O OP2   . A   D 4 19  ? 23.528  53.554 24.636  1.00 132.29 ? 19  A   R OP2   1 
ATOM   8245 O "O5'" . A   D 4 19  ? 22.635  51.257 25.006  1.00 141.76 ? 19  A   R "O5'" 1 
ATOM   8246 C "C5'" . A   D 4 19  ? 21.373  50.745 25.479  1.00 150.77 ? 19  A   R "C5'" 1 
ATOM   8247 C "C4'" . A   D 4 19  ? 21.568  49.916 26.729  1.00 149.29 ? 19  A   R "C4'" 1 
ATOM   8248 O "O4'" . A   D 4 19  ? 22.863  49.258 26.685  1.00 150.98 ? 19  A   R "O4'" 1 
ATOM   8249 C "C3'" . A   D 4 19  ? 21.562  50.689 28.045  1.00 147.65 ? 19  A   R "C3'" 1 
ATOM   8250 O "O3'" . A   D 4 19  ? 20.235  50.853 28.536  1.00 152.07 ? 19  A   R "O3'" 1 
ATOM   8251 C "C2'" . A   D 4 19  ? 22.393  49.789 28.953  1.00 144.58 ? 19  A   R "C2'" 1 
ATOM   8252 O "O2'" . A   D 4 19  ? 21.664  48.727 29.537  1.00 143.81 ? 19  A   R "O2'" 1 
ATOM   8253 C "C1'" . A   D 4 19  ? 23.443  49.252 27.979  1.00 147.57 ? 19  A   R "C1'" 1 
ATOM   8254 N N9    . A   D 4 19  ? 24.668  50.053 27.939  1.00 146.01 ? 19  A   R N9    1 
ATOM   8255 C C8    . A   D 4 19  ? 25.116  50.850 26.914  1.00 142.71 ? 19  A   R C8    1 
ATOM   8256 N N7    . A   D 4 19  ? 26.253  51.450 27.168  1.00 146.70 ? 19  A   R N7    1 
ATOM   8257 C C5    . A   D 4 19  ? 26.577  51.022 28.448  1.00 163.44 ? 19  A   R C5    1 
ATOM   8258 C C6    . A   D 4 19  ? 27.669  51.299 29.291  1.00 151.37 ? 19  A   R C6    1 
ATOM   8259 N N6    . A   D 4 19  ? 28.675  52.110 28.957  1.00 146.39 ? 19  A   R N6    1 
ATOM   8260 N N1    . A   D 4 19  ? 27.689  50.709 30.507  1.00 151.52 ? 19  A   R N1    1 
ATOM   8261 C C2    . A   D 4 19  ? 26.678  49.896 30.841  1.00 147.51 ? 19  A   R C2    1 
ATOM   8262 N N3    . A   D 4 19  ? 25.600  49.557 30.137  1.00 151.56 ? 19  A   R N3    1 
ATOM   8263 C C4    . A   D 4 19  ? 25.610  50.161 28.935  1.00 149.95 ? 19  A   R C4    1 
ATOM   8264 P P     . U   D 4 20  ? 19.811  52.168 29.350  1.00 147.78 ? 20  U   R P     1 
ATOM   8265 O OP1   . U   D 4 20  ? 18.345  52.104 29.580  1.00 169.47 ? 20  U   R OP1   1 
ATOM   8266 O OP2   . U   D 4 20  ? 20.391  53.355 28.670  1.00 133.08 ? 20  U   R OP2   1 
ATOM   8267 O "O5'" . U   D 4 20  ? 20.548  51.993 30.752  1.00 135.69 ? 20  U   R "O5'" 1 
ATOM   8268 C "C5'" . U   D 4 20  ? 20.165  50.951 31.672  1.00 146.39 ? 20  U   R "C5'" 1 
ATOM   8269 C "C4'" . U   D 4 20  ? 21.124  50.896 32.838  1.00 144.50 ? 20  U   R "C4'" 1 
ATOM   8270 O "O4'" . U   D 4 20  ? 22.461  50.602 32.355  1.00 148.30 ? 20  U   R "O4'" 1 
ATOM   8271 C "C3'" . U   D 4 20  ? 21.282  52.188 33.624  1.00 148.13 ? 20  U   R "C3'" 1 
ATOM   8272 O "O3'" . U   D 4 20  ? 20.246  52.335 34.590  1.00 153.52 ? 20  U   R "O3'" 1 
ATOM   8273 C "C2'" . U   D 4 20  ? 22.655  52.012 34.265  1.00 148.75 ? 20  U   R "C2'" 1 
ATOM   8274 O "O2'" . U   D 4 20  ? 22.640  51.263 35.465  1.00 135.20 ? 20  U   R "O2'" 1 
ATOM   8275 C "C1'" . U   D 4 20  ? 23.418  51.262 33.169  1.00 161.31 ? 20  U   R "C1'" 1 
ATOM   8276 N N1    . U   D 4 20  ? 24.242  52.132 32.314  1.00 157.60 ? 20  U   R N1    1 
ATOM   8277 C C2    . U   D 4 20  ? 25.465  52.551 32.806  1.00 154.72 ? 20  U   R C2    1 
ATOM   8278 O O2    . U   D 4 20  ? 25.884  52.232 33.906  1.00 151.08 ? 20  U   R O2    1 
ATOM   8279 N N3    . U   D 4 20  ? 26.180  53.360 31.958  1.00 152.96 ? 20  U   R N3    1 
ATOM   8280 C C4    . U   D 4 20  ? 25.812  53.785 30.698  1.00 148.60 ? 20  U   R C4    1 
ATOM   8281 O O4    . U   D 4 20  ? 26.571  54.514 30.057  1.00 136.82 ? 20  U   R O4    1 
ATOM   8282 C C5    . U   D 4 20  ? 24.535  53.309 30.260  1.00 151.74 ? 20  U   R C5    1 
ATOM   8283 C C6    . U   D 4 20  ? 23.811  52.518 31.063  1.00 154.33 ? 20  U   R C6    1 
ATOM   8284 P P     . A   D 4 21  ? 19.648  53.784 34.926  1.00 164.63 ? 21  A   R P     1 
ATOM   8285 O OP1   . A   D 4 21  ? 18.458  53.593 35.794  1.00 167.81 ? 21  A   R OP1   1 
ATOM   8286 O OP2   . A   D 4 21  ? 19.514  54.554 33.662  1.00 145.09 ? 21  A   R OP2   1 
ATOM   8287 O "O5'" . A   D 4 21  ? 20.803  54.454 35.796  1.00 160.29 ? 21  A   R "O5'" 1 
ATOM   8288 C "C5'" . A   D 4 21  ? 21.183  53.904 37.073  1.00 161.73 ? 21  A   R "C5'" 1 
ATOM   8289 C "C4'" . A   D 4 21  ? 22.391  54.622 37.628  1.00 158.28 ? 21  A   R "C4'" 1 
ATOM   8290 O "O4'" . A   D 4 21  ? 23.586  54.206 36.914  1.00 156.62 ? 21  A   R "O4'" 1 
ATOM   8291 C "C3'" . A   D 4 21  ? 22.394  56.140 37.491  1.00 152.58 ? 21  A   R "C3'" 1 
ATOM   8292 O "O3'" . A   D 4 21  ? 21.601  56.770 38.492  1.00 151.97 ? 21  A   R "O3'" 1 
ATOM   8293 C "C2'" . A   D 4 21  ? 23.880  56.458 37.616  1.00 149.59 ? 21  A   R "C2'" 1 
ATOM   8294 O "O2'" . A   D 4 21  ? 24.349  56.506 38.949  1.00 142.53 ? 21  A   R "O2'" 1 
ATOM   8295 C "C1'" . A   D 4 21  ? 24.506  55.286 36.857  1.00 151.07 ? 21  A   R "C1'" 1 
ATOM   8296 N N9    . A   D 4 21  ? 24.772  55.596 35.452  1.00 152.38 ? 21  A   R N9    1 
ATOM   8297 C C8    . A   D 4 21  ? 23.997  55.286 34.361  1.00 152.72 ? 21  A   R C8    1 
ATOM   8298 N N7    . A   D 4 21  ? 24.493  55.706 33.223  1.00 151.54 ? 21  A   R N7    1 
ATOM   8299 C C5    . A   D 4 21  ? 25.672  56.342 33.588  1.00 150.71 ? 21  A   R C5    1 
ATOM   8300 C C6    . A   D 4 21  ? 26.662  57.004 32.838  1.00 151.17 ? 21  A   R C6    1 
ATOM   8301 N N6    . A   D 4 21  ? 26.621  57.136 31.510  1.00 142.15 ? 21  A   R N6    1 
ATOM   8302 N N1    . A   D 4 21  ? 27.711  57.529 33.509  1.00 155.93 ? 21  A   R N1    1 
ATOM   8303 C C2    . A   D 4 21  ? 27.752  57.395 34.841  1.00 153.93 ? 21  A   R C2    1 
ATOM   8304 N N3    . A   D 4 21  ? 26.884  56.797 35.656  1.00 150.77 ? 21  A   R N3    1 
ATOM   8305 C C4    . A   D 4 21  ? 25.855  56.285 34.958  1.00 150.12 ? 21  A   R C4    1 
ATOM   8306 P P     . G   D 4 22  ? 20.832  58.135 38.148  1.00 152.85 ? 22  G   R P     1 
ATOM   8307 O OP1   . G   D 4 22  ? 19.854  58.392 39.237  1.00 148.87 ? 22  G   R OP1   1 
ATOM   8308 O OP2   . G   D 4 22  ? 20.361  58.087 36.739  1.00 149.83 ? 22  G   R OP2   1 
ATOM   8309 O "O5'" . G   D 4 22  ? 21.993  59.222 38.247  1.00 156.20 ? 22  G   R "O5'" 1 
ATOM   8310 C "C5'" . G   D 4 22  ? 22.671  59.460 39.495  1.00 153.38 ? 22  G   R "C5'" 1 
ATOM   8311 C "C4'" . G   D 4 22  ? 23.985  60.171 39.267  1.00 153.93 ? 22  G   R "C4'" 1 
ATOM   8312 O "O4'" . G   D 4 22  ? 24.825  59.400 38.368  1.00 153.07 ? 22  G   R "O4'" 1 
ATOM   8313 C "C3'" . G   D 4 22  ? 23.908  61.529 38.590  1.00 156.00 ? 22  G   R "C3'" 1 
ATOM   8314 O "O3'" . G   D 4 22  ? 23.488  62.561 39.475  1.00 161.05 ? 22  G   R "O3'" 1 
ATOM   8315 C "C2'" . G   D 4 22  ? 25.340  61.704 38.097  1.00 152.15 ? 22  G   R "C2'" 1 
ATOM   8316 O "O2'" . G   D 4 22  ? 26.240  62.159 39.088  1.00 140.88 ? 22  G   R "O2'" 1 
ATOM   8317 C "C1'" . G   D 4 22  ? 25.688  60.278 37.660  1.00 151.72 ? 22  G   R "C1'" 1 
ATOM   8318 N N9    . G   D 4 22  ? 25.497  60.067 36.227  1.00 153.47 ? 22  G   R N9    1 
ATOM   8319 C C8    . G   D 4 22  ? 24.481  59.371 35.617  1.00 153.72 ? 22  G   R C8    1 
ATOM   8320 N N7    . G   D 4 22  ? 24.572  59.368 34.315  1.00 153.13 ? 22  G   R N7    1 
ATOM   8321 C C5    . G   D 4 22  ? 25.711  60.115 34.048  1.00 150.49 ? 22  G   R C5    1 
ATOM   8322 C C6    . G   D 4 22  ? 26.317  60.458 32.810  1.00 148.04 ? 22  G   R C6    1 
ATOM   8323 O O6    . G   D 4 22  ? 25.955  60.161 31.665  1.00 137.14 ? 22  G   R O6    1 
ATOM   8324 N N1    . G   D 4 22  ? 27.460  61.230 32.997  1.00 150.42 ? 22  G   R N1    1 
ATOM   8325 C C2    . G   D 4 22  ? 27.959  61.620 34.216  1.00 149.29 ? 22  G   R C2    1 
ATOM   8326 N N2    . G   D 4 22  ? 29.075  62.363 34.189  1.00 150.27 ? 22  G   R N2    1 
ATOM   8327 N N3    . G   D 4 22  ? 27.405  61.306 35.376  1.00 145.72 ? 22  G   R N3    1 
ATOM   8328 C C4    . G   D 4 22  ? 26.293  60.556 35.218  1.00 151.09 ? 22  G   R C4    1 
ATOM   8329 P P     . G   D 4 23  ? 22.606  63.772 38.901  1.00 173.77 ? 23  G   R P     1 
ATOM   8330 O OP1   . G   D 4 23  ? 22.113  64.562 40.059  1.00 179.17 ? 23  G   R OP1   1 
ATOM   8331 O OP2   . G   D 4 23  ? 21.631  63.236 37.915  1.00 153.07 ? 23  G   R OP2   1 
ATOM   8332 O "O5'" . G   D 4 23  ? 23.678  64.650 38.114  1.00 161.05 ? 23  G   R "O5'" 1 
ATOM   8333 C "C5'" . G   D 4 23  ? 24.791  65.243 38.809  1.00 155.54 ? 23  G   R "C5'" 1 
ATOM   8334 C "C4'" . G   D 4 23  ? 25.845  65.719 37.836  1.00 153.17 ? 23  G   R "C4'" 1 
ATOM   8335 O "O4'" . G   D 4 23  ? 26.227  64.650 36.935  1.00 155.89 ? 23  G   R "O4'" 1 
ATOM   8336 C "C3'" . G   D 4 23  ? 25.432  66.828 36.886  1.00 153.53 ? 23  G   R "C3'" 1 
ATOM   8337 O "O3'" . G   D 4 23  ? 25.410  68.095 37.534  1.00 158.33 ? 23  G   R "O3'" 1 
ATOM   8338 C "C2'" . G   D 4 23  ? 26.503  66.726 35.802  1.00 154.63 ? 23  G   R "C2'" 1 
ATOM   8339 O "O2'" . G   D 4 23  ? 27.699  67.415 36.107  1.00 151.03 ? 23  G   R "O2'" 1 
ATOM   8340 C "C1'" . G   D 4 23  ? 26.747  65.213 35.741  1.00 155.35 ? 23  G   R "C1'" 1 
ATOM   8341 N N9    . G   D 4 23  ? 26.103  64.571 34.598  1.00 155.04 ? 23  G   R N9    1 
ATOM   8342 C C8    . G   D 4 23  ? 25.051  63.686 34.625  1.00 151.72 ? 23  G   R C8    1 
ATOM   8343 N N7    . G   D 4 23  ? 24.689  63.285 33.436  1.00 153.57 ? 23  G   R N7    1 
ATOM   8344 C C5    . G   D 4 23  ? 25.552  63.945 32.572  1.00 153.20 ? 23  G   R C5    1 
ATOM   8345 C C6    . G   D 4 23  ? 25.642  63.908 31.155  1.00 150.89 ? 23  G   R C6    1 
ATOM   8346 O O6    . G   D 4 23  ? 24.955  63.262 30.355  1.00 151.98 ? 23  G   R O6    1 
ATOM   8347 N N1    . G   D 4 23  ? 26.661  64.732 30.686  1.00 150.08 ? 23  G   R N1    1 
ATOM   8348 C C2    . G   D 4 23  ? 27.487  65.495 31.476  1.00 147.82 ? 23  G   R C2    1 
ATOM   8349 N N2    . G   D 4 23  ? 28.411  66.224 30.834  1.00 144.86 ? 23  G   R N2    1 
ATOM   8350 N N3    . G   D 4 23  ? 27.414  65.537 32.796  1.00 150.98 ? 23  G   R N3    1 
ATOM   8351 C C4    . G   D 4 23  ? 26.431  64.743 33.274  1.00 151.09 ? 23  G   R C4    1 
ATOM   8352 P P     . C   D 4 24  ? 24.312  69.185 37.114  1.00 173.51 ? 24  C   R P     1 
ATOM   8353 O OP1   . C   D 4 24  ? 24.237  70.196 38.200  1.00 169.71 ? 24  C   R OP1   1 
ATOM   8354 O OP2   . C   D 4 24  ? 23.074  68.489 36.676  1.00 165.70 ? 24  C   R OP2   1 
ATOM   8355 O "O5'" . C   D 4 24  ? 24.979  69.864 35.836  1.00 168.65 ? 24  C   R "O5'" 1 
ATOM   8356 C "C5'" . C   D 4 24  ? 26.216  70.593 35.953  1.00 162.61 ? 24  C   R "C5'" 1 
ATOM   8357 C "C4'" . C   D 4 24  ? 26.836  70.816 34.593  1.00 162.59 ? 24  C   R "C4'" 1 
ATOM   8358 O "O4'" . C   D 4 24  ? 27.034  69.544 33.925  1.00 161.81 ? 24  C   R "O4'" 1 
ATOM   8359 C "C3'" . C   D 4 24  ? 26.008  71.618 33.602  1.00 162.85 ? 24  C   R "C3'" 1 
ATOM   8360 O "O3'" . C   D 4 24  ? 26.123  73.018 33.837  1.00 159.90 ? 24  C   R "O3'" 1 
ATOM   8361 C "C2'" . C   D 4 24  ? 26.622  71.205 32.268  1.00 160.68 ? 24  C   R "C2'" 1 
ATOM   8362 O "O2'" . C   D 4 24  ? 27.780  71.934 31.915  1.00 153.61 ? 24  C   R "O2'" 1 
ATOM   8363 C "C1'" . C   D 4 24  ? 26.970  69.734 32.521  1.00 161.04 ? 24  C   R "C1'" 1 
ATOM   8364 N N1    . C   D 4 24  ? 25.984  68.790 31.962  1.00 158.64 ? 24  C   R N1    1 
ATOM   8365 C C2    . C   D 4 24  ? 25.960  68.578 30.578  1.00 154.20 ? 24  C   R C2    1 
ATOM   8366 O O2    . C   D 4 24  ? 26.770  69.187 29.862  1.00 154.62 ? 24  C   R O2    1 
ATOM   8367 N N3    . C   D 4 24  ? 25.058  67.714 30.057  1.00 156.58 ? 24  C   R N3    1 
ATOM   8368 C C4    . C   D 4 24  ? 24.204  67.076 30.862  1.00 151.21 ? 24  C   R C4    1 
ATOM   8369 N N4    . C   D 4 24  ? 23.331  66.232 30.305  1.00 147.15 ? 24  C   R N4    1 
ATOM   8370 C C5    . C   D 4 24  ? 24.207  67.274 32.274  1.00 150.21 ? 24  C   R C5    1 
ATOM   8371 C C6    . C   D 4 24  ? 25.105  68.132 32.776  1.00 155.80 ? 24  C   R C6    1 
ATOM   8372 P P     . A   D 4 25  ? 24.889  73.997 33.537  1.00 186.20 ? 25  A   R P     1 
ATOM   8373 O OP1   . A   D 4 25  ? 25.241  75.341 34.063  1.00 166.09 ? 25  A   R OP1   1 
ATOM   8374 O OP2   . A   D 4 25  ? 23.636  73.341 33.993  1.00 169.82 ? 25  A   R OP2   1 
ATOM   8375 O "O5'" . A   D 4 25  ? 24.858  74.070 31.945  1.00 176.70 ? 25  A   R "O5'" 1 
ATOM   8376 C "C5'" . A   D 4 25  ? 25.932  74.691 31.210  1.00 162.15 ? 25  A   R "C5'" 1 
ATOM   8377 C "C4'" . A   D 4 25  ? 25.790  74.421 29.730  1.00 159.00 ? 25  A   R "C4'" 1 
ATOM   8378 O "O4'" . A   D 4 25  ? 25.886  72.995 29.477  1.00 158.19 ? 25  A   R "O4'" 1 
ATOM   8379 C "C3'" . A   D 4 25  ? 24.460  74.820 29.101  1.00 164.53 ? 25  A   R "C3'" 1 
ATOM   8380 O "O3'" . A   D 4 25  ? 24.430  76.210 28.791  1.00 171.19 ? 25  A   R "O3'" 1 
ATOM   8381 C "C2'" . A   D 4 25  ? 24.420  73.941 27.855  1.00 155.70 ? 25  A   R "C2'" 1 
ATOM   8382 O "O2'" . A   D 4 25  ? 25.136  74.468 26.755  1.00 150.08 ? 25  A   R "O2'" 1 
ATOM   8383 C "C1'" . A   D 4 25  ? 25.076  72.654 28.363  1.00 152.97 ? 25  A   R "C1'" 1 
ATOM   8384 N N9    . A   D 4 25  ? 24.107  71.642 28.787  1.00 154.03 ? 25  A   R N9    1 
ATOM   8385 C C8    . A   D 4 25  ? 23.716  71.335 30.067  1.00 150.98 ? 25  A   R C8    1 
ATOM   8386 N N7    . A   D 4 25  ? 22.822  70.379 30.133  1.00 150.08 ? 25  A   R N7    1 
ATOM   8387 C C5    . A   D 4 25  ? 22.605  70.033 28.806  1.00 153.91 ? 25  A   R C5    1 
ATOM   8388 C C6    . A   D 4 25  ? 21.767  69.080 28.201  1.00 153.37 ? 25  A   R C6    1 
ATOM   8389 N N6    . A   D 4 25  ? 20.956  68.267 28.882  1.00 149.02 ? 25  A   R N6    1 
ATOM   8390 N N1    . A   D 4 25  ? 21.789  68.989 26.852  1.00 150.76 ? 25  A   R N1    1 
ATOM   8391 C C2    . A   D 4 25  ? 22.602  69.806 26.169  1.00 153.69 ? 25  A   R C2    1 
ATOM   8392 N N3    . A   D 4 25  ? 23.436  70.740 26.623  1.00 156.38 ? 25  A   R N3    1 
ATOM   8393 C C4    . A   D 4 25  ? 23.390  70.804 27.966  1.00 152.56 ? 25  A   R C4    1 
ATOM   8394 P P     . U   D 4 26  ? 23.098  77.065 29.046  1.00 170.11 ? 26  U   R P     1 
ATOM   8395 O OP1   . U   D 4 26  ? 23.465  78.504 28.978  1.00 163.09 ? 26  U   R OP1   1 
ATOM   8396 O OP2   . U   D 4 26  ? 22.411  76.544 30.256  1.00 154.17 ? 26  U   R OP2   1 
ATOM   8397 O "O5'" . U   D 4 26  ? 22.204  76.711 27.775  1.00 160.98 ? 26  U   R "O5'" 1 
ATOM   8398 C "C5'" . U   D 4 26  ? 22.583  77.151 26.456  1.00 158.89 ? 26  U   R "C5'" 1 
ATOM   8399 C "C4'" . U   D 4 26  ? 21.947  76.278 25.399  1.00 159.40 ? 26  U   R "C4'" 1 
ATOM   8400 O "O4'" . U   D 4 26  ? 22.150  74.882 25.732  1.00 161.18 ? 26  U   R "O4'" 1 
ATOM   8401 C "C3'" . U   D 4 26  ? 20.429  76.351 25.236  1.00 161.23 ? 26  U   R "C3'" 1 
ATOM   8402 O "O3'" . U   D 4 26  ? 20.109  77.508 24.410  1.00 153.69 ? 26  U   R "O3'" 1 
ATOM   8403 C "C2'" . U   D 4 26  ? 20.136  75.054 24.460  1.00 157.90 ? 26  U   R "C2'" 1 
ATOM   8404 O "O2'" . U   D 4 26  ? 20.325  75.066 23.059  1.00 152.93 ? 26  U   R "O2'" 1 
ATOM   8405 C "C1'" . U   D 4 26  ? 21.133  74.100 25.130  1.00 158.43 ? 26  U   R "C1'" 1 
ATOM   8406 N N1    . U   D 4 26  ? 20.532  73.236 26.159  1.00 159.48 ? 26  U   R N1    1 
ATOM   8407 C C2    . U   D 4 26  ? 19.936  72.059 25.742  1.00 158.45 ? 26  U   R C2    1 
ATOM   8408 O O2    . U   D 4 26  ? 19.887  71.718 24.573  1.00 154.40 ? 26  U   R O2    1 
ATOM   8409 N N3    . U   D 4 26  ? 19.395  71.300 26.750  1.00 159.72 ? 26  U   R N3    1 
ATOM   8410 C C4    . U   D 4 26  ? 19.388  71.582 28.100  1.00 159.26 ? 26  U   R C4    1 
ATOM   8411 O O4    . U   D 4 26  ? 18.859  70.792 28.883  1.00 158.54 ? 26  U   R O4    1 
ATOM   8412 C C5    . U   D 4 26  ? 20.026  72.815 28.451  1.00 156.13 ? 26  U   R C5    1 
ATOM   8413 C C6    . U   D 4 26  ? 20.563  73.580 27.493  1.00 158.14 ? 26  U   R C6    1 
HETATM 8414 N N1    . NVP E 5 .   ? 54.098  15.548 24.240  1.00 136.65 ? 999 NVP A N1    1 
HETATM 8415 C CA    . NVP E 5 .   ? 52.081  14.388 25.336  1.00 144.68 ? 999 NVP A CA    1 
HETATM 8416 C CB    . NVP E 5 .   ? 53.539  14.375 25.008  1.00 148.11 ? 999 NVP A CB    1 
HETATM 8417 C CC    . NVP E 5 .   ? 52.601  13.469 24.277  1.00 151.94 ? 999 NVP A CC    1 
HETATM 8418 N N3    . NVP E 5 .   ? 52.121  16.274 22.742  1.00 137.33 ? 999 NVP A N3    1 
HETATM 8419 C C4    . NVP E 5 .   ? 51.545  16.892 21.677  1.00 148.59 ? 999 NVP A C4    1 
HETATM 8420 C C5    . NVP E 5 .   ? 52.351  17.598 20.752  1.00 150.58 ? 999 NVP A C5    1 
HETATM 8421 C C6    . NVP E 5 .   ? 53.741  17.672 20.950  1.00 139.16 ? 999 NVP A C6    1 
HETATM 8422 C CD    . NVP E 5 .   ? 54.579  18.420 19.962  1.00 142.43 ? 999 NVP A CD    1 
HETATM 8423 C C2    . NVP E 5 .   ? 53.469  16.302 22.960  1.00 133.79 ? 999 NVP A C2    1 
HETATM 8424 C C7    . NVP E 5 .   ? 54.319  17.059 22.124  1.00 131.81 ? 999 NVP A C7    1 
HETATM 8425 N N8    . NVP E 5 .   ? 55.539  16.860 22.132  1.00 137.01 ? 999 NVP A N8    1 
HETATM 8426 C C9    . NVP E 5 .   ? 56.434  16.931 23.027  1.00 151.95 ? 999 NVP A C9    1 
HETATM 8427 O OE    . NVP E 5 .   ? 57.447  17.150 22.495  1.00 161.69 ? 999 NVP A OE    1 
HETATM 8428 C C10   . NVP E 5 .   ? 56.703  16.043 23.949  1.00 152.48 ? 999 NVP A C10   1 
HETATM 8429 C C15   . NVP E 5 .   ? 55.634  15.447 24.756  1.00 152.64 ? 999 NVP A C15   1 
HETATM 8430 C C11   . NVP E 5 .   ? 58.045  15.973 24.430  1.00 151.89 ? 999 NVP A C11   1 
HETATM 8431 C C12   . NVP E 5 .   ? 58.300  15.247 25.625  1.00 150.37 ? 999 NVP A C12   1 
HETATM 8432 C C13   . NVP E 5 .   ? 57.218  14.625 26.345  1.00 157.16 ? 999 NVP A C13   1 
HETATM 8433 N N14   . NVP E 5 .   ? 55.932  14.757 25.885  1.00 159.53 ? 999 NVP A N14   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  ?   ?   ?   A . n 
A 1 63  ILE 63  63  ?   ?   ?   A . n 
A 1 64  LYS 64  64  ?   ?   ?   A . n 
A 1 65  LYS 65  65  ?   ?   ?   A . n 
A 1 66  LYS 66  66  ?   ?   ?   A . n 
A 1 67  ASP 67  67  ?   ?   ?   A . n 
A 1 68  GLY 68  68  ?   ?   ?   A . n 
A 1 69  THR 69  69  ?   ?   ?   A . n 
A 1 70  LYS 70  70  ?   ?   ?   A . n 
A 1 71  TRP 71  71  ?   ?   ?   A . n 
A 1 72  ARG 72  72  ?   ?   ?   A . n 
A 1 73  LYS 73  73  ?   ?   ?   A . n 
A 1 74  LEU 74  74  ?   ?   ?   A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 HIS 235 235 235 HIS HIS A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 TRP 239 239 239 TRP TRP A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 TRP 252 252 252 TRP TRP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 GLN 258 258 258 GLN GLN A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 CYS 280 280 280 CYS CYS A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 MET 357 357 357 MET MET A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 HIS 361 361 361 HIS HIS A . n 
A 1 362 THR 362 362 362 THR THR A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 TRP 383 383 383 TRP TRP A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 PHE 389 389 389 PHE PHE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 TRP 402 402 402 TRP TRP A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 TRP 406 406 406 TRP TRP A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 GLU 413 413 413 GLU GLU A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 PHE 416 416 416 PHE PHE A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TYR 427 427 427 TYR TYR A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 ILE 434 434 434 ILE ILE A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 GLU 438 438 438 GLU GLU A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 SER 447 447 447 SER SER A . n 
A 1 448 ARG 448 448 448 ARG ARG A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ASN 460 460 460 ASN ASN A . n 
A 1 461 LYS 461 461 461 LYS LYS A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 GLN 464 464 464 GLN GLN A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 GLN 475 475 475 GLN GLN A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 GLU 478 478 478 GLU GLU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 HIS 483 483 483 HIS HIS A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLN 487 487 487 GLN GLN A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 ILE 495 495 495 ILE ILE A . n 
A 1 496 VAL 496 496 496 VAL VAL A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 ASN 498 498 498 ASN ASN A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 TYR 501 501 501 TYR TYR A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 PRO 510 510 510 PRO PRO A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 SER 513 513 513 SER SER A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 GLN 520 520 520 GLN GLN A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 ILE 522 522 522 ILE ILE A . n 
A 1 523 GLU 523 523 523 GLU GLU A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 TRP 535 535 535 TRP TRP A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 LYS 540 540 540 LYS LYS A . n 
A 1 541 GLY 541 541 541 GLY GLY A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASN 545 545 545 ASN ASN A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 ASP 549 549 549 ASP ASP A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 VAL 552 552 552 VAL VAL A . n 
A 1 553 SER 553 553 553 SER SER A . n 
A 1 554 ALA 554 554 554 ALA ALA A . n 
A 1 555 GLY 555 555 555 GLY GLY A . n 
A 1 556 ILE 556 556 556 ILE ILE A . n 
A 1 557 ARG 557 557 ?   ?   ?   A . n 
A 1 558 LYS 558 558 ?   ?   ?   A . n 
A 1 559 ILE 559 559 ?   ?   ?   A . n 
A 1 560 LEU 560 560 ?   ?   ?   A . n 
B 2 1   MET 1   -13 ?   ?   ?   B . n 
B 2 2   ARG 2   -12 ?   ?   ?   B . n 
B 2 3   GLY 3   -11 ?   ?   ?   B . n 
B 2 4   SER 4   -10 ?   ?   ?   B . n 
B 2 5   HIS 5   -9  ?   ?   ?   B . n 
B 2 6   HIS 6   -8  ?   ?   ?   B . n 
B 2 7   HIS 7   -7  ?   ?   ?   B . n 
B 2 8   HIS 8   -6  ?   ?   ?   B . n 
B 2 9   HIS 9   -5  ?   ?   ?   B . n 
B 2 10  HIS 10  -4  ?   ?   ?   B . n 
B 2 11  GLY 11  -3  ?   ?   ?   B . n 
B 2 12  SER 12  -2  ?   ?   ?   B . n 
B 2 13  GLN 13  -1  ?   ?   ?   B . n 
B 2 14  LEU 14  0   ?   ?   ?   B . n 
B 2 15  PRO 15  1   ?   ?   ?   B . n 
B 2 16  ILE 16  2   ?   ?   ?   B . n 
B 2 17  SER 17  3   ?   ?   ?   B . n 
B 2 18  PRO 18  4   ?   ?   ?   B . n 
B 2 19  ILE 19  5   ?   ?   ?   B . n 
B 2 20  GLU 20  6   ?   ?   ?   B . n 
B 2 21  THR 21  7   7   THR THR B . n 
B 2 22  VAL 22  8   8   VAL VAL B . n 
B 2 23  PRO 23  9   9   PRO PRO B . n 
B 2 24  VAL 24  10  10  VAL VAL B . n 
B 2 25  LYS 25  11  11  LYS LYS B . n 
B 2 26  LEU 26  12  12  LEU LEU B . n 
B 2 27  LYS 27  13  13  LYS LYS B . n 
B 2 28  PRO 28  14  14  PRO PRO B . n 
B 2 29  GLY 29  15  15  GLY GLY B . n 
B 2 30  MET 30  16  16  MET MET B . n 
B 2 31  ASP 31  17  17  ASP ASP B . n 
B 2 32  GLY 32  18  18  GLY GLY B . n 
B 2 33  PRO 33  19  19  PRO PRO B . n 
B 2 34  LYS 34  20  20  LYS LYS B . n 
B 2 35  VAL 35  21  21  VAL VAL B . n 
B 2 36  LYS 36  22  22  LYS LYS B . n 
B 2 37  GLN 37  23  23  GLN GLN B . n 
B 2 38  TRP 38  24  24  TRP TRP B . n 
B 2 39  PRO 39  25  25  PRO PRO B . n 
B 2 40  LEU 40  26  26  LEU LEU B . n 
B 2 41  THR 41  27  27  THR THR B . n 
B 2 42  GLU 42  28  28  GLU GLU B . n 
B 2 43  GLU 43  29  29  GLU GLU B . n 
B 2 44  LYS 44  30  30  LYS LYS B . n 
B 2 45  ILE 45  31  31  ILE ILE B . n 
B 2 46  LYS 46  32  32  LYS LYS B . n 
B 2 47  ALA 47  33  33  ALA ALA B . n 
B 2 48  LEU 48  34  34  LEU LEU B . n 
B 2 49  VAL 49  35  35  VAL VAL B . n 
B 2 50  GLU 50  36  36  GLU GLU B . n 
B 2 51  ILE 51  37  37  ILE ILE B . n 
B 2 52  CYS 52  38  38  CYS CYS B . n 
B 2 53  THR 53  39  39  THR THR B . n 
B 2 54  GLU 54  40  40  GLU GLU B . n 
B 2 55  MET 55  41  41  MET MET B . n 
B 2 56  GLU 56  42  42  GLU GLU B . n 
B 2 57  LYS 57  43  43  LYS LYS B . n 
B 2 58  GLU 58  44  44  GLU GLU B . n 
B 2 59  GLY 59  45  45  GLY GLY B . n 
B 2 60  LYS 60  46  46  LYS LYS B . n 
B 2 61  ILE 61  47  47  ILE ILE B . n 
B 2 62  SER 62  48  48  SER SER B . n 
B 2 63  LYS 63  49  49  LYS LYS B . n 
B 2 64  ILE 64  50  50  ILE ILE B . n 
B 2 65  GLY 65  51  51  GLY GLY B . n 
B 2 66  PRO 66  52  52  PRO PRO B . n 
B 2 67  GLU 67  53  53  GLU GLU B . n 
B 2 68  ASN 68  54  54  ASN ASN B . n 
B 2 69  PRO 69  55  55  PRO PRO B . n 
B 2 70  TYR 70  56  56  TYR TYR B . n 
B 2 71  ASN 71  57  57  ASN ASN B . n 
B 2 72  THR 72  58  58  THR THR B . n 
B 2 73  PRO 73  59  59  PRO PRO B . n 
B 2 74  VAL 74  60  60  VAL VAL B . n 
B 2 75  PHE 75  61  61  PHE PHE B . n 
B 2 76  ALA 76  62  62  ALA ALA B . n 
B 2 77  ILE 77  63  63  ILE ILE B . n 
B 2 78  LYS 78  64  64  LYS LYS B . n 
B 2 79  LYS 79  65  65  LYS LYS B . n 
B 2 80  LYS 80  66  66  LYS LYS B . n 
B 2 81  ASP 81  67  67  ASP ASP B . n 
B 2 82  GLY 82  68  68  GLY GLY B . n 
B 2 83  THR 83  69  69  THR THR B . n 
B 2 84  LYS 84  70  70  LYS LYS B . n 
B 2 85  TRP 85  71  71  TRP TRP B . n 
B 2 86  ARG 86  72  72  ARG ARG B . n 
B 2 87  LYS 87  73  73  LYS LYS B . n 
B 2 88  LEU 88  74  74  LEU LEU B . n 
B 2 89  VAL 89  75  75  VAL VAL B . n 
B 2 90  ASP 90  76  76  ASP ASP B . n 
B 2 91  PHE 91  77  77  PHE PHE B . n 
B 2 92  ARG 92  78  78  ARG ARG B . n 
B 2 93  GLU 93  79  79  GLU GLU B . n 
B 2 94  LEU 94  80  80  LEU LEU B . n 
B 2 95  ASN 95  81  81  ASN ASN B . n 
B 2 96  LYS 96  82  82  LYS LYS B . n 
B 2 97  LYS 97  83  83  LYS LYS B . n 
B 2 98  THR 98  84  84  THR THR B . n 
B 2 99  GLN 99  85  85  GLN GLN B . n 
B 2 100 ASP 100 86  86  ASP ASP B . n 
B 2 101 PHE 101 87  87  PHE PHE B . n 
B 2 102 TRP 102 88  88  TRP TRP B . n 
B 2 103 GLU 103 89  89  GLU GLU B . n 
B 2 104 VAL 104 90  90  VAL VAL B . n 
B 2 105 GLN 105 91  91  GLN GLN B . n 
B 2 106 LEU 106 92  92  LEU LEU B . n 
B 2 107 GLY 107 93  93  GLY GLY B . n 
B 2 108 ILE 108 94  94  ILE ILE B . n 
B 2 109 PRO 109 95  95  PRO PRO B . n 
B 2 110 HIS 110 96  96  HIS HIS B . n 
B 2 111 PRO 111 97  97  PRO PRO B . n 
B 2 112 ALA 112 98  98  ALA ALA B . n 
B 2 113 GLY 113 99  99  GLY GLY B . n 
B 2 114 LEU 114 100 100 LEU LEU B . n 
B 2 115 LYS 115 101 101 LYS LYS B . n 
B 2 116 LYS 116 102 102 LYS LYS B . n 
B 2 117 LYS 117 103 103 LYS LYS B . n 
B 2 118 LYS 118 104 104 LYS LYS B . n 
B 2 119 SER 119 105 105 SER SER B . n 
B 2 120 VAL 120 106 106 VAL VAL B . n 
B 2 121 THR 121 107 107 THR THR B . n 
B 2 122 VAL 122 108 108 VAL VAL B . n 
B 2 123 LEU 123 109 109 LEU LEU B . n 
B 2 124 ASP 124 110 110 ASP ASP B . n 
B 2 125 VAL 125 111 111 VAL VAL B . n 
B 2 126 GLY 126 112 112 GLY GLY B . n 
B 2 127 ASP 127 113 113 ASP ASP B . n 
B 2 128 ALA 128 114 114 ALA ALA B . n 
B 2 129 TYR 129 115 115 TYR TYR B . n 
B 2 130 PHE 130 116 116 PHE PHE B . n 
B 2 131 SER 131 117 117 SER SER B . n 
B 2 132 VAL 132 118 118 VAL VAL B . n 
B 2 133 PRO 133 119 119 PRO PRO B . n 
B 2 134 LEU 134 120 120 LEU LEU B . n 
B 2 135 ASP 135 121 121 ASP ASP B . n 
B 2 136 GLU 136 122 122 GLU GLU B . n 
B 2 137 ASP 137 123 123 ASP ASP B . n 
B 2 138 PHE 138 124 124 PHE PHE B . n 
B 2 139 ARG 139 125 125 ARG ARG B . n 
B 2 140 LYS 140 126 126 LYS LYS B . n 
B 2 141 TYR 141 127 127 TYR TYR B . n 
B 2 142 THR 142 128 128 THR THR B . n 
B 2 143 ALA 143 129 129 ALA ALA B . n 
B 2 144 PHE 144 130 130 PHE PHE B . n 
B 2 145 THR 145 131 131 THR THR B . n 
B 2 146 ILE 146 132 132 ILE ILE B . n 
B 2 147 PRO 147 133 133 PRO PRO B . n 
B 2 148 SER 148 134 134 SER SER B . n 
B 2 149 ILE 149 135 135 ILE ILE B . n 
B 2 150 ASN 150 136 136 ASN ASN B . n 
B 2 151 ASN 151 137 137 ASN ASN B . n 
B 2 152 GLU 152 138 138 GLU GLU B . n 
B 2 153 THR 153 139 139 THR THR B . n 
B 2 154 PRO 154 140 140 PRO PRO B . n 
B 2 155 GLY 155 141 141 GLY GLY B . n 
B 2 156 ILE 156 142 142 ILE ILE B . n 
B 2 157 ARG 157 143 143 ARG ARG B . n 
B 2 158 TYR 158 144 144 TYR TYR B . n 
B 2 159 GLN 159 145 145 GLN GLN B . n 
B 2 160 TYR 160 146 146 TYR TYR B . n 
B 2 161 ASN 161 147 147 ASN ASN B . n 
B 2 162 VAL 162 148 148 VAL VAL B . n 
B 2 163 LEU 163 149 149 LEU LEU B . n 
B 2 164 PRO 164 150 150 PRO PRO B . n 
B 2 165 GLN 165 151 151 GLN GLN B . n 
B 2 166 GLY 166 152 152 GLY GLY B . n 
B 2 167 TRP 167 153 153 TRP TRP B . n 
B 2 168 LYS 168 154 154 LYS LYS B . n 
B 2 169 GLY 169 155 155 GLY GLY B . n 
B 2 170 SER 170 156 156 SER SER B . n 
B 2 171 PRO 171 157 157 PRO PRO B . n 
B 2 172 ALA 172 158 158 ALA ALA B . n 
B 2 173 ILE 173 159 159 ILE ILE B . n 
B 2 174 PHE 174 160 160 PHE PHE B . n 
B 2 175 GLN 175 161 161 GLN GLN B . n 
B 2 176 SER 176 162 162 SER SER B . n 
B 2 177 SER 177 163 163 SER SER B . n 
B 2 178 MET 178 164 164 MET MET B . n 
B 2 179 THR 179 165 165 THR THR B . n 
B 2 180 LYS 180 166 166 LYS LYS B . n 
B 2 181 ILE 181 167 167 ILE ILE B . n 
B 2 182 LEU 182 168 168 LEU LEU B . n 
B 2 183 GLU 183 169 169 GLU GLU B . n 
B 2 184 PRO 184 170 170 PRO PRO B . n 
B 2 185 PHE 185 171 171 PHE PHE B . n 
B 2 186 ARG 186 172 172 ARG ARG B . n 
B 2 187 LYS 187 173 173 LYS LYS B . n 
B 2 188 GLN 188 174 174 GLN GLN B . n 
B 2 189 ASN 189 175 175 ASN ASN B . n 
B 2 190 PRO 190 176 176 PRO PRO B . n 
B 2 191 ASP 191 177 177 ASP ASP B . n 
B 2 192 ILE 192 178 178 ILE ILE B . n 
B 2 193 VAL 193 179 179 VAL VAL B . n 
B 2 194 ILE 194 180 180 ILE ILE B . n 
B 2 195 TYR 195 181 181 TYR TYR B . n 
B 2 196 GLN 196 182 182 GLN GLN B . n 
B 2 197 TYR 197 183 183 TYR TYR B . n 
B 2 198 MET 198 184 184 MET MET B . n 
B 2 199 ASP 199 185 185 ASP ASP B . n 
B 2 200 ASP 200 186 186 ASP ASP B . n 
B 2 201 LEU 201 187 187 LEU LEU B . n 
B 2 202 TYR 202 188 188 TYR TYR B . n 
B 2 203 VAL 203 189 189 VAL VAL B . n 
B 2 204 GLY 204 190 190 GLY GLY B . n 
B 2 205 SER 205 191 191 SER SER B . n 
B 2 206 ASP 206 192 192 ASP ASP B . n 
B 2 207 LEU 207 193 193 LEU LEU B . n 
B 2 208 GLU 208 194 194 GLU GLU B . n 
B 2 209 ILE 209 195 195 ILE ILE B . n 
B 2 210 GLY 210 196 196 GLY GLY B . n 
B 2 211 GLN 211 197 197 GLN GLN B . n 
B 2 212 HIS 212 198 198 HIS HIS B . n 
B 2 213 ARG 213 199 199 ARG ARG B . n 
B 2 214 THR 214 200 200 THR THR B . n 
B 2 215 LYS 215 201 201 LYS LYS B . n 
B 2 216 ILE 216 202 202 ILE ILE B . n 
B 2 217 GLU 217 203 203 GLU GLU B . n 
B 2 218 GLU 218 204 204 GLU GLU B . n 
B 2 219 LEU 219 205 205 LEU LEU B . n 
B 2 220 ARG 220 206 206 ARG ARG B . n 
B 2 221 GLN 221 207 207 GLN GLN B . n 
B 2 222 HIS 222 208 208 HIS HIS B . n 
B 2 223 LEU 223 209 209 LEU LEU B . n 
B 2 224 LEU 224 210 210 LEU LEU B . n 
B 2 225 ARG 225 211 211 ARG ARG B . n 
B 2 226 TRP 226 212 212 TRP TRP B . n 
B 2 227 GLY 227 213 213 GLY GLY B . n 
B 2 228 LEU 228 214 214 LEU LEU B . n 
B 2 229 THR 229 215 215 THR THR B . n 
B 2 230 THR 230 216 ?   ?   ?   B . n 
B 2 231 PRO 231 217 ?   ?   ?   B . n 
B 2 232 ASP 232 218 ?   ?   ?   B . n 
B 2 233 LYS 233 219 ?   ?   ?   B . n 
B 2 234 LYS 234 220 ?   ?   ?   B . n 
B 2 235 HIS 235 221 ?   ?   ?   B . n 
B 2 236 GLN 236 222 ?   ?   ?   B . n 
B 2 237 LYS 237 223 ?   ?   ?   B . n 
B 2 238 GLU 238 224 ?   ?   ?   B . n 
B 2 239 PRO 239 225 ?   ?   ?   B . n 
B 2 240 PRO 240 226 ?   ?   ?   B . n 
B 2 241 PHE 241 227 ?   ?   ?   B . n 
B 2 242 LEU 242 228 ?   ?   ?   B . n 
B 2 243 TRP 243 229 ?   ?   ?   B . n 
B 2 244 MET 244 230 ?   ?   ?   B . n 
B 2 245 GLY 245 231 231 GLY GLY B . n 
B 2 246 TYR 246 232 232 TYR TYR B . n 
B 2 247 GLU 247 233 233 GLU GLU B . n 
B 2 248 LEU 248 234 234 LEU LEU B . n 
B 2 249 HIS 249 235 235 HIS HIS B . n 
B 2 250 PRO 250 236 236 PRO PRO B . n 
B 2 251 ASP 251 237 237 ASP ASP B . n 
B 2 252 LYS 252 238 238 LYS LYS B . n 
B 2 253 TRP 253 239 239 TRP TRP B . n 
B 2 254 THR 254 240 240 THR THR B . n 
B 2 255 VAL 255 241 241 VAL VAL B . n 
B 2 256 GLN 256 242 242 GLN GLN B . n 
B 2 257 PRO 257 243 243 PRO PRO B . n 
B 2 258 ILE 258 244 244 ILE ILE B . n 
B 2 259 VAL 259 245 245 VAL VAL B . n 
B 2 260 LEU 260 246 246 LEU LEU B . n 
B 2 261 PRO 261 247 247 PRO PRO B . n 
B 2 262 GLU 262 248 248 GLU GLU B . n 
B 2 263 LYS 263 249 249 LYS LYS B . n 
B 2 264 ASP 264 250 250 ASP ASP B . n 
B 2 265 SER 265 251 251 SER SER B . n 
B 2 266 TRP 266 252 252 TRP TRP B . n 
B 2 267 THR 267 253 253 THR THR B . n 
B 2 268 VAL 268 254 254 VAL VAL B . n 
B 2 269 ASN 269 255 255 ASN ASN B . n 
B 2 270 ASP 270 256 256 ASP ASP B . n 
B 2 271 ILE 271 257 257 ILE ILE B . n 
B 2 272 GLN 272 258 258 GLN GLN B . n 
B 2 273 LYS 273 259 259 LYS LYS B . n 
B 2 274 LEU 274 260 260 LEU LEU B . n 
B 2 275 VAL 275 261 261 VAL VAL B . n 
B 2 276 GLY 276 262 262 GLY GLY B . n 
B 2 277 LYS 277 263 263 LYS LYS B . n 
B 2 278 LEU 278 264 264 LEU LEU B . n 
B 2 279 ASN 279 265 265 ASN ASN B . n 
B 2 280 TRP 280 266 266 TRP TRP B . n 
B 2 281 ALA 281 267 267 ALA ALA B . n 
B 2 282 SER 282 268 268 SER SER B . n 
B 2 283 GLN 283 269 269 GLN GLN B . n 
B 2 284 ILE 284 270 270 ILE ILE B . n 
B 2 285 TYR 285 271 271 TYR TYR B . n 
B 2 286 PRO 286 272 272 PRO PRO B . n 
B 2 287 GLY 287 273 273 GLY GLY B . n 
B 2 288 ILE 288 274 274 ILE ILE B . n 
B 2 289 LYS 289 275 275 LYS LYS B . n 
B 2 290 VAL 290 276 276 VAL VAL B . n 
B 2 291 ARG 291 277 277 ARG ARG B . n 
B 2 292 GLN 292 278 278 GLN GLN B . n 
B 2 293 LEU 293 279 279 LEU LEU B . n 
B 2 294 CYS 294 280 280 CYS CYS B . n 
B 2 295 LYS 295 281 281 LYS LYS B . n 
B 2 296 LEU 296 282 282 LEU LEU B . n 
B 2 297 LEU 297 283 283 LEU LEU B . n 
B 2 298 ARG 298 284 284 ARG ARG B . n 
B 2 299 GLY 299 285 285 GLY GLY B . n 
B 2 300 THR 300 286 286 THR THR B . n 
B 2 301 LYS 301 287 287 LYS LYS B . n 
B 2 302 ALA 302 288 288 ALA ALA B . n 
B 2 303 LEU 303 289 289 LEU LEU B . n 
B 2 304 THR 304 290 290 THR THR B . n 
B 2 305 GLU 305 291 291 GLU GLU B . n 
B 2 306 VAL 306 292 292 VAL VAL B . n 
B 2 307 ILE 307 293 293 ILE ILE B . n 
B 2 308 PRO 308 294 294 PRO PRO B . n 
B 2 309 LEU 309 295 295 LEU LEU B . n 
B 2 310 THR 310 296 296 THR THR B . n 
B 2 311 GLU 311 297 297 GLU GLU B . n 
B 2 312 GLU 312 298 298 GLU GLU B . n 
B 2 313 ALA 313 299 299 ALA ALA B . n 
B 2 314 GLU 314 300 300 GLU GLU B . n 
B 2 315 LEU 315 301 301 LEU LEU B . n 
B 2 316 GLU 316 302 302 GLU GLU B . n 
B 2 317 LEU 317 303 303 LEU LEU B . n 
B 2 318 ALA 318 304 304 ALA ALA B . n 
B 2 319 GLU 319 305 305 GLU GLU B . n 
B 2 320 ASN 320 306 306 ASN ASN B . n 
B 2 321 ARG 321 307 307 ARG ARG B . n 
B 2 322 GLU 322 308 308 GLU GLU B . n 
B 2 323 ILE 323 309 309 ILE ILE B . n 
B 2 324 LEU 324 310 310 LEU LEU B . n 
B 2 325 LYS 325 311 311 LYS LYS B . n 
B 2 326 GLU 326 312 312 GLU GLU B . n 
B 2 327 PRO 327 313 313 PRO PRO B . n 
B 2 328 VAL 328 314 314 VAL VAL B . n 
B 2 329 HIS 329 315 315 HIS HIS B . n 
B 2 330 GLY 330 316 316 GLY GLY B . n 
B 2 331 VAL 331 317 317 VAL VAL B . n 
B 2 332 TYR 332 318 318 TYR TYR B . n 
B 2 333 TYR 333 319 319 TYR TYR B . n 
B 2 334 ASP 334 320 320 ASP ASP B . n 
B 2 335 PRO 335 321 321 PRO PRO B . n 
B 2 336 SER 336 322 322 SER SER B . n 
B 2 337 LYS 337 323 323 LYS LYS B . n 
B 2 338 ASP 338 324 324 ASP ASP B . n 
B 2 339 LEU 339 325 325 LEU LEU B . n 
B 2 340 ILE 340 326 326 ILE ILE B . n 
B 2 341 ALA 341 327 327 ALA ALA B . n 
B 2 342 GLU 342 328 328 GLU GLU B . n 
B 2 343 ILE 343 329 329 ILE ILE B . n 
B 2 344 GLN 344 330 330 GLN GLN B . n 
B 2 345 LYS 345 331 331 LYS LYS B . n 
B 2 346 GLN 346 332 332 GLN GLN B . n 
B 2 347 GLY 347 333 333 GLY GLY B . n 
B 2 348 GLN 348 334 334 GLN GLN B . n 
B 2 349 GLY 349 335 335 GLY GLY B . n 
B 2 350 GLN 350 336 336 GLN GLN B . n 
B 2 351 TRP 351 337 337 TRP TRP B . n 
B 2 352 THR 352 338 338 THR THR B . n 
B 2 353 TYR 353 339 339 TYR TYR B . n 
B 2 354 GLN 354 340 340 GLN GLN B . n 
B 2 355 ILE 355 341 341 ILE ILE B . n 
B 2 356 TYR 356 342 342 TYR TYR B . n 
B 2 357 GLN 357 343 343 GLN GLN B . n 
B 2 358 GLU 358 344 344 GLU GLU B . n 
B 2 359 PRO 359 345 345 PRO PRO B . n 
B 2 360 PHE 360 346 346 PHE PHE B . n 
B 2 361 LYS 361 347 347 LYS LYS B . n 
B 2 362 ASN 362 348 348 ASN ASN B . n 
B 2 363 LEU 363 349 349 LEU LEU B . n 
B 2 364 LYS 364 350 350 LYS LYS B . n 
B 2 365 THR 365 351 351 THR THR B . n 
B 2 366 GLY 366 352 352 GLY GLY B . n 
B 2 367 LYS 367 353 353 LYS LYS B . n 
B 2 368 TYR 368 354 354 TYR TYR B . n 
B 2 369 ALA 369 355 355 ALA ALA B . n 
B 2 370 ARG 370 356 356 ARG ARG B . n 
B 2 371 MET 371 357 357 MET MET B . n 
B 2 372 ARG 372 358 358 ARG ARG B . n 
B 2 373 GLY 373 359 359 GLY GLY B . n 
B 2 374 ALA 374 360 360 ALA ALA B . n 
B 2 375 HIS 375 361 361 HIS HIS B . n 
B 2 376 THR 376 362 362 THR THR B . n 
B 2 377 ASN 377 363 363 ASN ASN B . n 
B 2 378 ASP 378 364 364 ASP ASP B . n 
B 2 379 VAL 379 365 365 VAL VAL B . n 
B 2 380 LYS 380 366 366 LYS LYS B . n 
B 2 381 GLN 381 367 367 GLN GLN B . n 
B 2 382 LEU 382 368 368 LEU LEU B . n 
B 2 383 THR 383 369 369 THR THR B . n 
B 2 384 GLU 384 370 370 GLU GLU B . n 
B 2 385 ALA 385 371 371 ALA ALA B . n 
B 2 386 VAL 386 372 372 VAL VAL B . n 
B 2 387 GLN 387 373 373 GLN GLN B . n 
B 2 388 LYS 388 374 374 LYS LYS B . n 
B 2 389 ILE 389 375 375 ILE ILE B . n 
B 2 390 THR 390 376 376 THR THR B . n 
B 2 391 THR 391 377 377 THR THR B . n 
B 2 392 GLU 392 378 378 GLU GLU B . n 
B 2 393 SER 393 379 379 SER SER B . n 
B 2 394 ILE 394 380 380 ILE ILE B . n 
B 2 395 VAL 395 381 381 VAL VAL B . n 
B 2 396 ILE 396 382 382 ILE ILE B . n 
B 2 397 TRP 397 383 383 TRP TRP B . n 
B 2 398 GLY 398 384 384 GLY GLY B . n 
B 2 399 LYS 399 385 385 LYS LYS B . n 
B 2 400 THR 400 386 386 THR THR B . n 
B 2 401 PRO 401 387 387 PRO PRO B . n 
B 2 402 LYS 402 388 388 LYS LYS B . n 
B 2 403 PHE 403 389 389 PHE PHE B . n 
B 2 404 LYS 404 390 390 LYS LYS B . n 
B 2 405 LEU 405 391 391 LEU LEU B . n 
B 2 406 PRO 406 392 392 PRO PRO B . n 
B 2 407 ILE 407 393 393 ILE ILE B . n 
B 2 408 GLN 408 394 394 GLN GLN B . n 
B 2 409 LYS 409 395 395 LYS LYS B . n 
B 2 410 GLU 410 396 396 GLU GLU B . n 
B 2 411 THR 411 397 397 THR THR B . n 
B 2 412 TRP 412 398 398 TRP TRP B . n 
B 2 413 GLU 413 399 399 GLU GLU B . n 
B 2 414 THR 414 400 400 THR THR B . n 
B 2 415 TRP 415 401 401 TRP TRP B . n 
B 2 416 TRP 416 402 402 TRP TRP B . n 
B 2 417 THR 417 403 403 THR THR B . n 
B 2 418 GLU 418 404 404 GLU GLU B . n 
B 2 419 TYR 419 405 405 TYR TYR B . n 
B 2 420 TRP 420 406 406 TRP TRP B . n 
B 2 421 GLN 421 407 407 GLN GLN B . n 
B 2 422 ALA 422 408 408 ALA ALA B . n 
B 2 423 THR 423 409 409 THR THR B . n 
B 2 424 TRP 424 410 410 TRP TRP B . n 
B 2 425 VAL 425 411 411 VAL VAL B . n 
B 2 426 PRO 426 412 412 PRO PRO B . n 
B 2 427 GLU 427 413 413 GLU GLU B . n 
B 2 428 TRP 428 414 414 TRP TRP B . n 
B 2 429 GLU 429 415 415 GLU GLU B . n 
B 2 430 PHE 430 416 416 PHE PHE B . n 
B 2 431 VAL 431 417 417 VAL VAL B . n 
B 2 432 ASN 432 418 418 ASN ASN B . n 
B 2 433 THR 433 419 419 THR THR B . n 
B 2 434 PRO 434 420 420 PRO PRO B . n 
B 2 435 PRO 435 421 421 PRO PRO B . n 
B 2 436 LEU 436 422 422 LEU LEU B . n 
B 2 437 VAL 437 423 423 VAL VAL B . n 
B 2 438 LYS 438 424 424 LYS LYS B . n 
B 2 439 LEU 439 425 425 LEU LEU B . n 
B 2 440 TRP 440 426 426 TRP TRP B . n 
B 2 441 TYR 441 427 427 TYR TYR B . n 
B 2 442 GLN 442 428 428 GLN GLN B . n 
B 2 443 LEU 443 429 429 LEU LEU B . n 
B 2 444 GLU 444 430 430 GLU GLU B . n 
B 2 445 LYS 445 431 431 LYS LYS B . n 
B 2 446 GLU 446 432 ?   ?   ?   B . n 
B 2 447 PRO 447 433 ?   ?   ?   B . n 
B 2 448 ILE 448 434 ?   ?   ?   B . n 
B 2 449 VAL 449 435 ?   ?   ?   B . n 
B 2 450 GLY 450 436 ?   ?   ?   B . n 
B 2 451 ALA 451 437 ?   ?   ?   B . n 
B 2 452 GLU 452 438 ?   ?   ?   B . n 
B 2 453 THR 453 439 ?   ?   ?   B . n 
B 2 454 PHE 454 440 ?   ?   ?   B . n 
C 3 1   DT  1   -1  ?   ?   ?   D . n 
C 3 2   DC  2   0   ?   ?   ?   D . n 
C 3 3   DG  3   1   ?   ?   ?   D . n 
C 3 4   DT  4   2   ?   ?   ?   D . n 
C 3 5   DA  5   3   3   DA  DA  D . n 
C 3 6   DT  6   4   4   DT  DT  D . n 
C 3 7   DG  7   5   5   DG  DG  D . n 
C 3 8   DC  8   6   6   DC  DC  D . n 
C 3 9   DC  9   7   7   DC  DC  D . n 
C 3 10  DT  10  8   8   DT  DT  D . n 
C 3 11  DA  11  9   9   DA  DA  D . n 
C 3 12  DT  12  10  10  DT  DT  D . n 
C 3 13  DA  13  11  11  DA  DA  D . n 
C 3 14  DG  14  12  12  DG  DG  D . n 
C 3 15  DT  15  13  13  DT  DT  D . n 
C 3 16  DT  16  14  14  DT  DT  D . n 
C 3 17  DA  17  15  15  DA  DA  D . n 
C 3 18  DT  18  16  16  DT  DT  D . n 
C 3 19  DT  19  17  17  DT  DT  D . n 
C 3 20  DG  20  18  18  DG  DG  D . n 
C 3 21  DT  21  19  19  DT  DT  D . n 
C 3 22  DG  22  20  20  DG  DG  D . n 
C 3 23  DG  23  21  21  DG  DG  D . n 
C 3 24  DC  24  22  22  DC  DC  D . n 
C 3 25  DC  25  23  23  DC  DC  D . n 
D 4 1   A   1   1   ?   ?   ?   R . n 
D 4 2   U   2   2   ?   ?   ?   R . n 
D 4 3   G   3   3   ?   ?   ?   R . n 
D 4 4   A   4   4   ?   ?   ?   R . n 
D 4 5   N   5   5   ?   ?   ?   R . n 
D 4 6   G   6   6   6   G   G   R . n 
D 4 7   G   7   7   7   G   G   R . n 
D 4 8   C   8   8   8   C   C   R . n 
D 4 9   C   9   9   9   C   C   R . n 
D 4 10  A   10  10  10  A   A   R . n 
D 4 11  C   11  11  11  C   C   R . n 
D 4 12  A   12  12  12  A   A   R . n 
D 4 13  A   13  13  13  A   A   R . n 
D 4 14  U   14  14  14  U   U   R . n 
D 4 15  A   15  15  15  A   A   R . n 
D 4 16  A   16  16  16  A   A   R . n 
D 4 17  C   17  17  17  C   C   R . n 
D 4 18  U   18  18  18  U   U   R . n 
D 4 19  A   19  19  19  A   A   R . n 
D 4 20  U   20  20  20  U   U   R . n 
D 4 21  A   21  21  21  A   A   R . n 
D 4 22  G   22  22  22  G   G   R . n 
D 4 23  G   23  23  23  G   G   R . n 
D 4 24  C   24  24  24  C   C   R . n 
D 4 25  A   25  25  25  A   A   R . n 
D 4 26  U   26  26  26  U   U   R . n 
D 4 27  A   27  27  ?   ?   ?   R . n 
D 4 28  C   28  28  ?   ?   ?   R . n 
D 4 29  G   29  29  ?   ?   ?   R . n 
D 4 30  A   30  30  ?   ?   ?   R . n 
D 4 31  C   31  31  ?   ?   ?   R . n 
D 4 32  C   32  32  ?   ?   ?   R . n 
D 4 33  A   33  33  ?   ?   ?   R . n 
D 4 34  C   34  34  ?   ?   ?   R . n 
# 
_pdbx_nonpoly_scheme.asym_id         E 
_pdbx_nonpoly_scheme.entity_id       5 
_pdbx_nonpoly_scheme.mon_id          NVP 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     999 
_pdbx_nonpoly_scheme.auth_seq_num    999 
_pdbx_nonpoly_scheme.pdb_mon_id      NVP 
_pdbx_nonpoly_scheme.auth_mon_id     NVP 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11940 ? 
1 MORE         -69.4 ? 
1 'SSA (A^2)'  52220 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-01-16 
2 'Structure model' 1 1 2013-01-23 
3 'Structure model' 1 2 2013-02-20 
4 'Structure model' 1 3 2019-03-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Database references'      
3 4 'Structure model' 'Data collection'          
4 4 'Structure model' 'Experimental preparation' 
5 4 'Structure model' Other                      
6 4 'Structure model' 'Source and taxonomy'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_PDB_rev            
2 4 'Structure model' database_PDB_rev_record     
3 4 'Structure model' exptl_crystal_grow          
4 4 'Structure model' pdbx_database_proc          
5 4 'Structure model' pdbx_database_status        
6 4 'Structure model' pdbx_entity_src_syn         
7 4 'Structure model' pdbx_seq_map_depositor_info 
8 4 'Structure model' struct_biol                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                       
2 4 'Structure model' '_exptl_crystal_grow.temp'                         
3 4 'Structure model' '_pdbx_database_status.recvd_author_approval'      
4 4 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
PHENIX    refinement       '(PHENIX.REFINE)' ? 1 ? ? ? ? 
DENZO     'data reduction' .                 ? 2 ? ? ? ? 
SCALEPACK 'data scaling'   .                 ? 3 ? ? ? ? 
MOLREP    phasing          .                 ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             4B3Q 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;P66 MUTATIONS S68G, R83K, I411V, N477S, R461K, Y483H,
D498N, V559I
P51 MUTATIONS S68G, R83K, I411V, N-TERMINAL MRGSHHHHHHGSQL
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 2   ? ? -134.44 -34.17  
2  1 GLU A 6   ? ? 36.33   108.45  
3  1 GLU A 28  ? ? 71.67   -40.37  
4  1 MET A 184 ? ? 52.17   -86.57  
5  1 GLU A 248 ? ? -119.27 76.85   
6  1 LYS A 249 ? ? -147.96 -70.30  
7  1 THR A 253 ? ? 45.24   -158.70 
8  1 LYS A 287 ? ? 57.27   76.11   
9  1 VAL A 292 ? ? 59.13   91.33   
10 1 PHE A 346 ? ? 70.13   -37.36  
11 1 LEU A 349 ? ? -96.20  -62.05  
12 1 ASN A 363 ? ? 69.42   130.37  
13 1 THR A 450 ? ? 65.79   -14.16  
14 1 LYS A 451 ? ? 58.91   71.06   
15 1 ASP A 471 ? ? 54.11   73.94   
16 1 ASP A 488 ? ? -101.57 56.49   
17 1 ASP A 511 ? ? -153.97 83.38   
18 1 HIS A 539 ? ? 55.75   80.23   
19 1 LYS A 540 ? ? -146.86 -44.31  
20 1 THR B 69  ? ? 33.33   51.61   
21 1 GLU B 89  ? ? -132.61 -51.07  
22 1 MET B 184 ? ? 54.23   -95.26  
23 1 TRP B 239 ? ? -92.84  45.08   
24 1 ALA B 355 ? ? -78.99  -87.84  
25 1 ALA B 360 ? ? -118.59 -87.34  
26 1 TRP B 383 ? ? -109.34 -70.17  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ILE 5   ? CG1 ? A ILE 5   CG1 
2   1 Y 1 A ILE 5   ? CG2 ? A ILE 5   CG2 
3   1 Y 1 A ILE 5   ? CD1 ? A ILE 5   CD1 
4   1 Y 1 A LYS 11  ? CG  ? A LYS 11  CG  
5   1 Y 1 A LYS 11  ? CD  ? A LYS 11  CD  
6   1 Y 1 A LYS 11  ? CE  ? A LYS 11  CE  
7   1 Y 1 A LYS 11  ? NZ  ? A LYS 11  NZ  
8   1 Y 1 A LYS 20  ? CG  ? A LYS 20  CG  
9   1 Y 1 A LYS 20  ? CD  ? A LYS 20  CD  
10  1 Y 1 A LYS 20  ? CE  ? A LYS 20  CE  
11  1 Y 1 A LYS 20  ? NZ  ? A LYS 20  NZ  
12  1 Y 1 A LYS 22  ? CG  ? A LYS 22  CG  
13  1 Y 1 A LYS 22  ? CD  ? A LYS 22  CD  
14  1 Y 1 A LYS 22  ? CE  ? A LYS 22  CE  
15  1 Y 1 A LYS 22  ? NZ  ? A LYS 22  NZ  
16  1 Y 1 A TRP 24  ? CG  ? A TRP 24  CG  
17  1 Y 1 A TRP 24  ? CD1 ? A TRP 24  CD1 
18  1 Y 1 A TRP 24  ? CD2 ? A TRP 24  CD2 
19  1 Y 1 A TRP 24  ? NE1 ? A TRP 24  NE1 
20  1 Y 1 A TRP 24  ? CE2 ? A TRP 24  CE2 
21  1 Y 1 A TRP 24  ? CE3 ? A TRP 24  CE3 
22  1 Y 1 A TRP 24  ? CZ2 ? A TRP 24  CZ2 
23  1 Y 1 A TRP 24  ? CZ3 ? A TRP 24  CZ3 
24  1 Y 1 A TRP 24  ? CH2 ? A TRP 24  CH2 
25  1 Y 1 A GLU 29  ? CG  ? A GLU 29  CG  
26  1 Y 1 A GLU 29  ? CD  ? A GLU 29  CD  
27  1 Y 1 A GLU 29  ? OE1 ? A GLU 29  OE1 
28  1 Y 1 A GLU 29  ? OE2 ? A GLU 29  OE2 
29  1 Y 1 A LYS 30  ? CG  ? A LYS 30  CG  
30  1 Y 1 A LYS 30  ? CD  ? A LYS 30  CD  
31  1 Y 1 A LYS 30  ? CE  ? A LYS 30  CE  
32  1 Y 1 A LYS 30  ? NZ  ? A LYS 30  NZ  
33  1 Y 1 A LYS 32  ? CG  ? A LYS 32  CG  
34  1 Y 1 A LYS 32  ? CD  ? A LYS 32  CD  
35  1 Y 1 A LYS 32  ? CE  ? A LYS 32  CE  
36  1 Y 1 A LYS 32  ? NZ  ? A LYS 32  NZ  
37  1 Y 1 A GLU 36  ? CG  ? A GLU 36  CG  
38  1 Y 1 A GLU 36  ? CD  ? A GLU 36  CD  
39  1 Y 1 A GLU 36  ? OE1 ? A GLU 36  OE1 
40  1 Y 1 A GLU 36  ? OE2 ? A GLU 36  OE2 
41  1 Y 1 A LYS 43  ? CG  ? A LYS 43  CG  
42  1 Y 1 A LYS 43  ? CD  ? A LYS 43  CD  
43  1 Y 1 A LYS 43  ? CE  ? A LYS 43  CE  
44  1 Y 1 A LYS 43  ? NZ  ? A LYS 43  NZ  
45  1 Y 1 A LYS 46  ? CG  ? A LYS 46  CG  
46  1 Y 1 A LYS 46  ? CD  ? A LYS 46  CD  
47  1 Y 1 A LYS 46  ? CE  ? A LYS 46  CE  
48  1 Y 1 A LYS 46  ? NZ  ? A LYS 46  NZ  
49  1 Y 1 A PHE 61  ? CG  ? A PHE 61  CG  
50  1 Y 1 A PHE 61  ? CD1 ? A PHE 61  CD1 
51  1 Y 1 A PHE 61  ? CD2 ? A PHE 61  CD2 
52  1 Y 1 A PHE 61  ? CE1 ? A PHE 61  CE1 
53  1 Y 1 A PHE 61  ? CE2 ? A PHE 61  CE2 
54  1 Y 1 A PHE 61  ? CZ  ? A PHE 61  CZ  
55  1 Y 1 A ARG 78  ? CG  ? A ARG 78  CG  
56  1 Y 1 A ARG 78  ? CD  ? A ARG 78  CD  
57  1 Y 1 A ARG 78  ? NE  ? A ARG 78  NE  
58  1 Y 1 A ARG 78  ? CZ  ? A ARG 78  CZ  
59  1 Y 1 A ARG 78  ? NH1 ? A ARG 78  NH1 
60  1 Y 1 A ARG 78  ? NH2 ? A ARG 78  NH2 
61  1 Y 1 A LYS 82  ? CG  ? A LYS 82  CG  
62  1 Y 1 A LYS 82  ? CD  ? A LYS 82  CD  
63  1 Y 1 A LYS 82  ? CE  ? A LYS 82  CE  
64  1 Y 1 A LYS 82  ? NZ  ? A LYS 82  NZ  
65  1 Y 1 A LYS 83  ? CG  ? A LYS 83  CG  
66  1 Y 1 A LYS 83  ? CD  ? A LYS 83  CD  
67  1 Y 1 A LYS 83  ? CE  ? A LYS 83  CE  
68  1 Y 1 A LYS 83  ? NZ  ? A LYS 83  NZ  
69  1 Y 1 A GLN 91  ? CG  ? A GLN 91  CG  
70  1 Y 1 A GLN 91  ? CD  ? A GLN 91  CD  
71  1 Y 1 A GLN 91  ? OE1 ? A GLN 91  OE1 
72  1 Y 1 A GLN 91  ? NE2 ? A GLN 91  NE2 
73  1 Y 1 A ASN 136 ? CG  ? A ASN 136 CG  
74  1 Y 1 A ASN 136 ? OD1 ? A ASN 136 OD1 
75  1 Y 1 A ASN 136 ? ND2 ? A ASN 136 ND2 
76  1 Y 1 A ASN 137 ? CG  ? A ASN 137 CG  
77  1 Y 1 A ASN 137 ? OD1 ? A ASN 137 OD1 
78  1 Y 1 A ASN 137 ? ND2 ? A ASN 137 ND2 
79  1 Y 1 A GLU 138 ? CG  ? A GLU 138 CG  
80  1 Y 1 A GLU 138 ? CD  ? A GLU 138 CD  
81  1 Y 1 A GLU 138 ? OE1 ? A GLU 138 OE1 
82  1 Y 1 A GLU 138 ? OE2 ? A GLU 138 OE2 
83  1 Y 1 A LYS 220 ? CG  ? A LYS 220 CG  
84  1 Y 1 A LYS 220 ? CD  ? A LYS 220 CD  
85  1 Y 1 A LYS 220 ? CE  ? A LYS 220 CE  
86  1 Y 1 A LYS 220 ? NZ  ? A LYS 220 NZ  
87  1 Y 1 A LYS 249 ? CG  ? A LYS 249 CG  
88  1 Y 1 A LYS 249 ? CD  ? A LYS 249 CD  
89  1 Y 1 A LYS 249 ? CE  ? A LYS 249 CE  
90  1 Y 1 A LYS 249 ? NZ  ? A LYS 249 NZ  
91  1 Y 1 A SER 251 ? OG  ? A SER 251 OG  
92  1 Y 1 A TRP 252 ? CG  ? A TRP 252 CG  
93  1 Y 1 A TRP 252 ? CD1 ? A TRP 252 CD1 
94  1 Y 1 A TRP 252 ? CD2 ? A TRP 252 CD2 
95  1 Y 1 A TRP 252 ? NE1 ? A TRP 252 NE1 
96  1 Y 1 A TRP 252 ? CE2 ? A TRP 252 CE2 
97  1 Y 1 A TRP 252 ? CE3 ? A TRP 252 CE3 
98  1 Y 1 A TRP 252 ? CZ2 ? A TRP 252 CZ2 
99  1 Y 1 A TRP 252 ? CZ3 ? A TRP 252 CZ3 
100 1 Y 1 A TRP 252 ? CH2 ? A TRP 252 CH2 
101 1 Y 1 A GLN 258 ? CG  ? A GLN 258 CG  
102 1 Y 1 A GLN 258 ? CD  ? A GLN 258 CD  
103 1 Y 1 A GLN 258 ? OE1 ? A GLN 258 OE1 
104 1 Y 1 A GLN 258 ? NE2 ? A GLN 258 NE2 
105 1 Y 1 A ARG 284 ? CG  ? A ARG 284 CG  
106 1 Y 1 A ARG 284 ? CD  ? A ARG 284 CD  
107 1 Y 1 A ARG 284 ? NE  ? A ARG 284 NE  
108 1 Y 1 A ARG 284 ? CZ  ? A ARG 284 CZ  
109 1 Y 1 A ARG 284 ? NH1 ? A ARG 284 NH1 
110 1 Y 1 A ARG 284 ? NH2 ? A ARG 284 NH2 
111 1 Y 1 A LYS 287 ? CG  ? A LYS 287 CG  
112 1 Y 1 A LYS 287 ? CD  ? A LYS 287 CD  
113 1 Y 1 A LYS 287 ? CE  ? A LYS 287 CE  
114 1 Y 1 A LYS 287 ? NZ  ? A LYS 287 NZ  
115 1 Y 1 A GLU 415 ? CG  ? A GLU 415 CG  
116 1 Y 1 A GLU 415 ? CD  ? A GLU 415 CD  
117 1 Y 1 A GLU 415 ? OE1 ? A GLU 415 OE1 
118 1 Y 1 A GLU 415 ? OE2 ? A GLU 415 OE2 
119 1 Y 1 A LYS 424 ? CG  ? A LYS 424 CG  
120 1 Y 1 A LYS 424 ? CD  ? A LYS 424 CD  
121 1 Y 1 A LYS 424 ? CE  ? A LYS 424 CE  
122 1 Y 1 A LYS 424 ? NZ  ? A LYS 424 NZ  
123 1 Y 1 A ARG 448 ? CG  ? A ARG 448 CG  
124 1 Y 1 A ARG 448 ? CD  ? A ARG 448 CD  
125 1 Y 1 A ARG 448 ? NE  ? A ARG 448 NE  
126 1 Y 1 A ARG 448 ? CZ  ? A ARG 448 CZ  
127 1 Y 1 A ARG 448 ? NH1 ? A ARG 448 NH1 
128 1 Y 1 A ARG 448 ? NH2 ? A ARG 448 NH2 
129 1 Y 1 A GLN 512 ? CG  ? A GLN 512 CG  
130 1 Y 1 A GLN 512 ? CD  ? A GLN 512 CD  
131 1 Y 1 A GLN 512 ? OE1 ? A GLN 512 OE1 
132 1 Y 1 A GLN 512 ? NE2 ? A GLN 512 NE2 
133 1 Y 1 A SER 515 ? OG  ? A SER 515 OG  
134 1 Y 1 B LYS 65  ? CG  ? B LYS 79  CG  
135 1 Y 1 B LYS 65  ? CD  ? B LYS 79  CD  
136 1 Y 1 B LYS 65  ? CE  ? B LYS 79  CE  
137 1 Y 1 B LYS 65  ? NZ  ? B LYS 79  NZ  
138 1 Y 1 B LYS 66  ? CG  ? B LYS 80  CG  
139 1 Y 1 B LYS 66  ? CD  ? B LYS 80  CD  
140 1 Y 1 B LYS 66  ? CE  ? B LYS 80  CE  
141 1 Y 1 B LYS 66  ? NZ  ? B LYS 80  NZ  
142 1 Y 1 B ASP 67  ? CG  ? B ASP 81  CG  
143 1 Y 1 B ASP 67  ? OD1 ? B ASP 81  OD1 
144 1 Y 1 B ASP 67  ? OD2 ? B ASP 81  OD2 
145 1 Y 1 B LYS 70  ? CG  ? B LYS 84  CG  
146 1 Y 1 B LYS 70  ? CD  ? B LYS 84  CD  
147 1 Y 1 B LYS 70  ? CE  ? B LYS 84  CE  
148 1 Y 1 B LYS 70  ? NZ  ? B LYS 84  NZ  
149 1 Y 1 B ARG 72  ? CB  ? B ARG 86  CB  
150 1 Y 1 B ARG 72  ? CG  ? B ARG 86  CG  
151 1 Y 1 B ARG 72  ? CD  ? B ARG 86  CD  
152 1 Y 1 B ARG 72  ? NE  ? B ARG 86  NE  
153 1 Y 1 B ARG 72  ? CZ  ? B ARG 86  CZ  
154 1 Y 1 B ARG 72  ? NH1 ? B ARG 86  NH1 
155 1 Y 1 B ARG 72  ? NH2 ? B ARG 86  NH2 
156 1 Y 1 B LYS 82  ? CG  ? B LYS 96  CG  
157 1 Y 1 B LYS 82  ? CD  ? B LYS 96  CD  
158 1 Y 1 B LYS 82  ? CE  ? B LYS 96  CE  
159 1 Y 1 B LYS 82  ? NZ  ? B LYS 96  NZ  
160 1 Y 1 B LYS 83  ? CG  ? B LYS 97  CG  
161 1 Y 1 B LYS 83  ? CD  ? B LYS 97  CD  
162 1 Y 1 B LYS 83  ? CE  ? B LYS 97  CE  
163 1 Y 1 B LYS 83  ? NZ  ? B LYS 97  NZ  
164 1 Y 1 B TRP 88  ? CG  ? B TRP 102 CG  
165 1 Y 1 B TRP 88  ? CD1 ? B TRP 102 CD1 
166 1 Y 1 B TRP 88  ? CD2 ? B TRP 102 CD2 
167 1 Y 1 B TRP 88  ? NE1 ? B TRP 102 NE1 
168 1 Y 1 B TRP 88  ? CE2 ? B TRP 102 CE2 
169 1 Y 1 B TRP 88  ? CE3 ? B TRP 102 CE3 
170 1 Y 1 B TRP 88  ? CZ2 ? B TRP 102 CZ2 
171 1 Y 1 B TRP 88  ? CZ3 ? B TRP 102 CZ3 
172 1 Y 1 B TRP 88  ? CH2 ? B TRP 102 CH2 
173 1 Y 1 B GLU 89  ? CG  ? B GLU 103 CG  
174 1 Y 1 B GLU 89  ? CD  ? B GLU 103 CD  
175 1 Y 1 B GLU 89  ? OE1 ? B GLU 103 OE1 
176 1 Y 1 B GLU 89  ? OE2 ? B GLU 103 OE2 
177 1 Y 1 B LYS 103 ? CG  ? B LYS 117 CG  
178 1 Y 1 B LYS 103 ? CD  ? B LYS 117 CD  
179 1 Y 1 B LYS 103 ? CE  ? B LYS 117 CE  
180 1 Y 1 B LYS 103 ? NZ  ? B LYS 117 NZ  
181 1 Y 1 B ASN 137 ? CG  ? B ASN 151 CG  
182 1 Y 1 B ASN 137 ? OD1 ? B ASN 151 OD1 
183 1 Y 1 B ASN 137 ? ND2 ? B ASN 151 ND2 
184 1 Y 1 B LYS 166 ? CG  ? B LYS 180 CG  
185 1 Y 1 B LYS 166 ? CD  ? B LYS 180 CD  
186 1 Y 1 B LYS 166 ? CE  ? B LYS 180 CE  
187 1 Y 1 B LYS 166 ? NZ  ? B LYS 180 NZ  
188 1 Y 1 B PHE 171 ? CG  ? B PHE 185 CG  
189 1 Y 1 B PHE 171 ? CD1 ? B PHE 185 CD1 
190 1 Y 1 B PHE 171 ? CD2 ? B PHE 185 CD2 
191 1 Y 1 B PHE 171 ? CE1 ? B PHE 185 CE1 
192 1 Y 1 B PHE 171 ? CE2 ? B PHE 185 CE2 
193 1 Y 1 B PHE 171 ? CZ  ? B PHE 185 CZ  
194 1 Y 1 B ARG 172 ? CG  ? B ARG 186 CG  
195 1 Y 1 B ARG 172 ? CD  ? B ARG 186 CD  
196 1 Y 1 B ARG 172 ? NE  ? B ARG 186 NE  
197 1 Y 1 B ARG 172 ? CZ  ? B ARG 186 CZ  
198 1 Y 1 B ARG 172 ? NH1 ? B ARG 186 NH1 
199 1 Y 1 B ARG 172 ? NH2 ? B ARG 186 NH2 
200 1 Y 1 B LYS 173 ? CG  ? B LYS 187 CG  
201 1 Y 1 B LYS 173 ? CD  ? B LYS 187 CD  
202 1 Y 1 B LYS 173 ? CE  ? B LYS 187 CE  
203 1 Y 1 B LYS 173 ? NZ  ? B LYS 187 NZ  
204 1 Y 1 B HIS 198 ? CG  ? B HIS 212 CG  
205 1 Y 1 B HIS 198 ? ND1 ? B HIS 212 ND1 
206 1 Y 1 B HIS 198 ? CD2 ? B HIS 212 CD2 
207 1 Y 1 B HIS 198 ? CE1 ? B HIS 212 CE1 
208 1 Y 1 B HIS 198 ? NE2 ? B HIS 212 NE2 
209 1 Y 1 B ARG 199 ? CG  ? B ARG 213 CG  
210 1 Y 1 B ARG 199 ? CD  ? B ARG 213 CD  
211 1 Y 1 B ARG 199 ? NE  ? B ARG 213 NE  
212 1 Y 1 B ARG 199 ? CZ  ? B ARG 213 CZ  
213 1 Y 1 B ARG 199 ? NH1 ? B ARG 213 NH1 
214 1 Y 1 B ARG 199 ? NH2 ? B ARG 213 NH2 
215 1 Y 1 B ARG 206 ? CG  ? B ARG 220 CG  
216 1 Y 1 B ARG 206 ? CD  ? B ARG 220 CD  
217 1 Y 1 B ARG 206 ? NE  ? B ARG 220 NE  
218 1 Y 1 B ARG 206 ? CZ  ? B ARG 220 CZ  
219 1 Y 1 B ARG 206 ? NH1 ? B ARG 220 NH1 
220 1 Y 1 B ARG 206 ? NH2 ? B ARG 220 NH2 
221 1 Y 1 B GLN 207 ? CG  ? B GLN 221 CG  
222 1 Y 1 B GLN 207 ? CD  ? B GLN 221 CD  
223 1 Y 1 B GLN 207 ? OE1 ? B GLN 221 OE1 
224 1 Y 1 B GLN 207 ? NE2 ? B GLN 221 NE2 
225 1 Y 1 B ARG 211 ? CG  ? B ARG 225 CG  
226 1 Y 1 B ARG 211 ? CD  ? B ARG 225 CD  
227 1 Y 1 B ARG 211 ? NE  ? B ARG 225 NE  
228 1 Y 1 B ARG 211 ? CZ  ? B ARG 225 CZ  
229 1 Y 1 B ARG 211 ? NH1 ? B ARG 225 NH1 
230 1 Y 1 B ARG 211 ? NH2 ? B ARG 225 NH2 
231 1 Y 1 B ARG 358 ? CG  ? B ARG 372 CG  
232 1 Y 1 B ARG 358 ? CD  ? B ARG 372 CD  
233 1 Y 1 B ARG 358 ? NE  ? B ARG 372 NE  
234 1 Y 1 B ARG 358 ? CZ  ? B ARG 372 CZ  
235 1 Y 1 B ARG 358 ? NH1 ? B ARG 372 NH1 
236 1 Y 1 B ARG 358 ? NH2 ? B ARG 372 NH2 
237 1 Y 1 B LYS 374 ? CG  ? B LYS 388 CG  
238 1 Y 1 B LYS 374 ? CD  ? B LYS 388 CD  
239 1 Y 1 B LYS 374 ? CE  ? B LYS 388 CE  
240 1 Y 1 B LYS 374 ? NZ  ? B LYS 388 NZ  
241 1 Y 1 B TRP 410 ? CG  ? B TRP 424 CG  
242 1 Y 1 B TRP 410 ? CD1 ? B TRP 424 CD1 
243 1 Y 1 B TRP 410 ? CD2 ? B TRP 424 CD2 
244 1 Y 1 B TRP 410 ? NE1 ? B TRP 424 NE1 
245 1 Y 1 B TRP 410 ? CE2 ? B TRP 424 CE2 
246 1 Y 1 B TRP 410 ? CE3 ? B TRP 424 CE3 
247 1 Y 1 B TRP 410 ? CZ2 ? B TRP 424 CZ2 
248 1 Y 1 B TRP 410 ? CZ3 ? B TRP 424 CZ3 
249 1 Y 1 B TRP 410 ? CH2 ? B TRP 424 CH2 
250 1 Y 1 B LYS 431 ? CG  ? B LYS 445 CG  
251 1 Y 1 B LYS 431 ? CD  ? B LYS 445 CD  
252 1 Y 1 B LYS 431 ? CE  ? B LYS 445 CE  
253 1 Y 1 B LYS 431 ? NZ  ? B LYS 445 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 62  ? A ALA 62  
2  1 Y 1 A ILE 63  ? A ILE 63  
3  1 Y 1 A LYS 64  ? A LYS 64  
4  1 Y 1 A LYS 65  ? A LYS 65  
5  1 Y 1 A LYS 66  ? A LYS 66  
6  1 Y 1 A ASP 67  ? A ASP 67  
7  1 Y 1 A GLY 68  ? A GLY 68  
8  1 Y 1 A THR 69  ? A THR 69  
9  1 Y 1 A LYS 70  ? A LYS 70  
10 1 Y 1 A TRP 71  ? A TRP 71  
11 1 Y 1 A ARG 72  ? A ARG 72  
12 1 Y 1 A LYS 73  ? A LYS 73  
13 1 Y 1 A LEU 74  ? A LEU 74  
14 1 Y 1 A ARG 557 ? A ARG 557 
15 1 Y 1 A LYS 558 ? A LYS 558 
16 1 Y 1 A ILE 559 ? A ILE 559 
17 1 Y 1 A LEU 560 ? A LEU 560 
18 1 Y 1 B MET -13 ? B MET 1   
19 1 Y 1 B ARG -12 ? B ARG 2   
20 1 Y 1 B GLY -11 ? B GLY 3   
21 1 Y 1 B SER -10 ? B SER 4   
22 1 Y 1 B HIS -9  ? B HIS 5   
23 1 Y 1 B HIS -8  ? B HIS 6   
24 1 Y 1 B HIS -7  ? B HIS 7   
25 1 Y 1 B HIS -6  ? B HIS 8   
26 1 Y 1 B HIS -5  ? B HIS 9   
27 1 Y 1 B HIS -4  ? B HIS 10  
28 1 Y 1 B GLY -3  ? B GLY 11  
29 1 Y 1 B SER -2  ? B SER 12  
30 1 Y 1 B GLN -1  ? B GLN 13  
31 1 Y 1 B LEU 0   ? B LEU 14  
32 1 Y 1 B PRO 1   ? B PRO 15  
33 1 Y 1 B ILE 2   ? B ILE 16  
34 1 Y 1 B SER 3   ? B SER 17  
35 1 Y 1 B PRO 4   ? B PRO 18  
36 1 Y 1 B ILE 5   ? B ILE 19  
37 1 Y 1 B GLU 6   ? B GLU 20  
38 1 Y 1 B THR 216 ? B THR 230 
39 1 Y 1 B PRO 217 ? B PRO 231 
40 1 Y 1 B ASP 218 ? B ASP 232 
41 1 Y 1 B LYS 219 ? B LYS 233 
42 1 Y 1 B LYS 220 ? B LYS 234 
43 1 Y 1 B HIS 221 ? B HIS 235 
44 1 Y 1 B GLN 222 ? B GLN 236 
45 1 Y 1 B LYS 223 ? B LYS 237 
46 1 Y 1 B GLU 224 ? B GLU 238 
47 1 Y 1 B PRO 225 ? B PRO 239 
48 1 Y 1 B PRO 226 ? B PRO 240 
49 1 Y 1 B PHE 227 ? B PHE 241 
50 1 Y 1 B LEU 228 ? B LEU 242 
51 1 Y 1 B TRP 229 ? B TRP 243 
52 1 Y 1 B MET 230 ? B MET 244 
53 1 Y 1 B GLU 432 ? B GLU 446 
54 1 Y 1 B PRO 433 ? B PRO 447 
55 1 Y 1 B ILE 434 ? B ILE 448 
56 1 Y 1 B VAL 435 ? B VAL 449 
57 1 Y 1 B GLY 436 ? B GLY 450 
58 1 Y 1 B ALA 437 ? B ALA 451 
59 1 Y 1 B GLU 438 ? B GLU 452 
60 1 Y 1 B THR 439 ? B THR 453 
61 1 Y 1 B PHE 440 ? B PHE 454 
62 1 Y 1 D DT  -1  ? C DT  1   
63 1 Y 1 D DC  0   ? C DC  2   
64 1 Y 1 D DG  1   ? C DG  3   
65 1 Y 1 D DT  2   ? C DT  4   
66 1 Y 1 R A   1   ? D A   1   
67 1 Y 1 R U   2   ? D U   2   
68 1 Y 1 R G   3   ? D G   3   
69 1 Y 1 R A   4   ? D A   4   
70 1 Y 1 R N   5   ? D N   5   
71 1 Y 1 R A   27  ? D A   27  
72 1 Y 1 R C   28  ? D C   28  
73 1 Y 1 R G   29  ? D G   29  
74 1 Y 1 R A   30  ? D A   30  
75 1 Y 1 R C   31  ? D C   31  
76 1 Y 1 R C   32  ? D C   32  
77 1 Y 1 R A   33  ? D A   33  
78 1 Y 1 R C   34  ? D C   34  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4B3Q 'double helix'        
4B3Q 'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DA 5  1_555 D U 26 1_555 0.176  -0.115 0.129  -13.199 -2.719  2.838  1  D_DA3:U26_R  D 3  ? R 26 ? 20 1 
1 C DT 6  1_555 D A 25 1_555 -0.421 -0.011 -0.023 14.736  -2.271  2.394  2  D_DT4:A25_R  D 4  ? R 25 ? 20 1 
1 C DG 7  1_555 D C 24 1_555 0.251  -0.068 -0.287 8.881   -3.050  1.590  3  D_DG5:C24_R  D 5  ? R 24 ? 19 1 
1 C DC 8  1_555 D G 23 1_555 0.582  -0.082 -0.451 10.211  -7.323  5.203  4  D_DC6:G23_R  D 6  ? R 23 ? 19 1 
1 C DC 9  1_555 D G 22 1_555 0.149  0.022  -0.430 2.022   -0.642  4.951  5  D_DC7:G22_R  D 7  ? R 22 ? 19 1 
1 C DT 10 1_555 D A 21 1_555 -0.150 -0.034 -0.674 9.500   -5.271  5.732  6  D_DT8:A21_R  D 8  ? R 21 ? 20 1 
1 C DA 11 1_555 D U 20 1_555 0.370  -0.116 -0.018 -3.364  -8.116  1.897  7  D_DA9:U20_R  D 9  ? R 20 ? 20 1 
1 C DT 12 1_555 D A 19 1_555 0.322  -0.028 -0.285 3.434   -9.272  -0.679 8  D_DT10:A19_R D 10 ? R 19 ? 20 1 
1 C DA 13 1_555 D U 18 1_555 -0.078 -0.016 -0.471 -9.255  -7.230  -1.690 9  D_DA11:U18_R D 11 ? R 18 ? 20 1 
1 C DG 14 1_555 D C 17 1_555 0.446  0.116  -0.251 -0.951  -3.789  4.575  10 D_DG12:C17_R D 12 ? R 17 ? 19 1 
1 C DT 15 1_555 D A 16 1_555 0.463  -0.131 -0.273 3.814   -4.649  -1.057 11 D_DT13:A16_R D 13 ? R 16 ? 20 1 
1 C DT 16 1_555 D A 15 1_555 0.533  -0.251 -0.366 5.652   1.970   -5.917 12 D_DT14:A15_R D 14 ? R 15 ? 20 1 
1 C DA 17 1_555 D U 14 1_555 -0.220 -0.231 -0.256 -1.610  -4.850  0.191  13 D_DA15:U14_R D 15 ? R 14 ? 20 1 
1 C DT 18 1_555 D A 13 1_555 0.371  -0.253 0.149  8.619   -7.278  1.126  14 D_DT16:A13_R D 16 ? R 13 ? 20 1 
1 C DT 19 1_555 D A 12 1_555 -0.119 -0.075 -0.452 7.190   -11.781 0.760  15 D_DT17:A12_R D 17 ? R 12 ? 20 1 
1 C DG 20 1_555 D C 11 1_555 0.005  -0.023 -0.271 -7.353  -3.300  1.567  16 D_DG18:C11_R D 18 ? R 11 ? 19 1 
1 C DT 21 1_555 D A 10 1_555 -0.205 -0.097 -0.277 5.167   -6.363  -2.616 17 D_DT19:A10_R D 19 ? R 10 ? 20 1 
1 C DG 22 1_555 D C 9  1_555 -0.375 -0.091 -0.438 -4.800  -0.053  0.644  18 D_DG20:C9_R  D 20 ? R 9  ? 19 1 
1 C DG 23 1_555 D C 8  1_555 0.427  -0.047 -0.858 -8.476  -6.181  -2.871 19 D_DG21:C8_R  D 21 ? R 8  ? 19 1 
1 C DC 24 1_555 D G 7  1_555 0.761  -0.246 -0.717 2.261   -6.345  -3.861 20 D_DC22:G7_R  D 22 ? R 7  ? 19 1 
1 C DC 25 1_555 D G 6  1_555 0.005  -0.001 -0.527 5.870   1.811   -0.815 21 D_DC23:G6_R  D 23 ? R 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DA 5  1_555 D U 26 1_555 C DT 6  1_555 D A 25 1_555 -0.585 -1.047 2.829 0.322  3.973  26.016 -3.195 1.358  2.636 8.759  -0.711 
26.314 1  DD_DA3DT4:A25U26_RR   D 3  ? R 26 ? D 4  ? R 25 ? 
1 C DT 6  1_555 D A 25 1_555 C DG 7  1_555 D C 24 1_555 -0.394 -0.897 3.392 -2.792 9.631  36.463 -2.639 0.245  3.086 15.046 4.361  
37.772 2  DD_DT4DG5:C24A25_RR   D 4  ? R 25 ? D 5  ? R 24 ? 
1 C DG 7  1_555 D C 24 1_555 C DC 8  1_555 D G 23 1_555 0.504  -1.341 3.305 -0.339 1.775  32.097 -2.738 -0.971 3.222 3.207  0.612  
32.146 3  DD_DG5DC6:G23C24_RR   D 5  ? R 24 ? D 6  ? R 23 ? 
1 C DC 8  1_555 D G 23 1_555 C DC 9  1_555 D G 22 1_555 -0.309 -1.969 3.422 -0.612 10.853 26.595 -6.256 0.494  2.451 22.438 1.264  
28.694 4  DD_DC6DC7:G22G23_RR   D 6  ? R 23 ? D 7  ? R 22 ? 
1 C DC 9  1_555 D G 22 1_555 C DT 10 1_555 D A 21 1_555 -0.062 -1.437 3.096 3.331  7.910  26.142 -4.739 0.852  2.534 16.916 -7.123 
27.492 5  DD_DC7DT8:A21G22_RR   D 7  ? R 22 ? D 8  ? R 21 ? 
1 C DT 10 1_555 D A 21 1_555 C DA 11 1_555 D U 20 1_555 0.061  -1.175 3.515 -2.827 17.175 33.664 -4.022 -0.458 2.621 27.493 4.525  
37.782 6  DD_DT8DA9:U20A21_RR   D 8  ? R 21 ? D 9  ? R 20 ? 
1 C DA 11 1_555 D U 20 1_555 C DT 12 1_555 D A 19 1_555 -0.265 -1.441 3.154 2.242  0.912  34.419 -2.565 0.779  3.094 1.539  -3.783 
34.502 7  DD_DA9DT10:A19U20_RR  D 9  ? R 20 ? D 10 ? R 19 ? 
1 C DT 12 1_555 D A 19 1_555 C DA 13 1_555 D U 18 1_555 0.979  -1.640 3.640 5.070  21.298 35.944 -4.540 -0.835 2.450 31.210 -7.430 
41.898 8  DD_DT10DA11:U18A19_RR D 10 ? R 19 ? D 11 ? R 18 ? 
1 C DA 13 1_555 D U 18 1_555 C DG 14 1_555 D C 17 1_555 0.893  -1.284 3.208 -1.759 4.361  32.691 -2.960 -1.855 2.966 7.697  3.105  
33.019 9  DD_DA11DG12:C17U18_RR D 11 ? R 18 ? D 12 ? R 17 ? 
1 C DG 14 1_555 D C 17 1_555 C DT 15 1_555 D A 16 1_555 -0.115 -1.566 3.215 -0.589 -1.403 34.030 -2.451 0.104  3.276 -2.395 1.005  
34.063 10 DD_DG12DT13:A16C17_RR D 12 ? R 17 ? D 13 ? R 16 ? 
1 C DT 15 1_555 D A 16 1_555 C DT 16 1_555 D A 15 1_555 -0.024 -1.638 3.553 0.093  0.505  32.387 -3.033 0.060  3.528 0.905  -0.166 
32.391 11 DD_DT13DT14:A15A16_RR D 13 ? R 16 ? D 14 ? R 15 ? 
1 C DT 16 1_555 D A 15 1_555 C DA 17 1_555 D U 14 1_555 0.110  -1.113 3.492 -2.501 10.397 35.194 -3.215 -0.522 3.038 16.724 4.023  
36.734 12 DD_DT14DA15:U14A15_RR D 14 ? R 15 ? D 15 ? R 14 ? 
1 C DA 17 1_555 D U 14 1_555 C DT 18 1_555 D A 13 1_555 0.102  -1.420 3.050 -5.705 -3.555 34.669 -1.842 -0.973 3.120 -5.898 9.464  
35.295 13 DD_DA15DT16:A13U14_RR D 15 ? R 14 ? D 16 ? R 13 ? 
1 C DT 18 1_555 D A 13 1_555 C DT 19 1_555 D A 12 1_555 0.576  -0.809 3.379 3.301  2.940  34.252 -1.832 -0.444 3.340 4.966  -5.575 
34.528 14 DD_DT16DT17:A12A13_RR D 16 ? R 13 ? D 17 ? R 12 ? 
1 C DT 19 1_555 D A 12 1_555 C DG 20 1_555 D C 11 1_555 0.057  -1.323 3.633 -4.083 11.895 31.206 -4.316 -0.794 2.918 21.071 7.233  
33.587 15 DD_DT17DG18:C11A12_RR D 17 ? R 12 ? D 18 ? R 11 ? 
1 C DG 20 1_555 D C 11 1_555 C DT 21 1_555 D A 10 1_555 -0.642 -1.259 2.993 -1.071 4.107  30.992 -3.030 1.010  2.826 7.642  1.992  
31.275 16 DD_DG18DT19:A10C11_RR D 18 ? R 11 ? D 19 ? R 10 ? 
1 C DT 21 1_555 D A 10 1_555 C DG 22 1_555 D C 9  1_555 0.413  -1.332 3.397 -0.628 20.127 31.513 -4.569 -0.723 2.179 33.164 1.034  
37.259 17 DD_DT19DG20:C9A10_RR  D 19 ? R 10 ? D 20 ? R 9  ? 
1 C DG 22 1_555 D C 9  1_555 C DG 23 1_555 D C 8  1_555 0.527  -1.914 3.501 3.887  16.520 29.915 -5.681 -0.320 2.222 29.232 -6.877 
34.298 18 DD_DG20DG21:C8C9_RR   D 20 ? R 9  ? D 21 ? R 8  ? 
1 C DG 23 1_555 D C 8  1_555 C DC 24 1_555 D G 7  1_555 0.085  -1.658 3.126 0.732  2.406  33.437 -3.245 -0.035 3.004 4.175  -1.270 
33.528 19 DD_DG21DC22:G7C8_RR   D 21 ? R 8  ? D 22 ? R 7  ? 
1 C DC 24 1_555 D G 7  1_555 C DC 25 1_555 D G 6  1_555 0.245  -1.142 3.509 1.881  4.976  29.919 -3.226 -0.072 3.289 9.543  -3.608 
30.378 20 DD_DC22DC23:G6G7_RR   D 22 ? R 7  ? D 23 ? R 6  ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        "11-CYCLOPROPYL-5,11-DIHYDRO-4-METHYL-6H-DIPYRIDO[3,2-B:2',3'-E][1,4]DIAZEPIN-6-ONE" 
_pdbx_entity_nonpoly.comp_id     NVP 
#