data_4B84
# 
_entry.id   4B84 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4B84         
PDBE  EBI-53846    
WWPDB D_1290053846 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- DECIDIUM COMPLEX' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- GALLAMINE COMPLEX' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- PROPIDIUM COMPLEX' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- TZ2PA6SYN COMPLEX' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- TZ2PA6ANTI COMPLEX' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE'     
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 2WLS unspecified 'CRYSTAL STRUCTURE OF MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH AMTS13' 
PDB 2WU3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND HI-6' 
PDB 2WU4 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND ORTHO-7' 
PDB 2XUD unspecified 'CRYSTAL STRUCTURE OF THE Y337A MUTANT OF MOUSE ACETYLCHOLINESTERASE' 
PDB 2XUF unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 1 MTH)' 
PDB 2XUG unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 1 WK)' 
PDB 2XUH unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 10 MTH)' 
PDB 2XUI unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 WK)' 
PDB 2XUJ unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 MTH)' 
PDB 2XUK unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX ( 10 MTH)' 
PDB 2XUO unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI INHIBITOR' 
PDB 2XUP unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 SYN INHIBITOR' 
PDB 2XUQ unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI-SYN INHIBITORS' 
PDB 4A16 unspecified 'STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEX WITH HUPRINE DERIVATIVE' 
PDB 4A23 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH RACEMIC C5685' 
PDB 4ARA unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH (R)- C5685 AT 2.5 A RESOLUTION.' 
PDB 4ARB unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH (S)- C5685 AT 2.25 A RESOLUTION.' 
PDB 4B7Z unspecified 
'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-1-(4-METHYLPHENYL)-METHANESULFONAMIDE'  
PDB 4B80 unspecified 
'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-1-(4-FLUORO-PHENYL)-METHANESULFONAMIDE' 
PDB 4B81 unspecified 
'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH C-(4- CHLORO-PHENYL)-N-(2-DIETHYLAMINO-ETHYL)-METHANESULFONAMIDE' 
PDB 4B82 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-2-FLUORANYL-BENZENESULFONAMIDE' 
PDB 4B83 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-3-METHOXY-BENZENESULFONAMIDE' 
PDB 4B85 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH 4- CHLORANYL-N-(2-DIETHYLAMINO-ETHYL)-BENZENESULFONAMIDE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4B84 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-08-24 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Andersson, C.D.' 1 
'Forsgren, N.'    2 
'Akfur, C.'       3 
'Allgardsson, A.' 4 
'Berg, L.'        5 
'Qian, W.'        6 
'Ekstrom, F.'     7 
'Linusson, A.'    8 
# 
_citation.id                        primary 
_citation.title                     
'Divergent Structure-Activity Relationships of Structurally Similar Acetylcholinesterase Inhibitors.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            56 
_citation.page_first                7615 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23984975 
_citation.pdbx_database_id_DOI      10.1021/JM400990P 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Andersson, C.D.' 1 ? 
primary 'Forsgren, N.'    2 ? 
primary 'Akfur, C.'       3 ? 
primary 'Allgardsson, A.' 4 ? 
primary 'Berg, L.'        5 ? 
primary 'Engdahl, C.'     6 ? 
primary 'Qian, W.'        7 ? 
primary 'Ekstrom, F.J.'   8 ? 
primary 'Linusson, A.'    9 ? 
# 
_cell.entry_id           4B84 
_cell.length_a           79.158 
_cell.length_b           112.356 
_cell.length_c           227.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4B84 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                              60262.039 2   3.1.1.7 ? 
'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                          221.208   1   ?       ? ? ? 
3 non-polymer syn 3,6,9,12,15-PENTAOXAHEPTADECANE                                   250.332   4   ?       ? ? ? 
4 non-polymer syn 'SULFATE ION'                                                     96.063    2   ?       ? ? ? 
5 non-polymer syn 'N-[2-(diethylamino)ethyl]-3-(trifluoromethyl)benzenesulfonamide' 324.362   3   ?       ? ? ? 
6 non-polymer syn 'HEXAETHYLENE GLYCOL'                                             282.331   1   ?       ? ? ? 
7 water       nat water                                                             18.015    384 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAAANDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAAANDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 ALA n 
1 264 ALA n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293F' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCDNA3.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4B84 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 4B84 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4B84 ALA A 544 ? UNP P21836 ?   ?   'expression tag' 544 1  
1 4B84 THR A 545 ? UNP P21836 ?   ?   'expression tag' 545 2  
1 4B84 GLU A 546 ? UNP P21836 ?   ?   'expression tag' 546 3  
1 4B84 ALA A 547 ? UNP P21836 ?   ?   'expression tag' 547 4  
1 4B84 PRO A 548 ? UNP P21836 ?   ?   'expression tag' 548 5  
1 4B84 ALA A 263 ? UNP P21836 GLY 294 conflict         263 6  
1 4B84 ALA A 264 ? UNP P21836 GLY 295 conflict         264 7  
2 4B84 ALA B 544 ? UNP P21836 ?   ?   'expression tag' 544 8  
2 4B84 THR B 545 ? UNP P21836 ?   ?   'expression tag' 545 9  
2 4B84 GLU B 546 ? UNP P21836 ?   ?   'expression tag' 546 10 
2 4B84 ALA B 547 ? UNP P21836 ?   ?   'expression tag' 547 11 
2 4B84 PRO B 548 ? UNP P21836 ?   ?   'expression tag' 548 12 
2 4B84 ALA B 263 ? UNP P21836 GLY 294 conflict         263 13 
2 4B84 ALA B 264 ? UNP P21836 GLY 295 conflict         264 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                           ?                            
'C3 H7 N O2'         89.093  
ARG 'L-peptide linking'          y ARGININE                                                          ?                            
'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                        ?                            
'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                   ?                            
'C4 H7 N O4'         133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                          ?                            
'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                         ?                            
'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                   ?                            
'C5 H9 N O4'         147.129 
GLY 'peptide linking'            y GLYCINE                                                           ?                            
'C2 H5 N O2'         75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                         ?                            
'C6 H10 N3 O2 1'     156.162 
HOH non-polymer                  . WATER                                                             ?                            
'H2 O'               18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                        ?                            
'C6 H13 N O2'        131.173 
LEU 'L-peptide linking'          y LEUCINE                                                           ?                            
'C6 H13 N O2'        131.173 
LYS 'L-peptide linking'          y LYSINE                                                            ?                            
'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking'          y METHIONINE                                                        ?                            
'C5 H11 N O2 S'      149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                          ?                            
'C8 H15 N O6'        221.208 
P3G non-polymer                  . 3,6,9,12,15-PENTAOXAHEPTADECANE                                   ?                            
'C12 H26 O5'         250.332 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                             'POLYETHYLENE GLYCOL PEG400' 
'C12 H26 O7'         282.331 
PHE 'L-peptide linking'          y PHENYLALANINE                                                     ?                            
'C9 H11 N O2'        165.189 
PRO 'L-peptide linking'          y PROLINE                                                           ?                            
'C5 H9 N O2'         115.130 
SER 'L-peptide linking'          y SERINE                                                            ?                            
'C3 H7 N O3'         105.093 
SO4 non-polymer                  . 'SULFATE ION'                                                     ?                            
'O4 S -2'            96.063  
THR 'L-peptide linking'          y THREONINE                                                         ?                            
'C4 H9 N O3'         119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                        ?                            
'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking'          y TYROSINE                                                          ?                            
'C9 H11 N O3'        181.189 
VAL 'L-peptide linking'          y VALINE                                                            ?                            
'C5 H11 N O2'        117.146 
Z5K non-polymer                  . 'N-[2-(diethylamino)ethyl]-3-(trifluoromethyl)benzenesulfonamide' ?                            
'C13 H19 F3 N2 O2 S' 324.362 
# 
_exptl.entry_id          4B84 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.2 
_exptl_crystal.density_percent_sol   70.7 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '27-31 % (W/V)PEG750 MME, 0.1 M HEPES PH 7.0-7.1' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2012-02-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.041 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-2' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-2 
_diffrn_source.pdbx_wavelength             1.041 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4B84 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.75 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   57324 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.5 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.00 
_reflns.B_iso_Wilson_estimate        52.23 
_reflns.pdbx_redundancy              5.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   93.6 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.50 
_reflns_shell.pdbx_redundancy        4.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4B84 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     57214 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.082 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    90.60 
_refine.ls_R_factor_obs                          0.1775 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1764 
_refine.ls_R_factor_R_free                       0.2355 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1133 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.8 
_refine.aniso_B[1][1]                            -0.4353 
_refine.aniso_B[2][2]                            0.3214 
_refine.aniso_B[3][3]                            0.1139 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.307 
_refine.solvent_model_param_bsol                 54.455 
_refine.pdbx_solvent_vdw_probe_radii             1.30 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.11 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.pdbx_overall_phase_error                 24.10 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8299 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         135 
_refine_hist.number_atoms_solvent             384 
_refine_hist.number_atoms_total               8818 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        29.082 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 8731  'X-RAY DIFFRACTION' ? 
f_angle_d          1.212  ? ? 11922 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.202 ? ? 3195  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.078  ? ? 1274  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1557  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.6000 2.7183  7081 0.2827 93.00 0.3233 . . 151 . . 
'X-RAY DIFFRACTION' . 2.7183 2.8615  7083 0.2605 93.00 0.3391 . . 146 . . 
'X-RAY DIFFRACTION' . 2.8615 3.0406  7077 0.2274 92.00 0.2698 . . 141 . . 
'X-RAY DIFFRACTION' . 3.0406 3.2751  7035 0.1981 92.00 0.2730 . . 144 . . 
'X-RAY DIFFRACTION' . 3.2751 3.6041  7024 0.1925 91.00 0.2694 . . 134 . . 
'X-RAY DIFFRACTION' . 3.6041 4.1243  6950 0.1476 90.00 0.2448 . . 138 . . 
'X-RAY DIFFRACTION' . 4.1243 5.1914  6938 0.1260 89.00 0.1513 . . 136 . . 
'X-RAY DIFFRACTION' . 5.1914 29.0837 6893 0.1666 85.00 0.2151 . . 143 . . 
# 
_struct.entry_id                  4B84 
_struct.title                     
'Mus musculus Acetylcholinesterase in complex with N-(2-Diethylamino- ethyl)-3-trifluoromethyl-benzenesulfonamide' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4B84 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 5 ? 
I N N 3 ? 
J N N 5 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 7 ? 
O N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2  2  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3  3  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4  4  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P5  5  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6  6  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7  7  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8  8  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9  9  LEU A 216 ? ARG A 219 ? LEU A 216 ARG A 219 5 ? 4  
HELX_P HELX_P10 10 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11 11 ALA A 264 ? ARG A 274 ? ALA A 264 ARG A 274 1 ? 11 
HELX_P HELX_P12 12 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P13 13 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P14 14 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15 15 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P16 16 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 17 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 18 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 19 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20 20 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 21 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22 22 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P23 23 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? PHE A 535 ? ARG A 525 PHE A 535 1 ? 11 
HELX_P HELX_P26 26 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P27 27 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28 28 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29 29 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30 30 GLY B 135 ? GLU B 142 ? GLY B 135 GLU B 142 1 ? 8  
HELX_P HELX_P31 31 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32 32 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P33 33 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34 34 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P35 35 SER B 215 ? ARG B 219 ? SER B 215 ARG B 219 5 ? 5  
HELX_P HELX_P36 36 ALA B 241 ? GLY B 256 ? ALA B 241 GLY B 256 1 ? 16 
HELX_P HELX_P37 37 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P38 38 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P39 39 HIS B 287 ? LEU B 289 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P40 40 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P41 41 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P42 42 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43 43 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44 44 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45 45 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46 46 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47 47 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48 48 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P49 49 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P50 50 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 PHE B 535 ? SER B 541 ? PHE B 535 SER B 541 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf2 disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.066 ? ?               
disulf3 disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf4 disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf5 disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf6 disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.060 ? ?               
covale1 covale one ? A ASN 464 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.465 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 3.71  
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 3.60  
3 ASP 494 B . ? ASP 494 B SER 495 B ? SER 495 B 1 11.56 
4 LYS 496 B . ? LYS 496 B SER 497 B ? SER 497 B 1 4.67  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
BD 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BD 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
BD 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
_database_PDB_matrix.entry_id          4B84 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4B84 
_atom_sites.fract_transf_matrix[1][1]   0.012633 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008900 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004401 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 32.234  14.209  55.536  1.00 98.61  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.801  14.328  55.329  1.00 90.32  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 30.141  14.439  56.678  1.00 92.33  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.808  14.339  57.706  1.00 102.60 ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.263  13.095  54.611  1.00 86.20  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.240  11.849  55.479  1.00 82.10  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.753  10.633  54.730  1.00 73.95  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 30.426  10.232  53.758  1.00 70.56  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 28.697  10.083  55.112  1.00 72.48  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.827  14.630  56.676  1.00 89.40  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.073  14.679  57.914  1.00 76.65  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.972  15.713  57.888  1.00 67.03  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.944  15.548  58.540  1.00 54.59  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 27.185  16.785  57.133  1.00 77.24  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 26.199  17.860  57.059  1.00 73.31  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.730  18.119  55.617  1.00 72.34  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.890  18.982  55.375  1.00 80.20  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.738  19.133  57.725  1.00 64.02  ? 3    ARG A CB  1 
ATOM   19   N N   . GLU A 1 4   ? 26.265  17.350  54.673  1.00 62.15  ? 4    GLU A N   1 
ATOM   20   C CA  . GLU A 1 4   ? 25.883  17.440  53.266  1.00 58.30  ? 4    GLU A CA  1 
ATOM   21   C C   . GLU A 1 4   ? 24.580  16.685  52.990  1.00 43.64  ? 4    GLU A C   1 
ATOM   22   O O   . GLU A 1 4   ? 23.962  16.177  53.904  1.00 43.43  ? 4    GLU A O   1 
ATOM   23   C CB  . GLU A 1 4   ? 26.995  16.851  52.390  1.00 76.70  ? 4    GLU A CB  1 
ATOM   24   C CG  . GLU A 1 4   ? 28.325  17.569  52.490  1.00 83.72  ? 4    GLU A CG  1 
ATOM   25   C CD  . GLU A 1 4   ? 29.469  16.727  51.974  1.00 98.95  ? 4    GLU A CD  1 
ATOM   26   O OE1 . GLU A 1 4   ? 29.721  15.646  52.548  1.00 101.00 ? 4    GLU A OE1 1 
ATOM   27   O OE2 . GLU A 1 4   ? 30.117  17.144  50.992  1.00 108.41 ? 4    GLU A OE2 1 
ATOM   28   N N   . ASP A 1 5   ? 24.170  16.619  51.726  1.00 39.47  ? 5    ASP A N   1 
ATOM   29   C CA  . ASP A 1 5   ? 23.025  15.809  51.315  1.00 47.40  ? 5    ASP A CA  1 
ATOM   30   C C   . ASP A 1 5   ? 23.448  14.337  51.196  1.00 60.48  ? 5    ASP A C   1 
ATOM   31   O O   . ASP A 1 5   ? 24.279  13.993  50.360  1.00 63.08  ? 5    ASP A O   1 
ATOM   32   C CB  . ASP A 1 5   ? 22.487  16.309  49.972  1.00 43.36  ? 5    ASP A CB  1 
ATOM   33   C CG  . ASP A 1 5   ? 21.187  15.634  49.565  1.00 55.77  ? 5    ASP A CG  1 
ATOM   34   O OD1 . ASP A 1 5   ? 20.897  14.528  50.062  1.00 59.82  ? 5    ASP A OD1 1 
ATOM   35   O OD2 . ASP A 1 5   ? 20.455  16.214  48.730  1.00 62.83  ? 5    ASP A OD2 1 
ATOM   36   N N   . PRO A 1 6   ? 22.879  13.461  52.038  1.00 57.99  ? 6    PRO A N   1 
ATOM   37   C CA  . PRO A 1 6   ? 23.287  12.055  51.999  1.00 59.96  ? 6    PRO A CA  1 
ATOM   38   C C   . PRO A 1 6   ? 22.892  11.382  50.689  1.00 58.72  ? 6    PRO A C   1 
ATOM   39   O O   . PRO A 1 6   ? 23.163  10.200  50.499  1.00 67.67  ? 6    PRO A O   1 
ATOM   40   C CB  . PRO A 1 6   ? 22.500  11.439  53.157  1.00 64.43  ? 6    PRO A CB  1 
ATOM   41   C CG  . PRO A 1 6   ? 21.303  12.308  53.293  1.00 56.57  ? 6    PRO A CG  1 
ATOM   42   C CD  . PRO A 1 6   ? 21.794  13.692  53.007  1.00 49.74  ? 6    PRO A CD  1 
ATOM   43   N N   . GLN A 1 7   ? 22.268  12.130  49.789  1.00 49.81  ? 7    GLN A N   1 
ATOM   44   C CA  A GLN A 1 7   ? 21.755  11.567  48.550  0.56 51.95  ? 7    GLN A CA  1 
ATOM   45   C CA  B GLN A 1 7   ? 21.766  11.547  48.544  0.44 51.80  ? 7    GLN A CA  1 
ATOM   46   C C   . GLN A 1 7   ? 22.609  11.964  47.343  1.00 51.75  ? 7    GLN A C   1 
ATOM   47   O O   . GLN A 1 7   ? 22.310  11.614  46.205  1.00 61.36  ? 7    GLN A O   1 
ATOM   48   C CB  A GLN A 1 7   ? 20.285  11.970  48.386  0.56 52.40  ? 7    GLN A CB  1 
ATOM   49   C CB  B GLN A 1 7   ? 20.287  11.908  48.337  0.44 51.28  ? 7    GLN A CB  1 
ATOM   50   C CG  A GLN A 1 7   ? 19.376  11.255  49.394  0.56 53.04  ? 7    GLN A CG  1 
ATOM   51   C CG  B GLN A 1 7   ? 19.716  11.584  46.950  0.44 44.33  ? 7    GLN A CG  1 
ATOM   52   C CD  A GLN A 1 7   ? 18.042  11.942  49.627  0.56 51.36  ? 7    GLN A CD  1 
ATOM   53   C CD  B GLN A 1 7   ? 19.747  10.102  46.586  0.44 37.01  ? 7    GLN A CD  1 
ATOM   54   O OE1 A GLN A 1 7   ? 17.951  13.174  49.628  0.56 48.89  ? 7    GLN A OE1 1 
ATOM   55   O OE1 B GLN A 1 7   ? 20.143  9.745   45.482  0.44 39.25  ? 7    GLN A OE1 1 
ATOM   56   N NE2 A GLN A 1 7   ? 17.000  11.142  49.854  0.56 42.09  ? 7    GLN A NE2 1 
ATOM   57   N NE2 B GLN A 1 7   ? 19.303  9.244   47.499  0.44 28.99  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.686  12.688  47.614  1.00 52.19  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.585  13.186  46.582  1.00 46.67  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.997  12.662  46.821  1.00 52.36  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.963  13.155  46.232  1.00 53.07  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.588  14.718  46.600  1.00 38.31  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.234  15.338  46.273  1.00 34.38  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.185  16.745  46.748  1.00 44.90  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 23.002  15.266  44.770  1.00 41.97  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.108  11.668  47.698  1.00 46.48  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.395  11.064  48.017  1.00 44.93  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.400  9.600   47.576  1.00 45.00  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.677  8.775   48.126  1.00 44.30  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.723  11.199  49.515  1.00 40.81  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.626  12.593  50.176  1.00 47.79  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.745  12.511  51.702  1.00 45.56  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.657  13.568  49.631  1.00 50.75  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.220  9.301   46.570  1.00 47.21  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.357  7.959   46.020  1.00 45.54  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.838  7.570   45.927  1.00 55.33  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.718  8.445   45.834  1.00 43.35  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.705  7.883   44.622  1.00 48.78  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.195  6.689   43.865  1.00 42.85  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.181  7.841   44.739  1.00 57.01  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.108  6.260   45.973  1.00 47.31  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.460  5.744   45.762  1.00 36.36  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.591  4.982   44.455  1.00 39.05  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.691  4.242   44.078  1.00 52.53  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.875  4.815   46.888  1.00 40.62  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.189  4.094   46.609  1.00 45.92  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.682  3.344   47.823  1.00 52.94  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 33.998  4.249   48.923  1.00 51.69  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.230  4.619   49.239  1.00 53.88  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 36.253  4.158   48.536  1.00 56.16  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 35.438  5.438   50.257  1.00 51.71  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.727  5.146   43.781  1.00 42.54  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.020  4.423   42.543  1.00 42.91  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.364  3.693   42.677  1.00 47.87  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.054  3.844   43.689  1.00 44.55  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 33.071  5.380   41.346  1.00 42.27  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.681  5.881   41.000  1.00 37.77  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.988  6.542   41.660  1.00 48.52  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.746  2.899   41.681  1.00 36.48  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.015  2.178   41.802  1.00 40.18  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.203  3.116   42.060  1.00 43.77  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.197  2.719   42.657  1.00 39.76  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.268  1.287   40.587  1.00 34.67  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.612  0.589   40.613  1.00 40.04  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.647  -0.505  41.644  1.00 47.27  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.912  -1.231  41.643  1.00 48.98  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.029  -0.792  42.216  1.00 56.59  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.053  0.386   42.810  1.00 51.66  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 41.130  -1.524  42.191  1.00 64.26  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.091  4.367   41.624  1.00 49.77  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.174  5.317   41.803  1.00 44.95  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.164  6.099   43.106  1.00 48.09  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.166  6.710   43.479  1.00 54.38  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.027  6.102   43.789  1.00 39.71  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.913  6.764   45.073  1.00 38.54  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.553  7.397   45.306  1.00 46.57  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.587  7.128   44.599  1.00 45.27  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.478  8.259   46.305  1.00 42.57  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.216  8.877   46.649  1.00 44.94  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.901  10.100  45.791  1.00 53.01  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.784  10.919  45.512  1.00 59.06  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.198  9.244   48.135  1.00 42.67  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 34.030  8.037   49.024  1.00 49.33  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.772  8.403   50.456  1.00 63.32  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 34.687  8.790   51.179  1.00 61.69  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.516  8.286   50.881  1.00 77.17  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.634  10.209  45.389  1.00 40.61  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.141  11.376  44.680  1.00 43.05  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.097  12.132  45.470  1.00 45.70  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.320  11.537  46.200  1.00 51.10  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.466  10.961  43.390  1.00 36.98  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.144  10.031  42.409  1.00 31.11  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.102  9.738   41.348  1.00 30.42  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.407  10.661  41.803  1.00 32.75  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.076  13.450  45.301  1.00 53.24  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.955  14.262  45.744  1.00 43.58  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.334  14.937  44.531  1.00 50.10  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.987  15.714  43.840  1.00 50.70  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.382  15.313  46.746  1.00 46.04  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.203  16.154  47.204  1.00 57.33  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.588  17.254  48.168  1.00 53.47  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.684  18.064  47.660  1.00 63.12  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.925  18.022  48.135  1.00 78.86  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.233  17.203  49.139  1.00 72.38  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 32.860  18.805  47.606  1.00 87.77  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.074  14.616  44.262  1.00 51.27  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.370  15.183  43.132  1.00 42.49  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.532  16.387  43.516  1.00 49.36  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.679  16.953  44.607  1.00 46.39  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.620  16.758  42.626  1.00 44.68  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.818  17.947  42.825  1.00 41.78  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.339  17.707  42.482  1.00 48.77  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 23.012  17.055  41.490  1.00 54.19  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.415  19.136  42.013  1.00 42.03  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.608  20.418  42.228  1.00 36.37  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.530  18.787  40.514  1.00 24.39  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.180  21.614  41.474  1.00 29.35  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.453  18.229  43.323  1.00 45.14  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 21.017  18.133  43.102  1.00 44.03  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.603  19.296  42.226  1.00 52.83  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.666  20.450  42.651  1.00 68.55  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.280  18.183  44.452  1.00 47.09  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.757  18.255  44.385  1.00 41.78  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 18.123  18.628  45.736  1.00 41.52  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.926  19.447  45.543  1.00 68.58  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.707  19.150  45.997  1.00 90.46  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.499  18.044  46.710  1.00 99.89  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.685  19.970  45.747  1.00 89.00  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.207  19.003  40.991  1.00 44.16  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.807  20.055  40.062  1.00 36.59  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.309  20.155  40.011  1.00 45.60  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.621  19.184  40.324  1.00 52.09  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.299  19.773  38.655  1.00 32.40  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.802  19.683  38.456  1.00 38.87  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.080  19.411  37.004  1.00 31.87  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.465  20.947  38.924  1.00 31.41  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.810  21.326  39.609  1.00 39.57  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.376  21.522  39.404  1.00 44.26  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.990  21.333  37.932  1.00 45.85  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.676  21.810  37.033  1.00 49.16  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.917  22.894  39.928  1.00 59.18  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 15.592  22.907  41.434  1.00 76.41  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 15.319  24.309  41.976  1.00 85.53  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 16.614  25.057  42.296  1.00 88.69  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 16.361  26.468  42.733  1.00 93.02  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.914  20.596  37.692  1.00 45.26  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.303  20.556  36.372  1.00 42.65  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.842  20.931  36.521  1.00 44.11  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.297  20.874  37.618  1.00 46.12  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.433  19.194  35.751  1.00 43.57  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.205  21.323  35.416  1.00 40.53  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.811  21.754  35.460  1.00 43.08  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.962   20.928  36.417  1.00 51.54  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.168   21.499  37.169  1.00 63.02  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.361  21.536  34.027  1.00 44.52  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.583  21.880  33.232  1.00 42.60  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.751  21.379  34.048  1.00 39.26  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 10.137  19.610  36.408  1.00 46.37  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 9.217   18.726  37.103  1.00 43.65  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.685   18.267  38.464  1.00 58.06  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.926   17.624  39.196  1.00 53.75  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.930  18.601  38.803  1.00 50.06  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.543  18.140  40.039  1.00 49.72  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 13.061  18.073  39.984  1.00 55.41  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.678  18.379  38.958  1.00 60.89  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.678  17.685  41.105  1.00 45.48  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 15.137  17.544  41.250  1.00 31.30  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.732  16.322  40.552  1.00 57.91  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 15.062  15.290  40.418  1.00 65.11  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.320  17.407  42.776  1.00 32.04  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.981  16.935  43.291  1.00 33.52  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.979  17.605  42.398  1.00 35.27  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.991  16.444  40.135  1.00 47.36  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.740  15.317  39.602  1.00 48.35  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 19.105  15.284  40.250  1.00 47.72  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.609  16.307  40.708  1.00 50.20  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.954  15.414  38.077  1.00 45.41  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.630  15.414  37.343  1.00 44.13  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.730  16.649  37.758  1.00 48.57  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.703  14.099  40.279  1.00 47.36  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.062  13.946  40.772  1.00 42.83  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 22.034  14.089  39.601  1.00 45.91  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.860  13.473  38.547  1.00 40.59  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.235  12.581  41.447  1.00 41.30  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.480  12.467  42.645  1.00 48.92  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 23.051  14.920  39.761  1.00 40.78  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 24.038  15.040  38.707  1.00 32.54  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.446  14.938  39.266  1.00 46.69  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.784  15.560  40.299  1.00 34.60  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.847  16.316  37.925  1.00 43.06  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.245  14.117  38.586  1.00 39.97  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.643  13.910  38.918  1.00 38.34  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.482  14.248  37.684  1.00 37.96  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.361  13.624  36.637  1.00 31.74  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.844  12.462  39.338  1.00 40.09  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.056  12.074  40.544  1.00 40.64  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 27.578  12.262  41.822  1.00 41.98  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 25.792  11.533  40.411  1.00 41.38  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 26.850  11.906  42.950  1.00 44.52  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 25.053  11.164  41.532  1.00 41.76  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.585  11.349  42.808  1.00 41.37  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 29.331  15.250  37.803  1.00 40.17  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.874  15.882  36.618  1.00 40.75  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.382  15.959  36.717  1.00 42.94  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.930  16.236  37.777  1.00 40.13  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.276  17.284  36.460  1.00 31.42  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.751  17.452  36.389  1.00 31.39  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.427  18.929  36.153  1.00 40.29  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 27.078  16.595  35.308  1.00 17.75  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 32.058  15.704  35.610  1.00 35.95  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.500  15.653  35.645  1.00 42.55  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.066  14.487  36.441  1.00 45.18  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.060  14.640  37.144  1.00 40.70  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.446  13.317  36.337  1.00 41.24  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.041  12.108  36.900  1.00 44.44  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.152  11.566  35.988  1.00 47.48  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 34.871  11.075  34.900  1.00 50.10  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 32.991  11.017  37.029  1.00 41.50  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.784  11.552  37.806  1.00 38.99  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.615  9.765   37.625  1.00 24.55  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.551  10.685  37.710  1.00 27.02  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.415  11.656  36.424  1.00 45.23  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.549  11.204  35.595  1.00 41.68  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.584  9.689   35.420  1.00 38.99  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.568  8.966   36.412  1.00 43.37  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.766  11.635  36.415  1.00 45.64  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.250  11.657  37.866  1.00 42.23  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.850  12.181  37.732  1.00 41.40  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.659  9.213   34.184  1.00 40.57  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.653  7.774   33.945  1.00 48.80  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.939  7.284   33.301  1.00 46.88  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.070  6.109   32.958  1.00 59.57  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.468  7.382   33.075  1.00 49.82  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.538  7.935   31.695  1.00 58.20  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 36.186  9.249   31.450  1.00 42.02  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 36.966  7.140   30.634  1.00 65.22  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 36.251  9.760   30.169  1.00 48.69  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 37.034  7.653   29.352  1.00 53.27  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.680  8.966   29.123  1.00 42.55  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.892  8.187   33.145  1.00 35.29  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.165  7.841   32.538  1.00 37.83  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.244  8.790   33.045  1.00 46.16  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.939  9.894   33.505  1.00 43.57  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.055  7.889   31.025  1.00 31.92  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.496  8.349   33.007  1.00 41.32  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.584  9.231   33.388  1.00 48.10  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.709  10.278  32.303  1.00 54.53  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.589  9.950   31.128  1.00 54.59  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.880  8.445   33.539  1.00 45.53  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 45.975  7.694   34.856  1.00 50.20  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.252  8.612   36.029  1.00 55.60  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.196  9.423   35.924  1.00 71.74  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.532  8.534   37.051  1.00 49.90  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.912  11.548  32.694  1.00 53.90  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.991  12.669  31.746  1.00 46.31  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.949  12.372  30.594  1.00 46.43  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.135  12.153  30.823  1.00 64.72  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.557  13.811  32.597  1.00 42.86  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.191  13.487  33.968  1.00 36.33  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.142  11.982  34.082  1.00 39.20  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.437  12.351  29.359  1.00 33.51  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.264  11.948  28.223  1.00 38.91  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.191  13.059  27.772  1.00 43.91  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.126  13.456  26.612  1.00 33.93  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.232  11.659  27.137  1.00 31.09  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.098  12.505  27.470  1.00 28.93  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.043  12.593  28.961  1.00 28.37  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.047  13.532  28.675  1.00 37.21  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.931  14.658  28.386  1.00 36.71  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.392  14.259  28.262  1.00 45.38  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.753  13.093  28.435  1.00 50.26  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.837  15.727  29.468  1.00 43.27  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.405  16.219  29.605  1.00 35.76  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.342  15.175  30.783  1.00 30.96  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.225  15.251  27.968  1.00 41.61  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.636  15.036  27.703  1.00 42.99  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.898  13.863  26.787  1.00 54.64  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.361  13.780  25.682  1.00 60.19  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.716  12.942  27.280  1.00 63.87  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.154  11.754  26.555  1.00 57.26  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 53.055  10.703  26.335  1.00 50.01  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.281  9.693   25.664  1.00 54.00  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.265  11.119  27.351  1.00 49.33  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.751  10.860  28.641  1.00 60.14  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.878  10.933  26.905  1.00 43.75  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.715  10.098  26.614  1.00 47.16  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.853  10.685  25.499  1.00 48.04  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.844  10.098  25.128  1.00 41.12  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.832  9.928   27.842  1.00 52.26  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.435  9.188   28.995  1.00 53.41  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.319  8.822   29.976  1.00 75.32  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.828  8.333   31.255  1.00 92.66  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.806  9.034   32.383  1.00 103.65 ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 49.286  10.259  32.400  1.00 98.64  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 50.295  8.504   33.498  1.00 111.98 ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.228  11.851  24.984  1.00 51.08  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.498  12.431  23.862  1.00 48.12  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.618  11.454  22.720  1.00 38.49  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.697  10.944  22.477  1.00 40.59  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.077  13.800  23.470  1.00 47.56  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.421  14.455  22.266  1.00 34.61  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.279  15.620  21.716  1.00 41.46  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.975  16.905  22.338  1.00 35.22  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.669  18.027  22.153  1.00 46.75  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.725  18.037  21.356  1.00 38.61  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.304  19.151  22.769  1.00 43.22  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.503  11.201  22.036  1.00 43.65  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.396  10.243  20.916  1.00 43.33  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.279  8.772   21.352  1.00 47.31  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.983  7.901   20.531  1.00 46.73  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.552  10.358  19.914  1.00 43.77  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.791  11.738  19.383  1.00 42.98  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.756  12.508  18.903  1.00 51.20  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.073  12.254  19.345  1.00 38.02  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.991  13.775  18.404  1.00 34.85  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.306  13.520  18.856  1.00 44.16  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.256  14.282  18.389  1.00 37.04  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.542  8.502   22.628  1.00 49.54  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.522  7.144   23.153  1.00 45.36  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.131  6.728   23.584  1.00 45.10  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.308  7.566   23.932  1.00 44.58  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.457  7.022   24.351  1.00 46.58  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.906  7.163   24.008  1.00 51.57  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.380  5.974   22.758  1.00 70.47  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.731  4.538   23.754  1.00 42.65  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.876  5.412   23.573  1.00 48.15  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.647  4.812   24.098  1.00 36.69  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.469  5.217   25.555  1.00 37.15  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.449  5.363   26.280  1.00 37.89  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.923  3.324   23.998  1.00 41.95  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.942  3.208   22.918  1.00 53.79  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.809  4.403   23.053  1.00 48.88  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.222  5.429   25.987  1.00 40.55  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 44.007  5.910   27.354  1.00 39.73  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.347  4.869   28.393  1.00 54.16  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.008  3.683   28.226  1.00 53.38  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.512  6.186   27.396  1.00 40.18  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.953  5.223   26.392  1.00 53.38  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.957  5.187   25.279  1.00 39.61  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 45.020  5.328   29.447  1.00 55.66  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.208  4.559   30.666  1.00 54.19  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 44.070  4.873   31.642  1.00 62.26  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.716  6.038   31.864  1.00 58.11  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.565  4.877   31.299  1.00 55.04  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.761  4.536   30.411  1.00 80.40  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 49.108  4.884   31.056  1.00 97.47  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.114  5.496   32.145  1.00 103.39 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 50.164  4.548   30.471  1.00 95.00  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.490  3.822   32.230  1.00 63.66  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.414  3.906   33.229  1.00 60.81  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.811  4.790   34.415  1.00 54.22  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.918  4.632   34.947  1.00 48.53  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.270  2.453   33.706  1.00 43.15  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.825  1.642   32.601  1.00 51.15  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.941  2.440   32.013  1.00 43.19  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.914  5.681   34.830  1.00 44.49  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.178  6.597   35.940  1.00 39.05  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.568  5.909   37.235  1.00 50.76  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.964  4.916   37.639  1.00 60.92  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.966  7.472   36.217  1.00 34.12  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 41.119  8.312   37.475  1.00 48.39  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.121  9.428   37.288  1.00 53.67  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.970  10.477  38.381  1.00 58.45  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.942  11.601  38.260  1.00 57.67  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.568  6.464   37.901  1.00 46.49  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.058  5.881   39.134  1.00 45.97  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.312  6.470   40.323  1.00 56.22  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 43.117  7.679   40.397  1.00 56.35  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.562  6.114   39.271  1.00 40.75  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.397  5.313   38.283  1.00 45.46  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.857  5.214   38.724  1.00 52.86  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.437  6.533   38.948  1.00 76.09  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.121  7.213   38.031  1.00 96.62  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.326  6.693   36.822  1.00 97.02  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.605  8.413   38.327  1.00 100.07 ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.909  5.609   41.268  1.00 55.80  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.059  5.999   42.396  1.00 53.53  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.559  7.259   43.069  1.00 52.98  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.759  7.501   43.109  1.00 54.26  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.184  4.815   43.345  1.00 36.33  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.454  3.669   42.453  1.00 64.92  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.329  4.202   41.365  1.00 54.95  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.636  8.059   43.583  1.00 54.17  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.997  9.275   44.294  1.00 48.62  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.603  9.153   45.753  1.00 56.35  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.871  8.231   46.141  1.00 61.32  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.289  10.478  43.681  1.00 38.46  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.809  10.329  43.693  1.00 53.72  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.942  10.729  44.677  1.00 52.19  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.006  9.722   42.676  1.00 53.69  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.648  10.422  44.318  1.00 45.23  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.663  9.799   43.099  1.00 32.89  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.292  9.124   41.448  1.00 46.10  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.618  9.298   42.340  1.00 36.48  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.247  8.635   40.689  1.00 48.88  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.925  8.724   41.137  1.00 41.33  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.090  10.091  46.561  1.00 58.09  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.726  10.140  47.965  1.00 59.44  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.770  11.294  48.226  1.00 59.76  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.781  12.297  47.508  1.00 59.02  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.972  10.319  48.816  1.00 65.23  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.571  11.562  48.520  1.00 69.58  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.964  11.150  49.272  1.00 55.01  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.999  12.165  49.637  1.00 45.30  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.773  12.096  48.753  1.00 48.35  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.712  11.306  47.819  1.00 47.33  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.782  12.922  49.055  1.00 54.72  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.599  13.007  48.215  1.00 44.82  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.871  14.006  47.097  1.00 55.33  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.146  15.178  47.352  1.00 63.62  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.371  13.459  49.030  1.00 43.00  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.089  13.321  48.210  1.00 45.67  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.269  12.659  50.317  1.00 44.17  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.815  13.531  45.861  1.00 45.96  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.981  14.383  44.700  1.00 48.05  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.703  15.175  44.430  1.00 56.64  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.630  14.594  44.311  1.00 50.57  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.307  13.518  43.490  1.00 47.60  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.599  14.181  42.137  1.00 48.37  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.429  13.245  41.292  1.00 49.36  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.322  14.537  41.381  1.00 55.33  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.818  16.499  44.337  1.00 57.20  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.681  17.338  43.973  1.00 46.74  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.284  17.092  42.528  1.00 50.40  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.012  17.456  41.610  1.00 52.79  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.017  18.816  44.135  1.00 56.78  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.848  19.725  43.770  1.00 70.43  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.534  19.843  42.565  1.00 69.58  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.246  20.322  44.691  1.00 77.55  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.119  16.487  42.332  1.00 54.18  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.607  16.213  41.000  1.00 45.07  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.379  17.080  40.700  1.00 48.25  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.338  16.584  40.255  1.00 43.47  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.281  14.729  40.865  1.00 37.70  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.514  18.381  40.938  1.00 52.45  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.373  19.286  40.829  1.00 52.69  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.442  20.235  39.633  1.00 49.78  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.533  21.023  39.415  1.00 54.35  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.167  20.117  42.113  1.00 57.56  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.054  21.244  42.112  1.00 54.91  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.392  19.258  43.364  1.00 50.63  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.510  20.161  38.850  1.00 51.18  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.645  21.060  37.709  1.00 35.31  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.240  20.350  36.532  1.00 45.16  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.860  19.296  36.666  1.00 49.82  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.567  22.242  38.008  1.00 40.80  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.914  21.773  38.075  1.00 65.72  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 31.206  22.873  39.333  1.00 40.42  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 31.054  20.937  35.363  1.00 43.11  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.619  20.345  34.172  1.00 40.57  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 33.119  20.520  34.126  1.00 43.98  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.655  21.567  34.488  1.00 59.04  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.968  20.900  32.914  1.00 27.39  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.651  20.269  32.606  1.00 45.49  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.575  18.907  32.326  1.00 31.00  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.480  21.022  32.616  1.00 45.54  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 28.356  18.304  32.036  1.00 38.73  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 27.249  20.425  32.347  1.00 44.27  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 27.187  19.061  32.056  1.00 45.15  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.782  19.467  33.668  1.00 40.17  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.205  19.488  33.380  1.00 38.33  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.603  20.127  32.040  1.00 48.32  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.759  20.567  31.235  1.00 41.50  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.744  18.062  33.419  1.00 42.01  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.225  17.659  34.778  1.00 51.95  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.552  18.294  35.136  1.00 59.91  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 38.162  19.008  34.331  1.00 70.36  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 38.013  18.032  36.353  1.00 55.96  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.916  20.157  31.824  1.00 52.83  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.522  20.700  30.621  1.00 48.19  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 37.041  20.040  29.342  1.00 52.36  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.772  18.826  29.306  1.00 43.83  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 39.037  20.557  30.716  1.00 47.51  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.647  21.524  31.703  1.00 43.27  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.187  22.647  31.846  1.00 42.36  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.691  21.093  32.383  1.00 47.72  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.942  20.844  28.289  1.00 48.04  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.671  20.318  26.957  1.00 33.62  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.970  19.947  26.261  1.00 38.46  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 39.003  20.604  26.442  1.00 52.52  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.875  21.300  26.111  1.00 35.31  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.648  20.723  24.733  1.00 29.45  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.546  21.631  26.806  1.00 29.29  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.914  18.862  25.497  1.00 33.61  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 39.084  18.313  24.837  1.00 32.63  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.540  19.283  23.784  1.00 33.35  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.714  19.853  23.094  1.00 41.20  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.724  16.984  24.181  1.00 42.10  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.538  15.649  25.352  1.00 47.35  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.848  19.465  23.653  1.00 29.81  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.380  20.503  22.773  1.00 32.52  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.868  20.395  21.336  1.00 42.93  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.926  19.322  20.723  1.00 43.41  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.911  20.526  22.811  1.00 40.84  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.446  21.921  23.016  1.00 49.37  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.293  22.885  22.032  1.00 51.17  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 44.070  22.287  24.203  1.00 44.31  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 43.762  24.156  22.204  1.00 47.09  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 44.551  23.564  24.385  1.00 39.26  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.385  24.501  23.382  1.00 52.18  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.845  25.794  23.541  1.00 64.62  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.354  21.506  20.804  1.00 42.27  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.697  21.478  19.493  1.00 43.24  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.649  22.832  18.778  1.00 49.10  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.817  23.891  19.392  1.00 39.19  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.278  20.921  19.622  1.00 42.84  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.326  21.793  20.443  1.00 29.59  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.044  21.064  20.820  1.00 50.65  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.942  21.435  20.379  1.00 41.06  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.181  20.008  21.638  1.00 35.18  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.421  22.783  17.470  1.00 49.80  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.288  23.995  16.684  1.00 53.46  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.950  24.606  17.062  1.00 53.15  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.999  23.884  17.362  1.00 62.20  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 39.372  23.671  15.187  1.00 44.56  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.834  24.746  14.264  1.00 43.22  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.481  24.790  13.933  1.00 48.75  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.675  25.704  13.705  1.00 51.59  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.977  25.763  13.088  1.00 53.84  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.179  26.687  12.845  1.00 49.47  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.832  26.708  12.541  1.00 60.79  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.326  27.677  11.703  1.00 68.13  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.882  25.930  17.094  1.00 44.87  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.638  26.612  17.471  1.00 54.30  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.098  27.420  16.305  1.00 47.07  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.824  28.207  15.706  1.00 52.81  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.818  27.540  18.703  1.00 46.02  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.596  28.414  18.897  1.00 41.24  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.095  26.724  19.953  1.00 35.71  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.824  27.209  15.995  1.00 43.06  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.162  27.888  14.891  1.00 61.04  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 34.072  29.412  15.070  1.00 63.37  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.621  29.907  16.100  1.00 70.33  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.760  27.313  14.704  1.00 62.68  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.370  27.212  13.252  1.00 76.01  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 32.754  26.199  12.619  1.00 92.43  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.699  28.143  12.747  1.00 54.62  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.487  30.153  14.051  1.00 65.66  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.423  31.617  14.105  1.00 79.71  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.638  32.224  12.940  1.00 78.24  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.532  33.450  12.824  1.00 70.82  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.829  32.247  14.131  1.00 77.99  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.728  31.456  13.335  1.00 70.01  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.344  32.338  15.564  1.00 66.01  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 33.085  31.354  12.095  1.00 71.82  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.415  31.773  10.876  1.00 58.84  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.393  32.840  11.189  1.00 72.73  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.370  33.901  10.567  1.00 84.57  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.742  30.583  10.187  1.00 52.71  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.805  30.912  9.016   1.00 70.68  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 31.503  31.805  8.008   1.00 75.68  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.263  29.663  8.328   1.00 67.48  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.555  32.556  12.173  1.00 68.97  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.470  33.450  12.522  1.00 64.78  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.546  33.795  14.005  1.00 72.18  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.970  33.102  14.837  1.00 68.73  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.137  32.797  12.176  1.00 54.82  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.873  32.628  10.684  1.00 60.69  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.750  33.733  9.848   1.00 55.57  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.699  31.361  10.122  1.00 54.97  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.485  33.585  8.484   1.00 68.21  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.437  31.198  8.758   1.00 56.19  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.330  32.313  7.936   1.00 72.67  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.061  32.168  6.571   1.00 65.91  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.276  34.877  14.328  1.00 86.00  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.605  35.370  15.672  1.00 79.39  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.392  35.836  16.478  1.00 70.02  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.727  36.786  16.074  1.00 67.26  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.510  36.573  15.381  1.00 81.69  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.049  36.324  14.019  1.00 81.43  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 30.922  35.690  13.284  1.00 84.46  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 29.124  35.180  17.607  1.00 68.86  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 28.054  35.587  18.511  1.00 75.48  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.663  35.140  18.100  1.00 73.95  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.658  35.535  18.700  1.00 70.47  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.621  34.310  17.064  1.00 68.41  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.392  33.771  16.516  1.00 53.03  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 25.114  32.441  17.193  1.00 47.69  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.966  31.560  17.215  1.00 53.35  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.569  33.584  15.014  1.00 57.45  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.400  32.952  14.329  1.00 56.61  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.200  33.633  14.206  1.00 63.21  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.513  31.691  13.776  1.00 52.83  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.128  33.060  13.562  1.00 62.43  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.450  31.111  13.127  1.00 55.80  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.254  31.792  13.023  1.00 63.51  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.921  32.323  17.761  1.00 49.88  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.533  31.183  18.578  1.00 46.55  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.583  29.900  17.780  1.00 55.38  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.984  28.847  18.294  1.00 58.76  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.118  31.395  19.125  1.00 63.85  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.533  30.189  19.835  1.00 80.14  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.804  30.208  21.323  1.00 87.86  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.906  31.330  21.877  1.00 86.50  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 21.910  29.108  21.925  1.00 83.77  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.173  29.996  16.518  1.00 53.26  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.182  28.859  15.615  1.00 55.14  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.480  28.084  15.675  1.00 56.81  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.466  26.852  15.716  1.00 59.60  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.601  28.806  15.688  1.00 49.09  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.922  28.184  15.776  1.00 43.20  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.438  28.050  17.221  1.00 55.82  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.943  26.979  17.624  1.00 41.53  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.969  28.926  14.892  1.00 53.09  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 28.138  30.270  15.351  1.00 61.52  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.549  28.932  13.430  1.00 42.18  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.300  29.125  18.002  1.00 47.82  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.838  29.139  19.362  1.00 45.68  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.449  27.907  20.177  1.00 44.16  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 28.273  27.343  20.887  1.00 55.15  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.428  30.408  20.094  1.00 55.70  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 27.978  31.694  19.469  1.00 71.25  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.496  31.789  19.535  1.00 83.41  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.114  30.986  20.272  1.00 82.01  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 30.072  32.666  18.847  1.00 86.67  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 26.194  27.490  20.061  1.00 44.66  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.653  26.372  20.837  1.00 38.56  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.431  25.056  20.674  1.00 47.67  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.220  24.103  21.428  1.00 53.05  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.191  26.143  20.447  1.00 34.51  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 24.001  25.759  18.966  1.00 34.86  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.297  25.452  18.452  1.00 52.86  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.935  23.954  19.382  1.00 45.14  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.305  24.993  19.677  1.00 39.60  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 28.111  23.801  19.472  1.00 30.44  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.545  24.011  19.963  1.00 30.39  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.303  23.056  20.157  1.00 38.87  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 28.097  23.417  17.990  1.00 34.40  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.716  23.285  17.417  1.00 37.35  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.107  24.142  16.558  1.00 40.11  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.763  22.239  17.684  1.00 43.52  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.842  23.698  16.262  1.00 46.19  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.605  22.531  16.939  1.00 46.13  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.776  21.092  18.486  1.00 34.03  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.467  21.718  16.970  1.00 44.25  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.651  20.275  18.505  1.00 28.04  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.515  20.592  17.751  1.00 44.04  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.907  25.271  20.177  1.00 46.49  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.228  25.638  20.658  1.00 32.19  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.431  25.253  22.123  1.00 42.69  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.496  25.338  22.923  1.00 40.86  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.449  27.141  20.471  1.00 42.74  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.786  27.518  19.027  1.00 45.69  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.265  26.693  18.246  1.00 49.45  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.542  28.768  18.674  1.00 43.35  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.660  24.838  22.484  1.00 46.85  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.008  24.442  23.862  1.00 46.29  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.617  25.500  24.888  1.00 45.10  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.835  26.702  24.659  1.00 47.47  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.536  24.322  23.832  1.00 40.64  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.878  24.114  22.419  1.00 42.19  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.834  24.836  21.596  1.00 42.82  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.055  25.046  26.007  1.00 38.33  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.560  25.934  27.048  1.00 31.37  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.306  25.738  28.357  1.00 31.59  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.806  26.082  29.423  1.00 39.29  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 30.056  25.784  27.224  1.00 31.11  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.651  24.377  27.648  1.00 53.47  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.464  23.473  27.639  1.00 28.31  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.383  24.194  28.010  1.00 48.86  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.500  25.153  28.261  1.00 34.66  ? 90   ARG A N   1 
ATOM   702  C CA  A ARG A 1 90  ? 34.441  25.109  29.375  0.48 34.59  ? 90   ARG A CA  1 
ATOM   703  C CA  B ARG A 1 90  ? 34.444  25.076  29.375  0.52 34.41  ? 90   ARG A CA  1 
ATOM   704  C C   . ARG A 1 90  ? 35.841  25.174  28.797  1.00 38.68  ? 90   ARG A C   1 
ATOM   705  O O   . ARG A 1 90  ? 36.043  24.913  27.619  1.00 43.12  ? 90   ARG A O   1 
ATOM   706  C CB  A ARG A 1 90  ? 34.279  23.845  30.222  0.48 34.13  ? 90   ARG A CB  1 
ATOM   707  C CB  B ARG A 1 90  ? 34.313  23.764  30.150  0.52 33.20  ? 90   ARG A CB  1 
ATOM   708  C CG  A ARG A 1 90  ? 32.967  23.754  30.984  0.48 38.82  ? 90   ARG A CG  1 
ATOM   709  C CG  B ARG A 1 90  ? 32.952  23.534  30.767  0.52 37.18  ? 90   ARG A CG  1 
ATOM   710  C CD  A ARG A 1 90  ? 32.798  24.877  32.001  0.48 45.71  ? 90   ARG A CD  1 
ATOM   711  C CD  B ARG A 1 90  ? 32.600  24.628  31.749  0.52 43.59  ? 90   ARG A CD  1 
ATOM   712  N NE  A ARG A 1 90  ? 31.497  24.802  32.664  0.48 45.14  ? 90   ARG A NE  1 
ATOM   713  N NE  B ARG A 1 90  ? 32.886  24.239  33.124  0.52 47.89  ? 90   ARG A NE  1 
ATOM   714  C CZ  A ARG A 1 90  ? 30.423  25.487  32.284  0.48 43.86  ? 90   ARG A CZ  1 
ATOM   715  C CZ  B ARG A 1 90  ? 32.949  25.093  34.136  0.52 51.65  ? 90   ARG A CZ  1 
ATOM   716  N NH1 A ARG A 1 90  ? 30.489  26.319  31.251  0.48 32.82  ? 90   ARG A NH1 1 
ATOM   717  N NH1 B ARG A 1 90  ? 32.747  26.389  33.921  0.52 51.21  ? 90   ARG A NH1 1 
ATOM   718  N NH2 A ARG A 1 90  ? 29.281  25.346  32.943  0.48 42.33  ? 90   ARG A NH2 1 
ATOM   719  N NH2 B ARG A 1 90  ? 33.215  24.652  35.359  0.52 52.51  ? 90   ARG A NH2 1 
ATOM   720  N N   . GLU A 1 91  ? 36.799  25.541  29.630  1.00 40.36  ? 91   GLU A N   1 
ATOM   721  C CA  . GLU A 1 91  ? 38.172  25.660  29.199  1.00 33.17  ? 91   GLU A CA  1 
ATOM   722  C C   . GLU A 1 91  ? 38.672  24.478  28.364  1.00 51.26  ? 91   GLU A C   1 
ATOM   723  O O   . GLU A 1 91  ? 38.371  23.304  28.647  1.00 42.06  ? 91   GLU A O   1 
ATOM   724  C CB  . GLU A 1 91  ? 39.059  25.822  30.413  1.00 34.12  ? 91   GLU A CB  1 
ATOM   725  C CG  . GLU A 1 91  ? 40.515  25.867  30.082  1.00 44.31  ? 91   GLU A CG  1 
ATOM   726  C CD  . GLU A 1 91  ? 41.363  25.865  31.328  1.00 58.80  ? 91   GLU A CD  1 
ATOM   727  O OE1 . GLU A 1 91  ? 40.790  25.689  32.429  1.00 66.91  ? 91   GLU A OE1 1 
ATOM   728  O OE2 . GLU A 1 91  ? 42.593  26.030  31.208  1.00 64.89  ? 91   GLU A OE2 1 
ATOM   729  N N   . LEU A 1 92  ? 39.457  24.810  27.343  1.00 37.35  ? 92   LEU A N   1 
ATOM   730  C CA  . LEU A 1 92  ? 40.065  23.823  26.479  1.00 38.58  ? 92   LEU A CA  1 
ATOM   731  C C   . LEU A 1 92  ? 41.317  23.242  27.117  1.00 39.86  ? 92   LEU A C   1 
ATOM   732  O O   . LEU A 1 92  ? 42.184  23.978  27.573  1.00 36.95  ? 92   LEU A O   1 
ATOM   733  C CB  . LEU A 1 92  ? 40.408  24.439  25.129  1.00 40.44  ? 92   LEU A CB  1 
ATOM   734  C CG  . LEU A 1 92  ? 39.248  24.666  24.159  1.00 40.09  ? 92   LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 92  ? 39.777  25.238  22.883  1.00 33.86  ? 92   LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 92  ? 38.549  23.341  23.889  1.00 49.45  ? 92   LEU A CD2 1 
ATOM   737  N N   . SER A 1 93  ? 41.406  21.914  27.158  1.00 42.84  ? 93   SER A N   1 
ATOM   738  C CA  . SER A 1 93  ? 42.590  21.265  27.709  1.00 34.11  ? 93   SER A CA  1 
ATOM   739  C C   . SER A 1 93  ? 42.737  19.830  27.227  1.00 45.38  ? 93   SER A C   1 
ATOM   740  O O   . SER A 1 93  ? 41.740  19.173  26.904  1.00 53.15  ? 93   SER A O   1 
ATOM   741  C CB  . SER A 1 93  ? 42.562  21.331  29.235  1.00 33.23  ? 93   SER A CB  1 
ATOM   742  O OG  . SER A 1 93  ? 43.549  20.513  29.830  1.00 40.63  ? 93   SER A OG  1 
ATOM   743  N N   . GLU A 1 94  ? 43.984  19.359  27.164  1.00 39.19  ? 94   GLU A N   1 
ATOM   744  C CA  . GLU A 1 94  ? 44.274  17.991  26.759  1.00 41.90  ? 94   GLU A CA  1 
ATOM   745  C C   . GLU A 1 94  ? 43.905  17.081  27.903  1.00 36.37  ? 94   GLU A C   1 
ATOM   746  O O   . GLU A 1 94  ? 43.748  15.881  27.727  1.00 51.53  ? 94   GLU A O   1 
ATOM   747  C CB  . GLU A 1 94  ? 45.753  17.814  26.412  1.00 43.22  ? 94   GLU A CB  1 
ATOM   748  C CG  . GLU A 1 94  ? 46.154  18.269  25.020  1.00 35.05  ? 94   GLU A CG  1 
ATOM   749  C CD  . GLU A 1 94  ? 47.600  17.930  24.691  1.00 48.96  ? 94   GLU A CD  1 
ATOM   750  O OE1 . GLU A 1 94  ? 48.492  18.763  24.973  1.00 56.40  ? 94   GLU A OE1 1 
ATOM   751  O OE2 . GLU A 1 94  ? 47.849  16.833  24.148  1.00 47.52  ? 94   GLU A OE2 1 
ATOM   752  N N   . ASP A 1 95  ? 43.792  17.671  29.085  1.00 38.67  ? 95   ASP A N   1 
ATOM   753  C CA  . ASP A 1 95  ? 43.260  16.980  30.250  1.00 40.51  ? 95   ASP A CA  1 
ATOM   754  C C   . ASP A 1 95  ? 41.770  17.180  30.248  1.00 36.55  ? 95   ASP A C   1 
ATOM   755  O O   . ASP A 1 95  ? 41.278  18.157  30.801  1.00 47.34  ? 95   ASP A O   1 
ATOM   756  C CB  . ASP A 1 95  ? 43.839  17.563  31.536  1.00 45.26  ? 95   ASP A CB  1 
ATOM   757  C CG  . ASP A 1 95  ? 43.321  16.866  32.774  1.00 49.07  ? 95   ASP A CG  1 
ATOM   758  O OD1 . ASP A 1 95  ? 42.323  16.132  32.668  1.00 52.34  ? 95   ASP A OD1 1 
ATOM   759  O OD2 . ASP A 1 95  ? 43.898  17.060  33.860  1.00 49.22  ? 95   ASP A OD2 1 
ATOM   760  N N   . CYS A 1 96  ? 41.061  16.239  29.635  1.00 45.70  ? 96   CYS A N   1 
ATOM   761  C CA  . CYS A 1 96  ? 39.643  16.387  29.351  1.00 36.30  ? 96   CYS A CA  1 
ATOM   762  C C   . CYS A 1 96  ? 38.840  15.083  29.432  1.00 39.13  ? 96   CYS A C   1 
ATOM   763  O O   . CYS A 1 96  ? 37.643  15.093  29.166  1.00 44.65  ? 96   CYS A O   1 
ATOM   764  C CB  . CYS A 1 96  ? 39.479  16.953  27.939  1.00 44.91  ? 96   CYS A CB  1 
ATOM   765  S SG  . CYS A 1 96  ? 40.085  15.819  26.653  1.00 39.12  ? 96   CYS A SG  1 
ATOM   766  N N   . LEU A 1 97  ? 39.481  13.963  29.760  1.00 38.09  ? 97   LEU A N   1 
ATOM   767  C CA  . LEU A 1 97  ? 38.771  12.677  29.854  1.00 33.70  ? 97   LEU A CA  1 
ATOM   768  C C   . LEU A 1 97  ? 37.897  12.521  31.138  1.00 42.57  ? 97   LEU A C   1 
ATOM   769  O O   . LEU A 1 97  ? 38.328  11.990  32.152  1.00 32.56  ? 97   LEU A O   1 
ATOM   770  C CB  . LEU A 1 97  ? 39.763  11.528  29.708  1.00 39.19  ? 97   LEU A CB  1 
ATOM   771  C CG  . LEU A 1 97  ? 40.535  11.649  28.389  1.00 39.08  ? 97   LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 97  ? 41.472  10.481  28.156  1.00 30.60  ? 97   LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 97  ? 39.592  11.812  27.218  1.00 29.62  ? 97   LEU A CD2 1 
ATOM   774  N N   . TYR A 1 98  ? 36.657  12.996  31.077  1.00 42.55  ? 98   TYR A N   1 
ATOM   775  C CA  . TYR A 1 98  ? 35.773  13.020  32.234  1.00 39.02  ? 98   TYR A CA  1 
ATOM   776  C C   . TYR A 1 98  ? 34.391  12.659  31.749  1.00 36.58  ? 98   TYR A C   1 
ATOM   777  O O   . TYR A 1 98  ? 34.039  13.012  30.638  1.00 47.50  ? 98   TYR A O   1 
ATOM   778  C CB  . TYR A 1 98  ? 35.754  14.417  32.870  1.00 42.24  ? 98   TYR A CB  1 
ATOM   779  C CG  . TYR A 1 98  ? 37.114  14.856  33.393  1.00 35.75  ? 98   TYR A CG  1 
ATOM   780  C CD1 . TYR A 1 98  ? 38.031  15.485  32.565  1.00 25.65  ? 98   TYR A CD1 1 
ATOM   781  C CD2 . TYR A 1 98  ? 37.487  14.605  34.707  1.00 25.58  ? 98   TYR A CD2 1 
ATOM   782  C CE1 . TYR A 1 98  ? 39.273  15.866  33.034  1.00 29.30  ? 98   TYR A CE1 1 
ATOM   783  C CE2 . TYR A 1 98  ? 38.731  14.981  35.182  1.00 31.72  ? 98   TYR A CE2 1 
ATOM   784  C CZ  . TYR A 1 98  ? 39.614  15.618  34.341  1.00 29.65  ? 98   TYR A CZ  1 
ATOM   785  O OH  . TYR A 1 98  ? 40.854  15.992  34.808  1.00 44.05  ? 98   TYR A OH  1 
ATOM   786  N N   . LEU A 1 99  ? 33.620  11.927  32.549  1.00 37.99  ? 99   LEU A N   1 
ATOM   787  C CA  . LEU A 1 99  ? 32.240  11.656  32.171  1.00 39.67  ? 99   LEU A CA  1 
ATOM   788  C C   . LEU A 1 99  ? 31.247  12.269  33.149  1.00 36.76  ? 99   LEU A C   1 
ATOM   789  O O   . LEU A 1 99  ? 31.620  12.706  34.252  1.00 31.03  ? 99   LEU A O   1 
ATOM   790  C CB  . LEU A 1 99  ? 31.992  10.159  31.945  1.00 39.78  ? 99   LEU A CB  1 
ATOM   791  C CG  . LEU A 1 99  ? 32.432  9.162   33.022  1.00 43.12  ? 99   LEU A CG  1 
ATOM   792  C CD1 . LEU A 1 99  ? 31.341  9.044   34.061  1.00 33.26  ? 99   LEU A CD1 1 
ATOM   793  C CD2 . LEU A 1 99  ? 32.793  7.790   32.436  1.00 29.46  ? 99   LEU A CD2 1 
ATOM   794  N N   . ASN A 1 100 ? 29.993  12.327  32.708  1.00 29.15  ? 100  ASN A N   1 
ATOM   795  C CA  . ASN A 1 100 ? 28.904  12.895  33.489  1.00 37.17  ? 100  ASN A CA  1 
ATOM   796  C C   . ASN A 1 100 ? 27.785  11.892  33.690  1.00 40.97  ? 100  ASN A C   1 
ATOM   797  O O   . ASN A 1 100 ? 27.523  11.048  32.823  1.00 37.82  ? 100  ASN A O   1 
ATOM   798  C CB  . ASN A 1 100 ? 28.352  14.150  32.801  1.00 41.01  ? 100  ASN A CB  1 
ATOM   799  C CG  . ASN A 1 100 ? 29.447  15.075  32.334  1.00 35.16  ? 100  ASN A CG  1 
ATOM   800  O OD1 . ASN A 1 100 ? 30.202  15.615  33.138  1.00 42.58  ? 100  ASN A OD1 1 
ATOM   801  N ND2 . ASN A 1 100 ? 29.551  15.250  31.031  1.00 30.43  ? 100  ASN A ND2 1 
ATOM   802  N N   . VAL A 1 101 ? 27.115  11.981  34.833  1.00 43.40  ? 101  VAL A N   1 
ATOM   803  C CA  . VAL A 1 101 ? 26.014  11.074  35.112  1.00 45.58  ? 101  VAL A CA  1 
ATOM   804  C C   . VAL A 1 101 ? 24.841  11.854  35.670  1.00 46.44  ? 101  VAL A C   1 
ATOM   805  O O   . VAL A 1 101 ? 25.014  12.660  36.577  1.00 51.29  ? 101  VAL A O   1 
ATOM   806  C CB  . VAL A 1 101 ? 26.419  9.965   36.116  1.00 37.81  ? 101  VAL A CB  1 
ATOM   807  C CG1 . VAL A 1 101 ? 25.321  8.928   36.226  1.00 38.62  ? 101  VAL A CG1 1 
ATOM   808  C CG2 . VAL A 1 101 ? 27.699  9.297   35.677  1.00 35.13  ? 101  VAL A CG2 1 
ATOM   809  N N   . TRP A 1 102 ? 23.660  11.625  35.104  1.00 45.17  ? 102  TRP A N   1 
ATOM   810  C CA  . TRP A 1 102 ? 22.419  12.149  35.655  1.00 46.92  ? 102  TRP A CA  1 
ATOM   811  C C   . TRP A 1 102 ? 21.511  10.982  35.994  1.00 49.62  ? 102  TRP A C   1 
ATOM   812  O O   . TRP A 1 102 ? 21.405  10.027  35.210  1.00 41.71  ? 102  TRP A O   1 
ATOM   813  C CB  . TRP A 1 102 ? 21.664  12.981  34.635  1.00 40.39  ? 102  TRP A CB  1 
ATOM   814  C CG  . TRP A 1 102 ? 22.234  14.285  34.249  1.00 45.05  ? 102  TRP A CG  1 
ATOM   815  C CD1 . TRP A 1 102 ? 21.918  15.513  34.776  1.00 41.97  ? 102  TRP A CD1 1 
ATOM   816  C CD2 . TRP A 1 102 ? 23.163  14.527  33.190  1.00 39.00  ? 102  TRP A CD2 1 
ATOM   817  N NE1 . TRP A 1 102 ? 22.613  16.499  34.115  1.00 48.55  ? 102  TRP A NE1 1 
ATOM   818  C CE2 . TRP A 1 102 ? 23.377  15.922  33.130  1.00 47.25  ? 102  TRP A CE2 1 
ATOM   819  C CE3 . TRP A 1 102 ? 23.827  13.702  32.279  1.00 46.66  ? 102  TRP A CE3 1 
ATOM   820  C CZ2 . TRP A 1 102 ? 24.249  16.508  32.203  1.00 52.82  ? 102  TRP A CZ2 1 
ATOM   821  C CZ3 . TRP A 1 102 ? 24.693  14.285  31.350  1.00 44.10  ? 102  TRP A CZ3 1 
ATOM   822  C CH2 . TRP A 1 102 ? 24.893  15.675  31.320  1.00 45.80  ? 102  TRP A CH2 1 
ATOM   823  N N   . THR A 1 103 ? 20.845  11.082  37.142  1.00 41.96  ? 103  THR A N   1 
ATOM   824  C CA  . THR A 1 103 ? 19.879  10.098  37.591  1.00 38.72  ? 103  THR A CA  1 
ATOM   825  C C   . THR A 1 103 ? 18.782  10.772  38.387  1.00 42.86  ? 103  THR A C   1 
ATOM   826  O O   . THR A 1 103 ? 18.968  11.871  38.909  1.00 43.58  ? 103  THR A O   1 
ATOM   827  C CB  . THR A 1 103 ? 20.509  9.045   38.530  1.00 50.90  ? 103  THR A CB  1 
ATOM   828  O OG1 . THR A 1 103 ? 21.082  9.703   39.660  1.00 54.99  ? 103  THR A OG1 1 
ATOM   829  C CG2 . THR A 1 103 ? 21.591  8.248   37.835  1.00 51.75  ? 103  THR A CG2 1 
ATOM   830  N N   . PRO A 1 104 ? 17.630  10.103  38.491  1.00 42.29  ? 104  PRO A N   1 
ATOM   831  C CA  . PRO A 1 104 ? 16.534  10.534  39.352  1.00 43.34  ? 104  PRO A CA  1 
ATOM   832  C C   . PRO A 1 104 ? 17.016  10.964  40.725  1.00 48.01  ? 104  PRO A C   1 
ATOM   833  O O   . PRO A 1 104 ? 18.143  10.670  41.125  1.00 56.63  ? 104  PRO A O   1 
ATOM   834  C CB  . PRO A 1 104 ? 15.694  9.271   39.457  1.00 46.04  ? 104  PRO A CB  1 
ATOM   835  C CG  . PRO A 1 104 ? 15.827  8.678   38.109  1.00 33.50  ? 104  PRO A CG  1 
ATOM   836  C CD  . PRO A 1 104 ? 17.242  8.946   37.671  1.00 36.19  ? 104  PRO A CD  1 
ATOM   837  N N   . TYR A 1 105 ? 16.158  11.668  41.443  1.00 44.92  ? 105  TYR A N   1 
ATOM   838  C CA  . TYR A 1 105 ? 16.502  12.106  42.783  1.00 48.38  ? 105  TYR A CA  1 
ATOM   839  C C   . TYR A 1 105 ? 15.321  11.929  43.725  1.00 54.05  ? 105  TYR A C   1 
ATOM   840  O O   . TYR A 1 105 ? 14.331  12.638  43.629  1.00 62.39  ? 105  TYR A O   1 
ATOM   841  C CB  . TYR A 1 105 ? 16.953  13.562  42.777  1.00 48.86  ? 105  TYR A CB  1 
ATOM   842  C CG  . TYR A 1 105 ? 17.285  14.088  44.144  1.00 42.07  ? 105  TYR A CG  1 
ATOM   843  C CD1 . TYR A 1 105 ? 16.287  14.321  45.078  1.00 45.01  ? 105  TYR A CD1 1 
ATOM   844  C CD2 . TYR A 1 105 ? 18.595  14.335  44.514  1.00 40.47  ? 105  TYR A CD2 1 
ATOM   845  C CE1 . TYR A 1 105 ? 16.585  14.793  46.342  1.00 55.94  ? 105  TYR A CE1 1 
ATOM   846  C CE2 . TYR A 1 105 ? 18.895  14.815  45.786  1.00 42.90  ? 105  TYR A CE2 1 
ATOM   847  C CZ  . TYR A 1 105 ? 17.887  15.037  46.683  1.00 44.35  ? 105  TYR A CZ  1 
ATOM   848  O OH  . TYR A 1 105 ? 18.186  15.510  47.929  1.00 58.45  ? 105  TYR A OH  1 
ATOM   849  N N   . PRO A 1 106 ? 15.441  10.989  44.662  1.00 62.38  ? 106  PRO A N   1 
ATOM   850  C CA  . PRO A 1 106 ? 16.663  10.193  44.870  1.00 66.18  ? 106  PRO A CA  1 
ATOM   851  C C   . PRO A 1 106 ? 16.867  9.095   43.834  1.00 59.88  ? 106  PRO A C   1 
ATOM   852  O O   . PRO A 1 106 ? 15.926  8.707   43.144  1.00 57.38  ? 106  PRO A O   1 
ATOM   853  C CB  . PRO A 1 106 ? 16.432  9.559   46.239  1.00 68.06  ? 106  PRO A CB  1 
ATOM   854  C CG  . PRO A 1 106 ? 14.929  9.462   46.341  1.00 64.96  ? 106  PRO A CG  1 
ATOM   855  C CD  . PRO A 1 106 ? 14.390  10.681  45.648  1.00 55.47  ? 106  PRO A CD  1 
ATOM   856  N N   . ARG A 1 107 ? 18.100  8.603   43.748  1.00 62.69  ? 107  ARG A N   1 
ATOM   857  C CA  . ARG A 1 107 ? 18.455  7.491   42.873  1.00 60.45  ? 107  ARG A CA  1 
ATOM   858  C C   . ARG A 1 107 ? 17.484  6.322   42.979  1.00 72.90  ? 107  ARG A C   1 
ATOM   859  O O   . ARG A 1 107 ? 16.920  6.067   44.042  1.00 83.29  ? 107  ARG A O   1 
ATOM   860  C CB  . ARG A 1 107 ? 19.868  7.013   43.187  1.00 53.03  ? 107  ARG A CB  1 
ATOM   861  C CG  . ARG A 1 107 ? 20.915  8.100   42.981  1.00 62.98  ? 107  ARG A CG  1 
ATOM   862  C CD  . ARG A 1 107 ? 22.312  7.537   43.039  1.00 53.47  ? 107  ARG A CD  1 
ATOM   863  N NE  . ARG A 1 107 ? 22.590  6.907   44.325  1.00 51.34  ? 107  ARG A NE  1 
ATOM   864  C CZ  . ARG A 1 107 ? 22.939  7.577   45.416  1.00 56.10  ? 107  ARG A CZ  1 
ATOM   865  N NH1 . ARG A 1 107 ? 23.032  8.894   45.376  1.00 62.68  ? 107  ARG A NH1 1 
ATOM   866  N NH2 . ARG A 1 107 ? 23.188  6.934   46.547  1.00 61.12  ? 107  ARG A NH2 1 
ATOM   867  N N   . PRO A 1 108 ? 17.309  5.593   41.868  1.00 70.14  ? 108  PRO A N   1 
ATOM   868  C CA  . PRO A 1 108 ? 16.355  4.486   41.755  1.00 67.59  ? 108  PRO A CA  1 
ATOM   869  C C   . PRO A 1 108 ? 16.666  3.359   42.730  1.00 80.22  ? 108  PRO A C   1 
ATOM   870  O O   . PRO A 1 108 ? 17.811  3.190   43.157  1.00 87.71  ? 108  PRO A O   1 
ATOM   871  C CB  . PRO A 1 108 ? 16.572  3.982   40.319  1.00 60.42  ? 108  PRO A CB  1 
ATOM   872  C CG  . PRO A 1 108 ? 17.310  5.053   39.612  1.00 44.76  ? 108  PRO A CG  1 
ATOM   873  C CD  . PRO A 1 108 ? 18.130  5.741   40.652  1.00 59.07  ? 108  PRO A CD  1 
ATOM   874  N N   . ALA A 1 109 ? 15.646  2.582   43.066  1.00 83.47  ? 109  ALA A N   1 
ATOM   875  C CA  . ALA A 1 109 ? 15.829  1.449   43.959  1.00 83.70  ? 109  ALA A CA  1 
ATOM   876  C C   . ALA A 1 109 ? 16.001  0.167   43.147  1.00 87.44  ? 109  ALA A C   1 
ATOM   877  O O   . ALA A 1 109 ? 16.762  -0.721  43.520  1.00 89.53  ? 109  ALA A O   1 
ATOM   878  C CB  . ALA A 1 109 ? 14.661  1.336   44.900  1.00 89.97  ? 109  ALA A CB  1 
ATOM   879  N N   . SER A 1 110 ? 15.287  0.073   42.033  1.00 82.01  ? 110  SER A N   1 
ATOM   880  C CA  . SER A 1 110 ? 15.489  -1.024  41.097  1.00 69.09  ? 110  SER A CA  1 
ATOM   881  C C   . SER A 1 110 ? 16.479  -0.595  40.025  1.00 65.36  ? 110  SER A C   1 
ATOM   882  O O   . SER A 1 110 ? 16.607  0.591   39.727  1.00 64.35  ? 110  SER A O   1 
ATOM   883  C CB  . SER A 1 110 ? 14.163  -1.408  40.459  1.00 68.64  ? 110  SER A CB  1 
ATOM   884  O OG  . SER A 1 110 ? 13.489  -0.247  40.005  1.00 74.59  ? 110  SER A OG  1 
ATOM   885  N N   . PRO A 1 111 ? 17.197  -1.556  39.438  1.00 65.55  ? 111  PRO A N   1 
ATOM   886  C CA  . PRO A 1 111 ? 18.146  -1.182  38.382  1.00 60.07  ? 111  PRO A CA  1 
ATOM   887  C C   . PRO A 1 111 ? 17.487  -0.506  37.163  1.00 59.55  ? 111  PRO A C   1 
ATOM   888  O O   . PRO A 1 111 ? 16.527  -1.008  36.584  1.00 58.84  ? 111  PRO A O   1 
ATOM   889  C CB  . PRO A 1 111 ? 18.785  -2.521  38.003  1.00 55.30  ? 111  PRO A CB  1 
ATOM   890  C CG  . PRO A 1 111 ? 18.672  -3.339  39.245  1.00 58.36  ? 111  PRO A CG  1 
ATOM   891  C CD  . PRO A 1 111 ? 17.335  -2.966  39.830  1.00 56.18  ? 111  PRO A CD  1 
ATOM   892  N N   . THR A 1 112 ? 18.025  0.642   36.774  1.00 57.45  ? 112  THR A N   1 
ATOM   893  C CA  . THR A 1 112 ? 17.489  1.385   35.652  1.00 45.94  ? 112  THR A CA  1 
ATOM   894  C C   . THR A 1 112 ? 18.340  1.254   34.403  1.00 41.63  ? 112  THR A C   1 
ATOM   895  O O   . THR A 1 112 ? 19.555  1.435   34.442  1.00 53.85  ? 112  THR A O   1 
ATOM   896  C CB  . THR A 1 112 ? 17.379  2.883   35.970  1.00 41.36  ? 112  THR A CB  1 
ATOM   897  O OG1 . THR A 1 112 ? 16.715  3.060   37.226  1.00 56.75  ? 112  THR A OG1 1 
ATOM   898  C CG2 . THR A 1 112 ? 16.594  3.587   34.872  1.00 39.75  ? 112  THR A CG2 1 
ATOM   899  N N   . PRO A 1 113 ? 17.690  0.965   33.279  1.00 36.96  ? 113  PRO A N   1 
ATOM   900  C CA  . PRO A 1 113 ? 18.290  1.028   31.951  1.00 42.26  ? 113  PRO A CA  1 
ATOM   901  C C   . PRO A 1 113 ? 19.105  2.312   31.770  1.00 51.83  ? 113  PRO A C   1 
ATOM   902  O O   . PRO A 1 113 ? 18.728  3.395   32.245  1.00 53.26  ? 113  PRO A O   1 
ATOM   903  C CB  . PRO A 1 113 ? 17.067  1.043   31.040  1.00 39.30  ? 113  PRO A CB  1 
ATOM   904  C CG  . PRO A 1 113 ? 16.072  0.250   31.769  1.00 44.57  ? 113  PRO A CG  1 
ATOM   905  C CD  . PRO A 1 113 ? 16.266  0.606   33.217  1.00 42.67  ? 113  PRO A CD  1 
ATOM   906  N N   . VAL A 1 114 ? 20.219  2.180   31.061  1.00 50.69  ? 114  VAL A N   1 
ATOM   907  C CA  . VAL A 1 114 ? 21.193  3.257   30.945  1.00 40.60  ? 114  VAL A CA  1 
ATOM   908  C C   . VAL A 1 114 ? 21.361  3.748   29.525  1.00 36.50  ? 114  VAL A C   1 
ATOM   909  O O   . VAL A 1 114 ? 21.475  2.966   28.597  1.00 40.96  ? 114  VAL A O   1 
ATOM   910  C CB  . VAL A 1 114 ? 22.566  2.797   31.454  1.00 39.99  ? 114  VAL A CB  1 
ATOM   911  C CG1 . VAL A 1 114 ? 23.612  3.848   31.166  1.00 35.49  ? 114  VAL A CG1 1 
ATOM   912  C CG2 . VAL A 1 114 ? 22.494  2.479   32.958  1.00 39.70  ? 114  VAL A CG2 1 
ATOM   913  N N   . LEU A 1 115 ? 21.382  5.062   29.374  1.00 52.25  ? 115  LEU A N   1 
ATOM   914  C CA  . LEU A 1 115 ? 21.592  5.684   28.079  1.00 48.58  ? 115  LEU A CA  1 
ATOM   915  C C   . LEU A 1 115 ? 22.968  6.309   28.039  1.00 41.98  ? 115  LEU A C   1 
ATOM   916  O O   . LEU A 1 115 ? 23.285  7.150   28.865  1.00 49.09  ? 115  LEU A O   1 
ATOM   917  C CB  . LEU A 1 115 ? 20.538  6.766   27.831  1.00 44.63  ? 115  LEU A CB  1 
ATOM   918  C CG  . LEU A 1 115 ? 19.156  6.242   27.427  1.00 64.60  ? 115  LEU A CG  1 
ATOM   919  C CD1 . LEU A 1 115 ? 18.239  7.373   27.017  1.00 61.46  ? 115  LEU A CD1 1 
ATOM   920  C CD2 . LEU A 1 115 ? 19.283  5.233   26.297  1.00 74.36  ? 115  LEU A CD2 1 
ATOM   921  N N   . ILE A 1 116 ? 23.779  5.909   27.072  1.00 37.49  ? 116  ILE A N   1 
ATOM   922  C CA  . ILE A 1 116 ? 25.071  6.547   26.887  1.00 44.47  ? 116  ILE A CA  1 
ATOM   923  C C   . ILE A 1 116 ? 25.130  7.399   25.630  1.00 47.92  ? 116  ILE A C   1 
ATOM   924  O O   . ILE A 1 116 ? 25.021  6.878   24.504  1.00 38.77  ? 116  ILE A O   1 
ATOM   925  C CB  . ILE A 1 116 ? 26.194  5.529   26.819  1.00 50.89  ? 116  ILE A CB  1 
ATOM   926  C CG1 . ILE A 1 116 ? 26.170  4.657   28.070  1.00 54.00  ? 116  ILE A CG1 1 
ATOM   927  C CG2 . ILE A 1 116 ? 27.520  6.243   26.696  1.00 49.08  ? 116  ILE A CG2 1 
ATOM   928  C CD1 . ILE A 1 116 ? 27.186  3.573   28.043  1.00 49.08  ? 116  ILE A CD1 1 
ATOM   929  N N   . TRP A 1 117 ? 25.326  8.706   25.834  1.00 40.79  ? 117  TRP A N   1 
ATOM   930  C CA  . TRP A 1 117 ? 25.425  9.657   24.731  1.00 35.00  ? 117  TRP A CA  1 
ATOM   931  C C   . TRP A 1 117 ? 26.852  9.968   24.301  1.00 39.56  ? 117  TRP A C   1 
ATOM   932  O O   . TRP A 1 117 ? 27.746  10.118  25.126  1.00 42.16  ? 117  TRP A O   1 
ATOM   933  C CB  . TRP A 1 117 ? 24.705  10.952  25.072  1.00 41.55  ? 117  TRP A CB  1 
ATOM   934  C CG  . TRP A 1 117 ? 24.873  12.021  24.041  1.00 38.71  ? 117  TRP A CG  1 
ATOM   935  C CD1 . TRP A 1 117 ? 25.714  13.100  24.099  1.00 32.44  ? 117  TRP A CD1 1 
ATOM   936  C CD2 . TRP A 1 117 ? 24.179  12.123  22.800  1.00 35.49  ? 117  TRP A CD2 1 
ATOM   937  N NE1 . TRP A 1 117 ? 25.582  13.860  22.969  1.00 35.09  ? 117  TRP A NE1 1 
ATOM   938  C CE2 . TRP A 1 117 ? 24.639  13.284  22.158  1.00 37.78  ? 117  TRP A CE2 1 
ATOM   939  C CE3 . TRP A 1 117 ? 23.200  11.353  22.176  1.00 39.90  ? 117  TRP A CE3 1 
ATOM   940  C CZ2 . TRP A 1 117 ? 24.157  13.688  20.929  1.00 31.11  ? 117  TRP A CZ2 1 
ATOM   941  C CZ3 . TRP A 1 117 ? 22.723  11.758  20.959  1.00 44.25  ? 117  TRP A CZ3 1 
ATOM   942  C CH2 . TRP A 1 117 ? 23.201  12.914  20.348  1.00 40.83  ? 117  TRP A CH2 1 
ATOM   943  N N   . ILE A 1 118 ? 27.036  10.097  22.994  1.00 47.75  ? 118  ILE A N   1 
ATOM   944  C CA  . ILE A 1 118 ? 28.334  10.373  22.401  1.00 37.46  ? 118  ILE A CA  1 
ATOM   945  C C   . ILE A 1 118 ? 28.218  11.514  21.400  1.00 40.58  ? 118  ILE A C   1 
ATOM   946  O O   . ILE A 1 118 ? 27.618  11.303  20.324  1.00 27.82  ? 118  ILE A O   1 
ATOM   947  C CB  . ILE A 1 118 ? 28.807  9.169   21.590  1.00 36.71  ? 118  ILE A CB  1 
ATOM   948  C CG1 . ILE A 1 118 ? 28.622  7.871   22.399  1.00 38.62  ? 118  ILE A CG1 1 
ATOM   949  C CG2 . ILE A 1 118 ? 30.231  9.414   21.110  1.00 26.86  ? 118  ILE A CG2 1 
ATOM   950  C CD1 . ILE A 1 118 ? 29.437  6.669   21.917  1.00 21.85  ? 118  ILE A CD1 1 
ATOM   951  N N   . TYR A 1 119 ? 28.798  12.689  21.718  1.00 28.05  ? 119  TYR A N   1 
ATOM   952  C CA  . TYR A 1 119 ? 28.588  13.885  20.890  1.00 22.67  ? 119  TYR A CA  1 
ATOM   953  C C   . TYR A 1 119 ? 29.188  13.679  19.509  1.00 31.95  ? 119  TYR A C   1 
ATOM   954  O O   . TYR A 1 119 ? 30.162  12.962  19.348  1.00 31.78  ? 119  TYR A O   1 
ATOM   955  C CB  . TYR A 1 119 ? 29.163  15.178  21.534  1.00 51.36  ? 119  TYR A CB  1 
ATOM   956  C CG  . TYR A 1 119 ? 30.628  15.061  21.962  1.00 40.58  ? 119  TYR A CG  1 
ATOM   957  C CD1 . TYR A 1 119 ? 31.664  15.028  21.009  1.00 25.63  ? 119  TYR A CD1 1 
ATOM   958  C CD2 . TYR A 1 119 ? 30.969  14.960  23.313  1.00 24.51  ? 119  TYR A CD2 1 
ATOM   959  C CE1 . TYR A 1 119 ? 32.974  14.879  21.383  1.00 18.16  ? 119  TYR A CE1 1 
ATOM   960  C CE2 . TYR A 1 119 ? 32.286  14.817  23.696  1.00 25.19  ? 119  TYR A CE2 1 
ATOM   961  C CZ  . TYR A 1 119 ? 33.280  14.788  22.727  1.00 18.48  ? 119  TYR A CZ  1 
ATOM   962  O OH  . TYR A 1 119 ? 34.582  14.646  23.133  1.00 24.44  ? 119  TYR A OH  1 
ATOM   963  N N   . GLY A 1 120 ? 28.589  14.316  18.514  1.00 35.83  ? 120  GLY A N   1 
ATOM   964  C CA  . GLY A 1 120 ? 29.234  14.475  17.229  1.00 34.77  ? 120  GLY A CA  1 
ATOM   965  C C   . GLY A 1 120 ? 29.992  15.801  17.156  1.00 41.37  ? 120  GLY A C   1 
ATOM   966  O O   . GLY A 1 120 ? 30.192  16.497  18.168  1.00 29.73  ? 120  GLY A O   1 
ATOM   967  N N   . GLY A 1 121 ? 30.411  16.151  15.944  1.00 42.91  ? 121  GLY A N   1 
ATOM   968  C CA  . GLY A 1 121 ? 31.303  17.270  15.737  1.00 51.65  ? 121  GLY A CA  1 
ATOM   969  C C   . GLY A 1 121 ? 32.499  16.879  14.895  1.00 40.88  ? 121  GLY A C   1 
ATOM   970  O O   . GLY A 1 121 ? 33.612  17.391  15.101  1.00 38.82  ? 121  GLY A O   1 
ATOM   971  N N   . GLY A 1 122 ? 32.268  15.958  13.959  1.00 20.24  ? 122  GLY A N   1 
ATOM   972  C CA  . GLY A 1 122 ? 33.262  15.612  12.942  1.00 26.87  ? 122  GLY A CA  1 
ATOM   973  C C   . GLY A 1 122 ? 34.532  14.917  13.409  1.00 36.43  ? 122  GLY A C   1 
ATOM   974  O O   . GLY A 1 122 ? 35.418  14.631  12.617  1.00 46.51  ? 122  GLY A O   1 
ATOM   975  N N   . PHE A 1 123 ? 34.611  14.625  14.701  1.00 40.45  ? 123  PHE A N   1 
ATOM   976  C CA  . PHE A 1 123 ? 35.849  14.155  15.306  1.00 31.94  ? 123  PHE A CA  1 
ATOM   977  C C   . PHE A 1 123 ? 36.842  15.293  15.481  1.00 26.33  ? 123  PHE A C   1 
ATOM   978  O O   . PHE A 1 123 ? 37.944  15.097  15.968  1.00 36.86  ? 123  PHE A O   1 
ATOM   979  C CB  . PHE A 1 123 ? 36.476  13.006  14.500  1.00 35.54  ? 123  PHE A CB  1 
ATOM   980  C CG  . PHE A 1 123 ? 35.578  11.797  14.351  1.00 23.92  ? 123  PHE A CG  1 
ATOM   981  C CD1 . PHE A 1 123 ? 35.334  10.960  15.423  1.00 27.48  ? 123  PHE A CD1 1 
ATOM   982  C CD2 . PHE A 1 123 ? 34.977  11.506  13.130  1.00 36.81  ? 123  PHE A CD2 1 
ATOM   983  C CE1 . PHE A 1 123 ? 34.496  9.824   15.279  1.00 28.03  ? 123  PHE A CE1 1 
ATOM   984  C CE2 . PHE A 1 123 ? 34.151  10.396  12.971  1.00 29.71  ? 123  PHE A CE2 1 
ATOM   985  C CZ  . PHE A 1 123 ? 33.911  9.550   14.046  1.00 23.37  ? 123  PHE A CZ  1 
ATOM   986  N N   . TYR A 1 124 ? 36.451  16.495  15.083  1.00 48.36  ? 124  TYR A N   1 
ATOM   987  C CA  . TYR A 1 124 ? 37.333  17.642  15.241  1.00 39.62  ? 124  TYR A CA  1 
ATOM   988  C C   . TYR A 1 124 ? 36.874  18.465  16.437  1.00 37.58  ? 124  TYR A C   1 
ATOM   989  O O   . TYR A 1 124 ? 37.587  19.336  16.908  1.00 39.54  ? 124  TYR A O   1 
ATOM   990  C CB  . TYR A 1 124 ? 37.398  18.465  13.945  1.00 26.31  ? 124  TYR A CB  1 
ATOM   991  C CG  . TYR A 1 124 ? 36.261  19.431  13.739  1.00 33.91  ? 124  TYR A CG  1 
ATOM   992  C CD1 . TYR A 1 124 ? 36.328  20.720  14.268  1.00 48.49  ? 124  TYR A CD1 1 
ATOM   993  C CD2 . TYR A 1 124 ? 35.121  19.065  13.018  1.00 34.14  ? 124  TYR A CD2 1 
ATOM   994  C CE1 . TYR A 1 124 ? 35.292  21.621  14.099  1.00 54.71  ? 124  TYR A CE1 1 
ATOM   995  C CE2 . TYR A 1 124 ? 34.074  19.958  12.836  1.00 33.71  ? 124  TYR A CE2 1 
ATOM   996  C CZ  . TYR A 1 124 ? 34.171  21.243  13.387  1.00 52.20  ? 124  TYR A CZ  1 
ATOM   997  O OH  . TYR A 1 124 ? 33.164  22.167  13.247  1.00 46.54  ? 124  TYR A OH  1 
ATOM   998  N N   . SER A 1 125 ? 35.683  18.162  16.945  1.00 34.69  ? 125  SER A N   1 
ATOM   999  C CA  . SER A 1 125 ? 35.102  18.966  18.020  1.00 42.22  ? 125  SER A CA  1 
ATOM   1000 C C   . SER A 1 125 ? 34.023  18.190  18.793  1.00 34.55  ? 125  SER A C   1 
ATOM   1001 O O   . SER A 1 125 ? 33.781  17.028  18.509  1.00 35.07  ? 125  SER A O   1 
ATOM   1002 C CB  . SER A 1 125 ? 34.553  20.297  17.474  1.00 40.98  ? 125  SER A CB  1 
ATOM   1003 O OG  . SER A 1 125 ? 33.580  20.092  16.456  1.00 40.82  ? 125  SER A OG  1 
ATOM   1004 N N   . GLY A 1 126 ? 33.421  18.826  19.796  1.00 31.78  ? 126  GLY A N   1 
ATOM   1005 C CA  . GLY A 1 126 ? 32.380  18.207  20.603  1.00 22.09  ? 126  GLY A CA  1 
ATOM   1006 C C   . GLY A 1 126 ? 32.675  18.130  22.082  1.00 22.59  ? 126  GLY A C   1 
ATOM   1007 O O   . GLY A 1 126 ? 33.801  17.870  22.491  1.00 33.53  ? 126  GLY A O   1 
ATOM   1008 N N   . ALA A 1 127 ? 31.655  18.351  22.898  1.00 27.62  ? 127  ALA A N   1 
ATOM   1009 C CA  . ALA A 1 127 ? 31.792  18.237  24.353  1.00 32.22  ? 127  ALA A CA  1 
ATOM   1010 C C   . ALA A 1 127 ? 30.513  17.672  24.988  1.00 43.23  ? 127  ALA A C   1 
ATOM   1011 O O   . ALA A 1 127 ? 29.408  18.045  24.597  1.00 48.97  ? 127  ALA A O   1 
ATOM   1012 C CB  . ALA A 1 127 ? 32.118  19.586  24.944  1.00 38.04  ? 127  ALA A CB  1 
ATOM   1013 N N   . ALA A 1 128 ? 30.644  16.778  25.964  1.00 45.10  ? 128  ALA A N   1 
ATOM   1014 C CA  . ALA A 1 128 ? 29.438  16.272  26.620  1.00 51.46  ? 128  ALA A CA  1 
ATOM   1015 C C   . ALA A 1 128 ? 28.768  17.346  27.482  1.00 32.90  ? 128  ALA A C   1 
ATOM   1016 O O   . ALA A 1 128 ? 27.714  17.111  28.056  1.00 45.62  ? 128  ALA A O   1 
ATOM   1017 C CB  . ALA A 1 128 ? 29.715  14.972  27.438  1.00 24.91  ? 128  ALA A CB  1 
ATOM   1018 N N   . SER A 1 129 ? 29.371  18.524  27.568  1.00 41.00  ? 129  SER A N   1 
ATOM   1019 C CA  . SER A 1 129 ? 28.858  19.586  28.465  1.00 40.66  ? 129  SER A CA  1 
ATOM   1020 C C   . SER A 1 129 ? 27.948  20.622  27.829  1.00 27.92  ? 129  SER A C   1 
ATOM   1021 O O   . SER A 1 129 ? 27.346  21.423  28.534  1.00 34.30  ? 129  SER A O   1 
ATOM   1022 C CB  . SER A 1 129 ? 29.999  20.327  29.144  1.00 25.63  ? 129  SER A CB  1 
ATOM   1023 O OG  . SER A 1 129 ? 30.834  20.897  28.163  1.00 31.10  ? 129  SER A OG  1 
ATOM   1024 N N   . LEU A 1 130 ? 27.844  20.624  26.509  1.00 24.32  ? 130  LEU A N   1 
ATOM   1025 C CA  . LEU A 1 130 ? 26.915  21.528  25.830  1.00 20.40  ? 130  LEU A CA  1 
ATOM   1026 C C   . LEU A 1 130 ? 25.481  21.395  26.355  1.00 32.06  ? 130  LEU A C   1 
ATOM   1027 O O   . LEU A 1 130 ? 25.025  20.308  26.730  1.00 42.26  ? 130  LEU A O   1 
ATOM   1028 C CB  . LEU A 1 130 ? 26.928  21.266  24.319  1.00 26.86  ? 130  LEU A CB  1 
ATOM   1029 C CG  . LEU A 1 130 ? 28.259  21.211  23.579  1.00 25.77  ? 130  LEU A CG  1 
ATOM   1030 C CD1 . LEU A 1 130 ? 28.015  21.122  22.092  1.00 31.59  ? 130  LEU A CD1 1 
ATOM   1031 C CD2 . LEU A 1 130 ? 29.135  22.410  23.915  1.00 33.44  ? 130  LEU A CD2 1 
ATOM   1032 N N   . ASP A 1 131 ? 24.753  22.497  26.336  1.00 41.05  ? 131  ASP A N   1 
ATOM   1033 C CA  . ASP A 1 131 ? 23.393  22.493  26.837  1.00 44.69  ? 131  ASP A CA  1 
ATOM   1034 C C   . ASP A 1 131 ? 22.500  21.475  26.148  1.00 43.58  ? 131  ASP A C   1 
ATOM   1035 O O   . ASP A 1 131 ? 21.714  20.812  26.808  1.00 38.89  ? 131  ASP A O   1 
ATOM   1036 C CB  . ASP A 1 131 ? 22.788  23.879  26.740  1.00 28.98  ? 131  ASP A CB  1 
ATOM   1037 C CG  . ASP A 1 131 ? 23.420  24.852  27.732  1.00 55.46  ? 131  ASP A CG  1 
ATOM   1038 O OD1 . ASP A 1 131 ? 24.214  24.386  28.576  1.00 60.11  ? 131  ASP A OD1 1 
ATOM   1039 O OD2 . ASP A 1 131 ? 23.124  26.071  27.682  1.00 50.46  ? 131  ASP A OD2 1 
ATOM   1040 N N   . VAL A 1 132 ? 22.634  21.355  24.831  1.00 28.60  ? 132  VAL A N   1 
ATOM   1041 C CA  . VAL A 1 132 ? 21.789  20.473  24.057  1.00 23.60  ? 132  VAL A CA  1 
ATOM   1042 C C   . VAL A 1 132 ? 21.953  18.978  24.438  1.00 46.13  ? 132  VAL A C   1 
ATOM   1043 O O   . VAL A 1 132 ? 21.143  18.147  24.046  1.00 38.28  ? 132  VAL A O   1 
ATOM   1044 C CB  . VAL A 1 132 ? 21.994  20.675  22.519  1.00 22.15  ? 132  VAL A CB  1 
ATOM   1045 C CG1 . VAL A 1 132 ? 21.355  21.961  22.047  1.00 33.99  ? 132  VAL A CG1 1 
ATOM   1046 C CG2 . VAL A 1 132 ? 23.466  20.632  22.144  1.00 29.30  ? 132  VAL A CG2 1 
ATOM   1047 N N   . TYR A 1 133 ? 22.991  18.639  25.199  1.00 34.92  ? 133  TYR A N   1 
ATOM   1048 C CA  . TYR A 1 133 ? 23.156  17.259  25.666  1.00 27.96  ? 133  TYR A CA  1 
ATOM   1049 C C   . TYR A 1 133 ? 22.871  17.135  27.165  1.00 24.00  ? 133  TYR A C   1 
ATOM   1050 O O   . TYR A 1 133 ? 23.528  16.375  27.849  1.00 41.99  ? 133  TYR A O   1 
ATOM   1051 C CB  . TYR A 1 133 ? 24.583  16.703  25.365  1.00 21.52  ? 133  TYR A CB  1 
ATOM   1052 C CG  . TYR A 1 133 ? 25.091  16.942  23.946  1.00 27.94  ? 133  TYR A CG  1 
ATOM   1053 C CD1 . TYR A 1 133 ? 24.234  16.865  22.861  1.00 26.18  ? 133  TYR A CD1 1 
ATOM   1054 C CD2 . TYR A 1 133 ? 26.426  17.259  23.697  1.00 35.53  ? 133  TYR A CD2 1 
ATOM   1055 C CE1 . TYR A 1 133 ? 24.682  17.070  21.575  1.00 18.03  ? 133  TYR A CE1 1 
ATOM   1056 C CE2 . TYR A 1 133 ? 26.890  17.476  22.395  1.00 19.70  ? 133  TYR A CE2 1 
ATOM   1057 C CZ  . TYR A 1 133 ? 26.004  17.386  21.342  1.00 25.53  ? 133  TYR A CZ  1 
ATOM   1058 O OH  . TYR A 1 133 ? 26.420  17.614  20.039  1.00 26.37  ? 133  TYR A OH  1 
ATOM   1059 N N   . ASP A 1 134 ? 21.879  17.849  27.674  1.00 23.42  ? 134  ASP A N   1 
ATOM   1060 C CA  . ASP A 1 134 ? 21.595  17.844  29.115  1.00 30.53  ? 134  ASP A CA  1 
ATOM   1061 C C   . ASP A 1 134 ? 20.695  16.683  29.507  1.00 39.48  ? 134  ASP A C   1 
ATOM   1062 O O   . ASP A 1 134 ? 19.543  16.600  29.073  1.00 42.20  ? 134  ASP A O   1 
ATOM   1063 C CB  . ASP A 1 134 ? 20.922  19.149  29.547  1.00 26.91  ? 134  ASP A CB  1 
ATOM   1064 C CG  . ASP A 1 134 ? 20.712  19.222  31.050  1.00 43.35  ? 134  ASP A CG  1 
ATOM   1065 O OD1 . ASP A 1 134 ? 20.707  18.157  31.691  1.00 54.54  ? 134  ASP A OD1 1 
ATOM   1066 O OD2 . ASP A 1 134 ? 20.542  20.334  31.598  1.00 50.32  ? 134  ASP A OD2 1 
ATOM   1067 N N   . GLY A 1 135 ? 21.203  15.797  30.349  1.00 32.46  ? 135  GLY A N   1 
ATOM   1068 C CA  . GLY A 1 135 ? 20.434  14.629  30.716  1.00 40.51  ? 135  GLY A CA  1 
ATOM   1069 C C   . GLY A 1 135 ? 19.382  14.902  31.766  1.00 37.69  ? 135  GLY A C   1 
ATOM   1070 O O   . GLY A 1 135 ? 18.676  13.995  32.188  1.00 45.54  ? 135  GLY A O   1 
ATOM   1071 N N   . ARG A 1 136 ? 19.256  16.151  32.194  1.00 40.18  ? 136  ARG A N   1 
ATOM   1072 C CA  . ARG A 1 136 ? 18.402  16.416  33.343  1.00 33.89  ? 136  ARG A CA  1 
ATOM   1073 C C   . ARG A 1 136 ? 16.948  16.049  33.062  1.00 45.04  ? 136  ARG A C   1 
ATOM   1074 O O   . ARG A 1 136 ? 16.256  15.598  33.965  1.00 44.55  ? 136  ARG A O   1 
ATOM   1075 C CB  . ARG A 1 136 ? 18.562  17.851  33.871  1.00 26.62  ? 136  ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 136 ? 17.592  18.892  33.311  1.00 47.38  ? 136  ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 136 ? 17.786  20.262  33.981  1.00 35.11  ? 136  ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 136 ? 19.171  20.689  33.876  1.00 39.57  ? 136  ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 136 ? 19.801  21.462  34.755  1.00 38.64  ? 136  ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 136 ? 19.174  21.924  35.823  1.00 26.03  ? 136  ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 136 ? 21.076  21.776  34.559  1.00 32.33  ? 136  ARG A NH2 1 
ATOM   1082 N N   . PHE A 1 137 ? 16.505  16.199  31.807  1.00 45.08  ? 137  PHE A N   1 
ATOM   1083 C CA  . PHE A 1 137 ? 15.092  16.013  31.447  1.00 34.31  ? 137  PHE A CA  1 
ATOM   1084 C C   . PHE A 1 137 ? 14.729  14.558  31.228  1.00 43.25  ? 137  PHE A C   1 
ATOM   1085 O O   . PHE A 1 137 ? 13.669  14.097  31.638  1.00 50.02  ? 137  PHE A O   1 
ATOM   1086 C CB  . PHE A 1 137 ? 14.735  16.794  30.186  1.00 28.50  ? 137  PHE A CB  1 
ATOM   1087 C CG  . PHE A 1 137 ? 15.129  18.224  30.241  1.00 37.94  ? 137  PHE A CG  1 
ATOM   1088 C CD1 . PHE A 1 137 ? 14.415  19.121  31.013  1.00 35.03  ? 137  PHE A CD1 1 
ATOM   1089 C CD2 . PHE A 1 137 ? 16.222  18.682  29.526  1.00 41.95  ? 137  PHE A CD2 1 
ATOM   1090 C CE1 . PHE A 1 137 ? 14.772  20.450  31.069  1.00 33.84  ? 137  PHE A CE1 1 
ATOM   1091 C CE2 . PHE A 1 137 ? 16.586  20.026  29.576  1.00 35.18  ? 137  PHE A CE2 1 
ATOM   1092 C CZ  . PHE A 1 137 ? 15.860  20.905  30.354  1.00 35.59  ? 137  PHE A CZ  1 
ATOM   1093 N N   . LEU A 1 138 ? 15.605  13.848  30.542  1.00 43.91  ? 138  LEU A N   1 
ATOM   1094 C CA  . LEU A 1 138 ? 15.413  12.439  30.312  1.00 31.26  ? 138  LEU A CA  1 
ATOM   1095 C C   . LEU A 1 138 ? 15.438  11.735  31.650  1.00 42.35  ? 138  LEU A C   1 
ATOM   1096 O O   . LEU A 1 138 ? 14.626  10.840  31.913  1.00 44.59  ? 138  LEU A O   1 
ATOM   1097 C CB  . LEU A 1 138 ? 16.540  11.915  29.439  1.00 37.02  ? 138  LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 138 ? 16.521  12.383  27.988  1.00 43.06  ? 138  LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 138 ? 17.836  12.051  27.336  1.00 43.27  ? 138  LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 138 ? 15.379  11.724  27.243  1.00 48.88  ? 138  LEU A CD2 1 
ATOM   1101 N N   . ALA A 1 139 ? 16.380  12.143  32.496  1.00 44.63  ? 139  ALA A N   1 
ATOM   1102 C CA  . ALA A 1 139 ? 16.503  11.587  33.841  1.00 39.48  ? 139  ALA A CA  1 
ATOM   1103 C C   . ALA A 1 139 ? 15.231  11.815  34.650  1.00 50.66  ? 139  ALA A C   1 
ATOM   1104 O O   . ALA A 1 139 ? 14.574  10.854  35.067  1.00 52.57  ? 139  ALA A O   1 
ATOM   1105 C CB  . ALA A 1 139 ? 17.685  12.192  34.548  1.00 24.94  ? 139  ALA A CB  1 
ATOM   1106 N N   . GLN A 1 140 ? 14.886  13.090  34.858  1.00 50.36  ? 140  GLN A N   1 
ATOM   1107 C CA  . GLN A 1 140 ? 13.693  13.479  35.621  1.00 51.08  ? 140  GLN A CA  1 
ATOM   1108 C C   . GLN A 1 140 ? 12.386  12.920  35.062  1.00 55.85  ? 140  GLN A C   1 
ATOM   1109 O O   . GLN A 1 140 ? 11.564  12.385  35.802  1.00 62.10  ? 140  GLN A O   1 
ATOM   1110 C CB  . GLN A 1 140 ? 13.571  15.001  35.692  1.00 50.30  ? 140  GLN A CB  1 
ATOM   1111 C CG  . GLN A 1 140 ? 12.874  15.535  36.934  1.00 47.75  ? 140  GLN A CG  1 
ATOM   1112 C CD  . GLN A 1 140 ? 11.350  15.438  36.902  1.00 55.89  ? 140  GLN A CD  1 
ATOM   1113 O OE1 . GLN A 1 140 ? 10.727  15.470  35.833  1.00 49.45  ? 140  GLN A OE1 1 
ATOM   1114 N NE2 . GLN A 1 140 ? 10.737  15.338  38.099  1.00 45.03  ? 140  GLN A NE2 1 
ATOM   1115 N N   . VAL A 1 141 ? 12.197  13.048  33.754  1.00 47.47  ? 141  VAL A N   1 
ATOM   1116 C CA  . VAL A 1 141 ? 10.899  12.791  33.144  1.00 43.01  ? 141  VAL A CA  1 
ATOM   1117 C C   . VAL A 1 141 ? 10.683  11.328  32.787  1.00 48.40  ? 141  VAL A C   1 
ATOM   1118 O O   . VAL A 1 141 ? 9.580   10.814  32.938  1.00 57.37  ? 141  VAL A O   1 
ATOM   1119 C CB  . VAL A 1 141 ? 10.674  13.711  31.914  1.00 47.89  ? 141  VAL A CB  1 
ATOM   1120 C CG1 . VAL A 1 141 ? 9.276   13.577  31.372  1.00 35.81  ? 141  VAL A CG1 1 
ATOM   1121 C CG2 . VAL A 1 141 ? 10.924  15.159  32.295  1.00 39.47  ? 141  VAL A CG2 1 
ATOM   1122 N N   . GLU A 1 142 ? 11.730  10.651  32.334  1.00 51.63  ? 142  GLU A N   1 
ATOM   1123 C CA  . GLU A 1 142 ? 11.621  9.234   31.989  1.00 43.14  ? 142  GLU A CA  1 
ATOM   1124 C C   . GLU A 1 142 ? 12.260  8.291   33.011  1.00 40.95  ? 142  GLU A C   1 
ATOM   1125 O O   . GLU A 1 142 ? 12.168  7.075   32.873  1.00 51.15  ? 142  GLU A O   1 
ATOM   1126 C CB  . GLU A 1 142 ? 12.231  8.976   30.607  1.00 51.94  ? 142  GLU A CB  1 
ATOM   1127 C CG  . GLU A 1 142 ? 11.418  9.519   29.450  1.00 52.76  ? 142  GLU A CG  1 
ATOM   1128 C CD  . GLU A 1 142 ? 10.049  8.879   29.344  1.00 61.50  ? 142  GLU A CD  1 
ATOM   1129 O OE1 . GLU A 1 142 ? 9.848   7.755   29.876  1.00 63.54  ? 142  GLU A OE1 1 
ATOM   1130 O OE2 . GLU A 1 142 ? 9.167   9.512   28.731  1.00 54.04  ? 142  GLU A OE2 1 
ATOM   1131 N N   . GLY A 1 143 ? 12.925  8.845   34.019  1.00 44.14  ? 143  GLY A N   1 
ATOM   1132 C CA  . GLY A 1 143 ? 13.616  8.034   35.014  1.00 31.16  ? 143  GLY A CA  1 
ATOM   1133 C C   . GLY A 1 143 ? 14.871  7.383   34.484  1.00 40.59  ? 143  GLY A C   1 
ATOM   1134 O O   . GLY A 1 143 ? 15.351  6.406   35.035  1.00 55.15  ? 143  GLY A O   1 
ATOM   1135 N N   . ALA A 1 144 ? 15.402  7.931   33.399  1.00 52.59  ? 144  ALA A N   1 
ATOM   1136 C CA  . ALA A 1 144 ? 16.601  7.402   32.764  1.00 50.68  ? 144  ALA A CA  1 
ATOM   1137 C C   . ALA A 1 144 ? 17.845  7.709   33.578  1.00 46.11  ? 144  ALA A C   1 
ATOM   1138 O O   . ALA A 1 144 ? 17.929  8.766   34.192  1.00 34.30  ? 144  ALA A O   1 
ATOM   1139 C CB  . ALA A 1 144 ? 16.755  7.998   31.370  1.00 40.67  ? 144  ALA A CB  1 
ATOM   1140 N N   . VAL A 1 145 ? 18.791  6.768   33.586  1.00 45.07  ? 145  VAL A N   1 
ATOM   1141 C CA  . VAL A 1 145 ? 20.172  7.065   33.942  1.00 41.84  ? 145  VAL A CA  1 
ATOM   1142 C C   . VAL A 1 145 ? 20.917  7.436   32.652  1.00 55.80  ? 145  VAL A C   1 
ATOM   1143 O O   . VAL A 1 145 ? 21.034  6.620   31.721  1.00 45.44  ? 145  VAL A O   1 
ATOM   1144 C CB  . VAL A 1 145 ? 20.889  5.876   34.606  1.00 42.95  ? 145  VAL A CB  1 
ATOM   1145 C CG1 . VAL A 1 145 ? 22.314  6.266   34.979  1.00 36.15  ? 145  VAL A CG1 1 
ATOM   1146 C CG2 . VAL A 1 145 ? 20.133  5.410   35.849  1.00 52.44  ? 145  VAL A CG2 1 
ATOM   1147 N N   . LEU A 1 146 ? 21.398  8.676   32.595  1.00 43.23  ? 146  LEU A N   1 
ATOM   1148 C CA  . LEU A 1 146 ? 22.074  9.157   31.412  1.00 37.30  ? 146  LEU A CA  1 
ATOM   1149 C C   . LEU A 1 146 ? 23.570  9.390   31.670  1.00 48.66  ? 146  LEU A C   1 
ATOM   1150 O O   . LEU A 1 146 ? 23.967  10.041  32.642  1.00 50.09  ? 146  LEU A O   1 
ATOM   1151 C CB  . LEU A 1 146 ? 21.388  10.415  30.849  1.00 34.23  ? 146  LEU A CB  1 
ATOM   1152 C CG  . LEU A 1 146 ? 21.628  10.529  29.336  1.00 39.00  ? 146  LEU A CG  1 
ATOM   1153 C CD1 . LEU A 1 146 ? 20.378  10.934  28.589  1.00 37.19  ? 146  LEU A CD1 1 
ATOM   1154 C CD2 . LEU A 1 146 ? 22.776  11.475  29.029  1.00 30.26  ? 146  LEU A CD2 1 
ATOM   1155 N N   . VAL A 1 147 ? 24.389  8.826   30.789  1.00 37.86  ? 147  VAL A N   1 
ATOM   1156 C CA  . VAL A 1 147 ? 25.824  9.002   30.843  1.00 44.56  ? 147  VAL A CA  1 
ATOM   1157 C C   . VAL A 1 147 ? 26.334  9.653   29.569  1.00 45.31  ? 147  VAL A C   1 
ATOM   1158 O O   . VAL A 1 147 ? 26.080  9.178   28.464  1.00 48.07  ? 147  VAL A O   1 
ATOM   1159 C CB  . VAL A 1 147 ? 26.560  7.655   31.026  1.00 42.22  ? 147  VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 147 ? 28.056  7.872   31.019  1.00 49.23  ? 147  VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 147 ? 26.149  6.994   32.314  1.00 33.36  ? 147  VAL A CG2 1 
ATOM   1162 N N   . SER A 1 148 ? 27.061  10.749  29.725  1.00 39.04  ? 148  SER A N   1 
ATOM   1163 C CA  . SER A 1 148 ? 27.685  11.405  28.576  1.00 28.59  ? 148  SER A CA  1 
ATOM   1164 C C   . SER A 1 148 ? 29.155  11.626  28.897  1.00 20.24  ? 148  SER A C   1 
ATOM   1165 O O   . SER A 1 148 ? 29.537  11.795  30.063  1.00 38.41  ? 148  SER A O   1 
ATOM   1166 C CB  . SER A 1 148 ? 26.980  12.718  28.238  1.00 26.34  ? 148  SER A CB  1 
ATOM   1167 O OG  . SER A 1 148 ? 27.568  13.778  28.965  1.00 40.81  ? 148  SER A OG  1 
ATOM   1168 N N   . MET A 1 149 ? 29.991  11.596  27.871  1.00 31.36  ? 149  MET A N   1 
ATOM   1169 C CA  . MET A 1 149 ? 31.435  11.601  28.104  1.00 39.36  ? 149  MET A CA  1 
ATOM   1170 C C   . MET A 1 149 ? 32.253  12.384  27.074  1.00 27.91  ? 149  MET A C   1 
ATOM   1171 O O   . MET A 1 149 ? 31.913  12.439  25.883  1.00 31.77  ? 149  MET A O   1 
ATOM   1172 C CB  . MET A 1 149 ? 31.977  10.159  28.199  1.00 27.31  ? 149  MET A CB  1 
ATOM   1173 C CG  . MET A 1 149 ? 32.687  9.671   26.935  1.00 28.39  ? 149  MET A CG  1 
ATOM   1174 S SD  . MET A 1 149 ? 31.618  9.239   25.538  1.00 44.12  ? 149  MET A SD  1 
ATOM   1175 C CE  . MET A 1 149 ? 30.892  7.677   26.024  1.00 28.27  ? 149  MET A CE  1 
ATOM   1176 N N   . ASN A 1 150 ? 33.342  12.964  27.563  1.00 20.06  ? 150  ASN A N   1 
ATOM   1177 C CA  . ASN A 1 150 ? 34.348  13.593  26.732  1.00 24.30  ? 150  ASN A CA  1 
ATOM   1178 C C   . ASN A 1 150 ? 35.257  12.563  26.109  1.00 38.29  ? 150  ASN A C   1 
ATOM   1179 O O   . ASN A 1 150 ? 35.615  11.577  26.753  1.00 41.84  ? 150  ASN A O   1 
ATOM   1180 C CB  . ASN A 1 150 ? 35.166  14.571  27.574  1.00 28.07  ? 150  ASN A CB  1 
ATOM   1181 C CG  . ASN A 1 150 ? 34.450  15.906  27.777  1.00 31.94  ? 150  ASN A CG  1 
ATOM   1182 O OD1 . ASN A 1 150 ? 33.299  16.070  27.371  1.00 19.60  ? 150  ASN A OD1 1 
ATOM   1183 N ND2 . ASN A 1 150 ? 35.131  16.862  28.415  1.00 38.30  ? 150  ASN A ND2 1 
ATOM   1184 N N   . TYR A 1 151 ? 35.620  12.773  24.848  1.00 37.84  ? 151  TYR A N   1 
ATOM   1185 C CA  . TYR A 1 151 ? 36.588  11.894  24.208  1.00 38.62  ? 151  TYR A CA  1 
ATOM   1186 C C   . TYR A 1 151 ? 37.461  12.727  23.276  1.00 39.40  ? 151  TYR A C   1 
ATOM   1187 O O   . TYR A 1 151 ? 36.992  13.692  22.686  1.00 46.44  ? 151  TYR A O   1 
ATOM   1188 C CB  . TYR A 1 151 ? 35.904  10.678  23.523  1.00 34.40  ? 151  TYR A CB  1 
ATOM   1189 C CG  . TYR A 1 151 ? 35.028  11.031  22.347  1.00 19.83  ? 151  TYR A CG  1 
ATOM   1190 C CD1 . TYR A 1 151 ? 33.702  11.438  22.521  1.00 19.36  ? 151  TYR A CD1 1 
ATOM   1191 C CD2 . TYR A 1 151 ? 35.531  10.954  21.051  1.00 26.01  ? 151  TYR A CD2 1 
ATOM   1192 C CE1 . TYR A 1 151 ? 32.900  11.762  21.441  1.00 18.91  ? 151  TYR A CE1 1 
ATOM   1193 C CE2 . TYR A 1 151 ? 34.748  11.302  19.962  1.00 24.21  ? 151  TYR A CE2 1 
ATOM   1194 C CZ  . TYR A 1 151 ? 33.438  11.711  20.167  1.00 26.85  ? 151  TYR A CZ  1 
ATOM   1195 O OH  . TYR A 1 151 ? 32.694  12.038  19.061  1.00 25.45  ? 151  TYR A OH  1 
ATOM   1196 N N   . ARG A 1 152 ? 38.742  12.384  23.182  1.00 49.59  ? 152  ARG A N   1 
ATOM   1197 C CA  . ARG A 1 152 ? 39.695  13.185  22.409  1.00 40.27  ? 152  ARG A CA  1 
ATOM   1198 C C   . ARG A 1 152 ? 39.343  13.275  20.936  1.00 39.79  ? 152  ARG A C   1 
ATOM   1199 O O   . ARG A 1 152 ? 39.036  12.276  20.276  1.00 40.57  ? 152  ARG A O   1 
ATOM   1200 C CB  . ARG A 1 152 ? 41.120  12.649  22.557  1.00 40.63  ? 152  ARG A CB  1 
ATOM   1201 C CG  . ARG A 1 152 ? 41.802  13.000  23.870  1.00 39.71  ? 152  ARG A CG  1 
ATOM   1202 C CD  . ARG A 1 152 ? 43.160  12.313  23.974  1.00 35.63  ? 152  ARG A CD  1 
ATOM   1203 N NE  . ARG A 1 152 ? 43.002  10.882  24.180  1.00 33.41  ? 152  ARG A NE  1 
ATOM   1204 C CZ  . ARG A 1 152 ? 43.998  10.002  24.150  1.00 45.52  ? 152  ARG A CZ  1 
ATOM   1205 N NH1 . ARG A 1 152 ? 45.231  10.425  23.894  1.00 45.87  ? 152  ARG A NH1 1 
ATOM   1206 N NH2 . ARG A 1 152 ? 43.759  8.702   24.371  1.00 27.74  ? 152  ARG A NH2 1 
ATOM   1207 N N   . VAL A 1 153 ? 39.410  14.493  20.429  1.00 35.60  ? 153  VAL A N   1 
ATOM   1208 C CA  . VAL A 1 153 ? 39.098  14.782  19.048  1.00 35.23  ? 153  VAL A CA  1 
ATOM   1209 C C   . VAL A 1 153 ? 40.337  15.295  18.326  1.00 40.02  ? 153  VAL A C   1 
ATOM   1210 O O   . VAL A 1 153 ? 41.402  15.474  18.921  1.00 49.06  ? 153  VAL A O   1 
ATOM   1211 C CB  . VAL A 1 153 ? 38.001  15.861  18.950  1.00 38.84  ? 153  VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 153 ? 36.719  15.336  19.477  1.00 33.92  ? 153  VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 153 ? 38.402  17.114  19.728  1.00 42.19  ? 153  VAL A CG2 1 
ATOM   1214 N N   . GLY A 1 154 ? 40.178  15.543  17.034  1.00 33.19  ? 154  GLY A N   1 
ATOM   1215 C CA  . GLY A 1 154 ? 41.228  16.124  16.232  1.00 24.52  ? 154  GLY A CA  1 
ATOM   1216 C C   . GLY A 1 154 ? 42.451  15.231  16.162  1.00 44.25  ? 154  GLY A C   1 
ATOM   1217 O O   . GLY A 1 154 ? 42.354  13.989  16.131  1.00 40.86  ? 154  GLY A O   1 
ATOM   1218 N N   . THR A 1 155 ? 43.611  15.877  16.120  1.00 31.33  ? 155  THR A N   1 
ATOM   1219 C CA  . THR A 1 155 ? 44.852  15.152  16.074  1.00 33.61  ? 155  THR A CA  1 
ATOM   1220 C C   . THR A 1 155 ? 44.957  14.276  17.315  1.00 36.87  ? 155  THR A C   1 
ATOM   1221 O O   . THR A 1 155 ? 45.296  13.096  17.225  1.00 62.39  ? 155  THR A O   1 
ATOM   1222 C CB  . THR A 1 155 ? 46.071  16.099  15.954  1.00 34.93  ? 155  THR A CB  1 
ATOM   1223 O OG1 . THR A 1 155 ? 45.963  17.161  16.911  1.00 39.77  ? 155  THR A OG1 1 
ATOM   1224 C CG2 . THR A 1 155 ? 46.143  16.688  14.558  1.00 29.68  ? 155  THR A CG2 1 
ATOM   1225 N N   . PHE A 1 156 ? 44.632  14.857  18.462  1.00 29.18  ? 156  PHE A N   1 
ATOM   1226 C CA  . PHE A 1 156 ? 44.843  14.224  19.756  1.00 31.50  ? 156  PHE A CA  1 
ATOM   1227 C C   . PHE A 1 156 ? 44.083  12.913  19.864  1.00 38.44  ? 156  PHE A C   1 
ATOM   1228 O O   . PHE A 1 156 ? 44.538  11.977  20.506  1.00 43.80  ? 156  PHE A O   1 
ATOM   1229 C CB  . PHE A 1 156 ? 44.418  15.171  20.882  1.00 31.63  ? 156  PHE A CB  1 
ATOM   1230 C CG  . PHE A 1 156 ? 44.910  16.587  20.708  1.00 42.42  ? 156  PHE A CG  1 
ATOM   1231 C CD1 . PHE A 1 156 ? 46.163  16.960  21.161  1.00 45.54  ? 156  PHE A CD1 1 
ATOM   1232 C CD2 . PHE A 1 156 ? 44.113  17.548  20.089  1.00 38.14  ? 156  PHE A CD2 1 
ATOM   1233 C CE1 . PHE A 1 156 ? 46.619  18.276  21.001  1.00 44.65  ? 156  PHE A CE1 1 
ATOM   1234 C CE2 . PHE A 1 156 ? 44.565  18.852  19.921  1.00 38.32  ? 156  PHE A CE2 1 
ATOM   1235 C CZ  . PHE A 1 156 ? 45.819  19.215  20.374  1.00 32.29  ? 156  PHE A CZ  1 
ATOM   1236 N N   . GLY A 1 157 ? 42.926  12.841  19.220  1.00 40.30  ? 157  GLY A N   1 
ATOM   1237 C CA  . GLY A 1 157 ? 42.115  11.647  19.274  1.00 28.51  ? 157  GLY A CA  1 
ATOM   1238 C C   . GLY A 1 157 ? 42.341  10.680  18.122  1.00 37.29  ? 157  GLY A C   1 
ATOM   1239 O O   . GLY A 1 157 ? 42.187  9.463   18.292  1.00 41.33  ? 157  GLY A O   1 
ATOM   1240 N N   . PHE A 1 158 ? 42.718  11.206  16.958  1.00 36.46  ? 158  PHE A N   1 
ATOM   1241 C CA  . PHE A 1 158 ? 42.718  10.389  15.746  1.00 23.26  ? 158  PHE A CA  1 
ATOM   1242 C C   . PHE A 1 158 ? 43.908  10.480  14.793  1.00 32.63  ? 158  PHE A C   1 
ATOM   1243 O O   . PHE A 1 158 ? 44.007  9.672   13.871  1.00 39.20  ? 158  PHE A O   1 
ATOM   1244 C CB  . PHE A 1 158 ? 41.407  10.563  14.991  1.00 27.15  ? 158  PHE A CB  1 
ATOM   1245 C CG  . PHE A 1 158 ? 40.202  10.322  15.842  1.00 28.11  ? 158  PHE A CG  1 
ATOM   1246 C CD1 . PHE A 1 158 ? 39.709  9.044   16.017  1.00 35.58  ? 158  PHE A CD1 1 
ATOM   1247 C CD2 . PHE A 1 158 ? 39.574  11.374  16.489  1.00 41.61  ? 158  PHE A CD2 1 
ATOM   1248 C CE1 . PHE A 1 158 ? 38.612  8.824   16.807  1.00 35.68  ? 158  PHE A CE1 1 
ATOM   1249 C CE2 . PHE A 1 158 ? 38.473  11.159  17.278  1.00 35.91  ? 158  PHE A CE2 1 
ATOM   1250 C CZ  . PHE A 1 158 ? 38.001  9.880   17.448  1.00 31.49  ? 158  PHE A CZ  1 
ATOM   1251 N N   . LEU A 1 159 ? 44.831  11.408  15.019  1.00 34.89  ? 159  LEU A N   1 
ATOM   1252 C CA  . LEU A 1 159 ? 46.080  11.379  14.256  1.00 33.78  ? 159  LEU A CA  1 
ATOM   1253 C C   . LEU A 1 159 ? 46.815  10.030  14.411  1.00 31.25  ? 159  LEU A C   1 
ATOM   1254 O O   . LEU A 1 159 ? 47.087  9.589   15.518  1.00 43.99  ? 159  LEU A O   1 
ATOM   1255 C CB  . LEU A 1 159 ? 46.996  12.527  14.654  1.00 26.54  ? 159  LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 159 ? 48.318  12.605  13.876  1.00 44.00  ? 159  LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 159 ? 48.825  14.045  13.744  1.00 35.19  ? 159  LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 159 ? 49.399  11.704  14.515  1.00 41.24  ? 159  LEU A CD2 1 
ATOM   1259 N N   . ALA A 1 160 ? 47.150  9.390   13.297  1.00 32.30  ? 160  ALA A N   1 
ATOM   1260 C CA  . ALA A 1 160 ? 47.783  8.077   13.356  1.00 41.12  ? 160  ALA A CA  1 
ATOM   1261 C C   . ALA A 1 160 ? 48.889  7.849   12.338  1.00 40.81  ? 160  ALA A C   1 
ATOM   1262 O O   . ALA A 1 160 ? 48.760  8.139   11.155  1.00 45.98  ? 160  ALA A O   1 
ATOM   1263 C CB  . ALA A 1 160 ? 46.729  6.960   13.247  1.00 39.85  ? 160  ALA A CB  1 
ATOM   1264 N N   . LEU A 1 161 ? 49.994  7.317   12.830  1.00 47.96  ? 161  LEU A N   1 
ATOM   1265 C CA  . LEU A 1 161 ? 50.978  6.695   11.980  1.00 45.30  ? 161  LEU A CA  1 
ATOM   1266 C C   . LEU A 1 161 ? 50.790  5.191   12.156  1.00 48.21  ? 161  LEU A C   1 
ATOM   1267 O O   . LEU A 1 161 ? 51.402  4.571   13.020  1.00 42.91  ? 161  LEU A O   1 
ATOM   1268 C CB  . LEU A 1 161 ? 52.362  7.179   12.372  1.00 40.64  ? 161  LEU A CB  1 
ATOM   1269 C CG  . LEU A 1 161 ? 52.403  8.662   11.995  1.00 63.99  ? 161  LEU A CG  1 
ATOM   1270 C CD1 . LEU A 1 161 ? 53.302  9.460   12.912  1.00 75.16  ? 161  LEU A CD1 1 
ATOM   1271 C CD2 . LEU A 1 161 ? 52.830  8.830   10.537  1.00 57.27  ? 161  LEU A CD2 1 
ATOM   1272 N N   . PRO A 1 162 ? 49.888  4.615   11.355  1.00 43.70  ? 162  PRO A N   1 
ATOM   1273 C CA  . PRO A 1 162 ? 49.439  3.222   11.446  1.00 47.98  ? 162  PRO A CA  1 
ATOM   1274 C C   . PRO A 1 162 ? 50.572  2.213   11.520  1.00 45.32  ? 162  PRO A C   1 
ATOM   1275 O O   . PRO A 1 162 ? 51.483  2.251   10.724  1.00 52.89  ? 162  PRO A O   1 
ATOM   1276 C CB  . PRO A 1 162 ? 48.645  3.038   10.157  1.00 39.83  ? 162  PRO A CB  1 
ATOM   1277 C CG  . PRO A 1 162 ? 48.053  4.386   9.942   1.00 35.85  ? 162  PRO A CG  1 
ATOM   1278 C CD  . PRO A 1 162 ? 49.157  5.351   10.313  1.00 38.50  ? 162  PRO A CD  1 
ATOM   1279 N N   . GLY A 1 163 ? 50.509  1.315   12.493  1.00 58.85  ? 163  GLY A N   1 
ATOM   1280 C CA  . GLY A 1 163 ? 51.484  0.247   12.610  1.00 53.04  ? 163  GLY A CA  1 
ATOM   1281 C C   . GLY A 1 163 ? 52.462  0.559   13.715  1.00 64.62  ? 163  GLY A C   1 
ATOM   1282 O O   . GLY A 1 163 ? 53.181  -0.323  14.192  1.00 72.84  ? 163  GLY A O   1 
ATOM   1283 N N   . SER A 1 164 ? 52.475  1.823   14.134  1.00 55.95  ? 164  SER A N   1 
ATOM   1284 C CA  . SER A 1 164 ? 53.439  2.288   15.125  1.00 47.40  ? 164  SER A CA  1 
ATOM   1285 C C   . SER A 1 164 ? 52.887  2.166   16.539  1.00 59.65  ? 164  SER A C   1 
ATOM   1286 O O   . SER A 1 164 ? 51.679  1.948   16.734  1.00 64.70  ? 164  SER A O   1 
ATOM   1287 C CB  . SER A 1 164 ? 53.853  3.737   14.835  1.00 50.23  ? 164  SER A CB  1 
ATOM   1288 O OG  . SER A 1 164 ? 52.910  4.681   15.324  1.00 39.64  ? 164  SER A OG  1 
ATOM   1289 N N   . ARG A 1 165 ? 53.777  2.318   17.518  1.00 59.05  ? 165  ARG A N   1 
ATOM   1290 C CA  . ARG A 1 165 ? 53.414  2.182   18.921  1.00 61.94  ? 165  ARG A CA  1 
ATOM   1291 C C   . ARG A 1 165 ? 52.988  3.518   19.531  1.00 54.38  ? 165  ARG A C   1 
ATOM   1292 O O   . ARG A 1 165 ? 52.142  3.559   20.432  1.00 44.46  ? 165  ARG A O   1 
ATOM   1293 C CB  . ARG A 1 165 ? 54.580  1.598   19.717  1.00 79.66  ? 165  ARG A CB  1 
ATOM   1294 C CG  . ARG A 1 165 ? 54.180  0.485   20.674  1.00 100.63 ? 165  ARG A CG  1 
ATOM   1295 C CD  . ARG A 1 165 ? 55.148  0.391   21.853  1.00 113.66 ? 165  ARG A CD  1 
ATOM   1296 N NE  . ARG A 1 165 ? 54.966  1.504   22.785  1.00 117.59 ? 165  ARG A NE  1 
ATOM   1297 C CZ  . ARG A 1 165 ? 55.779  2.553   22.880  1.00 113.06 ? 165  ARG A CZ  1 
ATOM   1298 N NH1 . ARG A 1 165 ? 56.855  2.634   22.106  1.00 114.47 ? 165  ARG A NH1 1 
ATOM   1299 N NH2 . ARG A 1 165 ? 55.520  3.519   23.756  1.00 103.73 ? 165  ARG A NH2 1 
ATOM   1300 N N   . GLU A 1 166 ? 53.567  4.606   19.031  1.00 47.81  ? 166  GLU A N   1 
ATOM   1301 C CA  . GLU A 1 166 ? 53.349  5.931   19.614  1.00 46.70  ? 166  GLU A CA  1 
ATOM   1302 C C   . GLU A 1 166 ? 52.090  6.643   19.128  1.00 51.62  ? 166  GLU A C   1 
ATOM   1303 O O   . GLU A 1 166 ? 51.613  7.567   19.792  1.00 47.17  ? 166  GLU A O   1 
ATOM   1304 C CB  . GLU A 1 166 ? 54.572  6.829   19.409  1.00 58.94  ? 166  GLU A CB  1 
ATOM   1305 C CG  . GLU A 1 166 ? 55.858  6.279   20.004  1.00 72.12  ? 166  GLU A CG  1 
ATOM   1306 C CD  . GLU A 1 166 ? 56.598  5.340   19.053  1.00 84.96  ? 166  GLU A CD  1 
ATOM   1307 O OE1 . GLU A 1 166 ? 55.982  4.817   18.095  1.00 78.11  ? 166  GLU A OE1 1 
ATOM   1308 O OE2 . GLU A 1 166 ? 57.810  5.128   19.264  1.00 94.59  ? 166  GLU A OE2 1 
ATOM   1309 N N   . ALA A 1 167 ? 51.563  6.222   17.976  1.00 59.30  ? 167  ALA A N   1 
ATOM   1310 C CA  . ALA A 1 167 ? 50.337  6.803   17.407  1.00 51.58  ? 167  ALA A CA  1 
ATOM   1311 C C   . ALA A 1 167 ? 49.597  5.763   16.590  1.00 53.09  ? 167  ALA A C   1 
ATOM   1312 O O   . ALA A 1 167 ? 49.567  5.831   15.365  1.00 56.05  ? 167  ALA A O   1 
ATOM   1313 C CB  . ALA A 1 167 ? 50.655  8.009   16.550  1.00 40.54  ? 167  ALA A CB  1 
ATOM   1314 N N   . PRO A 1 168 ? 49.005  4.790   17.280  1.00 43.43  ? 168  PRO A N   1 
ATOM   1315 C CA  . PRO A 1 168 ? 48.340  3.622   16.708  1.00 41.24  ? 168  PRO A CA  1 
ATOM   1316 C C   . PRO A 1 168 ? 47.074  3.982   15.940  1.00 55.23  ? 168  PRO A C   1 
ATOM   1317 O O   . PRO A 1 168 ? 46.638  3.192   15.090  1.00 47.44  ? 168  PRO A O   1 
ATOM   1318 C CB  . PRO A 1 168 ? 47.960  2.824   17.952  1.00 53.31  ? 168  PRO A CB  1 
ATOM   1319 C CG  . PRO A 1 168 ? 47.790  3.881   19.027  1.00 42.37  ? 168  PRO A CG  1 
ATOM   1320 C CD  . PRO A 1 168 ? 48.936  4.794   18.751  1.00 37.93  ? 168  PRO A CD  1 
ATOM   1321 N N   . GLY A 1 169 ? 46.496  5.148   16.240  1.00 51.58  ? 169  GLY A N   1 
ATOM   1322 C CA  . GLY A 1 169 ? 45.239  5.557   15.638  1.00 41.50  ? 169  GLY A CA  1 
ATOM   1323 C C   . GLY A 1 169 ? 44.051  5.238   16.530  1.00 35.83  ? 169  GLY A C   1 
ATOM   1324 O O   . GLY A 1 169 ? 44.190  4.475   17.473  1.00 43.63  ? 169  GLY A O   1 
ATOM   1325 N N   . ASN A 1 170 ? 42.899  5.845   16.245  1.00 39.19  ? 170  ASN A N   1 
ATOM   1326 C CA  . ASN A 1 170 ? 41.628  5.555   16.935  1.00 42.70  ? 170  ASN A CA  1 
ATOM   1327 C C   . ASN A 1 170 ? 41.539  5.779   18.468  1.00 33.05  ? 170  ASN A C   1 
ATOM   1328 O O   . ASN A 1 170 ? 40.575  5.347   19.080  1.00 37.57  ? 170  ASN A O   1 
ATOM   1329 C CB  . ASN A 1 170 ? 41.144  4.122   16.621  1.00 40.46  ? 170  ASN A CB  1 
ATOM   1330 C CG  . ASN A 1 170 ? 40.980  3.853   15.129  1.00 44.13  ? 170  ASN A CG  1 
ATOM   1331 O OD1 . ASN A 1 170 ? 40.476  4.691   14.393  1.00 43.25  ? 170  ASN A OD1 1 
ATOM   1332 N ND2 . ASN A 1 170 ? 41.405  2.661   14.681  1.00 45.09  ? 170  ASN A ND2 1 
ATOM   1333 N N   . VAL A 1 171 ? 42.511  6.436   19.095  1.00 37.98  ? 171  VAL A N   1 
ATOM   1334 C CA  . VAL A 1 171 ? 42.498  6.533   20.562  1.00 33.64  ? 171  VAL A CA  1 
ATOM   1335 C C   . VAL A 1 171 ? 41.247  7.267   21.061  1.00 48.74  ? 171  VAL A C   1 
ATOM   1336 O O   . VAL A 1 171 ? 40.719  6.969   22.153  1.00 34.06  ? 171  VAL A O   1 
ATOM   1337 C CB  . VAL A 1 171 ? 43.777  7.199   21.130  1.00 44.06  ? 171  VAL A CB  1 
ATOM   1338 C CG1 . VAL A 1 171 ? 45.032  6.480   20.619  1.00 27.29  ? 171  VAL A CG1 1 
ATOM   1339 C CG2 . VAL A 1 171 ? 43.806  8.721   20.819  1.00 25.09  ? 171  VAL A CG2 1 
ATOM   1340 N N   . GLY A 1 172 ? 40.776  8.227   20.264  1.00 31.55  ? 172  GLY A N   1 
ATOM   1341 C CA  . GLY A 1 172 ? 39.457  8.782   20.486  1.00 30.63  ? 172  GLY A CA  1 
ATOM   1342 C C   . GLY A 1 172 ? 38.393  7.715   20.721  1.00 22.45  ? 172  GLY A C   1 
ATOM   1343 O O   . GLY A 1 172 ? 37.621  7.807   21.664  1.00 35.90  ? 172  GLY A O   1 
ATOM   1344 N N   . LEU A 1 173 ? 38.339  6.707   19.854  1.00 49.88  ? 173  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 173 ? 37.402  5.586   20.027  1.00 39.51  ? 173  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 173 ? 37.687  4.792   21.294  1.00 27.07  ? 173  LEU A C   1 
ATOM   1347 O O   . LEU A 1 173 ? 36.779  4.408   22.020  1.00 43.45  ? 173  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 173 ? 37.397  4.670   18.808  1.00 23.91  ? 173  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 173 ? 36.862  5.350   17.543  1.00 33.87  ? 173  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 173 ? 37.110  4.500   16.327  1.00 23.99  ? 173  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 173 ? 35.377  5.711   17.662  1.00 22.43  ? 173  LEU A CD2 1 
ATOM   1352 N N   . LEU A 1 174 ? 38.960  4.589   21.584  1.00 32.02  ? 174  LEU A N   1 
ATOM   1353 C CA  . LEU A 1 174 ? 39.346  3.913   22.803  1.00 25.63  ? 174  LEU A CA  1 
ATOM   1354 C C   . LEU A 1 174 ? 38.989  4.675   24.082  1.00 35.80  ? 174  LEU A C   1 
ATOM   1355 O O   . LEU A 1 174 ? 38.695  4.050   25.101  1.00 34.80  ? 174  LEU A O   1 
ATOM   1356 C CB  . LEU A 1 174 ? 40.827  3.565   22.771  1.00 31.35  ? 174  LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 174 ? 41.314  2.563   21.707  1.00 39.11  ? 174  LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 174 ? 42.833  2.482   21.760  1.00 28.77  ? 174  LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 174 ? 40.690  1.149   21.888  1.00 40.25  ? 174  LEU A CD2 1 
ATOM   1360 N N   . ASP A 1 175 ? 39.031  6.008   24.047  1.00 43.59  ? 175  ASP A N   1 
ATOM   1361 C CA  . ASP A 1 175 ? 38.569  6.787   25.193  1.00 39.25  ? 175  ASP A CA  1 
ATOM   1362 C C   . ASP A 1 175 ? 37.123  6.375   25.466  1.00 40.75  ? 175  ASP A C   1 
ATOM   1363 O O   . ASP A 1 175 ? 36.717  6.118   26.607  1.00 40.16  ? 175  ASP A O   1 
ATOM   1364 C CB  . ASP A 1 175 ? 38.619  8.299   24.927  1.00 47.03  ? 175  ASP A CB  1 
ATOM   1365 C CG  . ASP A 1 175 ? 40.034  8.826   24.678  1.00 61.76  ? 175  ASP A CG  1 
ATOM   1366 O OD1 . ASP A 1 175 ? 41.011  8.118   24.989  1.00 55.08  ? 175  ASP A OD1 1 
ATOM   1367 O OD2 . ASP A 1 175 ? 40.166  9.968   24.172  1.00 65.60  ? 175  ASP A OD2 1 
ATOM   1368 N N   . GLN A 1 176 ? 36.337  6.297   24.402  1.00 31.49  ? 176  GLN A N   1 
ATOM   1369 C CA  . GLN A 1 176 ? 34.932  5.989   24.564  1.00 23.90  ? 176  GLN A CA  1 
ATOM   1370 C C   . GLN A 1 176 ? 34.790  4.612   25.165  1.00 40.95  ? 176  GLN A C   1 
ATOM   1371 O O   . GLN A 1 176 ? 34.082  4.430   26.142  1.00 49.88  ? 176  GLN A O   1 
ATOM   1372 C CB  . GLN A 1 176 ? 34.226  6.047   23.225  1.00 26.52  ? 176  GLN A CB  1 
ATOM   1373 C CG  . GLN A 1 176 ? 34.335  7.393   22.500  1.00 31.07  ? 176  GLN A CG  1 
ATOM   1374 C CD  . GLN A 1 176 ? 33.590  7.354   21.180  1.00 47.43  ? 176  GLN A CD  1 
ATOM   1375 O OE1 . GLN A 1 176 ? 33.073  6.299   20.772  1.00 53.55  ? 176  GLN A OE1 1 
ATOM   1376 N NE2 . GLN A 1 176 ? 33.526  8.489   20.504  1.00 30.07  ? 176  GLN A NE2 1 
ATOM   1377 N N   . ARG A 1 177 ? 35.478  3.642   24.570  1.00 42.78  ? 177  ARG A N   1 
ATOM   1378 C CA  . ARG A 1 177 ? 35.401  2.281   25.037  1.00 45.44  ? 177  ARG A CA  1 
ATOM   1379 C C   . ARG A 1 177 ? 35.723  2.213   26.527  1.00 49.51  ? 177  ARG A C   1 
ATOM   1380 O O   . ARG A 1 177 ? 35.085  1.473   27.277  1.00 48.66  ? 177  ARG A O   1 
ATOM   1381 C CB  . ARG A 1 177 ? 36.351  1.397   24.241  1.00 47.15  ? 177  ARG A CB  1 
ATOM   1382 C CG  . ARG A 1 177 ? 36.289  -0.069  24.657  1.00 40.32  ? 177  ARG A CG  1 
ATOM   1383 C CD  . ARG A 1 177 ? 37.200  -0.903  23.791  1.00 44.47  ? 177  ARG A CD  1 
ATOM   1384 N NE  . ARG A 1 177 ? 36.625  -1.064  22.461  1.00 43.32  ? 177  ARG A NE  1 
ATOM   1385 C CZ  . ARG A 1 177 ? 37.294  -1.545  21.424  1.00 45.64  ? 177  ARG A CZ  1 
ATOM   1386 N NH1 . ARG A 1 177 ? 38.562  -1.906  21.578  1.00 40.93  ? 177  ARG A NH1 1 
ATOM   1387 N NH2 . ARG A 1 177 ? 36.694  -1.662  20.244  1.00 40.18  ? 177  ARG A NH2 1 
ATOM   1388 N N   . LEU A 1 178 ? 36.703  3.003   26.955  1.00 45.05  ? 178  LEU A N   1 
ATOM   1389 C CA  . LEU A 1 178 ? 37.064  3.076   28.369  1.00 38.34  ? 178  LEU A CA  1 
ATOM   1390 C C   . LEU A 1 178 ? 35.914  3.584   29.239  1.00 43.81  ? 178  LEU A C   1 
ATOM   1391 O O   . LEU A 1 178 ? 35.738  3.082   30.342  1.00 45.23  ? 178  LEU A O   1 
ATOM   1392 C CB  . LEU A 1 178 ? 38.310  3.942   28.566  1.00 36.49  ? 178  LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 178 ? 38.834  4.114   29.989  1.00 38.20  ? 178  LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 178 ? 38.701  2.816   30.749  1.00 40.36  ? 178  LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 178 ? 40.278  4.562   29.947  1.00 27.24  ? 178  LEU A CD2 1 
ATOM   1396 N N   . ALA A 1 179 ? 35.141  4.566   28.748  1.00 30.34  ? 179  ALA A N   1 
ATOM   1397 C CA  . ALA A 1 179 ? 33.984  5.073   29.482  1.00 24.07  ? 179  ALA A CA  1 
ATOM   1398 C C   . ALA A 1 179 ? 32.880  4.034   29.538  1.00 49.47  ? 179  ALA A C   1 
ATOM   1399 O O   . ALA A 1 179 ? 32.208  3.911   30.558  1.00 49.98  ? 179  ALA A O   1 
ATOM   1400 C CB  . ALA A 1 179 ? 33.448  6.435   28.893  1.00 22.95  ? 179  ALA A CB  1 
ATOM   1401 N N   . LEU A 1 180 ? 32.676  3.291   28.455  1.00 24.66  ? 180  LEU A N   1 
ATOM   1402 C CA  . LEU A 1 180 ? 31.751  2.157   28.507  1.00 52.66  ? 180  LEU A CA  1 
ATOM   1403 C C   . LEU A 1 180 ? 32.183  1.130   29.568  1.00 47.87  ? 180  LEU A C   1 
ATOM   1404 O O   . LEU A 1 180 ? 31.348  0.607   30.308  1.00 39.68  ? 180  LEU A O   1 
ATOM   1405 C CB  . LEU A 1 180 ? 31.595  1.468   27.147  1.00 47.05  ? 180  LEU A CB  1 
ATOM   1406 C CG  . LEU A 1 180 ? 31.261  2.330   25.935  1.00 42.20  ? 180  LEU A CG  1 
ATOM   1407 C CD1 . LEU A 1 180 ? 30.792  1.467   24.763  1.00 33.46  ? 180  LEU A CD1 1 
ATOM   1408 C CD2 . LEU A 1 180 ? 30.249  3.414   26.279  1.00 35.79  ? 180  LEU A CD2 1 
ATOM   1409 N N   . GLN A 1 181 ? 33.482  0.853   29.648  1.00 37.86  ? 181  GLN A N   1 
ATOM   1410 C CA  . GLN A 1 181 ? 33.985  -0.042  30.685  1.00 42.10  ? 181  GLN A CA  1 
ATOM   1411 C C   . GLN A 1 181 ? 33.693  0.508   32.073  1.00 47.39  ? 181  GLN A C   1 
ATOM   1412 O O   . GLN A 1 181 ? 33.273  -0.225  32.986  1.00 43.02  ? 181  GLN A O   1 
ATOM   1413 C CB  . GLN A 1 181 ? 35.483  -0.257  30.523  1.00 35.32  ? 181  GLN A CB  1 
ATOM   1414 C CG  . GLN A 1 181 ? 35.783  -1.345  29.548  1.00 55.26  ? 181  GLN A CG  1 
ATOM   1415 C CD  . GLN A 1 181 ? 37.147  -1.215  28.960  1.00 49.36  ? 181  GLN A CD  1 
ATOM   1416 O OE1 . GLN A 1 181 ? 37.909  -0.331  29.335  1.00 59.83  ? 181  GLN A OE1 1 
ATOM   1417 N NE2 . GLN A 1 181 ? 37.469  -2.088  28.020  1.00 38.83  ? 181  GLN A NE2 1 
ATOM   1418 N N   . TRP A 1 182 ? 33.915  1.810   32.215  1.00 43.26  ? 182  TRP A N   1 
ATOM   1419 C CA  . TRP A 1 182 ? 33.619  2.501   33.451  1.00 37.82  ? 182  TRP A CA  1 
ATOM   1420 C C   . TRP A 1 182 ? 32.159  2.304   33.865  1.00 38.84  ? 182  TRP A C   1 
ATOM   1421 O O   . TRP A 1 182 ? 31.860  2.140   35.052  1.00 38.46  ? 182  TRP A O   1 
ATOM   1422 C CB  . TRP A 1 182 ? 33.933  3.995   33.327  1.00 37.97  ? 182  TRP A CB  1 
ATOM   1423 C CG  . TRP A 1 182 ? 33.822  4.699   34.649  1.00 42.26  ? 182  TRP A CG  1 
ATOM   1424 C CD1 . TRP A 1 182 ? 34.817  4.871   35.577  1.00 28.59  ? 182  TRP A CD1 1 
ATOM   1425 C CD2 . TRP A 1 182 ? 32.639  5.291   35.212  1.00 34.26  ? 182  TRP A CD2 1 
ATOM   1426 N NE1 . TRP A 1 182 ? 34.324  5.542   36.675  1.00 41.59  ? 182  TRP A NE1 1 
ATOM   1427 C CE2 . TRP A 1 182 ? 32.994  5.816   36.473  1.00 31.18  ? 182  TRP A CE2 1 
ATOM   1428 C CE3 . TRP A 1 182 ? 31.313  5.410   34.780  1.00 35.04  ? 182  TRP A CE3 1 
ATOM   1429 C CZ2 . TRP A 1 182 ? 32.076  6.463   37.298  1.00 35.95  ? 182  TRP A CZ2 1 
ATOM   1430 C CZ3 . TRP A 1 182 ? 30.399  6.061   35.601  1.00 35.01  ? 182  TRP A CZ3 1 
ATOM   1431 C CH2 . TRP A 1 182 ? 30.788  6.582   36.845  1.00 35.01  ? 182  TRP A CH2 1 
ATOM   1432 N N   . VAL A 1 183 ? 31.250  2.313   32.893  1.00 30.15  ? 183  VAL A N   1 
ATOM   1433 C CA  . VAL A 1 183 ? 29.839  2.237   33.221  1.00 37.50  ? 183  VAL A CA  1 
ATOM   1434 C C   . VAL A 1 183 ? 29.542  0.835   33.705  1.00 47.54  ? 183  VAL A C   1 
ATOM   1435 O O   . VAL A 1 183 ? 28.769  0.623   34.641  1.00 51.70  ? 183  VAL A O   1 
ATOM   1436 C CB  . VAL A 1 183 ? 28.941  2.583   32.026  1.00 39.97  ? 183  VAL A CB  1 
ATOM   1437 C CG1 . VAL A 1 183 ? 27.487  2.141   32.279  1.00 31.20  ? 183  VAL A CG1 1 
ATOM   1438 C CG2 . VAL A 1 183 ? 29.018  4.074   31.728  1.00 30.80  ? 183  VAL A CG2 1 
ATOM   1439 N N   . GLN A 1 184 ? 30.186  -0.125  33.070  1.00 49.72  ? 184  GLN A N   1 
ATOM   1440 C CA  . GLN A 1 184 ? 29.981  -1.508  33.428  1.00 41.82  ? 184  GLN A CA  1 
ATOM   1441 C C   . GLN A 1 184 ? 30.442  -1.781  34.845  1.00 45.48  ? 184  GLN A C   1 
ATOM   1442 O O   . GLN A 1 184 ? 29.839  -2.606  35.555  1.00 45.00  ? 184  GLN A O   1 
ATOM   1443 C CB  . GLN A 1 184 ? 30.679  -2.407  32.424  1.00 33.97  ? 184  GLN A CB  1 
ATOM   1444 C CG  . GLN A 1 184 ? 29.926  -2.477  31.119  1.00 34.72  ? 184  GLN A CG  1 
ATOM   1445 C CD  . GLN A 1 184 ? 28.773  -3.474  31.170  1.00 52.99  ? 184  GLN A CD  1 
ATOM   1446 O OE1 . GLN A 1 184 ? 28.972  -4.676  31.403  1.00 49.75  ? 184  GLN A OE1 1 
ATOM   1447 N NE2 . GLN A 1 184 ? 27.561  -2.977  30.949  1.00 49.44  ? 184  GLN A NE2 1 
ATOM   1448 N N   . GLU A 1 185 ? 31.486  -1.087  35.290  1.00 41.00  ? 185  GLU A N   1 
ATOM   1449 C CA  . GLU A 1 185 ? 31.924  -1.337  36.661  1.00 49.19  ? 185  GLU A CA  1 
ATOM   1450 C C   . GLU A 1 185 ? 31.175  -0.533  37.718  1.00 38.98  ? 185  GLU A C   1 
ATOM   1451 O O   . GLU A 1 185 ? 31.014  -0.977  38.837  1.00 55.18  ? 185  GLU A O   1 
ATOM   1452 C CB  . GLU A 1 185 ? 33.429  -1.155  36.842  1.00 46.88  ? 185  GLU A CB  1 
ATOM   1453 C CG  . GLU A 1 185 ? 33.993  -2.161  37.838  1.00 49.05  ? 185  GLU A CG  1 
ATOM   1454 C CD  . GLU A 1 185 ? 35.376  -1.809  38.318  1.00 64.53  ? 185  GLU A CD  1 
ATOM   1455 O OE1 . GLU A 1 185 ? 36.081  -1.078  37.582  1.00 70.06  ? 185  GLU A OE1 1 
ATOM   1456 O OE2 . GLU A 1 185 ? 35.751  -2.261  39.431  1.00 65.77  ? 185  GLU A OE2 1 
ATOM   1457 N N   . ASN A 1 186 ? 30.688  0.638   37.353  1.00 39.73  ? 186  ASN A N   1 
ATOM   1458 C CA  . ASN A 1 186 ? 30.301  1.601   38.366  1.00 39.14  ? 186  ASN A CA  1 
ATOM   1459 C C   . ASN A 1 186 ? 28.846  2.022   38.355  1.00 45.03  ? 186  ASN A C   1 
ATOM   1460 O O   . ASN A 1 186 ? 28.343  2.506   39.361  1.00 54.88  ? 186  ASN A O   1 
ATOM   1461 C CB  . ASN A 1 186 ? 31.205  2.830   38.253  1.00 28.39  ? 186  ASN A CB  1 
ATOM   1462 C CG  . ASN A 1 186 ? 32.664  2.478   38.413  1.00 45.42  ? 186  ASN A CG  1 
ATOM   1463 O OD1 . ASN A 1 186 ? 33.109  2.061   39.503  1.00 39.84  ? 186  ASN A OD1 1 
ATOM   1464 N ND2 . ASN A 1 186 ? 33.427  2.631   37.333  1.00 33.22  ? 186  ASN A ND2 1 
ATOM   1465 N N   . ILE A 1 187 ? 28.168  1.842   37.227  1.00 39.56  ? 187  ILE A N   1 
ATOM   1466 C CA  . ILE A 1 187 ? 26.853  2.441   37.060  1.00 28.63  ? 187  ILE A CA  1 
ATOM   1467 C C   . ILE A 1 187 ? 25.807  1.952   38.085  1.00 35.81  ? 187  ILE A C   1 
ATOM   1468 O O   . ILE A 1 187 ? 24.876  2.680   38.421  1.00 51.23  ? 187  ILE A O   1 
ATOM   1469 C CB  . ILE A 1 187 ? 26.339  2.378   35.578  1.00 29.55  ? 187  ILE A CB  1 
ATOM   1470 C CG1 . ILE A 1 187 ? 25.359  3.538   35.312  1.00 38.53  ? 187  ILE A CG1 1 
ATOM   1471 C CG2 . ILE A 1 187 ? 25.722  0.997   35.231  1.00 28.10  ? 187  ILE A CG2 1 
ATOM   1472 C CD1 . ILE A 1 187 ? 25.976  4.943   35.511  1.00 31.64  ? 187  ILE A CD1 1 
ATOM   1473 N N   . ALA A 1 188 ? 25.974  0.743   38.606  1.00 40.72  ? 188  ALA A N   1 
ATOM   1474 C CA  . ALA A 1 188 ? 25.066  0.245   39.639  1.00 44.37  ? 188  ALA A CA  1 
ATOM   1475 C C   . ALA A 1 188 ? 25.084  1.087   40.917  1.00 42.49  ? 188  ALA A C   1 
ATOM   1476 O O   . ALA A 1 188 ? 24.104  1.123   41.654  1.00 45.55  ? 188  ALA A O   1 
ATOM   1477 C CB  . ALA A 1 188 ? 25.354  -1.219  39.956  1.00 32.06  ? 188  ALA A CB  1 
ATOM   1478 N N   . ALA A 1 189 ? 26.203  1.744   41.192  1.00 39.52  ? 189  ALA A N   1 
ATOM   1479 C CA  . ALA A 1 189 ? 26.285  2.644   42.336  1.00 44.84  ? 189  ALA A CA  1 
ATOM   1480 C C   . ALA A 1 189 ? 25.324  3.841   42.196  1.00 55.70  ? 189  ALA A C   1 
ATOM   1481 O O   . ALA A 1 189 ? 25.028  4.528   43.173  1.00 66.28  ? 189  ALA A O   1 
ATOM   1482 C CB  . ALA A 1 189 ? 27.722  3.135   42.525  1.00 30.27  ? 189  ALA A CB  1 
ATOM   1483 N N   . PHE A 1 190 ? 24.848  4.109   40.986  1.00 46.62  ? 190  PHE A N   1 
ATOM   1484 C CA  . PHE A 1 190 ? 23.935  5.218   40.808  1.00 42.47  ? 190  PHE A CA  1 
ATOM   1485 C C   . PHE A 1 190 ? 22.516  4.740   40.557  1.00 49.52  ? 190  PHE A C   1 
ATOM   1486 O O   . PHE A 1 190 ? 21.597  5.551   40.407  1.00 56.96  ? 190  PHE A O   1 
ATOM   1487 C CB  . PHE A 1 190 ? 24.385  6.100   39.659  1.00 39.83  ? 190  PHE A CB  1 
ATOM   1488 C CG  . PHE A 1 190 ? 25.781  6.615   39.799  1.00 38.04  ? 190  PHE A CG  1 
ATOM   1489 C CD1 . PHE A 1 190 ? 26.861  5.795   39.532  1.00 32.92  ? 190  PHE A CD1 1 
ATOM   1490 C CD2 . PHE A 1 190 ? 26.014  7.939   40.163  1.00 44.10  ? 190  PHE A CD2 1 
ATOM   1491 C CE1 . PHE A 1 190 ? 28.156  6.280   39.637  1.00 46.11  ? 190  PHE A CE1 1 
ATOM   1492 C CE2 . PHE A 1 190 ? 27.308  8.436   40.268  1.00 42.08  ? 190  PHE A CE2 1 
ATOM   1493 C CZ  . PHE A 1 190 ? 28.382  7.604   40.000  1.00 43.33  ? 190  PHE A CZ  1 
ATOM   1494 N N   . GLY A 1 191 ? 22.339  3.424   40.512  1.00 35.57  ? 191  GLY A N   1 
ATOM   1495 C CA  . GLY A 1 191 ? 21.037  2.845   40.271  1.00 30.08  ? 191  GLY A CA  1 
ATOM   1496 C C   . GLY A 1 191 ? 20.835  2.471   38.816  1.00 38.59  ? 191  GLY A C   1 
ATOM   1497 O O   . GLY A 1 191 ? 19.752  2.032   38.442  1.00 42.22  ? 191  GLY A O   1 
ATOM   1498 N N   . GLY A 1 192 ? 21.861  2.639   37.985  1.00 28.82  ? 192  GLY A N   1 
ATOM   1499 C CA  . GLY A 1 192 ? 21.779  2.186   36.600  1.00 52.04  ? 192  GLY A CA  1 
ATOM   1500 C C   . GLY A 1 192 ? 21.988  0.683   36.438  1.00 52.49  ? 192  GLY A C   1 
ATOM   1501 O O   . GLY A 1 192 ? 22.677  0.063   37.250  1.00 45.96  ? 192  GLY A O   1 
ATOM   1502 N N   . ASP A 1 193 ? 21.391  0.100   35.396  1.00 52.32  ? 193  ASP A N   1 
ATOM   1503 C CA  . ASP A 1 193 ? 21.479  -1.340  35.118  1.00 41.09  ? 193  ASP A CA  1 
ATOM   1504 C C   . ASP A 1 193 ? 22.546  -1.617  34.063  1.00 40.00  ? 193  ASP A C   1 
ATOM   1505 O O   . ASP A 1 193 ? 22.368  -1.265  32.907  1.00 41.13  ? 193  ASP A O   1 
ATOM   1506 C CB  . ASP A 1 193 ? 20.126  -1.858  34.609  1.00 41.28  ? 193  ASP A CB  1 
ATOM   1507 C CG  . ASP A 1 193 ? 20.046  -3.404  34.523  1.00 61.80  ? 193  ASP A CG  1 
ATOM   1508 O OD1 . ASP A 1 193 ? 21.082  -4.121  34.738  1.00 39.13  ? 193  ASP A OD1 1 
ATOM   1509 O OD2 . ASP A 1 193 ? 18.915  -3.887  34.223  1.00 50.52  ? 193  ASP A OD2 1 
ATOM   1510 N N   . PRO A 1 194 ? 23.662  -2.262  34.455  1.00 49.33  ? 194  PRO A N   1 
ATOM   1511 C CA  . PRO A 1 194 ? 24.677  -2.565  33.436  1.00 39.25  ? 194  PRO A CA  1 
ATOM   1512 C C   . PRO A 1 194 ? 24.256  -3.692  32.508  1.00 44.78  ? 194  PRO A C   1 
ATOM   1513 O O   . PRO A 1 194 ? 24.860  -3.832  31.443  1.00 40.84  ? 194  PRO A O   1 
ATOM   1514 C CB  . PRO A 1 194 ? 25.915  -2.949  34.250  1.00 31.23  ? 194  PRO A CB  1 
ATOM   1515 C CG  . PRO A 1 194 ? 25.421  -3.281  35.576  1.00 32.06  ? 194  PRO A CG  1 
ATOM   1516 C CD  . PRO A 1 194 ? 24.110  -2.616  35.813  1.00 31.66  ? 194  PRO A CD  1 
ATOM   1517 N N   . MET A 1 195 ? 23.243  -4.474  32.882  1.00 49.02  ? 195  MET A N   1 
ATOM   1518 C CA  . MET A 1 195 ? 22.748  -5.492  31.968  1.00 56.34  ? 195  MET A CA  1 
ATOM   1519 C C   . MET A 1 195 ? 21.920  -4.845  30.851  1.00 51.61  ? 195  MET A C   1 
ATOM   1520 O O   . MET A 1 195 ? 21.465  -5.532  29.932  1.00 51.89  ? 195  MET A O   1 
ATOM   1521 C CB  . MET A 1 195 ? 21.913  -6.538  32.702  1.00 70.57  ? 195  MET A CB  1 
ATOM   1522 C CG  . MET A 1 195 ? 22.558  -7.110  33.957  1.00 86.94  ? 195  MET A CG  1 
ATOM   1523 S SD  . MET A 1 195 ? 23.054  -8.839  33.819  1.00 72.64  ? 195  MET A SD  1 
ATOM   1524 C CE  . MET A 1 195 ? 24.224  -8.686  32.461  1.00 60.09  ? 195  MET A CE  1 
ATOM   1525 N N   . SER A 1 196 ? 21.743  -3.524  30.924  1.00 42.59  ? 196  SER A N   1 
ATOM   1526 C CA  . SER A 1 196 ? 20.885  -2.798  29.988  1.00 31.74  ? 196  SER A CA  1 
ATOM   1527 C C   . SER A 1 196 ? 21.442  -1.421  29.602  1.00 49.31  ? 196  SER A C   1 
ATOM   1528 O O   . SER A 1 196 ? 21.062  -0.367  30.162  1.00 40.71  ? 196  SER A O   1 
ATOM   1529 C CB  . SER A 1 196 ? 19.498  -2.628  30.582  1.00 38.72  ? 196  SER A CB  1 
ATOM   1530 O OG  . SER A 1 196 ? 18.715  -1.768  29.786  1.00 45.24  ? 196  SER A OG  1 
ATOM   1531 N N   . VAL A 1 197 ? 22.335  -1.433  28.624  1.00 44.15  ? 197  VAL A N   1 
ATOM   1532 C CA  . VAL A 1 197 ? 23.018  -0.228  28.216  1.00 48.65  ? 197  VAL A CA  1 
ATOM   1533 C C   . VAL A 1 197 ? 22.802  0.051   26.734  1.00 54.46  ? 197  VAL A C   1 
ATOM   1534 O O   . VAL A 1 197 ? 22.992  -0.835  25.876  1.00 40.32  ? 197  VAL A O   1 
ATOM   1535 C CB  . VAL A 1 197 ? 24.517  -0.321  28.512  1.00 56.43  ? 197  VAL A CB  1 
ATOM   1536 C CG1 . VAL A 1 197 ? 25.260  0.863   27.866  1.00 49.76  ? 197  VAL A CG1 1 
ATOM   1537 C CG2 . VAL A 1 197 ? 24.762  -0.419  30.038  1.00 38.26  ? 197  VAL A CG2 1 
ATOM   1538 N N   . THR A 1 198 ? 22.408  1.296   26.459  1.00 44.95  ? 198  THR A N   1 
ATOM   1539 C CA  . THR A 1 198 ? 22.023  1.728   25.129  1.00 33.37  ? 198  THR A CA  1 
ATOM   1540 C C   . THR A 1 198 ? 22.850  2.947   24.711  1.00 49.28  ? 198  THR A C   1 
ATOM   1541 O O   . THR A 1 198 ? 22.778  4.015   25.338  1.00 54.16  ? 198  THR A O   1 
ATOM   1542 C CB  . THR A 1 198 ? 20.499  2.035   25.063  1.00 44.99  ? 198  THR A CB  1 
ATOM   1543 O OG1 . THR A 1 198 ? 19.758  0.814   24.924  1.00 44.93  ? 198  THR A OG1 1 
ATOM   1544 C CG2 . THR A 1 198 ? 20.163  2.963   23.892  1.00 37.02  ? 198  THR A CG2 1 
ATOM   1545 N N   . LEU A 1 199 ? 23.656  2.761   23.664  1.00 39.79  ? 199  LEU A N   1 
ATOM   1546 C CA  . LEU A 1 199 ? 24.444  3.830   23.080  1.00 41.31  ? 199  LEU A CA  1 
ATOM   1547 C C   . LEU A 1 199 ? 23.600  4.704   22.194  1.00 43.56  ? 199  LEU A C   1 
ATOM   1548 O O   . LEU A 1 199 ? 22.746  4.203   21.471  1.00 43.16  ? 199  LEU A O   1 
ATOM   1549 C CB  . LEU A 1 199 ? 25.523  3.246   22.195  1.00 42.49  ? 199  LEU A CB  1 
ATOM   1550 C CG  . LEU A 1 199 ? 26.403  2.173   22.805  1.00 36.76  ? 199  LEU A CG  1 
ATOM   1551 C CD1 . LEU A 1 199 ? 27.592  1.906   21.868  1.00 30.72  ? 199  LEU A CD1 1 
ATOM   1552 C CD2 . LEU A 1 199 ? 26.844  2.579   24.183  1.00 37.42  ? 199  LEU A CD2 1 
ATOM   1553 N N   . PHE A 1 200 ? 23.855  6.007   22.222  1.00 30.94  ? 200  PHE A N   1 
ATOM   1554 C CA  . PHE A 1 200 ? 23.288  6.876   21.207  1.00 34.31  ? 200  PHE A CA  1 
ATOM   1555 C C   . PHE A 1 200 ? 24.095  8.142   21.024  1.00 43.51  ? 200  PHE A C   1 
ATOM   1556 O O   . PHE A 1 200 ? 24.875  8.545   21.899  1.00 35.61  ? 200  PHE A O   1 
ATOM   1557 C CB  . PHE A 1 200 ? 21.801  7.163   21.434  1.00 42.80  ? 200  PHE A CB  1 
ATOM   1558 C CG  . PHE A 1 200 ? 21.511  8.196   22.496  1.00 46.14  ? 200  PHE A CG  1 
ATOM   1559 C CD1 . PHE A 1 200 ? 22.084  8.108   23.750  1.00 41.70  ? 200  PHE A CD1 1 
ATOM   1560 C CD2 . PHE A 1 200 ? 20.617  9.237   22.245  1.00 33.56  ? 200  PHE A CD2 1 
ATOM   1561 C CE1 . PHE A 1 200 ? 21.785  9.036   24.739  1.00 29.59  ? 200  PHE A CE1 1 
ATOM   1562 C CE2 . PHE A 1 200 ? 20.315  10.159  23.229  1.00 30.46  ? 200  PHE A CE2 1 
ATOM   1563 C CZ  . PHE A 1 200 ? 20.904  10.066  24.476  1.00 33.42  ? 200  PHE A CZ  1 
ATOM   1564 N N   . GLY A 1 201 ? 23.905  8.750   19.862  1.00 36.34  ? 201  GLY A N   1 
ATOM   1565 C CA  . GLY A 1 201 ? 24.800  9.765   19.385  1.00 19.47  ? 201  GLY A CA  1 
ATOM   1566 C C   . GLY A 1 201 ? 24.406  10.211  18.005  1.00 35.79  ? 201  GLY A C   1 
ATOM   1567 O O   . GLY A 1 201 ? 23.681  9.525   17.290  1.00 27.95  ? 201  GLY A O   1 
ATOM   1568 N N   . GLU A 1 202 ? 24.878  11.390  17.633  1.00 41.40  ? 202  GLU A N   1 
ATOM   1569 C CA  . GLU A 1 202 ? 24.525  11.954  16.359  1.00 30.84  ? 202  GLU A CA  1 
ATOM   1570 C C   . GLU A 1 202 ? 25.793  12.272  15.547  1.00 32.81  ? 202  GLU A C   1 
ATOM   1571 O O   . GLU A 1 202 ? 26.899  12.344  16.092  1.00 31.18  ? 202  GLU A O   1 
ATOM   1572 C CB  . GLU A 1 202 ? 23.637  13.176  16.594  1.00 37.80  ? 202  GLU A CB  1 
ATOM   1573 C CG  . GLU A 1 202 ? 23.263  13.942  15.339  1.00 40.53  ? 202  GLU A CG  1 
ATOM   1574 C CD  . GLU A 1 202 ? 24.265  15.015  15.061  1.00 50.11  ? 202  GLU A CD  1 
ATOM   1575 O OE1 . GLU A 1 202 ? 25.304  15.050  15.767  1.00 45.90  ? 202  GLU A OE1 1 
ATOM   1576 O OE2 . GLU A 1 202 ? 24.016  15.824  14.149  1.00 58.77  ? 202  GLU A OE2 1 
ATOM   1577 N N   . SER A 1 203 ? 25.622  12.443  14.241  1.00 20.89  ? 203  SER A N   1 
ATOM   1578 C CA  . SER A 1 203 ? 26.733  12.530  13.281  1.00 33.14  ? 203  SER A CA  1 
ATOM   1579 C C   . SER A 1 203 ? 27.939  11.632  13.635  1.00 39.58  ? 203  SER A C   1 
ATOM   1580 O O   . SER A 1 203 ? 27.831  10.407  13.590  1.00 41.44  ? 203  SER A O   1 
ATOM   1581 C CB  . SER A 1 203 ? 27.135  13.982  12.998  1.00 38.19  ? 203  SER A CB  1 
ATOM   1582 O OG  . SER A 1 203 ? 28.036  14.464  13.967  1.00 63.16  ? 203  SER A OG  1 
ATOM   1583 N N   . ALA A 1 204 ? 29.069  12.237  13.983  1.00 40.10  ? 204  ALA A N   1 
ATOM   1584 C CA  . ALA A 1 204 ? 30.272  11.485  14.330  1.00 34.25  ? 204  ALA A CA  1 
ATOM   1585 C C   . ALA A 1 204 ? 30.045  10.629  15.577  1.00 37.40  ? 204  ALA A C   1 
ATOM   1586 O O   . ALA A 1 204 ? 30.681  9.595   15.737  1.00 44.71  ? 204  ALA A O   1 
ATOM   1587 C CB  . ALA A 1 204 ? 31.466  12.452  14.549  1.00 26.43  ? 204  ALA A CB  1 
ATOM   1588 N N   . GLY A 1 205 ? 29.171  11.090  16.474  1.00 33.14  ? 205  GLY A N   1 
ATOM   1589 C CA  . GLY A 1 205 ? 28.737  10.298  17.604  1.00 36.05  ? 205  GLY A CA  1 
ATOM   1590 C C   . GLY A 1 205 ? 28.014  9.045   17.088  1.00 43.31  ? 205  GLY A C   1 
ATOM   1591 O O   . GLY A 1 205 ? 28.343  7.929   17.474  1.00 29.67  ? 205  GLY A O   1 
ATOM   1592 N N   . ALA A 1 206 ? 27.043  9.234   16.199  1.00 19.42  ? 206  ALA A N   1 
ATOM   1593 C CA  . ALA A 1 206 ? 26.379  8.137   15.540  1.00 37.41  ? 206  ALA A CA  1 
ATOM   1594 C C   . ALA A 1 206 ? 27.391  7.196   14.886  1.00 42.69  ? 206  ALA A C   1 
ATOM   1595 O O   . ALA A 1 206 ? 27.325  5.975   15.065  1.00 37.40  ? 206  ALA A O   1 
ATOM   1596 C CB  . ALA A 1 206 ? 25.409  8.661   14.514  1.00 31.74  ? 206  ALA A CB  1 
ATOM   1597 N N   . ALA A 1 207 ? 28.326  7.764   14.130  1.00 29.95  ? 207  ALA A N   1 
ATOM   1598 C CA  . ALA A 1 207 ? 29.350  6.967   13.470  1.00 29.25  ? 207  ALA A CA  1 
ATOM   1599 C C   . ALA A 1 207 ? 30.089  6.160   14.523  1.00 44.28  ? 207  ALA A C   1 
ATOM   1600 O O   . ALA A 1 207 ? 30.296  4.943   14.390  1.00 37.51  ? 207  ALA A O   1 
ATOM   1601 C CB  . ALA A 1 207 ? 30.302  7.857   12.717  1.00 25.36  ? 207  ALA A CB  1 
ATOM   1602 N N   . SER A 1 208 ? 30.472  6.858   15.585  1.00 45.54  ? 208  SER A N   1 
ATOM   1603 C CA  . SER A 1 208 ? 31.125  6.223   16.722  1.00 42.22  ? 208  SER A CA  1 
ATOM   1604 C C   . SER A 1 208 ? 30.356  4.999   17.227  1.00 45.15  ? 208  SER A C   1 
ATOM   1605 O O   . SER A 1 208 ? 30.944  3.959   17.503  1.00 38.04  ? 208  SER A O   1 
ATOM   1606 C CB  . SER A 1 208 ? 31.302  7.236   17.851  1.00 32.50  ? 208  SER A CB  1 
ATOM   1607 O OG  . SER A 1 208 ? 32.312  8.185   17.535  1.00 37.61  ? 208  SER A OG  1 
ATOM   1608 N N   . VAL A 1 209 ? 29.045  5.145   17.366  1.00 21.79  ? 209  VAL A N   1 
ATOM   1609 C CA  . VAL A 1 209 ? 28.222  4.075   17.850  1.00 30.09  ? 209  VAL A CA  1 
ATOM   1610 C C   . VAL A 1 209 ? 28.358  2.890   16.883  1.00 43.29  ? 209  VAL A C   1 
ATOM   1611 O O   . VAL A 1 209 ? 28.635  1.753   17.296  1.00 28.53  ? 209  VAL A O   1 
ATOM   1612 C CB  . VAL A 1 209 ? 26.771  4.533   17.954  1.00 32.40  ? 209  VAL A CB  1 
ATOM   1613 C CG1 . VAL A 1 209 ? 25.827  3.342   18.250  1.00 26.87  ? 209  VAL A CG1 1 
ATOM   1614 C CG2 . VAL A 1 209 ? 26.647  5.616   19.025  1.00 41.41  ? 209  VAL A CG2 1 
ATOM   1615 N N   . GLY A 1 210 ? 28.211  3.186   15.591  1.00 37.36  ? 210  GLY A N   1 
ATOM   1616 C CA  . GLY A 1 210 ? 28.369  2.193   14.550  1.00 39.77  ? 210  GLY A CA  1 
ATOM   1617 C C   . GLY A 1 210 ? 29.636  1.403   14.754  1.00 37.54  ? 210  GLY A C   1 
ATOM   1618 O O   . GLY A 1 210 ? 29.671  0.173   14.681  1.00 44.20  ? 210  GLY A O   1 
ATOM   1619 N N   . MET A 1 211 ? 30.687  2.137   15.039  1.00 24.54  ? 211  MET A N   1 
ATOM   1620 C CA  . MET A 1 211 ? 32.014  1.576   15.119  1.00 29.07  ? 211  MET A CA  1 
ATOM   1621 C C   . MET A 1 211 ? 32.192  0.636   16.294  1.00 50.79  ? 211  MET A C   1 
ATOM   1622 O O   . MET A 1 211 ? 32.996  -0.300  16.202  1.00 27.11  ? 211  MET A O   1 
ATOM   1623 C CB  . MET A 1 211 ? 33.084  2.694   15.092  1.00 25.87  ? 211  MET A CB  1 
ATOM   1624 C CG  . MET A 1 211 ? 33.502  3.019   13.645  1.00 29.74  ? 211  MET A CG  1 
ATOM   1625 S SD  . MET A 1 211 ? 34.352  4.572   13.347  1.00 66.69  ? 211  MET A SD  1 
ATOM   1626 C CE  . MET A 1 211 ? 32.978  5.719   13.294  1.00 136.38 ? 211  MET A CE  1 
ATOM   1627 N N   . HIS A 1 212 ? 31.452  0.873   17.385  1.00 25.55  ? 212  HIS A N   1 
ATOM   1628 C CA  . HIS A 1 212 ? 31.481  -0.064  18.499  1.00 31.32  ? 212  HIS A CA  1 
ATOM   1629 C C   . HIS A 1 212 ? 30.712  -1.344  18.165  1.00 44.56  ? 212  HIS A C   1 
ATOM   1630 O O   . HIS A 1 212 ? 31.076  -2.441  18.583  1.00 48.75  ? 212  HIS A O   1 
ATOM   1631 C CB  . HIS A 1 212 ? 30.923  0.563   19.756  1.00 33.61  ? 212  HIS A CB  1 
ATOM   1632 C CG  . HIS A 1 212 ? 31.768  1.673   20.286  1.00 50.36  ? 212  HIS A CG  1 
ATOM   1633 N ND1 . HIS A 1 212 ? 33.045  1.463   20.754  1.00 39.43  ? 212  HIS A ND1 1 
ATOM   1634 C CD2 . HIS A 1 212 ? 31.526  3.000   20.417  1.00 23.59  ? 212  HIS A CD2 1 
ATOM   1635 C CE1 . HIS A 1 212 ? 33.561  2.617   21.143  1.00 32.92  ? 212  HIS A CE1 1 
ATOM   1636 N NE2 . HIS A 1 212 ? 32.657  3.561   20.959  1.00 32.79  ? 212  HIS A NE2 1 
ATOM   1637 N N   . ILE A 1 213 ? 29.637  -1.190  17.414  1.00 40.72  ? 213  ILE A N   1 
ATOM   1638 C CA  . ILE A 1 213 ? 28.899  -2.334  16.957  1.00 47.29  ? 213  ILE A CA  1 
ATOM   1639 C C   . ILE A 1 213 ? 29.846  -3.195  16.156  1.00 53.58  ? 213  ILE A C   1 
ATOM   1640 O O   . ILE A 1 213 ? 29.779  -4.424  16.186  1.00 50.36  ? 213  ILE A O   1 
ATOM   1641 C CB  . ILE A 1 213 ? 27.771  -1.890  16.051  1.00 45.73  ? 213  ILE A CB  1 
ATOM   1642 C CG1 . ILE A 1 213 ? 26.830  -0.988  16.836  1.00 39.77  ? 213  ILE A CG1 1 
ATOM   1643 C CG2 . ILE A 1 213 ? 27.060  -3.098  15.451  1.00 30.08  ? 213  ILE A CG2 1 
ATOM   1644 C CD1 . ILE A 1 213 ? 25.630  -0.585  16.063  1.00 49.33  ? 213  ILE A CD1 1 
ATOM   1645 N N   . LEU A 1 214 ? 30.734  -2.528  15.432  1.00 53.46  ? 214  LEU A N   1 
ATOM   1646 C CA  . LEU A 1 214 ? 31.574  -3.206  14.467  1.00 43.49  ? 214  LEU A CA  1 
ATOM   1647 C C   . LEU A 1 214 ? 32.859  -3.693  15.087  1.00 36.74  ? 214  LEU A C   1 
ATOM   1648 O O   . LEU A 1 214 ? 33.572  -4.473  14.475  1.00 49.20  ? 214  LEU A O   1 
ATOM   1649 C CB  . LEU A 1 214 ? 31.882  -2.286  13.273  1.00 48.73  ? 214  LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 214 ? 30.698  -2.044  12.339  1.00 47.52  ? 214  LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 214 ? 31.070  -1.205  11.147  1.00 40.94  ? 214  LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 214 ? 30.117  -3.377  11.890  1.00 50.13  ? 214  LEU A CD2 1 
ATOM   1653 N N   . SER A 1 215 ? 33.162  -3.240  16.296  1.00 30.40  ? 215  SER A N   1 
ATOM   1654 C CA  . SER A 1 215 ? 34.452  -3.552  16.894  1.00 31.91  ? 215  SER A CA  1 
ATOM   1655 C C   . SER A 1 215 ? 34.287  -4.503  18.057  1.00 45.18  ? 215  SER A C   1 
ATOM   1656 O O   . SER A 1 215 ? 33.732  -4.124  19.092  1.00 40.60  ? 215  SER A O   1 
ATOM   1657 C CB  . SER A 1 215 ? 35.167  -2.279  17.348  1.00 39.39  ? 215  SER A CB  1 
ATOM   1658 O OG  . SER A 1 215 ? 36.523  -2.531  17.664  1.00 36.59  ? 215  SER A OG  1 
ATOM   1659 N N   . LEU A 1 216 ? 34.799  -5.725  17.883  1.00 52.84  ? 216  LEU A N   1 
ATOM   1660 C CA  . LEU A 1 216 ? 34.494  -6.865  18.759  1.00 54.23  ? 216  LEU A CA  1 
ATOM   1661 C C   . LEU A 1 216 ? 34.594  -6.593  20.264  1.00 62.10  ? 216  LEU A C   1 
ATOM   1662 O O   . LEU A 1 216 ? 33.679  -6.926  21.020  1.00 56.56  ? 216  LEU A O   1 
ATOM   1663 C CB  . LEU A 1 216 ? 35.349  -8.078  18.374  1.00 72.15  ? 216  LEU A CB  1 
ATOM   1664 C CG  . LEU A 1 216 ? 35.122  -9.360  19.185  1.00 87.34  ? 216  LEU A CG  1 
ATOM   1665 C CD1 . LEU A 1 216 ? 33.735  -9.956  18.930  1.00 72.71  ? 216  LEU A CD1 1 
ATOM   1666 C CD2 . LEU A 1 216 ? 36.214  -10.383 18.901  1.00 98.94  ? 216  LEU A CD2 1 
ATOM   1667 N N   . PRO A 1 217 ? 35.697  -5.964  20.702  1.00 68.37  ? 217  PRO A N   1 
ATOM   1668 C CA  . PRO A 1 217 ? 35.910  -5.610  22.111  1.00 55.49  ? 217  PRO A CA  1 
ATOM   1669 C C   . PRO A 1 217 ? 34.852  -4.662  22.689  1.00 52.55  ? 217  PRO A C   1 
ATOM   1670 O O   . PRO A 1 217 ? 34.781  -4.522  23.909  1.00 54.22  ? 217  PRO A O   1 
ATOM   1671 C CB  . PRO A 1 217 ? 37.263  -4.889  22.095  1.00 36.57  ? 217  PRO A CB  1 
ATOM   1672 C CG  . PRO A 1 217 ? 37.903  -5.293  20.874  1.00 43.78  ? 217  PRO A CG  1 
ATOM   1673 C CD  . PRO A 1 217 ? 36.814  -5.513  19.862  1.00 58.03  ? 217  PRO A CD  1 
ATOM   1674 N N   . SER A 1 218 ? 34.059  -4.008  21.847  1.00 40.99  ? 218  SER A N   1 
ATOM   1675 C CA  . SER A 1 218 ? 33.054  -3.089  22.367  1.00 39.15  ? 218  SER A CA  1 
ATOM   1676 C C   . SER A 1 218 ? 31.710  -3.767  22.548  1.00 55.54  ? 218  SER A C   1 
ATOM   1677 O O   . SER A 1 218 ? 30.808  -3.160  23.141  1.00 52.63  ? 218  SER A O   1 
ATOM   1678 C CB  . SER A 1 218 ? 32.877  -1.863  21.465  1.00 41.26  ? 218  SER A CB  1 
ATOM   1679 O OG  . SER A 1 218 ? 33.916  -0.907  21.637  1.00 42.74  ? 218  SER A OG  1 
ATOM   1680 N N   . ARG A 1 219 ? 31.559  -5.001  22.043  1.00 52.28  ? 219  ARG A N   1 
ATOM   1681 C CA  . ARG A 1 219 ? 30.200  -5.533  21.860  1.00 65.93  ? 219  ARG A CA  1 
ATOM   1682 C C   . ARG A 1 219 ? 29.706  -6.321  23.075  1.00 66.15  ? 219  ARG A C   1 
ATOM   1683 O O   . ARG A 1 219 ? 28.786  -7.135  22.983  1.00 76.59  ? 219  ARG A O   1 
ATOM   1684 C CB  . ARG A 1 219 ? 29.989  -6.269  20.501  1.00 110.14 ? 219  ARG A CB  1 
ATOM   1685 C CG  . ARG A 1 219 ? 28.509  -6.190  19.926  1.00 178.52 ? 219  ARG A CG  1 
ATOM   1686 C CD  . ARG A 1 219 ? 28.328  -6.755  18.468  1.00 99.24  ? 219  ARG A CD  1 
ATOM   1687 N NE  . ARG A 1 219 ? 26.928  -6.988  18.040  1.00 82.18  ? 219  ARG A NE  1 
ATOM   1688 C CZ  . ARG A 1 219 ? 26.567  -7.627  16.913  1.00 67.57  ? 219  ARG A CZ  1 
ATOM   1689 N NH1 . ARG A 1 219 ? 27.480  -8.113  16.080  1.00 68.49  ? 219  ARG A NH1 1 
ATOM   1690 N NH2 . ARG A 1 219 ? 25.286  -7.798  16.605  1.00 48.44  ? 219  ARG A NH2 1 
ATOM   1691 N N   . SER A 1 220 ? 30.313  -6.040  24.220  1.00 48.48  ? 220  SER A N   1 
ATOM   1692 C CA  . SER A 1 220 ? 29.861  -6.590  25.488  1.00 51.94  ? 220  SER A CA  1 
ATOM   1693 C C   . SER A 1 220 ? 29.627  -5.446  26.447  1.00 53.95  ? 220  SER A C   1 
ATOM   1694 O O   . SER A 1 220 ? 29.306  -5.638  27.616  1.00 61.08  ? 220  SER A O   1 
ATOM   1695 C CB  . SER A 1 220 ? 30.895  -7.550  26.076  1.00 58.20  ? 220  SER A CB  1 
ATOM   1696 O OG  . SER A 1 220 ? 32.154  -6.922  26.221  1.00 55.47  ? 220  SER A OG  1 
ATOM   1697 N N   . LEU A 1 221 ? 29.793  -4.240  25.934  1.00 49.94  ? 221  LEU A N   1 
ATOM   1698 C CA  . LEU A 1 221 ? 29.689  -3.062  26.760  1.00 42.44  ? 221  LEU A CA  1 
ATOM   1699 C C   . LEU A 1 221 ? 28.331  -2.390  26.606  1.00 43.08  ? 221  LEU A C   1 
ATOM   1700 O O   . LEU A 1 221 ? 28.024  -1.451  27.339  1.00 48.79  ? 221  LEU A O   1 
ATOM   1701 C CB  . LEU A 1 221 ? 30.836  -2.099  26.446  1.00 43.25  ? 221  LEU A CB  1 
ATOM   1702 C CG  . LEU A 1 221 ? 32.217  -2.775  26.502  1.00 46.29  ? 221  LEU A CG  1 
ATOM   1703 C CD1 . LEU A 1 221 ? 33.314  -1.741  26.247  1.00 38.36  ? 221  LEU A CD1 1 
ATOM   1704 C CD2 . LEU A 1 221 ? 32.437  -3.487  27.828  1.00 30.66  ? 221  LEU A CD2 1 
ATOM   1705 N N   . PHE A 1 222 ? 27.520  -2.880  25.666  1.00 35.10  ? 222  PHE A N   1 
ATOM   1706 C CA  . PHE A 1 222 ? 26.186  -2.312  25.402  1.00 43.43  ? 222  PHE A CA  1 
ATOM   1707 C C   . PHE A 1 222 ? 25.269  -3.328  24.712  1.00 47.97  ? 222  PHE A C   1 
ATOM   1708 O O   . PHE A 1 222 ? 25.732  -4.378  24.269  1.00 54.32  ? 222  PHE A O   1 
ATOM   1709 C CB  . PHE A 1 222 ? 26.269  -0.988  24.609  1.00 27.24  ? 222  PHE A CB  1 
ATOM   1710 C CG  . PHE A 1 222 ? 26.733  -1.151  23.211  1.00 27.27  ? 222  PHE A CG  1 
ATOM   1711 C CD1 . PHE A 1 222 ? 28.063  -1.427  22.930  1.00 29.39  ? 222  PHE A CD1 1 
ATOM   1712 C CD2 . PHE A 1 222 ? 25.852  -1.019  22.167  1.00 27.18  ? 222  PHE A CD2 1 
ATOM   1713 C CE1 . PHE A 1 222 ? 28.513  -1.586  21.611  1.00 27.63  ? 222  PHE A CE1 1 
ATOM   1714 C CE2 . PHE A 1 222 ? 26.283  -1.174  20.843  1.00 37.31  ? 222  PHE A CE2 1 
ATOM   1715 C CZ  . PHE A 1 222 ? 27.621  -1.456  20.567  1.00 27.51  ? 222  PHE A CZ  1 
ATOM   1716 N N   . HIS A 1 223 ? 23.979  -3.014  24.620  1.00 37.72  ? 223  HIS A N   1 
ATOM   1717 C CA  . HIS A 1 223 ? 22.997  -4.016  24.217  1.00 47.81  ? 223  HIS A CA  1 
ATOM   1718 C C   . HIS A 1 223 ? 22.136  -3.557  23.042  1.00 52.42  ? 223  HIS A C   1 
ATOM   1719 O O   . HIS A 1 223 ? 21.483  -4.366  22.349  1.00 57.68  ? 223  HIS A O   1 
ATOM   1720 C CB  . HIS A 1 223 ? 22.120  -4.380  25.427  1.00 49.21  ? 223  HIS A CB  1 
ATOM   1721 C CG  . HIS A 1 223 ? 22.910  -4.678  26.664  1.00 44.90  ? 223  HIS A CG  1 
ATOM   1722 N ND1 . HIS A 1 223 ? 23.122  -3.745  27.654  1.00 57.44  ? 223  HIS A ND1 1 
ATOM   1723 C CD2 . HIS A 1 223 ? 23.582  -5.790  27.046  1.00 36.56  ? 223  HIS A CD2 1 
ATOM   1724 C CE1 . HIS A 1 223 ? 23.877  -4.275  28.600  1.00 51.91  ? 223  HIS A CE1 1 
ATOM   1725 N NE2 . HIS A 1 223 ? 24.170  -5.514  28.254  1.00 36.21  ? 223  HIS A NE2 1 
ATOM   1726 N N   . ARG A 1 224 ? 22.151  -2.252  22.826  1.00 35.01  ? 224  ARG A N   1 
ATOM   1727 C CA  . ARG A 1 224 ? 21.297  -1.620  21.844  1.00 38.86  ? 224  ARG A CA  1 
ATOM   1728 C C   . ARG A 1 224 ? 21.931  -0.311  21.365  1.00 51.86  ? 224  ARG A C   1 
ATOM   1729 O O   . ARG A 1 224 ? 22.756  0.302   22.060  1.00 42.31  ? 224  ARG A O   1 
ATOM   1730 C CB  . ARG A 1 224 ? 19.912  -1.377  22.446  1.00 44.34  ? 224  ARG A CB  1 
ATOM   1731 C CG  . ARG A 1 224 ? 19.006  -2.610  22.404  1.00 55.99  ? 224  ARG A CG  1 
ATOM   1732 C CD  . ARG A 1 224 ? 17.699  -2.397  23.133  1.00 51.19  ? 224  ARG A CD  1 
ATOM   1733 N NE  . ARG A 1 224 ? 17.916  -2.315  24.571  1.00 64.47  ? 224  ARG A NE  1 
ATOM   1734 C CZ  . ARG A 1 224 ? 18.040  -3.378  25.359  1.00 75.14  ? 224  ARG A CZ  1 
ATOM   1735 N NH1 . ARG A 1 224 ? 17.968  -4.598  24.842  1.00 79.93  ? 224  ARG A NH1 1 
ATOM   1736 N NH2 . ARG A 1 224 ? 18.236  -3.224  26.661  1.00 76.30  ? 224  ARG A NH2 1 
ATOM   1737 N N   . ALA A 1 225 ? 21.544  0.113   20.172  1.00 44.44  ? 225  ALA A N   1 
ATOM   1738 C CA  . ALA A 1 225 ? 22.208  1.226   19.541  1.00 32.24  ? 225  ALA A CA  1 
ATOM   1739 C C   . ALA A 1 225 ? 21.224  2.205   18.935  1.00 39.68  ? 225  ALA A C   1 
ATOM   1740 O O   . ALA A 1 225 ? 20.224  1.789   18.342  1.00 32.73  ? 225  ALA A O   1 
ATOM   1741 C CB  . ALA A 1 225 ? 23.136  0.704   18.462  1.00 39.99  ? 225  ALA A CB  1 
ATOM   1742 N N   . VAL A 1 226 ? 21.514  3.503   19.084  1.00 39.22  ? 226  VAL A N   1 
ATOM   1743 C CA  . VAL A 1 226 ? 20.838  4.540   18.292  1.00 32.98  ? 226  VAL A CA  1 
ATOM   1744 C C   . VAL A 1 226 ? 21.819  5.363   17.474  1.00 36.62  ? 226  VAL A C   1 
ATOM   1745 O O   . VAL A 1 226 ? 22.836  5.832   17.986  1.00 47.84  ? 226  VAL A O   1 
ATOM   1746 C CB  . VAL A 1 226 ? 20.025  5.500   19.138  1.00 38.77  ? 226  VAL A CB  1 
ATOM   1747 C CG1 . VAL A 1 226 ? 19.400  6.586   18.228  1.00 46.77  ? 226  VAL A CG1 1 
ATOM   1748 C CG2 . VAL A 1 226 ? 18.981  4.752   19.926  1.00 24.19  ? 226  VAL A CG2 1 
ATOM   1749 N N   . LEU A 1 227 ? 21.508  5.542   16.197  1.00 37.74  ? 227  LEU A N   1 
ATOM   1750 C CA  . LEU A 1 227 ? 22.392  6.261   15.294  1.00 28.48  ? 227  LEU A CA  1 
ATOM   1751 C C   . LEU A 1 227 ? 21.677  7.414   14.622  1.00 31.83  ? 227  LEU A C   1 
ATOM   1752 O O   . LEU A 1 227 ? 20.954  7.204   13.662  1.00 36.97  ? 227  LEU A O   1 
ATOM   1753 C CB  . LEU A 1 227 ? 22.942  5.313   14.241  1.00 34.63  ? 227  LEU A CB  1 
ATOM   1754 C CG  . LEU A 1 227 ? 23.997  4.297   14.699  1.00 32.78  ? 227  LEU A CG  1 
ATOM   1755 C CD1 . LEU A 1 227 ? 23.370  3.025   15.258  1.00 31.75  ? 227  LEU A CD1 1 
ATOM   1756 C CD2 . LEU A 1 227 ? 24.920  3.974   13.565  1.00 30.66  ? 227  LEU A CD2 1 
ATOM   1757 N N   . GLN A 1 228 ? 21.888  8.628   15.136  1.00 38.46  ? 228  GLN A N   1 
ATOM   1758 C CA  . GLN A 1 228 ? 21.236  9.836   14.614  1.00 34.08  ? 228  GLN A CA  1 
ATOM   1759 C C   . GLN A 1 228 ? 22.111  10.579  13.605  1.00 43.32  ? 228  GLN A C   1 
ATOM   1760 O O   . GLN A 1 228 ? 23.153  11.132  13.973  1.00 41.12  ? 228  GLN A O   1 
ATOM   1761 C CB  . GLN A 1 228 ? 20.861  10.783  15.756  1.00 29.30  ? 228  GLN A CB  1 
ATOM   1762 C CG  . GLN A 1 228 ? 19.810  10.227  16.728  1.00 30.16  ? 228  GLN A CG  1 
ATOM   1763 C CD  . GLN A 1 228 ? 19.721  10.981  18.037  1.00 32.74  ? 228  GLN A CD  1 
ATOM   1764 O OE1 . GLN A 1 228 ? 19.573  10.379  19.096  1.00 38.24  ? 228  GLN A OE1 1 
ATOM   1765 N NE2 . GLN A 1 228 ? 19.821  12.312  17.976  1.00 49.03  ? 228  GLN A NE2 1 
ATOM   1766 N N   . SER A 1 229 ? 21.683  10.574  12.338  1.00 36.04  ? 229  SER A N   1 
ATOM   1767 C CA  . SER A 1 229 ? 22.303  11.384  11.294  1.00 31.16  ? 229  SER A CA  1 
ATOM   1768 C C   . SER A 1 229 ? 23.802  11.111  11.157  1.00 42.41  ? 229  SER A C   1 
ATOM   1769 O O   . SER A 1 229 ? 24.612  12.053  11.058  1.00 38.51  ? 229  SER A O   1 
ATOM   1770 C CB  . SER A 1 229 ? 22.077  12.885  11.565  1.00 42.94  ? 229  SER A CB  1 
ATOM   1771 O OG  . SER A 1 229 ? 20.703  13.209  11.760  1.00 41.29  ? 229  SER A OG  1 
ATOM   1772 N N   . GLY A 1 230 ? 24.166  9.827   11.149  1.00 36.82  ? 230  GLY A N   1 
ATOM   1773 C CA  . GLY A 1 230 ? 25.553  9.412   10.994  1.00 32.92  ? 230  GLY A CA  1 
ATOM   1774 C C   . GLY A 1 230 ? 25.708  7.893   10.891  1.00 48.43  ? 230  GLY A C   1 
ATOM   1775 O O   . GLY A 1 230 ? 24.831  7.148   11.323  1.00 38.37  ? 230  GLY A O   1 
ATOM   1776 N N   . THR A 1 231 ? 26.832  7.439   10.333  1.00 48.68  ? 231  THR A N   1 
ATOM   1777 C CA  . THR A 1 231 ? 27.107  6.010   10.138  1.00 35.23  ? 231  THR A CA  1 
ATOM   1778 C C   . THR A 1 231 ? 28.617  5.710   10.063  1.00 32.39  ? 231  THR A C   1 
ATOM   1779 O O   . THR A 1 231 ? 29.402  6.550   9.638   1.00 43.67  ? 231  THR A O   1 
ATOM   1780 C CB  . THR A 1 231 ? 26.439  5.498   8.839   1.00 51.57  ? 231  THR A CB  1 
ATOM   1781 O OG1 . THR A 1 231 ? 26.938  6.230   7.713   1.00 39.82  ? 231  THR A OG1 1 
ATOM   1782 C CG2 . THR A 1 231 ? 24.929  5.669   8.895   1.00 57.23  ? 231  THR A CG2 1 
ATOM   1783 N N   . PRO A 1 232 ? 29.031  4.503   10.468  1.00 41.70  ? 232  PRO A N   1 
ATOM   1784 C CA  . PRO A 1 232 ? 30.455  4.153   10.377  1.00 32.37  ? 232  PRO A CA  1 
ATOM   1785 C C   . PRO A 1 232 ? 30.894  3.979   8.912   1.00 40.59  ? 232  PRO A C   1 
ATOM   1786 O O   . PRO A 1 232 ? 32.035  4.260   8.537   1.00 40.19  ? 232  PRO A O   1 
ATOM   1787 C CB  . PRO A 1 232 ? 30.529  2.827   11.130  1.00 39.91  ? 232  PRO A CB  1 
ATOM   1788 C CG  . PRO A 1 232 ? 29.167  2.209   10.968  1.00 29.58  ? 232  PRO A CG  1 
ATOM   1789 C CD  . PRO A 1 232 ? 28.187  3.351   10.847  1.00 44.64  ? 232  PRO A CD  1 
ATOM   1790 N N   . ASN A 1 233 ? 29.967  3.524   8.080   1.00 44.12  ? 233  ASN A N   1 
ATOM   1791 C CA  . ASN A 1 233 ? 30.183  3.478   6.640   1.00 49.05  ? 233  ASN A CA  1 
ATOM   1792 C C   . ASN A 1 233 ? 29.941  4.886   6.066   1.00 39.70  ? 233  ASN A C   1 
ATOM   1793 O O   . ASN A 1 233 ? 29.443  5.759   6.766   1.00 48.25  ? 233  ASN A O   1 
ATOM   1794 C CB  . ASN A 1 233 ? 29.232  2.457   6.013   1.00 26.51  ? 233  ASN A CB  1 
ATOM   1795 C CG  . ASN A 1 233 ? 27.787  2.745   6.364   1.00 40.76  ? 233  ASN A CG  1 
ATOM   1796 O OD1 . ASN A 1 233 ? 27.408  2.714   7.541   1.00 35.03  ? 233  ASN A OD1 1 
ATOM   1797 N ND2 . ASN A 1 233 ? 26.979  3.077   5.357   1.00 32.99  ? 233  ASN A ND2 1 
ATOM   1798 N N   . GLY A 1 234 ? 30.283  5.104   4.802   1.00 38.21  ? 234  GLY A N   1 
ATOM   1799 C CA  . GLY A 1 234 ? 30.177  6.425   4.206   1.00 48.26  ? 234  GLY A CA  1 
ATOM   1800 C C   . GLY A 1 234 ? 31.511  7.097   3.907   1.00 51.20  ? 234  GLY A C   1 
ATOM   1801 O O   . GLY A 1 234 ? 32.575  6.573   4.248   1.00 51.55  ? 234  GLY A O   1 
ATOM   1802 N N   . PRO A 1 235 ? 31.458  8.289   3.294   1.00 52.81  ? 235  PRO A N   1 
ATOM   1803 C CA  . PRO A 1 235 ? 32.637  8.958   2.739   1.00 38.77  ? 235  PRO A CA  1 
ATOM   1804 C C   . PRO A 1 235 ? 33.531  9.671   3.759   1.00 35.11  ? 235  PRO A C   1 
ATOM   1805 O O   . PRO A 1 235 ? 34.721  9.855   3.495   1.00 45.52  ? 235  PRO A O   1 
ATOM   1806 C CB  . PRO A 1 235 ? 32.022  9.964   1.761   1.00 41.04  ? 235  PRO A CB  1 
ATOM   1807 C CG  . PRO A 1 235 ? 30.704  10.305  2.347   1.00 42.02  ? 235  PRO A CG  1 
ATOM   1808 C CD  . PRO A 1 235 ? 30.231  9.078   3.093   1.00 51.04  ? 235  PRO A CD  1 
ATOM   1809 N N   . TRP A 1 236 ? 32.992  10.046  4.914   1.00 32.75  ? 236  TRP A N   1 
ATOM   1810 C CA  . TRP A 1 236 ? 33.729  10.959  5.793   1.00 41.13  ? 236  TRP A CA  1 
ATOM   1811 C C   . TRP A 1 236 ? 34.123  10.366  7.138   1.00 43.85  ? 236  TRP A C   1 
ATOM   1812 O O   . TRP A 1 236 ? 35.000  10.900  7.811   1.00 37.49  ? 236  TRP A O   1 
ATOM   1813 C CB  . TRP A 1 236 ? 32.912  12.234  6.027   1.00 40.23  ? 236  TRP A CB  1 
ATOM   1814 C CG  . TRP A 1 236 ? 31.588  11.910  6.616   1.00 35.22  ? 236  TRP A CG  1 
ATOM   1815 C CD1 . TRP A 1 236 ? 30.426  11.674  5.942   1.00 32.69  ? 236  TRP A CD1 1 
ATOM   1816 C CD2 . TRP A 1 236 ? 31.299  11.717  8.004   1.00 38.68  ? 236  TRP A CD2 1 
ATOM   1817 N NE1 . TRP A 1 236 ? 29.421  11.365  6.829   1.00 34.25  ? 236  TRP A NE1 1 
ATOM   1818 C CE2 . TRP A 1 236 ? 29.929  11.381  8.101   1.00 33.40  ? 236  TRP A CE2 1 
ATOM   1819 C CE3 . TRP A 1 236 ? 32.061  11.818  9.178   1.00 31.05  ? 236  TRP A CE3 1 
ATOM   1820 C CZ2 . TRP A 1 236 ? 29.299  11.147  9.329   1.00 27.67  ? 236  TRP A CZ2 1 
ATOM   1821 C CZ3 . TRP A 1 236 ? 31.434  11.593  10.398  1.00 28.07  ? 236  TRP A CZ3 1 
ATOM   1822 C CH2 . TRP A 1 236 ? 30.064  11.252  10.462  1.00 33.98  ? 236  TRP A CH2 1 
ATOM   1823 N N   . ALA A 1 237 ? 33.483  9.270   7.533   1.00 50.01  ? 237  ALA A N   1 
ATOM   1824 C CA  . ALA A 1 237 ? 33.671  8.733   8.886   1.00 39.00  ? 237  ALA A CA  1 
ATOM   1825 C C   . ALA A 1 237 ? 34.993  7.999   9.110   1.00 28.85  ? 237  ALA A C   1 
ATOM   1826 O O   . ALA A 1 237 ? 35.396  7.806   10.257  1.00 27.72  ? 237  ALA A O   1 
ATOM   1827 C CB  . ALA A 1 237 ? 32.487  7.851   9.298   1.00 41.72  ? 237  ALA A CB  1 
ATOM   1828 N N   . THR A 1 238 ? 35.682  7.608   8.042   1.00 30.02  ? 238  THR A N   1 
ATOM   1829 C CA  . THR A 1 238 ? 36.927  6.827   8.193   1.00 30.03  ? 238  THR A CA  1 
ATOM   1830 C C   . THR A 1 238 ? 37.898  7.119   7.068   1.00 44.67  ? 238  THR A C   1 
ATOM   1831 O O   . THR A 1 238 ? 37.489  7.553   5.993   1.00 54.59  ? 238  THR A O   1 
ATOM   1832 C CB  . THR A 1 238 ? 36.689  5.282   8.202   1.00 38.49  ? 238  THR A CB  1 
ATOM   1833 O OG1 . THR A 1 238 ? 36.290  4.834   6.903   1.00 38.00  ? 238  THR A OG1 1 
ATOM   1834 C CG2 . THR A 1 238 ? 35.630  4.890   9.193   1.00 37.86  ? 238  THR A CG2 1 
ATOM   1835 N N   . VAL A 1 239 ? 39.183  6.885   7.312   1.00 44.28  ? 239  VAL A N   1 
ATOM   1836 C CA  . VAL A 1 239 ? 40.169  6.990   6.244   1.00 40.73  ? 239  VAL A CA  1 
ATOM   1837 C C   . VAL A 1 239 ? 41.031  5.731   6.238   1.00 30.26  ? 239  VAL A C   1 
ATOM   1838 O O   . VAL A 1 239 ? 41.214  5.099   7.268   1.00 43.83  ? 239  VAL A O   1 
ATOM   1839 C CB  . VAL A 1 239 ? 41.084  8.263   6.350   1.00 26.48  ? 239  VAL A CB  1 
ATOM   1840 C CG1 . VAL A 1 239 ? 40.300  9.523   6.127   1.00 30.32  ? 239  VAL A CG1 1 
ATOM   1841 C CG2 . VAL A 1 239 ? 41.842  8.292   7.690   1.00 27.03  ? 239  VAL A CG2 1 
ATOM   1842 N N   . SER A 1 240 ? 41.560  5.387   5.071   1.00 32.12  ? 240  SER A N   1 
ATOM   1843 C CA  . SER A 1 240 ? 42.505  4.290   4.950   1.00 35.64  ? 240  SER A CA  1 
ATOM   1844 C C   . SER A 1 240 ? 43.702  4.572   5.830   1.00 39.72  ? 240  SER A C   1 
ATOM   1845 O O   . SER A 1 240 ? 43.919  5.706   6.267   1.00 45.54  ? 240  SER A O   1 
ATOM   1846 C CB  . SER A 1 240 ? 42.961  4.118   3.497   1.00 32.65  ? 240  SER A CB  1 
ATOM   1847 O OG  . SER A 1 240 ? 43.894  5.128   3.096   1.00 46.26  ? 240  SER A OG  1 
ATOM   1848 N N   . ALA A 1 241 ? 44.482  3.531   6.080   1.00 48.94  ? 241  ALA A N   1 
ATOM   1849 C CA  . ALA A 1 241 ? 45.715  3.660   6.826   1.00 47.48  ? 241  ALA A CA  1 
ATOM   1850 C C   . ALA A 1 241 ? 46.701  4.511   6.034   1.00 48.66  ? 241  ALA A C   1 
ATOM   1851 O O   . ALA A 1 241 ? 47.406  5.351   6.589   1.00 38.81  ? 241  ALA A O   1 
ATOM   1852 C CB  . ALA A 1 241 ? 46.286  2.298   7.087   1.00 38.05  ? 241  ALA A CB  1 
ATOM   1853 N N   . GLY A 1 242 ? 46.734  4.288   4.726   1.00 52.57  ? 242  GLY A N   1 
ATOM   1854 C CA  . GLY A 1 242 ? 47.647  5.004   3.863   1.00 53.22  ? 242  GLY A CA  1 
ATOM   1855 C C   . GLY A 1 242 ? 47.383  6.486   3.926   1.00 44.70  ? 242  GLY A C   1 
ATOM   1856 O O   . GLY A 1 242 ? 48.303  7.296   3.979   1.00 48.75  ? 242  GLY A O   1 
ATOM   1857 N N   . GLU A 1 243 ? 46.110  6.841   3.928   1.00 35.68  ? 243  GLU A N   1 
ATOM   1858 C CA  . GLU A 1 243 ? 45.715  8.240   3.902   1.00 38.50  ? 243  GLU A CA  1 
ATOM   1859 C C   . GLU A 1 243 ? 45.908  8.915   5.279   1.00 51.22  ? 243  GLU A C   1 
ATOM   1860 O O   . GLU A 1 243 ? 46.172  10.124  5.371   1.00 43.15  ? 243  GLU A O   1 
ATOM   1861 C CB  . GLU A 1 243 ? 44.264  8.345   3.393   1.00 44.97  ? 243  GLU A CB  1 
ATOM   1862 C CG  . GLU A 1 243 ? 43.603  9.715   3.495   1.00 43.73  ? 243  GLU A CG  1 
ATOM   1863 C CD  . GLU A 1 243 ? 44.226  10.786  2.596   1.00 52.84  ? 243  GLU A CD  1 
ATOM   1864 O OE1 . GLU A 1 243 ? 45.144  10.486  1.800   1.00 43.39  ? 243  GLU A OE1 1 
ATOM   1865 O OE2 . GLU A 1 243 ? 43.781  11.953  2.690   1.00 63.52  ? 243  GLU A OE2 1 
ATOM   1866 N N   . ALA A 1 244 ? 45.792  8.132   6.349   1.00 47.77  ? 244  ALA A N   1 
ATOM   1867 C CA  . ALA A 1 244 ? 45.972  8.680   7.696   1.00 40.70  ? 244  ALA A CA  1 
ATOM   1868 C C   . ALA A 1 244 ? 47.437  9.042   7.922   1.00 45.65  ? 244  ALA A C   1 
ATOM   1869 O O   . ALA A 1 244 ? 47.758  10.095  8.466   1.00 60.42  ? 244  ALA A O   1 
ATOM   1870 C CB  . ALA A 1 244 ? 45.496  7.686   8.744   1.00 34.09  ? 244  ALA A CB  1 
ATOM   1871 N N   . ARG A 1 245 ? 48.312  8.155   7.474   1.00 33.26  ? 245  ARG A N   1 
ATOM   1872 C CA  . ARG A 1 245 ? 49.747  8.345   7.505   1.00 43.33  ? 245  ARG A CA  1 
ATOM   1873 C C   . ARG A 1 245 ? 50.130  9.559   6.667   1.00 45.07  ? 245  ARG A C   1 
ATOM   1874 O O   . ARG A 1 245 ? 50.913  10.414  7.091   1.00 47.49  ? 245  ARG A O   1 
ATOM   1875 C CB  . ARG A 1 245 ? 50.447  7.076   6.974   1.00 32.85  ? 245  ARG A CB  1 
ATOM   1876 C CG  . ARG A 1 245 ? 51.956  7.200   6.858   1.00 34.34  ? 245  ARG A CG  1 
ATOM   1877 C CD  . ARG A 1 245 ? 52.622  5.864   6.455   1.00 44.96  ? 245  ARG A CD  1 
ATOM   1878 N NE  . ARG A 1 245 ? 52.527  4.876   7.528   1.00 44.40  ? 245  ARG A NE  1 
ATOM   1879 C CZ  . ARG A 1 245 ? 53.249  4.919   8.640   1.00 50.63  ? 245  ARG A CZ  1 
ATOM   1880 N NH1 . ARG A 1 245 ? 54.142  5.876   8.826   1.00 50.03  ? 245  ARG A NH1 1 
ATOM   1881 N NH2 . ARG A 1 245 ? 53.082  4.002   9.570   1.00 71.47  ? 245  ARG A NH2 1 
ATOM   1882 N N   . ARG A 1 246 ? 49.572  9.609   5.464   1.00 43.33  ? 246  ARG A N   1 
ATOM   1883 C CA  . ARG A 1 246 ? 49.738  10.731  4.559   1.00 38.36  ? 246  ARG A CA  1 
ATOM   1884 C C   . ARG A 1 246 ? 49.443  12.050  5.298   1.00 51.01  ? 246  ARG A C   1 
ATOM   1885 O O   . ARG A 1 246 ? 50.249  12.983  5.254   1.00 50.82  ? 246  ARG A O   1 
ATOM   1886 C CB  . ARG A 1 246 ? 48.773  10.532  3.402   1.00 45.96  ? 246  ARG A CB  1 
ATOM   1887 C CG  . ARG A 1 246 ? 49.245  10.970  2.023   1.00 52.77  ? 246  ARG A CG  1 
ATOM   1888 C CD  . ARG A 1 246 ? 48.760  12.372  1.634   1.00 47.65  ? 246  ARG A CD  1 
ATOM   1889 N NE  . ARG A 1 246 ? 47.353  12.661  1.913   1.00 45.82  ? 246  ARG A NE  1 
ATOM   1890 C CZ  . ARG A 1 246 ? 46.846  13.899  1.938   1.00 50.57  ? 246  ARG A CZ  1 
ATOM   1891 N NH1 . ARG A 1 246 ? 47.635  14.948  1.688   1.00 38.09  ? 246  ARG A NH1 1 
ATOM   1892 N NH2 . ARG A 1 246 ? 45.554  14.098  2.211   1.00 37.62  ? 246  ARG A NH2 1 
ATOM   1893 N N   . ARG A 1 247 ? 48.308  12.126  6.000   1.00 40.88  ? 247  ARG A N   1 
ATOM   1894 C CA  . ARG A 1 247 ? 47.939  13.378  6.683   1.00 44.12  ? 247  ARG A CA  1 
ATOM   1895 C C   . ARG A 1 247 ? 48.713  13.638  7.965   1.00 51.76  ? 247  ARG A C   1 
ATOM   1896 O O   . ARG A 1 247 ? 48.921  14.792  8.332   1.00 43.47  ? 247  ARG A O   1 
ATOM   1897 C CB  . ARG A 1 247 ? 46.453  13.448  7.011   1.00 28.94  ? 247  ARG A CB  1 
ATOM   1898 C CG  . ARG A 1 247 ? 45.543  13.261  5.839   1.00 34.28  ? 247  ARG A CG  1 
ATOM   1899 C CD  . ARG A 1 247 ? 44.108  13.300  6.308   1.00 36.44  ? 247  ARG A CD  1 
ATOM   1900 N NE  . ARG A 1 247 ? 43.177  12.850  5.277   1.00 49.35  ? 247  ARG A NE  1 
ATOM   1901 C CZ  . ARG A 1 247 ? 41.855  12.955  5.377   1.00 56.51  ? 247  ARG A CZ  1 
ATOM   1902 N NH1 . ARG A 1 247 ? 41.315  13.505  6.456   1.00 68.00  ? 247  ARG A NH1 1 
ATOM   1903 N NH2 . ARG A 1 247 ? 41.073  12.526  4.401   1.00 43.68  ? 247  ARG A NH2 1 
ATOM   1904 N N   . ALA A 1 248 ? 49.107  12.576  8.662   1.00 41.83  ? 248  ALA A N   1 
ATOM   1905 C CA  . ALA A 1 248 ? 49.891  12.738  9.881   1.00 34.28  ? 248  ALA A CA  1 
ATOM   1906 C C   . ALA A 1 248 ? 51.227  13.347  9.507   1.00 43.97  ? 248  ALA A C   1 
ATOM   1907 O O   . ALA A 1 248 ? 51.688  14.322  10.105  1.00 49.85  ? 248  ALA A O   1 
ATOM   1908 C CB  . ALA A 1 248 ? 50.104  11.403  10.546  1.00 45.75  ? 248  ALA A CB  1 
ATOM   1909 N N   . THR A 1 249 ? 51.853  12.750  8.505   1.00 48.02  ? 249  THR A N   1 
ATOM   1910 C CA  . THR A 1 249 ? 53.121  13.240  8.017   1.00 51.08  ? 249  THR A CA  1 
ATOM   1911 C C   . THR A 1 249 ? 53.011  14.685  7.549   1.00 46.40  ? 249  THR A C   1 
ATOM   1912 O O   . THR A 1 249 ? 53.906  15.490  7.787   1.00 42.19  ? 249  THR A O   1 
ATOM   1913 C CB  . THR A 1 249 ? 53.615  12.416  6.838   1.00 51.24  ? 249  THR A CB  1 
ATOM   1914 O OG1 . THR A 1 249 ? 53.505  11.020  7.141   1.00 56.66  ? 249  THR A OG1 1 
ATOM   1915 C CG2 . THR A 1 249 ? 55.049  12.780  6.554   1.00 48.30  ? 249  THR A CG2 1 
ATOM   1916 N N   . LEU A 1 250 ? 51.920  15.012  6.868   1.00 44.99  ? 250  LEU A N   1 
ATOM   1917 C CA  . LEU A 1 250 ? 51.782  16.354  6.334   1.00 44.44  ? 250  LEU A CA  1 
ATOM   1918 C C   . LEU A 1 250 ? 51.689  17.366  7.466   1.00 48.11  ? 250  LEU A C   1 
ATOM   1919 O O   . LEU A 1 250 ? 52.331  18.409  7.431   1.00 44.47  ? 250  LEU A O   1 
ATOM   1920 C CB  . LEU A 1 250 ? 50.583  16.469  5.390   1.00 37.92  ? 250  LEU A CB  1 
ATOM   1921 C CG  . LEU A 1 250 ? 50.425  17.896  4.830   1.00 38.93  ? 250  LEU A CG  1 
ATOM   1922 C CD1 . LEU A 1 250 ? 51.766  18.559  4.533   1.00 31.90  ? 250  LEU A CD1 1 
ATOM   1923 C CD2 . LEU A 1 250 ? 49.605  17.889  3.584   1.00 34.28  ? 250  LEU A CD2 1 
ATOM   1924 N N   . LEU A 1 251 ? 50.905  17.040  8.485   1.00 55.05  ? 251  LEU A N   1 
ATOM   1925 C CA  . LEU A 1 251 ? 50.785  17.901  9.649   1.00 51.12  ? 251  LEU A CA  1 
ATOM   1926 C C   . LEU A 1 251 ? 52.136  18.143  10.305  1.00 50.55  ? 251  LEU A C   1 
ATOM   1927 O O   . LEU A 1 251 ? 52.446  19.259  10.722  1.00 54.78  ? 251  LEU A O   1 
ATOM   1928 C CB  . LEU A 1 251 ? 49.857  17.270  10.677  1.00 53.02  ? 251  LEU A CB  1 
ATOM   1929 C CG  . LEU A 1 251 ? 49.560  18.251  11.806  1.00 50.83  ? 251  LEU A CG  1 
ATOM   1930 C CD1 . LEU A 1 251 ? 48.256  18.986  11.536  1.00 47.11  ? 251  LEU A CD1 1 
ATOM   1931 C CD2 . LEU A 1 251 ? 49.550  17.546  13.133  1.00 52.22  ? 251  LEU A CD2 1 
ATOM   1932 N N   . ALA A 1 252 ? 52.924  17.082  10.419  1.00 44.88  ? 252  ALA A N   1 
ATOM   1933 C CA  . ALA A 1 252 ? 54.244  17.179  11.019  1.00 43.77  ? 252  ALA A CA  1 
ATOM   1934 C C   . ALA A 1 252 ? 55.072  18.236  10.313  1.00 51.43  ? 252  ALA A C   1 
ATOM   1935 O O   . ALA A 1 252 ? 55.709  19.066  10.966  1.00 49.56  ? 252  ALA A O   1 
ATOM   1936 C CB  . ALA A 1 252 ? 54.962  15.817  10.988  1.00 43.30  ? 252  ALA A CB  1 
ATOM   1937 N N   . ARG A 1 253 ? 55.066  18.209  8.980   1.00 46.58  ? 253  ARG A N   1 
ATOM   1938 C CA  . ARG A 1 253 ? 55.878  19.154  8.219   1.00 47.17  ? 253  ARG A CA  1 
ATOM   1939 C C   . ARG A 1 253 ? 55.401  20.566  8.482   1.00 49.30  ? 253  ARG A C   1 
ATOM   1940 O O   . ARG A 1 253 ? 56.184  21.444  8.851   1.00 54.45  ? 253  ARG A O   1 
ATOM   1941 C CB  . ARG A 1 253 ? 55.849  18.850  6.726   1.00 48.01  ? 253  ARG A CB  1 
ATOM   1942 C CG  . ARG A 1 253 ? 56.569  17.570  6.318   1.00 66.10  ? 253  ARG A CG  1 
ATOM   1943 C CD  . ARG A 1 253 ? 56.788  17.529  4.798   1.00 78.96  ? 253  ARG A CD  1 
ATOM   1944 N NE  . ARG A 1 253 ? 56.880  16.164  4.273   1.00 90.49  ? 253  ARG A NE  1 
ATOM   1945 C CZ  . ARG A 1 253 ? 55.897  15.534  3.626   1.00 86.72  ? 253  ARG A CZ  1 
ATOM   1946 N NH1 . ARG A 1 253 ? 54.730  16.147  3.410   1.00 64.50  ? 253  ARG A NH1 1 
ATOM   1947 N NH2 . ARG A 1 253 ? 56.084  14.288  3.190   1.00 85.01  ? 253  ARG A NH2 1 
ATOM   1948 N N   . LEU A 1 254 ? 54.104  20.780  8.312   1.00 40.43  ? 254  LEU A N   1 
ATOM   1949 C CA  . LEU A 1 254 ? 53.523  22.089  8.565   1.00 37.94  ? 254  LEU A CA  1 
ATOM   1950 C C   . LEU A 1 254 ? 53.959  22.658  9.901   1.00 48.54  ? 254  LEU A C   1 
ATOM   1951 O O   . LEU A 1 254 ? 54.019  23.871  10.050  1.00 57.79  ? 254  LEU A O   1 
ATOM   1952 C CB  . LEU A 1 254 ? 52.003  22.029  8.485   1.00 30.48  ? 254  LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 254 ? 51.585  21.510  7.119   1.00 41.82  ? 254  LEU A CG  1 
ATOM   1954 C CD1 . LEU A 1 254 ? 50.086  21.437  6.976   1.00 43.24  ? 254  LEU A CD1 1 
ATOM   1955 C CD2 . LEU A 1 254 ? 52.197  22.362  6.034   1.00 34.45  ? 254  LEU A CD2 1 
ATOM   1956 N N   . VAL A 1 255 ? 54.264  21.795  10.870  1.00 53.89  ? 255  VAL A N   1 
ATOM   1957 C CA  . VAL A 1 255 ? 54.685  22.281  12.191  1.00 55.12  ? 255  VAL A CA  1 
ATOM   1958 C C   . VAL A 1 255 ? 56.162  22.059  12.529  1.00 56.09  ? 255  VAL A C   1 
ATOM   1959 O O   . VAL A 1 255 ? 56.570  22.196  13.681  1.00 68.38  ? 255  VAL A O   1 
ATOM   1960 C CB  . VAL A 1 255 ? 53.792  21.752  13.347  1.00 44.35  ? 255  VAL A CB  1 
ATOM   1961 C CG1 . VAL A 1 255 ? 52.419  22.329  13.246  1.00 36.08  ? 255  VAL A CG1 1 
ATOM   1962 C CG2 . VAL A 1 255 ? 53.738  20.233  13.369  1.00 42.91  ? 255  VAL A CG2 1 
ATOM   1963 N N   . GLY A 1 256 ? 56.968  21.734  11.530  1.00 57.54  ? 256  GLY A N   1 
ATOM   1964 C CA  . GLY A 1 256 ? 58.403  21.660  11.733  1.00 59.61  ? 256  GLY A CA  1 
ATOM   1965 C C   . GLY A 1 256 ? 58.925  20.294  12.121  1.00 52.96  ? 256  GLY A C   1 
ATOM   1966 O O   . GLY A 1 256 ? 60.107  20.116  12.392  1.00 56.04  ? 256  GLY A O   1 
ATOM   1967 N N   . CYS A 1 257 ? 58.041  19.314  12.133  1.00 56.87  ? 257  CYS A N   1 
ATOM   1968 C CA  . CYS A 1 257 ? 58.421  17.978  12.548  1.00 59.47  ? 257  CYS A CA  1 
ATOM   1969 C C   . CYS A 1 257 ? 58.752  17.115  11.340  1.00 67.68  ? 257  CYS A C   1 
ATOM   1970 O O   . CYS A 1 257 ? 57.894  16.443  10.782  1.00 82.22  ? 257  CYS A O   1 
ATOM   1971 C CB  . CYS A 1 257 ? 57.304  17.371  13.399  1.00 59.77  ? 257  CYS A CB  1 
ATOM   1972 S SG  . CYS A 1 257 ? 57.159  18.137  15.050  1.00 59.96  ? 257  CYS A SG  1 
ATOM   1973 N N   . PRO A 1 258 ? 60.003  17.160  10.915  1.00 79.29  ? 258  PRO A N   1 
ATOM   1974 C CA  . PRO A 1 258 ? 60.403  16.422  9.732   1.00 83.38  ? 258  PRO A CA  1 
ATOM   1975 C C   . PRO A 1 258 ? 60.876  15.034  10.150  1.00 82.07  ? 258  PRO A C   1 
ATOM   1976 O O   . PRO A 1 258 ? 60.646  14.625  11.292  1.00 76.53  ? 258  PRO A O   1 
ATOM   1977 C CB  . PRO A 1 258 ? 61.490  17.186  8.974   1.00 71.12  ? 258  PRO A CB  1 
ATOM   1978 N N   . ALA A 1 264 ? 63.130  4.021   15.108  1.00 109.27 ? 264  ALA A N   1 
ATOM   1979 C CA  . ALA A 1 264 ? 62.988  5.404   15.551  1.00 110.38 ? 264  ALA A CA  1 
ATOM   1980 C C   . ALA A 1 264 ? 62.531  6.377   14.433  1.00 98.26  ? 264  ALA A C   1 
ATOM   1981 O O   . ALA A 1 264 ? 62.686  7.595   14.561  1.00 85.72  ? 264  ALA A O   1 
ATOM   1982 C CB  . ALA A 1 264 ? 64.292  5.886   16.226  1.00 99.78  ? 264  ALA A CB  1 
ATOM   1983 N N   . ASN A 1 265 ? 61.951  5.835   13.358  1.00 105.19 ? 265  ASN A N   1 
ATOM   1984 C CA  . ASN A 1 265 ? 61.494  6.635   12.206  1.00 105.67 ? 265  ASN A CA  1 
ATOM   1985 C C   . ASN A 1 265 ? 60.209  7.427   12.463  1.00 87.51  ? 265  ASN A C   1 
ATOM   1986 O O   . ASN A 1 265 ? 60.195  8.656   12.365  1.00 86.13  ? 265  ASN A O   1 
ATOM   1987 C CB  . ASN A 1 265 ? 61.320  5.754   10.957  1.00 120.36 ? 265  ASN A CB  1 
ATOM   1988 C CG  . ASN A 1 265 ? 60.413  4.548   11.203  1.00 128.04 ? 265  ASN A CG  1 
ATOM   1989 O OD1 . ASN A 1 265 ? 60.344  4.024   12.317  1.00 132.02 ? 265  ASN A OD1 1 
ATOM   1990 N ND2 . ASN A 1 265 ? 59.717  4.104   10.159  1.00 125.44 ? 265  ASN A ND2 1 
ATOM   1991 N N   . ASP A 1 266 ? 59.130  6.711   12.767  1.00 65.63  ? 266  ASP A N   1 
ATOM   1992 C CA  . ASP A 1 266 ? 57.884  7.328   13.194  1.00 51.78  ? 266  ASP A CA  1 
ATOM   1993 C C   . ASP A 1 266 ? 58.050  7.823   14.615  1.00 55.50  ? 266  ASP A C   1 
ATOM   1994 O O   . ASP A 1 266 ? 57.376  8.751   15.054  1.00 66.21  ? 266  ASP A O   1 
ATOM   1995 C CB  . ASP A 1 266 ? 56.750  6.303   13.188  1.00 55.69  ? 266  ASP A CB  1 
ATOM   1996 C CG  . ASP A 1 266 ? 56.203  6.030   11.801  1.00 62.20  ? 266  ASP A CG  1 
ATOM   1997 O OD1 . ASP A 1 266 ? 56.563  6.759   10.851  1.00 60.92  ? 266  ASP A OD1 1 
ATOM   1998 O OD2 . ASP A 1 266 ? 55.393  5.090   11.668  1.00 65.82  ? 266  ASP A OD2 1 
ATOM   1999 N N   . THR A 1 267 ? 58.940  7.170   15.344  1.00 59.80  ? 267  THR A N   1 
ATOM   2000 C CA  . THR A 1 267 ? 59.190  7.513   16.729  1.00 57.85  ? 267  THR A CA  1 
ATOM   2001 C C   . THR A 1 267 ? 59.670  8.944   16.864  1.00 47.01  ? 267  THR A C   1 
ATOM   2002 O O   . THR A 1 267 ? 59.195  9.688   17.708  1.00 41.51  ? 267  THR A O   1 
ATOM   2003 C CB  . THR A 1 267 ? 60.269  6.612   17.317  1.00 61.38  ? 267  THR A CB  1 
ATOM   2004 O OG1 . THR A 1 267 ? 59.929  5.248   17.069  1.00 58.15  ? 267  THR A OG1 1 
ATOM   2005 C CG2 . THR A 1 267 ? 60.383  6.838   18.808  1.00 60.69  ? 267  THR A CG2 1 
ATOM   2006 N N   . GLU A 1 268 ? 60.640  9.304   16.038  1.00 56.23  ? 268  GLU A N   1 
ATOM   2007 C CA  . GLU A 1 268 ? 61.241  10.628  16.066  1.00 57.81  ? 268  GLU A CA  1 
ATOM   2008 C C   . GLU A 1 268 ? 60.184  11.652  15.693  1.00 65.12  ? 268  GLU A C   1 
ATOM   2009 O O   . GLU A 1 268 ? 60.091  12.727  16.288  1.00 67.83  ? 268  GLU A O   1 
ATOM   2010 C CB  . GLU A 1 268 ? 62.418  10.665  15.085  1.00 57.60  ? 268  GLU A CB  1 
ATOM   2011 C CG  . GLU A 1 268 ? 63.199  11.960  15.052  1.00 83.64  ? 268  GLU A CG  1 
ATOM   2012 C CD  . GLU A 1 268 ? 64.492  11.841  14.242  1.00 96.85  ? 268  GLU A CD  1 
ATOM   2013 O OE1 . GLU A 1 268 ? 64.992  10.703  14.098  1.00 107.50 ? 268  GLU A OE1 1 
ATOM   2014 O OE2 . GLU A 1 268 ? 65.007  12.878  13.757  1.00 85.48  ? 268  GLU A OE2 1 
ATOM   2015 N N   . LEU A 1 269 ? 59.370  11.290  14.710  1.00 64.58  ? 269  LEU A N   1 
ATOM   2016 C CA  . LEU A 1 269 ? 58.355  12.180  14.183  1.00 58.22  ? 269  LEU A CA  1 
ATOM   2017 C C   . LEU A 1 269 ? 57.339  12.515  15.259  1.00 56.70  ? 269  LEU A C   1 
ATOM   2018 O O   . LEU A 1 269 ? 57.029  13.686  15.506  1.00 67.86  ? 269  LEU A O   1 
ATOM   2019 C CB  . LEU A 1 269 ? 57.674  11.522  12.985  1.00 58.74  ? 269  LEU A CB  1 
ATOM   2020 C CG  . LEU A 1 269 ? 56.505  12.276  12.361  1.00 63.64  ? 269  LEU A CG  1 
ATOM   2021 C CD1 . LEU A 1 269 ? 56.999  13.581  11.794  1.00 75.27  ? 269  LEU A CD1 1 
ATOM   2022 C CD2 . LEU A 1 269 ? 55.853  11.437  11.283  1.00 63.31  ? 269  LEU A CD2 1 
ATOM   2023 N N   . ILE A 1 270 ? 56.829  11.475  15.905  1.00 48.23  ? 270  ILE A N   1 
ATOM   2024 C CA  . ILE A 1 270 ? 55.798  11.636  16.920  1.00 50.18  ? 270  ILE A CA  1 
ATOM   2025 C C   . ILE A 1 270 ? 56.346  12.372  18.130  1.00 53.77  ? 270  ILE A C   1 
ATOM   2026 O O   . ILE A 1 270 ? 55.711  13.274  18.683  1.00 50.28  ? 270  ILE A O   1 
ATOM   2027 C CB  . ILE A 1 270 ? 55.248  10.271  17.353  1.00 42.18  ? 270  ILE A CB  1 
ATOM   2028 C CG1 . ILE A 1 270 ? 54.382  9.690   16.245  1.00 47.55  ? 270  ILE A CG1 1 
ATOM   2029 C CG2 . ILE A 1 270 ? 54.423  10.392  18.625  1.00 33.29  ? 270  ILE A CG2 1 
ATOM   2030 C CD1 . ILE A 1 270 ? 54.627  8.241   16.008  1.00 58.03  ? 270  ILE A CD1 1 
ATOM   2031 N N   . ALA A 1 271 ? 57.540  11.976  18.534  1.00 43.53  ? 271  ALA A N   1 
ATOM   2032 C CA  . ALA A 1 271 ? 58.186  12.592  19.658  1.00 41.95  ? 271  ALA A CA  1 
ATOM   2033 C C   . ALA A 1 271 ? 58.222  14.087  19.449  1.00 50.54  ? 271  ALA A C   1 
ATOM   2034 O O   . ALA A 1 271 ? 57.988  14.854  20.379  1.00 61.20  ? 271  ALA A O   1 
ATOM   2035 C CB  . ALA A 1 271 ? 59.575  12.053  19.797  1.00 47.21  ? 271  ALA A CB  1 
ATOM   2036 N N   . CYS A 1 272 ? 58.519  14.514  18.227  1.00 53.79  ? 272  CYS A N   1 
ATOM   2037 C CA  . CYS A 1 272 ? 58.588  15.947  17.962  1.00 48.02  ? 272  CYS A CA  1 
ATOM   2038 C C   . CYS A 1 272 ? 57.209  16.570  18.124  1.00 42.41  ? 272  CYS A C   1 
ATOM   2039 O O   . CYS A 1 272 ? 57.056  17.529  18.889  1.00 53.17  ? 272  CYS A O   1 
ATOM   2040 C CB  . CYS A 1 272 ? 59.220  16.262  16.592  1.00 37.74  ? 272  CYS A CB  1 
ATOM   2041 S SG  . CYS A 1 272 ? 58.982  17.977  16.009  1.00 80.46  ? 272  CYS A SG  1 
ATOM   2042 N N   . LEU A 1 273 ? 56.212  16.022  17.425  1.00 38.50  ? 273  LEU A N   1 
ATOM   2043 C CA  . LEU A 1 273 ? 54.814  16.466  17.598  1.00 40.41  ? 273  LEU A CA  1 
ATOM   2044 C C   . LEU A 1 273 ? 54.403  16.615  19.070  1.00 44.55  ? 273  LEU A C   1 
ATOM   2045 O O   . LEU A 1 273 ? 53.721  17.575  19.426  1.00 39.47  ? 273  LEU A O   1 
ATOM   2046 C CB  . LEU A 1 273 ? 53.829  15.526  16.888  1.00 38.18  ? 273  LEU A CB  1 
ATOM   2047 C CG  . LEU A 1 273 ? 53.733  15.547  15.356  1.00 42.63  ? 273  LEU A CG  1 
ATOM   2048 C CD1 . LEU A 1 273 ? 52.726  14.529  14.822  1.00 30.15  ? 273  LEU A CD1 1 
ATOM   2049 C CD2 . LEU A 1 273 ? 53.375  16.925  14.869  1.00 50.72  ? 273  LEU A CD2 1 
ATOM   2050 N N   . ARG A 1 274 ? 54.813  15.668  19.920  1.00 45.92  ? 274  ARG A N   1 
ATOM   2051 C CA  A ARG A 1 274 ? 54.506  15.735  21.347  0.52 38.44  ? 274  ARG A CA  1 
ATOM   2052 C CA  B ARG A 1 274 ? 54.497  15.738  21.343  0.48 38.57  ? 274  ARG A CA  1 
ATOM   2053 C C   . ARG A 1 274 ? 55.128  16.954  21.994  1.00 45.74  ? 274  ARG A C   1 
ATOM   2054 O O   . ARG A 1 274 ? 54.829  17.273  23.138  1.00 61.38  ? 274  ARG A O   1 
ATOM   2055 C CB  A ARG A 1 274 ? 55.001  14.498  22.085  0.52 36.03  ? 274  ARG A CB  1 
ATOM   2056 C CB  B ARG A 1 274 ? 54.949  14.479  22.077  0.48 35.32  ? 274  ARG A CB  1 
ATOM   2057 C CG  A ARG A 1 274 ? 54.249  13.226  21.769  0.52 31.37  ? 274  ARG A CG  1 
ATOM   2058 C CG  B ARG A 1 274 ? 54.272  13.217  21.591  0.48 29.97  ? 274  ARG A CG  1 
ATOM   2059 C CD  A ARG A 1 274 ? 54.525  12.206  22.850  0.52 30.88  ? 274  ARG A CD  1 
ATOM   2060 C CD  B ARG A 1 274 ? 54.059  12.239  22.729  0.48 30.85  ? 274  ARG A CD  1 
ATOM   2061 N NE  A ARG A 1 274 ? 55.958  12.008  23.037  0.52 36.08  ? 274  ARG A NE  1 
ATOM   2062 N NE  B ARG A 1 274 ? 53.165  11.156  22.327  0.48 33.50  ? 274  ARG A NE  1 
ATOM   2063 C CZ  A ARG A 1 274 ? 56.640  10.993  22.519  0.52 39.06  ? 274  ARG A CZ  1 
ATOM   2064 C CZ  B ARG A 1 274 ? 53.538  9.891   22.186  0.48 28.41  ? 274  ARG A CZ  1 
ATOM   2065 N NH1 A ARG A 1 274 ? 56.007  10.079  21.796  0.52 34.79  ? 274  ARG A NH1 1 
ATOM   2066 N NH1 B ARG A 1 274 ? 54.791  9.538   22.435  0.48 30.69  ? 274  ARG A NH1 1 
ATOM   2067 N NH2 A ARG A 1 274 ? 57.945  10.886  22.734  0.52 30.90  ? 274  ARG A NH2 1 
ATOM   2068 N NH2 B ARG A 1 274 ? 52.653  8.981   21.809  0.48 23.24  ? 274  ARG A NH2 1 
ATOM   2069 N N   . THR A 1 275 ? 56.006  17.628  21.277  1.00 31.28  ? 275  THR A N   1 
ATOM   2070 C CA  . THR A 1 275 ? 56.618  18.800  21.865  1.00 33.08  ? 275  THR A CA  1 
ATOM   2071 C C   . THR A 1 275 ? 55.922  20.105  21.419  1.00 47.73  ? 275  THR A C   1 
ATOM   2072 O O   . THR A 1 275 ? 56.253  21.198  21.869  1.00 40.89  ? 275  THR A O   1 
ATOM   2073 C CB  . THR A 1 275 ? 58.157  18.805  21.661  1.00 41.18  ? 275  THR A CB  1 
ATOM   2074 O OG1 . THR A 1 275 ? 58.497  19.348  20.386  1.00 48.28  ? 275  THR A OG1 1 
ATOM   2075 C CG2 . THR A 1 275 ? 58.697  17.375  21.768  1.00 38.82  ? 275  THR A CG2 1 
ATOM   2076 N N   . ARG A 1 276 ? 54.922  19.975  20.560  1.00 40.19  ? 276  ARG A N   1 
ATOM   2077 C CA  . ARG A 1 276 ? 54.187  21.132  20.093  1.00 35.49  ? 276  ARG A CA  1 
ATOM   2078 C C   . ARG A 1 276 ? 53.022  21.515  21.000  1.00 31.66  ? 276  ARG A C   1 
ATOM   2079 O O   . ARG A 1 276 ? 52.284  20.661  21.459  1.00 45.26  ? 276  ARG A O   1 
ATOM   2080 C CB  . ARG A 1 276 ? 53.675  20.871  18.681  1.00 33.73  ? 276  ARG A CB  1 
ATOM   2081 C CG  . ARG A 1 276 ? 54.783  20.727  17.687  1.00 40.34  ? 276  ARG A CG  1 
ATOM   2082 C CD  . ARG A 1 276 ? 55.282  22.097  17.297  1.00 43.92  ? 276  ARG A CD  1 
ATOM   2083 N NE  . ARG A 1 276 ? 56.507  21.981  16.542  1.00 47.39  ? 276  ARG A NE  1 
ATOM   2084 C CZ  . ARG A 1 276 ? 57.703  21.934  17.103  1.00 62.40  ? 276  ARG A CZ  1 
ATOM   2085 N NH1 . ARG A 1 276 ? 57.806  22.013  18.428  1.00 66.48  ? 276  ARG A NH1 1 
ATOM   2086 N NH2 . ARG A 1 276 ? 58.782  21.821  16.337  1.00 59.05  ? 276  ARG A NH2 1 
ATOM   2087 N N   . PRO A 1 277 ? 52.854  22.820  21.241  1.00 55.40  ? 277  PRO A N   1 
ATOM   2088 C CA  . PRO A 1 277 ? 51.685  23.340  21.947  1.00 47.96  ? 277  PRO A CA  1 
ATOM   2089 C C   . PRO A 1 277 ? 50.432  22.773  21.303  1.00 47.20  ? 277  PRO A C   1 
ATOM   2090 O O   . PRO A 1 277 ? 50.441  22.550  20.094  1.00 52.91  ? 277  PRO A O   1 
ATOM   2091 C CB  . PRO A 1 277 ? 51.773  24.845  21.681  1.00 38.42  ? 277  PRO A CB  1 
ATOM   2092 C CG  . PRO A 1 277 ? 53.181  25.088  21.420  1.00 41.61  ? 277  PRO A CG  1 
ATOM   2093 C CD  . PRO A 1 277 ? 53.678  23.903  20.686  1.00 35.30  ? 277  PRO A CD  1 
ATOM   2094 N N   . ALA A 1 278 ? 49.383  22.520  22.076  1.00 46.96  ? 278  ALA A N   1 
ATOM   2095 C CA  . ALA A 1 278 ? 48.202  21.867  21.511  1.00 39.43  ? 278  ALA A CA  1 
ATOM   2096 C C   . ALA A 1 278 ? 47.632  22.786  20.441  1.00 40.34  ? 278  ALA A C   1 
ATOM   2097 O O   . ALA A 1 278 ? 47.154  22.335  19.390  1.00 36.92  ? 278  ALA A O   1 
ATOM   2098 C CB  . ALA A 1 278 ? 47.174  21.575  22.574  1.00 29.12  ? 278  ALA A CB  1 
ATOM   2099 N N   . GLN A 1 279 ? 47.741  24.082  20.710  1.00 48.68  ? 279  GLN A N   1 
ATOM   2100 C CA  . GLN A 1 279 ? 47.160  25.101  19.863  1.00 33.80  ? 279  GLN A CA  1 
ATOM   2101 C C   . GLN A 1 279 ? 47.789  25.214  18.480  1.00 42.74  ? 279  GLN A C   1 
ATOM   2102 O O   . GLN A 1 279 ? 47.148  25.617  17.507  1.00 45.02  ? 279  GLN A O   1 
ATOM   2103 C CB  . GLN A 1 279 ? 47.248  26.444  20.548  1.00 49.47  ? 279  GLN A CB  1 
ATOM   2104 C CG  . GLN A 1 279 ? 46.428  27.438  19.825  1.00 37.84  ? 279  GLN A CG  1 
ATOM   2105 C CD  . GLN A 1 279 ? 44.988  26.994  19.730  1.00 49.57  ? 279  GLN A CD  1 
ATOM   2106 O OE1 . GLN A 1 279 ? 44.326  26.778  20.751  1.00 37.47  ? 279  GLN A OE1 1 
ATOM   2107 N NE2 . GLN A 1 279 ? 44.493  26.835  18.503  1.00 37.56  ? 279  GLN A NE2 1 
ATOM   2108 N N   . ASP A 1 280 ? 49.060  24.877  18.394  1.00 44.35  ? 280  ASP A N   1 
ATOM   2109 C CA  . ASP A 1 280 ? 49.716  24.845  17.105  1.00 56.27  ? 280  ASP A CA  1 
ATOM   2110 C C   . ASP A 1 280 ? 49.240  23.659  16.273  1.00 45.63  ? 280  ASP A C   1 
ATOM   2111 O O   . ASP A 1 280 ? 49.182  23.742  15.052  1.00 49.63  ? 280  ASP A O   1 
ATOM   2112 C CB  . ASP A 1 280 ? 51.244  24.886  17.268  1.00 59.90  ? 280  ASP A CB  1 
ATOM   2113 C CG  . ASP A 1 280 ? 51.740  26.283  17.615  1.00 63.83  ? 280  ASP A CG  1 
ATOM   2114 O OD1 . ASP A 1 280 ? 50.940  27.242  17.464  1.00 70.68  ? 280  ASP A OD1 1 
ATOM   2115 O OD2 . ASP A 1 280 ? 52.906  26.426  18.038  1.00 64.07  ? 280  ASP A OD2 1 
ATOM   2116 N N   . LEU A 1 281 ? 48.862  22.571  16.930  1.00 45.14  ? 281  LEU A N   1 
ATOM   2117 C CA  . LEU A 1 281 ? 48.353  21.425  16.200  1.00 45.52  ? 281  LEU A CA  1 
ATOM   2118 C C   . LEU A 1 281 ? 47.012  21.789  15.595  1.00 52.72  ? 281  LEU A C   1 
ATOM   2119 O O   . LEU A 1 281 ? 46.784  21.600  14.403  1.00 59.92  ? 281  LEU A O   1 
ATOM   2120 C CB  . LEU A 1 281 ? 48.220  20.199  17.107  1.00 51.66  ? 281  LEU A CB  1 
ATOM   2121 C CG  . LEU A 1 281 ? 49.546  19.614  17.593  1.00 43.64  ? 281  LEU A CG  1 
ATOM   2122 C CD1 . LEU A 1 281 ? 49.413  18.144  18.005  1.00 35.10  ? 281  LEU A CD1 1 
ATOM   2123 C CD2 . LEU A 1 281 ? 50.573  19.788  16.507  1.00 32.12  ? 281  LEU A CD2 1 
ATOM   2124 N N   . VAL A 1 282 ? 46.127  22.319  16.427  1.00 55.13  ? 282  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 282 ? 44.816  22.763  15.971  1.00 46.29  ? 282  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 282 ? 44.929  23.778  14.825  1.00 50.43  ? 282  VAL A C   1 
ATOM   2127 O O   . VAL A 1 282 ? 44.263  23.641  13.803  1.00 55.67  ? 282  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 282 ? 44.005  23.345  17.140  1.00 43.18  ? 282  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 282 ? 42.832  24.208  16.631  1.00 37.46  ? 282  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 282 ? 43.540  22.211  18.058  1.00 36.99  ? 282  VAL A CG2 1 
ATOM   2131 N N   . ASP A 1 283 ? 45.785  24.779  14.990  1.00 42.96  ? 283  ASP A N   1 
ATOM   2132 C CA  . ASP A 1 283 ? 45.938  25.824  13.982  1.00 45.36  ? 283  ASP A CA  1 
ATOM   2133 C C   . ASP A 1 283 ? 46.256  25.291  12.575  1.00 52.17  ? 283  ASP A C   1 
ATOM   2134 O O   . ASP A 1 283 ? 46.089  26.010  11.581  1.00 48.12  ? 283  ASP A O   1 
ATOM   2135 C CB  . ASP A 1 283 ? 47.001  26.847  14.417  1.00 51.05  ? 283  ASP A CB  1 
ATOM   2136 C CG  . ASP A 1 283 ? 46.509  27.775  15.529  1.00 60.94  ? 283  ASP A CG  1 
ATOM   2137 O OD1 . ASP A 1 283 ? 45.302  27.738  15.841  1.00 43.10  ? 283  ASP A OD1 1 
ATOM   2138 O OD2 . ASP A 1 283 ? 47.323  28.549  16.084  1.00 74.52  ? 283  ASP A OD2 1 
ATOM   2139 N N   . HIS A 1 284 ? 46.705  24.036  12.489  1.00 47.58  ? 284  HIS A N   1 
ATOM   2140 C CA  . HIS A 1 284 ? 47.113  23.448  11.206  1.00 40.82  ? 284  HIS A CA  1 
ATOM   2141 C C   . HIS A 1 284 ? 46.290  22.237  10.772  1.00 43.76  ? 284  HIS A C   1 
ATOM   2142 O O   . HIS A 1 284 ? 46.527  21.660  9.712   1.00 46.54  ? 284  HIS A O   1 
ATOM   2143 C CB  . HIS A 1 284 ? 48.587  23.067  11.235  1.00 48.88  ? 284  HIS A CB  1 
ATOM   2144 C CG  . HIS A 1 284 ? 49.513  24.240  11.205  1.00 57.99  ? 284  HIS A CG  1 
ATOM   2145 N ND1 . HIS A 1 284 ? 50.062  24.785  12.346  1.00 57.33  ? 284  HIS A ND1 1 
ATOM   2146 C CD2 . HIS A 1 284 ? 49.991  24.970  10.171  1.00 59.79  ? 284  HIS A CD2 1 
ATOM   2147 C CE1 . HIS A 1 284 ? 50.843  25.797  12.015  1.00 64.19  ? 284  HIS A CE1 1 
ATOM   2148 N NE2 . HIS A 1 284 ? 50.816  25.931  10.701  1.00 67.96  ? 284  HIS A NE2 1 
ATOM   2149 N N   . GLU A 1 285 ? 45.315  21.865  11.586  1.00 43.60  ? 285  GLU A N   1 
ATOM   2150 C CA  . GLU A 1 285 ? 44.563  20.647  11.355  1.00 47.09  ? 285  GLU A CA  1 
ATOM   2151 C C   . GLU A 1 285 ? 43.898  20.603  9.970   1.00 53.85  ? 285  GLU A C   1 
ATOM   2152 O O   . GLU A 1 285 ? 43.907  19.553  9.309   1.00 48.56  ? 285  GLU A O   1 
ATOM   2153 C CB  . GLU A 1 285 ? 43.523  20.465  12.452  1.00 41.40  ? 285  GLU A CB  1 
ATOM   2154 C CG  . GLU A 1 285 ? 42.697  19.233  12.283  1.00 61.90  ? 285  GLU A CG  1 
ATOM   2155 C CD  . GLU A 1 285 ? 41.594  19.133  13.304  1.00 67.36  ? 285  GLU A CD  1 
ATOM   2156 O OE1 . GLU A 1 285 ? 41.679  19.848  14.331  1.00 50.80  ? 285  GLU A OE1 1 
ATOM   2157 O OE2 . GLU A 1 285 ? 40.651  18.335  13.070  1.00 70.30  ? 285  GLU A OE2 1 
ATOM   2158 N N   . TRP A 1 286 ? 43.337  21.732  9.531   1.00 41.81  ? 286  TRP A N   1 
ATOM   2159 C CA  . TRP A 1 286 ? 42.537  21.767  8.294   1.00 35.24  ? 286  TRP A CA  1 
ATOM   2160 C C   . TRP A 1 286 ? 43.344  21.796  7.008   1.00 46.11  ? 286  TRP A C   1 
ATOM   2161 O O   . TRP A 1 286 ? 42.786  21.781  5.917   1.00 56.04  ? 286  TRP A O   1 
ATOM   2162 C CB  . TRP A 1 286 ? 41.580  22.948  8.293   1.00 36.87  ? 286  TRP A CB  1 
ATOM   2163 C CG  . TRP A 1 286 ? 40.533  22.795  9.305   1.00 39.79  ? 286  TRP A CG  1 
ATOM   2164 C CD1 . TRP A 1 286 ? 40.533  23.309  10.568  1.00 48.15  ? 286  TRP A CD1 1 
ATOM   2165 C CD2 . TRP A 1 286 ? 39.333  22.023  9.185   1.00 46.26  ? 286  TRP A CD2 1 
ATOM   2166 N NE1 . TRP A 1 286 ? 39.393  22.929  11.230  1.00 52.32  ? 286  TRP A NE1 1 
ATOM   2167 C CE2 . TRP A 1 286 ? 38.641  22.139  10.402  1.00 40.99  ? 286  TRP A CE2 1 
ATOM   2168 C CE3 . TRP A 1 286 ? 38.772  21.256  8.163   1.00 54.20  ? 286  TRP A CE3 1 
ATOM   2169 C CZ2 . TRP A 1 286 ? 37.420  21.532  10.618  1.00 44.04  ? 286  TRP A CZ2 1 
ATOM   2170 C CZ3 . TRP A 1 286 ? 37.561  20.648  8.385   1.00 50.26  ? 286  TRP A CZ3 1 
ATOM   2171 C CH2 . TRP A 1 286 ? 36.899  20.787  9.599   1.00 57.35  ? 286  TRP A CH2 1 
ATOM   2172 N N   . HIS A 1 287 ? 44.658  21.828  7.127   1.00 52.31  ? 287  HIS A N   1 
ATOM   2173 C CA  . HIS A 1 287 ? 45.485  21.948  5.942   1.00 54.54  ? 287  HIS A CA  1 
ATOM   2174 C C   . HIS A 1 287 ? 45.857  20.612  5.309   1.00 55.17  ? 287  HIS A C   1 
ATOM   2175 O O   . HIS A 1 287 ? 46.305  20.566  4.171   1.00 62.05  ? 287  HIS A O   1 
ATOM   2176 C CB  . HIS A 1 287 ? 46.713  22.792  6.258   1.00 45.03  ? 287  HIS A CB  1 
ATOM   2177 C CG  . HIS A 1 287 ? 46.368  24.176  6.695   1.00 54.20  ? 287  HIS A CG  1 
ATOM   2178 N ND1 . HIS A 1 287 ? 47.206  24.952  7.459   1.00 55.21  ? 287  HIS A ND1 1 
ATOM   2179 C CD2 . HIS A 1 287 ? 45.256  24.919  6.486   1.00 70.11  ? 287  HIS A CD2 1 
ATOM   2180 C CE1 . HIS A 1 287 ? 46.633  26.120  7.694   1.00 58.22  ? 287  HIS A CE1 1 
ATOM   2181 N NE2 . HIS A 1 287 ? 45.450  26.126  7.111   1.00 67.54  ? 287  HIS A NE2 1 
ATOM   2182 N N   . VAL A 1 288 ? 45.639  19.521  6.025   1.00 50.16  ? 288  VAL A N   1 
ATOM   2183 C CA  . VAL A 1 288 ? 46.024  18.229  5.487   1.00 46.81  ? 288  VAL A CA  1 
ATOM   2184 C C   . VAL A 1 288 ? 44.969  17.611  4.565   1.00 52.84  ? 288  VAL A C   1 
ATOM   2185 O O   . VAL A 1 288 ? 45.192  16.538  4.011   1.00 64.03  ? 288  VAL A O   1 
ATOM   2186 C CB  . VAL A 1 288 ? 46.436  17.242  6.603   1.00 36.44  ? 288  VAL A CB  1 
ATOM   2187 C CG1 . VAL A 1 288 ? 47.510  17.864  7.461   1.00 35.68  ? 288  VAL A CG1 1 
ATOM   2188 C CG2 . VAL A 1 288 ? 45.237  16.841  7.447   1.00 33.51  ? 288  VAL A CG2 1 
ATOM   2189 N N   . LEU A 1 289 ? 43.835  18.284  4.380   1.00 49.47  ? 289  LEU A N   1 
ATOM   2190 C CA  . LEU A 1 289 ? 42.801  17.762  3.471   1.00 53.26  ? 289  LEU A CA  1 
ATOM   2191 C C   . LEU A 1 289 ? 43.262  17.736  2.017   1.00 52.42  ? 289  LEU A C   1 
ATOM   2192 O O   . LEU A 1 289 ? 43.787  18.730  1.509   1.00 61.69  ? 289  LEU A O   1 
ATOM   2193 C CB  . LEU A 1 289 ? 41.500  18.547  3.567   1.00 44.80  ? 289  LEU A CB  1 
ATOM   2194 C CG  . LEU A 1 289 ? 40.676  18.397  4.839   1.00 43.94  ? 289  LEU A CG  1 
ATOM   2195 C CD1 . LEU A 1 289 ? 39.495  19.367  4.771   1.00 36.50  ? 289  LEU A CD1 1 
ATOM   2196 C CD2 . LEU A 1 289 ? 40.221  16.951  5.021   1.00 39.17  ? 289  LEU A CD2 1 
ATOM   2197 N N   . PRO A 1 290 ? 43.054  16.591  1.348   1.00 38.93  ? 290  PRO A N   1 
ATOM   2198 C CA  . PRO A 1 290 ? 43.487  16.327  -0.022  1.00 40.43  ? 290  PRO A CA  1 
ATOM   2199 C C   . PRO A 1 290 ? 42.816  17.235  -1.047  1.00 52.45  ? 290  PRO A C   1 
ATOM   2200 O O   . PRO A 1 290 ? 43.457  17.611  -2.030  1.00 55.43  ? 290  PRO A O   1 
ATOM   2201 C CB  . PRO A 1 290 ? 43.089  14.862  -0.237  1.00 51.09  ? 290  PRO A CB  1 
ATOM   2202 C CG  . PRO A 1 290 ? 42.034  14.596  0.777   1.00 42.02  ? 290  PRO A CG  1 
ATOM   2203 C CD  . PRO A 1 290 ? 42.379  15.427  1.948   1.00 41.90  ? 290  PRO A CD  1 
ATOM   2204 N N   . GLN A 1 291 ? 41.554  17.592  -0.822  1.00 61.43  ? 291  GLN A N   1 
ATOM   2205 C CA  . GLN A 1 291 ? 40.844  18.476  -1.741  1.00 57.66  ? 291  GLN A CA  1 
ATOM   2206 C C   . GLN A 1 291 ? 40.016  19.532  -1.009  1.00 60.81  ? 291  GLN A C   1 
ATOM   2207 O O   . GLN A 1 291 ? 39.637  19.357  0.150   1.00 70.45  ? 291  GLN A O   1 
ATOM   2208 C CB  . GLN A 1 291 ? 39.937  17.676  -2.678  1.00 58.27  ? 291  GLN A CB  1 
ATOM   2209 C CG  . GLN A 1 291 ? 40.606  16.511  -3.386  1.00 59.49  ? 291  GLN A CG  1 
ATOM   2210 C CD  . GLN A 1 291 ? 40.400  15.209  -2.658  1.00 67.75  ? 291  GLN A CD  1 
ATOM   2211 O OE1 . GLN A 1 291 ? 39.559  15.108  -1.757  1.00 75.16  ? 291  GLN A OE1 1 
ATOM   2212 N NE2 . GLN A 1 291 ? 41.166  14.199  -3.036  1.00 68.55  ? 291  GLN A NE2 1 
ATOM   2213 N N   . GLU A 1 292 ? 39.754  20.638  -1.696  1.00 60.18  ? 292  GLU A N   1 
ATOM   2214 C CA  . GLU A 1 292 ? 38.806  21.627  -1.213  1.00 59.92  ? 292  GLU A CA  1 
ATOM   2215 C C   . GLU A 1 292 ? 37.517  20.855  -1.020  1.00 55.08  ? 292  GLU A C   1 
ATOM   2216 O O   . GLU A 1 292 ? 37.091  20.142  -1.925  1.00 58.19  ? 292  GLU A O   1 
ATOM   2217 C CB  . GLU A 1 292 ? 38.633  22.737  -2.255  1.00 59.55  ? 292  GLU A CB  1 
ATOM   2218 C CG  . GLU A 1 292 ? 37.994  24.031  -1.763  1.00 72.97  ? 292  GLU A CG  1 
ATOM   2219 C CD  . GLU A 1 292 ? 38.006  25.121  -2.842  1.00 96.12  ? 292  GLU A CD  1 
ATOM   2220 O OE1 . GLU A 1 292 ? 37.208  25.019  -3.803  1.00 93.62  ? 292  GLU A OE1 1 
ATOM   2221 O OE2 . GLU A 1 292 ? 38.824  26.069  -2.737  1.00 105.01 ? 292  GLU A OE2 1 
ATOM   2222 N N   . SER A 1 293 ? 36.904  20.948  0.155   1.00 47.40  ? 293  SER A N   1 
ATOM   2223 C CA  . SER A 1 293 ? 35.717  20.130  0.385   1.00 53.96  ? 293  SER A CA  1 
ATOM   2224 C C   . SER A 1 293 ? 34.825  20.620  1.506   1.00 45.12  ? 293  SER A C   1 
ATOM   2225 O O   . SER A 1 293 ? 35.124  21.611  2.161   1.00 40.87  ? 293  SER A O   1 
ATOM   2226 C CB  . SER A 1 293 ? 36.107  18.668  0.644   1.00 47.68  ? 293  SER A CB  1 
ATOM   2227 O OG  . SER A 1 293 ? 37.026  18.575  1.710   1.00 51.97  ? 293  SER A OG  1 
ATOM   2228 N N   . ILE A 1 294 ? 33.711  19.917  1.677   1.00 27.90  ? 294  ILE A N   1 
ATOM   2229 C CA  . ILE A 1 294 ? 32.836  20.077  2.815   1.00 27.50  ? 294  ILE A CA  1 
ATOM   2230 C C   . ILE A 1 294 ? 32.416  18.677  3.249   1.00 42.78  ? 294  ILE A C   1 
ATOM   2231 O O   . ILE A 1 294 ? 32.364  17.751  2.435   1.00 39.44  ? 294  ILE A O   1 
ATOM   2232 C CB  . ILE A 1 294 ? 31.585  20.922  2.500   1.00 38.29  ? 294  ILE A CB  1 
ATOM   2233 C CG1 . ILE A 1 294 ? 30.766  20.250  1.409   1.00 44.97  ? 294  ILE A CG1 1 
ATOM   2234 C CG2 . ILE A 1 294 ? 31.949  22.377  2.110   1.00 31.98  ? 294  ILE A CG2 1 
ATOM   2235 C CD1 . ILE A 1 294 ? 29.633  21.115  0.940   1.00 55.39  ? 294  ILE A CD1 1 
ATOM   2236 N N   . PHE A 1 295 ? 32.149  18.534  4.543   1.00 31.12  ? 295  PHE A N   1 
ATOM   2237 C CA  . PHE A 1 295 ? 31.730  17.279  5.118   1.00 37.57  ? 295  PHE A CA  1 
ATOM   2238 C C   . PHE A 1 295 ? 32.856  16.271  5.013   1.00 47.89  ? 295  PHE A C   1 
ATOM   2239 O O   . PHE A 1 295 ? 32.642  15.060  4.986   1.00 43.24  ? 295  PHE A O   1 
ATOM   2240 C CB  . PHE A 1 295 ? 30.417  16.775  4.516   1.00 31.35  ? 295  PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 295 ? 29.479  16.196  5.547   1.00 37.14  ? 295  PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 295 ? 29.953  15.273  6.485   1.00 32.48  ? 295  PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 295 ? 28.140  16.593  5.608   1.00 30.43  ? 295  PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 295 ? 29.110  14.735  7.454   1.00 26.50  ? 295  PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 295 ? 27.278  16.058  6.576   1.00 31.17  ? 295  PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 295 ? 27.766  15.134  7.502   1.00 34.54  ? 295  PHE A CZ  1 
ATOM   2247 N N   . ARG A 1 296 ? 34.064  16.820  4.956   1.00 42.75  ? 296  ARG A N   1 
ATOM   2248 C CA  . ARG A 1 296 ? 35.291  16.073  5.180   1.00 42.96  ? 296  ARG A CA  1 
ATOM   2249 C C   . ARG A 1 296 ? 36.050  16.699  6.361   1.00 50.11  ? 296  ARG A C   1 
ATOM   2250 O O   . ARG A 1 296 ? 36.113  17.941  6.484   1.00 54.26  ? 296  ARG A O   1 
ATOM   2251 C CB  . ARG A 1 296 ? 36.175  16.096  3.930   1.00 37.85  ? 296  ARG A CB  1 
ATOM   2252 C CG  . ARG A 1 296 ? 35.604  15.390  2.728   1.00 39.24  ? 296  ARG A CG  1 
ATOM   2253 C CD  . ARG A 1 296 ? 35.145  13.975  3.036   1.00 49.75  ? 296  ARG A CD  1 
ATOM   2254 N NE  . ARG A 1 296 ? 34.586  13.368  1.835   1.00 50.16  ? 296  ARG A NE  1 
ATOM   2255 C CZ  . ARG A 1 296 ? 33.291  13.302  1.579   1.00 49.41  ? 296  ARG A CZ  1 
ATOM   2256 N NH1 . ARG A 1 296 ? 32.416  13.782  2.457   1.00 54.98  ? 296  ARG A NH1 1 
ATOM   2257 N NH2 . ARG A 1 296 ? 32.874  12.759  0.450   1.00 47.99  ? 296  ARG A NH2 1 
ATOM   2258 N N   . PHE A 1 297 ? 36.643  15.835  7.195   1.00 34.23  ? 297  PHE A N   1 
ATOM   2259 C CA  . PHE A 1 297 ? 37.395  16.237  8.396   1.00 38.93  ? 297  PHE A CA  1 
ATOM   2260 C C   . PHE A 1 297 ? 38.788  15.578  8.486   1.00 43.11  ? 297  PHE A C   1 
ATOM   2261 O O   . PHE A 1 297 ? 38.937  14.410  8.152   1.00 36.63  ? 297  PHE A O   1 
ATOM   2262 C CB  . PHE A 1 297 ? 36.586  15.891  9.641   1.00 41.09  ? 297  PHE A CB  1 
ATOM   2263 C CG  . PHE A 1 297 ? 35.104  15.998  9.439   1.00 41.65  ? 297  PHE A CG  1 
ATOM   2264 C CD1 . PHE A 1 297 ? 34.475  17.229  9.482   1.00 29.67  ? 297  PHE A CD1 1 
ATOM   2265 C CD2 . PHE A 1 297 ? 34.336  14.869  9.205   1.00 42.13  ? 297  PHE A CD2 1 
ATOM   2266 C CE1 . PHE A 1 297 ? 33.103  17.347  9.299   1.00 33.36  ? 297  PHE A CE1 1 
ATOM   2267 C CE2 . PHE A 1 297 ? 32.960  14.986  9.025   1.00 47.79  ? 297  PHE A CE2 1 
ATOM   2268 C CZ  . PHE A 1 297 ? 32.345  16.234  9.070   1.00 27.80  ? 297  PHE A CZ  1 
ATOM   2269 N N   . SER A 1 298 ? 39.792  16.316  8.967   1.00 38.01  ? 298  SER A N   1 
ATOM   2270 C CA  . SER A 1 298 ? 41.195  15.912  8.819   1.00 33.06  ? 298  SER A CA  1 
ATOM   2271 C C   . SER A 1 298 ? 41.580  14.632  9.553   1.00 34.14  ? 298  SER A C   1 
ATOM   2272 O O   . SER A 1 298 ? 42.369  13.837  9.062   1.00 41.48  ? 298  SER A O   1 
ATOM   2273 C CB  . SER A 1 298 ? 42.118  17.032  9.291   1.00 33.91  ? 298  SER A CB  1 
ATOM   2274 O OG  . SER A 1 298 ? 42.101  18.109  8.399   1.00 41.01  ? 298  SER A OG  1 
ATOM   2275 N N   . PHE A 1 299 ? 41.033  14.447  10.744  1.00 42.30  ? 299  PHE A N   1 
ATOM   2276 C CA  . PHE A 1 299 ? 41.490  13.378  11.609  1.00 39.14  ? 299  PHE A CA  1 
ATOM   2277 C C   . PHE A 1 299 ? 40.334  12.540  12.154  1.00 32.30  ? 299  PHE A C   1 
ATOM   2278 O O   . PHE A 1 299 ? 39.727  12.852  13.157  1.00 38.49  ? 299  PHE A O   1 
ATOM   2279 C CB  . PHE A 1 299 ? 42.416  13.955  12.684  1.00 24.88  ? 299  PHE A CB  1 
ATOM   2280 C CG  . PHE A 1 299 ? 43.714  14.449  12.113  1.00 26.06  ? 299  PHE A CG  1 
ATOM   2281 C CD1 . PHE A 1 299 ? 44.672  13.565  11.679  1.00 39.81  ? 299  PHE A CD1 1 
ATOM   2282 C CD2 . PHE A 1 299 ? 43.954  15.794  11.958  1.00 41.62  ? 299  PHE A CD2 1 
ATOM   2283 C CE1 . PHE A 1 299 ? 45.850  14.016  11.135  1.00 48.32  ? 299  PHE A CE1 1 
ATOM   2284 C CE2 . PHE A 1 299 ? 45.132  16.242  11.413  1.00 40.47  ? 299  PHE A CE2 1 
ATOM   2285 C CZ  . PHE A 1 299 ? 46.077  15.359  11.004  1.00 28.66  ? 299  PHE A CZ  1 
ATOM   2286 N N   . VAL A 1 300 ? 40.034  11.469  11.447  1.00 38.09  ? 300  VAL A N   1 
ATOM   2287 C CA  . VAL A 1 300 ? 38.907  10.615  11.785  1.00 53.97  ? 300  VAL A CA  1 
ATOM   2288 C C   . VAL A 1 300 ? 39.427  9.216   11.996  1.00 23.67  ? 300  VAL A C   1 
ATOM   2289 O O   . VAL A 1 300 ? 40.597  8.953   11.768  1.00 37.65  ? 300  VAL A O   1 
ATOM   2290 C CB  . VAL A 1 300 ? 37.865  10.623  10.658  1.00 41.10  ? 300  VAL A CB  1 
ATOM   2291 C CG1 . VAL A 1 300 ? 37.469  12.072  10.331  1.00 31.05  ? 300  VAL A CG1 1 
ATOM   2292 C CG2 . VAL A 1 300 ? 38.428  9.923   9.416   1.00 32.13  ? 300  VAL A CG2 1 
ATOM   2293 N N   . PRO A 1 301 ? 38.568  8.310   12.446  1.00 49.06  ? 301  PRO A N   1 
ATOM   2294 C CA  . PRO A 1 301 ? 39.009  6.929   12.696  1.00 26.27  ? 301  PRO A CA  1 
ATOM   2295 C C   . PRO A 1 301 ? 39.695  6.333   11.500  1.00 25.86  ? 301  PRO A C   1 
ATOM   2296 O O   . PRO A 1 301 ? 39.273  6.529   10.349  1.00 32.93  ? 301  PRO A O   1 
ATOM   2297 C CB  . PRO A 1 301 ? 37.708  6.201   12.982  1.00 30.90  ? 301  PRO A CB  1 
ATOM   2298 C CG  . PRO A 1 301 ? 36.852  7.279   13.647  1.00 44.29  ? 301  PRO A CG  1 
ATOM   2299 C CD  . PRO A 1 301 ? 37.216  8.573   12.962  1.00 44.97  ? 301  PRO A CD  1 
ATOM   2300 N N   . VAL A 1 302 ? 40.776  5.614   11.763  1.00 45.95  ? 302  VAL A N   1 
ATOM   2301 C CA  . VAL A 1 302 ? 41.460  4.912   10.695  1.00 38.19  ? 302  VAL A CA  1 
ATOM   2302 C C   . VAL A 1 302 ? 41.076  3.445   10.702  1.00 44.90  ? 302  VAL A C   1 
ATOM   2303 O O   . VAL A 1 302 ? 40.910  2.832   11.764  1.00 48.92  ? 302  VAL A O   1 
ATOM   2304 C CB  . VAL A 1 302 ? 42.994  5.048   10.820  1.00 36.70  ? 302  VAL A CB  1 
ATOM   2305 C CG1 . VAL A 1 302 ? 43.470  4.534   12.164  1.00 30.74  ? 302  VAL A CG1 1 
ATOM   2306 C CG2 . VAL A 1 302 ? 43.670  4.313   9.708   1.00 31.39  ? 302  VAL A CG2 1 
ATOM   2307 N N   . VAL A 1 303 ? 40.937  2.896   9.503   1.00 48.89  ? 303  VAL A N   1 
ATOM   2308 C CA  . VAL A 1 303 ? 40.845  1.457   9.301   1.00 42.02  ? 303  VAL A CA  1 
ATOM   2309 C C   . VAL A 1 303 ? 42.219  0.862   9.576   1.00 48.88  ? 303  VAL A C   1 
ATOM   2310 O O   . VAL A 1 303 ? 43.094  0.891   8.714   1.00 56.05  ? 303  VAL A O   1 
ATOM   2311 C CB  . VAL A 1 303 ? 40.405  1.145   7.856   1.00 44.72  ? 303  VAL A CB  1 
ATOM   2312 C CG1 . VAL A 1 303 ? 40.150  -0.361  7.650   1.00 39.60  ? 303  VAL A CG1 1 
ATOM   2313 C CG2 . VAL A 1 303 ? 39.161  1.930   7.531   1.00 52.72  ? 303  VAL A CG2 1 
ATOM   2314 N N   . ASP A 1 304 ? 42.397  0.323   10.781  1.00 56.94  ? 304  ASP A N   1 
ATOM   2315 C CA  . ASP A 1 304 ? 43.693  -0.174  11.252  1.00 54.15  ? 304  ASP A CA  1 
ATOM   2316 C C   . ASP A 1 304 ? 43.857  -1.691  11.221  1.00 53.51  ? 304  ASP A C   1 
ATOM   2317 O O   . ASP A 1 304 ? 44.929  -2.195  11.536  1.00 62.04  ? 304  ASP A O   1 
ATOM   2318 C CB  . ASP A 1 304 ? 43.965  0.322   12.681  1.00 68.30  ? 304  ASP A CB  1 
ATOM   2319 C CG  . ASP A 1 304 ? 42.851  -0.056  13.672  1.00 69.05  ? 304  ASP A CG  1 
ATOM   2320 O OD1 . ASP A 1 304 ? 41.771  -0.519  13.235  1.00 57.90  ? 304  ASP A OD1 1 
ATOM   2321 O OD2 . ASP A 1 304 ? 43.059  0.133   14.894  1.00 65.84  ? 304  ASP A OD2 1 
ATOM   2322 N N   . GLY A 1 305 ? 42.805  -2.412  10.844  1.00 53.36  ? 305  GLY A N   1 
ATOM   2323 C CA  . GLY A 1 305 ? 42.779  -3.856  10.989  1.00 43.44  ? 305  GLY A CA  1 
ATOM   2324 C C   . GLY A 1 305 ? 42.980  -4.293  12.432  1.00 50.56  ? 305  GLY A C   1 
ATOM   2325 O O   . GLY A 1 305 ? 43.635  -5.307  12.713  1.00 61.76  ? 305  GLY A O   1 
ATOM   2326 N N   . ASP A 1 306 ? 42.404  -3.515  13.343  1.00 47.05  ? 306  ASP A N   1 
ATOM   2327 C CA  . ASP A 1 306 ? 42.546  -3.692  14.783  1.00 43.55  ? 306  ASP A CA  1 
ATOM   2328 C C   . ASP A 1 306 ? 41.238  -3.273  15.489  1.00 45.97  ? 306  ASP A C   1 
ATOM   2329 O O   . ASP A 1 306 ? 40.367  -4.104  15.754  1.00 43.09  ? 306  ASP A O   1 
ATOM   2330 C CB  . ASP A 1 306 ? 43.729  -2.862  15.259  1.00 53.31  ? 306  ASP A CB  1 
ATOM   2331 C CG  . ASP A 1 306 ? 44.038  -3.059  16.723  1.00 61.86  ? 306  ASP A CG  1 
ATOM   2332 O OD1 . ASP A 1 306 ? 43.470  -3.988  17.337  1.00 56.39  ? 306  ASP A OD1 1 
ATOM   2333 O OD2 . ASP A 1 306 ? 44.871  -2.287  17.252  1.00 66.72  ? 306  ASP A OD2 1 
ATOM   2334 N N   . PHE A 1 307 ? 41.074  -1.984  15.775  1.00 40.32  ? 307  PHE A N   1 
ATOM   2335 C CA  . PHE A 1 307 ? 39.771  -1.514  16.234  1.00 42.73  ? 307  PHE A CA  1 
ATOM   2336 C C   . PHE A 1 307 ? 38.770  -1.843  15.154  1.00 50.10  ? 307  PHE A C   1 
ATOM   2337 O O   . PHE A 1 307 ? 37.669  -2.305  15.421  1.00 47.36  ? 307  PHE A O   1 
ATOM   2338 C CB  . PHE A 1 307 ? 39.759  -0.009  16.456  1.00 38.68  ? 307  PHE A CB  1 
ATOM   2339 C CG  . PHE A 1 307 ? 38.571  0.473   17.250  1.00 44.69  ? 307  PHE A CG  1 
ATOM   2340 C CD1 . PHE A 1 307 ? 37.360  0.730   16.624  1.00 32.58  ? 307  PHE A CD1 1 
ATOM   2341 C CD2 . PHE A 1 307 ? 38.667  0.656   18.627  1.00 38.53  ? 307  PHE A CD2 1 
ATOM   2342 C CE1 . PHE A 1 307 ? 36.282  1.152   17.346  1.00 31.78  ? 307  PHE A CE1 1 
ATOM   2343 C CE2 . PHE A 1 307 ? 37.585  1.093   19.372  1.00 34.10  ? 307  PHE A CE2 1 
ATOM   2344 C CZ  . PHE A 1 307 ? 36.390  1.341   18.733  1.00 35.97  ? 307  PHE A CZ  1 
ATOM   2345 N N   . LEU A 1 308 ? 39.176  -1.581  13.922  1.00 52.74  ? 308  LEU A N   1 
ATOM   2346 C CA  . LEU A 1 308 ? 38.361  -1.870  12.764  1.00 54.35  ? 308  LEU A CA  1 
ATOM   2347 C C   . LEU A 1 308 ? 39.090  -2.894  11.915  1.00 59.90  ? 308  LEU A C   1 
ATOM   2348 O O   . LEU A 1 308 ? 40.049  -2.566  11.226  1.00 72.60  ? 308  LEU A O   1 
ATOM   2349 C CB  . LEU A 1 308 ? 38.116  -0.589  11.966  1.00 46.69  ? 308  LEU A CB  1 
ATOM   2350 C CG  . LEU A 1 308 ? 37.050  0.328   12.555  1.00 50.75  ? 308  LEU A CG  1 
ATOM   2351 C CD1 . LEU A 1 308 ? 36.893  1.560   11.706  1.00 36.95  ? 308  LEU A CD1 1 
ATOM   2352 C CD2 . LEU A 1 308 ? 35.715  -0.421  12.689  1.00 54.55  ? 308  LEU A CD2 1 
ATOM   2353 N N   . SER A 1 309 ? 38.641  -4.141  11.978  1.00 57.13  ? 309  SER A N   1 
ATOM   2354 C CA  . SER A 1 309 ? 39.321  -5.240  11.309  1.00 43.63  ? 309  SER A CA  1 
ATOM   2355 C C   . SER A 1 309 ? 39.417  -5.063  9.793   1.00 53.26  ? 309  SER A C   1 
ATOM   2356 O O   . SER A 1 309 ? 40.466  -5.271  9.202   1.00 61.83  ? 309  SER A O   1 
ATOM   2357 C CB  . SER A 1 309 ? 38.612  -6.544  11.637  1.00 56.54  ? 309  SER A CB  1 
ATOM   2358 O OG  . SER A 1 309 ? 37.216  -6.397  11.484  1.00 50.52  ? 309  SER A OG  1 
ATOM   2359 N N   . ASP A 1 310 ? 38.307  -4.699  9.167   1.00 53.72  ? 310  ASP A N   1 
ATOM   2360 C CA  . ASP A 1 310 ? 38.276  -4.328  7.759   1.00 50.63  ? 310  ASP A CA  1 
ATOM   2361 C C   . ASP A 1 310 ? 37.556  -2.974  7.685   1.00 48.37  ? 310  ASP A C   1 
ATOM   2362 O O   . ASP A 1 310 ? 37.359  -2.333  8.705   1.00 48.96  ? 310  ASP A O   1 
ATOM   2363 C CB  . ASP A 1 310 ? 37.515  -5.380  6.954   1.00 43.45  ? 310  ASP A CB  1 
ATOM   2364 C CG  . ASP A 1 310 ? 37.753  -5.259  5.475   1.00 60.13  ? 310  ASP A CG  1 
ATOM   2365 O OD1 . ASP A 1 310 ? 38.076  -4.145  5.015   1.00 72.74  ? 310  ASP A OD1 1 
ATOM   2366 O OD2 . ASP A 1 310 ? 37.611  -6.272  4.766   1.00 48.87  ? 310  ASP A OD2 1 
ATOM   2367 N N   . THR A 1 311 ? 37.158  -2.540  6.494   1.00 46.46  ? 311  THR A N   1 
ATOM   2368 C CA  . THR A 1 311 ? 36.417  -1.293  6.370   1.00 50.58  ? 311  THR A CA  1 
ATOM   2369 C C   . THR A 1 311 ? 35.005  -1.482  6.854   1.00 53.17  ? 311  THR A C   1 
ATOM   2370 O O   . THR A 1 311 ? 34.436  -2.565  6.708   1.00 58.51  ? 311  THR A O   1 
ATOM   2371 C CB  . THR A 1 311 ? 36.290  -0.831  4.906   1.00 54.13  ? 311  THR A CB  1 
ATOM   2372 O OG1 . THR A 1 311 ? 35.665  -1.864  4.134   1.00 58.64  ? 311  THR A OG1 1 
ATOM   2373 C CG2 . THR A 1 311 ? 37.648  -0.488  4.321   1.00 37.15  ? 311  THR A CG2 1 
ATOM   2374 N N   . PRO A 1 312 ? 34.410  -0.414  7.395   1.00 49.68  ? 312  PRO A N   1 
ATOM   2375 C CA  . PRO A 1 312 ? 33.011  -0.498  7.811   1.00 51.19  ? 312  PRO A CA  1 
ATOM   2376 C C   . PRO A 1 312 ? 32.147  -1.075  6.701   1.00 52.59  ? 312  PRO A C   1 
ATOM   2377 O O   . PRO A 1 312 ? 31.318  -1.926  6.990   1.00 41.85  ? 312  PRO A O   1 
ATOM   2378 C CB  . PRO A 1 312 ? 32.637  0.962   8.072   1.00 41.05  ? 312  PRO A CB  1 
ATOM   2379 C CG  . PRO A 1 312 ? 33.917  1.580   8.494   1.00 46.79  ? 312  PRO A CG  1 
ATOM   2380 C CD  . PRO A 1 312 ? 34.957  0.935   7.594   1.00 52.08  ? 312  PRO A CD  1 
ATOM   2381 N N   . GLU A 1 313 ? 32.342  -0.621  5.464   1.00 63.62  ? 313  GLU A N   1 
ATOM   2382 C CA  . GLU A 1 313 ? 31.541  -1.100  4.336   1.00 62.72  ? 313  GLU A CA  1 
ATOM   2383 C C   . GLU A 1 313 ? 31.642  -2.609  4.213   1.00 60.55  ? 313  GLU A C   1 
ATOM   2384 O O   . GLU A 1 313 ? 30.641  -3.306  4.043   1.00 56.50  ? 313  GLU A O   1 
ATOM   2385 C CB  . GLU A 1 313 ? 31.960  -0.434  3.021   1.00 73.66  ? 313  GLU A CB  1 
ATOM   2386 C CG  . GLU A 1 313 ? 31.218  0.866   2.713   1.00 86.31  ? 313  GLU A CG  1 
ATOM   2387 C CD  . GLU A 1 313 ? 31.726  2.063   3.524   1.00 96.88  ? 313  GLU A CD  1 
ATOM   2388 O OE1 . GLU A 1 313 ? 32.648  1.898   4.363   1.00 99.71  ? 313  GLU A OE1 1 
ATOM   2389 O OE2 . GLU A 1 313 ? 31.203  3.178   3.306   1.00 92.26  ? 313  GLU A OE2 1 
ATOM   2390 N N   . ALA A 1 314 ? 32.861  -3.112  4.314   1.00 56.31  ? 314  ALA A N   1 
ATOM   2391 C CA  . ALA A 1 314 ? 33.081  -4.542  4.261   1.00 43.14  ? 314  ALA A CA  1 
ATOM   2392 C C   . ALA A 1 314 ? 32.340  -5.248  5.401   1.00 44.06  ? 314  ALA A C   1 
ATOM   2393 O O   . ALA A 1 314 ? 31.706  -6.282  5.203   1.00 55.66  ? 314  ALA A O   1 
ATOM   2394 C CB  . ALA A 1 314 ? 34.571  -4.835  4.313   1.00 41.85  ? 314  ALA A CB  1 
ATOM   2395 N N   . LEU A 1 315 ? 32.408  -4.678  6.596   1.00 43.30  ? 315  LEU A N   1 
ATOM   2396 C CA  . LEU A 1 315 ? 31.871  -5.347  7.780   1.00 50.03  ? 315  LEU A CA  1 
ATOM   2397 C C   . LEU A 1 315 ? 30.345  -5.413  7.804   1.00 55.74  ? 315  LEU A C   1 
ATOM   2398 O O   . LEU A 1 315 ? 29.771  -6.454  8.144   1.00 69.84  ? 315  LEU A O   1 
ATOM   2399 C CB  . LEU A 1 315 ? 32.438  -4.741  9.073   1.00 47.59  ? 315  LEU A CB  1 
ATOM   2400 C CG  . LEU A 1 315 ? 33.970  -4.821  9.190   1.00 64.40  ? 315  LEU A CG  1 
ATOM   2401 C CD1 . LEU A 1 315 ? 34.506  -3.839  10.209  1.00 37.69  ? 315  LEU A CD1 1 
ATOM   2402 C CD2 . LEU A 1 315 ? 34.469  -6.255  9.483   1.00 43.08  ? 315  LEU A CD2 1 
ATOM   2403 N N   . ILE A 1 316 ? 29.678  -4.333  7.423   1.00 44.60  ? 316  ILE A N   1 
ATOM   2404 C CA  . ILE A 1 316 ? 28.217  -4.382  7.370   1.00 57.04  ? 316  ILE A CA  1 
ATOM   2405 C C   . ILE A 1 316 ? 27.716  -5.323  6.256   1.00 58.59  ? 316  ILE A C   1 
ATOM   2406 O O   . ILE A 1 316 ? 26.656  -5.927  6.373   1.00 53.82  ? 316  ILE A O   1 
ATOM   2407 C CB  . ILE A 1 316 ? 27.578  -2.982  7.238   1.00 53.13  ? 316  ILE A CB  1 
ATOM   2408 C CG1 . ILE A 1 316 ? 27.908  -2.345  5.886   1.00 52.83  ? 316  ILE A CG1 1 
ATOM   2409 C CG2 . ILE A 1 316 ? 28.023  -2.073  8.378   1.00 44.08  ? 316  ILE A CG2 1 
ATOM   2410 C CD1 . ILE A 1 316 ? 27.561  -0.851  5.838   1.00 54.08  ? 316  ILE A CD1 1 
ATOM   2411 N N   . ASN A 1 317 ? 28.493  -5.448  5.188   1.00 53.09  ? 317  ASN A N   1 
ATOM   2412 C CA  . ASN A 1 317 ? 28.138  -6.303  4.070   1.00 58.83  ? 317  ASN A CA  1 
ATOM   2413 C C   . ASN A 1 317 ? 28.102  -7.783  4.441   1.00 80.37  ? 317  ASN A C   1 
ATOM   2414 O O   . ASN A 1 317 ? 27.391  -8.575  3.816   1.00 84.27  ? 317  ASN A O   1 
ATOM   2415 C CB  . ASN A 1 317 ? 29.149  -6.125  2.934   1.00 64.04  ? 317  ASN A CB  1 
ATOM   2416 C CG  . ASN A 1 317 ? 28.888  -4.887  2.089   1.00 75.04  ? 317  ASN A CG  1 
ATOM   2417 O OD1 . ASN A 1 317 ? 27.977  -4.090  2.366   1.00 71.32  ? 317  ASN A OD1 1 
ATOM   2418 N ND2 . ASN A 1 317 ? 29.704  -4.717  1.045   1.00 73.69  ? 317  ASN A ND2 1 
ATOM   2419 N N   . THR A 1 318 ? 28.880  -8.156  5.451   1.00 80.95  ? 318  THR A N   1 
ATOM   2420 C CA  . THR A 1 318 ? 29.195  -9.563  5.670   1.00 74.16  ? 318  THR A CA  1 
ATOM   2421 C C   . THR A 1 318 ? 28.973  -10.030 7.099   1.00 70.18  ? 318  THR A C   1 
ATOM   2422 O O   . THR A 1 318 ? 29.427  -11.104 7.478   1.00 83.98  ? 318  THR A O   1 
ATOM   2423 C CB  . THR A 1 318 ? 30.663  -9.841  5.309   1.00 74.92  ? 318  THR A CB  1 
ATOM   2424 O OG1 . THR A 1 318 ? 31.504  -8.897  5.987   1.00 76.47  ? 318  THR A OG1 1 
ATOM   2425 C CG2 . THR A 1 318 ? 30.870  -9.689  3.822   1.00 74.61  ? 318  THR A CG2 1 
ATOM   2426 N N   . GLY A 1 319 ? 28.279  -9.224  7.890   1.00 59.53  ? 319  GLY A N   1 
ATOM   2427 C CA  . GLY A 1 319 ? 28.117  -9.502  9.302   1.00 49.84  ? 319  GLY A CA  1 
ATOM   2428 C C   . GLY A 1 319 ? 26.876  -10.293 9.648   1.00 67.75  ? 319  GLY A C   1 
ATOM   2429 O O   . GLY A 1 319 ? 26.057  -10.639 8.783   1.00 84.55  ? 319  GLY A O   1 
ATOM   2430 N N   . ASP A 1 320 ? 26.746  -10.589 10.934  1.00 62.56  ? 320  ASP A N   1 
ATOM   2431 C CA  . ASP A 1 320 ? 25.642  -11.382 11.440  1.00 58.76  ? 320  ASP A CA  1 
ATOM   2432 C C   . ASP A 1 320 ? 25.126  -10.610 12.627  1.00 62.85  ? 320  ASP A C   1 
ATOM   2433 O O   . ASP A 1 320 ? 25.816  -10.489 13.644  1.00 70.72  ? 320  ASP A O   1 
ATOM   2434 C CB  . ASP A 1 320 ? 26.145  -12.770 11.855  1.00 72.53  ? 320  ASP A CB  1 
ATOM   2435 C CG  . ASP A 1 320 ? 25.145  -13.530 12.705  1.00 76.68  ? 320  ASP A CG  1 
ATOM   2436 O OD1 . ASP A 1 320 ? 24.215  -14.144 12.133  1.00 67.88  ? 320  ASP A OD1 1 
ATOM   2437 O OD2 . ASP A 1 320 ? 25.303  -13.517 13.946  1.00 79.75  ? 320  ASP A OD2 1 
ATOM   2438 N N   . PHE A 1 321 ? 23.929  -10.051 12.489  1.00 64.29  ? 321  PHE A N   1 
ATOM   2439 C CA  . PHE A 1 321 ? 23.457  -9.084  13.466  1.00 65.58  ? 321  PHE A CA  1 
ATOM   2440 C C   . PHE A 1 321 ? 22.108  -9.442  14.074  1.00 67.25  ? 321  PHE A C   1 
ATOM   2441 O O   . PHE A 1 321 ? 21.314  -8.551  14.353  1.00 72.54  ? 321  PHE A O   1 
ATOM   2442 C CB  . PHE A 1 321 ? 23.376  -7.702  12.822  1.00 63.47  ? 321  PHE A CB  1 
ATOM   2443 C CG  . PHE A 1 321 ? 24.634  -7.284  12.093  1.00 62.19  ? 321  PHE A CG  1 
ATOM   2444 C CD1 . PHE A 1 321 ? 25.727  -6.776  12.789  1.00 71.53  ? 321  PHE A CD1 1 
ATOM   2445 C CD2 . PHE A 1 321 ? 24.712  -7.371  10.710  1.00 63.46  ? 321  PHE A CD2 1 
ATOM   2446 C CE1 . PHE A 1 321 ? 26.880  -6.380  12.124  1.00 41.37  ? 321  PHE A CE1 1 
ATOM   2447 C CE2 . PHE A 1 321 ? 25.858  -6.980  10.037  1.00 61.24  ? 321  PHE A CE2 1 
ATOM   2448 C CZ  . PHE A 1 321 ? 26.945  -6.480  10.751  1.00 64.52  ? 321  PHE A CZ  1 
ATOM   2449 N N   . GLN A 1 322 ? 21.846  -10.730 14.287  1.00 70.84  ? 322  GLN A N   1 
ATOM   2450 C CA  . GLN A 1 322 ? 20.545  -11.143 14.798  1.00 77.86  ? 322  GLN A CA  1 
ATOM   2451 C C   . GLN A 1 322 ? 20.247  -10.485 16.132  1.00 84.11  ? 322  GLN A C   1 
ATOM   2452 O O   . GLN A 1 322 ? 19.100  -10.151 16.437  1.00 84.25  ? 322  GLN A O   1 
ATOM   2453 C CB  . GLN A 1 322 ? 20.488  -12.649 14.991  1.00 87.22  ? 322  GLN A CB  1 
ATOM   2454 C CG  . GLN A 1 322 ? 20.977  -13.459 13.823  1.00 89.51  ? 322  GLN A CG  1 
ATOM   2455 C CD  . GLN A 1 322 ? 21.487  -14.809 14.269  1.00 93.08  ? 322  GLN A CD  1 
ATOM   2456 O OE1 . GLN A 1 322 ? 21.153  -15.281 15.363  1.00 89.58  ? 322  GLN A OE1 1 
ATOM   2457 N NE2 . GLN A 1 322 ? 22.319  -15.433 13.438  1.00 94.65  ? 322  GLN A NE2 1 
ATOM   2458 N N   . ASP A 1 323 ? 21.293  -10.305 16.927  1.00 85.27  ? 323  ASP A N   1 
ATOM   2459 C CA  . ASP A 1 323 ? 21.134  -9.878  18.309  1.00 96.08  ? 323  ASP A CA  1 
ATOM   2460 C C   . ASP A 1 323 ? 20.993  -8.365  18.433  1.00 77.94  ? 323  ASP A C   1 
ATOM   2461 O O   . ASP A 1 323 ? 20.744  -7.821  19.507  1.00 74.14  ? 323  ASP A O   1 
ATOM   2462 C CB  . ASP A 1 323 ? 22.324  -10.376 19.126  1.00 115.17 ? 323  ASP A CB  1 
ATOM   2463 C CG  . ASP A 1 323 ? 22.581  -11.859 18.924  1.00 130.88 ? 323  ASP A CG  1 
ATOM   2464 O OD1 . ASP A 1 323 ? 21.607  -12.599 18.658  1.00 135.84 ? 323  ASP A OD1 1 
ATOM   2465 O OD2 . ASP A 1 323 ? 23.753  -12.284 19.023  1.00 135.80 ? 323  ASP A OD2 1 
ATOM   2466 N N   . LEU A 1 324 ? 21.138  -7.680  17.317  1.00 68.60  ? 324  LEU A N   1 
ATOM   2467 C CA  . LEU A 1 324 ? 21.224  -6.239  17.363  1.00 53.17  ? 324  LEU A CA  1 
ATOM   2468 C C   . LEU A 1 324 ? 19.870  -5.556  17.209  1.00 56.13  ? 324  LEU A C   1 
ATOM   2469 O O   . LEU A 1 324 ? 19.111  -5.868  16.300  1.00 55.12  ? 324  LEU A O   1 
ATOM   2470 C CB  . LEU A 1 324 ? 22.207  -5.749  16.303  1.00 52.07  ? 324  LEU A CB  1 
ATOM   2471 C CG  . LEU A 1 324 ? 22.279  -4.231  16.123  1.00 56.84  ? 324  LEU A CG  1 
ATOM   2472 C CD1 . LEU A 1 324 ? 22.658  -3.539  17.426  1.00 52.69  ? 324  LEU A CD1 1 
ATOM   2473 C CD2 . LEU A 1 324 ? 23.254  -3.912  15.032  1.00 51.30  ? 324  LEU A CD2 1 
ATOM   2474 N N   . GLN A 1 325 ? 19.582  -4.623  18.111  1.00 50.76  ? 325  GLN A N   1 
ATOM   2475 C CA  . GLN A 1 325 ? 18.434  -3.743  17.965  1.00 48.24  ? 325  GLN A CA  1 
ATOM   2476 C C   . GLN A 1 325 ? 18.914  -2.303  17.833  1.00 49.42  ? 325  GLN A C   1 
ATOM   2477 O O   . GLN A 1 325 ? 19.484  -1.704  18.755  1.00 44.76  ? 325  GLN A O   1 
ATOM   2478 C CB  . GLN A 1 325 ? 17.494  -3.883  19.145  1.00 48.15  ? 325  GLN A CB  1 
ATOM   2479 C CG  . GLN A 1 325 ? 17.097  -5.310  19.426  1.00 59.18  ? 325  GLN A CG  1 
ATOM   2480 C CD  . GLN A 1 325 ? 16.810  -5.523  20.886  1.00 73.50  ? 325  GLN A CD  1 
ATOM   2481 O OE1 . GLN A 1 325 ? 15.682  -5.342  21.336  1.00 83.75  ? 325  GLN A OE1 1 
ATOM   2482 N NE2 . GLN A 1 325 ? 17.840  -5.878  21.649  1.00 75.32  ? 325  GLN A NE2 1 
ATOM   2483 N N   . VAL A 1 326 ? 18.675  -1.754  16.663  1.00 37.42  ? 326  VAL A N   1 
ATOM   2484 C CA  . VAL A 1 326 ? 19.218  -0.473  16.332  1.00 44.97  ? 326  VAL A CA  1 
ATOM   2485 C C   . VAL A 1 326 ? 18.094  0.422   15.845  1.00 53.83  ? 326  VAL A C   1 
ATOM   2486 O O   . VAL A 1 326 ? 17.178  -0.005  15.143  1.00 50.02  ? 326  VAL A O   1 
ATOM   2487 C CB  . VAL A 1 326 ? 20.283  -0.605  15.248  1.00 44.96  ? 326  VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 326 ? 19.648  -1.052  13.947  1.00 57.11  ? 326  VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 326 ? 20.966  0.702   15.038  1.00 52.71  ? 326  VAL A CG2 1 
ATOM   2490 N N   . LEU A 1 327 ? 18.159  1.670   16.259  1.00 52.18  ? 327  LEU A N   1 
ATOM   2491 C CA  . LEU A 1 327 ? 17.236  2.668   15.790  1.00 50.16  ? 327  LEU A CA  1 
ATOM   2492 C C   . LEU A 1 327 ? 18.092  3.682   15.051  1.00 49.29  ? 327  LEU A C   1 
ATOM   2493 O O   . LEU A 1 327 ? 19.085  4.160   15.587  1.00 50.79  ? 327  LEU A O   1 
ATOM   2494 C CB  . LEU A 1 327 ? 16.542  3.302   16.985  1.00 42.21  ? 327  LEU A CB  1 
ATOM   2495 C CG  . LEU A 1 327 ? 15.296  4.139   16.759  1.00 52.15  ? 327  LEU A CG  1 
ATOM   2496 C CD1 . LEU A 1 327 ? 14.355  3.775   17.860  1.00 62.43  ? 327  LEU A CD1 1 
ATOM   2497 C CD2 . LEU A 1 327 ? 15.620  5.625   16.833  1.00 47.15  ? 327  LEU A CD2 1 
ATOM   2498 N N   . VAL A 1 328 ? 17.718  3.985   13.815  1.00 49.76  ? 328  VAL A N   1 
ATOM   2499 C CA  . VAL A 1 328 ? 18.481  4.894   12.974  1.00 43.50  ? 328  VAL A CA  1 
ATOM   2500 C C   . VAL A 1 328 ? 17.554  5.884   12.298  1.00 38.60  ? 328  VAL A C   1 
ATOM   2501 O O   . VAL A 1 328 ? 16.351  5.650   12.183  1.00 40.35  ? 328  VAL A O   1 
ATOM   2502 C CB  . VAL A 1 328 ? 19.172  4.124   11.854  1.00 44.65  ? 328  VAL A CB  1 
ATOM   2503 C CG1 . VAL A 1 328 ? 19.903  2.919   12.419  1.00 47.44  ? 328  VAL A CG1 1 
ATOM   2504 C CG2 . VAL A 1 328 ? 18.137  3.659   10.858  1.00 43.53  ? 328  VAL A CG2 1 
ATOM   2505 N N   . GLY A 1 329 ? 18.120  6.977   11.809  1.00 35.03  ? 329  GLY A N   1 
ATOM   2506 C CA  . GLY A 1 329 ? 17.333  7.951   11.082  1.00 36.25  ? 329  GLY A CA  1 
ATOM   2507 C C   . GLY A 1 329 ? 18.073  9.217   10.709  1.00 40.91  ? 329  GLY A C   1 
ATOM   2508 O O   . GLY A 1 329 ? 19.258  9.378   11.034  1.00 44.41  ? 329  GLY A O   1 
ATOM   2509 N N   . VAL A 1 330 ? 17.359  10.125  10.038  1.00 38.51  ? 330  VAL A N   1 
ATOM   2510 C CA  . VAL A 1 330 ? 17.943  11.376  9.540   1.00 29.94  ? 330  VAL A CA  1 
ATOM   2511 C C   . VAL A 1 330 ? 17.025  12.572  9.714   1.00 32.93  ? 330  VAL A C   1 
ATOM   2512 O O   . VAL A 1 330 ? 15.851  12.425  10.055  1.00 36.08  ? 330  VAL A O   1 
ATOM   2513 C CB  . VAL A 1 330 ? 18.266  11.279  8.046   1.00 32.45  ? 330  VAL A CB  1 
ATOM   2514 C CG1 . VAL A 1 330 ? 19.198  10.104  7.775   1.00 37.18  ? 330  VAL A CG1 1 
ATOM   2515 C CG2 . VAL A 1 330 ? 16.986  11.170  7.236   1.00 26.42  ? 330  VAL A CG2 1 
ATOM   2516 N N   . VAL A 1 331 ? 17.563  13.761  9.461   1.00 35.44  ? 331  VAL A N   1 
ATOM   2517 C CA  . VAL A 1 331 ? 16.760  14.980  9.438   1.00 22.96  ? 331  VAL A CA  1 
ATOM   2518 C C   . VAL A 1 331 ? 16.376  15.322  7.989   1.00 38.69  ? 331  VAL A C   1 
ATOM   2519 O O   . VAL A 1 331 ? 17.002  14.817  7.061   1.00 43.50  ? 331  VAL A O   1 
ATOM   2520 C CB  . VAL A 1 331 ? 17.517  16.140  10.098  1.00 28.62  ? 331  VAL A CB  1 
ATOM   2521 C CG1 . VAL A 1 331 ? 17.756  15.825  11.544  1.00 26.99  ? 331  VAL A CG1 1 
ATOM   2522 C CG2 . VAL A 1 331 ? 18.834  16.408  9.390   1.00 20.26  ? 331  VAL A CG2 1 
ATOM   2523 N N   . LYS A 1 332 ? 15.351  16.160  7.792   1.00 50.48  ? 332  LYS A N   1 
ATOM   2524 C CA  . LYS A 1 332 ? 14.857  16.491  6.443   1.00 42.39  ? 332  LYS A CA  1 
ATOM   2525 C C   . LYS A 1 332 ? 15.956  17.066  5.557   1.00 46.20  ? 332  LYS A C   1 
ATOM   2526 O O   . LYS A 1 332 ? 16.011  16.777  4.370   1.00 48.24  ? 332  LYS A O   1 
ATOM   2527 C CB  . LYS A 1 332 ? 13.680  17.472  6.504   1.00 42.16  ? 332  LYS A CB  1 
ATOM   2528 C CG  . LYS A 1 332 ? 12.708  17.465  5.290   1.00 54.73  ? 332  LYS A CG  1 
ATOM   2529 C CD  . LYS A 1 332 ? 11.713  18.646  5.393   1.00 53.12  ? 332  LYS A CD  1 
ATOM   2530 C CE  . LYS A 1 332 ? 12.490  19.928  5.821   1.00 81.76  ? 332  LYS A CE  1 
ATOM   2531 N NZ  . LYS A 1 332 ? 11.813  21.284  5.854   1.00 57.42  ? 332  LYS A NZ  1 
ATOM   2532 N N   . ASP A 1 333 ? 16.848  17.853  6.150   1.00 46.25  ? 333  ASP A N   1 
ATOM   2533 C CA  . ASP A 1 333 ? 17.832  18.609  5.385   1.00 32.37  ? 333  ASP A CA  1 
ATOM   2534 C C   . ASP A 1 333 ? 19.264  18.430  5.895   1.00 48.19  ? 333  ASP A C   1 
ATOM   2535 O O   . ASP A 1 333 ? 19.894  19.360  6.411   1.00 36.52  ? 333  ASP A O   1 
ATOM   2536 C CB  . ASP A 1 333 ? 17.434  20.071  5.384   1.00 23.61  ? 333  ASP A CB  1 
ATOM   2537 C CG  . ASP A 1 333 ? 16.043  20.266  4.856   1.00 34.71  ? 333  ASP A CG  1 
ATOM   2538 O OD1 . ASP A 1 333 ? 15.871  20.253  3.624   1.00 46.07  ? 333  ASP A OD1 1 
ATOM   2539 O OD2 . ASP A 1 333 ? 15.115  20.387  5.674   1.00 34.98  ? 333  ASP A OD2 1 
ATOM   2540 N N   . GLU A 1 334 ? 19.780  17.216  5.735   1.00 43.79  ? 334  GLU A N   1 
ATOM   2541 C CA  . GLU A 1 334 ? 21.077  16.890  6.284   1.00 39.23  ? 334  GLU A CA  1 
ATOM   2542 C C   . GLU A 1 334 ? 22.198  17.800  5.754   1.00 33.03  ? 334  GLU A C   1 
ATOM   2543 O O   . GLU A 1 334 ? 23.208  17.982  6.422   1.00 31.89  ? 334  GLU A O   1 
ATOM   2544 C CB  . GLU A 1 334 ? 21.396  15.423  5.995   1.00 40.25  ? 334  GLU A CB  1 
ATOM   2545 C CG  . GLU A 1 334 ? 20.556  14.441  6.776   1.00 42.45  ? 334  GLU A CG  1 
ATOM   2546 C CD  . GLU A 1 334 ? 20.942  14.400  8.237   1.00 47.11  ? 334  GLU A CD  1 
ATOM   2547 O OE1 . GLU A 1 334 ? 21.908  15.096  8.621   1.00 41.88  ? 334  GLU A OE1 1 
ATOM   2548 O OE2 . GLU A 1 334 ? 20.275  13.678  9.005   1.00 47.55  ? 334  GLU A OE2 1 
ATOM   2549 N N   . GLY A 1 335 ? 22.018  18.353  4.557   1.00 30.20  ? 335  GLY A N   1 
ATOM   2550 C CA  . GLY A 1 335 ? 23.102  19.002  3.844   1.00 35.82  ? 335  GLY A CA  1 
ATOM   2551 C C   . GLY A 1 335 ? 23.206  20.514  3.952   1.00 46.27  ? 335  GLY A C   1 
ATOM   2552 O O   . GLY A 1 335 ? 24.284  21.060  3.727   1.00 48.48  ? 335  GLY A O   1 
ATOM   2553 N N   . SER A 1 336 ? 22.117  21.194  4.315   1.00 36.15  ? 336  SER A N   1 
ATOM   2554 C CA  . SER A 1 336 ? 22.086  22.664  4.256   1.00 40.59  ? 336  SER A CA  1 
ATOM   2555 C C   . SER A 1 336 ? 23.227  23.394  5.001   1.00 41.48  ? 336  SER A C   1 
ATOM   2556 O O   . SER A 1 336 ? 23.876  24.269  4.438   1.00 47.77  ? 336  SER A O   1 
ATOM   2557 C CB  . SER A 1 336 ? 20.741  23.172  4.745   1.00 40.42  ? 336  SER A CB  1 
ATOM   2558 O OG  . SER A 1 336 ? 20.351  22.444  5.889   1.00 47.78  ? 336  SER A OG  1 
ATOM   2559 N N   . TYR A 1 337 ? 23.438  23.017  6.261   1.00 39.72  ? 337  TYR A N   1 
ATOM   2560 C CA  . TYR A 1 337 ? 24.441  23.574  7.189   1.00 31.65  ? 337  TYR A CA  1 
ATOM   2561 C C   . TYR A 1 337 ? 25.857  23.674  6.605   1.00 31.45  ? 337  TYR A C   1 
ATOM   2562 O O   . TYR A 1 337 ? 26.579  24.641  6.848   1.00 38.18  ? 337  TYR A O   1 
ATOM   2563 C CB  . TYR A 1 337 ? 24.441  22.712  8.470   1.00 36.75  ? 337  TYR A CB  1 
ATOM   2564 C CG  . TYR A 1 337 ? 25.083  23.281  9.727   1.00 34.54  ? 337  TYR A CG  1 
ATOM   2565 C CD1 . TYR A 1 337 ? 26.367  23.791  9.720   1.00 43.62  ? 337  TYR A CD1 1 
ATOM   2566 C CD2 . TYR A 1 337 ? 24.410  23.261  10.933  1.00 34.22  ? 337  TYR A CD2 1 
ATOM   2567 C CE1 . TYR A 1 337 ? 26.953  24.296  10.871  1.00 34.58  ? 337  TYR A CE1 1 
ATOM   2568 C CE2 . TYR A 1 337 ? 24.984  23.776  12.089  1.00 37.19  ? 337  TYR A CE2 1 
ATOM   2569 C CZ  . TYR A 1 337 ? 26.258  24.286  12.054  1.00 40.50  ? 337  TYR A CZ  1 
ATOM   2570 O OH  . TYR A 1 337 ? 26.842  24.794  13.203  1.00 45.12  ? 337  TYR A OH  1 
ATOM   2571 N N   . PHE A 1 338 ? 26.235  22.687  5.807   1.00 36.70  ? 338  PHE A N   1 
ATOM   2572 C CA  . PHE A 1 338 ? 27.586  22.590  5.266   1.00 29.21  ? 338  PHE A CA  1 
ATOM   2573 C C   . PHE A 1 338 ? 27.860  23.576  4.128   1.00 42.30  ? 338  PHE A C   1 
ATOM   2574 O O   . PHE A 1 338 ? 29.001  23.992  3.902   1.00 43.32  ? 338  PHE A O   1 
ATOM   2575 C CB  . PHE A 1 338 ? 27.832  21.148  4.831   1.00 40.91  ? 338  PHE A CB  1 
ATOM   2576 C CG  . PHE A 1 338 ? 27.704  20.182  5.964   1.00 47.15  ? 338  PHE A CG  1 
ATOM   2577 C CD1 . PHE A 1 338 ? 26.467  19.691  6.328   1.00 47.08  ? 338  PHE A CD1 1 
ATOM   2578 C CD2 . PHE A 1 338 ? 28.812  19.839  6.725   1.00 41.70  ? 338  PHE A CD2 1 
ATOM   2579 C CE1 . PHE A 1 338 ? 26.342  18.845  7.410   1.00 46.90  ? 338  PHE A CE1 1 
ATOM   2580 C CE2 . PHE A 1 338 ? 28.699  18.999  7.792   1.00 34.87  ? 338  PHE A CE2 1 
ATOM   2581 C CZ  . PHE A 1 338 ? 27.462  18.496  8.139   1.00 42.22  ? 338  PHE A CZ  1 
ATOM   2582 N N   . LEU A 1 339 ? 26.804  23.976  3.433   1.00 34.95  ? 339  LEU A N   1 
ATOM   2583 C CA  . LEU A 1 339 ? 26.978  24.802  2.257   1.00 42.61  ? 339  LEU A CA  1 
ATOM   2584 C C   . LEU A 1 339 ? 27.551  26.185  2.579   1.00 41.21  ? 339  LEU A C   1 
ATOM   2585 O O   . LEU A 1 339 ? 28.264  26.767  1.769   1.00 41.39  ? 339  LEU A O   1 
ATOM   2586 C CB  . LEU A 1 339 ? 25.655  24.921  1.509   1.00 42.22  ? 339  LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 339 ? 24.921  23.626  1.156   1.00 39.53  ? 339  LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 339 ? 23.836  23.964  0.150   1.00 50.76  ? 339  LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 339 ? 25.860  22.550  0.592   1.00 29.42  ? 339  LEU A CD2 1 
ATOM   2590 N N   . VAL A 1 340 ? 27.245  26.704  3.761   1.00 30.85  ? 340  VAL A N   1 
ATOM   2591 C CA  . VAL A 1 340 ? 27.608  28.080  4.083   1.00 43.11  ? 340  VAL A CA  1 
ATOM   2592 C C   . VAL A 1 340 ? 29.035  28.147  4.611   1.00 46.14  ? 340  VAL A C   1 
ATOM   2593 O O   . VAL A 1 340 ? 29.528  29.206  4.981   1.00 52.67  ? 340  VAL A O   1 
ATOM   2594 C CB  . VAL A 1 340 ? 26.608  28.742  5.080   1.00 28.60  ? 340  VAL A CB  1 
ATOM   2595 C CG1 . VAL A 1 340 ? 25.161  28.578  4.585   1.00 36.43  ? 340  VAL A CG1 1 
ATOM   2596 C CG2 . VAL A 1 340 ? 26.744  28.153  6.485   1.00 24.31  ? 340  VAL A CG2 1 
ATOM   2597 N N   . TYR A 1 341 ? 29.688  26.995  4.634   1.00 38.02  ? 341  TYR A N   1 
ATOM   2598 C CA  . TYR A 1 341 ? 31.058  26.887  5.113   1.00 49.28  ? 341  TYR A CA  1 
ATOM   2599 C C   . TYR A 1 341 ? 31.998  26.517  3.978   1.00 55.13  ? 341  TYR A C   1 
ATOM   2600 O O   . TYR A 1 341 ? 32.993  25.818  4.192   1.00 62.22  ? 341  TYR A O   1 
ATOM   2601 C CB  . TYR A 1 341 ? 31.163  25.763  6.146   1.00 45.61  ? 341  TYR A CB  1 
ATOM   2602 C CG  . TYR A 1 341 ? 30.749  26.120  7.552   1.00 45.18  ? 341  TYR A CG  1 
ATOM   2603 C CD1 . TYR A 1 341 ? 31.655  26.698  8.434   1.00 32.96  ? 341  TYR A CD1 1 
ATOM   2604 C CD2 . TYR A 1 341 ? 29.462  25.837  8.013   1.00 33.05  ? 341  TYR A CD2 1 
ATOM   2605 C CE1 . TYR A 1 341 ? 31.284  27.022  9.730   1.00 35.16  ? 341  TYR A CE1 1 
ATOM   2606 C CE2 . TYR A 1 341 ? 29.085  26.150  9.298   1.00 35.30  ? 341  TYR A CE2 1 
ATOM   2607 C CZ  . TYR A 1 341 ? 29.993  26.750  10.153  1.00 48.32  ? 341  TYR A CZ  1 
ATOM   2608 O OH  . TYR A 1 341 ? 29.606  27.057  11.440  1.00 55.20  ? 341  TYR A OH  1 
ATOM   2609 N N   . GLY A 1 342 ? 31.685  26.929  2.761   1.00 50.57  ? 342  GLY A N   1 
ATOM   2610 C CA  . GLY A 1 342 ? 32.489  26.446  1.668   1.00 43.32  ? 342  GLY A CA  1 
ATOM   2611 C C   . GLY A 1 342 ? 31.957  26.626  0.275   1.00 50.40  ? 342  GLY A C   1 
ATOM   2612 O O   . GLY A 1 342 ? 32.717  26.977  -0.616  1.00 71.78  ? 342  GLY A O   1 
ATOM   2613 N N   . VAL A 1 343 ? 30.676  26.381  0.048   1.00 41.32  ? 343  VAL A N   1 
ATOM   2614 C CA  . VAL A 1 343 ? 30.195  26.500  -1.323  1.00 43.02  ? 343  VAL A CA  1 
ATOM   2615 C C   . VAL A 1 343 ? 29.913  27.954  -1.679  1.00 53.58  ? 343  VAL A C   1 
ATOM   2616 O O   . VAL A 1 343 ? 29.007  28.575  -1.127  1.00 57.63  ? 343  VAL A O   1 
ATOM   2617 C CB  . VAL A 1 343 ? 28.985  25.596  -1.608  1.00 50.61  ? 343  VAL A CB  1 
ATOM   2618 C CG1 . VAL A 1 343 ? 28.621  25.640  -3.088  1.00 42.02  ? 343  VAL A CG1 1 
ATOM   2619 C CG2 . VAL A 1 343 ? 29.289  24.152  -1.177  1.00 52.89  ? 343  VAL A CG2 1 
ATOM   2620 N N   . PRO A 1 344 ? 30.721  28.509  -2.593  1.00 52.46  ? 344  PRO A N   1 
ATOM   2621 C CA  . PRO A 1 344 ? 30.488  29.869  -3.077  1.00 54.42  ? 344  PRO A CA  1 
ATOM   2622 C C   . PRO A 1 344 ? 29.040  29.969  -3.457  1.00 54.47  ? 344  PRO A C   1 
ATOM   2623 O O   . PRO A 1 344 ? 28.559  29.058  -4.136  1.00 52.77  ? 344  PRO A O   1 
ATOM   2624 C CB  . PRO A 1 344 ? 31.320  29.934  -4.359  1.00 40.18  ? 344  PRO A CB  1 
ATOM   2625 C CG  . PRO A 1 344 ? 32.390  28.930  -4.169  1.00 42.40  ? 344  PRO A CG  1 
ATOM   2626 C CD  . PRO A 1 344 ? 31.766  27.816  -3.364  1.00 49.62  ? 344  PRO A CD  1 
ATOM   2627 N N   . GLY A 1 345 ? 28.365  31.031  -3.028  1.00 45.96  ? 345  GLY A N   1 
ATOM   2628 C CA  . GLY A 1 345 ? 26.984  31.258  -3.404  1.00 33.39  ? 345  GLY A CA  1 
ATOM   2629 C C   . GLY A 1 345 ? 26.094  31.216  -2.194  1.00 40.41  ? 345  GLY A C   1 
ATOM   2630 O O   . GLY A 1 345 ? 25.030  31.818  -2.187  1.00 55.04  ? 345  GLY A O   1 
ATOM   2631 N N   . PHE A 1 346 ? 26.564  30.537  -1.151  1.00 47.80  ? 346  PHE A N   1 
ATOM   2632 C CA  . PHE A 1 346 ? 25.724  30.179  -0.011  1.00 44.42  ? 346  PHE A CA  1 
ATOM   2633 C C   . PHE A 1 346 ? 26.050  30.945  1.249   1.00 49.04  ? 346  PHE A C   1 
ATOM   2634 O O   . PHE A 1 346 ? 27.226  31.146  1.578   1.00 51.04  ? 346  PHE A O   1 
ATOM   2635 C CB  . PHE A 1 346 ? 25.823  28.686  0.277   1.00 30.88  ? 346  PHE A CB  1 
ATOM   2636 C CG  . PHE A 1 346 ? 25.198  27.825  -0.776  1.00 35.27  ? 346  PHE A CG  1 
ATOM   2637 C CD1 . PHE A 1 346 ? 25.904  27.487  -1.927  1.00 44.16  ? 346  PHE A CD1 1 
ATOM   2638 C CD2 . PHE A 1 346 ? 23.908  27.338  -0.614  1.00 29.80  ? 346  PHE A CD2 1 
ATOM   2639 C CE1 . PHE A 1 346 ? 25.333  26.669  -2.903  1.00 48.57  ? 346  PHE A CE1 1 
ATOM   2640 C CE2 . PHE A 1 346 ? 23.327  26.526  -1.575  1.00 41.82  ? 346  PHE A CE2 1 
ATOM   2641 C CZ  . PHE A 1 346 ? 24.038  26.190  -2.727  1.00 47.17  ? 346  PHE A CZ  1 
ATOM   2642 N N   . SER A 1 347 ? 24.989  31.337  1.959   1.00 47.25  ? 347  SER A N   1 
ATOM   2643 C CA  . SER A 1 347 ? 25.088  32.165  3.164   1.00 46.88  ? 347  SER A CA  1 
ATOM   2644 C C   . SER A 1 347 ? 23.816  32.179  4.019   1.00 48.45  ? 347  SER A C   1 
ATOM   2645 O O   . SER A 1 347 ? 22.695  32.149  3.500   1.00 53.52  ? 347  SER A O   1 
ATOM   2646 C CB  . SER A 1 347 ? 25.439  33.607  2.792   1.00 39.97  ? 347  SER A CB  1 
ATOM   2647 O OG  . SER A 1 347 ? 25.321  34.425  3.942   1.00 51.36  ? 347  SER A OG  1 
ATOM   2648 N N   . LYS A 1 348 ? 23.985  32.274  5.331   1.00 38.67  ? 348  LYS A N   1 
ATOM   2649 C CA  . LYS A 1 348 ? 22.825  32.261  6.216   1.00 40.63  ? 348  LYS A CA  1 
ATOM   2650 C C   . LYS A 1 348 ? 22.091  33.575  6.184   1.00 44.38  ? 348  LYS A C   1 
ATOM   2651 O O   . LYS A 1 348 ? 21.005  33.708  6.747   1.00 53.13  ? 348  LYS A O   1 
ATOM   2652 C CB  . LYS A 1 348 ? 23.214  31.926  7.660   1.00 40.36  ? 348  LYS A CB  1 
ATOM   2653 C CG  . LYS A 1 348 ? 23.837  33.041  8.439   1.00 42.06  ? 348  LYS A CG  1 
ATOM   2654 C CD  . LYS A 1 348 ? 23.959  32.679  9.909   1.00 53.63  ? 348  LYS A CD  1 
ATOM   2655 C CE  . LYS A 1 348 ? 24.462  33.872  10.724  1.00 59.38  ? 348  LYS A CE  1 
ATOM   2656 N NZ  . LYS A 1 348 ? 23.575  35.072  10.585  1.00 48.28  ? 348  LYS A NZ  1 
ATOM   2657 N N   . ASP A 1 349 ? 22.700  34.556  5.533   1.00 50.98  ? 349  ASP A N   1 
ATOM   2658 C CA  . ASP A 1 349 ? 22.203  35.919  5.605   1.00 40.39  ? 349  ASP A CA  1 
ATOM   2659 C C   . ASP A 1 349 ? 21.523  36.344  4.305   1.00 48.58  ? 349  ASP A C   1 
ATOM   2660 O O   . ASP A 1 349 ? 20.984  37.440  4.214   1.00 54.01  ? 349  ASP A O   1 
ATOM   2661 C CB  . ASP A 1 349 ? 23.326  36.860  6.031   1.00 41.20  ? 349  ASP A CB  1 
ATOM   2662 C CG  . ASP A 1 349 ? 23.849  36.541  7.442   1.00 56.75  ? 349  ASP A CG  1 
ATOM   2663 O OD1 . ASP A 1 349 ? 23.051  36.080  8.290   1.00 49.80  ? 349  ASP A OD1 1 
ATOM   2664 O OD2 . ASP A 1 349 ? 25.057  36.739  7.704   1.00 62.16  ? 349  ASP A OD2 1 
ATOM   2665 N N   . ASN A 1 350 ? 21.547  35.460  3.306   1.00 48.15  ? 350  ASN A N   1 
ATOM   2666 C CA  . ASN A 1 350 ? 20.665  35.593  2.148   1.00 50.94  ? 350  ASN A CA  1 
ATOM   2667 C C   . ASN A 1 350 ? 19.984  34.269  1.781   1.00 51.57  ? 350  ASN A C   1 
ATOM   2668 O O   . ASN A 1 350 ? 20.196  33.235  2.429   1.00 38.98  ? 350  ASN A O   1 
ATOM   2669 C CB  . ASN A 1 350 ? 21.347  36.263  0.936   1.00 49.10  ? 350  ASN A CB  1 
ATOM   2670 C CG  . ASN A 1 350 ? 22.533  35.472  0.400   1.00 61.74  ? 350  ASN A CG  1 
ATOM   2671 O OD1 . ASN A 1 350 ? 22.540  34.240  0.447   1.00 65.93  ? 350  ASN A OD1 1 
ATOM   2672 N ND2 . ASN A 1 350 ? 23.544  36.186  -0.133  1.00 57.56  ? 350  ASN A ND2 1 
ATOM   2673 N N   . GLU A 1 351 ? 19.143  34.321  0.756   1.00 48.47  ? 351  GLU A N   1 
ATOM   2674 C CA  . GLU A 1 351 ? 18.320  33.179  0.395   1.00 49.96  ? 351  GLU A CA  1 
ATOM   2675 C C   . GLU A 1 351 ? 19.095  32.157  -0.452  1.00 41.66  ? 351  GLU A C   1 
ATOM   2676 O O   . GLU A 1 351 ? 18.539  31.148  -0.887  1.00 46.85  ? 351  GLU A O   1 
ATOM   2677 C CB  . GLU A 1 351 ? 17.027  33.658  -0.288  1.00 43.90  ? 351  GLU A CB  1 
ATOM   2678 C CG  . GLU A 1 351 ? 15.923  34.044  0.701   1.00 54.17  ? 351  GLU A CG  1 
ATOM   2679 C CD  . GLU A 1 351 ? 15.307  32.831  1.427   1.00 83.57  ? 351  GLU A CD  1 
ATOM   2680 O OE1 . GLU A 1 351 ? 14.424  32.174  0.815   1.00 90.82  ? 351  GLU A OE1 1 
ATOM   2681 O OE2 . GLU A 1 351 ? 15.692  32.539  2.602   1.00 77.68  ? 351  GLU A OE2 1 
ATOM   2682 N N   . SER A 1 352 ? 20.380  32.443  -0.666  1.00 42.76  ? 352  SER A N   1 
ATOM   2683 C CA  . SER A 1 352 ? 21.317  31.576  -1.393  1.00 42.51  ? 352  SER A CA  1 
ATOM   2684 C C   . SER A 1 352 ? 20.814  30.975  -2.704  1.00 50.00  ? 352  SER A C   1 
ATOM   2685 O O   . SER A 1 352 ? 21.058  29.805  -2.977  1.00 54.55  ? 352  SER A O   1 
ATOM   2686 C CB  . SER A 1 352 ? 21.843  30.459  -0.488  1.00 38.33  ? 352  SER A CB  1 
ATOM   2687 O OG  . SER A 1 352 ? 22.461  31.006  0.670   1.00 35.85  ? 352  SER A OG  1 
ATOM   2688 N N   . LEU A 1 353 ? 20.128  31.766  -3.520  1.00 37.88  ? 353  LEU A N   1 
ATOM   2689 C CA  . LEU A 1 353 ? 19.778  31.307  -4.857  1.00 42.56  ? 353  LEU A CA  1 
ATOM   2690 C C   . LEU A 1 353 ? 21.010  31.262  -5.777  1.00 51.47  ? 353  LEU A C   1 
ATOM   2691 O O   . LEU A 1 353 ? 21.520  32.302  -6.188  1.00 65.27  ? 353  LEU A O   1 
ATOM   2692 C CB  . LEU A 1 353 ? 18.695  32.199  -5.462  1.00 41.52  ? 353  LEU A CB  1 
ATOM   2693 C CG  . LEU A 1 353 ? 17.398  32.317  -4.661  1.00 42.68  ? 353  LEU A CG  1 
ATOM   2694 C CD1 . LEU A 1 353 ? 16.297  32.839  -5.542  1.00 35.98  ? 353  LEU A CD1 1 
ATOM   2695 C CD2 . LEU A 1 353 ? 17.008  30.980  -4.069  1.00 44.22  ? 353  LEU A CD2 1 
ATOM   2696 N N   . ILE A 1 354 ? 21.476  30.058  -6.107  1.00 54.92  ? 354  ILE A N   1 
ATOM   2697 C CA  . ILE A 1 354 ? 22.672  29.881  -6.940  1.00 46.15  ? 354  ILE A CA  1 
ATOM   2698 C C   . ILE A 1 354 ? 22.390  29.691  -8.439  1.00 49.42  ? 354  ILE A C   1 
ATOM   2699 O O   . ILE A 1 354 ? 21.263  29.427  -8.855  1.00 50.91  ? 354  ILE A O   1 
ATOM   2700 C CB  . ILE A 1 354 ? 23.512  28.676  -6.467  1.00 31.76  ? 354  ILE A CB  1 
ATOM   2701 C CG1 . ILE A 1 354 ? 22.723  27.386  -6.637  1.00 30.90  ? 354  ILE A CG1 1 
ATOM   2702 C CG2 . ILE A 1 354 ? 23.941  28.860  -5.029  1.00 32.75  ? 354  ILE A CG2 1 
ATOM   2703 C CD1 . ILE A 1 354 ? 23.496  26.152  -6.251  1.00 49.28  ? 354  ILE A CD1 1 
ATOM   2704 N N   . SER A 1 355 ? 23.437  29.822  -9.242  1.00 40.61  ? 355  SER A N   1 
ATOM   2705 C CA  . SER A 1 355 ? 23.340  29.575  -10.665 1.00 36.54  ? 355  SER A CA  1 
ATOM   2706 C C   . SER A 1 355 ? 23.713  28.131  -11.005 1.00 45.00  ? 355  SER A C   1 
ATOM   2707 O O   . SER A 1 355 ? 24.246  27.394  -10.176 1.00 54.08  ? 355  SER A O   1 
ATOM   2708 C CB  . SER A 1 355 ? 24.266  30.525  -11.409 1.00 35.89  ? 355  SER A CB  1 
ATOM   2709 O OG  . SER A 1 355 ? 25.607  30.341  -10.986 1.00 54.13  ? 355  SER A OG  1 
ATOM   2710 N N   . ARG A 1 356 ? 23.449  27.726  -12.239 1.00 40.91  ? 356  ARG A N   1 
ATOM   2711 C CA  . ARG A 1 356 ? 23.909  26.427  -12.679 1.00 45.94  ? 356  ARG A CA  1 
ATOM   2712 C C   . ARG A 1 356 ? 25.424  26.307  -12.538 1.00 55.41  ? 356  ARG A C   1 
ATOM   2713 O O   . ARG A 1 356 ? 25.942  25.290  -12.051 1.00 60.83  ? 356  ARG A O   1 
ATOM   2714 C CB  . ARG A 1 356 ? 23.491  26.154  -14.110 1.00 46.00  ? 356  ARG A CB  1 
ATOM   2715 C CG  . ARG A 1 356 ? 23.813  24.741  -14.492 1.00 57.60  ? 356  ARG A CG  1 
ATOM   2716 C CD  . ARG A 1 356 ? 22.799  24.127  -15.416 1.00 53.62  ? 356  ARG A CD  1 
ATOM   2717 N NE  . ARG A 1 356 ? 23.179  22.743  -15.666 1.00 54.48  ? 356  ARG A NE  1 
ATOM   2718 C CZ  . ARG A 1 356 ? 22.655  21.696  -15.042 1.00 55.14  ? 356  ARG A CZ  1 
ATOM   2719 N NH1 . ARG A 1 356 ? 21.702  21.860  -14.139 1.00 57.73  ? 356  ARG A NH1 1 
ATOM   2720 N NH2 . ARG A 1 356 ? 23.083  20.481  -15.332 1.00 60.88  ? 356  ARG A NH2 1 
ATOM   2721 N N   . ALA A 1 357 ? 26.132  27.349  -12.961 1.00 40.62  ? 357  ALA A N   1 
ATOM   2722 C CA  . ALA A 1 357 ? 27.580  27.383  -12.792 1.00 50.08  ? 357  ALA A CA  1 
ATOM   2723 C C   . ALA A 1 357 ? 27.929  27.103  -11.338 1.00 50.26  ? 357  ALA A C   1 
ATOM   2724 O O   . ALA A 1 357 ? 28.734  26.224  -11.040 1.00 53.72  ? 357  ALA A O   1 
ATOM   2725 C CB  . ALA A 1 357 ? 28.147  28.717  -13.227 1.00 35.81  ? 357  ALA A CB  1 
ATOM   2726 N N   . GLN A 1 358 ? 27.315  27.847  -10.428 1.00 40.97  ? 358  GLN A N   1 
ATOM   2727 C CA  . GLN A 1 358 ? 27.621  27.662  -9.026  1.00 39.45  ? 358  GLN A CA  1 
ATOM   2728 C C   . GLN A 1 358 ? 27.281  26.242  -8.554  1.00 33.23  ? 358  GLN A C   1 
ATOM   2729 O O   . GLN A 1 358 ? 27.936  25.695  -7.682  1.00 41.35  ? 358  GLN A O   1 
ATOM   2730 C CB  . GLN A 1 358 ? 26.926  28.727  -8.182  1.00 36.93  ? 358  GLN A CB  1 
ATOM   2731 C CG  . GLN A 1 358 ? 27.542  30.108  -8.309  1.00 34.27  ? 358  GLN A CG  1 
ATOM   2732 C CD  . GLN A 1 358 ? 26.701  31.181  -7.640  1.00 50.82  ? 358  GLN A CD  1 
ATOM   2733 O OE1 . GLN A 1 358 ? 25.468  31.104  -7.614  1.00 58.19  ? 358  GLN A OE1 1 
ATOM   2734 N NE2 . GLN A 1 358 ? 27.361  32.181  -7.087  1.00 53.39  ? 358  GLN A NE2 1 
ATOM   2735 N N   . PHE A 1 359 ? 26.272  25.636  -9.151  1.00 33.14  ? 359  PHE A N   1 
ATOM   2736 C CA  . PHE A 1 359 ? 25.892  24.280  -8.771  1.00 43.43  ? 359  PHE A CA  1 
ATOM   2737 C C   . PHE A 1 359 ? 26.946  23.225  -9.201  1.00 46.33  ? 359  PHE A C   1 
ATOM   2738 O O   . PHE A 1 359 ? 27.363  22.361  -8.417  1.00 37.57  ? 359  PHE A O   1 
ATOM   2739 C CB  . PHE A 1 359 ? 24.510  23.988  -9.337  1.00 33.96  ? 359  PHE A CB  1 
ATOM   2740 C CG  . PHE A 1 359 ? 24.080  22.577  -9.192  1.00 45.05  ? 359  PHE A CG  1 
ATOM   2741 C CD1 . PHE A 1 359 ? 23.753  22.066  -7.961  1.00 50.98  ? 359  PHE A CD1 1 
ATOM   2742 C CD2 . PHE A 1 359 ? 23.984  21.752  -10.300 1.00 56.63  ? 359  PHE A CD2 1 
ATOM   2743 C CE1 . PHE A 1 359 ? 23.344  20.757  -7.837  1.00 39.07  ? 359  PHE A CE1 1 
ATOM   2744 C CE2 . PHE A 1 359 ? 23.576  20.439  -10.176 1.00 48.85  ? 359  PHE A CE2 1 
ATOM   2745 C CZ  . PHE A 1 359 ? 23.253  19.948  -8.944  1.00 44.03  ? 359  PHE A CZ  1 
ATOM   2746 N N   . LEU A 1 360 ? 27.400  23.318  -10.440 1.00 36.86  ? 360  LEU A N   1 
ATOM   2747 C CA  . LEU A 1 360 ? 28.443  22.427  -10.923 1.00 38.17  ? 360  LEU A CA  1 
ATOM   2748 C C   . LEU A 1 360 ? 29.741  22.571  -10.118 1.00 44.79  ? 360  LEU A C   1 
ATOM   2749 O O   . LEU A 1 360 ? 30.422  21.590  -9.824  1.00 54.40  ? 360  LEU A O   1 
ATOM   2750 C CB  . LEU A 1 360 ? 28.712  22.718  -12.400 1.00 37.82  ? 360  LEU A CB  1 
ATOM   2751 C CG  . LEU A 1 360 ? 27.446  22.751  -13.260 1.00 50.27  ? 360  LEU A CG  1 
ATOM   2752 C CD1 . LEU A 1 360 ? 27.814  22.862  -14.720 1.00 41.45  ? 360  LEU A CD1 1 
ATOM   2753 C CD2 . LEU A 1 360 ? 26.568  21.520  -13.014 1.00 45.87  ? 360  LEU A CD2 1 
ATOM   2754 N N   . ALA A 1 361 ? 30.089  23.808  -9.794  1.00 39.50  ? 361  ALA A N   1 
ATOM   2755 C CA  . ALA A 1 361 ? 31.248  24.094  -8.968  1.00 41.77  ? 361  ALA A CA  1 
ATOM   2756 C C   . ALA A 1 361 ? 31.041  23.498  -7.581  1.00 46.78  ? 361  ALA A C   1 
ATOM   2757 O O   . ALA A 1 361 ? 31.945  22.889  -7.002  1.00 50.05  ? 361  ALA A O   1 
ATOM   2758 C CB  . ALA A 1 361 ? 31.464  25.594  -8.877  1.00 31.36  ? 361  ALA A CB  1 
ATOM   2759 N N   . GLY A 1 362 ? 29.834  23.673  -7.057  1.00 45.91  ? 362  GLY A N   1 
ATOM   2760 C CA  . GLY A 1 362 ? 29.485  23.126  -5.766  1.00 49.24  ? 362  GLY A CA  1 
ATOM   2761 C C   . GLY A 1 362 ? 29.522  21.607  -5.708  1.00 44.11  ? 362  GLY A C   1 
ATOM   2762 O O   . GLY A 1 362 ? 29.887  21.041  -4.691  1.00 40.66  ? 362  GLY A O   1 
ATOM   2763 N N   . VAL A 1 363 ? 29.141  20.933  -6.785  1.00 42.45  ? 363  VAL A N   1 
ATOM   2764 C CA  . VAL A 1 363 ? 29.117  19.474  -6.747  1.00 33.44  ? 363  VAL A CA  1 
ATOM   2765 C C   . VAL A 1 363 ? 30.522  18.901  -6.608  1.00 46.25  ? 363  VAL A C   1 
ATOM   2766 O O   . VAL A 1 363 ? 30.709  17.905  -5.909  1.00 43.16  ? 363  VAL A O   1 
ATOM   2767 C CB  . VAL A 1 363 ? 28.416  18.883  -7.981  1.00 38.90  ? 363  VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 363 ? 28.772  17.417  -8.163  1.00 33.17  ? 363  VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 363 ? 26.903  19.065  -7.875  1.00 37.83  ? 363  VAL A CG2 1 
ATOM   2770 N N   . ARG A 1 364 ? 31.506  19.531  -7.259  1.00 35.87  ? 364  ARG A N   1 
ATOM   2771 C CA  . ARG A 1 364 ? 32.899  19.110  -7.116  1.00 40.15  ? 364  ARG A CA  1 
ATOM   2772 C C   . ARG A 1 364 ? 33.362  19.231  -5.669  1.00 49.45  ? 364  ARG A C   1 
ATOM   2773 O O   . ARG A 1 364 ? 34.073  18.369  -5.148  1.00 51.62  ? 364  ARG A O   1 
ATOM   2774 C CB  . ARG A 1 364 ? 33.839  19.925  -8.000  1.00 34.98  ? 364  ARG A CB  1 
ATOM   2775 C CG  . ARG A 1 364 ? 33.495  19.927  -9.489  1.00 47.22  ? 364  ARG A CG  1 
ATOM   2776 C CD  . ARG A 1 364 ? 33.209  18.541  -10.071 1.00 55.79  ? 364  ARG A CD  1 
ATOM   2777 N NE  . ARG A 1 364 ? 34.235  17.543  -9.766  1.00 71.32  ? 364  ARG A NE  1 
ATOM   2778 C CZ  . ARG A 1 364 ? 35.158  17.105  -10.624 1.00 73.67  ? 364  ARG A CZ  1 
ATOM   2779 N NH1 . ARG A 1 364 ? 35.218  17.578  -11.862 1.00 65.24  ? 364  ARG A NH1 1 
ATOM   2780 N NH2 . ARG A 1 364 ? 36.035  16.191  -10.234 1.00 77.33  ? 364  ARG A NH2 1 
ATOM   2781 N N   . ILE A 1 365 ? 32.961  20.312  -5.023  1.00 52.86  ? 365  ILE A N   1 
ATOM   2782 C CA  . ILE A 1 365 ? 33.361  20.546  -3.646  1.00 54.99  ? 365  ILE A CA  1 
ATOM   2783 C C   . ILE A 1 365 ? 32.663  19.556  -2.721  1.00 49.67  ? 365  ILE A C   1 
ATOM   2784 O O   . ILE A 1 365 ? 33.302  18.922  -1.884  1.00 45.94  ? 365  ILE A O   1 
ATOM   2785 C CB  . ILE A 1 365 ? 33.056  21.993  -3.217  1.00 45.42  ? 365  ILE A CB  1 
ATOM   2786 C CG1 . ILE A 1 365 ? 33.785  22.964  -4.128  1.00 47.70  ? 365  ILE A CG1 1 
ATOM   2787 C CG2 . ILE A 1 365 ? 33.461  22.248  -1.779  1.00 37.69  ? 365  ILE A CG2 1 
ATOM   2788 C CD1 . ILE A 1 365 ? 33.488  24.404  -3.813  1.00 52.58  ? 365  ILE A CD1 1 
ATOM   2789 N N   . GLY A 1 366 ? 31.353  19.424  -2.890  1.00 49.94  ? 366  GLY A N   1 
ATOM   2790 C CA  . GLY A 1 366 ? 30.546  18.544  -2.064  1.00 53.37  ? 366  GLY A CA  1 
ATOM   2791 C C   . GLY A 1 366 ? 30.803  17.063  -2.275  1.00 48.30  ? 366  GLY A C   1 
ATOM   2792 O O   . GLY A 1 366 ? 30.428  16.241  -1.446  1.00 60.27  ? 366  GLY A O   1 
ATOM   2793 N N   . VAL A 1 367 ? 31.438  16.717  -3.387  1.00 35.39  ? 367  VAL A N   1 
ATOM   2794 C CA  . VAL A 1 367 ? 31.762  15.327  -3.677  1.00 33.48  ? 367  VAL A CA  1 
ATOM   2795 C C   . VAL A 1 367 ? 33.226  15.287  -4.048  1.00 36.12  ? 367  VAL A C   1 
ATOM   2796 O O   . VAL A 1 367 ? 33.579  14.978  -5.178  1.00 43.12  ? 367  VAL A O   1 
ATOM   2797 C CB  . VAL A 1 367 ? 30.937  14.771  -4.866  1.00 34.40  ? 367  VAL A CB  1 
ATOM   2798 C CG1 . VAL A 1 367 ? 31.137  13.276  -4.986  1.00 48.58  ? 367  VAL A CG1 1 
ATOM   2799 C CG2 . VAL A 1 367 ? 29.451  15.086  -4.716  1.00 26.53  ? 367  VAL A CG2 1 
ATOM   2800 N N   . PRO A 1 368 ? 34.096  15.628  -3.097  1.00 34.35  ? 368  PRO A N   1 
ATOM   2801 C CA  . PRO A 1 368 ? 35.497  15.885  -3.447  1.00 32.95  ? 368  PRO A CA  1 
ATOM   2802 C C   . PRO A 1 368 ? 36.212  14.705  -4.088  1.00 45.86  ? 368  PRO A C   1 
ATOM   2803 O O   . PRO A 1 368 ? 37.112  14.930  -4.877  1.00 61.25  ? 368  PRO A O   1 
ATOM   2804 C CB  . PRO A 1 368 ? 36.136  16.246  -2.109  1.00 32.89  ? 368  PRO A CB  1 
ATOM   2805 C CG  . PRO A 1 368 ? 35.164  15.806  -1.054  1.00 30.29  ? 368  PRO A CG  1 
ATOM   2806 C CD  . PRO A 1 368 ? 33.815  15.880  -1.677  1.00 33.30  ? 368  PRO A CD  1 
ATOM   2807 N N   . GLN A 1 369 ? 35.794  13.480  -3.791  1.00 59.39  ? 369  GLN A N   1 
ATOM   2808 C CA  A GLN A 1 369 ? 36.495  12.303  -4.298  0.52 56.16  ? 369  GLN A CA  1 
ATOM   2809 C CA  B GLN A 1 369 ? 36.474  12.286  -4.280  0.48 55.98  ? 369  GLN A CA  1 
ATOM   2810 C C   . GLN A 1 369 ? 35.951  11.795  -5.626  1.00 61.69  ? 369  GLN A C   1 
ATOM   2811 O O   . GLN A 1 369 ? 36.359  10.738  -6.104  1.00 76.46  ? 369  GLN A O   1 
ATOM   2812 C CB  A GLN A 1 369 ? 36.473  11.173  -3.266  0.52 51.84  ? 369  GLN A CB  1 
ATOM   2813 C CB  B GLN A 1 369 ? 36.336  11.158  -3.259  0.48 54.36  ? 369  GLN A CB  1 
ATOM   2814 C CG  A GLN A 1 369 ? 37.496  11.325  -2.145  0.52 42.65  ? 369  GLN A CG  1 
ATOM   2815 C CG  B GLN A 1 369 ? 35.045  10.357  -3.384  0.48 56.53  ? 369  GLN A CG  1 
ATOM   2816 C CD  A GLN A 1 369 ? 37.056  12.304  -1.081  0.52 46.12  ? 369  GLN A CD  1 
ATOM   2817 C CD  B GLN A 1 369 ? 33.847  11.039  -2.749  0.48 52.45  ? 369  GLN A CD  1 
ATOM   2818 O OE1 A GLN A 1 369 ? 36.102  12.040  -0.341  0.52 28.65  ? 369  GLN A OE1 1 
ATOM   2819 O OE1 B GLN A 1 369 ? 33.853  12.246  -2.494  0.48 45.29  ? 369  GLN A OE1 1 
ATOM   2820 N NE2 A GLN A 1 369 ? 37.753  13.440  -0.990  0.52 30.03  ? 369  GLN A NE2 1 
ATOM   2821 N NE2 B GLN A 1 369 ? 32.810  10.259  -2.485  0.48 46.09  ? 369  GLN A NE2 1 
ATOM   2822 N N   . ALA A 1 370 ? 35.039  12.548  -6.232  1.00 58.62  ? 370  ALA A N   1 
ATOM   2823 C CA  . ALA A 1 370 ? 34.451  12.122  -7.504  1.00 51.74  ? 370  ALA A CA  1 
ATOM   2824 C C   . ALA A 1 370 ? 35.252  12.539  -8.729  1.00 59.33  ? 370  ALA A C   1 
ATOM   2825 O O   . ALA A 1 370 ? 35.647  13.708  -8.865  1.00 49.52  ? 370  ALA A O   1 
ATOM   2826 C CB  . ALA A 1 370 ? 33.026  12.622  -7.633  1.00 54.15  ? 370  ALA A CB  1 
ATOM   2827 N N   . SER A 1 371 ? 35.484  11.570  -9.616  1.00 55.75  ? 371  SER A N   1 
ATOM   2828 C CA  . SER A 1 371 ? 36.072  11.851  -10.915 1.00 42.63  ? 371  SER A CA  1 
ATOM   2829 C C   . SER A 1 371 ? 35.167  12.805  -11.689 1.00 56.58  ? 371  SER A C   1 
ATOM   2830 O O   . SER A 1 371 ? 34.032  13.080  -11.284 1.00 55.24  ? 371  SER A O   1 
ATOM   2831 C CB  . SER A 1 371 ? 36.264  10.568  -11.719 1.00 55.17  ? 371  SER A CB  1 
ATOM   2832 O OG  . SER A 1 371 ? 35.032  10.041  -12.199 1.00 61.21  ? 371  SER A OG  1 
ATOM   2833 N N   . ASP A 1 372 ? 35.668  13.302  -12.810 1.00 57.50  ? 372  ASP A N   1 
ATOM   2834 C CA  . ASP A 1 372 ? 34.910  14.242  -13.609 1.00 62.29  ? 372  ASP A CA  1 
ATOM   2835 C C   . ASP A 1 372 ? 33.612  13.597  -14.077 1.00 72.38  ? 372  ASP A C   1 
ATOM   2836 O O   . ASP A 1 372 ? 32.557  14.255  -14.149 1.00 64.78  ? 372  ASP A O   1 
ATOM   2837 C CB  . ASP A 1 372 ? 35.743  14.700  -14.800 1.00 58.31  ? 372  ASP A CB  1 
ATOM   2838 C CG  . ASP A 1 372 ? 36.637  15.865  -14.463 1.00 75.85  ? 372  ASP A CG  1 
ATOM   2839 O OD1 . ASP A 1 372 ? 37.136  15.923  -13.321 1.00 82.52  ? 372  ASP A OD1 1 
ATOM   2840 O OD2 . ASP A 1 372 ? 36.834  16.732  -15.337 1.00 87.94  ? 372  ASP A OD2 1 
ATOM   2841 N N   . LEU A 1 373 ? 33.709  12.303  -14.387 1.00 68.53  ? 373  LEU A N   1 
ATOM   2842 C CA  . LEU A 1 373 ? 32.592  11.535  -14.920 1.00 54.01  ? 373  LEU A CA  1 
ATOM   2843 C C   . LEU A 1 373 ? 31.575  11.240  -13.829 1.00 53.46  ? 373  LEU A C   1 
ATOM   2844 O O   . LEU A 1 373 ? 30.370  11.305  -14.048 1.00 64.05  ? 373  LEU A O   1 
ATOM   2845 C CB  . LEU A 1 373 ? 33.086  10.230  -15.555 1.00 46.87  ? 373  LEU A CB  1 
ATOM   2846 C CG  . LEU A 1 373 ? 31.998  9.347   -16.181 1.00 54.32  ? 373  LEU A CG  1 
ATOM   2847 C CD1 . LEU A 1 373 ? 31.186  10.124  -17.209 1.00 53.53  ? 373  LEU A CD1 1 
ATOM   2848 C CD2 . LEU A 1 373 ? 32.574  8.112   -16.823 1.00 54.49  ? 373  LEU A CD2 1 
ATOM   2849 N N   . ALA A 1 374 ? 32.060  10.910  -12.645 1.00 44.22  ? 374  ALA A N   1 
ATOM   2850 C CA  . ALA A 1 374 ? 31.157  10.646  -11.546 1.00 39.33  ? 374  ALA A CA  1 
ATOM   2851 C C   . ALA A 1 374 ? 30.389  11.924  -11.202 1.00 54.37  ? 374  ALA A C   1 
ATOM   2852 O O   . ALA A 1 374 ? 29.210  11.859  -10.823 1.00 50.62  ? 374  ALA A O   1 
ATOM   2853 C CB  . ALA A 1 374 ? 31.929  10.124  -10.346 1.00 38.86  ? 374  ALA A CB  1 
ATOM   2854 N N   . ALA A 1 375 ? 31.048  13.078  -11.356 1.00 46.43  ? 375  ALA A N   1 
ATOM   2855 C CA  . ALA A 1 375 ? 30.428  14.360  -11.016 1.00 47.76  ? 375  ALA A CA  1 
ATOM   2856 C C   . ALA A 1 375 ? 29.385  14.722  -12.045 1.00 57.16  ? 375  ALA A C   1 
ATOM   2857 O O   . ALA A 1 375 ? 28.314  15.221  -11.706 1.00 65.77  ? 375  ALA A O   1 
ATOM   2858 C CB  . ALA A 1 375 ? 31.456  15.477  -10.890 1.00 41.21  ? 375  ALA A CB  1 
ATOM   2859 N N   . GLU A 1 376 ? 29.686  14.466  -13.308 1.00 61.31  ? 376  GLU A N   1 
ATOM   2860 C CA  . GLU A 1 376 ? 28.665  14.644  -14.330 1.00 73.41  ? 376  GLU A CA  1 
ATOM   2861 C C   . GLU A 1 376 ? 27.439  13.848  -13.923 1.00 56.84  ? 376  GLU A C   1 
ATOM   2862 O O   . GLU A 1 376 ? 26.345  14.401  -13.853 1.00 56.75  ? 376  GLU A O   1 
ATOM   2863 C CB  . GLU A 1 376 ? 29.153  14.218  -15.720 1.00 92.50  ? 376  GLU A CB  1 
ATOM   2864 C CG  . GLU A 1 376 ? 30.165  15.166  -16.340 1.00 111.15 ? 376  GLU A CG  1 
ATOM   2865 C CD  . GLU A 1 376 ? 29.737  16.623  -16.249 1.00 125.55 ? 376  GLU A CD  1 
ATOM   2866 O OE1 . GLU A 1 376 ? 29.622  17.151  -15.118 1.00 125.60 ? 376  GLU A OE1 1 
ATOM   2867 O OE2 . GLU A 1 376 ? 29.520  17.241  -17.313 1.00 133.06 ? 376  GLU A OE2 1 
ATOM   2868 N N   . ALA A 1 377 ? 27.638  12.564  -13.623 1.00 40.74  ? 377  ALA A N   1 
ATOM   2869 C CA  . ALA A 1 377 ? 26.541  11.682  -13.233 1.00 44.07  ? 377  ALA A CA  1 
ATOM   2870 C C   . ALA A 1 377 ? 25.703  12.275  -12.105 1.00 44.31  ? 377  ALA A C   1 
ATOM   2871 O O   . ALA A 1 377 ? 24.478  12.304  -12.186 1.00 50.80  ? 377  ALA A O   1 
ATOM   2872 C CB  . ALA A 1 377 ? 27.062  10.304  -12.853 1.00 43.59  ? 377  ALA A CB  1 
ATOM   2873 N N   . VAL A 1 378 ? 26.370  12.754  -11.064 1.00 40.06  ? 378  VAL A N   1 
ATOM   2874 C CA  . VAL A 1 378 ? 25.702  13.406  -9.947  1.00 41.52  ? 378  VAL A CA  1 
ATOM   2875 C C   . VAL A 1 378 ? 24.856  14.598  -10.424 1.00 50.56  ? 378  VAL A C   1 
ATOM   2876 O O   . VAL A 1 378 ? 23.666  14.696  -10.118 1.00 46.85  ? 378  VAL A O   1 
ATOM   2877 C CB  . VAL A 1 378 ? 26.745  13.878  -8.907  1.00 40.34  ? 378  VAL A CB  1 
ATOM   2878 C CG1 . VAL A 1 378 ? 26.154  14.891  -7.954  1.00 38.03  ? 378  VAL A CG1 1 
ATOM   2879 C CG2 . VAL A 1 378 ? 27.318  12.693  -8.153  1.00 39.48  ? 378  VAL A CG2 1 
ATOM   2880 N N   . VAL A 1 379 ? 25.486  15.497  -11.178 1.00 47.08  ? 379  VAL A N   1 
ATOM   2881 C CA  . VAL A 1 379 ? 24.828  16.679  -11.726 1.00 41.18  ? 379  VAL A CA  1 
ATOM   2882 C C   . VAL A 1 379 ? 23.651  16.350  -12.663 1.00 48.86  ? 379  VAL A C   1 
ATOM   2883 O O   . VAL A 1 379 ? 22.664  17.080  -12.716 1.00 47.36  ? 379  VAL A O   1 
ATOM   2884 C CB  . VAL A 1 379 ? 25.824  17.528  -12.525 1.00 36.76  ? 379  VAL A CB  1 
ATOM   2885 C CG1 . VAL A 1 379 ? 25.079  18.510  -13.406 1.00 32.33  ? 379  VAL A CG1 1 
ATOM   2886 C CG2 . VAL A 1 379 ? 26.790  18.237  -11.595 1.00 34.92  ? 379  VAL A CG2 1 
ATOM   2887 N N   . LEU A 1 380 ? 23.746  15.263  -13.417 1.00 46.53  ? 380  LEU A N   1 
ATOM   2888 C CA  . LEU A 1 380 ? 22.650  14.917  -14.312 1.00 52.07  ? 380  LEU A CA  1 
ATOM   2889 C C   . LEU A 1 380 ? 21.488  14.303  -13.525 1.00 50.39  ? 380  LEU A C   1 
ATOM   2890 O O   . LEU A 1 380 ? 20.312  14.481  -13.874 1.00 46.70  ? 380  LEU A O   1 
ATOM   2891 C CB  . LEU A 1 380 ? 23.118  14.021  -15.469 1.00 70.86  ? 380  LEU A CB  1 
ATOM   2892 C CG  . LEU A 1 380 ? 24.429  14.466  -16.150 1.00 91.51  ? 380  LEU A CG  1 
ATOM   2893 C CD1 . LEU A 1 380 ? 24.727  13.619  -17.379 1.00 108.05 ? 380  LEU A CD1 1 
ATOM   2894 C CD2 . LEU A 1 380 ? 24.471  15.959  -16.508 1.00 87.52  ? 380  LEU A CD2 1 
ATOM   2895 N N   . HIS A 1 381 ? 21.808  13.625  -12.432 1.00 47.59  ? 381  HIS A N   1 
ATOM   2896 C CA  . HIS A 1 381 ? 20.763  13.062  -11.587 1.00 49.42  ? 381  HIS A CA  1 
ATOM   2897 C C   . HIS A 1 381 ? 19.981  14.134  -10.814 1.00 52.04  ? 381  HIS A C   1 
ATOM   2898 O O   . HIS A 1 381 ? 18.762  14.125  -10.785 1.00 44.39  ? 381  HIS A O   1 
ATOM   2899 C CB  . HIS A 1 381 ? 21.351  12.051  -10.614 1.00 49.80  ? 381  HIS A CB  1 
ATOM   2900 C CG  . HIS A 1 381 ? 20.320  11.304  -9.835  1.00 59.29  ? 381  HIS A CG  1 
ATOM   2901 N ND1 . HIS A 1 381 ? 19.766  10.123  -10.280 1.00 69.67  ? 381  HIS A ND1 1 
ATOM   2902 C CD2 . HIS A 1 381 ? 19.731  11.576  -8.648  1.00 58.41  ? 381  HIS A CD2 1 
ATOM   2903 C CE1 . HIS A 1 381 ? 18.891  9.690   -9.389  1.00 71.85  ? 381  HIS A CE1 1 
ATOM   2904 N NE2 . HIS A 1 381 ? 18.852  10.552  -8.389  1.00 66.04  ? 381  HIS A NE2 1 
ATOM   2905 N N   . TYR A 1 382 ? 20.687  15.066  -10.193 1.00 54.37  ? 382  TYR A N   1 
ATOM   2906 C CA  . TYR A 1 382 ? 20.025  16.039  -9.344  1.00 42.64  ? 382  TYR A CA  1 
ATOM   2907 C C   . TYR A 1 382 ? 19.498  17.227  -10.136 1.00 55.38  ? 382  TYR A C   1 
ATOM   2908 O O   . TYR A 1 382 ? 18.787  18.070  -9.586  1.00 61.77  ? 382  TYR A O   1 
ATOM   2909 C CB  . TYR A 1 382 ? 20.964  16.507  -8.230  1.00 46.18  ? 382  TYR A CB  1 
ATOM   2910 C CG  . TYR A 1 382 ? 21.129  15.497  -7.114  1.00 45.92  ? 382  TYR A CG  1 
ATOM   2911 C CD1 . TYR A 1 382 ? 22.076  14.485  -7.198  1.00 39.48  ? 382  TYR A CD1 1 
ATOM   2912 C CD2 . TYR A 1 382 ? 20.337  15.563  -5.977  1.00 47.45  ? 382  TYR A CD2 1 
ATOM   2913 C CE1 . TYR A 1 382 ? 22.214  13.566  -6.190  1.00 46.71  ? 382  TYR A CE1 1 
ATOM   2914 C CE2 . TYR A 1 382 ? 20.470  14.655  -4.968  1.00 47.96  ? 382  TYR A CE2 1 
ATOM   2915 C CZ  . TYR A 1 382 ? 21.406  13.655  -5.073  1.00 52.90  ? 382  TYR A CZ  1 
ATOM   2916 O OH  . TYR A 1 382 ? 21.530  12.742  -4.049  1.00 53.17  ? 382  TYR A OH  1 
ATOM   2917 N N   . THR A 1 383 ? 19.838  17.305  -11.422 1.00 50.47  ? 383  THR A N   1 
ATOM   2918 C CA  . THR A 1 383 ? 19.265  18.358  -12.263 1.00 40.02  ? 383  THR A CA  1 
ATOM   2919 C C   . THR A 1 383 ? 17.803  18.050  -12.606 1.00 42.02  ? 383  THR A C   1 
ATOM   2920 O O   . THR A 1 383 ? 17.452  16.914  -12.900 1.00 56.77  ? 383  THR A O   1 
ATOM   2921 C CB  . THR A 1 383 ? 20.103  18.612  -13.543 1.00 39.36  ? 383  THR A CB  1 
ATOM   2922 O OG1 . THR A 1 383 ? 21.289  19.321  -13.194 1.00 45.79  ? 383  THR A OG1 1 
ATOM   2923 C CG2 . THR A 1 383 ? 19.344  19.453  -14.557 1.00 33.94  ? 383  THR A CG2 1 
ATOM   2924 N N   . ASP A 1 384 ? 16.951  19.064  -12.527 1.00 43.12  ? 384  ASP A N   1 
ATOM   2925 C CA  . ASP A 1 384 ? 15.587  18.966  -13.014 1.00 47.22  ? 384  ASP A CA  1 
ATOM   2926 C C   . ASP A 1 384 ? 15.597  19.478  -14.457 1.00 59.13  ? 384  ASP A C   1 
ATOM   2927 O O   . ASP A 1 384 ? 15.828  20.666  -14.699 1.00 61.74  ? 384  ASP A O   1 
ATOM   2928 C CB  . ASP A 1 384 ? 14.650  19.799  -12.135 1.00 53.62  ? 384  ASP A CB  1 
ATOM   2929 C CG  . ASP A 1 384 ? 13.252  19.928  -12.719 1.00 67.29  ? 384  ASP A CG  1 
ATOM   2930 O OD1 . ASP A 1 384 ? 12.943  19.244  -13.719 1.00 68.43  ? 384  ASP A OD1 1 
ATOM   2931 O OD2 . ASP A 1 384 ? 12.460  20.723  -12.175 1.00 73.54  ? 384  ASP A OD2 1 
ATOM   2932 N N   . TRP A 1 385 ? 15.363  18.581  -15.413 1.00 51.76  ? 385  TRP A N   1 
ATOM   2933 C CA  . TRP A 1 385 ? 15.583  18.919  -16.815 1.00 51.23  ? 385  TRP A CA  1 
ATOM   2934 C C   . TRP A 1 385 ? 14.455  19.719  -17.441 1.00 56.06  ? 385  TRP A C   1 
ATOM   2935 O O   . TRP A 1 385 ? 14.578  20.195  -18.569 1.00 64.49  ? 385  TRP A O   1 
ATOM   2936 C CB  . TRP A 1 385 ? 15.980  17.686  -17.627 1.00 46.41  ? 385  TRP A CB  1 
ATOM   2937 C CG  . TRP A 1 385 ? 17.293  17.192  -17.156 1.00 44.44  ? 385  TRP A CG  1 
ATOM   2938 C CD1 . TRP A 1 385 ? 17.521  16.166  -16.292 1.00 44.00  ? 385  TRP A CD1 1 
ATOM   2939 C CD2 . TRP A 1 385 ? 18.572  17.758  -17.453 1.00 50.64  ? 385  TRP A CD2 1 
ATOM   2940 N NE1 . TRP A 1 385 ? 18.873  16.027  -16.059 1.00 37.51  ? 385  TRP A NE1 1 
ATOM   2941 C CE2 . TRP A 1 385 ? 19.540  16.995  -16.759 1.00 45.55  ? 385  TRP A CE2 1 
ATOM   2942 C CE3 . TRP A 1 385 ? 18.997  18.831  -18.243 1.00 49.44  ? 385  TRP A CE3 1 
ATOM   2943 C CZ2 . TRP A 1 385 ? 20.908  17.275  -16.831 1.00 45.00  ? 385  TRP A CZ2 1 
ATOM   2944 C CZ3 . TRP A 1 385 ? 20.361  19.110  -18.323 1.00 43.80  ? 385  TRP A CZ3 1 
ATOM   2945 C CH2 . TRP A 1 385 ? 21.301  18.331  -17.619 1.00 49.49  ? 385  TRP A CH2 1 
ATOM   2946 N N   . LEU A 1 386 ? 13.379  19.894  -16.682 1.00 52.72  ? 386  LEU A N   1 
ATOM   2947 C CA  . LEU A 1 386 ? 12.367  20.902  -16.989 1.00 57.79  ? 386  LEU A CA  1 
ATOM   2948 C C   . LEU A 1 386 ? 12.825  22.312  -16.616 1.00 60.09  ? 386  LEU A C   1 
ATOM   2949 O O   . LEU A 1 386 ? 12.505  23.281  -17.305 1.00 70.48  ? 386  LEU A O   1 
ATOM   2950 C CB  . LEU A 1 386 ? 11.089  20.606  -16.225 1.00 61.11  ? 386  LEU A CB  1 
ATOM   2951 C CG  . LEU A 1 386 ? 9.957   20.071  -17.074 1.00 65.48  ? 386  LEU A CG  1 
ATOM   2952 C CD1 . LEU A 1 386 ? 8.692   20.170  -16.262 1.00 67.33  ? 386  LEU A CD1 1 
ATOM   2953 C CD2 . LEU A 1 386 ? 9.876   20.880  -18.362 1.00 70.97  ? 386  LEU A CD2 1 
ATOM   2954 N N   . HIS A 1 387 ? 13.544  22.419  -15.500 1.00 61.63  ? 387  HIS A N   1 
ATOM   2955 C CA  . HIS A 1 387 ? 14.056  23.698  -15.010 1.00 55.05  ? 387  HIS A CA  1 
ATOM   2956 C C   . HIS A 1 387 ? 15.489  23.518  -14.545 1.00 46.62  ? 387  HIS A C   1 
ATOM   2957 O O   . HIS A 1 387 ? 15.776  23.577  -13.356 1.00 55.23  ? 387  HIS A O   1 
ATOM   2958 C CB  . HIS A 1 387 ? 13.195  24.242  -13.865 1.00 47.19  ? 387  HIS A CB  1 
ATOM   2959 C CG  . HIS A 1 387 ? 11.736  24.325  -14.196 1.00 59.21  ? 387  HIS A CG  1 
ATOM   2960 N ND1 . HIS A 1 387 ? 10.799  23.467  -13.658 1.00 55.30  ? 387  HIS A ND1 1 
ATOM   2961 C CD2 . HIS A 1 387 ? 11.055  25.150  -15.028 1.00 70.06  ? 387  HIS A CD2 1 
ATOM   2962 C CE1 . HIS A 1 387 ? 9.602   23.767  -14.133 1.00 62.89  ? 387  HIS A CE1 1 
ATOM   2963 N NE2 . HIS A 1 387 ? 9.729   24.787  -14.965 1.00 75.38  ? 387  HIS A NE2 1 
ATOM   2964 N N   . PRO A 1 388 ? 16.398  23.285  -15.492 1.00 46.28  ? 388  PRO A N   1 
ATOM   2965 C CA  . PRO A 1 388 ? 17.799  23.061  -15.140 1.00 43.67  ? 388  PRO A CA  1 
ATOM   2966 C C   . PRO A 1 388 ? 18.510  24.342  -14.737 1.00 51.95  ? 388  PRO A C   1 
ATOM   2967 O O   . PRO A 1 388 ? 19.644  24.267  -14.280 1.00 61.52  ? 388  PRO A O   1 
ATOM   2968 C CB  . PRO A 1 388 ? 18.404  22.504  -16.435 1.00 39.39  ? 388  PRO A CB  1 
ATOM   2969 C CG  . PRO A 1 388 ? 17.522  23.003  -17.512 1.00 39.77  ? 388  PRO A CG  1 
ATOM   2970 C CD  . PRO A 1 388 ? 16.148  23.145  -16.939 1.00 42.16  ? 388  PRO A CD  1 
ATOM   2971 N N   . GLU A 1 389 ? 17.879  25.500  -14.903 1.00 49.01  ? 389  GLU A N   1 
ATOM   2972 C CA  . GLU A 1 389 ? 18.557  26.727  -14.488 1.00 49.23  ? 389  GLU A CA  1 
ATOM   2973 C C   . GLU A 1 389 ? 17.906  27.504  -13.349 1.00 49.02  ? 389  GLU A C   1 
ATOM   2974 O O   . GLU A 1 389 ? 18.345  28.602  -13.014 1.00 46.79  ? 389  GLU A O   1 
ATOM   2975 C CB  . GLU A 1 389 ? 18.844  27.631  -15.680 1.00 48.23  ? 389  GLU A CB  1 
ATOM   2976 C CG  . GLU A 1 389 ? 19.979  27.097  -16.526 1.00 58.87  ? 389  GLU A CG  1 
ATOM   2977 C CD  . GLU A 1 389 ? 20.515  28.105  -17.503 1.00 67.44  ? 389  GLU A CD  1 
ATOM   2978 O OE1 . GLU A 1 389 ? 19.808  28.421  -18.483 1.00 66.96  ? 389  GLU A OE1 1 
ATOM   2979 O OE2 . GLU A 1 389 ? 21.651  28.577  -17.284 1.00 80.18  ? 389  GLU A OE2 1 
ATOM   2980 N N   . ASP A 1 390 ? 16.880  26.922  -12.739 1.00 40.83  ? 390  ASP A N   1 
ATOM   2981 C CA  . ASP A 1 390 ? 16.195  27.567  -11.630 1.00 40.56  ? 390  ASP A CA  1 
ATOM   2982 C C   . ASP A 1 390 ? 17.035  27.608  -10.346 1.00 43.09  ? 390  ASP A C   1 
ATOM   2983 O O   . ASP A 1 390 ? 17.382  26.568  -9.791  1.00 47.80  ? 390  ASP A O   1 
ATOM   2984 C CB  . ASP A 1 390 ? 14.842  26.902  -11.382 1.00 44.27  ? 390  ASP A CB  1 
ATOM   2985 C CG  . ASP A 1 390 ? 14.091  27.540  -10.248 1.00 49.85  ? 390  ASP A CG  1 
ATOM   2986 O OD1 . ASP A 1 390 ? 13.446  28.586  -10.473 1.00 42.89  ? 390  ASP A OD1 1 
ATOM   2987 O OD2 . ASP A 1 390 ? 14.168  27.008  -9.125  1.00 59.69  ? 390  ASP A OD2 1 
ATOM   2988 N N   . PRO A 1 391 ? 17.337  28.828  -9.864  1.00 49.01  ? 391  PRO A N   1 
ATOM   2989 C CA  . PRO A 1 391 ? 18.225  29.118  -8.731  1.00 45.22  ? 391  PRO A CA  1 
ATOM   2990 C C   . PRO A 1 391 ? 17.747  28.507  -7.429  1.00 43.72  ? 391  PRO A C   1 
ATOM   2991 O O   . PRO A 1 391 ? 18.565  28.138  -6.597  1.00 45.21  ? 391  PRO A O   1 
ATOM   2992 C CB  . PRO A 1 391 ? 18.159  30.648  -8.623  1.00 34.36  ? 391  PRO A CB  1 
ATOM   2993 C CG  . PRO A 1 391 ? 17.727  31.110  -9.938  1.00 36.68  ? 391  PRO A CG  1 
ATOM   2994 C CD  . PRO A 1 391 ? 16.774  30.067  -10.425 1.00 42.24  ? 391  PRO A CD  1 
ATOM   2995 N N   . THR A 1 392 ? 16.434  28.430  -7.257  1.00 45.16  ? 392  THR A N   1 
ATOM   2996 C CA  . THR A 1 392 ? 15.842  27.852  -6.065  1.00 41.58  ? 392  THR A CA  1 
ATOM   2997 C C   . THR A 1 392 ? 15.954  26.328  -6.105  1.00 45.90  ? 392  THR A C   1 
ATOM   2998 O O   . THR A 1 392 ? 16.276  25.691  -5.099  1.00 45.65  ? 392  THR A O   1 
ATOM   2999 C CB  . THR A 1 392 ? 14.368  28.276  -5.913  1.00 38.58  ? 392  THR A CB  1 
ATOM   3000 O OG1 . THR A 1 392 ? 14.289  29.700  -5.906  1.00 43.25  ? 392  THR A OG1 1 
ATOM   3001 C CG2 . THR A 1 392 ? 13.812  27.797  -4.613  1.00 31.30  ? 392  THR A CG2 1 
ATOM   3002 N N   . HIS A 1 393 ? 15.697  25.732  -7.264  1.00 44.92  ? 393  HIS A N   1 
ATOM   3003 C CA  . HIS A 1 393 ? 15.854  24.290  -7.361  1.00 39.87  ? 393  HIS A CA  1 
ATOM   3004 C C   . HIS A 1 393 ? 17.306  23.913  -7.135  1.00 46.12  ? 393  HIS A C   1 
ATOM   3005 O O   . HIS A 1 393 ? 17.601  22.966  -6.403  1.00 54.36  ? 393  HIS A O   1 
ATOM   3006 C CB  . HIS A 1 393 ? 15.382  23.708  -8.698  1.00 45.91  ? 393  HIS A CB  1 
ATOM   3007 C CG  . HIS A 1 393 ? 15.702  22.249  -8.832  1.00 65.68  ? 393  HIS A CG  1 
ATOM   3008 N ND1 . HIS A 1 393 ? 16.825  21.787  -9.486  1.00 62.12  ? 393  HIS A ND1 1 
ATOM   3009 C CD2 . HIS A 1 393 ? 15.086  21.153  -8.329  1.00 71.94  ? 393  HIS A CD2 1 
ATOM   3010 C CE1 . HIS A 1 393 ? 16.871  20.470  -9.405  1.00 59.88  ? 393  HIS A CE1 1 
ATOM   3011 N NE2 . HIS A 1 393 ? 15.823  20.059  -8.710  1.00 70.27  ? 393  HIS A NE2 1 
ATOM   3012 N N   . LEU A 1 394 ? 18.208  24.664  -7.766  1.00 36.60  ? 394  LEU A N   1 
ATOM   3013 C CA  . LEU A 1 394 ? 19.639  24.384  -7.687  1.00 40.01  ? 394  LEU A CA  1 
ATOM   3014 C C   . LEU A 1 394 ? 20.163  24.522  -6.253  1.00 48.08  ? 394  LEU A C   1 
ATOM   3015 O O   . LEU A 1 394 ? 20.960  23.712  -5.764  1.00 45.31  ? 394  LEU A O   1 
ATOM   3016 C CB  . LEU A 1 394 ? 20.403  25.296  -8.664  1.00 39.92  ? 394  LEU A CB  1 
ATOM   3017 C CG  . LEU A 1 394 ? 20.054  25.008  -10.137 1.00 47.57  ? 394  LEU A CG  1 
ATOM   3018 C CD1 . LEU A 1 394 ? 20.595  26.055  -11.098 1.00 31.37  ? 394  LEU A CD1 1 
ATOM   3019 C CD2 . LEU A 1 394 ? 20.506  23.594  -10.551 1.00 43.44  ? 394  LEU A CD2 1 
ATOM   3020 N N   . ARG A 1 395 ? 19.702  25.560  -5.577  1.00 44.35  ? 395  ARG A N   1 
ATOM   3021 C CA  . ARG A 1 395 ? 20.061  25.744  -4.200  1.00 36.58  ? 395  ARG A CA  1 
ATOM   3022 C C   . ARG A 1 395 ? 19.727  24.462  -3.424  1.00 35.63  ? 395  ARG A C   1 
ATOM   3023 O O   . ARG A 1 395 ? 20.547  23.959  -2.667  1.00 39.11  ? 395  ARG A O   1 
ATOM   3024 C CB  . ARG A 1 395 ? 19.326  26.964  -3.642  1.00 30.55  ? 395  ARG A CB  1 
ATOM   3025 C CG  . ARG A 1 395 ? 19.585  27.253  -2.180  1.00 26.40  ? 395  ARG A CG  1 
ATOM   3026 C CD  . ARG A 1 395 ? 18.282  27.138  -1.439  1.00 40.65  ? 395  ARG A CD  1 
ATOM   3027 N NE  . ARG A 1 395 ? 17.636  28.431  -1.297  1.00 37.87  ? 395  ARG A NE  1 
ATOM   3028 C CZ  . ARG A 1 395 ? 16.328  28.614  -1.159  1.00 53.11  ? 395  ARG A CZ  1 
ATOM   3029 N NH1 . ARG A 1 395 ? 15.485  27.576  -1.167  1.00 28.09  ? 395  ARG A NH1 1 
ATOM   3030 N NH2 . ARG A 1 395 ? 15.869  29.857  -1.031  1.00 52.49  ? 395  ARG A NH2 1 
ATOM   3031 N N   . ASP A 1 396 ? 18.537  23.915  -3.644  1.00 35.92  ? 396  ASP A N   1 
ATOM   3032 C CA  . ASP A 1 396 ? 18.062  22.782  -2.845  1.00 39.41  ? 396  ASP A CA  1 
ATOM   3033 C C   . ASP A 1 396 ? 18.620  21.430  -3.311  1.00 49.45  ? 396  ASP A C   1 
ATOM   3034 O O   . ASP A 1 396 ? 18.670  20.464  -2.545  1.00 53.36  ? 396  ASP A O   1 
ATOM   3035 C CB  . ASP A 1 396 ? 16.521  22.761  -2.791  1.00 37.56  ? 396  ASP A CB  1 
ATOM   3036 C CG  . ASP A 1 396 ? 15.916  24.073  -2.221  1.00 61.04  ? 396  ASP A CG  1 
ATOM   3037 O OD1 . ASP A 1 396 ? 16.656  24.867  -1.580  1.00 58.14  ? 396  ASP A OD1 1 
ATOM   3038 O OD2 . ASP A 1 396 ? 14.689  24.303  -2.403  1.00 47.11  ? 396  ASP A OD2 1 
ATOM   3039 N N   . ALA A 1 397 ? 19.041  21.364  -4.569  1.00 52.76  ? 397  ALA A N   1 
ATOM   3040 C CA  . ALA A 1 397 ? 19.704  20.170  -5.075  1.00 52.02  ? 397  ALA A CA  1 
ATOM   3041 C C   . ALA A 1 397 ? 21.112  20.090  -4.502  1.00 53.79  ? 397  ALA A C   1 
ATOM   3042 O O   . ALA A 1 397 ? 21.595  19.007  -4.133  1.00 48.45  ? 397  ALA A O   1 
ATOM   3043 C CB  . ALA A 1 397 ? 19.754  20.189  -6.578  1.00 49.25  ? 397  ALA A CB  1 
ATOM   3044 N N   . MET A 1 398 ? 21.763  21.249  -4.433  1.00 52.45  ? 398  MET A N   1 
ATOM   3045 C CA  . MET A 1 398 ? 23.079  21.351  -3.826  1.00 48.00  ? 398  MET A CA  1 
ATOM   3046 C C   . MET A 1 398 ? 23.016  20.851  -2.387  1.00 49.23  ? 398  MET A C   1 
ATOM   3047 O O   . MET A 1 398 ? 23.862  20.073  -1.946  1.00 45.68  ? 398  MET A O   1 
ATOM   3048 C CB  . MET A 1 398 ? 23.559  22.786  -3.844  1.00 38.79  ? 398  MET A CB  1 
ATOM   3049 C CG  . MET A 1 398 ? 25.001  22.945  -3.422  1.00 40.17  ? 398  MET A CG  1 
ATOM   3050 S SD  . MET A 1 398 ? 26.174  22.287  -4.621  1.00 45.29  ? 398  MET A SD  1 
ATOM   3051 C CE  . MET A 1 398 ? 26.113  20.543  -4.213  1.00 41.93  ? 398  MET A CE  1 
ATOM   3052 N N   . SER A 1 399 ? 21.996  21.285  -1.661  1.00 43.58  ? 399  SER A N   1 
ATOM   3053 C CA  . SER A 1 399 ? 21.813  20.809  -0.305  1.00 42.50  ? 399  SER A CA  1 
ATOM   3054 C C   . SER A 1 399 ? 21.637  19.284  -0.278  1.00 37.55  ? 399  SER A C   1 
ATOM   3055 O O   . SER A 1 399 ? 22.094  18.629  0.650   1.00 39.46  ? 399  SER A O   1 
ATOM   3056 C CB  . SER A 1 399 ? 20.631  21.519  0.355   1.00 42.97  ? 399  SER A CB  1 
ATOM   3057 O OG  . SER A 1 399 ? 20.205  20.846  1.527   1.00 46.66  ? 399  SER A OG  1 
ATOM   3058 N N   . ALA A 1 400 ? 21.013  18.730  -1.316  1.00 32.56  ? 400  ALA A N   1 
ATOM   3059 C CA  . ALA A 1 400 ? 20.590  17.325  -1.319  1.00 31.16  ? 400  ALA A CA  1 
ATOM   3060 C C   . ALA A 1 400 ? 21.709  16.398  -1.763  1.00 44.84  ? 400  ALA A C   1 
ATOM   3061 O O   . ALA A 1 400 ? 21.819  15.271  -1.289  1.00 33.82  ? 400  ALA A O   1 
ATOM   3062 C CB  . ALA A 1 400 ? 19.346  17.137  -2.206  1.00 27.92  ? 400  ALA A CB  1 
ATOM   3063 N N   . VAL A 1 401 ? 22.539  16.870  -2.686  1.00 51.97  ? 401  VAL A N   1 
ATOM   3064 C CA  . VAL A 1 401 ? 23.791  16.182  -2.986  1.00 43.17  ? 401  VAL A CA  1 
ATOM   3065 C C   . VAL A 1 401 ? 24.555  15.942  -1.679  1.00 40.75  ? 401  VAL A C   1 
ATOM   3066 O O   . VAL A 1 401 ? 24.830  14.808  -1.299  1.00 52.49  ? 401  VAL A O   1 
ATOM   3067 C CB  . VAL A 1 401 ? 24.659  17.013  -3.965  1.00 38.33  ? 401  VAL A CB  1 
ATOM   3068 C CG1 . VAL A 1 401 ? 26.053  16.469  -4.038  1.00 38.58  ? 401  VAL A CG1 1 
ATOM   3069 C CG2 . VAL A 1 401 ? 24.025  17.053  -5.358  1.00 29.31  ? 401  VAL A CG2 1 
ATOM   3070 N N   . VAL A 1 402 ? 24.861  17.021  -0.973  1.00 37.23  ? 402  VAL A N   1 
ATOM   3071 C CA  . VAL A 1 402 ? 25.620  16.935  0.269   1.00 47.66  ? 402  VAL A CA  1 
ATOM   3072 C C   . VAL A 1 402 ? 24.960  16.051  1.340   1.00 47.26  ? 402  VAL A C   1 
ATOM   3073 O O   . VAL A 1 402 ? 25.618  15.182  1.931   1.00 42.13  ? 402  VAL A O   1 
ATOM   3074 C CB  . VAL A 1 402 ? 25.923  18.345  0.831   1.00 47.19  ? 402  VAL A CB  1 
ATOM   3075 C CG1 . VAL A 1 402 ? 26.746  18.260  2.117   1.00 39.81  ? 402  VAL A CG1 1 
ATOM   3076 C CG2 . VAL A 1 402 ? 26.647  19.177  -0.221  1.00 34.38  ? 402  VAL A CG2 1 
ATOM   3077 N N   . GLY A 1 403 ? 23.671  16.272  1.584   1.00 33.48  ? 403  GLY A N   1 
ATOM   3078 C CA  . GLY A 1 403 ? 22.921  15.438  2.515   1.00 35.18  ? 403  GLY A CA  1 
ATOM   3079 C C   . GLY A 1 403 ? 22.850  13.960  2.119   1.00 47.05  ? 403  GLY A C   1 
ATOM   3080 O O   . GLY A 1 403 ? 23.109  13.082  2.935   1.00 50.13  ? 403  GLY A O   1 
ATOM   3081 N N   . ASP A 1 404 ? 22.506  13.677  0.866   1.00 38.01  ? 404  ASP A N   1 
ATOM   3082 C CA  . ASP A 1 404 ? 22.369  12.296  0.404   1.00 32.05  ? 404  ASP A CA  1 
ATOM   3083 C C   . ASP A 1 404 ? 23.679  11.536  0.474   1.00 37.72  ? 404  ASP A C   1 
ATOM   3084 O O   . ASP A 1 404 ? 23.741  10.442  1.028   1.00 51.40  ? 404  ASP A O   1 
ATOM   3085 C CB  . ASP A 1 404 ? 21.861  12.255  -1.029  1.00 23.31  ? 404  ASP A CB  1 
ATOM   3086 C CG  . ASP A 1 404 ? 20.501  12.861  -1.171  1.00 39.80  ? 404  ASP A CG  1 
ATOM   3087 O OD1 . ASP A 1 404 ? 19.922  13.217  -0.130  1.00 36.43  ? 404  ASP A OD1 1 
ATOM   3088 O OD2 . ASP A 1 404 ? 19.997  12.972  -2.309  1.00 41.68  ? 404  ASP A OD2 1 
ATOM   3089 N N   . HIS A 1 405 ? 24.718  12.129  -0.107  1.00 34.08  ? 405  HIS A N   1 
ATOM   3090 C CA  . HIS A 1 405 ? 26.031  11.516  -0.224  1.00 43.28  ? 405  HIS A CA  1 
ATOM   3091 C C   . HIS A 1 405 ? 26.590  11.127  1.141   1.00 50.03  ? 405  HIS A C   1 
ATOM   3092 O O   . HIS A 1 405 ? 27.121  10.029  1.323   1.00 46.41  ? 405  HIS A O   1 
ATOM   3093 C CB  . HIS A 1 405 ? 26.972  12.518  -0.907  1.00 45.70  ? 405  HIS A CB  1 
ATOM   3094 C CG  . HIS A 1 405 ? 28.398  12.059  -1.038  1.00 39.07  ? 405  HIS A CG  1 
ATOM   3095 N ND1 . HIS A 1 405 ? 28.747  10.806  -1.507  1.00 37.47  ? 405  HIS A ND1 1 
ATOM   3096 C CD2 . HIS A 1 405 ? 29.565  12.704  -0.797  1.00 25.77  ? 405  HIS A CD2 1 
ATOM   3097 C CE1 . HIS A 1 405 ? 30.061  10.699  -1.544  1.00 34.60  ? 405  HIS A CE1 1 
ATOM   3098 N NE2 . HIS A 1 405 ? 30.585  11.838  -1.117  1.00 40.55  ? 405  HIS A NE2 1 
ATOM   3099 N N   . ASN A 1 406 ? 26.450  12.049  2.086   1.00 44.95  ? 406  ASN A N   1 
ATOM   3100 C CA  . ASN A 1 406 ? 27.098  11.964  3.382   1.00 41.61  ? 406  ASN A CA  1 
ATOM   3101 C C   . ASN A 1 406 ? 26.276  11.283  4.487   1.00 40.66  ? 406  ASN A C   1 
ATOM   3102 O O   . ASN A 1 406 ? 26.824  10.617  5.356   1.00 38.55  ? 406  ASN A O   1 
ATOM   3103 C CB  . ASN A 1 406 ? 27.524  13.375  3.847   1.00 29.70  ? 406  ASN A CB  1 
ATOM   3104 C CG  . ASN A 1 406 ? 28.631  13.972  2.982   1.00 45.46  ? 406  ASN A CG  1 
ATOM   3105 O OD1 . ASN A 1 406 ? 29.792  13.537  3.046   1.00 46.55  ? 406  ASN A OD1 1 
ATOM   3106 N ND2 . ASN A 1 406 ? 28.282  14.988  2.179   1.00 39.37  ? 406  ASN A ND2 1 
ATOM   3107 N N   . VAL A 1 407 ? 24.968  11.479  4.497   1.00 48.42  ? 407  VAL A N   1 
ATOM   3108 C CA  . VAL A 1 407 ? 24.174  10.925  5.580   1.00 39.96  ? 407  VAL A CA  1 
ATOM   3109 C C   . VAL A 1 407 ? 23.077  10.008  5.073   1.00 47.90  ? 407  VAL A C   1 
ATOM   3110 O O   . VAL A 1 407 ? 23.097  8.808   5.330   1.00 44.26  ? 407  VAL A O   1 
ATOM   3111 C CB  . VAL A 1 407 ? 23.540  12.028  6.422   1.00 36.60  ? 407  VAL A CB  1 
ATOM   3112 C CG1 . VAL A 1 407 ? 22.688  11.424  7.572   1.00 27.25  ? 407  VAL A CG1 1 
ATOM   3113 C CG2 . VAL A 1 407 ? 24.620  12.954  6.973   1.00 36.01  ? 407  VAL A CG2 1 
ATOM   3114 N N   . VAL A 1 408 ? 22.125  10.583  4.343   1.00 43.53  ? 408  VAL A N   1 
ATOM   3115 C CA  . VAL A 1 408 ? 20.892  9.874   4.028   1.00 45.18  ? 408  VAL A CA  1 
ATOM   3116 C C   . VAL A 1 408 ? 21.142  8.547   3.316   1.00 50.72  ? 408  VAL A C   1 
ATOM   3117 O O   . VAL A 1 408 ? 20.433  7.568   3.563   1.00 44.21  ? 408  VAL A O   1 
ATOM   3118 C CB  . VAL A 1 408 ? 19.870  10.757  3.248   1.00 22.81  ? 408  VAL A CB  1 
ATOM   3119 C CG1 . VAL A 1 408 ? 18.641  9.963   2.939   1.00 25.30  ? 408  VAL A CG1 1 
ATOM   3120 C CG2 . VAL A 1 408 ? 19.475  11.956  4.054   1.00 40.80  ? 408  VAL A CG2 1 
ATOM   3121 N N   . CYS A 1 409 ? 22.152  8.490   2.451   1.00 39.64  ? 409  CYS A N   1 
ATOM   3122 C CA  . CYS A 1 409 ? 22.351  7.246   1.706   1.00 44.38  ? 409  CYS A CA  1 
ATOM   3123 C C   . CYS A 1 409 ? 23.194  6.207   2.447   1.00 44.01  ? 409  CYS A C   1 
ATOM   3124 O O   . CYS A 1 409 ? 22.921  5.018   2.361   1.00 55.66  ? 409  CYS A O   1 
ATOM   3125 C CB  . CYS A 1 409 ? 22.822  7.502   0.258   1.00 42.00  ? 409  CYS A CB  1 
ATOM   3126 S SG  . CYS A 1 409 ? 21.496  8.240   -0.763  1.00 54.23  ? 409  CYS A SG  1 
ATOM   3127 N N   . PRO A 1 410 ? 24.221  6.652   3.175   1.00 44.05  ? 410  PRO A N   1 
ATOM   3128 C CA  . PRO A 1 410 ? 24.936  5.755   4.083   1.00 50.18  ? 410  PRO A CA  1 
ATOM   3129 C C   . PRO A 1 410 ? 24.004  5.140   5.128   1.00 47.63  ? 410  PRO A C   1 
ATOM   3130 O O   . PRO A 1 410 ? 24.099  3.955   5.451   1.00 44.97  ? 410  PRO A O   1 
ATOM   3131 C CB  . PRO A 1 410 ? 25.943  6.699   4.752   1.00 41.10  ? 410  PRO A CB  1 
ATOM   3132 C CG  . PRO A 1 410 ? 26.272  7.652   3.667   1.00 33.59  ? 410  PRO A CG  1 
ATOM   3133 C CD  . PRO A 1 410 ? 24.917  7.943   3.045   1.00 47.65  ? 410  PRO A CD  1 
ATOM   3134 N N   . VAL A 1 411 ? 23.108  5.957   5.657   1.00 35.02  ? 411  VAL A N   1 
ATOM   3135 C CA  . VAL A 1 411 ? 22.159  5.501   6.656   1.00 33.35  ? 411  VAL A CA  1 
ATOM   3136 C C   . VAL A 1 411 ? 21.248  4.507   5.972   1.00 36.58  ? 411  VAL A C   1 
ATOM   3137 O O   . VAL A 1 411 ? 20.957  3.437   6.499   1.00 48.94  ? 411  VAL A O   1 
ATOM   3138 C CB  . VAL A 1 411 ? 21.359  6.699   7.211   1.00 43.56  ? 411  VAL A CB  1 
ATOM   3139 C CG1 . VAL A 1 411 ? 20.065  6.270   7.883   1.00 25.12  ? 411  VAL A CG1 1 
ATOM   3140 C CG2 . VAL A 1 411 ? 22.226  7.529   8.153   1.00 34.67  ? 411  VAL A CG2 1 
ATOM   3141 N N   . ALA A 1 412 ? 20.817  4.852   4.769   1.00 35.00  ? 412  ALA A N   1 
ATOM   3142 C CA  . ALA A 1 412 ? 20.018  3.929   3.985   1.00 43.12  ? 412  ALA A CA  1 
ATOM   3143 C C   . ALA A 1 412 ? 20.798  2.639   3.734   1.00 38.43  ? 412  ALA A C   1 
ATOM   3144 O O   . ALA A 1 412 ? 20.273  1.552   3.907   1.00 38.84  ? 412  ALA A O   1 
ATOM   3145 C CB  . ALA A 1 412 ? 19.604  4.566   2.696   1.00 50.30  ? 412  ALA A CB  1 
ATOM   3146 N N   . GLN A 1 413 ? 22.062  2.768   3.350   1.00 41.64  ? 413  GLN A N   1 
ATOM   3147 C CA  . GLN A 1 413 ? 22.920  1.604   3.137   1.00 48.09  ? 413  GLN A CA  1 
ATOM   3148 C C   . GLN A 1 413 ? 23.002  0.742   4.414   1.00 55.07  ? 413  GLN A C   1 
ATOM   3149 O O   . GLN A 1 413 ? 22.933  -0.494  4.361   1.00 42.50  ? 413  GLN A O   1 
ATOM   3150 C CB  . GLN A 1 413 ? 24.312  2.050   2.643   1.00 37.81  ? 413  GLN A CB  1 
ATOM   3151 C CG  . GLN A 1 413 ? 25.345  0.933   2.421   1.00 54.14  ? 413  GLN A CG  1 
ATOM   3152 C CD  . GLN A 1 413 ? 25.006  -0.020  1.271   1.00 71.10  ? 413  GLN A CD  1 
ATOM   3153 O OE1 . GLN A 1 413 ? 24.057  0.201   0.515   1.00 77.47  ? 413  GLN A OE1 1 
ATOM   3154 N NE2 . GLN A 1 413 ? 25.791  -1.088  1.140   1.00 71.34  ? 413  GLN A NE2 1 
ATOM   3155 N N   . LEU A 1 414 ? 23.118  1.401   5.564   1.00 53.08  ? 414  LEU A N   1 
ATOM   3156 C CA  . LEU A 1 414 ? 23.300  0.687   6.818   1.00 45.25  ? 414  LEU A CA  1 
ATOM   3157 C C   . LEU A 1 414 ? 22.051  -0.106  7.197   1.00 47.96  ? 414  LEU A C   1 
ATOM   3158 O O   . LEU A 1 414 ? 22.132  -1.297  7.505   1.00 51.47  ? 414  LEU A O   1 
ATOM   3159 C CB  . LEU A 1 414 ? 23.700  1.648   7.937   1.00 37.76  ? 414  LEU A CB  1 
ATOM   3160 C CG  . LEU A 1 414 ? 23.841  1.135   9.378   1.00 40.32  ? 414  LEU A CG  1 
ATOM   3161 C CD1 . LEU A 1 414 ? 25.030  0.194   9.521   1.00 44.70  ? 414  LEU A CD1 1 
ATOM   3162 C CD2 . LEU A 1 414 ? 23.993  2.300   10.325  1.00 50.59  ? 414  LEU A CD2 1 
ATOM   3163 N N   . ALA A 1 415 ? 20.903  0.561   7.166   1.00 36.63  ? 415  ALA A N   1 
ATOM   3164 C CA  . ALA A 1 415 ? 19.646  -0.066  7.542   1.00 39.26  ? 415  ALA A CA  1 
ATOM   3165 C C   . ALA A 1 415 ? 19.394  -1.281  6.652   1.00 54.54  ? 415  ALA A C   1 
ATOM   3166 O O   . ALA A 1 415 ? 18.957  -2.349  7.113   1.00 44.48  ? 415  ALA A O   1 
ATOM   3167 C CB  . ALA A 1 415 ? 18.518  0.927   7.408   1.00 32.30  ? 415  ALA A CB  1 
ATOM   3168 N N   . GLY A 1 416 ? 19.687  -1.106  5.368   1.00 53.10  ? 416  GLY A N   1 
ATOM   3169 C CA  . GLY A 1 416 ? 19.492  -2.161  4.404   1.00 55.18  ? 416  GLY A CA  1 
ATOM   3170 C C   . GLY A 1 416 ? 20.309  -3.393  4.735   1.00 58.83  ? 416  GLY A C   1 
ATOM   3171 O O   . GLY A 1 416 ? 19.799  -4.515  4.725   1.00 60.32  ? 416  GLY A O   1 
ATOM   3172 N N   . ARG A 1 417 ? 21.589  -3.194  5.011   1.00 56.82  ? 417  ARG A N   1 
ATOM   3173 C CA  . ARG A 1 417 ? 22.455  -4.334  5.230   1.00 48.83  ? 417  ARG A CA  1 
ATOM   3174 C C   . ARG A 1 417 ? 22.142  -4.956  6.579   1.00 48.90  ? 417  ARG A C   1 
ATOM   3175 O O   . ARG A 1 417 ? 22.099  -6.173  6.716   1.00 56.16  ? 417  ARG A O   1 
ATOM   3176 C CB  . ARG A 1 417 ? 23.931  -3.944  5.125   1.00 46.57  ? 417  ARG A CB  1 
ATOM   3177 C CG  . ARG A 1 417 ? 24.405  -3.553  3.718   1.00 48.10  ? 417  ARG A CG  1 
ATOM   3178 C CD  . ARG A 1 417 ? 23.804  -4.408  2.618   1.00 64.86  ? 417  ARG A CD  1 
ATOM   3179 N NE  . ARG A 1 417 ? 24.555  -5.628  2.330   1.00 83.54  ? 417  ARG A NE  1 
ATOM   3180 C CZ  . ARG A 1 417 ? 25.208  -5.852  1.189   1.00 102.46 ? 417  ARG A CZ  1 
ATOM   3181 N NH1 . ARG A 1 417 ? 25.208  -4.935  0.226   1.00 108.34 ? 417  ARG A NH1 1 
ATOM   3182 N NH2 . ARG A 1 417 ? 25.862  -6.995  1.005   1.00 104.29 ? 417  ARG A NH2 1 
ATOM   3183 N N   . LEU A 1 418 ? 21.893  -4.122  7.577   1.00 45.78  ? 418  LEU A N   1 
ATOM   3184 C CA  . LEU A 1 418 ? 21.607  -4.643  8.907   1.00 51.18  ? 418  LEU A CA  1 
ATOM   3185 C C   . LEU A 1 418 ? 20.340  -5.492  8.923   1.00 59.57  ? 418  LEU A C   1 
ATOM   3186 O O   . LEU A 1 418 ? 20.311  -6.583  9.495   1.00 60.63  ? 418  LEU A O   1 
ATOM   3187 C CB  . LEU A 1 418 ? 21.494  -3.509  9.926   1.00 44.51  ? 418  LEU A CB  1 
ATOM   3188 C CG  . LEU A 1 418 ? 22.761  -2.724  10.277  1.00 38.42  ? 418  LEU A CG  1 
ATOM   3189 C CD1 . LEU A 1 418 ? 22.550  -2.112  11.609  1.00 35.31  ? 418  LEU A CD1 1 
ATOM   3190 C CD2 . LEU A 1 418 ? 24.002  -3.601  10.301  1.00 51.18  ? 418  LEU A CD2 1 
ATOM   3191 N N   . ALA A 1 419 ? 19.287  -4.981  8.303   1.00 54.66  ? 419  ALA A N   1 
ATOM   3192 C CA  . ALA A 1 419 ? 18.019  -5.685  8.310   1.00 48.45  ? 419  ALA A CA  1 
ATOM   3193 C C   . ALA A 1 419 ? 18.205  -7.003  7.582   1.00 64.25  ? 419  ALA A C   1 
ATOM   3194 O O   . ALA A 1 419 ? 17.823  -8.066  8.070   1.00 72.05  ? 419  ALA A O   1 
ATOM   3195 C CB  . ALA A 1 419 ? 16.948  -4.855  7.632   1.00 44.80  ? 419  ALA A CB  1 
ATOM   3196 N N   . ALA A 1 420 ? 18.816  -6.925  6.410   1.00 59.73  ? 420  ALA A N   1 
ATOM   3197 C CA  . ALA A 1 420 ? 19.008  -8.105  5.588   1.00 57.45  ? 420  ALA A CA  1 
ATOM   3198 C C   . ALA A 1 420 ? 19.791  -9.167  6.331   1.00 55.31  ? 420  ALA A C   1 
ATOM   3199 O O   . ALA A 1 420 ? 19.816  -10.314 5.915   1.00 62.22  ? 420  ALA A O   1 
ATOM   3200 C CB  . ALA A 1 420 ? 19.712  -7.743  4.296   1.00 52.39  ? 420  ALA A CB  1 
ATOM   3201 N N   . GLN A 1 421 ? 20.427  -8.789  7.433   1.00 61.00  ? 421  GLN A N   1 
ATOM   3202 C CA  . GLN A 1 421 ? 21.342  -9.703  8.105   1.00 59.58  ? 421  GLN A CA  1 
ATOM   3203 C C   . GLN A 1 421 ? 21.033  -9.863  9.575   1.00 62.19  ? 421  GLN A C   1 
ATOM   3204 O O   . GLN A 1 421 ? 21.944  -9.952  10.397  1.00 69.39  ? 421  GLN A O   1 
ATOM   3205 C CB  . GLN A 1 421 ? 22.795  -9.265  7.917   1.00 56.00  ? 421  GLN A CB  1 
ATOM   3206 C CG  . GLN A 1 421 ? 23.327  -9.481  6.509   1.00 66.52  ? 421  GLN A CG  1 
ATOM   3207 C CD  . GLN A 1 421 ? 24.410  -8.477  6.147   1.00 77.22  ? 421  GLN A CD  1 
ATOM   3208 O OE1 . GLN A 1 421 ? 24.511  -8.028  5.001   1.00 71.21  ? 421  GLN A OE1 1 
ATOM   3209 N NE2 . GLN A 1 421 ? 25.219  -8.110  7.135   1.00 82.87  ? 421  GLN A NE2 1 
ATOM   3210 N N   . GLY A 1 422 ? 19.745  -9.874  9.902   1.00 70.25  ? 422  GLY A N   1 
ATOM   3211 C CA  . GLY A 1 422 ? 19.289  -10.407 11.175  1.00 53.13  ? 422  GLY A CA  1 
ATOM   3212 C C   . GLY A 1 422 ? 18.817  -9.438  12.228  1.00 58.01  ? 422  GLY A C   1 
ATOM   3213 O O   . GLY A 1 422 ? 18.301  -9.860  13.262  1.00 59.08  ? 422  GLY A O   1 
ATOM   3214 N N   . ALA A 1 423 ? 18.977  -8.147  11.964  1.00 52.37  ? 423  ALA A N   1 
ATOM   3215 C CA  . ALA A 1 423 ? 18.848  -7.148  13.007  1.00 45.93  ? 423  ALA A CA  1 
ATOM   3216 C C   . ALA A 1 423 ? 17.487  -6.452  13.019  1.00 52.25  ? 423  ALA A C   1 
ATOM   3217 O O   . ALA A 1 423 ? 16.913  -6.155  11.970  1.00 58.04  ? 423  ALA A O   1 
ATOM   3218 C CB  . ALA A 1 423 ? 19.966  -6.125  12.861  1.00 52.14  ? 423  ALA A CB  1 
ATOM   3219 N N   . ARG A 1 424 ? 16.974  -6.171  14.209  1.00 44.81  ? 424  ARG A N   1 
ATOM   3220 C CA  . ARG A 1 424 ? 15.809  -5.310  14.302  1.00 53.37  ? 424  ARG A CA  1 
ATOM   3221 C C   . ARG A 1 424 ? 16.221  -3.845  14.103  1.00 55.62  ? 424  ARG A C   1 
ATOM   3222 O O   . ARG A 1 424 ? 16.966  -3.286  14.918  1.00 51.54  ? 424  ARG A O   1 
ATOM   3223 C CB  . ARG A 1 424 ? 15.060  -5.498  15.631  1.00 52.23  ? 424  ARG A CB  1 
ATOM   3224 C CG  . ARG A 1 424 ? 13.624  -4.938  15.618  1.00 59.89  ? 424  ARG A CG  1 
ATOM   3225 C CD  . ARG A 1 424 ? 12.607  -5.858  16.309  1.00 85.95  ? 424  ARG A CD  1 
ATOM   3226 N NE  . ARG A 1 424 ? 12.386  -5.501  17.712  1.00 100.82 ? 424  ARG A NE  1 
ATOM   3227 C CZ  . ARG A 1 424 ? 12.846  -6.197  18.749  1.00 109.83 ? 424  ARG A CZ  1 
ATOM   3228 N NH1 . ARG A 1 424 ? 13.551  -7.307  18.551  1.00 116.55 ? 424  ARG A NH1 1 
ATOM   3229 N NH2 . ARG A 1 424 ? 12.593  -5.788  19.988  1.00 104.44 ? 424  ARG A NH2 1 
ATOM   3230 N N   . VAL A 1 425 ? 15.733  -3.242  13.014  1.00 50.89  ? 425  VAL A N   1 
ATOM   3231 C CA  . VAL A 1 425 ? 15.982  -1.837  12.723  1.00 45.86  ? 425  VAL A CA  1 
ATOM   3232 C C   . VAL A 1 425 ? 14.700  -1.039  12.750  1.00 48.87  ? 425  VAL A C   1 
ATOM   3233 O O   . VAL A 1 425 ? 13.680  -1.479  12.232  1.00 53.19  ? 425  VAL A O   1 
ATOM   3234 C CB  . VAL A 1 425 ? 16.569  -1.628  11.332  1.00 53.84  ? 425  VAL A CB  1 
ATOM   3235 C CG1 . VAL A 1 425 ? 16.982  -0.158  11.175  1.00 52.59  ? 425  VAL A CG1 1 
ATOM   3236 C CG2 . VAL A 1 425 ? 17.739  -2.565  11.095  1.00 37.69  ? 425  VAL A CG2 1 
ATOM   3237 N N   . TYR A 1 426 ? 14.766  0.139   13.361  1.00 46.11  ? 426  TYR A N   1 
ATOM   3238 C CA  . TYR A 1 426 ? 13.680  1.107   13.316  1.00 36.02  ? 426  TYR A CA  1 
ATOM   3239 C C   . TYR A 1 426 ? 14.244  2.343   12.675  1.00 43.43  ? 426  TYR A C   1 
ATOM   3240 O O   . TYR A 1 426 ? 15.301  2.829   13.072  1.00 48.82  ? 426  TYR A O   1 
ATOM   3241 C CB  . TYR A 1 426 ? 13.147  1.425   14.715  1.00 41.43  ? 426  TYR A CB  1 
ATOM   3242 C CG  . TYR A 1 426 ? 12.374  0.280   15.324  1.00 55.30  ? 426  TYR A CG  1 
ATOM   3243 C CD1 . TYR A 1 426 ? 13.023  -0.716  16.037  1.00 52.79  ? 426  TYR A CD1 1 
ATOM   3244 C CD2 . TYR A 1 426 ? 10.999  0.180   15.164  1.00 51.74  ? 426  TYR A CD2 1 
ATOM   3245 C CE1 . TYR A 1 426 ? 12.336  -1.762  16.580  1.00 53.49  ? 426  TYR A CE1 1 
ATOM   3246 C CE2 . TYR A 1 426 ? 10.301  -0.865  15.699  1.00 53.77  ? 426  TYR A CE2 1 
ATOM   3247 C CZ  . TYR A 1 426 ? 10.968  -1.844  16.409  1.00 61.46  ? 426  TYR A CZ  1 
ATOM   3248 O OH  . TYR A 1 426 ? 10.270  -2.911  16.958  1.00 63.27  ? 426  TYR A OH  1 
ATOM   3249 N N   . ALA A 1 427 ? 13.545  2.854   11.674  1.00 42.65  ? 427  ALA A N   1 
ATOM   3250 C CA  . ALA A 1 427 ? 14.043  4.002   10.934  1.00 40.07  ? 427  ALA A CA  1 
ATOM   3251 C C   . ALA A 1 427 ? 13.072  5.170   11.014  1.00 48.60  ? 427  ALA A C   1 
ATOM   3252 O O   . ALA A 1 427 ? 11.858  4.966   11.077  1.00 54.00  ? 427  ALA A O   1 
ATOM   3253 C CB  . ALA A 1 427 ? 14.290  3.604   9.492   1.00 31.76  ? 427  ALA A CB  1 
ATOM   3254 N N   . TYR A 1 428 ? 13.600  6.394   11.001  1.00 49.21  ? 428  TYR A N   1 
ATOM   3255 C CA  . TYR A 1 428 ? 12.751  7.582   11.052  1.00 38.10  ? 428  TYR A CA  1 
ATOM   3256 C C   . TYR A 1 428 ? 13.317  8.703   10.205  1.00 41.25  ? 428  TYR A C   1 
ATOM   3257 O O   . TYR A 1 428 ? 14.503  8.713   9.879   1.00 39.35  ? 428  TYR A O   1 
ATOM   3258 C CB  . TYR A 1 428 ? 12.642  8.086   12.488  1.00 37.72  ? 428  TYR A CB  1 
ATOM   3259 C CG  . TYR A 1 428 ? 13.950  8.645   12.997  1.00 52.74  ? 428  TYR A CG  1 
ATOM   3260 C CD1 . TYR A 1 428 ? 14.356  9.942   12.674  1.00 53.09  ? 428  TYR A CD1 1 
ATOM   3261 C CD2 . TYR A 1 428 ? 14.790  7.878   13.791  1.00 49.67  ? 428  TYR A CD2 1 
ATOM   3262 C CE1 . TYR A 1 428 ? 15.569  10.448  13.134  1.00 49.79  ? 428  TYR A CE1 1 
ATOM   3263 C CE2 . TYR A 1 428 ? 15.998  8.374   14.252  1.00 48.01  ? 428  TYR A CE2 1 
ATOM   3264 C CZ  . TYR A 1 428 ? 16.386  9.652   13.921  1.00 49.17  ? 428  TYR A CZ  1 
ATOM   3265 O OH  . TYR A 1 428 ? 17.589  10.131  14.393  1.00 51.23  ? 428  TYR A OH  1 
ATOM   3266 N N   . ILE A 1 429 ? 12.469  9.664   9.857   1.00 40.28  ? 429  ILE A N   1 
ATOM   3267 C CA  . ILE A 1 429 ? 12.958  10.934  9.348   1.00 37.26  ? 429  ILE A CA  1 
ATOM   3268 C C   . ILE A 1 429 ? 12.398  12.063  10.214  1.00 41.39  ? 429  ILE A C   1 
ATOM   3269 O O   . ILE A 1 429 ? 11.219  12.077  10.533  1.00 46.26  ? 429  ILE A O   1 
ATOM   3270 C CB  . ILE A 1 429 ? 12.631  11.164  7.867   1.00 44.32  ? 429  ILE A CB  1 
ATOM   3271 C CG1 . ILE A 1 429 ? 13.050  12.586  7.473   1.00 52.16  ? 429  ILE A CG1 1 
ATOM   3272 C CG2 . ILE A 1 429 ? 11.158  10.929  7.599   1.00 34.99  ? 429  ILE A CG2 1 
ATOM   3273 C CD1 . ILE A 1 429 ? 12.716  12.971  6.052   1.00 52.07  ? 429  ILE A CD1 1 
ATOM   3274 N N   . PHE A 1 430 ? 13.248  13.003  10.607  1.00 29.02  ? 430  PHE A N   1 
ATOM   3275 C CA  . PHE A 1 430 ? 12.815  14.019  11.548  1.00 36.59  ? 430  PHE A CA  1 
ATOM   3276 C C   . PHE A 1 430 ? 12.553  15.345  10.805  1.00 45.20  ? 430  PHE A C   1 
ATOM   3277 O O   . PHE A 1 430 ? 13.466  15.983  10.271  1.00 40.50  ? 430  PHE A O   1 
ATOM   3278 C CB  . PHE A 1 430 ? 13.844  14.128  12.681  1.00 37.44  ? 430  PHE A CB  1 
ATOM   3279 C CG  . PHE A 1 430 ? 13.495  15.139  13.732  1.00 40.43  ? 430  PHE A CG  1 
ATOM   3280 C CD1 . PHE A 1 430 ? 13.794  16.484  13.544  1.00 45.54  ? 430  PHE A CD1 1 
ATOM   3281 C CD2 . PHE A 1 430 ? 12.892  14.752  14.911  1.00 46.58  ? 430  PHE A CD2 1 
ATOM   3282 C CE1 . PHE A 1 430 ? 13.483  17.418  14.503  1.00 40.67  ? 430  PHE A CE1 1 
ATOM   3283 C CE2 . PHE A 1 430 ? 12.578  15.691  15.885  1.00 41.02  ? 430  PHE A CE2 1 
ATOM   3284 C CZ  . PHE A 1 430 ? 12.873  17.017  15.676  1.00 38.61  ? 430  PHE A CZ  1 
ATOM   3285 N N   . GLU A 1 431 ? 11.290  15.745  10.752  1.00 42.01  ? 431  GLU A N   1 
ATOM   3286 C CA  . GLU A 1 431 ? 10.886  16.778  9.806   1.00 48.05  ? 431  GLU A CA  1 
ATOM   3287 C C   . GLU A 1 431 ? 10.461  18.106  10.422  1.00 54.36  ? 431  GLU A C   1 
ATOM   3288 O O   . GLU A 1 431 ? 9.902   18.955  9.726   1.00 50.38  ? 431  GLU A O   1 
ATOM   3289 C CB  . GLU A 1 431 ? 9.716   16.279  8.962   1.00 45.84  ? 431  GLU A CB  1 
ATOM   3290 C CG  . GLU A 1 431 ? 10.008  15.101  8.093   1.00 53.53  ? 431  GLU A CG  1 
ATOM   3291 C CD  . GLU A 1 431 ? 8.873   14.830  7.128   1.00 64.33  ? 431  GLU A CD  1 
ATOM   3292 O OE1 . GLU A 1 431 ? 7.709   14.749  7.586   1.00 59.92  ? 431  GLU A OE1 1 
ATOM   3293 O OE2 . GLU A 1 431 ? 9.146   14.719  5.910   1.00 72.66  ? 431  GLU A OE2 1 
ATOM   3294 N N   . HIS A 1 432 ? 10.694  18.290  11.713  1.00 50.96  ? 432  HIS A N   1 
ATOM   3295 C CA  . HIS A 1 432 ? 10.172  19.475  12.376  1.00 40.32  ? 432  HIS A CA  1 
ATOM   3296 C C   . HIS A 1 432 ? 11.238  20.529  12.644  1.00 49.93  ? 432  HIS A C   1 
ATOM   3297 O O   . HIS A 1 432 ? 12.158  20.306  13.430  1.00 44.25  ? 432  HIS A O   1 
ATOM   3298 C CB  . HIS A 1 432 ? 9.472   19.103  13.677  1.00 42.90  ? 432  HIS A CB  1 
ATOM   3299 C CG  . HIS A 1 432 ? 9.135   20.288  14.523  1.00 50.11  ? 432  HIS A CG  1 
ATOM   3300 N ND1 . HIS A 1 432 ? 8.044   21.091  14.275  1.00 48.87  ? 432  HIS A ND1 1 
ATOM   3301 C CD2 . HIS A 1 432 ? 9.763   20.828  15.594  1.00 48.70  ? 432  HIS A CD2 1 
ATOM   3302 C CE1 . HIS A 1 432 ? 8.005   22.064  15.167  1.00 46.53  ? 432  HIS A CE1 1 
ATOM   3303 N NE2 . HIS A 1 432 ? 9.038   21.927  15.979  1.00 45.03  ? 432  HIS A NE2 1 
ATOM   3304 N N   . ARG A 1 433 ? 11.114  21.681  11.986  1.00 53.63  ? 433  ARG A N   1 
ATOM   3305 C CA  . ARG A 1 433 ? 11.991  22.809  12.287  1.00 51.55  ? 433  ARG A CA  1 
ATOM   3306 C C   . ARG A 1 433 ? 11.552  23.538  13.566  1.00 51.02  ? 433  ARG A C   1 
ATOM   3307 O O   . ARG A 1 433 ? 10.368  23.849  13.751  1.00 45.09  ? 433  ARG A O   1 
ATOM   3308 C CB  . ARG A 1 433 ? 12.042  23.807  11.135  1.00 43.85  ? 433  ARG A CB  1 
ATOM   3309 C CG  . ARG A 1 433 ? 11.954  25.235  11.664  1.00 61.11  ? 433  ARG A CG  1 
ATOM   3310 C CD  . ARG A 1 433 ? 12.074  26.276  10.592  1.00 55.23  ? 433  ARG A CD  1 
ATOM   3311 N NE  . ARG A 1 433 ? 13.351  26.196  9.910   1.00 50.14  ? 433  ARG A NE  1 
ATOM   3312 C CZ  . ARG A 1 433 ? 14.188  27.214  9.781   1.00 50.90  ? 433  ARG A CZ  1 
ATOM   3313 N NH1 . ARG A 1 433 ? 13.876  28.398  10.297  1.00 53.77  ? 433  ARG A NH1 1 
ATOM   3314 N NH2 . ARG A 1 433 ? 15.330  27.045  9.123   1.00 48.22  ? 433  ARG A NH2 1 
ATOM   3315 N N   . ALA A 1 434 ? 12.510  23.830  14.440  1.00 39.54  ? 434  ALA A N   1 
ATOM   3316 C CA  . ALA A 1 434 ? 12.179  24.423  15.724  1.00 38.02  ? 434  ALA A CA  1 
ATOM   3317 C C   . ALA A 1 434 ? 11.656  25.819  15.483  1.00 44.58  ? 434  ALA A C   1 
ATOM   3318 O O   . ALA A 1 434 ? 12.139  26.530  14.606  1.00 45.90  ? 434  ALA A O   1 
ATOM   3319 C CB  . ALA A 1 434 ? 13.392  24.438  16.655  1.00 33.77  ? 434  ALA A CB  1 
ATOM   3320 N N   . SER A 1 435 ? 10.637  26.200  16.237  1.00 47.71  ? 435  SER A N   1 
ATOM   3321 C CA  . SER A 1 435 ? 10.096  27.538  16.117  1.00 48.32  ? 435  SER A CA  1 
ATOM   3322 C C   . SER A 1 435 ? 11.198  28.497  16.544  1.00 58.00  ? 435  SER A C   1 
ATOM   3323 O O   . SER A 1 435 ? 11.199  29.681  16.197  1.00 56.29  ? 435  SER A O   1 
ATOM   3324 C CB  . SER A 1 435 ? 8.875   27.680  17.021  1.00 42.74  ? 435  SER A CB  1 
ATOM   3325 O OG  . SER A 1 435 ? 9.198   27.359  18.362  1.00 42.89  ? 435  SER A OG  1 
ATOM   3326 N N   . THR A 1 436 ? 12.154  27.958  17.292  1.00 54.35  ? 436  THR A N   1 
ATOM   3327 C CA  . THR A 1 436 ? 13.216  28.763  17.880  1.00 58.47  ? 436  THR A CA  1 
ATOM   3328 C C   . THR A 1 436 ? 14.466  28.787  17.020  1.00 53.55  ? 436  THR A C   1 
ATOM   3329 O O   . THR A 1 436 ? 15.408  29.507  17.327  1.00 57.63  ? 436  THR A O   1 
ATOM   3330 C CB  . THR A 1 436 ? 13.607  28.241  19.280  1.00 49.74  ? 436  THR A CB  1 
ATOM   3331 O OG1 . THR A 1 436 ? 14.250  26.966  19.158  1.00 50.62  ? 436  THR A OG1 1 
ATOM   3332 C CG2 . THR A 1 436 ? 12.378  28.077  20.137  1.00 48.30  ? 436  THR A CG2 1 
ATOM   3333 N N   . LEU A 1 437 ? 14.477  27.997  15.950  1.00 57.00  ? 437  LEU A N   1 
ATOM   3334 C CA  . LEU A 1 437 ? 15.680  27.830  15.145  1.00 43.29  ? 437  LEU A CA  1 
ATOM   3335 C C   . LEU A 1 437 ? 16.113  29.182  14.656  1.00 45.25  ? 437  LEU A C   1 
ATOM   3336 O O   . LEU A 1 437 ? 15.294  30.034  14.318  1.00 49.27  ? 437  LEU A O   1 
ATOM   3337 C CB  . LEU A 1 437 ? 15.431  26.903  13.959  1.00 47.10  ? 437  LEU A CB  1 
ATOM   3338 C CG  . LEU A 1 437 ? 16.650  26.353  13.205  1.00 41.13  ? 437  LEU A CG  1 
ATOM   3339 C CD1 . LEU A 1 437 ? 17.447  25.417  14.062  1.00 33.76  ? 437  LEU A CD1 1 
ATOM   3340 C CD2 . LEU A 1 437 ? 16.211  25.642  11.951  1.00 49.24  ? 437  LEU A CD2 1 
ATOM   3341 N N   . THR A 1 438 ? 17.415  29.377  14.599  1.00 48.31  ? 438  THR A N   1 
ATOM   3342 C CA  . THR A 1 438 ? 17.943  30.706  14.408  1.00 53.77  ? 438  THR A CA  1 
ATOM   3343 C C   . THR A 1 438 ? 18.574  30.845  13.013  1.00 54.95  ? 438  THR A C   1 
ATOM   3344 O O   . THR A 1 438 ? 18.862  31.950  12.547  1.00 53.94  ? 438  THR A O   1 
ATOM   3345 C CB  . THR A 1 438 ? 18.907  31.017  15.553  1.00 52.41  ? 438  THR A CB  1 
ATOM   3346 O OG1 . THR A 1 438 ? 19.423  32.346  15.411  1.00 60.97  ? 438  THR A OG1 1 
ATOM   3347 C CG2 . THR A 1 438 ? 20.026  29.967  15.589  1.00 40.57  ? 438  THR A CG2 1 
ATOM   3348 N N   . TRP A 1 439 ? 18.744  29.710  12.341  1.00 45.74  ? 439  TRP A N   1 
ATOM   3349 C CA  . TRP A 1 439 ? 19.157  29.679  10.944  1.00 43.25  ? 439  TRP A CA  1 
ATOM   3350 C C   . TRP A 1 439 ? 18.019  30.089  10.011  1.00 46.58  ? 439  TRP A C   1 
ATOM   3351 O O   . TRP A 1 439 ? 16.843  30.008  10.381  1.00 48.90  ? 439  TRP A O   1 
ATOM   3352 C CB  . TRP A 1 439 ? 19.593  28.263  10.574  1.00 46.35  ? 439  TRP A CB  1 
ATOM   3353 C CG  . TRP A 1 439 ? 20.791  27.781  11.317  1.00 40.36  ? 439  TRP A CG  1 
ATOM   3354 C CD1 . TRP A 1 439 ? 20.800  27.004  12.428  1.00 45.40  ? 439  TRP A CD1 1 
ATOM   3355 C CD2 . TRP A 1 439 ? 22.166  28.062  11.007  1.00 43.77  ? 439  TRP A CD2 1 
ATOM   3356 N NE1 . TRP A 1 439 ? 22.094  26.781  12.844  1.00 47.45  ? 439  TRP A NE1 1 
ATOM   3357 C CE2 . TRP A 1 439 ? 22.954  27.415  11.988  1.00 40.67  ? 439  TRP A CE2 1 
ATOM   3358 C CE3 . TRP A 1 439 ? 22.808  28.803  9.998   1.00 34.79  ? 439  TRP A CE3 1 
ATOM   3359 C CZ2 . TRP A 1 439 ? 24.354  27.470  11.987  1.00 40.20  ? 439  TRP A CZ2 1 
ATOM   3360 C CZ3 . TRP A 1 439 ? 24.201  28.861  9.997   1.00 38.20  ? 439  TRP A CZ3 1 
ATOM   3361 C CH2 . TRP A 1 439 ? 24.959  28.192  10.989  1.00 44.57  ? 439  TRP A CH2 1 
ATOM   3362 N N   . PRO A 1 440 ? 18.357  30.510  8.777   1.00 34.86  ? 440  PRO A N   1 
ATOM   3363 C CA  . PRO A 1 440 ? 17.313  30.890  7.814   1.00 27.20  ? 440  PRO A CA  1 
ATOM   3364 C C   . PRO A 1 440 ? 16.422  29.714  7.397   1.00 52.07  ? 440  PRO A C   1 
ATOM   3365 O O   . PRO A 1 440 ? 16.804  28.544  7.501   1.00 54.11  ? 440  PRO A O   1 
ATOM   3366 C CB  . PRO A 1 440 ? 18.103  31.411  6.615   1.00 27.62  ? 440  PRO A CB  1 
ATOM   3367 C CG  . PRO A 1 440 ? 19.455  30.842  6.748   1.00 27.49  ? 440  PRO A CG  1 
ATOM   3368 C CD  . PRO A 1 440 ? 19.708  30.714  8.230   1.00 31.23  ? 440  PRO A CD  1 
ATOM   3369 N N   . LEU A 1 441 ? 15.232  30.046  6.918   1.00 41.02  ? 441  LEU A N   1 
ATOM   3370 C CA  . LEU A 1 441 ? 14.252  29.064  6.513   1.00 40.91  ? 441  LEU A CA  1 
ATOM   3371 C C   . LEU A 1 441 ? 14.739  28.134  5.438   1.00 52.23  ? 441  LEU A C   1 
ATOM   3372 O O   . LEU A 1 441 ? 14.350  26.971  5.404   1.00 51.76  ? 441  LEU A O   1 
ATOM   3373 C CB  . LEU A 1 441 ? 13.025  29.767  5.994   1.00 45.21  ? 441  LEU A CB  1 
ATOM   3374 C CG  . LEU A 1 441 ? 12.110  30.052  7.156   1.00 58.63  ? 441  LEU A CG  1 
ATOM   3375 C CD1 . LEU A 1 441 ? 11.176  31.177  6.768   1.00 52.47  ? 441  LEU A CD1 1 
ATOM   3376 C CD2 . LEU A 1 441 ? 11.372  28.760  7.475   1.00 57.97  ? 441  LEU A CD2 1 
ATOM   3377 N N   . TRP A 1 442 ? 15.564  28.648  4.536   1.00 49.17  ? 442  TRP A N   1 
ATOM   3378 C CA  . TRP A 1 442 ? 15.947  27.843  3.395   1.00 45.66  ? 442  TRP A CA  1 
ATOM   3379 C C   . TRP A 1 442 ? 16.698  26.566  3.813   1.00 45.67  ? 442  TRP A C   1 
ATOM   3380 O O   . TRP A 1 442 ? 16.745  25.598  3.053   1.00 45.06  ? 442  TRP A O   1 
ATOM   3381 C CB  . TRP A 1 442 ? 16.688  28.672  2.322   1.00 34.77  ? 442  TRP A CB  1 
ATOM   3382 C CG  . TRP A 1 442 ? 18.115  29.038  2.609   1.00 41.43  ? 442  TRP A CG  1 
ATOM   3383 C CD1 . TRP A 1 442 ? 18.589  30.273  2.981   1.00 43.16  ? 442  TRP A CD1 1 
ATOM   3384 C CD2 . TRP A 1 442 ? 19.273  28.185  2.502   1.00 39.13  ? 442  TRP A CD2 1 
ATOM   3385 N NE1 . TRP A 1 442 ? 19.960  30.236  3.127   1.00 30.65  ? 442  TRP A NE1 1 
ATOM   3386 C CE2 . TRP A 1 442 ? 20.409  28.976  2.835   1.00 35.73  ? 442  TRP A CE2 1 
ATOM   3387 C CE3 . TRP A 1 442 ? 19.463  26.839  2.151   1.00 33.88  ? 442  TRP A CE3 1 
ATOM   3388 C CZ2 . TRP A 1 442 ? 21.713  28.454  2.858   1.00 37.78  ? 442  TRP A CZ2 1 
ATOM   3389 C CZ3 . TRP A 1 442 ? 20.774  26.315  2.159   1.00 23.45  ? 442  TRP A CZ3 1 
ATOM   3390 C CH2 . TRP A 1 442 ? 21.875  27.125  2.524   1.00 48.69  ? 442  TRP A CH2 1 
ATOM   3391 N N   . MET A 1 443 ? 17.235  26.537  5.032   1.00 36.47  ? 443  MET A N   1 
ATOM   3392 C CA  . MET A 1 443 ? 18.043  25.388  5.455   1.00 34.09  ? 443  MET A CA  1 
ATOM   3393 C C   . MET A 1 443 ? 17.186  24.219  5.945   1.00 38.78  ? 443  MET A C   1 
ATOM   3394 O O   . MET A 1 443 ? 17.679  23.107  6.157   1.00 42.64  ? 443  MET A O   1 
ATOM   3395 C CB  . MET A 1 443 ? 19.108  25.778  6.487   1.00 35.11  ? 443  MET A CB  1 
ATOM   3396 C CG  . MET A 1 443 ? 20.064  26.890  6.021   1.00 34.91  ? 443  MET A CG  1 
ATOM   3397 S SD  . MET A 1 443 ? 21.548  27.088  7.043   1.00 45.82  ? 443  MET A SD  1 
ATOM   3398 C CE  . MET A 1 443 ? 21.823  28.842  6.871   1.00 90.23  ? 443  MET A CE  1 
ATOM   3399 N N   . GLY A 1 444 ? 15.892  24.464  6.070   1.00 36.71  ? 444  GLY A N   1 
ATOM   3400 C CA  . GLY A 1 444 ? 14.957  23.426  6.446   1.00 28.11  ? 444  GLY A CA  1 
ATOM   3401 C C   . GLY A 1 444 ? 15.167  22.997  7.884   1.00 44.65  ? 444  GLY A C   1 
ATOM   3402 O O   . GLY A 1 444 ? 15.255  23.846  8.775   1.00 41.89  ? 444  GLY A O   1 
ATOM   3403 N N   . VAL A 1 445 ? 15.241  21.678  8.100   1.00 43.91  ? 445  VAL A N   1 
ATOM   3404 C CA  . VAL A 1 445 ? 15.632  21.112  9.386   1.00 33.47  ? 445  VAL A CA  1 
ATOM   3405 C C   . VAL A 1 445 ? 17.050  20.598  9.219   1.00 46.86  ? 445  VAL A C   1 
ATOM   3406 O O   . VAL A 1 445 ? 17.252  19.500  8.696   1.00 58.65  ? 445  VAL A O   1 
ATOM   3407 C CB  . VAL A 1 445 ? 14.752  19.910  9.786   1.00 34.05  ? 445  VAL A CB  1 
ATOM   3408 C CG1 . VAL A 1 445 ? 15.014  19.535  11.219  1.00 37.93  ? 445  VAL A CG1 1 
ATOM   3409 C CG2 . VAL A 1 445 ? 13.265  20.198  9.580   1.00 30.57  ? 445  VAL A CG2 1 
ATOM   3410 N N   . PRO A 1 446 ? 18.042  21.393  9.652   1.00 37.01  ? 446  PRO A N   1 
ATOM   3411 C CA  . PRO A 1 446 ? 19.456  21.103  9.394   1.00 33.65  ? 446  PRO A CA  1 
ATOM   3412 C C   . PRO A 1 446 ? 20.021  19.965  10.235  1.00 38.90  ? 446  PRO A C   1 
ATOM   3413 O O   . PRO A 1 446 ? 19.419  19.562  11.219  1.00 42.24  ? 446  PRO A O   1 
ATOM   3414 C CB  . PRO A 1 446 ? 20.161  22.418  9.768   1.00 29.11  ? 446  PRO A CB  1 
ATOM   3415 C CG  . PRO A 1 446 ? 19.085  23.443  9.929   1.00 21.85  ? 446  PRO A CG  1 
ATOM   3416 C CD  . PRO A 1 446 ? 17.859  22.695  10.310  1.00 34.82  ? 446  PRO A CD  1 
ATOM   3417 N N   . HIS A 1 447 ? 21.182  19.468  9.822   1.00 47.75  ? 447  HIS A N   1 
ATOM   3418 C CA  . HIS A 1 447 ? 21.987  18.515  10.582  1.00 43.47  ? 447  HIS A CA  1 
ATOM   3419 C C   . HIS A 1 447 ? 22.076  18.934  12.053  1.00 47.78  ? 447  HIS A C   1 
ATOM   3420 O O   . HIS A 1 447 ? 22.543  20.037  12.361  1.00 48.83  ? 447  HIS A O   1 
ATOM   3421 C CB  . HIS A 1 447 ? 23.397  18.481  9.963   1.00 39.16  ? 447  HIS A CB  1 
ATOM   3422 C CG  . HIS A 1 447 ? 24.210  17.276  10.325  1.00 44.33  ? 447  HIS A CG  1 
ATOM   3423 N ND1 . HIS A 1 447 ? 23.765  15.982  10.130  1.00 46.75  ? 447  HIS A ND1 1 
ATOM   3424 C CD2 . HIS A 1 447 ? 25.452  17.169  10.858  1.00 40.37  ? 447  HIS A CD2 1 
ATOM   3425 C CE1 . HIS A 1 447 ? 24.695  15.134  10.533  1.00 42.70  ? 447  HIS A CE1 1 
ATOM   3426 N NE2 . HIS A 1 447 ? 25.730  15.828  10.978  1.00 44.23  ? 447  HIS A NE2 1 
ATOM   3427 N N   . GLY A 1 448 ? 21.624  18.068  12.961  1.00 43.74  ? 448  GLY A N   1 
ATOM   3428 C CA  . GLY A 1 448 ? 21.777  18.322  14.386  1.00 29.38  ? 448  GLY A CA  1 
ATOM   3429 C C   . GLY A 1 448 ? 20.611  18.941  15.149  1.00 32.28  ? 448  GLY A C   1 
ATOM   3430 O O   . GLY A 1 448 ? 20.626  19.005  16.377  1.00 39.19  ? 448  GLY A O   1 
ATOM   3431 N N   . TYR A 1 449 ? 19.579  19.387  14.453  1.00 32.18  ? 449  TYR A N   1 
ATOM   3432 C CA  . TYR A 1 449 ? 18.505  20.059  15.175  1.00 34.88  ? 449  TYR A CA  1 
ATOM   3433 C C   . TYR A 1 449 ? 17.359  19.136  15.563  1.00 47.91  ? 449  TYR A C   1 
ATOM   3434 O O   . TYR A 1 449 ? 16.243  19.588  15.814  1.00 40.57  ? 449  TYR A O   1 
ATOM   3435 C CB  . TYR A 1 449 ? 18.069  21.339  14.460  1.00 30.02  ? 449  TYR A CB  1 
ATOM   3436 C CG  . TYR A 1 449 ? 19.208  22.319  14.525  1.00 37.54  ? 449  TYR A CG  1 
ATOM   3437 C CD1 . TYR A 1 449 ? 20.249  22.241  13.618  1.00 39.14  ? 449  TYR A CD1 1 
ATOM   3438 C CD2 . TYR A 1 449 ? 19.303  23.251  15.552  1.00 33.36  ? 449  TYR A CD2 1 
ATOM   3439 C CE1 . TYR A 1 449 ? 21.314  23.084  13.685  1.00 39.04  ? 449  TYR A CE1 1 
ATOM   3440 C CE2 . TYR A 1 449 ? 20.383  24.112  15.625  1.00 34.76  ? 449  TYR A CE2 1 
ATOM   3441 C CZ  . TYR A 1 449 ? 21.382  24.017  14.683  1.00 36.89  ? 449  TYR A CZ  1 
ATOM   3442 O OH  . TYR A 1 449 ? 22.467  24.844  14.715  1.00 39.88  ? 449  TYR A OH  1 
ATOM   3443 N N   . GLU A 1 450 ? 17.648  17.838  15.635  1.00 38.55  ? 450  GLU A N   1 
ATOM   3444 C CA  . GLU A 1 450 ? 16.728  16.940  16.302  1.00 30.29  ? 450  GLU A CA  1 
ATOM   3445 C C   . GLU A 1 450 ? 17.135  16.837  17.763  1.00 36.95  ? 450  GLU A C   1 
ATOM   3446 O O   . GLU A 1 450 ? 16.304  16.602  18.634  1.00 39.33  ? 450  GLU A O   1 
ATOM   3447 C CB  . GLU A 1 450 ? 16.712  15.555  15.657  1.00 30.37  ? 450  GLU A CB  1 
ATOM   3448 C CG  . GLU A 1 450 ? 17.776  14.607  16.160  1.00 35.28  ? 450  GLU A CG  1 
ATOM   3449 C CD  . GLU A 1 450 ? 19.103  14.724  15.424  1.00 48.99  ? 450  GLU A CD  1 
ATOM   3450 O OE1 . GLU A 1 450 ? 19.418  15.815  14.880  1.00 43.42  ? 450  GLU A OE1 1 
ATOM   3451 O OE2 . GLU A 1 450 ? 19.832  13.705  15.399  1.00 54.69  ? 450  GLU A OE2 1 
ATOM   3452 N N   . ILE A 1 451 ? 18.418  17.049  18.032  1.00 42.71  ? 451  ILE A N   1 
ATOM   3453 C CA  . ILE A 1 451 ? 18.956  16.767  19.360  1.00 40.47  ? 451  ILE A CA  1 
ATOM   3454 C C   . ILE A 1 451 ? 18.166  17.452  20.488  1.00 42.48  ? 451  ILE A C   1 
ATOM   3455 O O   . ILE A 1 451 ? 17.680  16.781  21.395  1.00 44.00  ? 451  ILE A O   1 
ATOM   3456 C CB  . ILE A 1 451 ? 20.462  17.068  19.425  1.00 38.82  ? 451  ILE A CB  1 
ATOM   3457 C CG1 . ILE A 1 451 ? 21.210  16.176  18.421  1.00 30.76  ? 451  ILE A CG1 1 
ATOM   3458 C CG2 . ILE A 1 451 ? 20.980  16.887  20.842  1.00 46.01  ? 451  ILE A CG2 1 
ATOM   3459 C CD1 . ILE A 1 451 ? 22.661  16.527  18.207  1.00 40.91  ? 451  ILE A CD1 1 
ATOM   3460 N N   . GLU A 1 452 ? 18.010  18.772  20.410  1.00 38.73  ? 452  GLU A N   1 
ATOM   3461 C CA  . GLU A 1 452 ? 17.270  19.522  21.422  1.00 40.60  ? 452  GLU A CA  1 
ATOM   3462 C C   . GLU A 1 452 ? 15.914  18.900  21.765  1.00 49.08  ? 452  GLU A C   1 
ATOM   3463 O O   . GLU A 1 452 ? 15.462  18.971  22.911  1.00 49.14  ? 452  GLU A O   1 
ATOM   3464 C CB  . GLU A 1 452 ? 17.088  20.982  20.995  1.00 40.20  ? 452  GLU A CB  1 
ATOM   3465 C CG  . GLU A 1 452 ? 16.700  21.169  19.532  1.00 38.21  ? 452  GLU A CG  1 
ATOM   3466 C CD  . GLU A 1 452 ? 16.751  22.631  19.093  1.00 37.84  ? 452  GLU A CD  1 
ATOM   3467 O OE1 . GLU A 1 452 ? 17.818  23.140  18.671  1.00 43.45  ? 452  GLU A OE1 1 
ATOM   3468 O OE2 . GLU A 1 452 ? 15.710  23.288  19.173  1.00 38.02  ? 452  GLU A OE2 1 
ATOM   3469 N N   . PHE A 1 453 ? 15.261  18.294  20.781  1.00 37.46  ? 453  PHE A N   1 
ATOM   3470 C CA  . PHE A 1 453 ? 13.980  17.653  21.058  1.00 36.40  ? 453  PHE A CA  1 
ATOM   3471 C C   . PHE A 1 453 ? 14.092  16.286  21.762  1.00 36.11  ? 453  PHE A C   1 
ATOM   3472 O O   . PHE A 1 453 ? 13.321  16.002  22.672  1.00 42.38  ? 453  PHE A O   1 
ATOM   3473 C CB  . PHE A 1 453 ? 13.106  17.577  19.806  1.00 36.19  ? 453  PHE A CB  1 
ATOM   3474 C CG  . PHE A 1 453 ? 12.637  18.911  19.322  1.00 48.09  ? 453  PHE A CG  1 
ATOM   3475 C CD1 . PHE A 1 453 ? 13.416  19.663  18.447  1.00 54.61  ? 453  PHE A CD1 1 
ATOM   3476 C CD2 . PHE A 1 453 ? 11.430  19.428  19.748  1.00 44.93  ? 453  PHE A CD2 1 
ATOM   3477 C CE1 . PHE A 1 453 ? 12.991  20.903  18.001  1.00 52.94  ? 453  PHE A CE1 1 
ATOM   3478 C CE2 . PHE A 1 453 ? 10.999  20.673  19.307  1.00 47.74  ? 453  PHE A CE2 1 
ATOM   3479 C CZ  . PHE A 1 453 ? 11.781  21.410  18.436  1.00 50.84  ? 453  PHE A CZ  1 
ATOM   3480 N N   . ILE A 1 454 ? 15.055  15.463  21.357  1.00 41.48  ? 454  ILE A N   1 
ATOM   3481 C CA  . ILE A 1 454 ? 15.270  14.151  21.963  1.00 30.61  ? 454  ILE A CA  1 
ATOM   3482 C C   . ILE A 1 454 ? 15.722  14.228  23.418  1.00 37.06  ? 454  ILE A C   1 
ATOM   3483 O O   . ILE A 1 454 ? 15.409  13.352  24.225  1.00 39.05  ? 454  ILE A O   1 
ATOM   3484 C CB  . ILE A 1 454 ? 16.302  13.369  21.159  1.00 49.92  ? 454  ILE A CB  1 
ATOM   3485 C CG1 . ILE A 1 454 ? 15.736  13.080  19.773  1.00 47.41  ? 454  ILE A CG1 1 
ATOM   3486 C CG2 . ILE A 1 454 ? 16.702  12.061  21.875  1.00 43.78  ? 454  ILE A CG2 1 
ATOM   3487 C CD1 . ILE A 1 454 ? 16.624  12.221  18.971  1.00 53.59  ? 454  ILE A CD1 1 
ATOM   3488 N N   . PHE A 1 455 ? 16.468  15.279  23.742  1.00 49.68  ? 455  PHE A N   1 
ATOM   3489 C CA  . PHE A 1 455 ? 16.951  15.506  25.098  1.00 40.15  ? 455  PHE A CA  1 
ATOM   3490 C C   . PHE A 1 455 ? 15.899  16.233  25.915  1.00 46.81  ? 455  PHE A C   1 
ATOM   3491 O O   . PHE A 1 455 ? 16.029  16.356  27.129  1.00 52.27  ? 455  PHE A O   1 
ATOM   3492 C CB  . PHE A 1 455 ? 18.221  16.340  25.072  1.00 30.91  ? 455  PHE A CB  1 
ATOM   3493 C CG  . PHE A 1 455 ? 19.490  15.533  25.051  1.00 27.10  ? 455  PHE A CG  1 
ATOM   3494 C CD1 . PHE A 1 455 ? 20.100  15.139  26.241  1.00 34.98  ? 455  PHE A CD1 1 
ATOM   3495 C CD2 . PHE A 1 455 ? 20.096  15.202  23.853  1.00 25.94  ? 455  PHE A CD2 1 
ATOM   3496 C CE1 . PHE A 1 455 ? 21.293  14.414  26.247  1.00 29.67  ? 455  PHE A CE1 1 
ATOM   3497 C CE2 . PHE A 1 455 ? 21.282  14.488  23.839  1.00 37.85  ? 455  PHE A CE2 1 
ATOM   3498 C CZ  . PHE A 1 455 ? 21.879  14.090  25.042  1.00 46.82  ? 455  PHE A CZ  1 
ATOM   3499 N N   . GLY A 1 456 ? 14.861  16.719  25.240  1.00 49.85  ? 456  GLY A N   1 
ATOM   3500 C CA  . GLY A 1 456 ? 13.717  17.320  25.914  1.00 48.42  ? 456  GLY A CA  1 
ATOM   3501 C C   . GLY A 1 456 ? 13.848  18.771  26.348  1.00 36.56  ? 456  GLY A C   1 
ATOM   3502 O O   . GLY A 1 456 ? 13.190  19.200  27.282  1.00 48.30  ? 456  GLY A O   1 
ATOM   3503 N N   . LEU A 1 457 ? 14.687  19.537  25.665  1.00 34.88  ? 457  LEU A N   1 
ATOM   3504 C CA  . LEU A 1 457 ? 14.898  20.940  26.028  1.00 47.95  ? 457  LEU A CA  1 
ATOM   3505 C C   . LEU A 1 457 ? 13.657  21.832  25.942  1.00 50.57  ? 457  LEU A C   1 
ATOM   3506 O O   . LEU A 1 457 ? 13.566  22.810  26.663  1.00 53.79  ? 457  LEU A O   1 
ATOM   3507 C CB  . LEU A 1 457 ? 16.031  21.567  25.210  1.00 38.26  ? 457  LEU A CB  1 
ATOM   3508 C CG  . LEU A 1 457 ? 17.431  21.536  25.829  1.00 39.98  ? 457  LEU A CG  1 
ATOM   3509 C CD1 . LEU A 1 457 ? 18.071  20.128  25.752  1.00 34.70  ? 457  LEU A CD1 1 
ATOM   3510 C CD2 . LEU A 1 457 ? 18.336  22.623  25.205  1.00 37.69  ? 457  LEU A CD2 1 
ATOM   3511 N N   . PRO A 1 458 ? 12.707  21.514  25.051  1.00 49.08  ? 458  PRO A N   1 
ATOM   3512 C CA  . PRO A 1 458 ? 11.526  22.381  25.013  1.00 53.96  ? 458  PRO A CA  1 
ATOM   3513 C C   . PRO A 1 458 ? 10.774  22.447  26.357  1.00 56.03  ? 458  PRO A C   1 
ATOM   3514 O O   . PRO A 1 458 ? 9.969   23.365  26.547  1.00 46.31  ? 458  PRO A O   1 
ATOM   3515 C CB  . PRO A 1 458 ? 10.659  21.748  23.915  1.00 46.42  ? 458  PRO A CB  1 
ATOM   3516 C CG  . PRO A 1 458 ? 11.626  21.020  23.052  1.00 41.30  ? 458  PRO A CG  1 
ATOM   3517 C CD  . PRO A 1 458 ? 12.673  20.493  23.990  1.00 50.54  ? 458  PRO A CD  1 
ATOM   3518 N N   . LEU A 1 459 ? 11.045  21.511  27.269  1.00 49.18  ? 459  LEU A N   1 
ATOM   3519 C CA  . LEU A 1 459 ? 10.426  21.529  28.597  1.00 48.69  ? 459  LEU A CA  1 
ATOM   3520 C C   . LEU A 1 459 ? 10.986  22.635  29.476  1.00 54.86  ? 459  LEU A C   1 
ATOM   3521 O O   . LEU A 1 459 ? 10.409  22.988  30.508  1.00 61.56  ? 459  LEU A O   1 
ATOM   3522 C CB  . LEU A 1 459 ? 10.601  20.194  29.315  1.00 43.98  ? 459  LEU A CB  1 
ATOM   3523 C CG  . LEU A 1 459 ? 9.761   19.064  28.756  1.00 47.21  ? 459  LEU A CG  1 
ATOM   3524 C CD1 . LEU A 1 459 ? 9.996   18.982  27.274  1.00 58.78  ? 459  LEU A CD1 1 
ATOM   3525 C CD2 . LEU A 1 459 ? 10.167  17.786  29.416  1.00 46.52  ? 459  LEU A CD2 1 
ATOM   3526 N N   . ASP A 1 460 ? 12.128  23.172  29.085  1.00 48.69  ? 460  ASP A N   1 
ATOM   3527 C CA  . ASP A 1 460 ? 12.633  24.324  29.787  1.00 52.67  ? 460  ASP A CA  1 
ATOM   3528 C C   . ASP A 1 460 ? 11.777  25.526  29.395  1.00 55.43  ? 460  ASP A C   1 
ATOM   3529 O O   . ASP A 1 460 ? 11.859  26.017  28.279  1.00 58.87  ? 460  ASP A O   1 
ATOM   3530 C CB  . ASP A 1 460 ? 14.104  24.560  29.477  1.00 50.57  ? 460  ASP A CB  1 
ATOM   3531 C CG  . ASP A 1 460 ? 14.676  25.692  30.288  1.00 59.08  ? 460  ASP A CG  1 
ATOM   3532 O OD1 . ASP A 1 460 ? 13.875  26.497  30.816  1.00 53.80  ? 460  ASP A OD1 1 
ATOM   3533 O OD2 . ASP A 1 460 ? 15.913  25.775  30.409  1.00 68.40  ? 460  ASP A OD2 1 
ATOM   3534 N N   . PRO A 1 461 ? 10.948  25.999  30.327  1.00 56.60  ? 461  PRO A N   1 
ATOM   3535 C CA  . PRO A 1 461 ? 9.951   27.041  30.064  1.00 59.05  ? 461  PRO A CA  1 
ATOM   3536 C C   . PRO A 1 461 ? 10.616  28.294  29.550  1.00 66.05  ? 461  PRO A C   1 
ATOM   3537 O O   . PRO A 1 461 ? 10.047  29.024  28.742  1.00 81.60  ? 461  PRO A O   1 
ATOM   3538 C CB  . PRO A 1 461 ? 9.377   27.341  31.448  1.00 49.08  ? 461  PRO A CB  1 
ATOM   3539 C CG  . PRO A 1 461 ? 9.819   26.230  32.326  1.00 63.03  ? 461  PRO A CG  1 
ATOM   3540 C CD  . PRO A 1 461 ? 11.101  25.729  31.763  1.00 59.85  ? 461  PRO A CD  1 
ATOM   3541 N N   . SER A 1 462 ? 11.824  28.540  30.032  1.00 58.11  ? 462  SER A N   1 
ATOM   3542 C CA  . SER A 1 462 ? 12.543  29.752  29.680  1.00 59.04  ? 462  SER A CA  1 
ATOM   3543 C C   . SER A 1 462 ? 13.158  29.717  28.271  1.00 59.93  ? 462  SER A C   1 
ATOM   3544 O O   . SER A 1 462 ? 13.764  30.691  27.836  1.00 67.09  ? 462  SER A O   1 
ATOM   3545 C CB  . SER A 1 462 ? 13.615  30.038  30.725  1.00 52.45  ? 462  SER A CB  1 
ATOM   3546 O OG  . SER A 1 462 ? 14.769  29.267  30.473  1.00 58.01  ? 462  SER A OG  1 
ATOM   3547 N N   . LEU A 1 463 ? 12.985  28.607  27.558  1.00 58.96  ? 463  LEU A N   1 
ATOM   3548 C CA  . LEU A 1 463 ? 13.501  28.473  26.196  1.00 44.78  ? 463  LEU A CA  1 
ATOM   3549 C C   . LEU A 1 463 ? 12.493  28.870  25.115  1.00 51.06  ? 463  LEU A C   1 
ATOM   3550 O O   . LEU A 1 463 ? 12.777  28.746  23.921  1.00 54.45  ? 463  LEU A O   1 
ATOM   3551 C CB  . LEU A 1 463 ? 13.974  27.043  25.933  1.00 46.41  ? 463  LEU A CB  1 
ATOM   3552 C CG  . LEU A 1 463 ? 15.214  26.541  26.667  1.00 56.31  ? 463  LEU A CG  1 
ATOM   3553 C CD1 . LEU A 1 463 ? 15.595  25.131  26.166  1.00 58.53  ? 463  LEU A CD1 1 
ATOM   3554 C CD2 . LEU A 1 463 ? 16.377  27.529  26.521  1.00 28.27  ? 463  LEU A CD2 1 
ATOM   3555 N N   . ASN A 1 464 ? 11.316  29.336  25.523  1.00 62.47  ? 464  ASN A N   1 
ATOM   3556 C CA  . ASN A 1 464 ? 10.356  29.916  24.571  1.00 77.95  ? 464  ASN A CA  1 
ATOM   3557 C C   . ASN A 1 464 ? 9.902   28.949  23.435  1.00 60.71  ? 464  ASN A C   1 
ATOM   3558 O O   . ASN A 1 464 ? 9.489   29.402  22.368  1.00 55.29  ? 464  ASN A O   1 
ATOM   3559 C CB  . ASN A 1 464 ? 10.867  31.277  23.992  1.00 42.30  ? 464  ASN A CB  1 
ATOM   3560 C CG  . ASN A 1 464 ? 10.976  32.407  25.063  1.00 100.99 ? 464  ASN A CG  1 
ATOM   3561 O OD1 . ASN A 1 464 ? 10.421  32.291  26.152  1.00 92.49  ? 464  ASN A OD1 1 
ATOM   3562 N ND2 . ASN A 1 464 ? 11.691  33.508  24.720  1.00 117.56 ? 464  ASN A ND2 1 
ATOM   3563 N N   . TYR A 1 465 ? 9.969   27.630  23.655  1.00 51.20  ? 465  TYR A N   1 
ATOM   3564 C CA  . TYR A 1 465 ? 9.322   26.680  22.728  1.00 42.57  ? 465  TYR A CA  1 
ATOM   3565 C C   . TYR A 1 465 ? 7.791   26.726  22.850  1.00 53.00  ? 465  TYR A C   1 
ATOM   3566 O O   . TYR A 1 465 ? 7.251   27.241  23.824  1.00 55.76  ? 465  TYR A O   1 
ATOM   3567 C CB  . TYR A 1 465 ? 9.767   25.240  22.977  1.00 34.77  ? 465  TYR A CB  1 
ATOM   3568 C CG  . TYR A 1 465 ? 11.175  24.905  22.560  1.00 35.97  ? 465  TYR A CG  1 
ATOM   3569 C CD1 . TYR A 1 465 ? 11.456  24.442  21.276  1.00 33.89  ? 465  TYR A CD1 1 
ATOM   3570 C CD2 . TYR A 1 465 ? 12.224  25.023  23.460  1.00 42.06  ? 465  TYR A CD2 1 
ATOM   3571 C CE1 . TYR A 1 465 ? 12.756  24.127  20.896  1.00 32.10  ? 465  TYR A CE1 1 
ATOM   3572 C CE2 . TYR A 1 465 ? 13.510  24.714  23.097  1.00 39.58  ? 465  TYR A CE2 1 
ATOM   3573 C CZ  . TYR A 1 465 ? 13.779  24.274  21.816  1.00 33.58  ? 465  TYR A CZ  1 
ATOM   3574 O OH  . TYR A 1 465 ? 15.081  23.968  21.485  1.00 37.98  ? 465  TYR A OH  1 
ATOM   3575 N N   . THR A 1 466 ? 7.093   26.152  21.876  1.00 56.49  ? 466  THR A N   1 
ATOM   3576 C CA  . THR A 1 466 ? 5.633   26.158  21.883  1.00 48.80  ? 466  THR A CA  1 
ATOM   3577 C C   . THR A 1 466 ? 5.082   24.924  22.560  1.00 52.04  ? 466  THR A C   1 
ATOM   3578 O O   . THR A 1 466 ? 5.760   23.904  22.653  1.00 51.95  ? 466  THR A O   1 
ATOM   3579 C CB  . THR A 1 466 ? 5.058   26.151  20.467  1.00 54.40  ? 466  THR A CB  1 
ATOM   3580 O OG1 . THR A 1 466 ? 5.400   24.916  19.821  1.00 51.38  ? 466  THR A OG1 1 
ATOM   3581 C CG2 . THR A 1 466 ? 5.586   27.326  19.665  1.00 47.20  ? 466  THR A CG2 1 
ATOM   3582 N N   . THR A 1 467 ? 3.837   25.020  23.013  1.00 63.06  ? 467  THR A N   1 
ATOM   3583 C CA  . THR A 1 467 ? 3.179   23.911  23.690  1.00 62.41  ? 467  THR A CA  1 
ATOM   3584 C C   . THR A 1 467 ? 3.245   22.602  22.899  1.00 61.62  ? 467  THR A C   1 
ATOM   3585 O O   . THR A 1 467 ? 3.601   21.563  23.452  1.00 62.34  ? 467  THR A O   1 
ATOM   3586 C CB  . THR A 1 467 ? 1.724   24.251  24.009  1.00 68.30  ? 467  THR A CB  1 
ATOM   3587 O OG1 . THR A 1 467 ? 1.677   25.039  25.201  1.00 57.19  ? 467  THR A OG1 1 
ATOM   3588 C CG2 . THR A 1 467 ? 0.927   22.987  24.225  1.00 74.72  ? 467  THR A CG2 1 
ATOM   3589 N N   . GLU A 1 468 ? 2.908   22.661  21.611  1.00 62.87  ? 468  GLU A N   1 
ATOM   3590 C CA  . GLU A 1 468 ? 3.014   21.511  20.704  1.00 54.45  ? 468  GLU A CA  1 
ATOM   3591 C C   . GLU A 1 468 ? 4.386   20.860  20.816  1.00 55.56  ? 468  GLU A C   1 
ATOM   3592 O O   . GLU A 1 468 ? 4.511   19.641  20.968  1.00 66.42  ? 468  GLU A O   1 
ATOM   3593 C CB  . GLU A 1 468 ? 2.796   21.947  19.247  1.00 56.71  ? 468  GLU A CB  1 
ATOM   3594 C CG  . GLU A 1 468 ? 1.381   22.372  18.889  1.00 67.62  ? 468  GLU A CG  1 
ATOM   3595 C CD  . GLU A 1 468 ? 0.946   23.647  19.598  1.00 89.86  ? 468  GLU A CD  1 
ATOM   3596 O OE1 . GLU A 1 468 ? 1.818   24.427  20.041  1.00 98.74  ? 468  GLU A OE1 1 
ATOM   3597 O OE2 . GLU A 1 468 ? -0.277  23.872  19.713  1.00 97.87  ? 468  GLU A OE2 1 
ATOM   3598 N N   . GLU A 1 469 ? 5.413   21.695  20.720  1.00 45.22  ? 469  GLU A N   1 
ATOM   3599 C CA  . GLU A 1 469 ? 6.790   21.259  20.812  1.00 43.25  ? 469  GLU A CA  1 
ATOM   3600 C C   . GLU A 1 469 ? 7.128   20.521  22.112  1.00 53.06  ? 469  GLU A C   1 
ATOM   3601 O O   . GLU A 1 469 ? 7.966   19.616  22.109  1.00 51.40  ? 469  GLU A O   1 
ATOM   3602 C CB  . GLU A 1 469 ? 7.716   22.454  20.599  1.00 46.42  ? 469  GLU A CB  1 
ATOM   3603 C CG  . GLU A 1 469 ? 7.859   22.806  19.128  1.00 48.29  ? 469  GLU A CG  1 
ATOM   3604 C CD  . GLU A 1 469 ? 8.654   24.062  18.880  1.00 52.81  ? 469  GLU A CD  1 
ATOM   3605 O OE1 . GLU A 1 469 ? 8.568   25.002  19.697  1.00 68.98  ? 469  GLU A OE1 1 
ATOM   3606 O OE2 . GLU A 1 469 ? 9.353   24.115  17.852  1.00 47.76  ? 469  GLU A OE2 1 
ATOM   3607 N N   . ARG A 1 470 ? 6.482   20.897  23.215  1.00 45.35  ? 470  ARG A N   1 
ATOM   3608 C CA  . ARG A 1 470 ? 6.688   20.182  24.468  1.00 43.98  ? 470  ARG A CA  1 
ATOM   3609 C C   . ARG A 1 470 ? 6.082   18.787  24.371  1.00 56.58  ? 470  ARG A C   1 
ATOM   3610 O O   . ARG A 1 470 ? 6.748   17.790  24.640  1.00 59.32  ? 470  ARG A O   1 
ATOM   3611 C CB  . ARG A 1 470 ? 6.091   20.946  25.649  1.00 45.28  ? 470  ARG A CB  1 
ATOM   3612 C CG  . ARG A 1 470 ? 6.896   22.152  26.100  1.00 62.40  ? 470  ARG A CG  1 
ATOM   3613 C CD  . ARG A 1 470 ? 6.075   23.108  26.990  1.00 88.90  ? 470  ARG A CD  1 
ATOM   3614 N NE  . ARG A 1 470 ? 6.178   24.497  26.522  1.00 104.56 ? 470  ARG A NE  1 
ATOM   3615 C CZ  . ARG A 1 470 ? 6.948   25.435  27.074  1.00 102.87 ? 470  ARG A CZ  1 
ATOM   3616 N NH1 . ARG A 1 470 ? 7.688   25.156  28.142  1.00 105.85 ? 470  ARG A NH1 1 
ATOM   3617 N NH2 . ARG A 1 470 ? 6.972   26.660  26.563  1.00 92.12  ? 470  ARG A NH2 1 
ATOM   3618 N N   . ILE A 1 471 ? 4.814   18.719  23.977  1.00 54.75  ? 471  ILE A N   1 
ATOM   3619 C CA  . ILE A 1 471 ? 4.170   17.435  23.784  1.00 46.33  ? 471  ILE A CA  1 
ATOM   3620 C C   . ILE A 1 471 ? 5.063   16.598  22.900  1.00 47.05  ? 471  ILE A C   1 
ATOM   3621 O O   . ILE A 1 471 ? 5.303   15.427  23.164  1.00 60.63  ? 471  ILE A O   1 
ATOM   3622 C CB  . ILE A 1 471 ? 2.800   17.568  23.087  1.00 50.42  ? 471  ILE A CB  1 
ATOM   3623 C CG1 . ILE A 1 471 ? 1.907   18.604  23.788  1.00 47.71  ? 471  ILE A CG1 1 
ATOM   3624 C CG2 . ILE A 1 471 ? 2.104   16.209  23.023  1.00 41.27  ? 471  ILE A CG2 1 
ATOM   3625 C CD1 . ILE A 1 471 ? 1.876   18.490  25.292  1.00 57.85  ? 471  ILE A CD1 1 
ATOM   3626 N N   . PHE A 1 472 ? 5.559   17.222  21.842  1.00 43.89  ? 472  PHE A N   1 
ATOM   3627 C CA  . PHE A 1 472 ? 6.350   16.535  20.836  1.00 44.87  ? 472  PHE A CA  1 
ATOM   3628 C C   . PHE A 1 472 ? 7.656   16.055  21.425  1.00 45.88  ? 472  PHE A C   1 
ATOM   3629 O O   . PHE A 1 472 ? 8.011   14.890  21.282  1.00 55.61  ? 472  PHE A O   1 
ATOM   3630 C CB  . PHE A 1 472 ? 6.605   17.471  19.659  1.00 37.03  ? 472  PHE A CB  1 
ATOM   3631 C CG  . PHE A 1 472 ? 7.475   16.884  18.576  1.00 36.00  ? 472  PHE A CG  1 
ATOM   3632 C CD1 . PHE A 1 472 ? 7.143   15.687  17.969  1.00 46.60  ? 472  PHE A CD1 1 
ATOM   3633 C CD2 . PHE A 1 472 ? 8.599   17.566  18.124  1.00 47.47  ? 472  PHE A CD2 1 
ATOM   3634 C CE1 . PHE A 1 472 ? 7.937   15.155  16.952  1.00 44.44  ? 472  PHE A CE1 1 
ATOM   3635 C CE2 . PHE A 1 472 ? 9.396   17.052  17.105  1.00 46.88  ? 472  PHE A CE2 1 
ATOM   3636 C CZ  . PHE A 1 472 ? 9.069   15.839  16.521  1.00 44.38  ? 472  PHE A CZ  1 
ATOM   3637 N N   . ALA A 1 473 ? 8.373   16.947  22.099  1.00 43.96  ? 473  ALA A N   1 
ATOM   3638 C CA  . ALA A 1 473 ? 9.643   16.561  22.707  1.00 41.95  ? 473  ALA A CA  1 
ATOM   3639 C C   . ALA A 1 473 ? 9.429   15.345  23.598  1.00 47.40  ? 473  ALA A C   1 
ATOM   3640 O O   . ALA A 1 473 ? 10.234  14.420  23.611  1.00 47.16  ? 473  ALA A O   1 
ATOM   3641 C CB  . ALA A 1 473 ? 10.242  17.708  23.493  1.00 27.70  ? 473  ALA A CB  1 
ATOM   3642 N N   . GLN A 1 474 ? 8.321   15.350  24.325  1.00 43.30  ? 474  GLN A N   1 
ATOM   3643 C CA  . GLN A 1 474 ? 8.021   14.287  25.270  1.00 45.29  ? 474  GLN A CA  1 
ATOM   3644 C C   . GLN A 1 474 ? 7.777   12.958  24.576  1.00 50.95  ? 474  GLN A C   1 
ATOM   3645 O O   . GLN A 1 474 ? 8.238   11.913  25.034  1.00 53.84  ? 474  GLN A O   1 
ATOM   3646 C CB  . GLN A 1 474 ? 6.810   14.669  26.114  1.00 46.02  ? 474  GLN A CB  1 
ATOM   3647 C CG  . GLN A 1 474 ? 7.066   15.827  27.078  1.00 58.35  ? 474  GLN A CG  1 
ATOM   3648 C CD  . GLN A 1 474 ? 5.834   16.198  27.893  1.00 72.71  ? 474  GLN A CD  1 
ATOM   3649 O OE1 . GLN A 1 474 ? 4.820   16.660  27.351  1.00 78.42  ? 474  GLN A OE1 1 
ATOM   3650 N NE2 . GLN A 1 474 ? 5.918   15.996  29.205  1.00 68.34  ? 474  GLN A NE2 1 
ATOM   3651 N N   . ARG A 1 475 ? 7.044   13.008  23.470  1.00 50.42  ? 475  ARG A N   1 
ATOM   3652 C CA  . ARG A 1 475 ? 6.757   11.825  22.673  1.00 44.12  ? 475  ARG A CA  1 
ATOM   3653 C C   . ARG A 1 475 ? 8.057   11.132  22.278  1.00 48.34  ? 475  ARG A C   1 
ATOM   3654 O O   . ARG A 1 475 ? 8.215   9.919   22.434  1.00 53.67  ? 475  ARG A O   1 
ATOM   3655 C CB  . ARG A 1 475 ? 5.984   12.231  21.421  1.00 43.92  ? 475  ARG A CB  1 
ATOM   3656 C CG  . ARG A 1 475 ? 4.798   11.343  21.118  1.00 48.03  ? 475  ARG A CG  1 
ATOM   3657 C CD  . ARG A 1 475 ? 3.973   11.907  19.975  1.00 55.81  ? 475  ARG A CD  1 
ATOM   3658 N NE  . ARG A 1 475 ? 4.445   11.454  18.671  1.00 57.48  ? 475  ARG A NE  1 
ATOM   3659 C CZ  . ARG A 1 475 ? 4.489   12.224  17.594  1.00 57.12  ? 475  ARG A CZ  1 
ATOM   3660 N NH1 . ARG A 1 475 ? 4.100   13.489  17.668  1.00 60.14  ? 475  ARG A NH1 1 
ATOM   3661 N NH2 . ARG A 1 475 ? 4.933   11.734  16.447  1.00 57.74  ? 475  ARG A NH2 1 
ATOM   3662 N N   . LEU A 1 476 ? 8.986   11.933  21.776  1.00 43.95  ? 476  LEU A N   1 
ATOM   3663 C CA  . LEU A 1 476 ? 10.286  11.456  21.329  1.00 44.32  ? 476  LEU A CA  1 
ATOM   3664 C C   . LEU A 1 476 ? 11.143  10.862  22.433  1.00 40.61  ? 476  LEU A C   1 
ATOM   3665 O O   . LEU A 1 476 ? 11.958  9.992   22.162  1.00 39.95  ? 476  LEU A O   1 
ATOM   3666 C CB  . LEU A 1 476 ? 11.070  12.595  20.657  1.00 45.58  ? 476  LEU A CB  1 
ATOM   3667 C CG  . LEU A 1 476 ? 10.480  13.157  19.371  1.00 37.24  ? 476  LEU A CG  1 
ATOM   3668 C CD1 . LEU A 1 476 ? 11.438  14.129  18.744  1.00 36.63  ? 476  LEU A CD1 1 
ATOM   3669 C CD2 . LEU A 1 476 ? 10.176  12.023  18.421  1.00 44.28  ? 476  LEU A CD2 1 
ATOM   3670 N N   . MET A 1 477 ? 11.018  11.375  23.656  1.00 33.64  ? 477  MET A N   1 
ATOM   3671 C CA  . MET A 1 477 ? 11.771  10.817  24.763  1.00 34.87  ? 477  MET A CA  1 
ATOM   3672 C C   . MET A 1 477 ? 11.176  9.439   25.074  1.00 42.71  ? 477  MET A C   1 
ATOM   3673 O O   . MET A 1 477 ? 11.895  8.457   25.281  1.00 42.52  ? 477  MET A O   1 
ATOM   3674 C CB  . MET A 1 477 ? 11.721  11.745  25.969  1.00 40.56  ? 477  MET A CB  1 
ATOM   3675 C CG  . MET A 1 477 ? 12.437  13.084  25.730  1.00 55.42  ? 477  MET A CG  1 
ATOM   3676 S SD  . MET A 1 477 ? 11.884  14.433  26.816  1.00 47.17  ? 477  MET A SD  1 
ATOM   3677 C CE  . MET A 1 477 ? 12.684  14.060  28.350  1.00 28.18  ? 477  MET A CE  1 
ATOM   3678 N N   . LYS A 1 478 ? 9.852   9.373   25.073  1.00 37.62  ? 478  LYS A N   1 
ATOM   3679 C CA  . LYS A 1 478 ? 9.170   8.109   25.220  1.00 47.03  ? 478  LYS A CA  1 
ATOM   3680 C C   . LYS A 1 478 ? 9.722   7.094   24.220  1.00 50.71  ? 478  LYS A C   1 
ATOM   3681 O O   . LYS A 1 478 ? 9.971   5.953   24.578  1.00 38.74  ? 478  LYS A O   1 
ATOM   3682 C CB  . LYS A 1 478 ? 7.671   8.275   25.007  1.00 52.08  ? 478  LYS A CB  1 
ATOM   3683 C CG  . LYS A 1 478 ? 6.902   8.739   26.210  1.00 57.85  ? 478  LYS A CG  1 
ATOM   3684 C CD  . LYS A 1 478 ? 6.953   7.717   27.324  1.00 62.62  ? 478  LYS A CD  1 
ATOM   3685 C CE  . LYS A 1 478 ? 6.239   8.235   28.567  1.00 52.14  ? 478  LYS A CE  1 
ATOM   3686 N NZ  . LYS A 1 478 ? 6.891   7.756   29.821  1.00 53.58  ? 478  LYS A NZ  1 
ATOM   3687 N N   . TYR A 1 479 ? 9.914   7.501   22.969  1.00 47.91  ? 479  TYR A N   1 
ATOM   3688 C CA  . TYR A 1 479 ? 10.373  6.561   21.946  1.00 40.99  ? 479  TYR A CA  1 
ATOM   3689 C C   . TYR A 1 479 ? 11.764  6.053   22.253  1.00 41.42  ? 479  TYR A C   1 
ATOM   3690 O O   . TYR A 1 479 ? 12.006  4.846   22.347  1.00 53.97  ? 479  TYR A O   1 
ATOM   3691 C CB  . TYR A 1 479 ? 10.435  7.234   20.594  1.00 39.78  ? 479  TYR A CB  1 
ATOM   3692 C CG  . TYR A 1 479 ? 9.105   7.515   19.964  1.00 47.89  ? 479  TYR A CG  1 
ATOM   3693 C CD1 . TYR A 1 479 ? 8.044   6.621   20.083  1.00 46.33  ? 479  TYR A CD1 1 
ATOM   3694 C CD2 . TYR A 1 479 ? 8.916   8.676   19.218  1.00 43.47  ? 479  TYR A CD2 1 
ATOM   3695 C CE1 . TYR A 1 479 ? 6.815   6.892   19.478  1.00 49.59  ? 479  TYR A CE1 1 
ATOM   3696 C CE2 . TYR A 1 479 ? 7.707   8.962   18.625  1.00 49.63  ? 479  TYR A CE2 1 
ATOM   3697 C CZ  . TYR A 1 479 ? 6.654   8.073   18.745  1.00 53.62  ? 479  TYR A CZ  1 
ATOM   3698 O OH  . TYR A 1 479 ? 5.447   8.383   18.132  1.00 51.03  ? 479  TYR A OH  1 
ATOM   3699 N N   . TRP A 1 480 ? 12.682  7.000   22.374  1.00 34.39  ? 480  TRP A N   1 
ATOM   3700 C CA  . TRP A 1 480 ? 14.068  6.708   22.687  1.00 46.94  ? 480  TRP A CA  1 
ATOM   3701 C C   . TRP A 1 480 ? 14.140  5.849   23.940  1.00 55.28  ? 480  TRP A C   1 
ATOM   3702 O O   . TRP A 1 480 ? 14.720  4.759   23.933  1.00 41.80  ? 480  TRP A O   1 
ATOM   3703 C CB  . TRP A 1 480 ? 14.848  8.017   22.875  1.00 39.70  ? 480  TRP A CB  1 
ATOM   3704 C CG  . TRP A 1 480 ? 15.683  8.389   21.661  1.00 42.94  ? 480  TRP A CG  1 
ATOM   3705 C CD1 . TRP A 1 480 ? 17.050  8.495   21.596  1.00 36.37  ? 480  TRP A CD1 1 
ATOM   3706 C CD2 . TRP A 1 480 ? 15.204  8.664   20.339  1.00 40.49  ? 480  TRP A CD2 1 
ATOM   3707 N NE1 . TRP A 1 480 ? 17.442  8.823   20.316  1.00 41.14  ? 480  TRP A NE1 1 
ATOM   3708 C CE2 . TRP A 1 480 ? 16.328  8.940   19.531  1.00 24.77  ? 480  TRP A CE2 1 
ATOM   3709 C CE3 . TRP A 1 480 ? 13.934  8.691   19.757  1.00 35.76  ? 480  TRP A CE3 1 
ATOM   3710 C CZ2 . TRP A 1 480 ? 16.215  9.253   18.192  1.00 38.41  ? 480  TRP A CZ2 1 
ATOM   3711 C CZ3 . TRP A 1 480 ? 13.826  8.997   18.433  1.00 28.06  ? 480  TRP A CZ3 1 
ATOM   3712 C CH2 . TRP A 1 480 ? 14.956  9.293   17.662  1.00 25.66  ? 480  TRP A CH2 1 
ATOM   3713 N N   . THR A 1 481 ? 13.518  6.329   25.011  1.00 53.83  ? 481  THR A N   1 
ATOM   3714 C CA  . THR A 1 481 ? 13.614  5.631   26.279  1.00 45.79  ? 481  THR A CA  1 
ATOM   3715 C C   . THR A 1 481 ? 12.869  4.302   26.292  1.00 42.53  ? 481  THR A C   1 
ATOM   3716 O O   . THR A 1 481 ? 13.243  3.424   27.048  1.00 49.43  ? 481  THR A O   1 
ATOM   3717 C CB  . THR A 1 481 ? 13.200  6.517   27.477  1.00 40.96  ? 481  THR A CB  1 
ATOM   3718 O OG1 . THR A 1 481 ? 11.827  6.884   27.351  1.00 55.76  ? 481  THR A OG1 1 
ATOM   3719 C CG2 . THR A 1 481 ? 14.037  7.776   27.512  1.00 34.80  ? 481  THR A CG2 1 
ATOM   3720 N N   . ASN A 1 482 ? 11.829  4.144   25.474  1.00 43.76  ? 482  ASN A N   1 
ATOM   3721 C CA  . ASN A 1 482 ? 11.162  2.827   25.338  1.00 50.86  ? 482  ASN A CA  1 
ATOM   3722 C C   . ASN A 1 482 ? 12.087  1.847   24.625  1.00 52.78  ? 482  ASN A C   1 
ATOM   3723 O O   . ASN A 1 482 ? 12.203  0.690   25.012  1.00 41.24  ? 482  ASN A O   1 
ATOM   3724 C CB  . ASN A 1 482 ? 9.843   2.894   24.545  1.00 38.22  ? 482  ASN A CB  1 
ATOM   3725 C CG  . ASN A 1 482 ? 8.664   3.374   25.374  1.00 45.00  ? 482  ASN A CG  1 
ATOM   3726 O OD1 . ASN A 1 482 ? 8.615   3.190   26.584  1.00 54.59  ? 482  ASN A OD1 1 
ATOM   3727 N ND2 . ASN A 1 482 ? 7.700   3.992   24.713  1.00 51.99  ? 482  ASN A ND2 1 
ATOM   3728 N N   . PHE A 1 483 ? 12.724  2.326   23.560  1.00 51.57  ? 483  PHE A N   1 
ATOM   3729 C CA  . PHE A 1 483 ? 13.669  1.525   22.810  1.00 43.46  ? 483  PHE A CA  1 
ATOM   3730 C C   . PHE A 1 483 ? 14.812  1.086   23.701  1.00 56.08  ? 483  PHE A C   1 
ATOM   3731 O O   . PHE A 1 483 ? 15.224  -0.079  23.665  1.00 61.62  ? 483  PHE A O   1 
ATOM   3732 C CB  . PHE A 1 483 ? 14.214  2.300   21.608  1.00 37.66  ? 483  PHE A CB  1 
ATOM   3733 C CG  . PHE A 1 483 ? 15.277  1.556   20.843  1.00 46.56  ? 483  PHE A CG  1 
ATOM   3734 C CD1 . PHE A 1 483 ? 14.935  0.497   19.997  1.00 35.26  ? 483  PHE A CD1 1 
ATOM   3735 C CD2 . PHE A 1 483 ? 16.619  1.901   20.978  1.00 34.16  ? 483  PHE A CD2 1 
ATOM   3736 C CE1 . PHE A 1 483 ? 15.908  -0.201  19.305  1.00 43.19  ? 483  PHE A CE1 1 
ATOM   3737 C CE2 . PHE A 1 483 ? 17.608  1.200   20.287  1.00 44.78  ? 483  PHE A CE2 1 
ATOM   3738 C CZ  . PHE A 1 483 ? 17.247  0.144   19.441  1.00 47.46  ? 483  PHE A CZ  1 
ATOM   3739 N N   . ALA A 1 484 ? 15.330  2.018   24.497  1.00 53.40  ? 484  ALA A N   1 
ATOM   3740 C CA  . ALA A 1 484 ? 16.372  1.679   25.454  1.00 57.54  ? 484  ALA A CA  1 
ATOM   3741 C C   . ALA A 1 484 ? 15.929  0.527   26.365  1.00 53.74  ? 484  ALA A C   1 
ATOM   3742 O O   . ALA A 1 484 ? 16.666  -0.447  26.539  1.00 51.10  ? 484  ALA A O   1 
ATOM   3743 C CB  . ALA A 1 484 ? 16.765  2.879   26.265  1.00 32.97  ? 484  ALA A CB  1 
ATOM   3744 N N   . ARG A 1 485 ? 14.722  0.634   26.922  1.00 47.86  ? 485  ARG A N   1 
ATOM   3745 C CA  . ARG A 1 485 ? 14.194  -0.377  27.850  1.00 56.83  ? 485  ARG A CA  1 
ATOM   3746 C C   . ARG A 1 485 ? 13.994  -1.777  27.241  1.00 47.48  ? 485  ARG A C   1 
ATOM   3747 O O   . ARG A 1 485 ? 14.260  -2.785  27.878  1.00 44.65  ? 485  ARG A O   1 
ATOM   3748 C CB  . ARG A 1 485 ? 12.862  0.091   28.464  1.00 67.71  ? 485  ARG A CB  1 
ATOM   3749 C CG  . ARG A 1 485 ? 12.963  1.094   29.622  1.00 78.05  ? 485  ARG A CG  1 
ATOM   3750 C CD  . ARG A 1 485 ? 11.566  1.528   30.132  1.00 86.07  ? 485  ARG A CD  1 
ATOM   3751 N NE  . ARG A 1 485 ? 10.925  2.511   29.249  1.00 91.47  ? 485  ARG A NE  1 
ATOM   3752 C CZ  . ARG A 1 485 ? 10.913  3.833   29.451  1.00 88.85  ? 485  ARG A CZ  1 
ATOM   3753 N NH1 . ARG A 1 485 ? 11.489  4.362   30.529  1.00 78.51  ? 485  ARG A NH1 1 
ATOM   3754 N NH2 . ARG A 1 485 ? 10.314  4.635   28.573  1.00 87.22  ? 485  ARG A NH2 1 
ATOM   3755 N N   . THR A 1 486 ? 13.536  -1.824  26.000  1.00 42.09  ? 486  THR A N   1 
ATOM   3756 C CA  . THR A 1 486 ? 12.910  -3.014  25.468  1.00 48.52  ? 486  THR A CA  1 
ATOM   3757 C C   . THR A 1 486 ? 13.414  -3.376  24.081  1.00 53.10  ? 486  THR A C   1 
ATOM   3758 O O   . THR A 1 486 ? 13.221  -4.492  23.624  1.00 55.67  ? 486  THR A O   1 
ATOM   3759 C CB  . THR A 1 486 ? 11.409  -2.779  25.346  1.00 53.58  ? 486  THR A CB  1 
ATOM   3760 O OG1 . THR A 1 486 ? 11.167  -1.850  24.282  1.00 51.26  ? 486  THR A OG1 1 
ATOM   3761 C CG2 . THR A 1 486 ? 10.857  -2.207  26.638  1.00 45.61  ? 486  THR A CG2 1 
ATOM   3762 N N   . GLY A 1 487 ? 14.049  -2.424  23.411  1.00 74.65  ? 487  GLY A N   1 
ATOM   3763 C CA  . GLY A 1 487 ? 14.527  -2.644  22.059  1.00 80.51  ? 487  GLY A CA  1 
ATOM   3764 C C   . GLY A 1 487 ? 13.449  -2.327  21.041  1.00 71.81  ? 487  GLY A C   1 
ATOM   3765 O O   . GLY A 1 487 ? 13.612  -2.555  19.846  1.00 63.56  ? 487  GLY A O   1 
ATOM   3766 N N   . ASP A 1 488 ? 12.343  -1.786  21.531  1.00 72.05  ? 488  ASP A N   1 
ATOM   3767 C CA  . ASP A 1 488 ? 11.209  -1.430  20.698  1.00 69.74  ? 488  ASP A CA  1 
ATOM   3768 C C   . ASP A 1 488 ? 10.706  -0.065  21.155  1.00 47.22  ? 488  ASP A C   1 
ATOM   3769 O O   . ASP A 1 488 ? 10.407  0.124   22.327  1.00 60.66  ? 488  ASP A O   1 
ATOM   3770 C CB  . ASP A 1 488 ? 10.127  -2.498  20.863  1.00 67.47  ? 488  ASP A CB  1 
ATOM   3771 C CG  . ASP A 1 488 ? 8.856   -2.168  20.124  1.00 65.38  ? 488  ASP A CG  1 
ATOM   3772 O OD1 . ASP A 1 488 ? 8.737   -1.038  19.603  1.00 59.63  ? 488  ASP A OD1 1 
ATOM   3773 O OD2 . ASP A 1 488 ? 7.971   -3.043  20.078  1.00 56.65  ? 488  ASP A OD2 1 
ATOM   3774 N N   . PRO A 1 489 ? 10.630  0.898   20.234  1.00 46.40  ? 489  PRO A N   1 
ATOM   3775 C CA  . PRO A 1 489 ? 10.252  2.279   20.579  1.00 50.97  ? 489  PRO A CA  1 
ATOM   3776 C C   . PRO A 1 489 ? 8.775   2.445   20.918  1.00 55.13  ? 489  PRO A C   1 
ATOM   3777 O O   . PRO A 1 489 ? 8.401   3.456   21.497  1.00 68.08  ? 489  PRO A O   1 
ATOM   3778 C CB  . PRO A 1 489 ? 10.587  3.066   19.309  1.00 50.24  ? 489  PRO A CB  1 
ATOM   3779 C CG  . PRO A 1 489 ? 10.520  2.044   18.203  1.00 53.05  ? 489  PRO A CG  1 
ATOM   3780 C CD  . PRO A 1 489 ? 10.964  0.741   18.809  1.00 49.98  ? 489  PRO A CD  1 
ATOM   3781 N N   . ASN A 1 490 ? 7.951   1.463   20.577  1.00 50.30  ? 490  ASN A N   1 
ATOM   3782 C CA  . ASN A 1 490 ? 6.513   1.581   20.786  1.00 53.08  ? 490  ASN A CA  1 
ATOM   3783 C C   . ASN A 1 490 ? 6.102   1.471   22.237  1.00 61.84  ? 490  ASN A C   1 
ATOM   3784 O O   . ASN A 1 490 ? 6.888   1.059   23.094  1.00 71.06  ? 490  ASN A O   1 
ATOM   3785 C CB  . ASN A 1 490 ? 5.745   0.557   19.945  1.00 54.95  ? 490  ASN A CB  1 
ATOM   3786 C CG  . ASN A 1 490 ? 5.892   0.797   18.448  1.00 62.56  ? 490  ASN A CG  1 
ATOM   3787 O OD1 . ASN A 1 490 ? 5.256   1.695   17.891  1.00 58.39  ? 490  ASN A OD1 1 
ATOM   3788 N ND2 . ASN A 1 490 ? 6.731   -0.011  17.788  1.00 54.83  ? 490  ASN A ND2 1 
ATOM   3789 N N   . ASP A 1 491 ? 4.856   1.843   22.504  1.00 68.27  ? 491  ASP A N   1 
ATOM   3790 C CA  . ASP A 1 491 ? 4.285   1.760   23.840  1.00 72.71  ? 491  ASP A CA  1 
ATOM   3791 C C   . ASP A 1 491 ? 3.252   0.636   23.861  1.00 85.13  ? 491  ASP A C   1 
ATOM   3792 O O   . ASP A 1 491 ? 2.379   0.583   22.991  1.00 84.51  ? 491  ASP A O   1 
ATOM   3793 C CB  . ASP A 1 491 ? 3.619   3.095   24.191  1.00 86.01  ? 491  ASP A CB  1 
ATOM   3794 C CG  . ASP A 1 491 ? 3.724   3.439   25.668  1.00 104.74 ? 491  ASP A CG  1 
ATOM   3795 O OD1 . ASP A 1 491 ? 3.489   2.551   26.522  1.00 105.82 ? 491  ASP A OD1 1 
ATOM   3796 O OD2 . ASP A 1 491 ? 4.050   4.608   25.971  1.00 108.23 ? 491  ASP A OD2 1 
ATOM   3797 N N   . PRO A 1 492 ? 3.360   -0.285  24.834  1.00 98.72  ? 492  PRO A N   1 
ATOM   3798 C CA  . PRO A 1 492 ? 2.348   -1.343  24.998  1.00 105.49 ? 492  PRO A CA  1 
ATOM   3799 C C   . PRO A 1 492 ? 1.022   -0.797  25.529  1.00 117.25 ? 492  PRO A C   1 
ATOM   3800 O O   . PRO A 1 492 ? -0.036  -1.367  25.251  1.00 114.71 ? 492  PRO A O   1 
ATOM   3801 C CB  . PRO A 1 492 ? 2.981   -2.285  26.034  1.00 97.76  ? 492  PRO A CB  1 
ATOM   3802 C CG  . PRO A 1 492 ? 4.451   -1.982  25.990  1.00 99.78  ? 492  PRO A CG  1 
ATOM   3803 C CD  . PRO A 1 492 ? 4.539   -0.514  25.687  1.00 98.45  ? 492  PRO A CD  1 
ATOM   3804 N N   . ARG A 1 493 ? 1.092   0.307   26.273  1.00 129.90 ? 493  ARG A N   1 
ATOM   3805 C CA  . ARG A 1 493 ? -0.068  0.878   26.962  1.00 135.05 ? 493  ARG A CA  1 
ATOM   3806 C C   . ARG A 1 493 ? -0.824  1.910   26.122  1.00 142.93 ? 493  ARG A C   1 
ATOM   3807 O O   . ARG A 1 493 ? -2.049  2.023   26.233  1.00 152.16 ? 493  ARG A O   1 
ATOM   3808 C CB  . ARG A 1 493 ? 0.350   1.495   28.303  1.00 126.97 ? 493  ARG A CB  1 
ATOM   3809 N N   . ASP A 1 494 ? -0.096  2.666   25.298  1.00 134.96 ? 494  ASP A N   1 
ATOM   3810 C CA  . ASP A 1 494 ? -0.715  3.597   24.350  1.00 124.58 ? 494  ASP A CA  1 
ATOM   3811 C C   . ASP A 1 494 ? -0.923  2.903   23.010  1.00 128.83 ? 494  ASP A C   1 
ATOM   3812 O O   . ASP A 1 494 ? -0.696  3.492   21.954  1.00 129.62 ? 494  ASP A O   1 
ATOM   3813 C CB  . ASP A 1 494 ? 0.145   4.850   24.163  1.00 105.96 ? 494  ASP A CB  1 
ATOM   3814 N N   . SER A 1 495 ? -1.372  1.651   23.075  1.00 136.91 ? 495  SER A N   1 
ATOM   3815 C CA  . SER A 1 495 ? -1.420  0.747   21.924  1.00 141.02 ? 495  SER A CA  1 
ATOM   3816 C C   . SER A 1 495 ? -2.267  1.227   20.742  1.00 146.54 ? 495  SER A C   1 
ATOM   3817 O O   . SER A 1 495 ? -2.049  0.796   19.606  1.00 145.37 ? 495  SER A O   1 
ATOM   3818 C CB  . SER A 1 495 ? -1.889  -0.644  22.369  1.00 144.64 ? 495  SER A CB  1 
ATOM   3819 N N   . LYS A 1 496 ? -3.229  2.108   21.010  1.00 150.93 ? 496  LYS A N   1 
ATOM   3820 C CA  . LYS A 1 496 ? -4.101  2.646   19.961  1.00 150.72 ? 496  LYS A CA  1 
ATOM   3821 C C   . LYS A 1 496 ? -3.370  3.610   19.009  1.00 146.19 ? 496  LYS A C   1 
ATOM   3822 O O   . LYS A 1 496 ? -3.713  3.710   17.824  1.00 142.64 ? 496  LYS A O   1 
ATOM   3823 C CB  . LYS A 1 496 ? -5.325  3.329   20.579  1.00 149.79 ? 496  LYS A CB  1 
ATOM   3824 N N   . SER A 1 497 ? -2.364  4.309   19.535  1.00 138.92 ? 497  SER A N   1 
ATOM   3825 C CA  . SER A 1 497 ? -1.552  5.239   18.748  1.00 120.23 ? 497  SER A CA  1 
ATOM   3826 C C   . SER A 1 497 ? -0.870  4.522   17.587  1.00 109.17 ? 497  SER A C   1 
ATOM   3827 O O   . SER A 1 497 ? -0.567  3.329   17.681  1.00 113.04 ? 497  SER A O   1 
ATOM   3828 C CB  . SER A 1 497 ? -0.485  5.904   19.627  1.00 111.14 ? 497  SER A CB  1 
ATOM   3829 O OG  . SER A 1 497 ? -0.925  6.059   20.967  1.00 117.35 ? 497  SER A OG  1 
ATOM   3830 N N   . PRO A 1 498 ? -0.602  5.255   16.494  1.00 93.95  ? 498  PRO A N   1 
ATOM   3831 C CA  . PRO A 1 498 ? 0.042   4.661   15.321  1.00 83.78  ? 498  PRO A CA  1 
ATOM   3832 C C   . PRO A 1 498 ? 1.251   3.850   15.754  1.00 78.99  ? 498  PRO A C   1 
ATOM   3833 O O   . PRO A 1 498 ? 1.988   4.308   16.628  1.00 78.89  ? 498  PRO A O   1 
ATOM   3834 C CB  . PRO A 1 498 ? 0.504   5.883   14.522  1.00 83.19  ? 498  PRO A CB  1 
ATOM   3835 C CG  . PRO A 1 498 ? -0.393  6.979   14.939  1.00 83.02  ? 498  PRO A CG  1 
ATOM   3836 C CD  . PRO A 1 498 ? -0.727  6.718   16.377  1.00 90.62  ? 498  PRO A CD  1 
ATOM   3837 N N   . GLN A 1 499 ? 1.441   2.670   15.169  1.00 75.50  ? 499  GLN A N   1 
ATOM   3838 C CA  . GLN A 1 499 ? 2.606   1.837   15.467  1.00 63.88  ? 499  GLN A CA  1 
ATOM   3839 C C   . GLN A 1 499 ? 3.777   2.244   14.612  1.00 65.76  ? 499  GLN A C   1 
ATOM   3840 O O   . GLN A 1 499 ? 3.595   2.848   13.557  1.00 74.96  ? 499  GLN A O   1 
ATOM   3841 C CB  . GLN A 1 499 ? 2.310   0.359   15.231  1.00 73.68  ? 499  GLN A CB  1 
ATOM   3842 C CG  . GLN A 1 499 ? 1.421   -0.250  16.297  1.00 92.11  ? 499  GLN A CG  1 
ATOM   3843 C CD  . GLN A 1 499 ? 2.141   -0.369  17.620  1.00 95.64  ? 499  GLN A CD  1 
ATOM   3844 O OE1 . GLN A 1 499 ? 3.217   -0.971  17.695  1.00 86.54  ? 499  GLN A OE1 1 
ATOM   3845 N NE2 . GLN A 1 499 ? 1.567   0.220   18.670  1.00 67.08  ? 499  GLN A NE2 1 
ATOM   3846 N N   . TRP A 1 500 ? 4.978   1.913   15.079  1.00 53.97  ? 500  TRP A N   1 
ATOM   3847 C CA  . TRP A 1 500 ? 6.207   2.195   14.356  1.00 44.13  ? 500  TRP A CA  1 
ATOM   3848 C C   . TRP A 1 500 ? 6.788   0.864   13.920  1.00 54.70  ? 500  TRP A C   1 
ATOM   3849 O O   . TRP A 1 500 ? 7.441   0.176   14.702  1.00 64.14  ? 500  TRP A O   1 
ATOM   3850 C CB  . TRP A 1 500 ? 7.192   2.963   15.251  1.00 47.93  ? 500  TRP A CB  1 
ATOM   3851 C CG  . TRP A 1 500 ? 8.501   3.353   14.610  1.00 48.20  ? 500  TRP A CG  1 
ATOM   3852 C CD1 . TRP A 1 500 ? 8.991   2.939   13.400  1.00 54.37  ? 500  TRP A CD1 1 
ATOM   3853 C CD2 . TRP A 1 500 ? 9.486   4.239   15.157  1.00 48.62  ? 500  TRP A CD2 1 
ATOM   3854 N NE1 . TRP A 1 500 ? 10.218  3.512   13.164  1.00 53.00  ? 500  TRP A NE1 1 
ATOM   3855 C CE2 . TRP A 1 500 ? 10.544  4.315   14.227  1.00 43.39  ? 500  TRP A CE2 1 
ATOM   3856 C CE3 . TRP A 1 500 ? 9.574   4.979   16.343  1.00 44.60  ? 500  TRP A CE3 1 
ATOM   3857 C CZ2 . TRP A 1 500 ? 11.671  5.101   14.446  1.00 36.02  ? 500  TRP A CZ2 1 
ATOM   3858 C CZ3 . TRP A 1 500 ? 10.691  5.764   16.554  1.00 35.04  ? 500  TRP A CZ3 1 
ATOM   3859 C CH2 . TRP A 1 500 ? 11.726  5.817   15.611  1.00 30.94  ? 500  TRP A CH2 1 
ATOM   3860 N N   . PRO A 1 501 ? 6.536   0.487   12.663  1.00 54.31  ? 501  PRO A N   1 
ATOM   3861 C CA  . PRO A 1 501 ? 6.972   -0.816  12.172  1.00 53.19  ? 501  PRO A CA  1 
ATOM   3862 C C   . PRO A 1 501 ? 8.472   -0.812  11.988  1.00 47.12  ? 501  PRO A C   1 
ATOM   3863 O O   . PRO A 1 501 ? 9.038   0.253   11.760  1.00 57.10  ? 501  PRO A O   1 
ATOM   3864 C CB  . PRO A 1 501 ? 6.274   -0.913  10.818  1.00 61.19  ? 501  PRO A CB  1 
ATOM   3865 C CG  . PRO A 1 501 ? 6.174   0.503   10.363  1.00 57.01  ? 501  PRO A CG  1 
ATOM   3866 C CD  . PRO A 1 501 ? 5.908   1.296   11.605  1.00 58.04  ? 501  PRO A CD  1 
ATOM   3867 N N   . PRO A 1 502 ? 9.114   -1.984  12.099  1.00 44.77  ? 502  PRO A N   1 
ATOM   3868 C CA  . PRO A 1 502 ? 10.551  -2.093  11.844  1.00 41.29  ? 502  PRO A CA  1 
ATOM   3869 C C   . PRO A 1 502 ? 10.850  -1.880  10.358  1.00 51.52  ? 502  PRO A C   1 
ATOM   3870 O O   . PRO A 1 502 ? 9.997   -2.100  9.507   1.00 42.12  ? 502  PRO A O   1 
ATOM   3871 C CB  . PRO A 1 502 ? 10.871  -3.541  12.218  1.00 45.78  ? 502  PRO A CB  1 
ATOM   3872 C CG  . PRO A 1 502 ? 9.663   -4.073  12.901  1.00 54.14  ? 502  PRO A CG  1 
ATOM   3873 C CD  . PRO A 1 502 ? 8.509   -3.290  12.394  1.00 48.63  ? 502  PRO A CD  1 
ATOM   3874 N N   . TYR A 1 503 ? 12.057  -1.437  10.048  1.00 38.10  ? 503  TYR A N   1 
ATOM   3875 C CA  . TYR A 1 503 ? 12.463  -1.331  8.664   1.00 48.46  ? 503  TYR A CA  1 
ATOM   3876 C C   . TYR A 1 503 ? 12.889  -2.713  8.159   1.00 54.27  ? 503  TYR A C   1 
ATOM   3877 O O   . TYR A 1 503 ? 13.620  -3.437  8.832   1.00 47.12  ? 503  TYR A O   1 
ATOM   3878 C CB  . TYR A 1 503 ? 13.599  -0.320  8.549   1.00 33.14  ? 503  TYR A CB  1 
ATOM   3879 C CG  . TYR A 1 503 ? 14.191  -0.145  7.177   1.00 43.00  ? 503  TYR A CG  1 
ATOM   3880 C CD1 . TYR A 1 503 ? 13.633  0.737   6.264   1.00 48.56  ? 503  TYR A CD1 1 
ATOM   3881 C CD2 . TYR A 1 503 ? 15.345  -0.827  6.809   1.00 57.69  ? 503  TYR A CD2 1 
ATOM   3882 C CE1 . TYR A 1 503 ? 14.201  0.923   5.013   1.00 52.07  ? 503  TYR A CE1 1 
ATOM   3883 C CE2 . TYR A 1 503 ? 15.919  -0.650  5.564   1.00 51.99  ? 503  TYR A CE2 1 
ATOM   3884 C CZ  . TYR A 1 503 ? 15.346  0.225   4.671   1.00 48.84  ? 503  TYR A CZ  1 
ATOM   3885 O OH  . TYR A 1 503 ? 15.925  0.404   3.435   1.00 42.97  ? 503  TYR A OH  1 
ATOM   3886 N N   . THR A 1 504 ? 12.425  -3.069  6.969   1.00 59.56  ? 504  THR A N   1 
ATOM   3887 C CA  . THR A 1 504 ? 12.720  -4.371  6.401   1.00 49.22  ? 504  THR A CA  1 
ATOM   3888 C C   . THR A 1 504 ? 13.040  -4.276  4.915   1.00 55.11  ? 504  THR A C   1 
ATOM   3889 O O   . THR A 1 504 ? 12.496  -3.436  4.201   1.00 59.26  ? 504  THR A O   1 
ATOM   3890 C CB  . THR A 1 504 ? 11.542  -5.322  6.603   1.00 53.78  ? 504  THR A CB  1 
ATOM   3891 O OG1 . THR A 1 504 ? 10.422  -4.879  5.821   1.00 59.20  ? 504  THR A OG1 1 
ATOM   3892 C CG2 . THR A 1 504 ? 11.156  -5.347  8.058   1.00 50.54  ? 504  THR A CG2 1 
ATOM   3893 N N   . THR A 1 505 ? 13.924  -5.144  4.444   1.00 50.79  ? 505  THR A N   1 
ATOM   3894 C CA  . THR A 1 505 ? 14.280  -5.109  3.042   1.00 62.91  ? 505  THR A CA  1 
ATOM   3895 C C   . THR A 1 505 ? 13.039  -5.276  2.176   1.00 69.00  ? 505  THR A C   1 
ATOM   3896 O O   . THR A 1 505 ? 12.947  -4.686  1.106   1.00 77.18  ? 505  THR A O   1 
ATOM   3897 C CB  . THR A 1 505 ? 15.368  -6.140  2.700   1.00 67.35  ? 505  THR A CB  1 
ATOM   3898 O OG1 . THR A 1 505 ? 14.885  -7.468  2.941   1.00 66.15  ? 505  THR A OG1 1 
ATOM   3899 C CG2 . THR A 1 505 ? 16.610  -5.876  3.553   1.00 60.10  ? 505  THR A CG2 1 
ATOM   3900 N N   . ALA A 1 506 ? 12.070  -6.046  2.660   1.00 69.96  ? 506  ALA A N   1 
ATOM   3901 C CA  . ALA A 1 506 ? 10.835  -6.269  1.911   1.00 73.62  ? 506  ALA A CA  1 
ATOM   3902 C C   . ALA A 1 506 ? 9.958   -5.025  1.781   1.00 75.78  ? 506  ALA A C   1 
ATOM   3903 O O   . ALA A 1 506 ? 9.382   -4.798  0.721   1.00 82.74  ? 506  ALA A O   1 
ATOM   3904 C CB  . ALA A 1 506 ? 10.035  -7.420  2.506   1.00 71.10  ? 506  ALA A CB  1 
ATOM   3905 N N   . ALA A 1 507 ? 9.850   -4.220  2.838   1.00 61.22  ? 507  ALA A N   1 
ATOM   3906 C CA  . ALA A 1 507 ? 8.935   -3.077  2.795   1.00 60.73  ? 507  ALA A CA  1 
ATOM   3907 C C   . ALA A 1 507 ? 9.567   -1.711  3.098   1.00 64.36  ? 507  ALA A C   1 
ATOM   3908 O O   . ALA A 1 507 ? 8.921   -0.674  2.944   1.00 70.42  ? 507  ALA A O   1 
ATOM   3909 C CB  . ALA A 1 507 ? 7.752   -3.319  3.702   1.00 59.57  ? 507  ALA A CB  1 
ATOM   3910 N N   . GLN A 1 508 ? 10.809  -1.711  3.556   1.00 57.23  ? 508  GLN A N   1 
ATOM   3911 C CA  . GLN A 1 508 ? 11.562  -0.470  3.697   1.00 60.76  ? 508  GLN A CA  1 
ATOM   3912 C C   . GLN A 1 508 ? 10.752  0.610   4.401   1.00 57.98  ? 508  GLN A C   1 
ATOM   3913 O O   . GLN A 1 508 ? 10.875  1.795   4.108   1.00 47.63  ? 508  GLN A O   1 
ATOM   3914 C CB  . GLN A 1 508 ? 12.019  0.009   2.324   1.00 56.64  ? 508  GLN A CB  1 
ATOM   3915 C CG  . GLN A 1 508 ? 12.380  -1.143  1.398   1.00 70.89  ? 508  GLN A CG  1 
ATOM   3916 C CD  . GLN A 1 508 ? 12.967  -0.666  0.099   1.00 79.47  ? 508  GLN A CD  1 
ATOM   3917 O OE1 . GLN A 1 508 ? 13.545  0.418   0.038   1.00 81.33  ? 508  GLN A OE1 1 
ATOM   3918 N NE2 . GLN A 1 508 ? 12.817  -1.464  -0.955  1.00 81.21  ? 508  GLN A NE2 1 
ATOM   3919 N N   . GLN A 1 509 ? 9.927   0.174   5.344   1.00 60.55  ? 509  GLN A N   1 
ATOM   3920 C CA  . GLN A 1 509 ? 9.105   1.071   6.142   1.00 52.75  ? 509  GLN A CA  1 
ATOM   3921 C C   . GLN A 1 509 ? 9.879   1.915   7.139   1.00 46.96  ? 509  GLN A C   1 
ATOM   3922 O O   . GLN A 1 509 ? 10.860  1.460   7.735   1.00 47.56  ? 509  GLN A O   1 
ATOM   3923 C CB  . GLN A 1 509 ? 8.059   0.269   6.892   1.00 43.39  ? 509  GLN A CB  1 
ATOM   3924 C CG  . GLN A 1 509 ? 6.759   0.226   6.184   1.00 60.47  ? 509  GLN A CG  1 
ATOM   3925 C CD  . GLN A 1 509 ? 5.875   -0.827  6.745   1.00 66.33  ? 509  GLN A CD  1 
ATOM   3926 O OE1 . GLN A 1 509 ? 4.702   -0.584  7.017   1.00 84.50  ? 509  GLN A OE1 1 
ATOM   3927 N NE2 . GLN A 1 509 ? 6.428   -2.019  6.934   1.00 63.03  ? 509  GLN A NE2 1 
ATOM   3928 N N   . TYR A 1 510 ? 9.401   3.144   7.332   1.00 43.94  ? 510  TYR A N   1 
ATOM   3929 C CA  . TYR A 1 510 ? 10.000  4.073   8.283   1.00 41.70  ? 510  TYR A CA  1 
ATOM   3930 C C   . TYR A 1 510 ? 8.991   5.173   8.598   1.00 49.46  ? 510  TYR A C   1 
ATOM   3931 O O   . TYR A 1 510 ? 8.084   5.423   7.810   1.00 70.08  ? 510  TYR A O   1 
ATOM   3932 C CB  . TYR A 1 510 ? 11.292  4.666   7.714   1.00 29.33  ? 510  TYR A CB  1 
ATOM   3933 C CG  . TYR A 1 510 ? 11.082  5.650   6.583   1.00 42.74  ? 510  TYR A CG  1 
ATOM   3934 C CD1 . TYR A 1 510 ? 11.014  5.219   5.266   1.00 38.76  ? 510  TYR A CD1 1 
ATOM   3935 C CD2 . TYR A 1 510 ? 10.958  7.018   6.838   1.00 44.48  ? 510  TYR A CD2 1 
ATOM   3936 C CE1 . TYR A 1 510 ? 10.829  6.116   4.238   1.00 59.23  ? 510  TYR A CE1 1 
ATOM   3937 C CE2 . TYR A 1 510 ? 10.776  7.924   5.820   1.00 47.37  ? 510  TYR A CE2 1 
ATOM   3938 C CZ  . TYR A 1 510 ? 10.708  7.472   4.513   1.00 61.55  ? 510  TYR A CZ  1 
ATOM   3939 O OH  . TYR A 1 510 ? 10.513  8.368   3.473   1.00 56.99  ? 510  TYR A OH  1 
ATOM   3940 N N   . VAL A 1 511 ? 9.136   5.824   9.746   1.00 39.48  ? 511  VAL A N   1 
ATOM   3941 C CA  . VAL A 1 511 ? 8.156   6.823   10.159  1.00 45.39  ? 511  VAL A CA  1 
ATOM   3942 C C   . VAL A 1 511 ? 8.641   8.273   10.049  1.00 42.22  ? 511  VAL A C   1 
ATOM   3943 O O   . VAL A 1 511 ? 9.828   8.576   10.176  1.00 46.15  ? 511  VAL A O   1 
ATOM   3944 C CB  . VAL A 1 511 ? 7.651   6.578   11.615  1.00 51.46  ? 511  VAL A CB  1 
ATOM   3945 C CG1 . VAL A 1 511 ? 6.898   5.258   11.715  1.00 44.97  ? 511  VAL A CG1 1 
ATOM   3946 C CG2 . VAL A 1 511 ? 8.809   6.622   12.603  1.00 49.19  ? 511  VAL A CG2 1 
ATOM   3947 N N   . SER A 1 512 ? 7.695   9.165   9.826   1.00 32.04  ? 512  SER A N   1 
ATOM   3948 C CA  . SER A 1 512 ? 7.947   10.593  9.916   1.00 43.55  ? 512  SER A CA  1 
ATOM   3949 C C   . SER A 1 512 ? 7.835   11.064  11.373  1.00 53.00  ? 512  SER A C   1 
ATOM   3950 O O   . SER A 1 512 ? 6.878   10.727  12.068  1.00 62.68  ? 512  SER A O   1 
ATOM   3951 C CB  . SER A 1 512 ? 6.956   11.356  9.027   1.00 30.94  ? 512  SER A CB  1 
ATOM   3952 O OG  . SER A 1 512 ? 5.598   11.066  9.367   1.00 41.30  ? 512  SER A OG  1 
ATOM   3953 N N   . LEU A 1 513 ? 8.816   11.839  11.830  1.00 56.07  ? 513  LEU A N   1 
ATOM   3954 C CA  . LEU A 1 513 ? 8.785   12.439  13.166  1.00 51.91  ? 513  LEU A CA  1 
ATOM   3955 C C   . LEU A 1 513 ? 8.536   13.961  13.108  1.00 44.37  ? 513  LEU A C   1 
ATOM   3956 O O   . LEU A 1 513 ? 9.410   14.751  12.711  1.00 39.69  ? 513  LEU A O   1 
ATOM   3957 C CB  . LEU A 1 513 ? 10.067  12.106  13.953  1.00 51.92  ? 513  LEU A CB  1 
ATOM   3958 C CG  . LEU A 1 513 ? 10.375  10.636  14.292  1.00 47.43  ? 513  LEU A CG  1 
ATOM   3959 C CD1 . LEU A 1 513 ? 11.673  10.489  15.078  1.00 39.09  ? 513  LEU A CD1 1 
ATOM   3960 C CD2 . LEU A 1 513 ? 9.244   10.015  15.076  1.00 44.94  ? 513  LEU A CD2 1 
ATOM   3961 N N   . ASN A 1 514 ? 7.322   14.351  13.485  1.00 49.44  ? 514  ASN A N   1 
ATOM   3962 C CA  . ASN A 1 514 ? 6.902   15.748  13.498  1.00 45.43  ? 514  ASN A CA  1 
ATOM   3963 C C   . ASN A 1 514 ? 5.668   15.919  14.381  1.00 54.36  ? 514  ASN A C   1 
ATOM   3964 O O   . ASN A 1 514 ? 5.222   14.964  15.021  1.00 58.83  ? 514  ASN A O   1 
ATOM   3965 C CB  . ASN A 1 514 ? 6.604   16.243  12.083  1.00 41.94  ? 514  ASN A CB  1 
ATOM   3966 C CG  . ASN A 1 514 ? 5.480   15.465  11.415  1.00 49.68  ? 514  ASN A CG  1 
ATOM   3967 O OD1 . ASN A 1 514 ? 4.318   15.619  11.767  1.00 65.49  ? 514  ASN A OD1 1 
ATOM   3968 N ND2 . ASN A 1 514 ? 5.824   14.633  10.436  1.00 49.90  ? 514  ASN A ND2 1 
ATOM   3969 N N   . LEU A 1 515 ? 5.115   17.131  14.403  1.00 40.95  ? 515  LEU A N   1 
ATOM   3970 C CA  . LEU A 1 515 ? 3.999   17.465  15.284  1.00 42.50  ? 515  LEU A CA  1 
ATOM   3971 C C   . LEU A 1 515 ? 2.758   16.609  15.084  1.00 41.74  ? 515  LEU A C   1 
ATOM   3972 O O   . LEU A 1 515 ? 1.941   16.467  15.986  1.00 73.20  ? 515  LEU A O   1 
ATOM   3973 C CB  . LEU A 1 515 ? 3.630   18.941  15.143  1.00 55.00  ? 515  LEU A CB  1 
ATOM   3974 C CG  . LEU A 1 515 ? 4.751   19.952  15.365  1.00 51.91  ? 515  LEU A CG  1 
ATOM   3975 C CD1 . LEU A 1 515 ? 4.173   21.331  15.545  1.00 47.20  ? 515  LEU A CD1 1 
ATOM   3976 C CD2 . LEU A 1 515 ? 5.568   19.568  16.569  1.00 58.78  ? 515  LEU A CD2 1 
ATOM   3977 N N   . LYS A 1 516 ? 2.611   16.044  13.897  1.00 60.74  ? 516  LYS A N   1 
ATOM   3978 C CA  . LYS A 1 516 ? 1.479   15.177  13.610  1.00 47.85  ? 516  LYS A CA  1 
ATOM   3979 C C   . LYS A 1 516 ? 1.792   13.759  14.047  1.00 46.99  ? 516  LYS A C   1 
ATOM   3980 O O   . LYS A 1 516 ? 2.947   13.363  14.153  1.00 45.36  ? 516  LYS A O   1 
ATOM   3981 C CB  . LYS A 1 516 ? 1.134   15.227  12.128  1.00 53.30  ? 516  LYS A CB  1 
ATOM   3982 C CG  . LYS A 1 516 ? 0.495   16.549  11.682  1.00 75.42  ? 516  LYS A CG  1 
ATOM   3983 C CD  . LYS A 1 516 ? 1.117   17.089  10.383  1.00 96.35  ? 516  LYS A CD  1 
ATOM   3984 C CE  . LYS A 1 516 ? 0.937   16.133  9.198   1.00 106.75 ? 516  LYS A CE  1 
ATOM   3985 N NZ  . LYS A 1 516 ? 1.561   16.643  7.933   1.00 109.40 ? 516  LYS A NZ  1 
ATOM   3986 N N   . PRO A 1 517 ? 0.753   12.982  14.311  1.00 52.66  ? 517  PRO A N   1 
ATOM   3987 C CA  . PRO A 1 517 ? 0.963   11.607  14.764  1.00 51.05  ? 517  PRO A CA  1 
ATOM   3988 C C   . PRO A 1 517 ? 1.817   10.868  13.748  1.00 57.31  ? 517  PRO A C   1 
ATOM   3989 O O   . PRO A 1 517 ? 1.838   11.269  12.586  1.00 61.69  ? 517  PRO A O   1 
ATOM   3990 C CB  . PRO A 1 517 ? -0.450  11.032  14.784  1.00 47.45  ? 517  PRO A CB  1 
ATOM   3991 C CG  . PRO A 1 517 ? -1.369  12.261  14.859  1.00 44.33  ? 517  PRO A CG  1 
ATOM   3992 C CD  . PRO A 1 517 ? -0.662  13.294  14.059  1.00 45.31  ? 517  PRO A CD  1 
ATOM   3993 N N   . LEU A 1 518 ? 2.498   9.812   14.183  1.00 51.97  ? 518  LEU A N   1 
ATOM   3994 C CA  . LEU A 1 518 ? 3.377   9.024   13.320  1.00 51.03  ? 518  LEU A CA  1 
ATOM   3995 C C   . LEU A 1 518 ? 2.767   8.613   11.988  1.00 54.61  ? 518  LEU A C   1 
ATOM   3996 O O   . LEU A 1 518 ? 1.680   8.020   11.944  1.00 59.55  ? 518  LEU A O   1 
ATOM   3997 C CB  . LEU A 1 518 ? 3.788   7.735   14.021  1.00 40.40  ? 518  LEU A CB  1 
ATOM   3998 C CG  . LEU A 1 518 ? 4.886   7.702   15.068  1.00 43.59  ? 518  LEU A CG  1 
ATOM   3999 C CD1 . LEU A 1 518 ? 5.351   6.254   15.167  1.00 46.74  ? 518  LEU A CD1 1 
ATOM   4000 C CD2 . LEU A 1 518 ? 6.038   8.635   14.715  1.00 48.26  ? 518  LEU A CD2 1 
ATOM   4001 N N   . GLU A 1 519 ? 3.497   8.880   10.910  1.00 50.70  ? 519  GLU A N   1 
ATOM   4002 C CA  . GLU A 1 519 ? 3.099   8.423   9.580   1.00 57.95  ? 519  GLU A CA  1 
ATOM   4003 C C   . GLU A 1 519 ? 4.109   7.423   9.054   1.00 53.14  ? 519  GLU A C   1 
ATOM   4004 O O   . GLU A 1 519 ? 5.313   7.651   9.165   1.00 54.19  ? 519  GLU A O   1 
ATOM   4005 C CB  . GLU A 1 519 ? 3.012   9.601   8.623   1.00 59.92  ? 519  GLU A CB  1 
ATOM   4006 C CG  . GLU A 1 519 ? 3.151   9.201   7.183   1.00 74.92  ? 519  GLU A CG  1 
ATOM   4007 C CD  . GLU A 1 519 ? 2.637   10.271  6.252   1.00 88.85  ? 519  GLU A CD  1 
ATOM   4008 O OE1 . GLU A 1 519 ? 1.506   10.749  6.491   1.00 104.31 ? 519  GLU A OE1 1 
ATOM   4009 O OE2 . GLU A 1 519 ? 3.361   10.644  5.302   1.00 81.54  ? 519  GLU A OE2 1 
ATOM   4010 N N   . VAL A 1 520 ? 3.639   6.315   8.491   1.00 46.09  ? 520  VAL A N   1 
ATOM   4011 C CA  . VAL A 1 520 ? 4.576   5.306   7.992   1.00 50.66  ? 520  VAL A CA  1 
ATOM   4012 C C   . VAL A 1 520 ? 4.842   5.468   6.510   1.00 60.11  ? 520  VAL A C   1 
ATOM   4013 O O   . VAL A 1 520 ? 3.905   5.626   5.718   1.00 61.85  ? 520  VAL A O   1 
ATOM   4014 C CB  . VAL A 1 520 ? 4.091   3.881   8.221   1.00 50.47  ? 520  VAL A CB  1 
ATOM   4015 C CG1 . VAL A 1 520 ? 5.017   2.908   7.508   1.00 41.58  ? 520  VAL A CG1 1 
ATOM   4016 C CG2 . VAL A 1 520 ? 4.029   3.579   9.703   1.00 54.65  ? 520  VAL A CG2 1 
ATOM   4017 N N   . ARG A 1 521 ? 6.120   5.422   6.138   1.00 55.78  ? 521  ARG A N   1 
ATOM   4018 C CA  . ARG A 1 521 ? 6.522   5.598   4.744   1.00 51.21  ? 521  ARG A CA  1 
ATOM   4019 C C   . ARG A 1 521 ? 7.386   4.444   4.260   1.00 50.53  ? 521  ARG A C   1 
ATOM   4020 O O   . ARG A 1 521 ? 7.996   3.733   5.060   1.00 51.23  ? 521  ARG A O   1 
ATOM   4021 C CB  . ARG A 1 521 ? 7.246   6.935   4.554   1.00 48.49  ? 521  ARG A CB  1 
ATOM   4022 C CG  . ARG A 1 521 ? 6.349   8.130   4.843   1.00 51.05  ? 521  ARG A CG  1 
ATOM   4023 C CD  . ARG A 1 521 ? 7.056   9.440   4.628   1.00 50.30  ? 521  ARG A CD  1 
ATOM   4024 N NE  . ARG A 1 521 ? 6.318   10.570  5.177   1.00 45.17  ? 521  ARG A NE  1 
ATOM   4025 C CZ  . ARG A 1 521 ? 6.904   11.690  5.596   1.00 52.62  ? 521  ARG A CZ  1 
ATOM   4026 N NH1 . ARG A 1 521 ? 8.219   11.820  5.507   1.00 49.66  ? 521  ARG A NH1 1 
ATOM   4027 N NH2 . ARG A 1 521 ? 6.187   12.681  6.106   1.00 42.56  ? 521  ARG A NH2 1 
ATOM   4028 N N   . ARG A 1 522 ? 7.427   4.265   2.945   1.00 48.34  ? 522  ARG A N   1 
ATOM   4029 C CA  . ARG A 1 522 ? 8.222   3.211   2.337   1.00 49.84  ? 522  ARG A CA  1 
ATOM   4030 C C   . ARG A 1 522 ? 9.368   3.765   1.491   1.00 54.93  ? 522  ARG A C   1 
ATOM   4031 O O   . ARG A 1 522 ? 9.144   4.558   0.571   1.00 57.48  ? 522  ARG A O   1 
ATOM   4032 C CB  . ARG A 1 522 ? 7.333   2.330   1.459   1.00 56.11  ? 522  ARG A CB  1 
ATOM   4033 C CG  . ARG A 1 522 ? 6.248   1.546   2.198   1.00 68.86  ? 522  ARG A CG  1 
ATOM   4034 C CD  . ARG A 1 522 ? 5.722   0.408   1.318   1.00 87.72  ? 522  ARG A CD  1 
ATOM   4035 N NE  . ARG A 1 522 ? 6.811   -0.474  0.884   1.00 99.18  ? 522  ARG A NE  1 
ATOM   4036 C CZ  . ARG A 1 522 ? 6.902   -1.031  -0.322  1.00 96.99  ? 522  ARG A CZ  1 
ATOM   4037 N NH1 . ARG A 1 522 ? 5.964   -0.806  -1.232  1.00 100.34 ? 522  ARG A NH1 1 
ATOM   4038 N NH2 . ARG A 1 522 ? 7.935   -1.813  -0.621  1.00 88.49  ? 522  ARG A NH2 1 
ATOM   4039 N N   . GLY A 1 523 ? 10.589  3.338   1.803   1.00 52.31  ? 523  GLY A N   1 
ATOM   4040 C CA  . GLY A 1 523 ? 11.768  3.650   1.002   1.00 48.86  ? 523  GLY A CA  1 
ATOM   4041 C C   . GLY A 1 523 ? 12.560  4.911   1.343   1.00 48.48  ? 523  GLY A C   1 
ATOM   4042 O O   . GLY A 1 523 ? 12.178  6.020   0.973   1.00 59.73  ? 523  GLY A O   1 
ATOM   4043 N N   . LEU A 1 524 ? 13.683  4.741   2.030   1.00 45.36  ? 524  LEU A N   1 
ATOM   4044 C CA  . LEU A 1 524 ? 14.603  5.845   2.289   1.00 42.92  ? 524  LEU A CA  1 
ATOM   4045 C C   . LEU A 1 524 ? 15.238  6.321   1.002   1.00 53.44  ? 524  LEU A C   1 
ATOM   4046 O O   . LEU A 1 524 ? 16.192  5.694   0.534   1.00 59.80  ? 524  LEU A O   1 
ATOM   4047 C CB  . LEU A 1 524 ? 15.740  5.375   3.183   1.00 52.85  ? 524  LEU A CB  1 
ATOM   4048 C CG  . LEU A 1 524 ? 15.519  5.346   4.689   1.00 64.07  ? 524  LEU A CG  1 
ATOM   4049 C CD1 . LEU A 1 524 ? 14.347  6.251   5.061   1.00 69.83  ? 524  LEU A CD1 1 
ATOM   4050 C CD2 . LEU A 1 524 ? 15.322  3.911   5.159   1.00 60.19  ? 524  LEU A CD2 1 
ATOM   4051 N N   . ARG A 1 525 ? 14.742  7.431   0.452   1.00 53.56  ? 525  ARG A N   1 
ATOM   4052 C CA  . ARG A 1 525 ? 15.229  7.951   -0.829  1.00 56.26  ? 525  ARG A CA  1 
ATOM   4053 C C   . ARG A 1 525 ? 15.775  6.825   -1.692  1.00 66.44  ? 525  ARG A C   1 
ATOM   4054 O O   . ARG A 1 525 ? 16.893  6.902   -2.205  1.00 74.42  ? 525  ARG A O   1 
ATOM   4055 C CB  . ARG A 1 525 ? 16.271  9.052   -0.620  1.00 56.42  ? 525  ARG A CB  1 
ATOM   4056 C CG  . ARG A 1 525 ? 15.644  10.424  -0.694  1.00 63.12  ? 525  ARG A CG  1 
ATOM   4057 C CD  . ARG A 1 525 ? 16.548  11.530  -0.244  1.00 63.38  ? 525  ARG A CD  1 
ATOM   4058 N NE  . ARG A 1 525 ? 15.735  12.683  0.148   1.00 74.98  ? 525  ARG A NE  1 
ATOM   4059 C CZ  . ARG A 1 525 ? 16.220  13.869  0.511   1.00 76.28  ? 525  ARG A CZ  1 
ATOM   4060 N NH1 . ARG A 1 525 ? 17.527  14.081  0.538   1.00 55.20  ? 525  ARG A NH1 1 
ATOM   4061 N NH2 . ARG A 1 525 ? 15.392  14.851  0.851   1.00 92.06  ? 525  ARG A NH2 1 
ATOM   4062 N N   . ALA A 1 526 ? 14.954  5.785   -1.832  1.00 58.75  ? 526  ALA A N   1 
ATOM   4063 C CA  . ALA A 1 526 ? 15.313  4.518   -2.463  1.00 43.54  ? 526  ALA A CA  1 
ATOM   4064 C C   . ALA A 1 526 ? 16.009  4.633   -3.823  1.00 48.19  ? 526  ALA A C   1 
ATOM   4065 O O   . ALA A 1 526 ? 17.116  4.128   -3.998  1.00 69.59  ? 526  ALA A O   1 
ATOM   4066 C CB  . ALA A 1 526 ? 14.078  3.655   -2.584  1.00 36.10  ? 526  ALA A CB  1 
ATOM   4067 N N   . GLN A 1 527 ? 15.353  5.284   -4.778  1.00 38.85  ? 527  GLN A N   1 
ATOM   4068 C CA  . GLN A 1 527 ? 15.886  5.448   -6.129  1.00 47.89  ? 527  GLN A CA  1 
ATOM   4069 C C   . GLN A 1 527 ? 17.203  6.227   -6.180  1.00 51.93  ? 527  GLN A C   1 
ATOM   4070 O O   . GLN A 1 527 ? 18.175  5.768   -6.774  1.00 69.41  ? 527  GLN A O   1 
ATOM   4071 C CB  . GLN A 1 527 ? 14.845  6.114   -7.028  1.00 49.06  ? 527  GLN A CB  1 
ATOM   4072 C CG  . GLN A 1 527 ? 14.911  5.685   -8.475  1.00 58.95  ? 527  GLN A CG  1 
ATOM   4073 C CD  . GLN A 1 527 ? 14.431  4.267   -8.689  1.00 65.48  ? 527  GLN A CD  1 
ATOM   4074 O OE1 . GLN A 1 527 ? 13.716  3.704   -7.850  1.00 62.41  ? 527  GLN A OE1 1 
ATOM   4075 N NE2 . GLN A 1 527 ? 14.814  3.678   -9.824  1.00 69.30  ? 527  GLN A NE2 1 
ATOM   4076 N N   . THR A 1 528 ? 17.232  7.406   -5.568  1.00 54.61  ? 528  THR A N   1 
ATOM   4077 C CA  . THR A 1 528 ? 18.447  8.220   -5.507  1.00 51.05  ? 528  THR A CA  1 
ATOM   4078 C C   . THR A 1 528 ? 19.588  7.528   -4.766  1.00 47.78  ? 528  THR A C   1 
ATOM   4079 O O   . THR A 1 528 ? 20.756  7.795   -5.018  1.00 60.83  ? 528  THR A O   1 
ATOM   4080 C CB  . THR A 1 528 ? 18.176  9.572   -4.821  1.00 52.01  ? 528  THR A CB  1 
ATOM   4081 O OG1 . THR A 1 528 ? 17.313  10.361  -5.642  1.00 47.63  ? 528  THR A OG1 1 
ATOM   4082 C CG2 . THR A 1 528 ? 19.475  10.340  -4.577  1.00 46.41  ? 528  THR A CG2 1 
ATOM   4083 N N   . CYS A 1 529 ? 19.259  6.647   -3.834  1.00 54.94  ? 529  CYS A N   1 
ATOM   4084 C CA  . CYS A 1 529 ? 20.300  5.940   -3.086  1.00 43.05  ? 529  CYS A CA  1 
ATOM   4085 C C   . CYS A 1 529 ? 20.814  4.729   -3.842  1.00 50.73  ? 529  CYS A C   1 
ATOM   4086 O O   . CYS A 1 529 ? 21.919  4.256   -3.584  1.00 59.04  ? 529  CYS A O   1 
ATOM   4087 C CB  . CYS A 1 529 ? 19.812  5.558   -1.697  1.00 35.47  ? 529  CYS A CB  1 
ATOM   4088 S SG  . CYS A 1 529 ? 19.964  6.920   -0.510  1.00 60.00  ? 529  CYS A SG  1 
ATOM   4089 N N   . ALA A 1 530 ? 20.018  4.234   -4.784  1.00 39.06  ? 530  ALA A N   1 
ATOM   4090 C CA  . ALA A 1 530 ? 20.508  3.216   -5.692  1.00 46.35  ? 530  ALA A CA  1 
ATOM   4091 C C   . ALA A 1 530 ? 21.655  3.811   -6.489  1.00 51.76  ? 530  ALA A C   1 
ATOM   4092 O O   . ALA A 1 530 ? 22.625  3.123   -6.816  1.00 48.81  ? 530  ALA A O   1 
ATOM   4093 C CB  . ALA A 1 530 ? 19.406  2.740   -6.612  1.00 41.77  ? 530  ALA A CB  1 
ATOM   4094 N N   . PHE A 1 531 ? 21.538  5.103   -6.789  1.00 54.12  ? 531  PHE A N   1 
ATOM   4095 C CA  . PHE A 1 531 ? 22.573  5.819   -7.531  1.00 51.49  ? 531  PHE A CA  1 
ATOM   4096 C C   . PHE A 1 531 ? 23.865  5.877   -6.731  1.00 55.50  ? 531  PHE A C   1 
ATOM   4097 O O   . PHE A 1 531 ? 24.894  5.369   -7.175  1.00 54.82  ? 531  PHE A O   1 
ATOM   4098 C CB  . PHE A 1 531 ? 22.104  7.228   -7.897  1.00 45.68  ? 531  PHE A CB  1 
ATOM   4099 C CG  . PHE A 1 531 ? 23.192  8.109   -8.468  1.00 47.86  ? 531  PHE A CG  1 
ATOM   4100 C CD1 . PHE A 1 531 ? 23.610  7.962   -9.778  1.00 54.81  ? 531  PHE A CD1 1 
ATOM   4101 C CD2 . PHE A 1 531 ? 23.770  9.098   -7.702  1.00 50.46  ? 531  PHE A CD2 1 
ATOM   4102 C CE1 . PHE A 1 531 ? 24.591  8.767   -10.303 1.00 55.36  ? 531  PHE A CE1 1 
ATOM   4103 C CE2 . PHE A 1 531 ? 24.754  9.916   -8.226  1.00 52.05  ? 531  PHE A CE2 1 
ATOM   4104 C CZ  . PHE A 1 531 ? 25.165  9.753   -9.519  1.00 56.14  ? 531  PHE A CZ  1 
ATOM   4105 N N   . TRP A 1 532 ? 23.793  6.477   -5.543  1.00 48.83  ? 532  TRP A N   1 
ATOM   4106 C CA  . TRP A 1 532 ? 24.965  6.650   -4.688  1.00 49.17  ? 532  TRP A CA  1 
ATOM   4107 C C   . TRP A 1 532 ? 25.505  5.335   -4.180  1.00 50.09  ? 532  TRP A C   1 
ATOM   4108 O O   . TRP A 1 532 ? 26.708  5.152   -4.097  1.00 52.41  ? 532  TRP A O   1 
ATOM   4109 C CB  . TRP A 1 532 ? 24.645  7.518   -3.477  1.00 38.48  ? 532  TRP A CB  1 
ATOM   4110 C CG  . TRP A 1 532 ? 24.313  8.946   -3.780  1.00 39.74  ? 532  TRP A CG  1 
ATOM   4111 C CD1 . TRP A 1 532 ? 23.065  9.503   -3.845  1.00 44.33  ? 532  TRP A CD1 1 
ATOM   4112 C CD2 . TRP A 1 532 ? 25.241  10.009  -4.043  1.00 41.83  ? 532  TRP A CD2 1 
ATOM   4113 N NE1 . TRP A 1 532 ? 23.160  10.846  -4.134  1.00 48.08  ? 532  TRP A NE1 1 
ATOM   4114 C CE2 . TRP A 1 532 ? 24.483  11.182  -4.259  1.00 42.84  ? 532  TRP A CE2 1 
ATOM   4115 C CE3 . TRP A 1 532 ? 26.636  10.081  -4.130  1.00 34.26  ? 532  TRP A CE3 1 
ATOM   4116 C CZ2 . TRP A 1 532 ? 25.073  12.408  -4.552  1.00 43.46  ? 532  TRP A CZ2 1 
ATOM   4117 C CZ3 . TRP A 1 532 ? 27.220  11.298  -4.408  1.00 43.87  ? 532  TRP A CZ3 1 
ATOM   4118 C CH2 . TRP A 1 532 ? 26.439  12.447  -4.621  1.00 49.22  ? 532  TRP A CH2 1 
ATOM   4119 N N   . ASN A 1 533 ? 24.609  4.420   -3.837  1.00 57.48  ? 533  ASN A N   1 
ATOM   4120 C CA  . ASN A 1 533 ? 25.000  3.203   -3.134  1.00 46.28  ? 533  ASN A CA  1 
ATOM   4121 C C   . ASN A 1 533 ? 25.287  2.016   -4.032  1.00 48.50  ? 533  ASN A C   1 
ATOM   4122 O O   . ASN A 1 533 ? 25.965  1.071   -3.612  1.00 57.53  ? 533  ASN A O   1 
ATOM   4123 C CB  . ASN A 1 533 ? 23.940  2.815   -2.105  1.00 40.07  ? 533  ASN A CB  1 
ATOM   4124 C CG  . ASN A 1 533 ? 23.886  3.769   -0.935  1.00 50.41  ? 533  ASN A CG  1 
ATOM   4125 O OD1 . ASN A 1 533 ? 24.812  4.544   -0.711  1.00 49.62  ? 533  ASN A OD1 1 
ATOM   4126 N ND2 . ASN A 1 533 ? 22.805  3.704   -0.167  1.00 58.67  ? 533  ASN A ND2 1 
ATOM   4127 N N   . ARG A 1 534 ? 24.769  2.060   -5.256  1.00 45.05  ? 534  ARG A N   1 
ATOM   4128 C CA  . ARG A 1 534 ? 24.874  0.927   -6.171  1.00 49.30  ? 534  ARG A CA  1 
ATOM   4129 C C   . ARG A 1 534 ? 25.609  1.250   -7.461  1.00 56.11  ? 534  ARG A C   1 
ATOM   4130 O O   . ARG A 1 534 ? 26.438  0.470   -7.926  1.00 60.79  ? 534  ARG A O   1 
ATOM   4131 C CB  . ARG A 1 534 ? 23.490  0.395   -6.520  1.00 51.25  ? 534  ARG A CB  1 
ATOM   4132 C CG  . ARG A 1 534 ? 22.855  -0.434  -5.434  1.00 52.53  ? 534  ARG A CG  1 
ATOM   4133 C CD  . ARG A 1 534 ? 21.444  -0.839  -5.823  1.00 51.54  ? 534  ARG A CD  1 
ATOM   4134 N NE  . ARG A 1 534 ? 20.667  -1.239  -4.653  1.00 59.43  ? 534  ARG A NE  1 
ATOM   4135 C CZ  . ARG A 1 534 ? 20.573  -2.488  -4.202  1.00 68.54  ? 534  ARG A CZ  1 
ATOM   4136 N NH1 . ARG A 1 534 ? 21.204  -3.477  -4.830  1.00 78.18  ? 534  ARG A NH1 1 
ATOM   4137 N NH2 . ARG A 1 534 ? 19.838  -2.751  -3.126  1.00 58.67  ? 534  ARG A NH2 1 
ATOM   4138 N N   . PHE A 1 535 ? 25.300  2.389   -8.059  1.00 51.74  ? 535  PHE A N   1 
ATOM   4139 C CA  . PHE A 1 535 ? 25.933  2.706   -9.324  1.00 55.78  ? 535  PHE A CA  1 
ATOM   4140 C C   . PHE A 1 535 ? 27.304  3.330   -9.165  1.00 57.28  ? 535  PHE A C   1 
ATOM   4141 O O   . PHE A 1 535 ? 28.277  2.831   -9.713  1.00 71.81  ? 535  PHE A O   1 
ATOM   4142 C CB  . PHE A 1 535 ? 25.056  3.607   -10.185 1.00 45.15  ? 535  PHE A CB  1 
ATOM   4143 C CG  . PHE A 1 535 ? 25.717  4.028   -11.448 1.00 39.42  ? 535  PHE A CG  1 
ATOM   4144 C CD1 . PHE A 1 535 ? 25.937  3.117   -12.460 1.00 39.61  ? 535  PHE A CD1 1 
ATOM   4145 C CD2 . PHE A 1 535 ? 26.146  5.339   -11.623 1.00 59.15  ? 535  PHE A CD2 1 
ATOM   4146 C CE1 . PHE A 1 535 ? 26.557  3.497   -13.626 1.00 40.38  ? 535  PHE A CE1 1 
ATOM   4147 C CE2 . PHE A 1 535 ? 26.770  5.735   -12.803 1.00 51.02  ? 535  PHE A CE2 1 
ATOM   4148 C CZ  . PHE A 1 535 ? 26.975  4.815   -13.801 1.00 50.73  ? 535  PHE A CZ  1 
ATOM   4149 N N   . LEU A 1 536 ? 27.375  4.425   -8.421  1.00 55.75  ? 536  LEU A N   1 
ATOM   4150 C CA  . LEU A 1 536 ? 28.603  5.214   -8.309  1.00 50.04  ? 536  LEU A CA  1 
ATOM   4151 C C   . LEU A 1 536 ? 29.866  4.415   -7.998  1.00 63.21  ? 536  LEU A C   1 
ATOM   4152 O O   . LEU A 1 536 ? 30.937  4.700   -8.543  1.00 70.68  ? 536  LEU A O   1 
ATOM   4153 C CB  . LEU A 1 536 ? 28.424  6.315   -7.277  1.00 48.52  ? 536  LEU A CB  1 
ATOM   4154 C CG  . LEU A 1 536 ? 28.808  7.681   -7.841  1.00 66.83  ? 536  LEU A CG  1 
ATOM   4155 C CD1 . LEU A 1 536 ? 28.152  7.883   -9.196  1.00 68.37  ? 536  LEU A CD1 1 
ATOM   4156 C CD2 . LEU A 1 536 ? 28.417  8.794   -6.889  1.00 70.84  ? 536  LEU A CD2 1 
ATOM   4157 N N   . PRO A 1 537 ? 29.748  3.419   -7.109  1.00 66.39  ? 537  PRO A N   1 
ATOM   4158 C CA  . PRO A 1 537 ? 30.839  2.506   -6.745  1.00 62.48  ? 537  PRO A CA  1 
ATOM   4159 C C   . PRO A 1 537 ? 31.286  1.632   -7.910  1.00 66.61  ? 537  PRO A C   1 
ATOM   4160 O O   . PRO A 1 537 ? 32.458  1.279   -7.983  1.00 81.55  ? 537  PRO A O   1 
ATOM   4161 C CB  . PRO A 1 537 ? 30.218  1.637   -5.660  1.00 61.47  ? 537  PRO A CB  1 
ATOM   4162 C CG  . PRO A 1 537 ? 29.114  2.456   -5.116  1.00 66.66  ? 537  PRO A CG  1 
ATOM   4163 C CD  . PRO A 1 537 ? 28.558  3.206   -6.274  1.00 66.21  ? 537  PRO A CD  1 
ATOM   4164 N N   . LYS A 1 538 ? 30.363  1.276   -8.795  1.00 58.97  ? 538  LYS A N   1 
ATOM   4165 C CA  . LYS A 1 538 ? 30.714  0.577   -10.023 1.00 60.32  ? 538  LYS A CA  1 
ATOM   4166 C C   . LYS A 1 538 ? 31.425  1.522   -10.978 1.00 64.19  ? 538  LYS A C   1 
ATOM   4167 O O   . LYS A 1 538 ? 32.321  1.118   -11.720 1.00 61.42  ? 538  LYS A O   1 
ATOM   4168 C CB  . LYS A 1 538 ? 29.468  0.018   -10.710 1.00 68.18  ? 538  LYS A CB  1 
ATOM   4169 C CG  . LYS A 1 538 ? 28.869  -1.189  -10.027 1.00 81.72  ? 538  LYS A CG  1 
ATOM   4170 C CD  . LYS A 1 538 ? 29.869  -2.338  -9.981  1.00 100.33 ? 538  LYS A CD  1 
ATOM   4171 C CE  . LYS A 1 538 ? 29.257  -3.591  -9.366  1.00 100.24 ? 538  LYS A CE  1 
ATOM   4172 N NZ  . LYS A 1 538 ? 28.093  -4.068  -10.161 1.00 96.03  ? 538  LYS A NZ  1 
ATOM   4173 N N   . LEU A 1 539 ? 31.023  2.787   -10.958 1.00 71.72  ? 539  LEU A N   1 
ATOM   4174 C CA  . LEU A 1 539 ? 31.582  3.775   -11.876 1.00 72.30  ? 539  LEU A CA  1 
ATOM   4175 C C   . LEU A 1 539 ? 33.072  3.965   -11.644 1.00 79.41  ? 539  LEU A C   1 
ATOM   4176 O O   . LEU A 1 539 ? 33.762  4.601   -12.438 1.00 77.81  ? 539  LEU A O   1 
ATOM   4177 C CB  . LEU A 1 539 ? 30.854  5.116   -11.746 1.00 71.78  ? 539  LEU A CB  1 
ATOM   4178 C CG  . LEU A 1 539 ? 31.423  6.233   -12.622 1.00 66.98  ? 539  LEU A CG  1 
ATOM   4179 C CD1 . LEU A 1 539 ? 31.453  5.768   -14.059 1.00 55.30  ? 539  LEU A CD1 1 
ATOM   4180 C CD2 . LEU A 1 539 ? 30.636  7.520   -12.493 1.00 39.29  ? 539  LEU A CD2 1 
ATOM   4181 N N   . LEU A 1 540 ? 33.572  3.407   -10.550 1.00 96.92  ? 540  LEU A N   1 
ATOM   4182 C CA  . LEU A 1 540 ? 34.980  3.559   -10.218 1.00 100.47 ? 540  LEU A CA  1 
ATOM   4183 C C   . LEU A 1 540 ? 35.671  2.199   -9.997  1.00 93.02  ? 540  LEU A C   1 
ATOM   4184 O O   . LEU A 1 540 ? 36.871  2.062   -10.224 1.00 92.02  ? 540  LEU A O   1 
ATOM   4185 C CB  . LEU A 1 540 ? 35.136  4.527   -9.035  1.00 99.86  ? 540  LEU A CB  1 
ATOM   4186 C CG  . LEU A 1 540 ? 34.405  5.873   -9.243  1.00 93.87  ? 540  LEU A CG  1 
ATOM   4187 C CD1 . LEU A 1 540 ? 34.708  6.872   -8.121  1.00 91.48  ? 540  LEU A CD1 1 
ATOM   4188 C CD2 . LEU A 1 540 ? 34.703  6.503   -10.614 1.00 82.64  ? 540  LEU A CD2 1 
ATOM   4189 N N   . SER A 1 541 ? 34.898  1.192   -9.593  1.00 90.39  ? 541  SER A N   1 
ATOM   4190 C CA  . SER A 1 541 ? 35.389  -0.186  -9.491  1.00 79.47  ? 541  SER A CA  1 
ATOM   4191 C C   . SER A 1 541 ? 35.718  -0.769  -10.871 1.00 83.18  ? 541  SER A C   1 
ATOM   4192 O O   . SER A 1 541 ? 35.888  -0.038  -11.857 1.00 84.61  ? 541  SER A O   1 
ATOM   4193 C CB  . SER A 1 541 ? 34.371  -1.084  -8.760  1.00 64.08  ? 541  SER A CB  1 
ATOM   4194 N N   . GLU B 1 4   ? -16.528 6.196   -70.795 1.00 85.35  ? 4    GLU B N   1 
ATOM   4195 C CA  . GLU B 1 4   ? -15.634 6.339   -69.649 1.00 94.97  ? 4    GLU B CA  1 
ATOM   4196 C C   . GLU B 1 4   ? -15.992 7.558   -68.778 1.00 99.85  ? 4    GLU B C   1 
ATOM   4197 O O   . GLU B 1 4   ? -16.751 8.438   -69.194 1.00 98.01  ? 4    GLU B O   1 
ATOM   4198 C CB  . GLU B 1 4   ? -14.169 6.402   -70.107 1.00 93.82  ? 4    GLU B CB  1 
ATOM   4199 N N   . ASP B 1 5   ? -15.444 7.594   -67.566 1.00 96.99  ? 5    ASP B N   1 
ATOM   4200 C CA  . ASP B 1 5   ? -15.741 8.658   -66.612 1.00 90.57  ? 5    ASP B CA  1 
ATOM   4201 C C   . ASP B 1 5   ? -14.615 9.681   -66.564 1.00 97.01  ? 5    ASP B C   1 
ATOM   4202 O O   . ASP B 1 5   ? -13.494 9.354   -66.189 1.00 103.39 ? 5    ASP B O   1 
ATOM   4203 C CB  . ASP B 1 5   ? -15.952 8.074   -65.216 1.00 81.01  ? 5    ASP B CB  1 
ATOM   4204 C CG  . ASP B 1 5   ? -16.348 9.129   -64.192 1.00 79.59  ? 5    ASP B CG  1 
ATOM   4205 O OD1 . ASP B 1 5   ? -16.218 10.333  -64.506 1.00 80.97  ? 5    ASP B OD1 1 
ATOM   4206 O OD2 . ASP B 1 5   ? -16.798 8.753   -63.080 1.00 65.69  ? 5    ASP B OD2 1 
ATOM   4207 N N   . PRO B 1 6   ? -14.917 10.928  -66.938 1.00 93.10  ? 6    PRO B N   1 
ATOM   4208 C CA  . PRO B 1 6   ? -13.958 12.038  -66.979 1.00 82.45  ? 6    PRO B CA  1 
ATOM   4209 C C   . PRO B 1 6   ? -13.206 12.218  -65.672 1.00 87.25  ? 6    PRO B C   1 
ATOM   4210 O O   . PRO B 1 6   ? -12.021 12.543  -65.697 1.00 98.50  ? 6    PRO B O   1 
ATOM   4211 C CB  . PRO B 1 6   ? -14.849 13.251  -67.230 1.00 81.66  ? 6    PRO B CB  1 
ATOM   4212 C CG  . PRO B 1 6   ? -15.995 12.697  -68.000 1.00 90.36  ? 6    PRO B CG  1 
ATOM   4213 C CD  . PRO B 1 6   ? -16.238 11.318  -67.459 1.00 89.71  ? 6    PRO B CD  1 
ATOM   4214 N N   . GLN B 1 7   ? -13.884 12.019  -64.547 1.00 82.74  ? 7    GLN B N   1 
ATOM   4215 C CA  . GLN B 1 7   ? -13.260 12.212  -63.239 1.00 77.40  ? 7    GLN B CA  1 
ATOM   4216 C C   . GLN B 1 7   ? -12.242 11.136  -62.911 1.00 67.84  ? 7    GLN B C   1 
ATOM   4217 O O   . GLN B 1 7   ? -11.674 11.123  -61.824 1.00 69.43  ? 7    GLN B O   1 
ATOM   4218 C CB  . GLN B 1 7   ? -14.317 12.259  -62.138 1.00 82.61  ? 7    GLN B CB  1 
ATOM   4219 C CG  . GLN B 1 7   ? -15.112 13.549  -62.118 1.00 88.51  ? 7    GLN B CG  1 
ATOM   4220 C CD  . GLN B 1 7   ? -14.247 14.746  -61.807 1.00 90.27  ? 7    GLN B CD  1 
ATOM   4221 O OE1 . GLN B 1 7   ? -13.884 14.974  -60.653 1.00 98.99  ? 7    GLN B OE1 1 
ATOM   4222 N NE2 . GLN B 1 7   ? -13.897 15.512  -62.837 1.00 86.04  ? 7    GLN B NE2 1 
ATOM   4223 N N   . LEU B 1 8   ? -12.018 10.234  -63.855 1.00 63.76  ? 8    LEU B N   1 
ATOM   4224 C CA  . LEU B 1 8   ? -11.135 9.104   -63.622 1.00 67.00  ? 8    LEU B CA  1 
ATOM   4225 C C   . LEU B 1 8   ? -10.041 9.052   -64.683 1.00 66.09  ? 8    LEU B C   1 
ATOM   4226 O O   . LEU B 1 8   ? -9.149  8.210   -64.643 1.00 75.38  ? 8    LEU B O   1 
ATOM   4227 C CB  . LEU B 1 8   ? -11.938 7.799   -63.564 1.00 63.11  ? 8    LEU B CB  1 
ATOM   4228 C CG  . LEU B 1 8   ? -12.891 7.695   -62.365 1.00 65.86  ? 8    LEU B CG  1 
ATOM   4229 C CD1 . LEU B 1 8   ? -13.738 6.427   -62.434 1.00 58.72  ? 8    LEU B CD1 1 
ATOM   4230 C CD2 . LEU B 1 8   ? -12.106 7.752   -61.046 1.00 53.40  ? 8    LEU B CD2 1 
ATOM   4231 N N   . LEU B 1 9   ? -10.103 9.979   -65.624 1.00 58.96  ? 9    LEU B N   1 
ATOM   4232 C CA  . LEU B 1 9   ? -9.056  10.098  -66.623 1.00 75.10  ? 9    LEU B CA  1 
ATOM   4233 C C   . LEU B 1 9   ? -8.154  11.282  -66.283 1.00 70.53  ? 9    LEU B C   1 
ATOM   4234 O O   . LEU B 1 9   ? -8.629  12.399  -66.090 1.00 76.20  ? 9    LEU B O   1 
ATOM   4235 C CB  . LEU B 1 9   ? -9.654  10.232  -68.035 1.00 86.95  ? 9    LEU B CB  1 
ATOM   4236 C CG  . LEU B 1 9   ? -10.074 8.949   -68.777 1.00 93.57  ? 9    LEU B CG  1 
ATOM   4237 C CD1 . LEU B 1 9   ? -10.805 7.978   -67.856 1.00 100.62 ? 9    LEU B CD1 1 
ATOM   4238 C CD2 . LEU B 1 9   ? -10.940 9.259   -70.005 1.00 90.76  ? 9    LEU B CD2 1 
ATOM   4239 N N   . VAL B 1 10  ? -6.853  11.026  -66.189 1.00 63.29  ? 10   VAL B N   1 
ATOM   4240 C CA  . VAL B 1 10  ? -5.896  12.084  -65.902 1.00 62.13  ? 10   VAL B CA  1 
ATOM   4241 C C   . VAL B 1 10  ? -4.699  11.956  -66.822 1.00 65.24  ? 10   VAL B C   1 
ATOM   4242 O O   . VAL B 1 10  ? -4.168  10.861  -67.004 1.00 69.06  ? 10   VAL B O   1 
ATOM   4243 C CB  . VAL B 1 10  ? -5.394  12.015  -64.450 1.00 63.40  ? 10   VAL B CB  1 
ATOM   4244 C CG1 . VAL B 1 10  ? -4.693  13.294  -64.083 1.00 62.35  ? 10   VAL B CG1 1 
ATOM   4245 C CG2 . VAL B 1 10  ? -6.549  11.773  -63.501 1.00 74.65  ? 10   VAL B CG2 1 
ATOM   4246 N N   . ARG B 1 11  ? -4.280  13.070  -67.412 1.00 61.32  ? 11   ARG B N   1 
ATOM   4247 C CA  . ARG B 1 11  ? -3.038  13.081  -68.170 1.00 69.31  ? 11   ARG B CA  1 
ATOM   4248 C C   . ARG B 1 11  ? -1.900  13.662  -67.346 1.00 67.35  ? 11   ARG B C   1 
ATOM   4249 O O   . ARG B 1 11  ? -1.915  14.832  -66.967 1.00 59.43  ? 11   ARG B O   1 
ATOM   4250 C CB  . ARG B 1 11  ? -3.177  13.838  -69.491 1.00 72.78  ? 11   ARG B CB  1 
ATOM   4251 C CG  . ARG B 1 11  ? -1.841  14.304  -70.055 1.00 80.08  ? 11   ARG B CG  1 
ATOM   4252 C CD  . ARG B 1 11  ? -1.874  14.537  -71.562 1.00 89.08  ? 11   ARG B CD  1 
ATOM   4253 N NE  . ARG B 1 11  ? -1.526  13.326  -72.304 1.00 107.07 ? 11   ARG B NE  1 
ATOM   4254 C CZ  . ARG B 1 11  ? -2.374  12.634  -73.064 1.00 111.09 ? 11   ARG B CZ  1 
ATOM   4255 N NH1 . ARG B 1 11  ? -3.636  13.034  -73.205 1.00 107.52 ? 11   ARG B NH1 1 
ATOM   4256 N NH2 . ARG B 1 11  ? -1.954  11.541  -73.694 1.00 104.05 ? 11   ARG B NH2 1 
ATOM   4257 N N   . VAL B 1 12  ? -0.912  12.822  -67.066 1.00 64.36  ? 12   VAL B N   1 
ATOM   4258 C CA  . VAL B 1 12  ? 0.290   13.259  -66.378 1.00 55.36  ? 12   VAL B CA  1 
ATOM   4259 C C   . VAL B 1 12  ? 1.389   13.342  -67.425 1.00 55.64  ? 12   VAL B C   1 
ATOM   4260 O O   . VAL B 1 12  ? 1.164   12.989  -68.584 1.00 62.01  ? 12   VAL B O   1 
ATOM   4261 C CB  . VAL B 1 12  ? 0.678   12.287  -65.242 1.00 48.37  ? 12   VAL B CB  1 
ATOM   4262 C CG1 . VAL B 1 12  ? -0.473  12.131  -64.253 1.00 40.37  ? 12   VAL B CG1 1 
ATOM   4263 C CG2 . VAL B 1 12  ? 1.074   10.926  -65.805 1.00 52.30  ? 12   VAL B CG2 1 
ATOM   4264 N N   . ARG B 1 13  ? 2.567   13.809  -67.021 1.00 53.20  ? 13   ARG B N   1 
ATOM   4265 C CA  . ARG B 1 13  ? 3.692   13.989  -67.934 1.00 52.66  ? 13   ARG B CA  1 
ATOM   4266 C C   . ARG B 1 13  ? 4.084   12.745  -68.736 1.00 56.75  ? 13   ARG B C   1 
ATOM   4267 O O   . ARG B 1 13  ? 4.735   12.862  -69.765 1.00 68.75  ? 13   ARG B O   1 
ATOM   4268 C CB  . ARG B 1 13  ? 4.919   14.495  -67.171 1.00 56.21  ? 13   ARG B CB  1 
ATOM   4269 C CG  . ARG B 1 13  ? 5.073   16.008  -67.125 1.00 75.60  ? 13   ARG B CG  1 
ATOM   4270 C CD  . ARG B 1 13  ? 6.199   16.416  -66.175 1.00 93.45  ? 13   ARG B CD  1 
ATOM   4271 N NE  . ARG B 1 13  ? 7.057   15.289  -65.794 1.00 110.17 ? 13   ARG B NE  1 
ATOM   4272 C CZ  . ARG B 1 13  ? 8.199   14.966  -66.403 1.00 115.54 ? 13   ARG B CZ  1 
ATOM   4273 N NH1 . ARG B 1 13  ? 8.633   15.680  -67.430 1.00 122.03 ? 13   ARG B NH1 1 
ATOM   4274 N NH2 . ARG B 1 13  ? 8.914   13.928  -65.985 1.00 109.10 ? 13   ARG B NH2 1 
ATOM   4275 N N   . GLY B 1 14  ? 3.709   11.558  -68.277 1.00 52.81  ? 14   GLY B N   1 
ATOM   4276 C CA  . GLY B 1 14  ? 4.192   10.341  -68.908 1.00 52.84  ? 14   GLY B CA  1 
ATOM   4277 C C   . GLY B 1 14  ? 3.183   9.590   -69.745 1.00 56.02  ? 14   GLY B C   1 
ATOM   4278 O O   . GLY B 1 14  ? 3.514   8.610   -70.393 1.00 64.34  ? 14   GLY B O   1 
ATOM   4279 N N   . GLY B 1 15  ? 1.941   10.049  -69.733 1.00 55.86  ? 15   GLY B N   1 
ATOM   4280 C CA  . GLY B 1 15  ? 0.891   9.367   -70.453 1.00 59.55  ? 15   GLY B CA  1 
ATOM   4281 C C   . GLY B 1 15  ? -0.439  9.564   -69.765 1.00 72.14  ? 15   GLY B C   1 
ATOM   4282 O O   . GLY B 1 15  ? -0.581  10.455  -68.920 1.00 75.67  ? 15   GLY B O   1 
ATOM   4283 N N   . GLN B 1 16  ? -1.414  8.730   -70.122 1.00 67.83  ? 16   GLN B N   1 
ATOM   4284 C CA  . GLN B 1 16  ? -2.731  8.809   -69.511 1.00 59.32  ? 16   GLN B CA  1 
ATOM   4285 C C   . GLN B 1 16  ? -3.032  7.674   -68.557 1.00 54.89  ? 16   GLN B C   1 
ATOM   4286 O O   . GLN B 1 16  ? -2.627  6.537   -68.766 1.00 64.19  ? 16   GLN B O   1 
ATOM   4287 C CB  . GLN B 1 16  ? -3.814  8.902   -70.572 1.00 68.32  ? 16   GLN B CB  1 
ATOM   4288 C CG  . GLN B 1 16  ? -3.877  10.261  -71.211 1.00 74.28  ? 16   GLN B CG  1 
ATOM   4289 C CD  . GLN B 1 16  ? -5.115  10.435  -72.040 1.00 86.74  ? 16   GLN B CD  1 
ATOM   4290 O OE1 . GLN B 1 16  ? -5.922  11.329  -71.777 1.00 97.82  ? 16   GLN B OE1 1 
ATOM   4291 N NE2 . GLN B 1 16  ? -5.282  9.580   -73.054 1.00 77.01  ? 16   GLN B NE2 1 
ATOM   4292 N N   . LEU B 1 17  ? -3.762  8.011   -67.511 1.00 41.48  ? 17   LEU B N   1 
ATOM   4293 C CA  . LEU B 1 17  ? -4.085  7.087   -66.454 1.00 47.91  ? 17   LEU B CA  1 
ATOM   4294 C C   . LEU B 1 17  ? -5.583  6.995   -66.339 1.00 50.76  ? 17   LEU B C   1 
ATOM   4295 O O   . LEU B 1 17  ? -6.290  7.951   -66.642 1.00 58.56  ? 17   LEU B O   1 
ATOM   4296 C CB  . LEU B 1 17  ? -3.527  7.613   -65.118 1.00 39.46  ? 17   LEU B CB  1 
ATOM   4297 C CG  . LEU B 1 17  ? -2.017  7.741   -65.171 1.00 52.82  ? 17   LEU B CG  1 
ATOM   4298 C CD1 . LEU B 1 17  ? -1.510  8.406   -63.942 1.00 46.65  ? 17   LEU B CD1 1 
ATOM   4299 C CD2 . LEU B 1 17  ? -1.388  6.352   -65.340 1.00 68.70  ? 17   LEU B CD2 1 
ATOM   4300 N N   . ARG B 1 18  ? -6.062  5.849   -65.872 1.00 58.29  ? 18   ARG B N   1 
ATOM   4301 C CA  . ARG B 1 18  ? -7.470  5.671   -65.537 1.00 59.61  ? 18   ARG B CA  1 
ATOM   4302 C C   . ARG B 1 18  ? -7.557  5.255   -64.080 1.00 55.78  ? 18   ARG B C   1 
ATOM   4303 O O   . ARG B 1 18  ? -7.066  4.191   -63.698 1.00 58.97  ? 18   ARG B O   1 
ATOM   4304 C CB  . ARG B 1 18  ? -8.114  4.597   -66.424 1.00 55.41  ? 18   ARG B CB  1 
ATOM   4305 C CG  . ARG B 1 18  ? -9.614  4.426   -66.227 1.00 65.36  ? 18   ARG B CG  1 
ATOM   4306 C CD  . ARG B 1 18  ? -10.116 3.140   -66.890 1.00 73.16  ? 18   ARG B CD  1 
ATOM   4307 N NE  . ARG B 1 18  ? -9.511  2.937   -68.206 1.00 79.07  ? 18   ARG B NE  1 
ATOM   4308 C CZ  . ARG B 1 18  ? -10.004 3.420   -69.343 1.00 93.52  ? 18   ARG B CZ  1 
ATOM   4309 N NH1 . ARG B 1 18  ? -11.122 4.139   -69.340 1.00 102.16 ? 18   ARG B NH1 1 
ATOM   4310 N NH2 . ARG B 1 18  ? -9.378  3.187   -70.490 1.00 95.84  ? 18   ARG B NH2 1 
ATOM   4311 N N   . GLY B 1 19  ? -8.164  6.101   -63.260 1.00 51.82  ? 19   GLY B N   1 
ATOM   4312 C CA  . GLY B 1 19  ? -8.329  5.772   -61.861 1.00 57.86  ? 19   GLY B CA  1 
ATOM   4313 C C   . GLY B 1 19  ? -9.607  4.986   -61.671 1.00 62.58  ? 19   GLY B C   1 
ATOM   4314 O O   . GLY B 1 19  ? -10.280 4.611   -62.630 1.00 68.92  ? 19   GLY B O   1 
ATOM   4315 N N   . ILE B 1 20  ? -9.948  4.747   -60.420 1.00 53.58  ? 20   ILE B N   1 
ATOM   4316 C CA  . ILE B 1 20  ? -11.177 4.054   -60.104 1.00 53.34  ? 20   ILE B CA  1 
ATOM   4317 C C   . ILE B 1 20  ? -11.959 4.893   -59.104 1.00 62.60  ? 20   ILE B C   1 
ATOM   4318 O O   . ILE B 1 20  ? -11.375 5.654   -58.339 1.00 75.07  ? 20   ILE B O   1 
ATOM   4319 C CB  . ILE B 1 20  ? -10.876 2.659   -59.525 1.00 56.57  ? 20   ILE B CB  1 
ATOM   4320 C CG1 . ILE B 1 20  ? -12.164 1.878   -59.282 1.00 56.05  ? 20   ILE B CG1 1 
ATOM   4321 C CG2 . ILE B 1 20  ? -10.046 2.773   -58.241 1.00 44.89  ? 20   ILE B CG2 1 
ATOM   4322 C CD1 . ILE B 1 20  ? -11.933 0.398   -59.084 1.00 54.67  ? 20   ILE B CD1 1 
ATOM   4323 N N   . ARG B 1 21  ? -13.278 4.768   -59.133 1.00 63.32  ? 21   ARG B N   1 
ATOM   4324 C CA  . ARG B 1 21  ? -14.157 5.461   -58.201 1.00 59.53  ? 21   ARG B CA  1 
ATOM   4325 C C   . ARG B 1 21  ? -14.458 4.522   -57.044 1.00 66.64  ? 21   ARG B C   1 
ATOM   4326 O O   . ARG B 1 21  ? -15.010 3.433   -57.242 1.00 72.56  ? 21   ARG B O   1 
ATOM   4327 C CB  . ARG B 1 21  ? -15.449 5.872   -58.909 1.00 67.65  ? 21   ARG B CB  1 
ATOM   4328 C CG  . ARG B 1 21  ? -16.628 6.193   -57.991 1.00 70.62  ? 21   ARG B CG  1 
ATOM   4329 C CD  . ARG B 1 21  ? -17.958 6.170   -58.752 1.00 71.73  ? 21   ARG B CD  1 
ATOM   4330 N NE  . ARG B 1 21  ? -19.096 6.091   -57.843 1.00 84.59  ? 21   ARG B NE  1 
ATOM   4331 C CZ  . ARG B 1 21  ? -19.845 7.134   -57.491 1.00 96.83  ? 21   ARG B CZ  1 
ATOM   4332 N NH1 . ARG B 1 21  ? -19.583 8.334   -57.992 1.00 106.16 ? 21   ARG B NH1 1 
ATOM   4333 N NH2 . ARG B 1 21  ? -20.861 6.981   -56.648 1.00 87.36  ? 21   ARG B NH2 1 
ATOM   4334 N N   . LEU B 1 22  ? -14.074 4.939   -55.840 1.00 57.85  ? 22   LEU B N   1 
ATOM   4335 C CA  . LEU B 1 22  ? -14.213 4.101   -54.662 1.00 56.01  ? 22   LEU B CA  1 
ATOM   4336 C C   . LEU B 1 22  ? -15.251 4.680   -53.740 1.00 64.48  ? 22   LEU B C   1 
ATOM   4337 O O   . LEU B 1 22  ? -15.402 5.894   -53.662 1.00 72.61  ? 22   LEU B O   1 
ATOM   4338 C CB  . LEU B 1 22  ? -12.895 4.019   -53.914 1.00 61.45  ? 22   LEU B CB  1 
ATOM   4339 C CG  . LEU B 1 22  ? -11.711 3.379   -54.626 1.00 72.53  ? 22   LEU B CG  1 
ATOM   4340 C CD1 . LEU B 1 22  ? -10.508 3.491   -53.707 1.00 81.88  ? 22   LEU B CD1 1 
ATOM   4341 C CD2 . LEU B 1 22  ? -11.995 1.928   -54.998 1.00 70.09  ? 22   LEU B CD2 1 
ATOM   4342 N N   . LYS B 1 23  ? -15.954 3.809   -53.027 1.00 75.60  ? 23   LYS B N   1 
ATOM   4343 C CA  . LYS B 1 23  ? -16.985 4.247   -52.093 1.00 77.13  ? 23   LYS B CA  1 
ATOM   4344 C C   . LYS B 1 23  ? -16.449 4.317   -50.672 1.00 79.49  ? 23   LYS B C   1 
ATOM   4345 O O   . LYS B 1 23  ? -16.222 3.293   -50.033 1.00 89.06  ? 23   LYS B O   1 
ATOM   4346 C CB  . LYS B 1 23  ? -18.214 3.330   -52.152 1.00 68.90  ? 23   LYS B CB  1 
ATOM   4347 N N   . ALA B 1 24  ? -16.227 5.535   -50.193 1.00 70.52  ? 24   ALA B N   1 
ATOM   4348 C CA  . ALA B 1 24  ? -15.977 5.762   -48.782 1.00 59.32  ? 24   ALA B CA  1 
ATOM   4349 C C   . ALA B 1 24  ? -17.336 5.864   -48.092 1.00 68.88  ? 24   ALA B C   1 
ATOM   4350 O O   . ALA B 1 24  ? -18.358 6.041   -48.753 1.00 76.61  ? 24   ALA B O   1 
ATOM   4351 C CB  . ALA B 1 24  ? -15.176 7.028   -48.587 1.00 46.22  ? 24   ALA B CB  1 
ATOM   4352 N N   . PRO B 1 25  ? -17.357 5.756   -46.757 1.00 68.31  ? 25   PRO B N   1 
ATOM   4353 C CA  . PRO B 1 25  ? -18.630 5.713   -46.032 1.00 69.50  ? 25   PRO B CA  1 
ATOM   4354 C C   . PRO B 1 25  ? -19.491 6.913   -46.345 1.00 75.51  ? 25   PRO B C   1 
ATOM   4355 O O   . PRO B 1 25  ? -20.711 6.799   -46.395 1.00 90.75  ? 25   PRO B O   1 
ATOM   4356 C CB  . PRO B 1 25  ? -18.197 5.787   -44.567 1.00 50.63  ? 25   PRO B CB  1 
ATOM   4357 C CG  . PRO B 1 25  ? -16.811 5.276   -44.559 1.00 65.37  ? 25   PRO B CG  1 
ATOM   4358 C CD  . PRO B 1 25  ? -16.205 5.750   -45.842 1.00 62.69  ? 25   PRO B CD  1 
ATOM   4359 N N   . GLY B 1 26  ? -18.854 8.057   -46.554 1.00 73.99  ? 26   GLY B N   1 
ATOM   4360 C CA  . GLY B 1 26  ? -19.569 9.315   -46.625 1.00 75.01  ? 26   GLY B CA  1 
ATOM   4361 C C   . GLY B 1 26  ? -19.726 9.822   -48.035 1.00 69.98  ? 26   GLY B C   1 
ATOM   4362 O O   . GLY B 1 26  ? -20.411 10.820  -48.269 1.00 66.79  ? 26   GLY B O   1 
ATOM   4363 N N   . GLY B 1 27  ? -19.096 9.129   -48.974 1.00 56.73  ? 27   GLY B N   1 
ATOM   4364 C CA  . GLY B 1 27  ? -19.182 9.503   -50.371 1.00 62.79  ? 27   GLY B CA  1 
ATOM   4365 C C   . GLY B 1 27  ? -18.077 8.858   -51.182 1.00 73.50  ? 27   GLY B C   1 
ATOM   4366 O O   . GLY B 1 27  ? -17.248 8.120   -50.650 1.00 75.69  ? 27   GLY B O   1 
ATOM   4367 N N   . PRO B 1 28  ? -18.061 9.126   -52.488 1.00 70.63  ? 28   PRO B N   1 
ATOM   4368 C CA  . PRO B 1 28  ? -17.053 8.508   -53.344 1.00 69.33  ? 28   PRO B CA  1 
ATOM   4369 C C   . PRO B 1 28  ? -15.760 9.304   -53.322 1.00 71.62  ? 28   PRO B C   1 
ATOM   4370 O O   . PRO B 1 28  ? -15.767 10.473  -52.938 1.00 66.02  ? 28   PRO B O   1 
ATOM   4371 C CB  . PRO B 1 28  ? -17.701 8.570   -54.729 1.00 64.92  ? 28   PRO B CB  1 
ATOM   4372 C CG  . PRO B 1 28  ? -18.566 9.773   -54.673 1.00 58.21  ? 28   PRO B CG  1 
ATOM   4373 C CD  . PRO B 1 28  ? -19.045 9.906   -53.258 1.00 63.50  ? 28   PRO B CD  1 
ATOM   4374 N N   . VAL B 1 29  ? -14.668 8.654   -53.719 1.00 70.59  ? 29   VAL B N   1 
ATOM   4375 C CA  . VAL B 1 29  ? -13.379 9.299   -53.879 1.00 61.88  ? 29   VAL B CA  1 
ATOM   4376 C C   . VAL B 1 29  ? -12.771 8.753   -55.160 1.00 60.89  ? 29   VAL B C   1 
ATOM   4377 O O   . VAL B 1 29  ? -13.039 7.612   -55.517 1.00 64.89  ? 29   VAL B O   1 
ATOM   4378 C CB  . VAL B 1 29  ? -12.448 8.987   -52.688 1.00 56.90  ? 29   VAL B CB  1 
ATOM   4379 C CG1 . VAL B 1 29  ? -13.193 9.177   -51.385 1.00 58.51  ? 29   VAL B CG1 1 
ATOM   4380 C CG2 . VAL B 1 29  ? -11.927 7.572   -52.771 1.00 54.07  ? 29   VAL B CG2 1 
ATOM   4381 N N   . SER B 1 30  ? -11.983 9.568   -55.860 1.00 59.05  ? 30   SER B N   1 
ATOM   4382 C CA  . SER B 1 30  ? -11.223 9.109   -57.027 1.00 56.82  ? 30   SER B CA  1 
ATOM   4383 C C   . SER B 1 30  ? -9.894  8.503   -56.585 1.00 62.39  ? 30   SER B C   1 
ATOM   4384 O O   . SER B 1 30  ? -9.100  9.180   -55.936 1.00 75.64  ? 30   SER B O   1 
ATOM   4385 C CB  . SER B 1 30  ? -10.906 10.276  -57.974 1.00 56.66  ? 30   SER B CB  1 
ATOM   4386 O OG  . SER B 1 30  ? -12.052 11.016  -58.345 1.00 66.02  ? 30   SER B OG  1 
ATOM   4387 N N   . ALA B 1 31  ? -9.627  7.251   -56.951 1.00 52.71  ? 31   ALA B N   1 
ATOM   4388 C CA  . ALA B 1 31  ? -8.326  6.642   -56.652 1.00 47.31  ? 31   ALA B CA  1 
ATOM   4389 C C   . ALA B 1 31  ? -7.542  6.170   -57.876 1.00 60.67  ? 31   ALA B C   1 
ATOM   4390 O O   . ALA B 1 31  ? -8.099  5.637   -58.843 1.00 57.51  ? 31   ALA B O   1 
ATOM   4391 C CB  . ALA B 1 31  ? -8.464  5.512   -55.651 1.00 46.80  ? 31   ALA B CB  1 
ATOM   4392 N N   . PHE B 1 32  ? -6.233  6.378   -57.806 1.00 63.27  ? 32   PHE B N   1 
ATOM   4393 C CA  . PHE B 1 32  ? -5.315  6.017   -58.866 1.00 53.79  ? 32   PHE B CA  1 
ATOM   4394 C C   . PHE B 1 32  ? -4.185  5.206   -58.254 1.00 49.75  ? 32   PHE B C   1 
ATOM   4395 O O   . PHE B 1 32  ? -3.307  5.748   -57.601 1.00 51.57  ? 32   PHE B O   1 
ATOM   4396 C CB  . PHE B 1 32  ? -4.769  7.278   -59.511 1.00 43.12  ? 32   PHE B CB  1 
ATOM   4397 C CG  . PHE B 1 32  ? -5.833  8.222   -59.951 1.00 45.04  ? 32   PHE B CG  1 
ATOM   4398 C CD1 . PHE B 1 32  ? -6.391  8.115   -61.215 1.00 53.71  ? 32   PHE B CD1 1 
ATOM   4399 C CD2 . PHE B 1 32  ? -6.292  9.209   -59.101 1.00 49.02  ? 32   PHE B CD2 1 
ATOM   4400 C CE1 . PHE B 1 32  ? -7.381  8.983   -61.638 1.00 49.97  ? 32   PHE B CE1 1 
ATOM   4401 C CE2 . PHE B 1 32  ? -7.287  10.079  -59.510 1.00 55.44  ? 32   PHE B CE2 1 
ATOM   4402 C CZ  . PHE B 1 32  ? -7.829  9.966   -60.784 1.00 55.88  ? 32   PHE B CZ  1 
ATOM   4403 N N   . LEU B 1 33  ? -4.220  3.900   -58.451 1.00 49.63  ? 33   LEU B N   1 
ATOM   4404 C CA  . LEU B 1 33  ? -3.273  3.030   -57.779 1.00 54.95  ? 33   LEU B CA  1 
ATOM   4405 C C   . LEU B 1 33  ? -2.358  2.385   -58.787 1.00 46.31  ? 33   LEU B C   1 
ATOM   4406 O O   . LEU B 1 33  ? -2.736  2.202   -59.939 1.00 56.27  ? 33   LEU B O   1 
ATOM   4407 C CB  . LEU B 1 33  ? -4.014  1.946   -57.004 1.00 51.32  ? 33   LEU B CB  1 
ATOM   4408 C CG  . LEU B 1 33  ? -5.340  2.414   -56.420 1.00 47.93  ? 33   LEU B CG  1 
ATOM   4409 C CD1 . LEU B 1 33  ? -6.128  1.196   -55.968 1.00 56.57  ? 33   LEU B CD1 1 
ATOM   4410 C CD2 . LEU B 1 33  ? -5.117  3.390   -55.271 1.00 37.44  ? 33   LEU B CD2 1 
ATOM   4411 N N   . GLY B 1 34  ? -1.156  2.039   -58.351 1.00 48.03  ? 34   GLY B N   1 
ATOM   4412 C CA  . GLY B 1 34  ? -0.201  1.396   -59.230 1.00 55.95  ? 34   GLY B CA  1 
ATOM   4413 C C   . GLY B 1 34  ? 0.404   2.323   -60.266 1.00 54.59  ? 34   GLY B C   1 
ATOM   4414 O O   . GLY B 1 34  ? 0.775   1.887   -61.338 1.00 62.51  ? 34   GLY B O   1 
ATOM   4415 N N   . ILE B 1 35  ? 0.526   3.607   -59.957 1.00 54.65  ? 35   ILE B N   1 
ATOM   4416 C CA  . ILE B 1 35  ? 1.164   4.515   -60.905 1.00 50.21  ? 35   ILE B CA  1 
ATOM   4417 C C   . ILE B 1 35  ? 2.676   4.374   -60.854 1.00 43.14  ? 35   ILE B C   1 
ATOM   4418 O O   . ILE B 1 35  ? 3.295   4.524   -59.805 1.00 53.07  ? 35   ILE B O   1 
ATOM   4419 C CB  . ILE B 1 35  ? 0.800   5.980   -60.650 1.00 46.10  ? 35   ILE B CB  1 
ATOM   4420 C CG1 . ILE B 1 35  ? -0.720  6.143   -60.624 1.00 36.19  ? 35   ILE B CG1 1 
ATOM   4421 C CG2 . ILE B 1 35  ? 1.443   6.861   -61.715 1.00 40.11  ? 35   ILE B CG2 1 
ATOM   4422 C CD1 . ILE B 1 35  ? -1.195  7.517   -60.169 1.00 46.52  ? 35   ILE B CD1 1 
ATOM   4423 N N   . PRO B 1 36  ? 3.276   4.052   -61.991 1.00 39.56  ? 36   PRO B N   1 
ATOM   4424 C CA  . PRO B 1 36  ? 4.726   3.899   -62.086 1.00 43.19  ? 36   PRO B CA  1 
ATOM   4425 C C   . PRO B 1 36  ? 5.449   5.241   -62.056 1.00 46.88  ? 36   PRO B C   1 
ATOM   4426 O O   . PRO B 1 36  ? 5.169   6.137   -62.855 1.00 48.53  ? 36   PRO B O   1 
ATOM   4427 C CB  . PRO B 1 36  ? 4.908   3.240   -63.451 1.00 37.74  ? 36   PRO B CB  1 
ATOM   4428 C CG  . PRO B 1 36  ? 3.707   3.680   -64.254 1.00 36.76  ? 36   PRO B CG  1 
ATOM   4429 C CD  . PRO B 1 36  ? 2.590   3.695   -63.244 1.00 44.65  ? 36   PRO B CD  1 
ATOM   4430 N N   . PHE B 1 37  ? 6.391   5.377   -61.137 1.00 41.81  ? 37   PHE B N   1 
ATOM   4431 C CA  . PHE B 1 37  ? 7.207   6.576   -61.118 1.00 42.28  ? 37   PHE B CA  1 
ATOM   4432 C C   . PHE B 1 37  ? 8.670   6.323   -61.518 1.00 49.53  ? 37   PHE B C   1 
ATOM   4433 O O   . PHE B 1 37  ? 9.461   7.254   -61.633 1.00 51.91  ? 37   PHE B O   1 
ATOM   4434 C CB  . PHE B 1 37  ? 7.087   7.291   -59.766 1.00 49.53  ? 37   PHE B CB  1 
ATOM   4435 C CG  . PHE B 1 37  ? 7.706   6.549   -58.602 1.00 42.82  ? 37   PHE B CG  1 
ATOM   4436 C CD1 . PHE B 1 37  ? 6.970   5.630   -57.883 1.00 34.84  ? 37   PHE B CD1 1 
ATOM   4437 C CD2 . PHE B 1 37  ? 9.005   6.830   -58.189 1.00 47.89  ? 37   PHE B CD2 1 
ATOM   4438 C CE1 . PHE B 1 37  ? 7.522   4.969   -56.787 1.00 40.32  ? 37   PHE B CE1 1 
ATOM   4439 C CE2 . PHE B 1 37  ? 9.566   6.173   -57.099 1.00 49.03  ? 37   PHE B CE2 1 
ATOM   4440 C CZ  . PHE B 1 37  ? 8.821   5.230   -56.398 1.00 43.45  ? 37   PHE B CZ  1 
ATOM   4441 N N   . ALA B 1 38  ? 9.028   5.069   -61.759 1.00 45.62  ? 38   ALA B N   1 
ATOM   4442 C CA  . ALA B 1 38  ? 10.402  4.781   -62.138 1.00 47.56  ? 38   ALA B CA  1 
ATOM   4443 C C   . ALA B 1 38  ? 10.497  3.569   -63.033 1.00 51.67  ? 38   ALA B C   1 
ATOM   4444 O O   . ALA B 1 38  ? 9.602   2.725   -63.064 1.00 51.91  ? 38   ALA B O   1 
ATOM   4445 C CB  . ALA B 1 38  ? 11.255  4.573   -60.907 1.00 40.22  ? 38   ALA B CB  1 
ATOM   4446 N N   . GLU B 1 39  ? 11.592  3.489   -63.767 1.00 40.02  ? 39   GLU B N   1 
ATOM   4447 C CA  . GLU B 1 39  ? 11.915  2.258   -64.455 1.00 45.50  ? 39   GLU B CA  1 
ATOM   4448 C C   . GLU B 1 39  ? 12.171  1.171   -63.411 1.00 50.42  ? 39   GLU B C   1 
ATOM   4449 O O   . GLU B 1 39  ? 12.982  1.366   -62.502 1.00 56.91  ? 39   GLU B O   1 
ATOM   4450 C CB  . GLU B 1 39  ? 13.155  2.472   -65.303 1.00 38.89  ? 39   GLU B CB  1 
ATOM   4451 C CG  . GLU B 1 39  ? 12.972  3.538   -66.328 1.00 42.84  ? 39   GLU B CG  1 
ATOM   4452 C CD  . GLU B 1 39  ? 12.221  3.031   -67.542 1.00 54.61  ? 39   GLU B CD  1 
ATOM   4453 O OE1 . GLU B 1 39  ? 12.898  2.542   -68.474 1.00 59.52  ? 39   GLU B OE1 1 
ATOM   4454 O OE2 . GLU B 1 39  ? 10.972  3.117   -67.566 1.00 52.80  ? 39   GLU B OE2 1 
ATOM   4455 N N   . PRO B 1 40  ? 11.480  0.026   -63.542 1.00 46.71  ? 40   PRO B N   1 
ATOM   4456 C CA  . PRO B 1 40  ? 11.607  -1.154  -62.676 1.00 57.71  ? 40   PRO B CA  1 
ATOM   4457 C C   . PRO B 1 40  ? 13.065  -1.517  -62.394 1.00 61.71  ? 40   PRO B C   1 
ATOM   4458 O O   . PRO B 1 40  ? 13.734  -2.054  -63.273 1.00 59.49  ? 40   PRO B O   1 
ATOM   4459 C CB  . PRO B 1 40  ? 10.982  -2.270  -63.522 1.00 57.80  ? 40   PRO B CB  1 
ATOM   4460 C CG  . PRO B 1 40  ? 10.012  -1.579  -64.391 1.00 43.16  ? 40   PRO B CG  1 
ATOM   4461 C CD  . PRO B 1 40  ? 10.623  -0.245  -64.709 1.00 45.81  ? 40   PRO B CD  1 
ATOM   4462 N N   . PRO B 1 41  ? 13.539  -1.272  -61.164 1.00 60.31  ? 41   PRO B N   1 
ATOM   4463 C CA  . PRO B 1 41  ? 14.958  -1.465  -60.876 1.00 55.47  ? 41   PRO B CA  1 
ATOM   4464 C C   . PRO B 1 41  ? 15.268  -2.941  -60.701 1.00 51.05  ? 41   PRO B C   1 
ATOM   4465 O O   . PRO B 1 41  ? 15.609  -3.357  -59.597 1.00 55.73  ? 41   PRO B O   1 
ATOM   4466 C CB  . PRO B 1 41  ? 15.120  -0.745  -59.545 1.00 59.10  ? 41   PRO B CB  1 
ATOM   4467 C CG  . PRO B 1 41  ? 13.791  -0.991  -58.858 1.00 49.41  ? 41   PRO B CG  1 
ATOM   4468 C CD  . PRO B 1 41  ? 12.751  -1.048  -59.934 1.00 44.62  ? 41   PRO B CD  1 
ATOM   4469 N N   . VAL B 1 42  ? 15.136  -3.716  -61.774 1.00 55.37  ? 42   VAL B N   1 
ATOM   4470 C CA  . VAL B 1 42  ? 15.471  -5.140  -61.756 1.00 55.77  ? 42   VAL B CA  1 
ATOM   4471 C C   . VAL B 1 42  ? 16.700  -5.461  -62.607 1.00 50.60  ? 42   VAL B C   1 
ATOM   4472 O O   . VAL B 1 42  ? 17.269  -4.594  -63.281 1.00 38.18  ? 42   VAL B O   1 
ATOM   4473 C CB  . VAL B 1 42  ? 14.293  -6.004  -62.245 1.00 54.96  ? 42   VAL B CB  1 
ATOM   4474 C CG1 . VAL B 1 42  ? 13.050  -5.798  -61.353 1.00 49.36  ? 42   VAL B CG1 1 
ATOM   4475 C CG2 . VAL B 1 42  ? 13.976  -5.670  -63.681 1.00 58.87  ? 42   VAL B CG2 1 
ATOM   4476 N N   . GLY B 1 43  ? 17.107  -6.721  -62.578 1.00 56.29  ? 43   GLY B N   1 
ATOM   4477 C CA  . GLY B 1 43  ? 18.280  -7.138  -63.322 1.00 50.04  ? 43   GLY B CA  1 
ATOM   4478 C C   . GLY B 1 43  ? 19.527  -6.381  -62.901 1.00 52.47  ? 43   GLY B C   1 
ATOM   4479 O O   . GLY B 1 43  ? 19.927  -6.416  -61.731 1.00 50.64  ? 43   GLY B O   1 
ATOM   4480 N N   . SER B 1 44  ? 20.148  -5.707  -63.866 1.00 59.59  ? 44   SER B N   1 
ATOM   4481 C CA  . SER B 1 44  ? 21.350  -4.912  -63.627 1.00 54.21  ? 44   SER B CA  1 
ATOM   4482 C C   . SER B 1 44  ? 21.007  -3.622  -62.911 1.00 48.63  ? 44   SER B C   1 
ATOM   4483 O O   . SER B 1 44  ? 21.891  -2.854  -62.542 1.00 56.84  ? 44   SER B O   1 
ATOM   4484 C CB  . SER B 1 44  ? 22.021  -4.543  -64.944 1.00 56.10  ? 44   SER B CB  1 
ATOM   4485 O OG  . SER B 1 44  ? 21.509  -3.305  -65.411 1.00 58.82  ? 44   SER B OG  1 
ATOM   4486 N N   . ARG B 1 45  ? 19.721  -3.363  -62.735 1.00 42.49  ? 45   ARG B N   1 
ATOM   4487 C CA  . ARG B 1 45  ? 19.329  -2.125  -62.103 1.00 61.29  ? 45   ARG B CA  1 
ATOM   4488 C C   . ARG B 1 45  ? 19.147  -2.288  -60.588 1.00 62.56  ? 45   ARG B C   1 
ATOM   4489 O O   . ARG B 1 45  ? 18.805  -1.341  -59.868 1.00 61.92  ? 45   ARG B O   1 
ATOM   4490 C CB  . ARG B 1 45  ? 18.111  -1.544  -62.808 1.00 60.60  ? 45   ARG B CB  1 
ATOM   4491 C CG  . ARG B 1 45  ? 18.513  -0.517  -63.837 1.00 62.39  ? 45   ARG B CG  1 
ATOM   4492 C CD  . ARG B 1 45  ? 19.074  0.701   -63.128 1.00 72.84  ? 45   ARG B CD  1 
ATOM   4493 N NE  . ARG B 1 45  ? 20.231  1.290   -63.795 1.00 71.12  ? 45   ARG B NE  1 
ATOM   4494 C CZ  . ARG B 1 45  ? 20.746  2.480   -63.482 1.00 71.79  ? 45   ARG B CZ  1 
ATOM   4495 N NH1 . ARG B 1 45  ? 20.200  3.217   -62.515 1.00 61.59  ? 45   ARG B NH1 1 
ATOM   4496 N NH2 . ARG B 1 45  ? 21.806  2.937   -64.141 1.00 69.49  ? 45   ARG B NH2 1 
ATOM   4497 N N   . ARG B 1 46  ? 19.424  -3.498  -60.119 1.00 55.48  ? 46   ARG B N   1 
ATOM   4498 C CA  . ARG B 1 46  ? 19.428  -3.799  -58.696 1.00 57.29  ? 46   ARG B CA  1 
ATOM   4499 C C   . ARG B 1 46  ? 20.493  -2.976  -57.976 1.00 60.65  ? 46   ARG B C   1 
ATOM   4500 O O   . ARG B 1 46  ? 21.600  -2.808  -58.483 1.00 48.84  ? 46   ARG B O   1 
ATOM   4501 C CB  . ARG B 1 46  ? 19.709  -5.282  -58.490 1.00 52.94  ? 46   ARG B CB  1 
ATOM   4502 C CG  . ARG B 1 46  ? 19.381  -5.777  -57.120 1.00 51.47  ? 46   ARG B CG  1 
ATOM   4503 C CD  . ARG B 1 46  ? 19.763  -7.230  -56.998 1.00 52.35  ? 46   ARG B CD  1 
ATOM   4504 N NE  . ARG B 1 46  ? 18.587  -8.086  -57.060 1.00 62.32  ? 46   ARG B NE  1 
ATOM   4505 C CZ  . ARG B 1 46  ? 18.617  -9.410  -56.960 1.00 60.23  ? 46   ARG B CZ  1 
ATOM   4506 N NH1 . ARG B 1 46  ? 19.767  -10.036 -56.796 1.00 50.98  ? 46   ARG B NH1 1 
ATOM   4507 N NH2 . ARG B 1 46  ? 17.495  -10.109 -57.017 1.00 48.50  ? 46   ARG B NH2 1 
ATOM   4508 N N   . PHE B 1 47  ? 20.157  -2.473  -56.790 1.00 64.96  ? 47   PHE B N   1 
ATOM   4509 C CA  . PHE B 1 47  ? 21.076  -1.664  -55.984 1.00 42.80  ? 47   PHE B CA  1 
ATOM   4510 C C   . PHE B 1 47  ? 21.327  -0.287  -56.586 1.00 58.64  ? 47   PHE B C   1 
ATOM   4511 O O   . PHE B 1 47  ? 21.962  0.558   -55.962 1.00 61.54  ? 47   PHE B O   1 
ATOM   4512 C CB  . PHE B 1 47  ? 22.431  -2.362  -55.776 1.00 45.25  ? 47   PHE B CB  1 
ATOM   4513 C CG  . PHE B 1 47  ? 22.331  -3.780  -55.288 1.00 46.04  ? 47   PHE B CG  1 
ATOM   4514 C CD1 . PHE B 1 47  ? 21.541  -4.106  -54.202 1.00 44.44  ? 47   PHE B CD1 1 
ATOM   4515 C CD2 . PHE B 1 47  ? 23.039  -4.791  -55.919 1.00 48.64  ? 47   PHE B CD2 1 
ATOM   4516 C CE1 . PHE B 1 47  ? 21.446  -5.412  -53.762 1.00 48.83  ? 47   PHE B CE1 1 
ATOM   4517 C CE2 . PHE B 1 47  ? 22.956  -6.106  -55.483 1.00 49.63  ? 47   PHE B CE2 1 
ATOM   4518 C CZ  . PHE B 1 47  ? 22.157  -6.419  -54.410 1.00 54.34  ? 47   PHE B CZ  1 
ATOM   4519 N N   . MET B 1 48  ? 20.859  -0.063  -57.806 1.00 57.42  ? 48   MET B N   1 
ATOM   4520 C CA  . MET B 1 48  ? 21.154  1.188   -58.484 1.00 49.79  ? 48   MET B CA  1 
ATOM   4521 C C   . MET B 1 48  ? 20.140  2.271   -58.132 1.00 46.29  ? 48   MET B C   1 
ATOM   4522 O O   . MET B 1 48  ? 18.996  1.974   -57.777 1.00 49.41  ? 48   MET B O   1 
ATOM   4523 C CB  . MET B 1 48  ? 21.229  0.969   -59.993 1.00 53.92  ? 48   MET B CB  1 
ATOM   4524 C CG  . MET B 1 48  ? 22.503  0.253   -60.448 1.00 68.47  ? 48   MET B CG  1 
ATOM   4525 S SD  . MET B 1 48  ? 24.069  1.120   -60.131 1.00 76.64  ? 48   MET B SD  1 
ATOM   4526 C CE  . MET B 1 48  ? 24.050  2.384   -61.395 1.00 74.32  ? 48   MET B CE  1 
ATOM   4527 N N   . PRO B 1 49  ? 20.563  3.537   -58.194 1.00 47.20  ? 49   PRO B N   1 
ATOM   4528 C CA  . PRO B 1 49  ? 19.565  4.597   -58.051 1.00 44.59  ? 49   PRO B CA  1 
ATOM   4529 C C   . PRO B 1 49  ? 18.442  4.366   -59.050 1.00 53.82  ? 49   PRO B C   1 
ATOM   4530 O O   . PRO B 1 49  ? 18.646  3.690   -60.057 1.00 57.99  ? 49   PRO B O   1 
ATOM   4531 C CB  . PRO B 1 49  ? 20.353  5.855   -58.411 1.00 41.19  ? 49   PRO B CB  1 
ATOM   4532 C CG  . PRO B 1 49  ? 21.724  5.548   -57.968 1.00 48.46  ? 49   PRO B CG  1 
ATOM   4533 C CD  . PRO B 1 49  ? 21.932  4.075   -58.249 1.00 44.60  ? 49   PRO B CD  1 
ATOM   4534 N N   . PRO B 1 50  ? 17.248  4.892   -58.757 1.00 58.39  ? 50   PRO B N   1 
ATOM   4535 C CA  . PRO B 1 50  ? 16.111  4.796   -59.677 1.00 50.64  ? 50   PRO B CA  1 
ATOM   4536 C C   . PRO B 1 50  ? 16.185  5.801   -60.825 1.00 53.44  ? 50   PRO B C   1 
ATOM   4537 O O   . PRO B 1 50  ? 16.680  6.919   -60.635 1.00 58.88  ? 50   PRO B O   1 
ATOM   4538 C CB  . PRO B 1 50  ? 14.920  5.137   -58.784 1.00 48.86  ? 50   PRO B CB  1 
ATOM   4539 C CG  . PRO B 1 50  ? 15.487  6.041   -57.758 1.00 54.22  ? 50   PRO B CG  1 
ATOM   4540 C CD  . PRO B 1 50  ? 16.851  5.470   -57.462 1.00 55.59  ? 50   PRO B CD  1 
ATOM   4541 N N   . GLU B 1 51  ? 15.691  5.391   -61.995 1.00 43.62  ? 51   GLU B N   1 
ATOM   4542 C CA  . GLU B 1 51  ? 15.565  6.271   -63.143 1.00 49.15  ? 51   GLU B CA  1 
ATOM   4543 C C   . GLU B 1 51  ? 14.099  6.591   -63.398 1.00 53.28  ? 51   GLU B C   1 
ATOM   4544 O O   . GLU B 1 51  ? 13.230  5.712   -63.298 1.00 60.99  ? 51   GLU B O   1 
ATOM   4545 C CB  . GLU B 1 51  ? 16.166  5.617   -64.377 1.00 52.80  ? 51   GLU B CB  1 
ATOM   4546 C CG  . GLU B 1 51  ? 17.525  4.998   -64.128 1.00 70.52  ? 51   GLU B CG  1 
ATOM   4547 C CD  . GLU B 1 51  ? 18.036  4.246   -65.337 1.00 83.21  ? 51   GLU B CD  1 
ATOM   4548 O OE1 . GLU B 1 51  ? 17.315  3.337   -65.813 1.00 77.56  ? 51   GLU B OE1 1 
ATOM   4549 O OE2 . GLU B 1 51  ? 19.148  4.575   -65.815 1.00 86.99  ? 51   GLU B OE2 1 
ATOM   4550 N N   . PRO B 1 52  ? 13.819  7.855   -63.741 1.00 48.29  ? 52   PRO B N   1 
ATOM   4551 C CA  . PRO B 1 52  ? 12.450  8.310   -64.040 1.00 50.67  ? 52   PRO B CA  1 
ATOM   4552 C C   . PRO B 1 52  ? 11.770  7.416   -65.079 1.00 53.50  ? 52   PRO B C   1 
ATOM   4553 O O   . PRO B 1 52  ? 12.395  7.039   -66.060 1.00 54.18  ? 52   PRO B O   1 
ATOM   4554 C CB  . PRO B 1 52  ? 12.656  9.727   -64.591 1.00 45.85  ? 52   PRO B CB  1 
ATOM   4555 C CG  . PRO B 1 52  ? 14.142  9.821   -64.932 1.00 50.99  ? 52   PRO B CG  1 
ATOM   4556 C CD  . PRO B 1 52  ? 14.832  8.901   -63.972 1.00 45.55  ? 52   PRO B CD  1 
ATOM   4557 N N   . LYS B 1 53  ? 10.509  7.075   -64.859 1.00 52.59  ? 53   LYS B N   1 
ATOM   4558 C CA  . LYS B 1 53  ? 9.784   6.152   -65.740 1.00 51.68  ? 53   LYS B CA  1 
ATOM   4559 C C   . LYS B 1 53  ? 9.523   6.681   -67.147 1.00 56.25  ? 53   LYS B C   1 
ATOM   4560 O O   . LYS B 1 53  ? 9.006   7.781   -67.319 1.00 56.59  ? 53   LYS B O   1 
ATOM   4561 C CB  . LYS B 1 53  ? 8.451   5.761   -65.093 1.00 48.08  ? 53   LYS B CB  1 
ATOM   4562 C CG  . LYS B 1 53  ? 7.426   5.122   -66.013 1.00 48.05  ? 53   LYS B CG  1 
ATOM   4563 C CD  . LYS B 1 53  ? 7.723   3.653   -66.240 1.00 48.68  ? 53   LYS B CD  1 
ATOM   4564 C CE  . LYS B 1 53  ? 6.618   2.982   -67.051 1.00 45.18  ? 53   LYS B CE  1 
ATOM   4565 N NZ  . LYS B 1 53  ? 6.684   3.391   -68.471 1.00 42.38  ? 53   LYS B NZ  1 
ATOM   4566 N N   . ARG B 1 54  ? 9.843   5.871   -68.155 1.00 62.63  ? 54   ARG B N   1 
ATOM   4567 C CA  . ARG B 1 54  ? 9.614   6.268   -69.541 1.00 61.60  ? 54   ARG B CA  1 
ATOM   4568 C C   . ARG B 1 54  ? 8.133   6.498   -69.853 1.00 59.95  ? 54   ARG B C   1 
ATOM   4569 O O   . ARG B 1 54  ? 7.258   5.873   -69.273 1.00 66.19  ? 54   ARG B O   1 
ATOM   4570 C CB  . ARG B 1 54  ? 10.189  5.222   -70.493 1.00 54.59  ? 54   ARG B CB  1 
ATOM   4571 C CG  . ARG B 1 54  ? 11.659  4.974   -70.287 1.00 53.91  ? 54   ARG B CG  1 
ATOM   4572 C CD  . ARG B 1 54  ? 12.176  3.869   -71.209 1.00 53.59  ? 54   ARG B CD  1 
ATOM   4573 N NE  . ARG B 1 54  ? 11.521  2.593   -70.939 1.00 67.55  ? 54   ARG B NE  1 
ATOM   4574 C CZ  . ARG B 1 54  ? 10.774  1.924   -71.811 1.00 68.72  ? 54   ARG B CZ  1 
ATOM   4575 N NH1 . ARG B 1 54  ? 10.584  2.396   -73.041 1.00 63.59  ? 54   ARG B NH1 1 
ATOM   4576 N NH2 . ARG B 1 54  ? 10.224  0.773   -71.450 1.00 67.64  ? 54   ARG B NH2 1 
ATOM   4577 N N   . PRO B 1 55  ? 7.851   7.391   -70.795 1.00 62.04  ? 55   PRO B N   1 
ATOM   4578 C CA  . PRO B 1 55  ? 6.470   7.639   -71.217 1.00 60.61  ? 55   PRO B CA  1 
ATOM   4579 C C   . PRO B 1 55  ? 5.811   6.383   -71.756 1.00 57.57  ? 55   PRO B C   1 
ATOM   4580 O O   . PRO B 1 55  ? 6.511   5.440   -72.128 1.00 61.94  ? 55   PRO B O   1 
ATOM   4581 C CB  . PRO B 1 55  ? 6.636   8.658   -72.343 1.00 60.09  ? 55   PRO B CB  1 
ATOM   4582 C CG  . PRO B 1 55  ? 7.929   9.351   -72.023 1.00 67.17  ? 55   PRO B CG  1 
ATOM   4583 C CD  . PRO B 1 55  ? 8.808   8.267   -71.483 1.00 67.30  ? 55   PRO B CD  1 
ATOM   4584 N N   . TRP B 1 56  ? 4.481   6.381   -71.800 1.00 52.00  ? 56   TRP B N   1 
ATOM   4585 C CA  . TRP B 1 56  ? 3.716   5.239   -72.298 1.00 50.78  ? 56   TRP B CA  1 
ATOM   4586 C C   . TRP B 1 56  ? 2.627   5.648   -73.276 1.00 50.64  ? 56   TRP B C   1 
ATOM   4587 O O   . TRP B 1 56  ? 2.226   6.808   -73.337 1.00 56.87  ? 56   TRP B O   1 
ATOM   4588 C CB  . TRP B 1 56  ? 3.098   4.428   -71.149 1.00 48.91  ? 56   TRP B CB  1 
ATOM   4589 C CG  . TRP B 1 56  ? 2.156   5.198   -70.313 1.00 51.53  ? 56   TRP B CG  1 
ATOM   4590 C CD1 . TRP B 1 56  ? 0.829   5.394   -70.548 1.00 61.05  ? 56   TRP B CD1 1 
ATOM   4591 C CD2 . TRP B 1 56  ? 2.459   5.901   -69.097 1.00 55.21  ? 56   TRP B CD2 1 
ATOM   4592 N NE1 . TRP B 1 56  ? 0.284   6.175   -69.555 1.00 59.80  ? 56   TRP B NE1 1 
ATOM   4593 C CE2 . TRP B 1 56  ? 1.265   6.503   -68.654 1.00 57.57  ? 56   TRP B CE2 1 
ATOM   4594 C CE3 . TRP B 1 56  ? 3.627   6.083   -68.341 1.00 53.50  ? 56   TRP B CE3 1 
ATOM   4595 C CZ2 . TRP B 1 56  ? 1.201   7.270   -67.479 1.00 54.76  ? 56   TRP B CZ2 1 
ATOM   4596 C CZ3 . TRP B 1 56  ? 3.563   6.850   -67.174 1.00 40.53  ? 56   TRP B CZ3 1 
ATOM   4597 C CH2 . TRP B 1 56  ? 2.356   7.432   -66.758 1.00 41.05  ? 56   TRP B CH2 1 
ATOM   4598 N N   . SER B 1 57  ? 2.162   4.662   -74.033 1.00 55.76  ? 57   SER B N   1 
ATOM   4599 C CA  . SER B 1 57  ? 1.115   4.829   -75.019 1.00 53.12  ? 57   SER B CA  1 
ATOM   4600 C C   . SER B 1 57  ? -0.229  4.461   -74.407 1.00 56.11  ? 57   SER B C   1 
ATOM   4601 O O   . SER B 1 57  ? -0.289  3.790   -73.385 1.00 63.13  ? 57   SER B O   1 
ATOM   4602 C CB  . SER B 1 57  ? 1.386   3.915   -76.214 1.00 58.56  ? 57   SER B CB  1 
ATOM   4603 O OG  . SER B 1 57  ? 0.960   2.589   -75.942 1.00 55.48  ? 57   SER B OG  1 
ATOM   4604 N N   . GLY B 1 58  ? -1.306  4.914   -75.035 1.00 59.17  ? 58   GLY B N   1 
ATOM   4605 C CA  . GLY B 1 58  ? -2.646  4.564   -74.605 1.00 60.29  ? 58   GLY B CA  1 
ATOM   4606 C C   . GLY B 1 58  ? -2.999  4.996   -73.198 1.00 64.28  ? 58   GLY B C   1 
ATOM   4607 O O   . GLY B 1 58  ? -2.411  5.934   -72.634 1.00 57.06  ? 58   GLY B O   1 
ATOM   4608 N N   . VAL B 1 59  ? -3.985  4.308   -72.632 1.00 70.25  ? 59   VAL B N   1 
ATOM   4609 C CA  . VAL B 1 59  ? -4.445  4.604   -71.282 1.00 61.38  ? 59   VAL B CA  1 
ATOM   4610 C C   . VAL B 1 59  ? -4.075  3.474   -70.352 1.00 56.89  ? 59   VAL B C   1 
ATOM   4611 O O   . VAL B 1 59  ? -4.673  2.392   -70.401 1.00 57.03  ? 59   VAL B O   1 
ATOM   4612 C CB  . VAL B 1 59  ? -5.970  4.807   -71.224 1.00 62.27  ? 59   VAL B CB  1 
ATOM   4613 C CG1 . VAL B 1 59  ? -6.421  4.970   -69.791 1.00 61.55  ? 59   VAL B CG1 1 
ATOM   4614 C CG2 . VAL B 1 59  ? -6.365  6.014   -72.035 1.00 54.50  ? 59   VAL B CG2 1 
ATOM   4615 N N   . LEU B 1 60  ? -3.077  3.750   -69.520 1.00 47.85  ? 60   LEU B N   1 
ATOM   4616 C CA  . LEU B 1 60  ? -2.611  2.867   -68.459 1.00 46.85  ? 60   LEU B CA  1 
ATOM   4617 C C   . LEU B 1 60  ? -3.632  2.701   -67.331 1.00 57.33  ? 60   LEU B C   1 
ATOM   4618 O O   . LEU B 1 60  ? -4.141  3.686   -66.780 1.00 51.28  ? 60   LEU B O   1 
ATOM   4619 C CB  . LEU B 1 60  ? -1.335  3.452   -67.873 1.00 47.72  ? 60   LEU B CB  1 
ATOM   4620 C CG  . LEU B 1 60  ? -0.545  2.634   -66.864 1.00 52.43  ? 60   LEU B CG  1 
ATOM   4621 C CD1 . LEU B 1 60  ? 0.098   1.443   -67.543 1.00 54.93  ? 60   LEU B CD1 1 
ATOM   4622 C CD2 . LEU B 1 60  ? 0.509   3.523   -66.261 1.00 54.15  ? 60   LEU B CD2 1 
ATOM   4623 N N   . ASP B 1 61  ? -3.917  1.450   -66.984 1.00 60.61  ? 61   ASP B N   1 
ATOM   4624 C CA  . ASP B 1 61  ? -4.866  1.146   -65.925 1.00 60.33  ? 61   ASP B CA  1 
ATOM   4625 C C   . ASP B 1 61  ? -4.278  1.352   -64.528 1.00 66.03  ? 61   ASP B C   1 
ATOM   4626 O O   . ASP B 1 61  ? -3.423  0.575   -64.077 1.00 65.73  ? 61   ASP B O   1 
ATOM   4627 C CB  . ASP B 1 61  ? -5.373  -0.286  -66.056 1.00 63.28  ? 61   ASP B CB  1 
ATOM   4628 C CG  . ASP B 1 61  ? -6.088  -0.760  -64.804 1.00 84.99  ? 61   ASP B CG  1 
ATOM   4629 O OD1 . ASP B 1 61  ? -6.870  0.039   -64.241 1.00 89.94  ? 61   ASP B OD1 1 
ATOM   4630 O OD2 . ASP B 1 61  ? -5.858  -1.917  -64.374 1.00 85.42  ? 61   ASP B OD2 1 
ATOM   4631 N N   . ALA B 1 62  ? -4.752  2.391   -63.842 1.00 63.82  ? 62   ALA B N   1 
ATOM   4632 C CA  . ALA B 1 62  ? -4.281  2.713   -62.494 1.00 61.02  ? 62   ALA B CA  1 
ATOM   4633 C C   . ALA B 1 62  ? -5.411  2.569   -61.486 1.00 64.92  ? 62   ALA B C   1 
ATOM   4634 O O   . ALA B 1 62  ? -5.662  3.469   -60.688 1.00 56.90  ? 62   ALA B O   1 
ATOM   4635 C CB  . ALA B 1 62  ? -3.744  4.111   -62.455 1.00 53.93  ? 62   ALA B CB  1 
ATOM   4636 N N   . THR B 1 63  ? -6.099  1.437   -61.534 1.00 62.43  ? 63   THR B N   1 
ATOM   4637 C CA  . THR B 1 63  ? -7.245  1.231   -60.674 1.00 58.77  ? 63   THR B CA  1 
ATOM   4638 C C   . THR B 1 63  ? -6.984  0.118   -59.680 1.00 63.92  ? 63   THR B C   1 
ATOM   4639 O O   . THR B 1 63  ? -7.899  -0.321  -59.001 1.00 70.90  ? 63   THR B O   1 
ATOM   4640 C CB  . THR B 1 63  ? -8.505  0.862   -61.491 1.00 65.86  ? 63   THR B CB  1 
ATOM   4641 O OG1 . THR B 1 63  ? -8.316  -0.418  -62.107 1.00 61.36  ? 63   THR B OG1 1 
ATOM   4642 C CG2 . THR B 1 63  ? -8.812  1.931   -62.567 1.00 50.19  ? 63   THR B CG2 1 
ATOM   4643 N N   . THR B 1 64  ? -5.736  -0.325  -59.584 1.00 65.51  ? 64   THR B N   1 
ATOM   4644 C CA  . THR B 1 64  ? -5.403  -1.482  -58.757 1.00 58.72  ? 64   THR B CA  1 
ATOM   4645 C C   . THR B 1 64  ? -3.987  -1.389  -58.155 1.00 54.05  ? 64   THR B C   1 
ATOM   4646 O O   . THR B 1 64  ? -3.081  -0.833  -58.757 1.00 51.28  ? 64   THR B O   1 
ATOM   4647 C CB  . THR B 1 64  ? -5.581  -2.777  -59.570 1.00 66.88  ? 64   THR B CB  1 
ATOM   4648 O OG1 . THR B 1 64  ? -5.089  -3.891  -58.824 1.00 78.83  ? 64   THR B OG1 1 
ATOM   4649 C CG2 . THR B 1 64  ? -4.819  -2.684  -60.874 1.00 71.08  ? 64   THR B CG2 1 
ATOM   4650 N N   . PHE B 1 65  ? -3.804  -1.923  -56.954 1.00 56.70  ? 65   PHE B N   1 
ATOM   4651 C CA  . PHE B 1 65  ? -2.508  -1.847  -56.273 1.00 55.85  ? 65   PHE B CA  1 
ATOM   4652 C C   . PHE B 1 65  ? -1.440  -2.671  -56.946 1.00 56.19  ? 65   PHE B C   1 
ATOM   4653 O O   . PHE B 1 65  ? -1.637  -3.845  -57.239 1.00 55.48  ? 65   PHE B O   1 
ATOM   4654 C CB  . PHE B 1 65  ? -2.619  -2.309  -54.819 1.00 53.59  ? 65   PHE B CB  1 
ATOM   4655 C CG  . PHE B 1 65  ? -3.125  -1.252  -53.893 1.00 59.11  ? 65   PHE B CG  1 
ATOM   4656 C CD1 . PHE B 1 65  ? -2.529  -0.005  -53.864 1.00 53.95  ? 65   PHE B CD1 1 
ATOM   4657 C CD2 . PHE B 1 65  ? -4.220  -1.494  -53.072 1.00 56.45  ? 65   PHE B CD2 1 
ATOM   4658 C CE1 . PHE B 1 65  ? -3.001  0.968   -53.026 1.00 54.10  ? 65   PHE B CE1 1 
ATOM   4659 C CE2 . PHE B 1 65  ? -4.697  -0.521  -52.224 1.00 42.81  ? 65   PHE B CE2 1 
ATOM   4660 C CZ  . PHE B 1 65  ? -4.091  0.709   -52.201 1.00 56.23  ? 65   PHE B CZ  1 
ATOM   4661 N N   . GLN B 1 66  ? -0.290  -2.052  -57.162 1.00 61.36  ? 66   GLN B N   1 
ATOM   4662 C CA  . GLN B 1 66  ? 0.841   -2.745  -57.756 1.00 55.26  ? 66   GLN B CA  1 
ATOM   4663 C C   . GLN B 1 66  ? 1.544   -3.636  -56.742 1.00 56.13  ? 66   GLN B C   1 
ATOM   4664 O O   . GLN B 1 66  ? 1.155   -3.694  -55.577 1.00 43.68  ? 66   GLN B O   1 
ATOM   4665 C CB  . GLN B 1 66  ? 1.816   -1.746  -58.356 1.00 49.50  ? 66   GLN B CB  1 
ATOM   4666 C CG  . GLN B 1 66  ? 1.466   -1.356  -59.760 1.00 61.26  ? 66   GLN B CG  1 
ATOM   4667 C CD  . GLN B 1 66  ? 1.860   -2.423  -60.755 1.00 76.08  ? 66   GLN B CD  1 
ATOM   4668 O OE1 . GLN B 1 66  ? 2.571   -3.374  -60.416 1.00 81.33  ? 66   GLN B OE1 1 
ATOM   4669 N NE2 . GLN B 1 66  ? 1.408   -2.270  -61.994 1.00 78.38  ? 66   GLN B NE2 1 
ATOM   4670 N N   . ASN B 1 67  ? 2.580   -4.335  -57.197 1.00 58.56  ? 67   ASN B N   1 
ATOM   4671 C CA  . ASN B 1 67  ? 3.279   -5.290  -56.353 1.00 52.06  ? 67   ASN B CA  1 
ATOM   4672 C C   . ASN B 1 67  ? 4.012   -4.661  -55.199 1.00 50.87  ? 67   ASN B C   1 
ATOM   4673 O O   . ASN B 1 67  ? 4.309   -3.469  -55.199 1.00 63.52  ? 67   ASN B O   1 
ATOM   4674 C CB  . ASN B 1 67  ? 4.259   -6.115  -57.174 1.00 63.99  ? 67   ASN B CB  1 
ATOM   4675 C CG  . ASN B 1 67  ? 3.564   -7.019  -58.167 1.00 63.37  ? 67   ASN B CG  1 
ATOM   4676 O OD1 . ASN B 1 67  ? 2.518   -7.594  -57.870 1.00 60.53  ? 67   ASN B OD1 1 
ATOM   4677 N ND2 . ASN B 1 67  ? 4.146   -7.154  -59.351 1.00 62.29  ? 67   ASN B ND2 1 
ATOM   4678 N N   . VAL B 1 68  ? 4.311   -5.489  -54.210 1.00 52.00  ? 68   VAL B N   1 
ATOM   4679 C CA  . VAL B 1 68  ? 5.041   -5.051  -53.036 1.00 40.98  ? 68   VAL B CA  1 
ATOM   4680 C C   . VAL B 1 68  ? 6.523   -5.296  -53.247 1.00 44.61  ? 68   VAL B C   1 
ATOM   4681 O O   . VAL B 1 68  ? 6.926   -6.371  -53.732 1.00 48.76  ? 68   VAL B O   1 
ATOM   4682 C CB  . VAL B 1 68  ? 4.551   -5.800  -51.773 1.00 47.71  ? 68   VAL B CB  1 
ATOM   4683 C CG1 . VAL B 1 68  ? 5.500   -5.592  -50.620 1.00 50.48  ? 68   VAL B CG1 1 
ATOM   4684 C CG2 . VAL B 1 68  ? 3.172   -5.334  -51.394 1.00 51.57  ? 68   VAL B CG2 1 
ATOM   4685 N N   . CYS B 1 69  ? 7.330   -4.298  -52.896 1.00 38.96  ? 69   CYS B N   1 
ATOM   4686 C CA  . CYS B 1 69  ? 8.784   -4.425  -52.981 1.00 46.49  ? 69   CYS B CA  1 
ATOM   4687 C C   . CYS B 1 69  ? 9.260   -5.672  -52.237 1.00 50.47  ? 69   CYS B C   1 
ATOM   4688 O O   . CYS B 1 69  ? 8.727   -6.027  -51.173 1.00 44.96  ? 69   CYS B O   1 
ATOM   4689 C CB  . CYS B 1 69  ? 9.475   -3.179  -52.427 1.00 43.02  ? 69   CYS B CB  1 
ATOM   4690 S SG  . CYS B 1 69  ? 9.334   -1.705  -53.458 1.00 58.68  ? 69   CYS B SG  1 
ATOM   4691 N N   . TYR B 1 70  ? 10.264  -6.339  -52.794 1.00 53.58  ? 70   TYR B N   1 
ATOM   4692 C CA  . TYR B 1 70  ? 10.695  -7.618  -52.239 1.00 40.91  ? 70   TYR B CA  1 
ATOM   4693 C C   . TYR B 1 70  ? 11.297  -7.489  -50.839 1.00 50.33  ? 70   TYR B C   1 
ATOM   4694 O O   . TYR B 1 70  ? 12.232  -6.719  -50.602 1.00 50.46  ? 70   TYR B O   1 
ATOM   4695 C CB  . TYR B 1 70  ? 11.652  -8.326  -53.172 1.00 38.97  ? 70   TYR B CB  1 
ATOM   4696 C CG  . TYR B 1 70  ? 11.508  -9.813  -53.050 1.00 56.48  ? 70   TYR B CG  1 
ATOM   4697 C CD1 . TYR B 1 70  ? 12.163  -10.512 -52.048 1.00 51.76  ? 70   TYR B CD1 1 
ATOM   4698 C CD2 . TYR B 1 70  ? 10.688  -10.520 -53.908 1.00 51.72  ? 70   TYR B CD2 1 
ATOM   4699 C CE1 . TYR B 1 70  ? 12.020  -11.871 -51.922 1.00 57.35  ? 70   TYR B CE1 1 
ATOM   4700 C CE2 . TYR B 1 70  ? 10.544  -11.878 -53.789 1.00 59.52  ? 70   TYR B CE2 1 
ATOM   4701 C CZ  . TYR B 1 70  ? 11.207  -12.546 -52.792 1.00 57.56  ? 70   TYR B CZ  1 
ATOM   4702 O OH  . TYR B 1 70  ? 11.064  -13.903 -52.667 1.00 53.10  ? 70   TYR B OH  1 
ATOM   4703 N N   . GLN B 1 71  ? 10.751  -8.259  -49.910 1.00 60.05  ? 71   GLN B N   1 
ATOM   4704 C CA  . GLN B 1 71  ? 11.125  -8.129  -48.512 1.00 50.10  ? 71   GLN B CA  1 
ATOM   4705 C C   . GLN B 1 71  ? 10.861  -9.423  -47.784 1.00 54.17  ? 71   GLN B C   1 
ATOM   4706 O O   . GLN B 1 71  ? 10.091  -10.281 -48.234 1.00 46.14  ? 71   GLN B O   1 
ATOM   4707 C CB  . GLN B 1 71  ? 10.295  -7.039  -47.845 1.00 41.16  ? 71   GLN B CB  1 
ATOM   4708 C CG  . GLN B 1 71  ? 8.836   -7.443  -47.652 1.00 44.63  ? 71   GLN B CG  1 
ATOM   4709 C CD  . GLN B 1 71  ? 7.905   -6.266  -47.325 1.00 56.92  ? 71   GLN B CD  1 
ATOM   4710 O OE1 . GLN B 1 71  ? 7.255   -6.249  -46.273 1.00 49.11  ? 71   GLN B OE1 1 
ATOM   4711 N NE2 . GLN B 1 71  ? 7.828   -5.290  -48.235 1.00 32.58  ? 71   GLN B NE2 1 
ATOM   4712 N N   . TYR B 1 72  ? 11.519  -9.546  -46.645 1.00 49.36  ? 72   TYR B N   1 
ATOM   4713 C CA  . TYR B 1 72  ? 11.193  -10.553 -45.662 1.00 47.77  ? 72   TYR B CA  1 
ATOM   4714 C C   . TYR B 1 72  ? 9.728   -10.449 -45.214 1.00 58.39  ? 72   TYR B C   1 
ATOM   4715 O O   . TYR B 1 72  ? 9.184   -9.347  -45.000 1.00 55.65  ? 72   TYR B O   1 
ATOM   4716 C CB  . TYR B 1 72  ? 12.116  -10.359 -44.471 1.00 39.68  ? 72   TYR B CB  1 
ATOM   4717 C CG  . TYR B 1 72  ? 11.800  -11.220 -43.288 1.00 59.70  ? 72   TYR B CG  1 
ATOM   4718 C CD1 . TYR B 1 72  ? 12.163  -12.564 -43.268 1.00 59.04  ? 72   TYR B CD1 1 
ATOM   4719 C CD2 . TYR B 1 72  ? 11.154  -10.692 -42.179 1.00 54.30  ? 72   TYR B CD2 1 
ATOM   4720 C CE1 . TYR B 1 72  ? 11.885  -13.356 -42.181 1.00 57.73  ? 72   TYR B CE1 1 
ATOM   4721 C CE2 . TYR B 1 72  ? 10.870  -11.479 -41.083 1.00 63.90  ? 72   TYR B CE2 1 
ATOM   4722 C CZ  . TYR B 1 72  ? 11.243  -12.810 -41.086 1.00 62.90  ? 72   TYR B CZ  1 
ATOM   4723 O OH  . TYR B 1 72  ? 10.966  -13.601 -39.995 1.00 69.40  ? 72   TYR B OH  1 
ATOM   4724 N N   . VAL B 1 73  ? 9.090   -11.606 -45.081 1.00 51.50  ? 73   VAL B N   1 
ATOM   4725 C CA  . VAL B 1 73  ? 7.741   -11.681 -44.537 1.00 46.09  ? 73   VAL B CA  1 
ATOM   4726 C C   . VAL B 1 73  ? 7.741   -12.365 -43.175 1.00 50.80  ? 73   VAL B C   1 
ATOM   4727 O O   . VAL B 1 73  ? 8.336   -13.431 -43.001 1.00 68.23  ? 73   VAL B O   1 
ATOM   4728 C CB  . VAL B 1 73  ? 6.792   -12.435 -45.477 1.00 47.78  ? 73   VAL B CB  1 
ATOM   4729 C CG1 . VAL B 1 73  ? 5.460   -12.648 -44.796 1.00 51.36  ? 73   VAL B CG1 1 
ATOM   4730 C CG2 . VAL B 1 73  ? 6.610   -11.666 -46.774 1.00 45.87  ? 73   VAL B CG2 1 
ATOM   4731 N N   . ASP B 1 74  ? 7.055   -11.752 -42.219 1.00 60.96  ? 74   ASP B N   1 
ATOM   4732 C CA  . ASP B 1 74  ? 7.033   -12.218 -40.835 1.00 62.10  ? 74   ASP B CA  1 
ATOM   4733 C C   . ASP B 1 74  ? 6.167   -13.464 -40.653 1.00 58.09  ? 74   ASP B C   1 
ATOM   4734 O O   . ASP B 1 74  ? 5.137   -13.602 -41.311 1.00 58.82  ? 74   ASP B O   1 
ATOM   4735 C CB  . ASP B 1 74  ? 6.535   -11.105 -39.922 1.00 64.75  ? 74   ASP B CB  1 
ATOM   4736 C CG  . ASP B 1 74  ? 6.633   -11.476 -38.482 1.00 69.46  ? 74   ASP B CG  1 
ATOM   4737 O OD1 . ASP B 1 74  ? 7.621   -12.156 -38.130 1.00 72.47  ? 74   ASP B OD1 1 
ATOM   4738 O OD2 . ASP B 1 74  ? 5.722   -11.108 -37.715 1.00 69.10  ? 74   ASP B OD2 1 
ATOM   4739 N N   . THR B 1 75  ? 6.577   -14.365 -39.759 1.00 64.01  ? 75   THR B N   1 
ATOM   4740 C CA  . THR B 1 75  ? 5.903   -15.665 -39.632 1.00 69.52  ? 75   THR B CA  1 
ATOM   4741 C C   . THR B 1 75  ? 5.845   -16.170 -38.197 1.00 72.51  ? 75   THR B C   1 
ATOM   4742 O O   . THR B 1 75  ? 5.719   -17.375 -37.946 1.00 66.83  ? 75   THR B O   1 
ATOM   4743 C CB  . THR B 1 75  ? 6.592   -16.738 -40.493 1.00 66.14  ? 75   THR B CB  1 
ATOM   4744 O OG1 . THR B 1 75  ? 7.857   -17.093 -39.911 1.00 69.54  ? 75   THR B OG1 1 
ATOM   4745 C CG2 . THR B 1 75  ? 6.797   -16.220 -41.913 1.00 56.75  ? 75   THR B CG2 1 
ATOM   4746 N N   . LEU B 1 76  ? 5.935   -15.237 -37.262 1.00 64.40  ? 76   LEU B N   1 
ATOM   4747 C CA  . LEU B 1 76  ? 6.034   -15.575 -35.858 1.00 68.44  ? 76   LEU B CA  1 
ATOM   4748 C C   . LEU B 1 76  ? 4.684   -16.011 -35.303 1.00 68.51  ? 76   LEU B C   1 
ATOM   4749 O O   . LEU B 1 76  ? 4.606   -16.888 -34.441 1.00 71.67  ? 76   LEU B O   1 
ATOM   4750 C CB  . LEU B 1 76  ? 6.569   -14.370 -35.092 1.00 70.24  ? 76   LEU B CB  1 
ATOM   4751 C CG  . LEU B 1 76  ? 6.493   -14.407 -33.570 1.00 66.12  ? 76   LEU B CG  1 
ATOM   4752 C CD1 . LEU B 1 76  ? 7.455   -15.450 -33.001 1.00 61.28  ? 76   LEU B CD1 1 
ATOM   4753 C CD2 . LEU B 1 76  ? 6.774   -13.014 -33.020 1.00 62.30  ? 76   LEU B CD2 1 
ATOM   4754 N N   . TYR B 1 77  ? 3.623   -15.383 -35.792 1.00 66.51  ? 77   TYR B N   1 
ATOM   4755 C CA  . TYR B 1 77  ? 2.272   -15.738 -35.385 1.00 67.22  ? 77   TYR B CA  1 
ATOM   4756 C C   . TYR B 1 77  ? 1.421   -15.821 -36.638 1.00 72.27  ? 77   TYR B C   1 
ATOM   4757 O O   . TYR B 1 77  ? 0.586   -14.955 -36.889 1.00 65.14  ? 77   TYR B O   1 
ATOM   4758 C CB  . TYR B 1 77  ? 1.696   -14.710 -34.408 1.00 53.41  ? 77   TYR B CB  1 
ATOM   4759 C CG  . TYR B 1 77  ? 2.413   -14.630 -33.067 1.00 63.49  ? 77   TYR B CG  1 
ATOM   4760 C CD1 . TYR B 1 77  ? 2.038   -15.441 -31.999 1.00 65.90  ? 77   TYR B CD1 1 
ATOM   4761 C CD2 . TYR B 1 77  ? 3.454   -13.726 -32.863 1.00 72.01  ? 77   TYR B CD2 1 
ATOM   4762 C CE1 . TYR B 1 77  ? 2.689   -15.364 -30.770 1.00 77.92  ? 77   TYR B CE1 1 
ATOM   4763 C CE2 . TYR B 1 77  ? 4.111   -13.638 -31.639 1.00 69.62  ? 77   TYR B CE2 1 
ATOM   4764 C CZ  . TYR B 1 77  ? 3.728   -14.458 -30.596 1.00 84.97  ? 77   TYR B CZ  1 
ATOM   4765 O OH  . TYR B 1 77  ? 4.383   -14.366 -29.382 1.00 92.53  ? 77   TYR B OH  1 
ATOM   4766 N N   . PRO B 1 78  ? 1.644   -16.874 -37.436 1.00 79.03  ? 78   PRO B N   1 
ATOM   4767 C CA  . PRO B 1 78  ? 1.004   -17.051 -38.744 1.00 78.27  ? 78   PRO B CA  1 
ATOM   4768 C C   . PRO B 1 78  ? -0.512  -16.979 -38.627 1.00 72.73  ? 78   PRO B C   1 
ATOM   4769 O O   . PRO B 1 78  ? -1.077  -17.640 -37.764 1.00 71.09  ? 78   PRO B O   1 
ATOM   4770 C CB  . PRO B 1 78  ? 1.439   -18.459 -39.160 1.00 76.79  ? 78   PRO B CB  1 
ATOM   4771 C CG  . PRO B 1 78  ? 2.701   -18.710 -38.397 1.00 84.00  ? 78   PRO B CG  1 
ATOM   4772 C CD  . PRO B 1 78  ? 2.505   -18.015 -37.082 1.00 81.93  ? 78   PRO B CD  1 
ATOM   4773 N N   . GLY B 1 79  ? -1.151  -16.175 -39.471 1.00 66.38  ? 79   GLY B N   1 
ATOM   4774 C CA  . GLY B 1 79  ? -2.597  -16.044 -39.451 1.00 67.09  ? 79   GLY B CA  1 
ATOM   4775 C C   . GLY B 1 79  ? -3.154  -15.159 -38.342 1.00 71.64  ? 79   GLY B C   1 
ATOM   4776 O O   . GLY B 1 79  ? -4.355  -15.180 -38.075 1.00 73.73  ? 79   GLY B O   1 
ATOM   4777 N N   . PHE B 1 80  ? -2.295  -14.368 -37.706 1.00 58.65  ? 80   PHE B N   1 
ATOM   4778 C CA  . PHE B 1 80  ? -2.729  -13.504 -36.613 1.00 56.52  ? 80   PHE B CA  1 
ATOM   4779 C C   . PHE B 1 80  ? -2.813  -12.034 -37.032 1.00 56.98  ? 80   PHE B C   1 
ATOM   4780 O O   . PHE B 1 80  ? -1.811  -11.429 -37.420 1.00 64.63  ? 80   PHE B O   1 
ATOM   4781 C CB  . PHE B 1 80  ? -1.799  -13.677 -35.411 1.00 62.21  ? 80   PHE B CB  1 
ATOM   4782 C CG  . PHE B 1 80  ? -1.971  -12.629 -34.355 1.00 67.66  ? 80   PHE B CG  1 
ATOM   4783 C CD1 . PHE B 1 80  ? -2.977  -12.738 -33.409 1.00 60.89  ? 80   PHE B CD1 1 
ATOM   4784 C CD2 . PHE B 1 80  ? -1.120  -11.526 -34.305 1.00 70.07  ? 80   PHE B CD2 1 
ATOM   4785 C CE1 . PHE B 1 80  ? -3.134  -11.763 -32.424 1.00 60.63  ? 80   PHE B CE1 1 
ATOM   4786 C CE2 . PHE B 1 80  ? -1.269  -10.555 -33.320 1.00 61.36  ? 80   PHE B CE2 1 
ATOM   4787 C CZ  . PHE B 1 80  ? -2.277  -10.671 -32.385 1.00 60.16  ? 80   PHE B CZ  1 
ATOM   4788 N N   . GLU B 1 81  ? -4.014  -11.469 -36.939 1.00 52.21  ? 81   GLU B N   1 
ATOM   4789 C CA  . GLU B 1 81  ? -4.281  -10.101 -37.395 1.00 67.05  ? 81   GLU B CA  1 
ATOM   4790 C C   . GLU B 1 81  ? -3.250  -9.056  -36.947 1.00 66.68  ? 81   GLU B C   1 
ATOM   4791 O O   . GLU B 1 81  ? -2.901  -8.148  -37.711 1.00 57.75  ? 81   GLU B O   1 
ATOM   4792 C CB  . GLU B 1 81  ? -5.687  -9.653  -36.969 1.00 71.25  ? 81   GLU B CB  1 
ATOM   4793 C CG  . GLU B 1 81  ? -5.932  -8.144  -37.089 1.00 77.94  ? 81   GLU B CG  1 
ATOM   4794 C CD  . GLU B 1 81  ? -6.073  -7.646  -38.534 1.00 84.31  ? 81   GLU B CD  1 
ATOM   4795 O OE1 . GLU B 1 81  ? -6.119  -8.479  -39.473 1.00 82.36  ? 81   GLU B OE1 1 
ATOM   4796 O OE2 . GLU B 1 81  ? -6.152  -6.408  -38.724 1.00 78.84  ? 81   GLU B OE2 1 
ATOM   4797 N N   . GLY B 1 82  ? -2.772  -9.185  -35.714 1.00 57.82  ? 82   GLY B N   1 
ATOM   4798 C CA  . GLY B 1 82  ? -1.827  -8.234  -35.172 1.00 57.66  ? 82   GLY B CA  1 
ATOM   4799 C C   . GLY B 1 82  ? -0.512  -8.153  -35.925 1.00 52.16  ? 82   GLY B C   1 
ATOM   4800 O O   . GLY B 1 82  ? 0.168   -7.132  -35.867 1.00 51.45  ? 82   GLY B O   1 
ATOM   4801 N N   . THR B 1 83  ? -0.140  -9.222  -36.624 1.00 50.34  ? 83   THR B N   1 
ATOM   4802 C CA  . THR B 1 83  ? 1.129   -9.231  -37.346 1.00 40.53  ? 83   THR B CA  1 
ATOM   4803 C C   . THR B 1 83  ? 0.906   -9.171  -38.850 1.00 45.97  ? 83   THR B C   1 
ATOM   4804 O O   . THR B 1 83  ? 1.734   -8.646  -39.602 1.00 49.52  ? 83   THR B O   1 
ATOM   4805 C CB  . THR B 1 83  ? 2.014   -10.460 -36.976 1.00 64.46  ? 83   THR B CB  1 
ATOM   4806 O OG1 . THR B 1 83  ? 1.267   -11.678 -37.126 1.00 61.12  ? 83   THR B OG1 1 
ATOM   4807 C CG2 . THR B 1 83  ? 2.520   -10.350 -35.545 1.00 54.61  ? 83   THR B CG2 1 
ATOM   4808 N N   . GLU B 1 84  ? -0.221  -9.713  -39.289 1.00 45.68  ? 84   GLU B N   1 
ATOM   4809 C CA  . GLU B 1 84  ? -0.506  -9.816  -40.708 1.00 46.44  ? 84   GLU B CA  1 
ATOM   4810 C C   . GLU B 1 84  ? -0.842  -8.461  -41.283 1.00 52.28  ? 84   GLU B C   1 
ATOM   4811 O O   . GLU B 1 84  ? -0.543  -8.163  -42.442 1.00 58.07  ? 84   GLU B O   1 
ATOM   4812 C CB  . GLU B 1 84  ? -1.672  -10.766 -40.920 1.00 50.35  ? 84   GLU B CB  1 
ATOM   4813 C CG  . GLU B 1 84  ? -1.399  -12.156 -40.380 1.00 62.81  ? 84   GLU B CG  1 
ATOM   4814 C CD  . GLU B 1 84  ? -0.489  -12.940 -41.280 1.00 72.81  ? 84   GLU B CD  1 
ATOM   4815 O OE1 . GLU B 1 84  ? 0.090   -12.319 -42.196 1.00 70.15  ? 84   GLU B OE1 1 
ATOM   4816 O OE2 . GLU B 1 84  ? -0.366  -14.171 -41.085 1.00 83.14  ? 84   GLU B OE2 1 
ATOM   4817 N N   . MET B 1 85  ? -1.479  -7.638  -40.462 1.00 56.81  ? 85   MET B N   1 
ATOM   4818 C CA  . MET B 1 85  ? -1.908  -6.328  -40.901 1.00 48.38  ? 85   MET B CA  1 
ATOM   4819 C C   . MET B 1 85  ? -0.718  -5.525  -41.424 1.00 45.33  ? 85   MET B C   1 
ATOM   4820 O O   . MET B 1 85  ? -0.887  -4.525  -42.124 1.00 45.87  ? 85   MET B O   1 
ATOM   4821 C CB  . MET B 1 85  ? -2.621  -5.599  -39.762 1.00 48.60  ? 85   MET B CB  1 
ATOM   4822 C CG  . MET B 1 85  ? -1.845  -5.500  -38.444 1.00 41.54  ? 85   MET B CG  1 
ATOM   4823 S SD  . MET B 1 85  ? -2.701  -4.415  -37.278 1.00 62.57  ? 85   MET B SD  1 
ATOM   4824 C CE  . MET B 1 85  ? -2.391  -2.793  -38.011 1.00 52.08  ? 85   MET B CE  1 
ATOM   4825 N N   . TRP B 1 86  ? 0.483   -5.986  -41.085 1.00 37.76  ? 86   TRP B N   1 
ATOM   4826 C CA  . TRP B 1 86  ? 1.719   -5.389  -41.568 1.00 34.21  ? 86   TRP B CA  1 
ATOM   4827 C C   . TRP B 1 86  ? 2.387   -6.182  -42.695 1.00 42.30  ? 86   TRP B C   1 
ATOM   4828 O O   . TRP B 1 86  ? 3.267   -5.671  -43.385 1.00 33.94  ? 86   TRP B O   1 
ATOM   4829 C CB  . TRP B 1 86  ? 2.692   -5.260  -40.413 1.00 33.82  ? 86   TRP B CB  1 
ATOM   4830 C CG  . TRP B 1 86  ? 2.095   -4.599  -39.199 1.00 52.80  ? 86   TRP B CG  1 
ATOM   4831 C CD1 . TRP B 1 86  ? 1.797   -5.193  -38.001 1.00 52.44  ? 86   TRP B CD1 1 
ATOM   4832 C CD2 . TRP B 1 86  ? 1.721   -3.219  -39.065 1.00 47.96  ? 86   TRP B CD2 1 
ATOM   4833 N NE1 . TRP B 1 86  ? 1.267   -4.266  -37.134 1.00 47.52  ? 86   TRP B NE1 1 
ATOM   4834 C CE2 . TRP B 1 86  ? 1.208   -3.049  -37.759 1.00 49.03  ? 86   TRP B CE2 1 
ATOM   4835 C CE3 . TRP B 1 86  ? 1.762   -2.112  -39.925 1.00 46.74  ? 86   TRP B CE3 1 
ATOM   4836 C CZ2 . TRP B 1 86  ? 0.752   -1.806  -37.283 1.00 46.54  ? 86   TRP B CZ2 1 
ATOM   4837 C CZ3 . TRP B 1 86  ? 1.307   -0.866  -39.446 1.00 41.42  ? 86   TRP B CZ3 1 
ATOM   4838 C CH2 . TRP B 1 86  ? 0.820   -0.731  -38.134 1.00 34.46  ? 86   TRP B CH2 1 
ATOM   4839 N N   . ASN B 1 87  ? 1.991   -7.441  -42.878 1.00 46.64  ? 87   ASN B N   1 
ATOM   4840 C CA  . ASN B 1 87  ? 2.559   -8.235  -43.961 1.00 46.82  ? 87   ASN B CA  1 
ATOM   4841 C C   . ASN B 1 87  ? 2.073   -7.770  -45.329 1.00 51.31  ? 87   ASN B C   1 
ATOM   4842 O O   . ASN B 1 87  ? 1.072   -7.058  -45.427 1.00 43.60  ? 87   ASN B O   1 
ATOM   4843 C CB  . ASN B 1 87  ? 2.251   -9.717  -43.786 1.00 51.91  ? 87   ASN B CB  1 
ATOM   4844 C CG  . ASN B 1 87  ? 3.116   -10.380 -42.744 1.00 50.84  ? 87   ASN B CG  1 
ATOM   4845 O OD1 . ASN B 1 87  ? 4.330   -10.183 -42.698 1.00 54.17  ? 87   ASN B OD1 1 
ATOM   4846 N ND2 . ASN B 1 87  ? 2.490   -11.180 -41.895 1.00 56.53  ? 87   ASN B ND2 1 
ATOM   4847 N N   . PRO B 1 88  ? 2.786   -8.181  -46.394 1.00 56.99  ? 88   PRO B N   1 
ATOM   4848 C CA  . PRO B 1 88  ? 2.412   -7.819  -47.766 1.00 47.03  ? 88   PRO B CA  1 
ATOM   4849 C C   . PRO B 1 88  ? 1.047   -8.377  -48.146 1.00 60.63  ? 88   PRO B C   1 
ATOM   4850 O O   . PRO B 1 88  ? 0.713   -9.506  -47.756 1.00 61.35  ? 88   PRO B O   1 
ATOM   4851 C CB  . PRO B 1 88  ? 3.519   -8.460  -48.612 1.00 37.69  ? 88   PRO B CB  1 
ATOM   4852 C CG  . PRO B 1 88  ? 4.704   -8.570  -47.691 1.00 41.48  ? 88   PRO B CG  1 
ATOM   4853 C CD  . PRO B 1 88  ? 4.086   -8.882  -46.343 1.00 60.81  ? 88   PRO B CD  1 
ATOM   4854 N N   . ASN B 1 89  ? 0.265   -7.578  -48.873 1.00 54.15  ? 89   ASN B N   1 
ATOM   4855 C CA  . ASN B 1 89  ? -1.065  -7.985  -49.311 1.00 47.98  ? 89   ASN B CA  1 
ATOM   4856 C C   . ASN B 1 89  ? -1.189  -7.955  -50.831 1.00 54.92  ? 89   ASN B C   1 
ATOM   4857 O O   . ASN B 1 89  ? -2.282  -7.839  -51.370 1.00 62.99  ? 89   ASN B O   1 
ATOM   4858 C CB  . ASN B 1 89  ? -2.163  -7.151  -48.630 1.00 49.43  ? 89   ASN B CB  1 
ATOM   4859 C CG  . ASN B 1 89  ? -2.077  -5.672  -48.967 1.00 47.64  ? 89   ASN B CG  1 
ATOM   4860 O OD1 . ASN B 1 89  ? -1.029  -5.166  -49.352 1.00 44.73  ? 89   ASN B OD1 1 
ATOM   4861 N ND2 . ASN B 1 89  ? -3.187  -4.973  -48.813 1.00 47.83  ? 89   ASN B ND2 1 
ATOM   4862 N N   . ARG B 1 90  ? -0.048  -8.057  -51.505 1.00 53.66  ? 90   ARG B N   1 
ATOM   4863 C CA  . ARG B 1 90  ? 0.033   -8.200  -52.960 1.00 46.10  ? 90   ARG B CA  1 
ATOM   4864 C C   . ARG B 1 90  ? 1.270   -9.061  -53.237 1.00 56.63  ? 90   ARG B C   1 
ATOM   4865 O O   . ARG B 1 90  ? 2.079   -9.284  -52.336 1.00 54.44  ? 90   ARG B O   1 
ATOM   4866 C CB  . ARG B 1 90  ? 0.167   -6.831  -53.642 1.00 39.42  ? 90   ARG B CB  1 
ATOM   4867 C CG  . ARG B 1 90  ? -1.088  -5.936  -53.591 1.00 45.29  ? 90   ARG B CG  1 
ATOM   4868 C CD  . ARG B 1 90  ? -2.311  -6.655  -54.167 1.00 57.42  ? 90   ARG B CD  1 
ATOM   4869 N NE  . ARG B 1 90  ? -3.507  -5.817  -54.252 1.00 59.81  ? 90   ARG B NE  1 
ATOM   4870 C CZ  . ARG B 1 90  ? -4.338  -5.587  -53.237 1.00 59.85  ? 90   ARG B CZ  1 
ATOM   4871 N NH1 . ARG B 1 90  ? -4.105  -6.114  -52.043 1.00 56.43  ? 90   ARG B NH1 1 
ATOM   4872 N NH2 . ARG B 1 90  ? -5.395  -4.808  -53.411 1.00 56.77  ? 90   ARG B NH2 1 
ATOM   4873 N N   . GLU B 1 91  ? 1.426   -9.565  -54.457 1.00 55.54  ? 91   GLU B N   1 
ATOM   4874 C CA  . GLU B 1 91  ? 2.610   -10.369 -54.768 1.00 52.06  ? 91   GLU B CA  1 
ATOM   4875 C C   . GLU B 1 91  ? 3.904   -9.578  -54.521 1.00 58.27  ? 91   GLU B C   1 
ATOM   4876 O O   . GLU B 1 91  ? 3.927   -8.346  -54.609 1.00 58.90  ? 91   GLU B O   1 
ATOM   4877 C CB  . GLU B 1 91  ? 2.564   -10.880 -56.213 1.00 55.50  ? 91   GLU B CB  1 
ATOM   4878 C CG  . GLU B 1 91  ? 1.574   -12.025 -56.470 1.00 69.97  ? 91   GLU B CG  1 
ATOM   4879 C CD  . GLU B 1 91  ? 1.930   -13.297 -55.709 1.00 91.57  ? 91   GLU B CD  1 
ATOM   4880 O OE1 . GLU B 1 91  ? 2.843   -14.032 -56.153 1.00 97.01  ? 91   GLU B OE1 1 
ATOM   4881 O OE2 . GLU B 1 91  ? 1.300   -13.560 -54.660 1.00 96.76  ? 91   GLU B OE2 1 
ATOM   4882 N N   . LEU B 1 92  ? 4.978   -10.292 -54.205 1.00 61.21  ? 92   LEU B N   1 
ATOM   4883 C CA  . LEU B 1 92  ? 6.288   -9.676  -54.043 1.00 56.28  ? 92   LEU B CA  1 
ATOM   4884 C C   . LEU B 1 92  ? 6.996   -9.584  -55.385 1.00 54.63  ? 92   LEU B C   1 
ATOM   4885 O O   . LEU B 1 92  ? 7.017   -10.556 -56.152 1.00 60.13  ? 92   LEU B O   1 
ATOM   4886 C CB  . LEU B 1 92  ? 7.146   -10.499 -53.092 1.00 40.66  ? 92   LEU B CB  1 
ATOM   4887 C CG  . LEU B 1 92  ? 6.685   -10.624 -51.641 1.00 47.50  ? 92   LEU B CG  1 
ATOM   4888 C CD1 . LEU B 1 92  ? 7.743   -11.352 -50.847 1.00 41.04  ? 92   LEU B CD1 1 
ATOM   4889 C CD2 . LEU B 1 92  ? 6.381   -9.246  -51.024 1.00 43.19  ? 92   LEU B CD2 1 
ATOM   4890 N N   . SER B 1 93  ? 7.579   -8.422  -55.659 1.00 53.02  ? 93   SER B N   1 
ATOM   4891 C CA  . SER B 1 93  ? 8.359   -8.211  -56.877 1.00 53.84  ? 93   SER B CA  1 
ATOM   4892 C C   . SER B 1 93  ? 9.401   -7.111  -56.722 1.00 57.40  ? 93   SER B C   1 
ATOM   4893 O O   . SER B 1 93  ? 9.152   -6.095  -56.068 1.00 50.80  ? 93   SER B O   1 
ATOM   4894 C CB  . SER B 1 93  ? 7.445   -7.848  -58.039 1.00 41.05  ? 93   SER B CB  1 
ATOM   4895 O OG  . SER B 1 93  ? 8.190   -7.376  -59.149 1.00 40.63  ? 93   SER B OG  1 
ATOM   4896 N N   . GLU B 1 94  ? 10.565  -7.305  -57.332 1.00 43.71  ? 94   GLU B N   1 
ATOM   4897 C CA  . GLU B 1 94  ? 11.549  -6.239  -57.359 1.00 45.37  ? 94   GLU B CA  1 
ATOM   4898 C C   . GLU B 1 94  ? 11.010  -5.099  -58.195 1.00 43.92  ? 94   GLU B C   1 
ATOM   4899 O O   . GLU B 1 94  ? 11.448  -3.959  -58.069 1.00 45.82  ? 94   GLU B O   1 
ATOM   4900 C CB  . GLU B 1 94  ? 12.876  -6.719  -57.918 1.00 40.79  ? 94   GLU B CB  1 
ATOM   4901 C CG  . GLU B 1 94  ? 13.756  -7.370  -56.886 1.00 41.37  ? 94   GLU B CG  1 
ATOM   4902 C CD  . GLU B 1 94  ? 15.188  -7.427  -57.335 1.00 65.87  ? 94   GLU B CD  1 
ATOM   4903 O OE1 . GLU B 1 94  ? 15.880  -6.376  -57.258 1.00 71.64  ? 94   GLU B OE1 1 
ATOM   4904 O OE2 . GLU B 1 94  ? 15.606  -8.516  -57.786 1.00 51.85  ? 94   GLU B OE2 1 
ATOM   4905 N N   . ASP B 1 95  ? 10.064  -5.433  -59.060 1.00 38.89  ? 95   ASP B N   1 
ATOM   4906 C CA  . ASP B 1 95  ? 9.386   -4.454  -59.886 1.00 38.39  ? 95   ASP B CA  1 
ATOM   4907 C C   . ASP B 1 95  ? 8.293   -3.889  -59.022 1.00 41.05  ? 95   ASP B C   1 
ATOM   4908 O O   . ASP B 1 95  ? 7.168   -4.362  -59.087 1.00 39.24  ? 95   ASP B O   1 
ATOM   4909 C CB  . ASP B 1 95  ? 8.786   -5.154  -61.100 1.00 40.03  ? 95   ASP B CB  1 
ATOM   4910 C CG  . ASP B 1 95  ? 8.084   -4.205  -62.059 1.00 51.69  ? 95   ASP B CG  1 
ATOM   4911 O OD1 . ASP B 1 95  ? 7.755   -3.074  -61.670 1.00 43.46  ? 95   ASP B OD1 1 
ATOM   4912 O OD2 . ASP B 1 95  ? 7.838   -4.608  -63.215 1.00 44.51  ? 95   ASP B OD2 1 
ATOM   4913 N N   . CYS B 1 96  ? 8.618   -2.889  -58.202 1.00 47.95  ? 96   CYS B N   1 
ATOM   4914 C CA  . CYS B 1 96  ? 7.660   -2.377  -57.217 1.00 45.02  ? 96   CYS B CA  1 
ATOM   4915 C C   . CYS B 1 96  ? 7.569   -0.857  -57.147 1.00 41.04  ? 96   CYS B C   1 
ATOM   4916 O O   . CYS B 1 96  ? 6.928   -0.327  -56.251 1.00 44.91  ? 96   CYS B O   1 
ATOM   4917 C CB  . CYS B 1 96  ? 8.036   -2.875  -55.830 1.00 33.57  ? 96   CYS B CB  1 
ATOM   4918 S SG  . CYS B 1 96  ? 9.719   -2.354  -55.351 1.00 42.81  ? 96   CYS B SG  1 
ATOM   4919 N N   . LEU B 1 97  ? 8.217   -0.152  -58.061 1.00 37.12  ? 97   LEU B N   1 
ATOM   4920 C CA  . LEU B 1 97  ? 8.281   1.303   -57.953 1.00 33.18  ? 97   LEU B CA  1 
ATOM   4921 C C   . LEU B 1 97  ? 7.006   2.015   -58.474 1.00 38.93  ? 97   LEU B C   1 
ATOM   4922 O O   . LEU B 1 97  ? 6.917   2.476   -59.623 1.00 38.16  ? 97   LEU B O   1 
ATOM   4923 C CB  . LEU B 1 97  ? 9.564   1.829   -58.601 1.00 32.77  ? 97   LEU B CB  1 
ATOM   4924 C CG  . LEU B 1 97  ? 10.799  1.335   -57.843 1.00 36.05  ? 97   LEU B CG  1 
ATOM   4925 C CD1 . LEU B 1 97  ? 12.063  2.101   -58.233 1.00 33.35  ? 97   LEU B CD1 1 
ATOM   4926 C CD2 . LEU B 1 97  ? 10.559  1.380   -56.316 1.00 31.59  ? 97   LEU B CD2 1 
ATOM   4927 N N   . TYR B 1 98  ? 6.003   2.082   -57.612 1.00 31.50  ? 98   TYR B N   1 
ATOM   4928 C CA  . TYR B 1 98  ? 4.700   2.556   -58.032 1.00 38.14  ? 98   TYR B CA  1 
ATOM   4929 C C   . TYR B 1 98  ? 4.151   3.380   -56.904 1.00 44.12  ? 98   TYR B C   1 
ATOM   4930 O O   . TYR B 1 98  ? 4.540   3.201   -55.741 1.00 48.28  ? 98   TYR B O   1 
ATOM   4931 C CB  . TYR B 1 98  ? 3.756   1.383   -58.338 1.00 42.49  ? 98   TYR B CB  1 
ATOM   4932 C CG  . TYR B 1 98  ? 4.241   0.503   -59.457 1.00 37.44  ? 98   TYR B CG  1 
ATOM   4933 C CD1 . TYR B 1 98  ? 5.188   -0.502  -59.214 1.00 45.02  ? 98   TYR B CD1 1 
ATOM   4934 C CD2 . TYR B 1 98  ? 3.787   0.681   -60.766 1.00 36.18  ? 98   TYR B CD2 1 
ATOM   4935 C CE1 . TYR B 1 98  ? 5.665   -1.313  -60.236 1.00 47.65  ? 98   TYR B CE1 1 
ATOM   4936 C CE2 . TYR B 1 98  ? 4.262   -0.129  -61.802 1.00 36.52  ? 98   TYR B CE2 1 
ATOM   4937 C CZ  . TYR B 1 98  ? 5.201   -1.126  -61.530 1.00 48.56  ? 98   TYR B CZ  1 
ATOM   4938 O OH  . TYR B 1 98  ? 5.688   -1.934  -62.536 1.00 49.73  ? 98   TYR B OH  1 
ATOM   4939 N N   . LEU B 1 99  ? 3.256   4.295   -57.236 1.00 38.67  ? 99   LEU B N   1 
ATOM   4940 C CA  . LEU B 1 99  ? 2.652   5.105   -56.196 1.00 50.24  ? 99   LEU B CA  1 
ATOM   4941 C C   . LEU B 1 99  ? 1.151   5.168   -56.353 1.00 56.26  ? 99   LEU B C   1 
ATOM   4942 O O   . LEU B 1 99  ? 0.588   4.645   -57.325 1.00 60.93  ? 99   LEU B O   1 
ATOM   4943 C CB  . LEU B 1 99  ? 3.280   6.501   -56.126 1.00 44.60  ? 99   LEU B CB  1 
ATOM   4944 C CG  . LEU B 1 99  ? 3.234   7.378   -57.365 1.00 45.22  ? 99   LEU B CG  1 
ATOM   4945 C CD1 . LEU B 1 99  ? 1.946   8.180   -57.394 1.00 44.27  ? 99   LEU B CD1 1 
ATOM   4946 C CD2 . LEU B 1 99  ? 4.442   8.275   -57.360 1.00 45.87  ? 99   LEU B CD2 1 
ATOM   4947 N N   . ASN B 1 100 ? 0.520   5.797   -55.367 1.00 44.95  ? 100  ASN B N   1 
ATOM   4948 C CA  . ASN B 1 100 ? -0.920  5.825   -55.247 1.00 39.27  ? 100  ASN B CA  1 
ATOM   4949 C C   . ASN B 1 100 ? -1.368  7.236   -54.878 1.00 44.16  ? 100  ASN B C   1 
ATOM   4950 O O   . ASN B 1 100 ? -0.757  7.889   -54.032 1.00 47.88  ? 100  ASN B O   1 
ATOM   4951 C CB  . ASN B 1 100 ? -1.354  4.824   -54.174 1.00 40.30  ? 100  ASN B CB  1 
ATOM   4952 C CG  . ASN B 1 100 ? -0.782  3.429   -54.408 1.00 41.76  ? 100  ASN B CG  1 
ATOM   4953 O OD1 . ASN B 1 100 ? -0.833  2.905   -55.518 1.00 44.52  ? 100  ASN B OD1 1 
ATOM   4954 N ND2 . ASN B 1 100 ? -0.228  2.830   -53.364 1.00 35.65  ? 100  ASN B ND2 1 
ATOM   4955 N N   . VAL B 1 101 ? -2.432  7.702   -55.518 1.00 45.76  ? 101  VAL B N   1 
ATOM   4956 C CA  . VAL B 1 101 ? -3.000  9.015   -55.244 1.00 48.50  ? 101  VAL B CA  1 
ATOM   4957 C C   . VAL B 1 101 ? -4.492  8.858   -54.982 1.00 60.38  ? 101  VAL B C   1 
ATOM   4958 O O   . VAL B 1 101 ? -5.214  8.309   -55.814 1.00 65.45  ? 101  VAL B O   1 
ATOM   4959 C CB  . VAL B 1 101 ? -2.794  9.988   -56.450 1.00 49.11  ? 101  VAL B CB  1 
ATOM   4960 C CG1 . VAL B 1 101 ? -3.634  11.230  -56.298 1.00 49.00  ? 101  VAL B CG1 1 
ATOM   4961 C CG2 . VAL B 1 101 ? -1.326  10.373  -56.612 1.00 50.44  ? 101  VAL B CG2 1 
ATOM   4962 N N   . TRP B 1 102 ? -4.948  9.311   -53.818 1.00 56.94  ? 102  TRP B N   1 
ATOM   4963 C CA  . TRP B 1 102 ? -6.380  9.460   -53.577 1.00 55.55  ? 102  TRP B CA  1 
ATOM   4964 C C   . TRP B 1 102 ? -6.746  10.936  -53.596 1.00 52.95  ? 102  TRP B C   1 
ATOM   4965 O O   . TRP B 1 102 ? -5.962  11.782  -53.163 1.00 36.59  ? 102  TRP B O   1 
ATOM   4966 C CB  . TRP B 1 102 ? -6.778  8.908   -52.218 1.00 51.11  ? 102  TRP B CB  1 
ATOM   4967 C CG  . TRP B 1 102 ? -6.717  7.442   -52.062 1.00 47.92  ? 102  TRP B CG  1 
ATOM   4968 C CD1 . TRP B 1 102 ? -7.753  6.555   -52.208 1.00 49.02  ? 102  TRP B CD1 1 
ATOM   4969 C CD2 . TRP B 1 102 ? -5.579  6.675   -51.681 1.00 34.92  ? 102  TRP B CD2 1 
ATOM   4970 N NE1 . TRP B 1 102 ? -7.316  5.275   -51.949 1.00 48.47  ? 102  TRP B NE1 1 
ATOM   4971 C CE2 . TRP B 1 102 ? -5.986  5.322   -51.618 1.00 50.29  ? 102  TRP B CE2 1 
ATOM   4972 C CE3 . TRP B 1 102 ? -4.256  6.995   -51.395 1.00 38.65  ? 102  TRP B CE3 1 
ATOM   4973 C CZ2 . TRP B 1 102 ? -5.107  4.287   -51.285 1.00 47.21  ? 102  TRP B CZ2 1 
ATOM   4974 C CZ3 . TRP B 1 102 ? -3.372  5.968   -51.049 1.00 46.36  ? 102  TRP B CZ3 1 
ATOM   4975 C CH2 . TRP B 1 102 ? -3.805  4.626   -51.003 1.00 56.88  ? 102  TRP B CH2 1 
ATOM   4976 N N   . THR B 1 103 ? -7.944  11.235  -54.085 1.00 51.62  ? 103  THR B N   1 
ATOM   4977 C CA  . THR B 1 103 ? -8.468  12.603  -54.093 1.00 56.34  ? 103  THR B CA  1 
ATOM   4978 C C   . THR B 1 103 ? -9.990  12.588  -53.974 1.00 61.58  ? 103  THR B C   1 
ATOM   4979 O O   . THR B 1 103 ? -10.630 11.572  -54.214 1.00 64.39  ? 103  THR B O   1 
ATOM   4980 C CB  . THR B 1 103 ? -8.106  13.354  -55.384 1.00 50.39  ? 103  THR B CB  1 
ATOM   4981 O OG1 . THR B 1 103 ? -9.135  13.148  -56.360 1.00 48.12  ? 103  THR B OG1 1 
ATOM   4982 C CG2 . THR B 1 103 ? -6.795  12.839  -55.932 1.00 52.85  ? 103  THR B CG2 1 
ATOM   4983 N N   . PRO B 1 104 ? -10.580 13.721  -53.596 1.00 57.10  ? 104  PRO B N   1 
ATOM   4984 C CA  . PRO B 1 104 ? -12.038 13.730  -53.536 1.00 53.55  ? 104  PRO B CA  1 
ATOM   4985 C C   . PRO B 1 104 ? -12.666 13.586  -54.916 1.00 56.12  ? 104  PRO B C   1 
ATOM   4986 O O   . PRO B 1 104 ? -12.012 13.789  -55.935 1.00 68.57  ? 104  PRO B O   1 
ATOM   4987 C CB  . PRO B 1 104 ? -12.354 15.092  -52.926 1.00 54.29  ? 104  PRO B CB  1 
ATOM   4988 C CG  . PRO B 1 104 ? -11.132 15.909  -53.128 1.00 53.62  ? 104  PRO B CG  1 
ATOM   4989 C CD  . PRO B 1 104 ? -9.990  14.974  -53.102 1.00 49.80  ? 104  PRO B CD  1 
ATOM   4990 N N   . TYR B 1 105 ? -13.937 13.208  -54.922 1.00 60.21  ? 105  TYR B N   1 
ATOM   4991 C CA  . TYR B 1 105 ? -14.715 12.979  -56.129 1.00 58.65  ? 105  TYR B CA  1 
ATOM   4992 C C   . TYR B 1 105 ? -16.007 13.792  -55.975 1.00 74.37  ? 105  TYR B C   1 
ATOM   4993 O O   . TYR B 1 105 ? -16.813 13.529  -55.083 1.00 89.74  ? 105  TYR B O   1 
ATOM   4994 C CB  . TYR B 1 105 ? -15.018 11.483  -56.241 1.00 64.12  ? 105  TYR B CB  1 
ATOM   4995 C CG  . TYR B 1 105 ? -15.726 11.031  -57.505 1.00 79.96  ? 105  TYR B CG  1 
ATOM   4996 C CD1 . TYR B 1 105 ? -16.365 11.934  -58.336 1.00 87.03  ? 105  TYR B CD1 1 
ATOM   4997 C CD2 . TYR B 1 105 ? -15.751 9.689   -57.861 1.00 85.85  ? 105  TYR B CD2 1 
ATOM   4998 C CE1 . TYR B 1 105 ? -17.007 11.513  -59.490 1.00 92.74  ? 105  TYR B CE1 1 
ATOM   4999 C CE2 . TYR B 1 105 ? -16.388 9.260   -59.007 1.00 88.94  ? 105  TYR B CE2 1 
ATOM   5000 C CZ  . TYR B 1 105 ? -17.016 10.175  -59.820 1.00 92.55  ? 105  TYR B CZ  1 
ATOM   5001 O OH  . TYR B 1 105 ? -17.658 9.752   -60.966 1.00 86.02  ? 105  TYR B OH  1 
ATOM   5002 N N   . PRO B 1 106 ? -16.206 14.796  -56.835 1.00 71.83  ? 106  PRO B N   1 
ATOM   5003 C CA  . PRO B 1 106 ? -15.323 15.130  -57.956 1.00 76.76  ? 106  PRO B CA  1 
ATOM   5004 C C   . PRO B 1 106 ? -14.013 15.709  -57.461 1.00 75.28  ? 106  PRO B C   1 
ATOM   5005 O O   . PRO B 1 106 ? -13.984 16.298  -56.381 1.00 71.49  ? 106  PRO B O   1 
ATOM   5006 C CB  . PRO B 1 106 ? -16.116 16.195  -58.708 1.00 69.18  ? 106  PRO B CB  1 
ATOM   5007 C CG  . PRO B 1 106 ? -16.944 16.838  -57.651 1.00 68.07  ? 106  PRO B CG  1 
ATOM   5008 C CD  . PRO B 1 106 ? -17.333 15.734  -56.723 1.00 66.51  ? 106  PRO B CD  1 
ATOM   5009 N N   . ARG B 1 107 ? -12.954 15.539  -58.247 1.00 78.60  ? 107  ARG B N   1 
ATOM   5010 C CA  . ARG B 1 107 ? -11.638 16.030  -57.875 1.00 80.86  ? 107  ARG B CA  1 
ATOM   5011 C C   . ARG B 1 107 ? -11.694 17.519  -57.522 1.00 73.86  ? 107  ARG B C   1 
ATOM   5012 O O   . ARG B 1 107 ? -12.479 18.270  -58.096 1.00 66.91  ? 107  ARG B O   1 
ATOM   5013 C CB  . ARG B 1 107 ? -10.632 15.773  -58.996 1.00 88.55  ? 107  ARG B CB  1 
ATOM   5014 C CG  . ARG B 1 107 ? -10.744 16.733  -60.157 1.00 104.99 ? 107  ARG B CG  1 
ATOM   5015 C CD  . ARG B 1 107 ? -9.451  16.750  -60.959 1.00 117.13 ? 107  ARG B CD  1 
ATOM   5016 N NE  . ARG B 1 107 ? -8.849  18.081  -60.990 1.00 119.67 ? 107  ARG B NE  1 
ATOM   5017 C CZ  . ARG B 1 107 ? -8.309  18.629  -62.074 1.00 113.22 ? 107  ARG B CZ  1 
ATOM   5018 N NH1 . ARG B 1 107 ? -8.296  17.957  -63.218 1.00 113.05 ? 107  ARG B NH1 1 
ATOM   5019 N NH2 . ARG B 1 107 ? -7.785  19.846  -62.016 1.00 105.58 ? 107  ARG B NH2 1 
ATOM   5020 N N   . PRO B 1 108 ? -10.840 17.948  -56.582 1.00 67.77  ? 108  PRO B N   1 
ATOM   5021 C CA  . PRO B 1 108 ? -10.893 19.301  -56.015 1.00 72.10  ? 108  PRO B CA  1 
ATOM   5022 C C   . PRO B 1 108 ? -11.021 20.385  -57.085 1.00 78.18  ? 108  PRO B C   1 
ATOM   5023 O O   . PRO B 1 108 ? -10.424 20.278  -58.159 1.00 70.92  ? 108  PRO B O   1 
ATOM   5024 C CB  . PRO B 1 108 ? -9.546  19.432  -55.299 1.00 64.81  ? 108  PRO B CB  1 
ATOM   5025 C CG  . PRO B 1 108 ? -9.136  18.022  -54.997 1.00 66.91  ? 108  PRO B CG  1 
ATOM   5026 C CD  . PRO B 1 108 ? -9.644  17.204  -56.144 1.00 61.58  ? 108  PRO B CD  1 
ATOM   5027 N N   . ALA B 1 109 ? -11.789 21.427  -56.784 1.00 81.48  ? 109  ALA B N   1 
ATOM   5028 C CA  . ALA B 1 109 ? -11.960 22.534  -57.720 1.00 80.57  ? 109  ALA B CA  1 
ATOM   5029 C C   . ALA B 1 109 ? -10.778 23.510  -57.660 1.00 82.72  ? 109  ALA B C   1 
ATOM   5030 O O   . ALA B 1 109 ? -10.320 24.020  -58.682 1.00 83.01  ? 109  ALA B O   1 
ATOM   5031 C CB  . ALA B 1 109 ? -13.266 23.254  -57.451 1.00 73.74  ? 109  ALA B CB  1 
ATOM   5032 N N   . SER B 1 110 ? -10.290 23.764  -56.452 1.00 74.04  ? 110  SER B N   1 
ATOM   5033 C CA  . SER B 1 110 ? -9.130  24.614  -56.255 1.00 70.93  ? 110  SER B CA  1 
ATOM   5034 C C   . SER B 1 110 ? -8.020  23.786  -55.627 1.00 75.32  ? 110  SER B C   1 
ATOM   5035 O O   . SER B 1 110 ? -8.292  22.835  -54.894 1.00 82.16  ? 110  SER B O   1 
ATOM   5036 C CB  . SER B 1 110 ? -9.498  25.756  -55.328 1.00 78.05  ? 110  SER B CB  1 
ATOM   5037 O OG  . SER B 1 110 ? -10.120 25.232  -54.170 1.00 83.10  ? 110  SER B OG  1 
ATOM   5038 N N   . PRO B 1 111 ? -6.761  24.155  -55.899 1.00 69.54  ? 111  PRO B N   1 
ATOM   5039 C CA  . PRO B 1 111 ? -5.560  23.432  -55.468 1.00 60.72  ? 111  PRO B CA  1 
ATOM   5040 C C   . PRO B 1 111 ? -5.573  22.987  -53.996 1.00 67.04  ? 111  PRO B C   1 
ATOM   5041 O O   . PRO B 1 111 ? -5.545  23.810  -53.079 1.00 58.43  ? 111  PRO B O   1 
ATOM   5042 C CB  . PRO B 1 111 ? -4.448  24.453  -55.712 1.00 56.73  ? 111  PRO B CB  1 
ATOM   5043 C CG  . PRO B 1 111 ? -4.928  25.242  -56.854 1.00 52.34  ? 111  PRO B CG  1 
ATOM   5044 C CD  . PRO B 1 111 ? -6.416  25.386  -56.627 1.00 69.08  ? 111  PRO B CD  1 
ATOM   5045 N N   . THR B 1 112 ? -5.590  21.673  -53.788 1.00 62.14  ? 112  THR B N   1 
ATOM   5046 C CA  . THR B 1 112 ? -5.670  21.096  -52.454 1.00 50.50  ? 112  THR B CA  1 
ATOM   5047 C C   . THR B 1 112 ? -4.277  20.832  -51.894 1.00 51.10  ? 112  THR B C   1 
ATOM   5048 O O   . THR B 1 112 ? -3.382  20.416  -52.623 1.00 61.37  ? 112  THR B O   1 
ATOM   5049 C CB  . THR B 1 112 ? -6.442  19.759  -52.490 1.00 59.25  ? 112  THR B CB  1 
ATOM   5050 O OG1 . THR B 1 112 ? -7.657  19.919  -53.234 1.00 69.42  ? 112  THR B OG1 1 
ATOM   5051 C CG2 . THR B 1 112 ? -6.760  19.261  -51.081 1.00 52.25  ? 112  THR B CG2 1 
ATOM   5052 N N   . PRO B 1 113 ? -4.073  21.109  -50.599 1.00 50.68  ? 113  PRO B N   1 
ATOM   5053 C CA  . PRO B 1 113 ? -2.844  20.662  -49.939 1.00 56.68  ? 113  PRO B CA  1 
ATOM   5054 C C   . PRO B 1 113 ? -2.628  19.142  -50.071 1.00 56.81  ? 113  PRO B C   1 
ATOM   5055 O O   . PRO B 1 113 ? -3.592  18.378  -50.021 1.00 48.28  ? 113  PRO B O   1 
ATOM   5056 C CB  . PRO B 1 113 ? -3.075  21.077  -48.484 1.00 41.66  ? 113  PRO B CB  1 
ATOM   5057 C CG  . PRO B 1 113 ? -3.883  22.327  -48.616 1.00 48.75  ? 113  PRO B CG  1 
ATOM   5058 C CD  . PRO B 1 113 ? -4.781  22.131  -49.808 1.00 48.59  ? 113  PRO B CD  1 
ATOM   5059 N N   . VAL B 1 114 ? -1.372  18.730  -50.241 1.00 43.62  ? 114  VAL B N   1 
ATOM   5060 C CA  . VAL B 1 114 ? -1.020  17.329  -50.452 1.00 44.90  ? 114  VAL B CA  1 
ATOM   5061 C C   . VAL B 1 114 ? -0.416  16.668  -49.220 1.00 40.06  ? 114  VAL B C   1 
ATOM   5062 O O   . VAL B 1 114 ? 0.535   17.173  -48.637 1.00 33.79  ? 114  VAL B O   1 
ATOM   5063 C CB  . VAL B 1 114 ? 0.016   17.177  -51.593 1.00 43.82  ? 114  VAL B CB  1 
ATOM   5064 C CG1 . VAL B 1 114 ? 0.304   15.702  -51.844 1.00 39.32  ? 114  VAL B CG1 1 
ATOM   5065 C CG2 . VAL B 1 114 ? -0.471  17.867  -52.858 1.00 35.17  ? 114  VAL B CG2 1 
ATOM   5066 N N   . LEU B 1 115 ? -0.951  15.519  -48.830 1.00 51.65  ? 115  LEU B N   1 
ATOM   5067 C CA  . LEU B 1 115 ? -0.266  14.687  -47.839 1.00 54.89  ? 115  LEU B CA  1 
ATOM   5068 C C   . LEU B 1 115 ? 0.521   13.617  -48.575 1.00 47.68  ? 115  LEU B C   1 
ATOM   5069 O O   . LEU B 1 115 ? -0.012  12.954  -49.461 1.00 50.04  ? 115  LEU B O   1 
ATOM   5070 C CB  . LEU B 1 115 ? -1.253  14.007  -46.893 1.00 54.03  ? 115  LEU B CB  1 
ATOM   5071 C CG  . LEU B 1 115 ? -1.735  14.648  -45.589 1.00 52.95  ? 115  LEU B CG  1 
ATOM   5072 C CD1 . LEU B 1 115 ? -0.649  14.596  -44.541 1.00 59.05  ? 115  LEU B CD1 1 
ATOM   5073 C CD2 . LEU B 1 115 ? -2.204  16.080  -45.833 1.00 53.85  ? 115  LEU B CD2 1 
ATOM   5074 N N   . ILE B 1 116 ? 1.790   13.457  -48.224 1.00 42.34  ? 116  ILE B N   1 
ATOM   5075 C CA  . ILE B 1 116 ? 2.553   12.335  -48.742 1.00 40.73  ? 116  ILE B CA  1 
ATOM   5076 C C   . ILE B 1 116 ? 3.009   11.468  -47.613 1.00 42.35  ? 116  ILE B C   1 
ATOM   5077 O O   . ILE B 1 116 ? 3.785   11.923  -46.759 1.00 38.74  ? 116  ILE B O   1 
ATOM   5078 C CB  . ILE B 1 116 ? 3.786   12.752  -49.513 1.00 44.26  ? 116  ILE B CB  1 
ATOM   5079 C CG1 . ILE B 1 116 ? 3.411   13.715  -50.636 1.00 41.84  ? 116  ILE B CG1 1 
ATOM   5080 C CG2 . ILE B 1 116 ? 4.449   11.522  -50.087 1.00 50.85  ? 116  ILE B CG2 1 
ATOM   5081 C CD1 . ILE B 1 116 ? 4.584   14.135  -51.480 1.00 38.44  ? 116  ILE B CD1 1 
ATOM   5082 N N   . TRP B 1 117 ? 2.506   10.228  -47.618 1.00 41.51  ? 117  TRP B N   1 
ATOM   5083 C CA  . TRP B 1 117 ? 2.807   9.202   -46.623 1.00 26.04  ? 117  TRP B CA  1 
ATOM   5084 C C   . TRP B 1 117 ? 4.020   8.374   -47.018 1.00 38.57  ? 117  TRP B C   1 
ATOM   5085 O O   . TRP B 1 117 ? 4.159   7.982   -48.174 1.00 38.08  ? 117  TRP B O   1 
ATOM   5086 C CB  . TRP B 1 117 ? 1.614   8.276   -46.511 1.00 41.37  ? 117  TRP B CB  1 
ATOM   5087 C CG  . TRP B 1 117 ? 1.805   7.062   -45.671 1.00 46.86  ? 117  TRP B CG  1 
ATOM   5088 C CD1 . TRP B 1 117 ? 1.836   5.767   -46.094 1.00 52.87  ? 117  TRP B CD1 1 
ATOM   5089 C CD2 . TRP B 1 117 ? 1.948   7.024   -44.253 1.00 46.40  ? 117  TRP B CD2 1 
ATOM   5090 N NE1 . TRP B 1 117 ? 1.985   4.918   -45.022 1.00 48.04  ? 117  TRP B NE1 1 
ATOM   5091 C CE2 . TRP B 1 117 ? 2.060   5.665   -43.882 1.00 48.56  ? 117  TRP B CE2 1 
ATOM   5092 C CE3 . TRP B 1 117 ? 1.991   8.005   -43.260 1.00 34.89  ? 117  TRP B CE3 1 
ATOM   5093 C CZ2 . TRP B 1 117 ? 2.218   5.267   -42.565 1.00 48.34  ? 117  TRP B CZ2 1 
ATOM   5094 C CZ3 . TRP B 1 117 ? 2.145   7.613   -41.961 1.00 42.83  ? 117  TRP B CZ3 1 
ATOM   5095 C CH2 . TRP B 1 117 ? 2.269   6.253   -41.618 1.00 43.26  ? 117  TRP B CH2 1 
ATOM   5096 N N   . ILE B 1 118 ? 4.895   8.109   -46.053 1.00 36.90  ? 118  ILE B N   1 
ATOM   5097 C CA  . ILE B 1 118 ? 6.001   7.177   -46.235 1.00 36.77  ? 118  ILE B CA  1 
ATOM   5098 C C   . ILE B 1 118 ? 5.928   6.064   -45.184 1.00 48.41  ? 118  ILE B C   1 
ATOM   5099 O O   . ILE B 1 118 ? 5.999   6.336   -43.988 1.00 45.09  ? 118  ILE B O   1 
ATOM   5100 C CB  . ILE B 1 118 ? 7.360   7.882   -46.124 1.00 34.52  ? 118  ILE B CB  1 
ATOM   5101 C CG1 . ILE B 1 118 ? 7.387   9.146   -46.993 1.00 40.51  ? 118  ILE B CG1 1 
ATOM   5102 C CG2 . ILE B 1 118 ? 8.456   6.950   -46.574 1.00 41.74  ? 118  ILE B CG2 1 
ATOM   5103 C CD1 . ILE B 1 118 ? 8.733   9.855   -47.035 1.00 25.86  ? 118  ILE B CD1 1 
ATOM   5104 N N   . TYR B 1 119 ? 5.785   4.810   -45.609 1.00 43.88  ? 119  TYR B N   1 
ATOM   5105 C CA  . TYR B 1 119 ? 5.595   3.742   -44.615 1.00 50.55  ? 119  TYR B CA  1 
ATOM   5106 C C   . TYR B 1 119 ? 6.837   3.414   -43.801 1.00 51.13  ? 119  TYR B C   1 
ATOM   5107 O O   . TYR B 1 119 ? 7.934   3.878   -44.101 1.00 62.22  ? 119  TYR B O   1 
ATOM   5108 C CB  . TYR B 1 119 ? 5.007   2.453   -45.222 1.00 38.05  ? 119  TYR B CB  1 
ATOM   5109 C CG  . TYR B 1 119 ? 5.767   1.890   -46.396 1.00 33.36  ? 119  TYR B CG  1 
ATOM   5110 C CD1 . TYR B 1 119 ? 6.985   1.248   -46.219 1.00 42.73  ? 119  TYR B CD1 1 
ATOM   5111 C CD2 . TYR B 1 119 ? 5.255   1.985   -47.683 1.00 30.25  ? 119  TYR B CD2 1 
ATOM   5112 C CE1 . TYR B 1 119 ? 7.683   0.732   -47.297 1.00 39.70  ? 119  TYR B CE1 1 
ATOM   5113 C CE2 . TYR B 1 119 ? 5.938   1.485   -48.760 1.00 37.39  ? 119  TYR B CE2 1 
ATOM   5114 C CZ  . TYR B 1 119 ? 7.152   0.854   -48.569 1.00 44.30  ? 119  TYR B CZ  1 
ATOM   5115 O OH  . TYR B 1 119 ? 7.832   0.335   -49.660 1.00 41.85  ? 119  TYR B OH  1 
ATOM   5116 N N   . GLY B 1 120 ? 6.635   2.605   -42.767 1.00 41.53  ? 120  GLY B N   1 
ATOM   5117 C CA  . GLY B 1 120 ? 7.714   2.049   -41.973 1.00 36.01  ? 120  GLY B CA  1 
ATOM   5118 C C   . GLY B 1 120 ? 7.808   0.541   -42.148 1.00 51.12  ? 120  GLY B C   1 
ATOM   5119 O O   . GLY B 1 120 ? 7.266   -0.021  -43.105 1.00 52.18  ? 120  GLY B O   1 
ATOM   5120 N N   . GLY B 1 121 ? 8.494   -0.124  -41.224 1.00 53.54  ? 121  GLY B N   1 
ATOM   5121 C CA  . GLY B 1 121 ? 8.868   -1.511  -41.429 1.00 49.06  ? 121  GLY B CA  1 
ATOM   5122 C C   . GLY B 1 121 ? 10.374  -1.689  -41.294 1.00 53.59  ? 121  GLY B C   1 
ATOM   5123 O O   . GLY B 1 121 ? 10.954  -2.612  -41.885 1.00 48.38  ? 121  GLY B O   1 
ATOM   5124 N N   . GLY B 1 122 ? 11.002  -0.796  -40.519 1.00 38.24  ? 122  GLY B N   1 
ATOM   5125 C CA  . GLY B 1 122 ? 12.428  -0.860  -40.232 1.00 31.23  ? 122  GLY B CA  1 
ATOM   5126 C C   . GLY B 1 122 ? 13.352  -0.915  -41.435 1.00 45.54  ? 122  GLY B C   1 
ATOM   5127 O O   . GLY B 1 122 ? 14.446  -1.493  -41.374 1.00 61.21  ? 122  GLY B O   1 
ATOM   5128 N N   . PHE B 1 123 ? 12.907  -0.321  -42.538 1.00 43.93  ? 123  PHE B N   1 
ATOM   5129 C CA  . PHE B 1 123 ? 13.679  -0.298  -43.781 1.00 41.25  ? 123  PHE B CA  1 
ATOM   5130 C C   . PHE B 1 123 ? 13.858  -1.654  -44.389 1.00 49.58  ? 123  PHE B C   1 
ATOM   5131 O O   . PHE B 1 123 ? 14.690  -1.816  -45.272 1.00 53.41  ? 123  PHE B O   1 
ATOM   5132 C CB  . PHE B 1 123 ? 15.059  0.322   -43.562 1.00 44.59  ? 123  PHE B CB  1 
ATOM   5133 C CG  . PHE B 1 123 ? 15.008  1.778   -43.269 1.00 47.01  ? 123  PHE B CG  1 
ATOM   5134 C CD1 . PHE B 1 123 ? 14.645  2.683   -44.258 1.00 41.85  ? 123  PHE B CD1 1 
ATOM   5135 C CD2 . PHE B 1 123 ? 15.298  2.253   -42.008 1.00 40.83  ? 123  PHE B CD2 1 
ATOM   5136 C CE1 . PHE B 1 123 ? 14.572  4.036   -43.987 1.00 28.28  ? 123  PHE B CE1 1 
ATOM   5137 C CE2 . PHE B 1 123 ? 15.242  3.606   -41.737 1.00 26.74  ? 123  PHE B CE2 1 
ATOM   5138 C CZ  . PHE B 1 123 ? 14.878  4.494   -42.725 1.00 34.24  ? 123  PHE B CZ  1 
ATOM   5139 N N   . TYR B 1 124 ? 13.084  -2.632  -43.928 1.00 57.07  ? 124  TYR B N   1 
ATOM   5140 C CA  . TYR B 1 124 ? 13.234  -3.992  -44.428 1.00 40.55  ? 124  TYR B CA  1 
ATOM   5141 C C   . TYR B 1 124 ? 11.901  -4.566  -44.896 1.00 47.21  ? 124  TYR B C   1 
ATOM   5142 O O   . TYR B 1 124 ? 11.845  -5.603  -45.560 1.00 58.58  ? 124  TYR B O   1 
ATOM   5143 C CB  . TYR B 1 124 ? 13.835  -4.872  -43.343 1.00 34.65  ? 124  TYR B CB  1 
ATOM   5144 C CG  . TYR B 1 124 ? 12.827  -5.281  -42.308 1.00 42.64  ? 124  TYR B CG  1 
ATOM   5145 C CD1 . TYR B 1 124 ? 11.929  -6.316  -42.559 1.00 51.91  ? 124  TYR B CD1 1 
ATOM   5146 C CD2 . TYR B 1 124 ? 12.751  -4.629  -41.092 1.00 42.80  ? 124  TYR B CD2 1 
ATOM   5147 C CE1 . TYR B 1 124 ? 10.992  -6.685  -41.629 1.00 32.77  ? 124  TYR B CE1 1 
ATOM   5148 C CE2 . TYR B 1 124 ? 11.817  -5.002  -40.142 1.00 48.51  ? 124  TYR B CE2 1 
ATOM   5149 C CZ  . TYR B 1 124 ? 10.942  -6.036  -40.416 1.00 48.74  ? 124  TYR B CZ  1 
ATOM   5150 O OH  . TYR B 1 124 ? 10.006  -6.400  -39.478 1.00 53.18  ? 124  TYR B OH  1 
ATOM   5151 N N   . SER B 1 125 ? 10.822  -3.888  -44.540 1.00 46.22  ? 125  SER B N   1 
ATOM   5152 C CA  . SER B 1 125 ? 9.499   -4.292  -44.977 1.00 47.06  ? 125  SER B CA  1 
ATOM   5153 C C   . SER B 1 125 ? 8.610   -3.056  -45.215 1.00 53.12  ? 125  SER B C   1 
ATOM   5154 O O   . SER B 1 125 ? 9.071   -1.922  -45.084 1.00 39.67  ? 125  SER B O   1 
ATOM   5155 C CB  . SER B 1 125 ? 8.881   -5.239  -43.959 1.00 39.63  ? 125  SER B CB  1 
ATOM   5156 O OG  . SER B 1 125 ? 9.001   -4.710  -42.644 1.00 48.61  ? 125  SER B OG  1 
ATOM   5157 N N   . GLY B 1 126 ? 7.354   -3.287  -45.601 1.00 52.89  ? 126  GLY B N   1 
ATOM   5158 C CA  . GLY B 1 126 ? 6.393   -2.218  -45.781 1.00 42.57  ? 126  GLY B CA  1 
ATOM   5159 C C   . GLY B 1 126 ? 5.848   -2.105  -47.190 1.00 55.33  ? 126  GLY B C   1 
ATOM   5160 O O   . GLY B 1 126 ? 6.474   -2.588  -48.146 1.00 54.89  ? 126  GLY B O   1 
ATOM   5161 N N   . ALA B 1 127 ? 4.689   -1.450  -47.312 1.00 40.03  ? 127  ALA B N   1 
ATOM   5162 C CA  . ALA B 1 127 ? 3.971   -1.334  -48.579 1.00 34.41  ? 127  ALA B CA  1 
ATOM   5163 C C   . ALA B 1 127 ? 2.870   -0.307  -48.433 1.00 40.72  ? 127  ALA B C   1 
ATOM   5164 O O   . ALA B 1 127 ? 2.291   -0.192  -47.363 1.00 51.20  ? 127  ALA B O   1 
ATOM   5165 C CB  . ALA B 1 127 ? 3.367   -2.681  -48.969 1.00 39.76  ? 127  ALA B CB  1 
ATOM   5166 N N   . ALA B 1 128 ? 2.567   0.415   -49.509 1.00 42.79  ? 128  ALA B N   1 
ATOM   5167 C CA  . ALA B 1 128 ? 1.531   1.455   -49.491 1.00 41.42  ? 128  ALA B CA  1 
ATOM   5168 C C   . ALA B 1 128 ? 0.144   0.884   -49.707 1.00 39.59  ? 128  ALA B C   1 
ATOM   5169 O O   . ALA B 1 128 ? -0.838  1.613   -49.734 1.00 54.24  ? 128  ALA B O   1 
ATOM   5170 C CB  . ALA B 1 128 ? 1.821   2.539   -50.530 1.00 36.29  ? 128  ALA B CB  1 
ATOM   5171 N N   . SER B 1 129 ? 0.065   -0.429  -49.848 1.00 46.57  ? 129  SER B N   1 
ATOM   5172 C CA  . SER B 1 129 ? -1.203  -1.088  -50.142 1.00 44.55  ? 129  SER B CA  1 
ATOM   5173 C C   . SER B 1 129 ? -1.916  -1.625  -48.892 1.00 37.49  ? 129  SER B C   1 
ATOM   5174 O O   . SER B 1 129 ? -3.081  -2.016  -48.940 1.00 44.87  ? 129  SER B O   1 
ATOM   5175 C CB  . SER B 1 129 ? -0.959  -2.200  -51.151 1.00 41.30  ? 129  SER B CB  1 
ATOM   5176 O OG  . SER B 1 129 ? 0.169   -2.945  -50.761 1.00 46.45  ? 129  SER B OG  1 
ATOM   5177 N N   . LEU B 1 130 ? -1.202  -1.637  -47.780 1.00 33.87  ? 130  LEU B N   1 
ATOM   5178 C CA  . LEU B 1 130 ? -1.755  -2.032  -46.507 1.00 37.22  ? 130  LEU B CA  1 
ATOM   5179 C C   . LEU B 1 130 ? -3.074  -1.321  -46.256 1.00 47.10  ? 130  LEU B C   1 
ATOM   5180 O O   . LEU B 1 130 ? -3.186  -0.102  -46.463 1.00 54.70  ? 130  LEU B O   1 
ATOM   5181 C CB  . LEU B 1 130 ? -0.758  -1.693  -45.389 1.00 32.65  ? 130  LEU B CB  1 
ATOM   5182 C CG  . LEU B 1 130 ? 0.628   -2.359  -45.482 1.00 59.02  ? 130  LEU B CG  1 
ATOM   5183 C CD1 . LEU B 1 130 ? 1.447   -2.230  -44.169 1.00 35.54  ? 130  LEU B CD1 1 
ATOM   5184 C CD2 . LEU B 1 130 ? 0.520   -3.811  -45.906 1.00 34.03  ? 130  LEU B CD2 1 
ATOM   5185 N N   . ASP B 1 131 ? -4.067  -2.074  -45.788 1.00 43.92  ? 131  ASP B N   1 
ATOM   5186 C CA  . ASP B 1 131 ? -5.357  -1.490  -45.419 1.00 38.18  ? 131  ASP B CA  1 
ATOM   5187 C C   . ASP B 1 131 ? -5.213  -0.317  -44.438 1.00 50.88  ? 131  ASP B C   1 
ATOM   5188 O O   . ASP B 1 131 ? -5.956  0.651   -44.505 1.00 63.59  ? 131  ASP B O   1 
ATOM   5189 C CB  . ASP B 1 131 ? -6.266  -2.558  -44.830 1.00 47.87  ? 131  ASP B CB  1 
ATOM   5190 C CG  . ASP B 1 131 ? -6.612  -3.660  -45.834 1.00 62.25  ? 131  ASP B CG  1 
ATOM   5191 O OD1 . ASP B 1 131 ? -6.253  -3.539  -47.030 1.00 59.73  ? 131  ASP B OD1 1 
ATOM   5192 O OD2 . ASP B 1 131 ? -7.260  -4.644  -45.420 1.00 64.43  ? 131  ASP B OD2 1 
ATOM   5193 N N   . VAL B 1 132 ? -4.243  -0.403  -43.539 1.00 43.14  ? 132  VAL B N   1 
ATOM   5194 C CA  . VAL B 1 132 ? -4.017  0.632   -42.540 1.00 59.22  ? 132  VAL B CA  1 
ATOM   5195 C C   . VAL B 1 132 ? -3.624  1.962   -43.157 1.00 61.98  ? 132  VAL B C   1 
ATOM   5196 O O   . VAL B 1 132 ? -3.603  2.980   -42.477 1.00 56.07  ? 132  VAL B O   1 
ATOM   5197 C CB  . VAL B 1 132 ? -2.847  0.269   -41.600 1.00 62.23  ? 132  VAL B CB  1 
ATOM   5198 C CG1 . VAL B 1 132 ? -3.144  0.749   -40.206 1.00 64.32  ? 132  VAL B CG1 1 
ATOM   5199 C CG2 . VAL B 1 132 ? -2.577  -1.221  -41.609 1.00 64.08  ? 132  VAL B CG2 1 
ATOM   5200 N N   . TYR B 1 133 ? -3.263  1.944   -44.432 1.00 57.25  ? 133  TYR B N   1 
ATOM   5201 C CA  . TYR B 1 133 ? -2.721  3.129   -45.073 1.00 39.62  ? 133  TYR B CA  1 
ATOM   5202 C C   . TYR B 1 133 ? -3.711  3.630   -46.099 1.00 53.83  ? 133  TYR B C   1 
ATOM   5203 O O   . TYR B 1 133 ? -3.386  4.454   -46.952 1.00 60.13  ? 133  TYR B O   1 
ATOM   5204 C CB  . TYR B 1 133 ? -1.433  2.782   -45.783 1.00 43.63  ? 133  TYR B CB  1 
ATOM   5205 C CG  . TYR B 1 133 ? -0.353  2.283   -44.869 1.00 36.61  ? 133  TYR B CG  1 
ATOM   5206 C CD1 . TYR B 1 133 ? -0.462  2.421   -43.492 1.00 32.34  ? 133  TYR B CD1 1 
ATOM   5207 C CD2 . TYR B 1 133 ? 0.779   1.666   -45.384 1.00 33.82  ? 133  TYR B CD2 1 
ATOM   5208 C CE1 . TYR B 1 133 ? 0.537   1.959   -42.661 1.00 35.35  ? 133  TYR B CE1 1 
ATOM   5209 C CE2 . TYR B 1 133 ? 1.776   1.190   -44.565 1.00 28.45  ? 133  TYR B CE2 1 
ATOM   5210 C CZ  . TYR B 1 133 ? 1.659   1.348   -43.212 1.00 33.19  ? 133  TYR B CZ  1 
ATOM   5211 O OH  . TYR B 1 133 ? 2.669   0.888   -42.408 1.00 27.57  ? 133  TYR B OH  1 
ATOM   5212 N N   . ASP B 1 134 ? -4.923  3.104   -46.019 1.00 51.06  ? 134  ASP B N   1 
ATOM   5213 C CA  . ASP B 1 134 ? -5.988  3.457   -46.942 1.00 54.80  ? 134  ASP B CA  1 
ATOM   5214 C C   . ASP B 1 134 ? -6.278  4.967   -46.910 1.00 58.88  ? 134  ASP B C   1 
ATOM   5215 O O   . ASP B 1 134 ? -6.662  5.520   -45.871 1.00 53.01  ? 134  ASP B O   1 
ATOM   5216 C CB  . ASP B 1 134 ? -7.232  2.658   -46.574 1.00 45.84  ? 134  ASP B CB  1 
ATOM   5217 C CG  . ASP B 1 134 ? -8.302  2.767   -47.596 1.00 52.73  ? 134  ASP B CG  1 
ATOM   5218 O OD1 . ASP B 1 134 ? -8.286  3.754   -48.353 1.00 54.21  ? 134  ASP B OD1 1 
ATOM   5219 O OD2 . ASP B 1 134 ? -9.164  1.866   -47.636 1.00 59.52  ? 134  ASP B OD2 1 
ATOM   5220 N N   . GLY B 1 135 ? -6.096  5.630   -48.047 1.00 50.79  ? 135  GLY B N   1 
ATOM   5221 C CA  . GLY B 1 135 ? -6.218  7.077   -48.107 1.00 51.28  ? 135  GLY B CA  1 
ATOM   5222 C C   . GLY B 1 135 ? -7.612  7.619   -48.383 1.00 53.81  ? 135  GLY B C   1 
ATOM   5223 O O   . GLY B 1 135 ? -7.816  8.834   -48.465 1.00 61.78  ? 135  GLY B O   1 
ATOM   5224 N N   . ARG B 1 136 ? -8.585  6.733   -48.516 1.00 41.53  ? 136  ARG B N   1 
ATOM   5225 C CA  . ARG B 1 136 ? -9.897  7.173   -48.961 1.00 53.91  ? 136  ARG B CA  1 
ATOM   5226 C C   . ARG B 1 136 ? -10.551 8.092   -47.942 1.00 55.86  ? 136  ARG B C   1 
ATOM   5227 O O   . ARG B 1 136 ? -11.198 9.069   -48.306 1.00 60.62  ? 136  ARG B O   1 
ATOM   5228 C CB  . ARG B 1 136 ? -10.805 5.979   -49.284 1.00 49.99  ? 136  ARG B CB  1 
ATOM   5229 C CG  . ARG B 1 136 ? -11.488 5.401   -48.089 1.00 56.78  ? 136  ARG B CG  1 
ATOM   5230 C CD  . ARG B 1 136 ? -11.544 3.883   -48.154 1.00 61.30  ? 136  ARG B CD  1 
ATOM   5231 N NE  . ARG B 1 136 ? -12.069 3.353   -49.408 1.00 57.85  ? 136  ARG B NE  1 
ATOM   5232 C CZ  . ARG B 1 136 ? -11.802 2.125   -49.852 1.00 65.45  ? 136  ARG B CZ  1 
ATOM   5233 N NH1 . ARG B 1 136 ? -11.019 1.322   -49.151 1.00 82.18  ? 136  ARG B NH1 1 
ATOM   5234 N NH2 . ARG B 1 136 ? -12.301 1.692   -50.996 1.00 53.17  ? 136  ARG B NH2 1 
ATOM   5235 N N   . PHE B 1 137 ? -10.368 7.783   -46.666 1.00 53.83  ? 137  PHE B N   1 
ATOM   5236 C CA  . PHE B 1 137 ? -11.088 8.482   -45.607 1.00 49.36  ? 137  PHE B CA  1 
ATOM   5237 C C   . PHE B 1 137 ? -10.671 9.931   -45.493 1.00 50.26  ? 137  PHE B C   1 
ATOM   5238 O O   . PHE B 1 137 ? -11.517 10.816  -45.384 1.00 61.99  ? 137  PHE B O   1 
ATOM   5239 C CB  . PHE B 1 137 ? -10.912 7.772   -44.263 1.00 42.88  ? 137  PHE B CB  1 
ATOM   5240 C CG  . PHE B 1 137 ? -11.244 6.317   -44.311 1.00 52.70  ? 137  PHE B CG  1 
ATOM   5241 C CD1 . PHE B 1 137 ? -12.558 5.896   -44.298 1.00 47.21  ? 137  PHE B CD1 1 
ATOM   5242 C CD2 . PHE B 1 137 ? -10.240 5.368   -44.399 1.00 58.31  ? 137  PHE B CD2 1 
ATOM   5243 C CE1 . PHE B 1 137 ? -12.870 4.552   -44.358 1.00 57.84  ? 137  PHE B CE1 1 
ATOM   5244 C CE2 . PHE B 1 137 ? -10.539 4.028   -44.463 1.00 57.87  ? 137  PHE B CE2 1 
ATOM   5245 C CZ  . PHE B 1 137 ? -11.857 3.615   -44.439 1.00 61.10  ? 137  PHE B CZ  1 
ATOM   5246 N N   . LEU B 1 138 ? -9.369  10.175  -45.513 1.00 44.76  ? 138  LEU B N   1 
ATOM   5247 C CA  . LEU B 1 138 ? -8.860  11.541  -45.414 1.00 49.94  ? 138  LEU B CA  1 
ATOM   5248 C C   . LEU B 1 138 ? -9.282  12.347  -46.636 1.00 55.24  ? 138  LEU B C   1 
ATOM   5249 O O   . LEU B 1 138 ? -9.702  13.493  -46.528 1.00 55.87  ? 138  LEU B O   1 
ATOM   5250 C CB  . LEU B 1 138 ? -7.336  11.540  -45.277 1.00 40.37  ? 138  LEU B CB  1 
ATOM   5251 C CG  . LEU B 1 138 ? -6.750  11.169  -43.910 1.00 43.48  ? 138  LEU B CG  1 
ATOM   5252 C CD1 . LEU B 1 138 ? -5.257  10.959  -43.987 1.00 46.33  ? 138  LEU B CD1 1 
ATOM   5253 C CD2 . LEU B 1 138 ? -7.047  12.239  -42.901 1.00 53.81  ? 138  LEU B CD2 1 
ATOM   5254 N N   . ALA B 1 139 ? -9.166  11.724  -47.800 1.00 53.95  ? 139  ALA B N   1 
ATOM   5255 C CA  . ALA B 1 139 ? -9.547  12.353  -49.050 1.00 48.55  ? 139  ALA B CA  1 
ATOM   5256 C C   . ALA B 1 139 ? -11.010 12.718  -49.012 1.00 47.89  ? 139  ALA B C   1 
ATOM   5257 O O   . ALA B 1 139 ? -11.409 13.774  -49.478 1.00 57.86  ? 139  ALA B O   1 
ATOM   5258 C CB  . ALA B 1 139 ? -9.275  11.401  -50.229 1.00 41.42  ? 139  ALA B CB  1 
ATOM   5259 N N   . GLN B 1 140 ? -11.814 11.822  -48.466 1.00 54.91  ? 140  GLN B N   1 
ATOM   5260 C CA  . GLN B 1 140 ? -13.257 11.979  -48.516 1.00 54.25  ? 140  GLN B CA  1 
ATOM   5261 C C   . GLN B 1 140 ? -13.716 12.979  -47.467 1.00 66.53  ? 140  GLN B C   1 
ATOM   5262 O O   . GLN B 1 140 ? -14.426 13.938  -47.769 1.00 67.03  ? 140  GLN B O   1 
ATOM   5263 C CB  . GLN B 1 140 ? -13.929 10.629  -48.298 1.00 48.80  ? 140  GLN B CB  1 
ATOM   5264 C CG  . GLN B 1 140 ? -15.381 10.580  -48.730 1.00 54.18  ? 140  GLN B CG  1 
ATOM   5265 C CD  . GLN B 1 140 ? -16.330 10.939  -47.605 1.00 65.37  ? 140  GLN B CD  1 
ATOM   5266 O OE1 . GLN B 1 140 ? -16.160 10.491  -46.466 1.00 63.52  ? 140  GLN B OE1 1 
ATOM   5267 N NE2 . GLN B 1 140 ? -17.333 11.752  -47.914 1.00 56.82  ? 140  GLN B NE2 1 
ATOM   5268 N N   . VAL B 1 141 ? -13.274 12.757  -46.238 1.00 62.30  ? 141  VAL B N   1 
ATOM   5269 C CA  . VAL B 1 141 ? -13.735 13.518  -45.093 1.00 58.04  ? 141  VAL B CA  1 
ATOM   5270 C C   . VAL B 1 141 ? -13.108 14.903  -45.012 1.00 57.98  ? 141  VAL B C   1 
ATOM   5271 O O   . VAL B 1 141 ? -13.805 15.890  -44.771 1.00 56.37  ? 141  VAL B O   1 
ATOM   5272 C CB  . VAL B 1 141 ? -13.425 12.751  -43.807 1.00 58.34  ? 141  VAL B CB  1 
ATOM   5273 C CG1 . VAL B 1 141 ? -13.617 13.624  -42.592 1.00 58.81  ? 141  VAL B CG1 1 
ATOM   5274 C CG2 . VAL B 1 141 ? -14.285 11.526  -43.730 1.00 51.26  ? 141  VAL B CG2 1 
ATOM   5275 N N   . GLU B 1 142 ? -11.793 14.960  -45.207 1.00 50.87  ? 142  GLU B N   1 
ATOM   5276 C CA  . GLU B 1 142 ? -11.034 16.206  -45.111 1.00 48.93  ? 142  GLU B CA  1 
ATOM   5277 C C   . GLU B 1 142 ? -10.760 16.790  -46.485 1.00 50.54  ? 142  GLU B C   1 
ATOM   5278 O O   . GLU B 1 142 ? -10.188 17.878  -46.603 1.00 55.45  ? 142  GLU B O   1 
ATOM   5279 C CB  . GLU B 1 142 ? -9.709  15.974  -44.380 1.00 52.43  ? 142  GLU B CB  1 
ATOM   5280 C CG  . GLU B 1 142 ? -9.880  15.701  -42.910 1.00 60.21  ? 142  GLU B CG  1 
ATOM   5281 C CD  . GLU B 1 142 ? -10.585 16.852  -42.216 1.00 72.57  ? 142  GLU B CD  1 
ATOM   5282 O OE1 . GLU B 1 142 ? -10.525 17.978  -42.757 1.00 75.80  ? 142  GLU B OE1 1 
ATOM   5283 O OE2 . GLU B 1 142 ? -11.203 16.633  -41.147 1.00 68.61  ? 142  GLU B OE2 1 
ATOM   5284 N N   . GLY B 1 143 ? -11.178 16.060  -47.519 1.00 47.39  ? 143  GLY B N   1 
ATOM   5285 C CA  . GLY B 1 143 ? -10.973 16.479  -48.892 1.00 42.46  ? 143  GLY B CA  1 
ATOM   5286 C C   . GLY B 1 143 ? -9.507  16.689  -49.221 1.00 58.88  ? 143  GLY B C   1 
ATOM   5287 O O   . GLY B 1 143 ? -9.161  17.504  -50.078 1.00 66.04  ? 143  GLY B O   1 
ATOM   5288 N N   . ALA B 1 144 ? -8.641  15.949  -48.537 1.00 62.07  ? 144  ALA B N   1 
ATOM   5289 C CA  . ALA B 1 144 ? -7.206  15.972  -48.816 1.00 58.06  ? 144  ALA B CA  1 
ATOM   5290 C C   . ALA B 1 144 ? -6.852  15.224  -50.101 1.00 60.68  ? 144  ALA B C   1 
ATOM   5291 O O   . ALA B 1 144 ? -7.491  14.213  -50.427 1.00 56.93  ? 144  ALA B O   1 
ATOM   5292 C CB  . ALA B 1 144 ? -6.457  15.351  -47.665 1.00 46.48  ? 144  ALA B CB  1 
ATOM   5293 N N   . VAL B 1 145 ? -5.842  15.716  -50.823 1.00 46.71  ? 145  VAL B N   1 
ATOM   5294 C CA  . VAL B 1 145 ? -5.171  14.882  -51.814 1.00 53.88  ? 145  VAL B CA  1 
ATOM   5295 C C   . VAL B 1 145 ? -4.018  14.161  -51.126 1.00 55.39  ? 145  VAL B C   1 
ATOM   5296 O O   . VAL B 1 145 ? -3.117  14.795  -50.571 1.00 53.22  ? 145  VAL B O   1 
ATOM   5297 C CB  . VAL B 1 145 ? -4.601  15.666  -53.001 1.00 54.27  ? 145  VAL B CB  1 
ATOM   5298 C CG1 . VAL B 1 145 ? -3.707  14.756  -53.832 1.00 44.38  ? 145  VAL B CG1 1 
ATOM   5299 C CG2 . VAL B 1 145 ? -5.706  16.207  -53.860 1.00 58.93  ? 145  VAL B CG2 1 
ATOM   5300 N N   . LEU B 1 146 ? -4.048  12.835  -51.175 1.00 46.97  ? 146  LEU B N   1 
ATOM   5301 C CA  . LEU B 1 146 ? -3.103  12.022  -50.435 1.00 47.01  ? 146  LEU B CA  1 
ATOM   5302 C C   . LEU B 1 146 ? -2.331  11.054  -51.330 1.00 58.13  ? 146  LEU B C   1 
ATOM   5303 O O   . LEU B 1 146 ? -2.924  10.295  -52.113 1.00 57.39  ? 146  LEU B O   1 
ATOM   5304 C CB  . LEU B 1 146 ? -3.844  11.245  -49.352 1.00 55.35  ? 146  LEU B CB  1 
ATOM   5305 C CG  . LEU B 1 146 ? -2.900  10.492  -48.424 1.00 68.77  ? 146  LEU B CG  1 
ATOM   5306 C CD1 . LEU B 1 146 ? -3.487  10.400  -47.031 1.00 70.31  ? 146  LEU B CD1 1 
ATOM   5307 C CD2 . LEU B 1 146 ? -2.585  9.109   -48.983 1.00 65.50  ? 146  LEU B CD2 1 
ATOM   5308 N N   . VAL B 1 147 ? -1.006  11.070  -51.186 1.00 56.52  ? 147  VAL B N   1 
ATOM   5309 C CA  . VAL B 1 147 ? -0.119  10.249  -52.009 1.00 48.14  ? 147  VAL B CA  1 
ATOM   5310 C C   . VAL B 1 147 ? 0.735   9.285   -51.185 1.00 46.27  ? 147  VAL B C   1 
ATOM   5311 O O   . VAL B 1 147 ? 1.199   9.627   -50.104 1.00 57.00  ? 147  VAL B O   1 
ATOM   5312 C CB  . VAL B 1 147 ? 0.822   11.132  -52.825 1.00 48.75  ? 147  VAL B CB  1 
ATOM   5313 C CG1 . VAL B 1 147 ? 1.593   10.296  -53.819 1.00 48.96  ? 147  VAL B CG1 1 
ATOM   5314 C CG2 . VAL B 1 147 ? 0.039   12.239  -53.524 1.00 50.76  ? 147  VAL B CG2 1 
ATOM   5315 N N   . SER B 1 148 ? 0.926   8.073   -51.697 1.00 44.10  ? 148  SER B N   1 
ATOM   5316 C CA  . SER B 1 148 ? 1.807   7.092   -51.053 1.00 44.24  ? 148  SER B CA  1 
ATOM   5317 C C   . SER B 1 148 ? 2.569   6.268   -52.090 1.00 45.70  ? 148  SER B C   1 
ATOM   5318 O O   . SER B 1 148 ? 1.976   5.786   -53.067 1.00 43.75  ? 148  SER B O   1 
ATOM   5319 C CB  . SER B 1 148 ? 1.031   6.153   -50.135 1.00 31.29  ? 148  SER B CB  1 
ATOM   5320 O OG  . SER B 1 148 ? 0.229   5.245   -50.875 1.00 50.36  ? 148  SER B OG  1 
ATOM   5321 N N   . MET B 1 149 ? 3.876   6.114   -51.869 1.00 39.02  ? 149  MET B N   1 
ATOM   5322 C CA  . MET B 1 149 ? 4.753   5.400   -52.807 1.00 46.23  ? 149  MET B CA  1 
ATOM   5323 C C   . MET B 1 149 ? 5.326   4.139   -52.185 1.00 36.96  ? 149  MET B C   1 
ATOM   5324 O O   . MET B 1 149 ? 5.419   4.026   -50.958 1.00 42.29  ? 149  MET B O   1 
ATOM   5325 C CB  . MET B 1 149 ? 5.923   6.284   -53.276 1.00 38.80  ? 149  MET B CB  1 
ATOM   5326 C CG  . MET B 1 149 ? 7.091   6.315   -52.297 1.00 43.02  ? 149  MET B CG  1 
ATOM   5327 S SD  . MET B 1 149 ? 6.683   7.188   -50.765 1.00 44.32  ? 149  MET B SD  1 
ATOM   5328 C CE  . MET B 1 149 ? 7.371   8.794   -51.210 1.00 45.56  ? 149  MET B CE  1 
ATOM   5329 N N   . ASN B 1 150 ? 5.697   3.191   -53.037 1.00 38.65  ? 150  ASN B N   1 
ATOM   5330 C CA  . ASN B 1 150 ? 6.496   2.066   -52.595 1.00 39.04  ? 150  ASN B CA  1 
ATOM   5331 C C   . ASN B 1 150 ? 7.934   2.458   -52.816 1.00 43.24  ? 150  ASN B C   1 
ATOM   5332 O O   . ASN B 1 150 ? 8.258   3.076   -53.833 1.00 46.14  ? 150  ASN B O   1 
ATOM   5333 C CB  . ASN B 1 150 ? 6.204   0.811   -53.410 1.00 44.94  ? 150  ASN B CB  1 
ATOM   5334 C CG  . ASN B 1 150 ? 4.954   0.109   -52.968 1.00 60.90  ? 150  ASN B CG  1 
ATOM   5335 O OD1 . ASN B 1 150 ? 4.155   0.667   -52.218 1.00 60.41  ? 150  ASN B OD1 1 
ATOM   5336 N ND2 . ASN B 1 150 ? 4.761   -1.126  -53.444 1.00 65.09  ? 150  ASN B ND2 1 
ATOM   5337 N N   . TYR B 1 151 ? 8.798   2.097   -51.875 1.00 43.71  ? 151  TYR B N   1 
ATOM   5338 C CA  . TYR B 1 151 ? 10.225  2.296   -52.049 1.00 47.04  ? 151  TYR B CA  1 
ATOM   5339 C C   . TYR B 1 151 ? 10.971  1.016   -51.685 1.00 51.70  ? 151  TYR B C   1 
ATOM   5340 O O   . TYR B 1 151 ? 10.484  0.228   -50.882 1.00 54.26  ? 151  TYR B O   1 
ATOM   5341 C CB  . TYR B 1 151 ? 10.687  3.470   -51.202 1.00 37.45  ? 151  TYR B CB  1 
ATOM   5342 C CG  . TYR B 1 151 ? 10.519  3.246   -49.729 1.00 34.98  ? 151  TYR B CG  1 
ATOM   5343 C CD1 . TYR B 1 151 ? 9.287   3.429   -49.112 1.00 31.81  ? 151  TYR B CD1 1 
ATOM   5344 C CD2 . TYR B 1 151 ? 11.593  2.855   -48.945 1.00 36.32  ? 151  TYR B CD2 1 
ATOM   5345 C CE1 . TYR B 1 151 ? 9.140   3.221   -47.746 1.00 28.54  ? 151  TYR B CE1 1 
ATOM   5346 C CE2 . TYR B 1 151 ? 11.454  2.653   -47.577 1.00 28.37  ? 151  TYR B CE2 1 
ATOM   5347 C CZ  . TYR B 1 151 ? 10.235  2.838   -46.984 1.00 34.96  ? 151  TYR B CZ  1 
ATOM   5348 O OH  . TYR B 1 151 ? 10.112  2.627   -45.626 1.00 36.93  ? 151  TYR B OH  1 
ATOM   5349 N N   . ARG B 1 152 ? 12.141  0.802   -52.286 1.00 54.51  ? 152  ARG B N   1 
ATOM   5350 C CA  . ARG B 1 152 ? 12.910  -0.429  -52.064 1.00 50.45  ? 152  ARG B CA  1 
ATOM   5351 C C   . ARG B 1 152 ? 13.405  -0.591  -50.625 1.00 46.92  ? 152  ARG B C   1 
ATOM   5352 O O   . ARG B 1 152 ? 14.079  0.279   -50.074 1.00 50.43  ? 152  ARG B O   1 
ATOM   5353 C CB  . ARG B 1 152 ? 14.085  -0.511  -53.037 1.00 36.98  ? 152  ARG B CB  1 
ATOM   5354 C CG  . ARG B 1 152 ? 13.701  -0.941  -54.434 1.00 38.83  ? 152  ARG B CG  1 
ATOM   5355 C CD  . ARG B 1 152 ? 14.877  -0.887  -55.374 1.00 45.88  ? 152  ARG B CD  1 
ATOM   5356 N NE  . ARG B 1 152 ? 15.262  0.487   -55.661 1.00 44.72  ? 152  ARG B NE  1 
ATOM   5357 C CZ  . ARG B 1 152 ? 16.330  0.830   -56.375 1.00 51.00  ? 152  ARG B CZ  1 
ATOM   5358 N NH1 . ARG B 1 152 ? 17.133  -0.104  -56.868 1.00 46.61  ? 152  ARG B NH1 1 
ATOM   5359 N NH2 . ARG B 1 152 ? 16.594  2.111   -56.585 1.00 57.04  ? 152  ARG B NH2 1 
ATOM   5360 N N   . VAL B 1 153 ? 13.061  -1.716  -50.020 1.00 41.92  ? 153  VAL B N   1 
ATOM   5361 C CA  . VAL B 1 153 ? 13.479  -2.007  -48.656 1.00 38.76  ? 153  VAL B CA  1 
ATOM   5362 C C   . VAL B 1 153 ? 14.546  -3.107  -48.607 1.00 41.39  ? 153  VAL B C   1 
ATOM   5363 O O   . VAL B 1 153 ? 14.841  -3.739  -49.619 1.00 43.25  ? 153  VAL B O   1 
ATOM   5364 C CB  . VAL B 1 153 ? 12.288  -2.449  -47.818 1.00 45.35  ? 153  VAL B CB  1 
ATOM   5365 C CG1 . VAL B 1 153 ? 11.334  -1.270  -47.595 1.00 37.63  ? 153  VAL B CG1 1 
ATOM   5366 C CG2 . VAL B 1 153 ? 11.578  -3.655  -48.491 1.00 49.54  ? 153  VAL B CG2 1 
ATOM   5367 N N   . GLY B 1 154 ? 15.126  -3.320  -47.427 1.00 39.21  ? 154  GLY B N   1 
ATOM   5368 C CA  . GLY B 1 154 ? 16.108  -4.373  -47.235 1.00 49.29  ? 154  GLY B CA  1 
ATOM   5369 C C   . GLY B 1 154 ? 17.306  -4.253  -48.157 1.00 58.76  ? 154  GLY B C   1 
ATOM   5370 O O   . GLY B 1 154 ? 17.687  -3.138  -48.533 1.00 60.87  ? 154  GLY B O   1 
ATOM   5371 N N   . THR B 1 155 ? 17.902  -5.393  -48.517 1.00 48.14  ? 155  THR B N   1 
ATOM   5372 C CA  . THR B 1 155 ? 19.100  -5.384  -49.354 1.00 45.25  ? 155  THR B CA  1 
ATOM   5373 C C   . THR B 1 155 ? 18.868  -4.631  -50.664 1.00 46.80  ? 155  THR B C   1 
ATOM   5374 O O   . THR B 1 155 ? 19.753  -3.942  -51.166 1.00 58.18  ? 155  THR B O   1 
ATOM   5375 C CB  . THR B 1 155 ? 19.656  -6.809  -49.658 1.00 46.23  ? 155  THR B CB  1 
ATOM   5376 O OG1 . THR B 1 155 ? 18.643  -7.626  -50.244 1.00 42.98  ? 155  THR B OG1 1 
ATOM   5377 C CG2 . THR B 1 155 ? 20.153  -7.482  -48.410 1.00 51.43  ? 155  THR B CG2 1 
ATOM   5378 N N   . PHE B 1 156 ? 17.665  -4.736  -51.204 1.00 40.40  ? 156  PHE B N   1 
ATOM   5379 C CA  . PHE B 1 156 ? 17.387  -4.149  -52.500 1.00 44.50  ? 156  PHE B CA  1 
ATOM   5380 C C   . PHE B 1 156 ? 17.372  -2.629  -52.471 1.00 52.58  ? 156  PHE B C   1 
ATOM   5381 O O   . PHE B 1 156 ? 17.650  -1.986  -53.478 1.00 62.58  ? 156  PHE B O   1 
ATOM   5382 C CB  . PHE B 1 156 ? 16.071  -4.691  -53.030 1.00 46.87  ? 156  PHE B CB  1 
ATOM   5383 C CG  . PHE B 1 156 ? 15.983  -6.180  -52.974 1.00 43.78  ? 156  PHE B CG  1 
ATOM   5384 C CD1 . PHE B 1 156 ? 16.468  -6.956  -54.008 1.00 45.04  ? 156  PHE B CD1 1 
ATOM   5385 C CD2 . PHE B 1 156 ? 15.451  -6.808  -51.867 1.00 52.50  ? 156  PHE B CD2 1 
ATOM   5386 C CE1 . PHE B 1 156 ? 16.398  -8.330  -53.953 1.00 57.90  ? 156  PHE B CE1 1 
ATOM   5387 C CE2 . PHE B 1 156 ? 15.388  -8.190  -51.804 1.00 66.13  ? 156  PHE B CE2 1 
ATOM   5388 C CZ  . PHE B 1 156 ? 15.861  -8.950  -52.853 1.00 60.70  ? 156  PHE B CZ  1 
ATOM   5389 N N   . GLY B 1 157 ? 17.058  -2.058  -51.313 1.00 51.81  ? 157  GLY B N   1 
ATOM   5390 C CA  . GLY B 1 157 ? 16.958  -0.617  -51.185 1.00 45.03  ? 157  GLY B CA  1 
ATOM   5391 C C   . GLY B 1 157 ? 18.135  0.009   -50.473 1.00 45.42  ? 157  GLY B C   1 
ATOM   5392 O O   . GLY B 1 157 ? 18.472  1.168   -50.737 1.00 47.39  ? 157  GLY B O   1 
ATOM   5393 N N   . PHE B 1 158 ? 18.775  -0.755  -49.586 1.00 52.18  ? 158  PHE B N   1 
ATOM   5394 C CA  . PHE B 1 158 ? 19.843  -0.201  -48.748 1.00 43.21  ? 158  PHE B CA  1 
ATOM   5395 C C   . PHE B 1 158 ? 21.134  -0.998  -48.663 1.00 44.07  ? 158  PHE B C   1 
ATOM   5396 O O   . PHE B 1 158 ? 21.999  -0.689  -47.840 1.00 40.55  ? 158  PHE B O   1 
ATOM   5397 C CB  . PHE B 1 158 ? 19.319  0.130   -47.344 1.00 36.60  ? 158  PHE B CB  1 
ATOM   5398 C CG  . PHE B 1 158 ? 18.136  1.036   -47.368 1.00 47.08  ? 158  PHE B CG  1 
ATOM   5399 C CD1 . PHE B 1 158 ? 18.303  2.408   -47.508 1.00 47.66  ? 158  PHE B CD1 1 
ATOM   5400 C CD2 . PHE B 1 158 ? 16.852  0.520   -47.316 1.00 39.20  ? 158  PHE B CD2 1 
ATOM   5401 C CE1 . PHE B 1 158 ? 17.211  3.250   -47.568 1.00 41.92  ? 158  PHE B CE1 1 
ATOM   5402 C CE2 . PHE B 1 158 ? 15.752  1.357   -47.365 1.00 46.51  ? 158  PHE B CE2 1 
ATOM   5403 C CZ  . PHE B 1 158 ? 15.929  2.723   -47.498 1.00 48.51  ? 158  PHE B CZ  1 
ATOM   5404 N N   . LEU B 1 159 ? 21.310  -2.007  -49.504 1.00 46.88  ? 159  LEU B N   1 
ATOM   5405 C CA  . LEU B 1 159 ? 22.646  -2.599  -49.539 1.00 55.24  ? 159  LEU B CA  1 
ATOM   5406 C C   . LEU B 1 159 ? 23.612  -1.609  -50.207 1.00 58.77  ? 159  LEU B C   1 
ATOM   5407 O O   . LEU B 1 159 ? 23.354  -1.097  -51.306 1.00 67.14  ? 159  LEU B O   1 
ATOM   5408 C CB  . LEU B 1 159 ? 22.668  -3.987  -50.190 1.00 51.78  ? 159  LEU B CB  1 
ATOM   5409 C CG  . LEU B 1 159 ? 24.043  -4.659  -50.247 1.00 50.82  ? 159  LEU B CG  1 
ATOM   5410 C CD1 . LEU B 1 159 ? 23.974  -6.161  -49.968 1.00 51.88  ? 159  LEU B CD1 1 
ATOM   5411 C CD2 . LEU B 1 159 ? 24.657  -4.405  -51.596 1.00 53.98  ? 159  LEU B CD2 1 
ATOM   5412 N N   . ALA B 1 160 ? 24.703  -1.314  -49.511 1.00 56.91  ? 160  ALA B N   1 
ATOM   5413 C CA  . ALA B 1 160 ? 25.669  -0.329  -49.975 1.00 49.74  ? 160  ALA B CA  1 
ATOM   5414 C C   . ALA B 1 160 ? 27.093  -0.820  -49.819 1.00 54.47  ? 160  ALA B C   1 
ATOM   5415 O O   . ALA B 1 160 ? 27.456  -1.414  -48.805 1.00 65.95  ? 160  ALA B O   1 
ATOM   5416 C CB  . ALA B 1 160 ? 25.495  0.979   -49.229 1.00 52.12  ? 160  ALA B CB  1 
ATOM   5417 N N   . LEU B 1 161 ? 27.881  -0.588  -50.860 1.00 59.95  ? 161  LEU B N   1 
ATOM   5418 C CA  . LEU B 1 161 ? 29.324  -0.660  -50.787 1.00 62.86  ? 161  LEU B CA  1 
ATOM   5419 C C   . LEU B 1 161 ? 29.807  0.764   -50.999 1.00 60.29  ? 161  LEU B C   1 
ATOM   5420 O O   . LEU B 1 161 ? 30.086  1.173   -52.126 1.00 59.69  ? 161  LEU B O   1 
ATOM   5421 C CB  . LEU B 1 161 ? 29.876  -1.589  -51.863 1.00 61.53  ? 161  LEU B CB  1 
ATOM   5422 C CG  . LEU B 1 161 ? 29.700  -3.077  -51.585 1.00 61.55  ? 161  LEU B CG  1 
ATOM   5423 C CD1 . LEU B 1 161 ? 30.211  -3.887  -52.743 1.00 79.99  ? 161  LEU B CD1 1 
ATOM   5424 C CD2 . LEU B 1 161 ? 30.456  -3.447  -50.347 1.00 66.24  ? 161  LEU B CD2 1 
ATOM   5425 N N   . PRO B 1 162 ? 29.879  1.535   -49.908 1.00 57.30  ? 162  PRO B N   1 
ATOM   5426 C CA  . PRO B 1 162 ? 30.082  2.983   -49.992 1.00 60.79  ? 162  PRO B CA  1 
ATOM   5427 C C   . PRO B 1 162 ? 31.220  3.344   -50.922 1.00 60.37  ? 162  PRO B C   1 
ATOM   5428 O O   . PRO B 1 162 ? 32.288  2.748   -50.856 1.00 57.73  ? 162  PRO B O   1 
ATOM   5429 C CB  . PRO B 1 162 ? 30.411  3.362   -48.557 1.00 65.83  ? 162  PRO B CB  1 
ATOM   5430 C CG  . PRO B 1 162 ? 29.645  2.351   -47.746 1.00 58.24  ? 162  PRO B CG  1 
ATOM   5431 C CD  . PRO B 1 162 ? 29.761  1.071   -48.515 1.00 53.19  ? 162  PRO B CD  1 
ATOM   5432 N N   . GLY B 1 163 ? 30.967  4.301   -51.805 1.00 64.63  ? 163  GLY B N   1 
ATOM   5433 C CA  . GLY B 1 163 ? 31.977  4.757   -52.739 1.00 62.60  ? 163  GLY B CA  1 
ATOM   5434 C C   . GLY B 1 163 ? 32.049  3.941   -54.013 1.00 71.63  ? 163  GLY B C   1 
ATOM   5435 O O   . GLY B 1 163 ? 32.807  4.263   -54.941 1.00 67.03  ? 163  GLY B O   1 
ATOM   5436 N N   . SER B 1 164 ? 31.272  2.866   -54.061 1.00 75.50  ? 164  SER B N   1 
ATOM   5437 C CA  . SER B 1 164 ? 31.189  2.077   -55.279 1.00 76.41  ? 164  SER B CA  1 
ATOM   5438 C C   . SER B 1 164 ? 30.176  2.729   -56.196 1.00 71.10  ? 164  SER B C   1 
ATOM   5439 O O   . SER B 1 164 ? 29.285  3.447   -55.740 1.00 74.53  ? 164  SER B O   1 
ATOM   5440 C CB  . SER B 1 164 ? 30.784  0.634   -54.983 1.00 77.88  ? 164  SER B CB  1 
ATOM   5441 O OG  . SER B 1 164 ? 29.459  0.566   -54.497 1.00 74.49  ? 164  SER B OG  1 
ATOM   5442 N N   . ARG B 1 165 ? 30.320  2.485   -57.489 1.00 71.44  ? 165  ARG B N   1 
ATOM   5443 C CA  . ARG B 1 165 ? 29.459  3.111   -58.469 1.00 81.17  ? 165  ARG B CA  1 
ATOM   5444 C C   . ARG B 1 165 ? 28.170  2.316   -58.587 1.00 76.64  ? 165  ARG B C   1 
ATOM   5445 O O   . ARG B 1 165 ? 27.109  2.871   -58.877 1.00 77.25  ? 165  ARG B O   1 
ATOM   5446 C CB  . ARG B 1 165 ? 30.173  3.155   -59.817 1.00 98.40  ? 165  ARG B CB  1 
ATOM   5447 C CG  . ARG B 1 165 ? 29.459  3.962   -60.884 1.00 109.81 ? 165  ARG B CG  1 
ATOM   5448 C CD  . ARG B 1 165 ? 29.532  3.261   -62.236 1.00 114.69 ? 165  ARG B CD  1 
ATOM   5449 N NE  . ARG B 1 165 ? 28.255  2.635   -62.565 1.00 113.56 ? 165  ARG B NE  1 
ATOM   5450 C CZ  . ARG B 1 165 ? 28.121  1.545   -63.311 1.00 112.24 ? 165  ARG B CZ  1 
ATOM   5451 N NH1 . ARG B 1 165 ? 29.193  0.944   -63.813 1.00 114.92 ? 165  ARG B NH1 1 
ATOM   5452 N NH2 . ARG B 1 165 ? 26.912  1.057   -63.548 1.00 105.74 ? 165  ARG B NH2 1 
ATOM   5453 N N   . GLU B 1 166 ? 28.269  1.012   -58.346 1.00 71.77  ? 166  GLU B N   1 
ATOM   5454 C CA  . GLU B 1 166 ? 27.173  0.098   -58.652 1.00 79.45  ? 166  GLU B CA  1 
ATOM   5455 C C   . GLU B 1 166 ? 26.294  -0.256  -57.451 1.00 67.25  ? 166  GLU B C   1 
ATOM   5456 O O   . GLU B 1 166 ? 25.358  -1.055  -57.564 1.00 73.20  ? 166  GLU B O   1 
ATOM   5457 C CB  . GLU B 1 166 ? 27.690  -1.169  -59.362 1.00 93.53  ? 166  GLU B CB  1 
ATOM   5458 C CG  . GLU B 1 166 ? 29.021  -1.681  -58.859 1.00 103.07 ? 166  GLU B CG  1 
ATOM   5459 C CD  . GLU B 1 166 ? 30.198  -0.882  -59.392 1.00 113.74 ? 166  GLU B CD  1 
ATOM   5460 O OE1 . GLU B 1 166 ? 30.225  -0.608  -60.612 1.00 115.45 ? 166  GLU B OE1 1 
ATOM   5461 O OE2 . GLU B 1 166 ? 31.095  -0.528  -58.592 1.00 113.06 ? 166  GLU B OE2 1 
ATOM   5462 N N   . ALA B 1 167 ? 26.583  0.363   -56.314 1.00 57.66  ? 167  ALA B N   1 
ATOM   5463 C CA  . ALA B 1 167 ? 25.837  0.128   -55.082 1.00 60.40  ? 167  ALA B CA  1 
ATOM   5464 C C   . ALA B 1 167 ? 26.209  1.186   -54.054 1.00 55.09  ? 167  ALA B C   1 
ATOM   5465 O O   . ALA B 1 167 ? 26.796  0.875   -53.035 1.00 52.20  ? 167  ALA B O   1 
ATOM   5466 C CB  . ALA B 1 167 ? 26.131  -1.266  -54.534 1.00 52.85  ? 167  ALA B CB  1 
ATOM   5467 N N   . PRO B 1 168 ? 25.868  2.449   -54.328 1.00 59.86  ? 168  PRO B N   1 
ATOM   5468 C CA  . PRO B 1 168 ? 26.332  3.559   -53.495 1.00 60.55  ? 168  PRO B CA  1 
ATOM   5469 C C   . PRO B 1 168 ? 25.463  3.741   -52.256 1.00 65.16  ? 168  PRO B C   1 
ATOM   5470 O O   . PRO B 1 168 ? 25.739  4.622   -51.435 1.00 61.74  ? 168  PRO B O   1 
ATOM   5471 C CB  . PRO B 1 168 ? 26.185  4.757   -54.429 1.00 63.90  ? 168  PRO B CB  1 
ATOM   5472 C CG  . PRO B 1 168 ? 25.022  4.396   -55.298 1.00 54.77  ? 168  PRO B CG  1 
ATOM   5473 C CD  . PRO B 1 168 ? 25.075  2.907   -55.483 1.00 55.74  ? 168  PRO B CD  1 
ATOM   5474 N N   . GLY B 1 169 ? 24.427  2.914   -52.132 1.00 60.75  ? 169  GLY B N   1 
ATOM   5475 C CA  . GLY B 1 169 ? 23.541  2.962   -50.984 1.00 49.09  ? 169  GLY B CA  1 
ATOM   5476 C C   . GLY B 1 169 ? 22.482  4.051   -51.056 1.00 52.66  ? 169  GLY B C   1 
ATOM   5477 O O   . GLY B 1 169 ? 22.502  4.923   -51.945 1.00 55.48  ? 169  GLY B O   1 
ATOM   5478 N N   . ASN B 1 170 ? 21.560  3.994   -50.099 1.00 45.33  ? 170  ASN B N   1 
ATOM   5479 C CA  . ASN B 1 170 ? 20.468  4.961   -49.964 1.00 44.35  ? 170  ASN B CA  1 
ATOM   5480 C C   . ASN B 1 170 ? 19.456  4.983   -51.115 1.00 50.26  ? 170  ASN B C   1 
ATOM   5481 O O   . ASN B 1 170 ? 18.590  5.857   -51.170 1.00 50.77  ? 170  ASN B O   1 
ATOM   5482 C CB  . ASN B 1 170 ? 21.012  6.370   -49.709 1.00 52.05  ? 170  ASN B CB  1 
ATOM   5483 C CG  . ASN B 1 170 ? 21.742  6.482   -48.379 1.00 54.33  ? 170  ASN B CG  1 
ATOM   5484 O OD1 . ASN B 1 170 ? 21.555  5.658   -47.496 1.00 49.90  ? 170  ASN B OD1 1 
ATOM   5485 N ND2 . ASN B 1 170 ? 22.572  7.512   -48.234 1.00 55.02  ? 170  ASN B ND2 1 
ATOM   5486 N N   . VAL B 1 171 ? 19.546  4.027   -52.031 1.00 44.95  ? 171  VAL B N   1 
ATOM   5487 C CA  . VAL B 1 171 ? 18.651  4.056   -53.187 1.00 45.71  ? 171  VAL B CA  1 
ATOM   5488 C C   . VAL B 1 171 ? 17.163  3.976   -52.807 1.00 48.03  ? 171  VAL B C   1 
ATOM   5489 O O   . VAL B 1 171 ? 16.306  4.518   -53.495 1.00 51.96  ? 171  VAL B O   1 
ATOM   5490 C CB  . VAL B 1 171 ? 19.011  2.980   -54.217 1.00 42.81  ? 171  VAL B CB  1 
ATOM   5491 C CG1 . VAL B 1 171 ? 20.498  3.111   -54.597 1.00 39.75  ? 171  VAL B CG1 1 
ATOM   5492 C CG2 . VAL B 1 171 ? 18.660  1.578   -53.692 1.00 27.62  ? 171  VAL B CG2 1 
ATOM   5493 N N   . GLY B 1 172 ? 16.848  3.322   -51.702 1.00 37.92  ? 172  GLY B N   1 
ATOM   5494 C CA  . GLY B 1 172 ? 15.471  3.321   -51.262 1.00 30.36  ? 172  GLY B CA  1 
ATOM   5495 C C   . GLY B 1 172 ? 15.016  4.732   -50.966 1.00 30.77  ? 172  GLY B C   1 
ATOM   5496 O O   . GLY B 1 172 ? 13.846  5.085   -51.121 1.00 38.18  ? 172  GLY B O   1 
ATOM   5497 N N   . LEU B 1 173 ? 15.941  5.561   -50.513 1.00 39.49  ? 173  LEU B N   1 
ATOM   5498 C CA  . LEU B 1 173 ? 15.567  6.926   -50.149 1.00 34.26  ? 173  LEU B CA  1 
ATOM   5499 C C   . LEU B 1 173 ? 15.494  7.758   -51.407 1.00 40.68  ? 173  LEU B C   1 
ATOM   5500 O O   . LEU B 1 173 ? 14.659  8.655   -51.521 1.00 45.81  ? 173  LEU B O   1 
ATOM   5501 C CB  . LEU B 1 173 ? 16.541  7.514   -49.120 1.00 43.03  ? 173  LEU B CB  1 
ATOM   5502 C CG  . LEU B 1 173 ? 16.381  7.054   -47.659 1.00 34.96  ? 173  LEU B CG  1 
ATOM   5503 C CD1 . LEU B 1 173 ? 17.645  7.256   -46.840 1.00 30.86  ? 173  LEU B CD1 1 
ATOM   5504 C CD2 . LEU B 1 173 ? 15.223  7.783   -47.021 1.00 39.74  ? 173  LEU B CD2 1 
ATOM   5505 N N   . LEU B 1 174 ? 16.361  7.443   -52.367 1.00 31.13  ? 174  LEU B N   1 
ATOM   5506 C CA  . LEU B 1 174 ? 16.215  7.993   -53.706 1.00 35.58  ? 174  LEU B CA  1 
ATOM   5507 C C   . LEU B 1 174 ? 14.870  7.634   -54.375 1.00 46.99  ? 174  LEU B C   1 
ATOM   5508 O O   . LEU B 1 174 ? 14.279  8.449   -55.084 1.00 46.51  ? 174  LEU B O   1 
ATOM   5509 C CB  . LEU B 1 174 ? 17.398  7.581   -54.565 1.00 35.92  ? 174  LEU B CB  1 
ATOM   5510 C CG  . LEU B 1 174 ? 18.652  8.283   -54.039 1.00 45.46  ? 174  LEU B CG  1 
ATOM   5511 C CD1 . LEU B 1 174 ? 19.870  7.960   -54.868 1.00 41.64  ? 174  LEU B CD1 1 
ATOM   5512 C CD2 . LEU B 1 174 ? 18.425  9.776   -54.014 1.00 39.65  ? 174  LEU B CD2 1 
ATOM   5513 N N   . ASP B 1 175 ? 14.380  6.422   -54.136 1.00 47.52  ? 175  ASP B N   1 
ATOM   5514 C CA  . ASP B 1 175 ? 13.086  6.030   -54.664 1.00 36.15  ? 175  ASP B CA  1 
ATOM   5515 C C   . ASP B 1 175 ? 12.012  6.999   -54.151 1.00 45.47  ? 175  ASP B C   1 
ATOM   5516 O O   . ASP B 1 175 ? 11.180  7.497   -54.916 1.00 46.66  ? 175  ASP B O   1 
ATOM   5517 C CB  . ASP B 1 175 ? 12.732  4.594   -54.257 1.00 33.13  ? 175  ASP B CB  1 
ATOM   5518 C CG  . ASP B 1 175 ? 13.681  3.545   -54.849 1.00 42.40  ? 175  ASP B CG  1 
ATOM   5519 O OD1 . ASP B 1 175 ? 14.533  3.877   -55.708 1.00 40.24  ? 175  ASP B OD1 1 
ATOM   5520 O OD2 . ASP B 1 175 ? 13.567  2.368   -54.437 1.00 39.92  ? 175  ASP B OD2 1 
ATOM   5521 N N   . GLN B 1 176 ? 12.032  7.248   -52.847 1.00 41.69  ? 176  GLN B N   1 
ATOM   5522 C CA  . GLN B 1 176 ? 11.161  8.242   -52.223 1.00 35.14  ? 176  GLN B CA  1 
ATOM   5523 C C   . GLN B 1 176 ? 11.388  9.645   -52.806 1.00 39.33  ? 176  GLN B C   1 
ATOM   5524 O O   . GLN B 1 176 ? 10.444  10.337  -53.173 1.00 41.04  ? 176  GLN B O   1 
ATOM   5525 C CB  . GLN B 1 176 ? 11.394  8.284   -50.704 1.00 30.91  ? 176  GLN B CB  1 
ATOM   5526 C CG  . GLN B 1 176 ? 11.178  6.960   -49.987 1.00 28.79  ? 176  GLN B CG  1 
ATOM   5527 C CD  . GLN B 1 176 ? 11.575  7.003   -48.523 1.00 38.73  ? 176  GLN B CD  1 
ATOM   5528 O OE1 . GLN B 1 176 ? 11.957  8.047   -47.995 1.00 39.46  ? 176  GLN B OE1 1 
ATOM   5529 N NE2 . GLN B 1 176 ? 11.484  5.862   -47.860 1.00 43.27  ? 176  GLN B NE2 1 
ATOM   5530 N N   . ARG B 1 177 ? 12.640  10.071  -52.877 1.00 38.66  ? 177  ARG B N   1 
ATOM   5531 C CA  . ARG B 1 177 ? 12.926  11.394  -53.404 1.00 36.36  ? 177  ARG B CA  1 
ATOM   5532 C C   . ARG B 1 177 ? 12.320  11.548  -54.798 1.00 49.22  ? 177  ARG B C   1 
ATOM   5533 O O   . ARG B 1 177 ? 11.926  12.655  -55.186 1.00 45.95  ? 177  ARG B O   1 
ATOM   5534 C CB  . ARG B 1 177 ? 14.435  11.671  -53.439 1.00 27.96  ? 177  ARG B CB  1 
ATOM   5535 C CG  . ARG B 1 177 ? 14.811  12.917  -54.224 1.00 36.21  ? 177  ARG B CG  1 
ATOM   5536 C CD  . ARG B 1 177 ? 16.266  13.323  -54.019 1.00 36.89  ? 177  ARG B CD  1 
ATOM   5537 N NE  . ARG B 1 177 ? 16.552  13.481  -52.602 1.00 51.74  ? 177  ARG B NE  1 
ATOM   5538 C CZ  . ARG B 1 177 ? 17.770  13.520  -52.078 1.00 50.62  ? 177  ARG B CZ  1 
ATOM   5539 N NH1 . ARG B 1 177 ? 18.843  13.430  -52.862 1.00 33.22  ? 177  ARG B NH1 1 
ATOM   5540 N NH2 . ARG B 1 177 ? 17.909  13.641  -50.763 1.00 43.11  ? 177  ARG B NH2 1 
ATOM   5541 N N   . LEU B 1 178 ? 12.239  10.444  -55.548 1.00 42.87  ? 178  LEU B N   1 
ATOM   5542 C CA  . LEU B 1 178 ? 11.794  10.530  -56.942 1.00 43.58  ? 178  LEU B CA  1 
ATOM   5543 C C   . LEU B 1 178 ? 10.279  10.596  -57.039 1.00 39.94  ? 178  LEU B C   1 
ATOM   5544 O O   . LEU B 1 178 ? 9.719   11.043  -58.035 1.00 50.14  ? 178  LEU B O   1 
ATOM   5545 C CB  . LEU B 1 178 ? 12.342  9.382   -57.802 1.00 37.86  ? 178  LEU B CB  1 
ATOM   5546 C CG  . LEU B 1 178 ? 11.931  9.321   -59.294 1.00 44.05  ? 178  LEU B CG  1 
ATOM   5547 C CD1 . LEU B 1 178 ? 12.314  10.566  -60.094 1.00 51.39  ? 178  LEU B CD1 1 
ATOM   5548 C CD2 . LEU B 1 178 ? 12.509  8.118   -59.963 1.00 31.04  ? 178  LEU B CD2 1 
ATOM   5549 N N   . ALA B 1 179 ? 9.606   10.142  -56.001 1.00 42.27  ? 179  ALA B N   1 
ATOM   5550 C CA  . ALA B 1 179 ? 8.159   10.164  -56.022 1.00 50.66  ? 179  ALA B CA  1 
ATOM   5551 C C   . ALA B 1 179 ? 7.774   11.566  -55.550 1.00 43.05  ? 179  ALA B C   1 
ATOM   5552 O O   . ALA B 1 179 ? 6.870   12.196  -56.061 1.00 39.60  ? 179  ALA B O   1 
ATOM   5553 C CB  . ALA B 1 179 ? 7.618   9.075   -55.123 1.00 22.45  ? 179  ALA B CB  1 
ATOM   5554 N N   . LEU B 1 180 ? 8.525   12.059  -54.583 1.00 45.75  ? 180  LEU B N   1 
ATOM   5555 C CA  . LEU B 1 180 ? 8.505   13.465  -54.238 1.00 39.11  ? 180  LEU B CA  1 
ATOM   5556 C C   . LEU B 1 180 ? 8.566   14.357  -55.496 1.00 38.95  ? 180  LEU B C   1 
ATOM   5557 O O   . LEU B 1 180 ? 7.727   15.242  -55.663 1.00 40.60  ? 180  LEU B O   1 
ATOM   5558 C CB  . LEU B 1 180 ? 9.648   13.752  -53.275 1.00 31.56  ? 180  LEU B CB  1 
ATOM   5559 C CG  . LEU B 1 180 ? 9.249   13.718  -51.793 1.00 34.10  ? 180  LEU B CG  1 
ATOM   5560 C CD1 . LEU B 1 180 ? 8.396   12.531  -51.450 1.00 22.87  ? 180  LEU B CD1 1 
ATOM   5561 C CD2 . LEU B 1 180 ? 10.465  13.784  -50.866 1.00 27.93  ? 180  LEU B CD2 1 
ATOM   5562 N N   . GLN B 1 181 ? 9.531   14.103  -56.384 1.00 43.41  ? 181  GLN B N   1 
ATOM   5563 C CA  . GLN B 1 181 ? 9.635   14.838  -57.649 1.00 41.91  ? 181  GLN B CA  1 
ATOM   5564 C C   . GLN B 1 181 ? 8.398   14.660  -58.510 1.00 50.51  ? 181  GLN B C   1 
ATOM   5565 O O   . GLN B 1 181 ? 7.901   15.616  -59.141 1.00 46.60  ? 181  GLN B O   1 
ATOM   5566 C CB  . GLN B 1 181 ? 10.849  14.383  -58.450 1.00 50.59  ? 181  GLN B CB  1 
ATOM   5567 C CG  . GLN B 1 181 ? 12.120  15.172  -58.167 1.00 78.38  ? 181  GLN B CG  1 
ATOM   5568 C CD  . GLN B 1 181 ? 13.379  14.304  -58.184 1.00 85.81  ? 181  GLN B CD  1 
ATOM   5569 O OE1 . GLN B 1 181 ? 13.396  13.219  -58.770 1.00 99.77  ? 181  GLN B OE1 1 
ATOM   5570 N NE2 . GLN B 1 181 ? 14.433  14.778  -57.528 1.00 67.94  ? 181  GLN B NE2 1 
ATOM   5571 N N   . TRP B 1 182 ? 7.915   13.421  -58.552 1.00 44.22  ? 182  TRP B N   1 
ATOM   5572 C CA  . TRP B 1 182 ? 6.793   13.084  -59.407 1.00 42.06  ? 182  TRP B CA  1 
ATOM   5573 C C   . TRP B 1 182 ? 5.591   13.926  -59.008 1.00 42.23  ? 182  TRP B C   1 
ATOM   5574 O O   . TRP B 1 182 ? 4.883   14.495  -59.860 1.00 32.42  ? 182  TRP B O   1 
ATOM   5575 C CB  . TRP B 1 182 ? 6.458   11.616  -59.267 1.00 33.15  ? 182  TRP B CB  1 
ATOM   5576 C CG  . TRP B 1 182 ? 5.390   11.181  -60.198 1.00 32.52  ? 182  TRP B CG  1 
ATOM   5577 C CD1 . TRP B 1 182 ? 5.554   10.688  -61.462 1.00 32.55  ? 182  TRP B CD1 1 
ATOM   5578 C CD2 . TRP B 1 182 ? 3.984   11.198  -59.952 1.00 32.72  ? 182  TRP B CD2 1 
ATOM   5579 N NE1 . TRP B 1 182 ? 4.331   10.397  -62.019 1.00 37.10  ? 182  TRP B NE1 1 
ATOM   5580 C CE2 . TRP B 1 182 ? 3.350   10.699  -61.114 1.00 44.46  ? 182  TRP B CE2 1 
ATOM   5581 C CE3 . TRP B 1 182 ? 3.198   11.581  -58.865 1.00 44.85  ? 182  TRP B CE3 1 
ATOM   5582 C CZ2 . TRP B 1 182 ? 1.962   10.570  -61.217 1.00 52.47  ? 182  TRP B CZ2 1 
ATOM   5583 C CZ3 . TRP B 1 182 ? 1.821   11.460  -58.969 1.00 55.27  ? 182  TRP B CZ3 1 
ATOM   5584 C CH2 . TRP B 1 182 ? 1.216   10.954  -60.138 1.00 59.46  ? 182  TRP B CH2 1 
ATOM   5585 N N   . VAL B 1 183 ? 5.379   13.999  -57.698 1.00 34.07  ? 183  VAL B N   1 
ATOM   5586 C CA  . VAL B 1 183 ? 4.311   14.793  -57.123 1.00 47.58  ? 183  VAL B CA  1 
ATOM   5587 C C   . VAL B 1 183 ? 4.431   16.282  -57.497 1.00 59.83  ? 183  VAL B C   1 
ATOM   5588 O O   . VAL B 1 183 ? 3.431   16.966  -57.714 1.00 64.74  ? 183  VAL B O   1 
ATOM   5589 C CB  . VAL B 1 183 ? 4.266   14.623  -55.596 1.00 41.84  ? 183  VAL B CB  1 
ATOM   5590 C CG1 . VAL B 1 183 ? 3.477   15.756  -54.963 1.00 35.54  ? 183  VAL B CG1 1 
ATOM   5591 C CG2 . VAL B 1 183 ? 3.657   13.271  -55.235 1.00 33.90  ? 183  VAL B CG2 1 
ATOM   5592 N N   . GLN B 1 184 ? 5.659   16.775  -57.595 1.00 49.83  ? 184  GLN B N   1 
ATOM   5593 C CA  . GLN B 1 184 ? 5.871   18.166  -57.956 1.00 52.05  ? 184  GLN B CA  1 
ATOM   5594 C C   . GLN B 1 184 ? 5.469   18.413  -59.400 1.00 55.61  ? 184  GLN B C   1 
ATOM   5595 O O   . GLN B 1 184 ? 4.945   19.480  -59.737 1.00 53.07  ? 184  GLN B O   1 
ATOM   5596 C CB  . GLN B 1 184 ? 7.341   18.552  -57.742 1.00 43.55  ? 184  GLN B CB  1 
ATOM   5597 C CG  . GLN B 1 184 ? 7.674   18.883  -56.321 1.00 44.84  ? 184  GLN B CG  1 
ATOM   5598 C CD  . GLN B 1 184 ? 7.020   20.180  -55.895 1.00 68.02  ? 184  GLN B CD  1 
ATOM   5599 O OE1 . GLN B 1 184 ? 7.277   21.237  -56.475 1.00 74.31  ? 184  GLN B OE1 1 
ATOM   5600 N NE2 . GLN B 1 184 ? 6.158   20.106  -54.889 1.00 69.75  ? 184  GLN B NE2 1 
ATOM   5601 N N   . GLU B 1 185 ? 5.732   17.423  -60.248 1.00 51.50  ? 185  GLU B N   1 
ATOM   5602 C CA  . GLU B 1 185 ? 5.569   17.586  -61.688 1.00 62.09  ? 185  GLU B CA  1 
ATOM   5603 C C   . GLU B 1 185 ? 4.149   17.273  -62.150 1.00 61.23  ? 185  GLU B C   1 
ATOM   5604 O O   . GLU B 1 185 ? 3.731   17.691  -63.231 1.00 70.92  ? 185  GLU B O   1 
ATOM   5605 C CB  . GLU B 1 185 ? 6.529   16.656  -62.440 1.00 70.49  ? 185  GLU B CB  1 
ATOM   5606 C CG  . GLU B 1 185 ? 8.008   16.869  -62.182 1.00 76.49  ? 185  GLU B CG  1 
ATOM   5607 C CD  . GLU B 1 185 ? 8.843   15.734  -62.757 1.00 78.14  ? 185  GLU B CD  1 
ATOM   5608 O OE1 . GLU B 1 185 ? 8.235   14.790  -63.303 1.00 79.93  ? 185  GLU B OE1 1 
ATOM   5609 O OE2 . GLU B 1 185 ? 10.091  15.778  -62.661 1.00 76.06  ? 185  GLU B OE2 1 
ATOM   5610 N N   . ASN B 1 186 ? 3.417   16.526  -61.332 1.00 50.96  ? 186  ASN B N   1 
ATOM   5611 C CA  . ASN B 1 186 ? 2.193   15.890  -61.785 1.00 45.63  ? 186  ASN B CA  1 
ATOM   5612 C C   . ASN B 1 186 ? 0.958   16.135  -60.926 1.00 46.41  ? 186  ASN B C   1 
ATOM   5613 O O   . ASN B 1 186 ? -0.160  16.142  -61.442 1.00 56.44  ? 186  ASN B O   1 
ATOM   5614 C CB  . ASN B 1 186 ? 2.434   14.385  -61.928 1.00 51.73  ? 186  ASN B CB  1 
ATOM   5615 C CG  . ASN B 1 186 ? 3.476   14.072  -62.974 1.00 52.37  ? 186  ASN B CG  1 
ATOM   5616 O OD1 . ASN B 1 186 ? 3.240   14.249  -64.170 1.00 52.91  ? 186  ASN B OD1 1 
ATOM   5617 N ND2 . ASN B 1 186 ? 4.642   13.628  -62.532 1.00 44.74  ? 186  ASN B ND2 1 
ATOM   5618 N N   . ILE B 1 187 ? 1.158   16.338  -59.626 1.00 45.98  ? 187  ILE B N   1 
ATOM   5619 C CA  . ILE B 1 187 ? 0.047   16.393  -58.678 1.00 37.60  ? 187  ILE B CA  1 
ATOM   5620 C C   . ILE B 1 187 ? -0.992  17.467  -59.020 1.00 47.40  ? 187  ILE B C   1 
ATOM   5621 O O   . ILE B 1 187 ? -2.190  17.254  -58.834 1.00 50.91  ? 187  ILE B O   1 
ATOM   5622 C CB  . ILE B 1 187 ? 0.540   16.568  -57.232 1.00 44.07  ? 187  ILE B CB  1 
ATOM   5623 C CG1 . ILE B 1 187 ? -0.350  15.775  -56.269 1.00 50.18  ? 187  ILE B CG1 1 
ATOM   5624 C CG2 . ILE B 1 187 ? 0.594   18.052  -56.848 1.00 34.94  ? 187  ILE B CG2 1 
ATOM   5625 C CD1 . ILE B 1 187 ? -0.831  14.433  -56.814 1.00 33.20  ? 187  ILE B CD1 1 
ATOM   5626 N N   . ALA B 1 188 ? -0.538  18.607  -59.533 1.00 40.21  ? 188  ALA B N   1 
ATOM   5627 C CA  . ALA B 1 188 ? -1.459  19.652  -59.959 1.00 44.11  ? 188  ALA B CA  1 
ATOM   5628 C C   . ALA B 1 188 ? -2.574  19.080  -60.819 1.00 49.13  ? 188  ALA B C   1 
ATOM   5629 O O   . ALA B 1 188 ? -3.696  19.579  -60.812 1.00 53.97  ? 188  ALA B O   1 
ATOM   5630 C CB  . ALA B 1 188 ? -0.725  20.725  -60.735 1.00 50.60  ? 188  ALA B CB  1 
ATOM   5631 N N   . ALA B 1 189 ? -2.263  18.042  -61.584 1.00 50.14  ? 189  ALA B N   1 
ATOM   5632 C CA  . ALA B 1 189 ? -3.238  17.533  -62.533 1.00 50.63  ? 189  ALA B CA  1 
ATOM   5633 C C   . ALA B 1 189 ? -4.407  16.932  -61.774 1.00 55.97  ? 189  ALA B C   1 
ATOM   5634 O O   . ALA B 1 189 ? -5.537  16.980  -62.230 1.00 65.50  ? 189  ALA B O   1 
ATOM   5635 C CB  . ALA B 1 189 ? -2.608  16.520  -63.462 1.00 44.58  ? 189  ALA B CB  1 
ATOM   5636 N N   . PHE B 1 190 ? -4.126  16.383  -60.599 1.00 57.33  ? 190  PHE B N   1 
ATOM   5637 C CA  . PHE B 1 190 ? -5.166  15.792  -59.768 1.00 60.54  ? 190  PHE B CA  1 
ATOM   5638 C C   . PHE B 1 190 ? -5.853  16.826  -58.881 1.00 68.24  ? 190  PHE B C   1 
ATOM   5639 O O   . PHE B 1 190 ? -6.689  16.473  -58.061 1.00 70.93  ? 190  PHE B O   1 
ATOM   5640 C CB  . PHE B 1 190 ? -4.570  14.702  -58.884 1.00 48.33  ? 190  PHE B CB  1 
ATOM   5641 C CG  . PHE B 1 190 ? -3.840  13.642  -59.648 1.00 59.31  ? 190  PHE B CG  1 
ATOM   5642 C CD1 . PHE B 1 190 ? -2.595  13.906  -60.208 1.00 58.40  ? 190  PHE B CD1 1 
ATOM   5643 C CD2 . PHE B 1 190 ? -4.387  12.377  -59.799 1.00 55.79  ? 190  PHE B CD2 1 
ATOM   5644 C CE1 . PHE B 1 190 ? -1.913  12.936  -60.910 1.00 49.84  ? 190  PHE B CE1 1 
ATOM   5645 C CE2 . PHE B 1 190 ? -3.711  11.398  -60.500 1.00 52.10  ? 190  PHE B CE2 1 
ATOM   5646 C CZ  . PHE B 1 190 ? -2.469  11.681  -61.058 1.00 55.93  ? 190  PHE B CZ  1 
ATOM   5647 N N   . GLY B 1 191 ? -5.484  18.094  -59.035 1.00 66.06  ? 191  GLY B N   1 
ATOM   5648 C CA  . GLY B 1 191 ? -6.019  19.146  -58.194 1.00 58.82  ? 191  GLY B CA  1 
ATOM   5649 C C   . GLY B 1 191 ? -5.158  19.491  -56.989 1.00 62.52  ? 191  GLY B C   1 
ATOM   5650 O O   . GLY B 1 191 ? -5.437  20.471  -56.293 1.00 68.04  ? 191  GLY B O   1 
ATOM   5651 N N   . GLY B 1 192 ? -4.115  18.697  -56.737 1.00 60.86  ? 192  GLY B N   1 
ATOM   5652 C CA  . GLY B 1 192 ? -3.201  18.931  -55.621 1.00 45.02  ? 192  GLY B CA  1 
ATOM   5653 C C   . GLY B 1 192 ? -2.294  20.146  -55.789 1.00 51.96  ? 192  GLY B C   1 
ATOM   5654 O O   . GLY B 1 192 ? -1.953  20.516  -56.910 1.00 64.30  ? 192  GLY B O   1 
ATOM   5655 N N   . ASP B 1 193 ? -1.901  20.762  -54.674 1.00 53.34  ? 193  ASP B N   1 
ATOM   5656 C CA  . ASP B 1 193 ? -1.102  21.995  -54.679 1.00 48.68  ? 193  ASP B CA  1 
ATOM   5657 C C   . ASP B 1 193 ? 0.386   21.700  -54.470 1.00 59.80  ? 193  ASP B C   1 
ATOM   5658 O O   . ASP B 1 193 ? 0.828   21.508  -53.329 1.00 65.31  ? 193  ASP B O   1 
ATOM   5659 C CB  . ASP B 1 193 ? -1.591  22.925  -53.571 1.00 43.22  ? 193  ASP B CB  1 
ATOM   5660 C CG  . ASP B 1 193 ? -1.058  24.348  -53.709 1.00 62.06  ? 193  ASP B CG  1 
ATOM   5661 O OD1 . ASP B 1 193 ? -0.219  24.596  -54.606 1.00 71.00  ? 193  ASP B OD1 1 
ATOM   5662 O OD2 . ASP B 1 193 ? -1.474  25.220  -52.906 1.00 51.85  ? 193  ASP B OD2 1 
ATOM   5663 N N   . PRO B 1 194 ? 1.168   21.662  -55.567 1.00 46.12  ? 194  PRO B N   1 
ATOM   5664 C CA  . PRO B 1 194 ? 2.591   21.342  -55.420 1.00 45.24  ? 194  PRO B CA  1 
ATOM   5665 C C   . PRO B 1 194 ? 3.276   22.309  -54.480 1.00 47.62  ? 194  PRO B C   1 
ATOM   5666 O O   . PRO B 1 194 ? 4.384   22.047  -54.037 1.00 57.92  ? 194  PRO B O   1 
ATOM   5667 C CB  . PRO B 1 194 ? 3.155   21.471  -56.847 1.00 39.18  ? 194  PRO B CB  1 
ATOM   5668 C CG  . PRO B 1 194 ? 2.064   22.065  -57.682 1.00 45.69  ? 194  PRO B CG  1 
ATOM   5669 C CD  . PRO B 1 194 ? 0.767   21.803  -56.975 1.00 44.42  ? 194  PRO B CD  1 
ATOM   5670 N N   . MET B 1 195 ? 2.605   23.405  -54.159 1.00 53.75  ? 195  MET B N   1 
ATOM   5671 C CA  . MET B 1 195 ? 3.178   24.401  -53.271 1.00 49.91  ? 195  MET B CA  1 
ATOM   5672 C C   . MET B 1 195 ? 2.816   24.221  -51.792 1.00 54.03  ? 195  MET B C   1 
ATOM   5673 O O   . MET B 1 195 ? 3.216   25.027  -50.948 1.00 55.63  ? 195  MET B O   1 
ATOM   5674 C CB  . MET B 1 195 ? 2.827   25.792  -53.754 1.00 47.43  ? 195  MET B CB  1 
ATOM   5675 C CG  . MET B 1 195 ? 3.606   26.223  -54.988 1.00 39.23  ? 195  MET B CG  1 
ATOM   5676 S SD  . MET B 1 195 ? 3.303   27.975  -55.226 1.00 93.10  ? 195  MET B SD  1 
ATOM   5677 C CE  . MET B 1 195 ? 2.955   28.480  -53.533 1.00 88.34  ? 195  MET B CE  1 
ATOM   5678 N N   . SER B 1 196 ? 2.098   23.141  -51.490 1.00 46.85  ? 196  SER B N   1 
ATOM   5679 C CA  . SER B 1 196 ? 1.753   22.779  -50.118 1.00 43.04  ? 196  SER B CA  1 
ATOM   5680 C C   . SER B 1 196 ? 1.810   21.251  -49.941 1.00 52.11  ? 196  SER B C   1 
ATOM   5681 O O   . SER B 1 196 ? 0.786   20.552  -49.967 1.00 41.15  ? 196  SER B O   1 
ATOM   5682 C CB  . SER B 1 196 ? 0.360   23.304  -49.761 1.00 38.21  ? 196  SER B CB  1 
ATOM   5683 O OG  . SER B 1 196 ? 0.115   23.266  -48.364 1.00 41.72  ? 196  SER B OG  1 
ATOM   5684 N N   . VAL B 1 197 ? 3.016   20.736  -49.752 1.00 49.12  ? 197  VAL B N   1 
ATOM   5685 C CA  . VAL B 1 197 ? 3.209   19.301  -49.621 1.00 27.44  ? 197  VAL B CA  1 
ATOM   5686 C C   . VAL B 1 197 ? 3.766   18.954  -48.250 1.00 33.88  ? 197  VAL B C   1 
ATOM   5687 O O   . VAL B 1 197 ? 4.922   19.238  -47.945 1.00 45.67  ? 197  VAL B O   1 
ATOM   5688 C CB  . VAL B 1 197 ? 4.159   18.772  -50.728 1.00 31.89  ? 197  VAL B CB  1 
ATOM   5689 C CG1 . VAL B 1 197 ? 4.535   17.300  -50.492 1.00 29.46  ? 197  VAL B CG1 1 
ATOM   5690 C CG2 . VAL B 1 197 ? 3.522   18.961  -52.097 1.00 28.98  ? 197  VAL B CG2 1 
ATOM   5691 N N   . THR B 1 198 ? 2.928   18.365  -47.414 1.00 28.95  ? 198  THR B N   1 
ATOM   5692 C CA  . THR B 1 198 ? 3.375   17.821  -46.146 1.00 36.19  ? 198  THR B CA  1 
ATOM   5693 C C   . THR B 1 198 ? 3.763   16.339  -46.270 1.00 40.26  ? 198  THR B C   1 
ATOM   5694 O O   . THR B 1 198 ? 3.000   15.541  -46.814 1.00 32.83  ? 198  THR B O   1 
ATOM   5695 C CB  . THR B 1 198 ? 2.255   17.892  -45.128 1.00 42.72  ? 198  THR B CB  1 
ATOM   5696 O OG1 . THR B 1 198 ? 1.845   19.254  -44.967 1.00 58.39  ? 198  THR B OG1 1 
ATOM   5697 C CG2 . THR B 1 198 ? 2.726   17.315  -43.793 1.00 41.49  ? 198  THR B CG2 1 
ATOM   5698 N N   . LEU B 1 199 ? 4.939   15.972  -45.765 1.00 34.81  ? 199  LEU B N   1 
ATOM   5699 C CA  . LEU B 1 199 ? 5.295   14.551  -45.622 1.00 38.17  ? 199  LEU B CA  1 
ATOM   5700 C C   . LEU B 1 199 ? 4.916   13.997  -44.251 1.00 41.81  ? 199  LEU B C   1 
ATOM   5701 O O   . LEU B 1 199 ? 5.189   14.624  -43.223 1.00 49.49  ? 199  LEU B O   1 
ATOM   5702 C CB  . LEU B 1 199 ? 6.790   14.334  -45.791 1.00 28.46  ? 199  LEU B CB  1 
ATOM   5703 C CG  . LEU B 1 199 ? 7.559   14.903  -46.981 1.00 39.54  ? 199  LEU B CG  1 
ATOM   5704 C CD1 . LEU B 1 199 ? 9.045   14.566  -46.775 1.00 22.49  ? 199  LEU B CD1 1 
ATOM   5705 C CD2 . LEU B 1 199 ? 7.013   14.366  -48.309 1.00 33.38  ? 199  LEU B CD2 1 
ATOM   5706 N N   . PHE B 1 200 ? 4.303   12.820  -44.217 1.00 32.50  ? 200  PHE B N   1 
ATOM   5707 C CA  . PHE B 1 200 ? 4.219   12.127  -42.937 1.00 41.47  ? 200  PHE B CA  1 
ATOM   5708 C C   . PHE B 1 200 ? 4.609   10.651  -43.001 1.00 45.29  ? 200  PHE B C   1 
ATOM   5709 O O   . PHE B 1 200 ? 4.485   10.010  -44.040 1.00 46.86  ? 200  PHE B O   1 
ATOM   5710 C CB  . PHE B 1 200 ? 2.865   12.328  -42.253 1.00 35.61  ? 200  PHE B CB  1 
ATOM   5711 C CG  . PHE B 1 200 ? 1.690   11.728  -42.988 1.00 28.79  ? 200  PHE B CG  1 
ATOM   5712 C CD1 . PHE B 1 200 ? 1.598   11.792  -44.358 1.00 22.81  ? 200  PHE B CD1 1 
ATOM   5713 C CD2 . PHE B 1 200 ? 0.642   11.154  -42.279 1.00 23.65  ? 200  PHE B CD2 1 
ATOM   5714 C CE1 . PHE B 1 200 ? 0.487   11.262  -45.020 1.00 23.69  ? 200  PHE B CE1 1 
ATOM   5715 C CE2 . PHE B 1 200 ? -0.458  10.634  -42.916 1.00 24.60  ? 200  PHE B CE2 1 
ATOM   5716 C CZ  . PHE B 1 200 ? -0.537  10.676  -44.299 1.00 31.59  ? 200  PHE B CZ  1 
ATOM   5717 N N   . GLY B 1 201 ? 5.086   10.128  -41.879 1.00 34.34  ? 201  GLY B N   1 
ATOM   5718 C CA  . GLY B 1 201 ? 5.520   8.752   -41.813 1.00 37.26  ? 201  GLY B CA  1 
ATOM   5719 C C   . GLY B 1 201 ? 5.723   8.254   -40.407 1.00 39.94  ? 201  GLY B C   1 
ATOM   5720 O O   . GLY B 1 201 ? 5.889   9.049   -39.479 1.00 39.46  ? 201  GLY B O   1 
ATOM   5721 N N   . GLU B 1 202 ? 5.708   6.931   -40.251 1.00 42.83  ? 202  GLU B N   1 
ATOM   5722 C CA  . GLU B 1 202 ? 5.926   6.310   -38.949 1.00 40.95  ? 202  GLU B CA  1 
ATOM   5723 C C   . GLU B 1 202 ? 7.025   5.222   -38.933 1.00 51.71  ? 202  GLU B C   1 
ATOM   5724 O O   . GLU B 1 202 ? 7.331   4.624   -39.962 1.00 52.62  ? 202  GLU B O   1 
ATOM   5725 C CB  . GLU B 1 202 ? 4.613   5.790   -38.416 1.00 25.31  ? 202  GLU B CB  1 
ATOM   5726 C CG  . GLU B 1 202 ? 4.703   5.131   -37.050 1.00 50.94  ? 202  GLU B CG  1 
ATOM   5727 C CD  . GLU B 1 202 ? 4.921   3.632   -37.154 1.00 56.83  ? 202  GLU B CD  1 
ATOM   5728 O OE1 . GLU B 1 202 ? 5.083   3.140   -38.294 1.00 44.67  ? 202  GLU B OE1 1 
ATOM   5729 O OE2 . GLU B 1 202 ? 4.937   2.953   -36.101 1.00 59.56  ? 202  GLU B OE2 1 
ATOM   5730 N N   . SER B 1 203 ? 7.618   4.990   -37.761 1.00 48.49  ? 203  SER B N   1 
ATOM   5731 C CA  . SER B 1 203 ? 8.750   4.079   -37.614 1.00 44.67  ? 203  SER B CA  1 
ATOM   5732 C C   . SER B 1 203 ? 9.811   4.438   -38.661 1.00 50.87  ? 203  SER B C   1 
ATOM   5733 O O   . SER B 1 203 ? 10.269  5.585   -38.697 1.00 40.46  ? 203  SER B O   1 
ATOM   5734 C CB  . SER B 1 203 ? 8.301   2.621   -37.731 1.00 55.57  ? 203  SER B CB  1 
ATOM   5735 O OG  . SER B 1 203 ? 9.350   1.721   -37.424 1.00 64.22  ? 203  SER B OG  1 
ATOM   5736 N N   . ALA B 1 204 ? 10.201  3.485   -39.515 1.00 48.16  ? 204  ALA B N   1 
ATOM   5737 C CA  . ALA B 1 204 ? 11.226  3.779   -40.522 1.00 45.59  ? 204  ALA B CA  1 
ATOM   5738 C C   . ALA B 1 204 ? 10.813  4.977   -41.365 1.00 48.43  ? 204  ALA B C   1 
ATOM   5739 O O   . ALA B 1 204 ? 11.654  5.792   -41.759 1.00 42.61  ? 204  ALA B O   1 
ATOM   5740 C CB  . ALA B 1 204 ? 11.522  2.577   -41.404 1.00 32.25  ? 204  ALA B CB  1 
ATOM   5741 N N   . GLY B 1 205 ? 9.510   5.081   -41.618 1.00 48.78  ? 205  GLY B N   1 
ATOM   5742 C CA  . GLY B 1 205 ? 8.932   6.208   -42.335 1.00 51.87  ? 205  GLY B CA  1 
ATOM   5743 C C   . GLY B 1 205 ? 9.194   7.582   -41.742 1.00 47.19  ? 205  GLY B C   1 
ATOM   5744 O O   . GLY B 1 205 ? 9.570   8.511   -42.468 1.00 41.17  ? 205  GLY B O   1 
ATOM   5745 N N   . ALA B 1 206 ? 9.004   7.717   -40.430 1.00 46.42  ? 206  ALA B N   1 
ATOM   5746 C CA  . ALA B 1 206 ? 9.289   8.981   -39.750 1.00 40.48  ? 206  ALA B CA  1 
ATOM   5747 C C   . ALA B 1 206 ? 10.744  9.369   -39.956 1.00 33.60  ? 206  ALA B C   1 
ATOM   5748 O O   . ALA B 1 206 ? 11.068  10.536  -40.158 1.00 42.34  ? 206  ALA B O   1 
ATOM   5749 C CB  . ALA B 1 206 ? 8.957   8.890   -38.264 1.00 41.63  ? 206  ALA B CB  1 
ATOM   5750 N N   . ALA B 1 207 ? 11.624  8.378   -39.916 1.00 33.97  ? 207  ALA B N   1 
ATOM   5751 C CA  . ALA B 1 207 ? 13.052  8.614   -40.126 1.00 29.18  ? 207  ALA B CA  1 
ATOM   5752 C C   . ALA B 1 207 ? 13.411  9.046   -41.554 1.00 32.85  ? 207  ALA B C   1 
ATOM   5753 O O   . ALA B 1 207 ? 14.348  9.820   -41.764 1.00 37.21  ? 207  ALA B O   1 
ATOM   5754 C CB  . ALA B 1 207 ? 13.832  7.388   -39.745 1.00 38.23  ? 207  ALA B CB  1 
ATOM   5755 N N   . SER B 1 208 ? 12.683  8.535   -42.542 1.00 43.06  ? 208  SER B N   1 
ATOM   5756 C CA  . SER B 1 208 ? 12.922  8.962   -43.919 1.00 34.26  ? 208  SER B CA  1 
ATOM   5757 C C   . SER B 1 208 ? 12.537  10.430  -44.020 1.00 37.48  ? 208  SER B C   1 
ATOM   5758 O O   . SER B 1 208 ? 13.342  11.259  -44.435 1.00 41.48  ? 208  SER B O   1 
ATOM   5759 C CB  . SER B 1 208 ? 12.141  8.108   -44.907 1.00 31.11  ? 208  SER B CB  1 
ATOM   5760 O OG  . SER B 1 208 ? 12.450  6.740   -44.714 1.00 47.65  ? 208  SER B OG  1 
ATOM   5761 N N   . VAL B 1 209 ? 11.319  10.757  -43.606 1.00 30.02  ? 209  VAL B N   1 
ATOM   5762 C CA  . VAL B 1 209 ? 10.938  12.160  -43.467 1.00 28.19  ? 209  VAL B CA  1 
ATOM   5763 C C   . VAL B 1 209 ? 12.092  12.995  -42.897 1.00 35.82  ? 209  VAL B C   1 
ATOM   5764 O O   . VAL B 1 209 ? 12.577  13.947  -43.545 1.00 41.83  ? 209  VAL B O   1 
ATOM   5765 C CB  . VAL B 1 209 ? 9.662   12.316  -42.628 1.00 28.03  ? 209  VAL B CB  1 
ATOM   5766 C CG1 . VAL B 1 209 ? 9.329   13.766  -42.462 1.00 33.85  ? 209  VAL B CG1 1 
ATOM   5767 C CG2 . VAL B 1 209 ? 8.515   11.577  -43.306 1.00 20.99  ? 209  VAL B CG2 1 
ATOM   5768 N N   . GLY B 1 210 ? 12.564  12.616  -41.712 1.00 33.99  ? 210  GLY B N   1 
ATOM   5769 C CA  . GLY B 1 210 ? 13.719  13.274  -41.109 1.00 36.59  ? 210  GLY B CA  1 
ATOM   5770 C C   . GLY B 1 210 ? 14.930  13.369  -42.018 1.00 41.09  ? 210  GLY B C   1 
ATOM   5771 O O   . GLY B 1 210 ? 15.646  14.379  -42.048 1.00 44.12  ? 210  GLY B O   1 
ATOM   5772 N N   . MET B 1 211 ? 15.165  12.307  -42.775 1.00 34.07  ? 211  MET B N   1 
ATOM   5773 C CA  . MET B 1 211 ? 16.323  12.280  -43.655 1.00 36.78  ? 211  MET B CA  1 
ATOM   5774 C C   . MET B 1 211 ? 16.142  13.171  -44.867 1.00 31.86  ? 211  MET B C   1 
ATOM   5775 O O   . MET B 1 211 ? 17.111  13.646  -45.424 1.00 35.09  ? 211  MET B O   1 
ATOM   5776 C CB  . MET B 1 211 ? 16.654  10.846  -44.069 1.00 39.70  ? 211  MET B CB  1 
ATOM   5777 C CG  . MET B 1 211 ? 17.636  10.190  -43.121 1.00 43.47  ? 211  MET B CG  1 
ATOM   5778 S SD  . MET B 1 211 ? 17.505  8.397   -43.193 1.00 54.83  ? 211  MET B SD  1 
ATOM   5779 C CE  . MET B 1 211 ? 18.270  7.952   -41.647 1.00 36.41  ? 211  MET B CE  1 
ATOM   5780 N N   . HIS B 1 212 ? 14.900  13.388  -45.281 1.00 44.39  ? 212  HIS B N   1 
ATOM   5781 C CA  . HIS B 1 212 ? 14.606  14.359  -46.334 1.00 47.19  ? 212  HIS B CA  1 
ATOM   5782 C C   . HIS B 1 212 ? 14.790  15.783  -45.806 1.00 46.33  ? 212  HIS B C   1 
ATOM   5783 O O   . HIS B 1 212 ? 15.318  16.659  -46.487 1.00 55.44  ? 212  HIS B O   1 
ATOM   5784 C CB  . HIS B 1 212 ? 13.190  14.134  -46.888 1.00 43.85  ? 212  HIS B CB  1 
ATOM   5785 C CG  . HIS B 1 212 ? 13.035  12.841  -47.643 1.00 43.34  ? 212  HIS B CG  1 
ATOM   5786 N ND1 . HIS B 1 212 ? 13.555  12.642  -48.909 1.00 30.67  ? 212  HIS B ND1 1 
ATOM   5787 C CD2 . HIS B 1 212 ? 12.422  11.680  -47.306 1.00 42.05  ? 212  HIS B CD2 1 
ATOM   5788 C CE1 . HIS B 1 212 ? 13.268  11.417  -49.313 1.00 41.12  ? 212  HIS B CE1 1 
ATOM   5789 N NE2 . HIS B 1 212 ? 12.581  10.811  -48.360 1.00 36.29  ? 212  HIS B NE2 1 
ATOM   5790 N N   . ILE B 1 213 ? 14.372  16.005  -44.571 1.00 46.20  ? 213  ILE B N   1 
ATOM   5791 C CA  . ILE B 1 213 ? 14.600  17.288  -43.937 1.00 43.98  ? 213  ILE B CA  1 
ATOM   5792 C C   . ILE B 1 213 ? 16.079  17.599  -43.988 1.00 49.97  ? 213  ILE B C   1 
ATOM   5793 O O   . ILE B 1 213 ? 16.485  18.742  -44.216 1.00 58.68  ? 213  ILE B O   1 
ATOM   5794 C CB  . ILE B 1 213 ? 14.202  17.225  -42.469 1.00 41.48  ? 213  ILE B CB  1 
ATOM   5795 C CG1 . ILE B 1 213 ? 12.699  16.972  -42.348 1.00 40.29  ? 213  ILE B CG1 1 
ATOM   5796 C CG2 . ILE B 1 213 ? 14.603  18.490  -41.768 1.00 34.35  ? 213  ILE B CG2 1 
ATOM   5797 C CD1 . ILE B 1 213 ? 12.226  16.795  -40.937 1.00 34.86  ? 213  ILE B CD1 1 
ATOM   5798 N N   . LEU B 1 214 ? 16.877  16.555  -43.782 1.00 45.60  ? 214  LEU B N   1 
ATOM   5799 C CA  . LEU B 1 214 ? 18.321  16.688  -43.590 1.00 35.64  ? 214  LEU B CA  1 
ATOM   5800 C C   . LEU B 1 214 ? 19.129  16.556  -44.864 1.00 40.26  ? 214  LEU B C   1 
ATOM   5801 O O   . LEU B 1 214 ? 20.356  16.660  -44.821 1.00 57.36  ? 214  LEU B O   1 
ATOM   5802 C CB  . LEU B 1 214 ? 18.840  15.667  -42.569 1.00 32.97  ? 214  LEU B CB  1 
ATOM   5803 C CG  . LEU B 1 214 ? 18.257  15.821  -41.167 1.00 39.02  ? 214  LEU B CG  1 
ATOM   5804 C CD1 . LEU B 1 214 ? 18.827  14.788  -40.224 1.00 30.80  ? 214  LEU B CD1 1 
ATOM   5805 C CD2 . LEU B 1 214 ? 18.524  17.244  -40.664 1.00 31.84  ? 214  LEU B CD2 1 
ATOM   5806 N N   . SER B 1 215 ? 18.467  16.329  -45.996 1.00 38.10  ? 215  SER B N   1 
ATOM   5807 C CA  . SER B 1 215 ? 19.192  16.238  -47.267 1.00 42.44  ? 215  SER B CA  1 
ATOM   5808 C C   . SER B 1 215 ? 18.765  17.323  -48.231 1.00 55.02  ? 215  SER B C   1 
ATOM   5809 O O   . SER B 1 215 ? 17.615  17.346  -48.671 1.00 49.91  ? 215  SER B O   1 
ATOM   5810 C CB  . SER B 1 215 ? 19.024  14.871  -47.925 1.00 40.80  ? 215  SER B CB  1 
ATOM   5811 O OG  . SER B 1 215 ? 19.797  14.794  -49.112 1.00 52.36  ? 215  SER B OG  1 
ATOM   5812 N N   . LEU B 1 216 ? 19.707  18.204  -48.569 1.00 55.33  ? 216  LEU B N   1 
ATOM   5813 C CA  . LEU B 1 216 ? 19.390  19.414  -49.316 1.00 53.94  ? 216  LEU B CA  1 
ATOM   5814 C C   . LEU B 1 216 ? 18.611  19.178  -50.605 1.00 53.26  ? 216  LEU B C   1 
ATOM   5815 O O   . LEU B 1 216 ? 17.654  19.889  -50.892 1.00 56.94  ? 216  LEU B O   1 
ATOM   5816 C CB  . LEU B 1 216 ? 20.650  20.216  -49.621 1.00 65.65  ? 216  LEU B CB  1 
ATOM   5817 C CG  . LEU B 1 216 ? 20.293  21.394  -50.532 1.00 68.87  ? 216  LEU B CG  1 
ATOM   5818 C CD1 . LEU B 1 216 ? 19.475  22.435  -49.762 1.00 60.36  ? 216  LEU B CD1 1 
ATOM   5819 C CD2 . LEU B 1 216 ? 21.523  22.011  -51.198 1.00 67.53  ? 216  LEU B CD2 1 
ATOM   5820 N N   . PRO B 1 217 ? 19.027  18.190  -51.402 1.00 61.23  ? 217  PRO B N   1 
ATOM   5821 C CA  . PRO B 1 217 ? 18.275  17.890  -52.626 1.00 54.93  ? 217  PRO B CA  1 
ATOM   5822 C C   . PRO B 1 217 ? 16.772  17.702  -52.400 1.00 53.53  ? 217  PRO B C   1 
ATOM   5823 O O   . PRO B 1 217 ? 16.012  17.942  -53.335 1.00 56.47  ? 217  PRO B O   1 
ATOM   5824 C CB  . PRO B 1 217 ? 18.910  16.589  -53.116 1.00 47.36  ? 217  PRO B CB  1 
ATOM   5825 C CG  . PRO B 1 217 ? 20.286  16.647  -52.629 1.00 40.65  ? 217  PRO B CG  1 
ATOM   5826 C CD  . PRO B 1 217 ? 20.250  17.379  -51.296 1.00 61.33  ? 217  PRO B CD  1 
ATOM   5827 N N   . SER B 1 218 ? 16.349  17.317  -51.195 1.00 46.29  ? 218  SER B N   1 
ATOM   5828 C CA  . SER B 1 218 ? 14.917  17.129  -50.915 1.00 31.28  ? 218  SER B CA  1 
ATOM   5829 C C   . SER B 1 218 ? 14.160  18.359  -50.405 1.00 48.81  ? 218  SER B C   1 
ATOM   5830 O O   . SER B 1 218 ? 12.949  18.427  -50.553 1.00 48.63  ? 218  SER B O   1 
ATOM   5831 C CB  . SER B 1 218 ? 14.673  15.970  -49.927 1.00 33.45  ? 218  SER B CB  1 
ATOM   5832 O OG  . SER B 1 218 ? 15.037  14.699  -50.450 1.00 41.03  ? 218  SER B OG  1 
ATOM   5833 N N   A ARG B 1 219 ? 14.865  19.311  -49.799 0.61 61.95  ? 219  ARG B N   1 
ATOM   5834 N N   B ARG B 1 219 ? 14.864  19.321  -49.814 0.39 61.70  ? 219  ARG B N   1 
ATOM   5835 C CA  A ARG B 1 219 ? 14.198  20.426  -49.119 0.61 67.76  ? 219  ARG B CA  1 
ATOM   5836 C CA  B ARG B 1 219 ? 14.193  20.429  -49.128 0.39 66.65  ? 219  ARG B CA  1 
ATOM   5837 C C   A ARG B 1 219 ? 13.375  21.319  -50.064 0.61 64.96  ? 219  ARG B C   1 
ATOM   5838 C C   B ARG B 1 219 ? 13.397  21.340  -50.070 0.39 65.05  ? 219  ARG B C   1 
ATOM   5839 O O   A ARG B 1 219 ? 12.699  22.246  -49.617 0.61 71.23  ? 219  ARG B O   1 
ATOM   5840 O O   B ARG B 1 219 ? 12.770  22.304  -49.630 0.39 70.50  ? 219  ARG B O   1 
ATOM   5841 C CB  A ARG B 1 219 ? 15.184  21.254  -48.257 0.61 71.37  ? 219  ARG B CB  1 
ATOM   5842 C CB  B ARG B 1 219 ? 15.180  21.244  -48.274 0.39 70.39  ? 219  ARG B CB  1 
ATOM   5843 C CG  A ARG B 1 219 ? 15.520  20.652  -46.856 0.61 61.03  ? 219  ARG B CG  1 
ATOM   5844 C CG  B ARG B 1 219 ? 14.512  22.161  -47.230 0.39 70.76  ? 219  ARG B CG  1 
ATOM   5845 C CD  A ARG B 1 219 ? 14.358  20.750  -45.814 0.61 62.28  ? 219  ARG B CD  1 
ATOM   5846 C CD  B ARG B 1 219 ? 13.866  21.387  -46.057 0.39 59.75  ? 219  ARG B CD  1 
ATOM   5847 N NE  A ARG B 1 219 ? 14.322  22.008  -45.054 0.61 48.41  ? 219  ARG B NE  1 
ATOM   5848 N NE  B ARG B 1 219 ? 12.427  21.632  -45.941 0.39 48.39  ? 219  ARG B NE  1 
ATOM   5849 C CZ  A ARG B 1 219 ? 15.045  22.250  -43.963 0.61 45.10  ? 219  ARG B CZ  1 
ATOM   5850 C CZ  B ARG B 1 219 ? 11.894  22.792  -45.562 0.39 49.88  ? 219  ARG B CZ  1 
ATOM   5851 N NH1 A ARG B 1 219 ? 15.867  21.314  -43.506 0.61 39.67  ? 219  ARG B NH1 1 
ATOM   5852 N NH1 B ARG B 1 219 ? 12.671  23.826  -45.265 0.39 46.19  ? 219  ARG B NH1 1 
ATOM   5853 N NH2 A ARG B 1 219 ? 14.957  23.425  -43.330 0.61 38.45  ? 219  ARG B NH2 1 
ATOM   5854 N NH2 B ARG B 1 219 ? 10.580  22.926  -45.488 0.39 44.53  ? 219  ARG B NH2 1 
ATOM   5855 N N   . SER B 1 220 ? 13.408  21.027  -51.359 1.00 49.65  ? 220  SER B N   1 
ATOM   5856 C CA  . SER B 1 220 ? 12.603  21.783  -52.314 1.00 45.83  ? 220  SER B CA  1 
ATOM   5857 C C   . SER B 1 220 ? 11.370  21.020  -52.819 1.00 53.60  ? 220  SER B C   1 
ATOM   5858 O O   . SER B 1 220 ? 10.589  21.550  -53.613 1.00 56.98  ? 220  SER B O   1 
ATOM   5859 C CB  . SER B 1 220 ? 13.450  22.294  -53.488 1.00 48.22  ? 220  SER B CB  1 
ATOM   5860 O OG  . SER B 1 220 ? 13.685  21.282  -54.442 1.00 56.36  ? 220  SER B OG  1 
ATOM   5861 N N   . LEU B 1 221 ? 11.191  19.791  -52.340 1.00 43.28  ? 221  LEU B N   1 
ATOM   5862 C CA  . LEU B 1 221 ? 10.044  18.960  -52.707 1.00 47.22  ? 221  LEU B CA  1 
ATOM   5863 C C   . LEU B 1 221 ? 8.918   18.953  -51.655 1.00 51.86  ? 221  LEU B C   1 
ATOM   5864 O O   . LEU B 1 221 ? 7.835   18.426  -51.911 1.00 59.81  ? 221  LEU B O   1 
ATOM   5865 C CB  . LEU B 1 221 ? 10.499  17.517  -52.974 1.00 41.07  ? 221  LEU B CB  1 
ATOM   5866 C CG  . LEU B 1 221 ? 11.795  17.448  -53.780 1.00 52.00  ? 221  LEU B CG  1 
ATOM   5867 C CD1 . LEU B 1 221 ? 12.228  15.999  -54.027 1.00 49.74  ? 221  LEU B CD1 1 
ATOM   5868 C CD2 . LEU B 1 221 ? 11.653  18.237  -55.082 1.00 44.74  ? 221  LEU B CD2 1 
ATOM   5869 N N   . PHE B 1 222 ? 9.167   19.515  -50.475 1.00 46.33  ? 222  PHE B N   1 
ATOM   5870 C CA  . PHE B 1 222 ? 8.111   19.602  -49.466 1.00 48.32  ? 222  PHE B CA  1 
ATOM   5871 C C   . PHE B 1 222 ? 8.234   20.839  -48.575 1.00 38.23  ? 222  PHE B C   1 
ATOM   5872 O O   . PHE B 1 222 ? 9.259   21.501  -48.566 1.00 49.40  ? 222  PHE B O   1 
ATOM   5873 C CB  . PHE B 1 222 ? 8.040   18.320  -48.630 1.00 30.30  ? 222  PHE B CB  1 
ATOM   5874 C CG  . PHE B 1 222 ? 9.252   18.074  -47.807 1.00 29.44  ? 222  PHE B CG  1 
ATOM   5875 C CD1 . PHE B 1 222 ? 10.442  17.694  -48.407 1.00 29.36  ? 222  PHE B CD1 1 
ATOM   5876 C CD2 . PHE B 1 222 ? 9.210   18.208  -46.429 1.00 39.27  ? 222  PHE B CD2 1 
ATOM   5877 C CE1 . PHE B 1 222 ? 11.572  17.438  -47.652 1.00 27.02  ? 222  PHE B CE1 1 
ATOM   5878 C CE2 . PHE B 1 222 ? 10.335  17.972  -45.661 1.00 37.78  ? 222  PHE B CE2 1 
ATOM   5879 C CZ  . PHE B 1 222 ? 11.521  17.581  -46.275 1.00 39.54  ? 222  PHE B CZ  1 
ATOM   5880 N N   . HIS B 1 223 ? 7.181   21.126  -47.814 1.00 45.13  ? 223  HIS B N   1 
ATOM   5881 C CA  . HIS B 1 223 ? 7.120   22.333  -46.985 1.00 40.57  ? 223  HIS B CA  1 
ATOM   5882 C C   . HIS B 1 223 ? 6.863   22.047  -45.502 1.00 46.98  ? 223  HIS B C   1 
ATOM   5883 O O   . HIS B 1 223 ? 7.020   22.938  -44.664 1.00 56.54  ? 223  HIS B O   1 
ATOM   5884 C CB  . HIS B 1 223 ? 6.048   23.274  -47.533 1.00 37.40  ? 223  HIS B CB  1 
ATOM   5885 C CG  . HIS B 1 223 ? 5.930   23.233  -49.024 1.00 55.50  ? 223  HIS B CG  1 
ATOM   5886 N ND1 . HIS B 1 223 ? 5.176   22.283  -49.683 1.00 66.10  ? 223  HIS B ND1 1 
ATOM   5887 C CD2 . HIS B 1 223 ? 6.499   23.996  -49.988 1.00 48.84  ? 223  HIS B CD2 1 
ATOM   5888 C CE1 . HIS B 1 223 ? 5.275   22.471  -50.987 1.00 57.51  ? 223  HIS B CE1 1 
ATOM   5889 N NE2 . HIS B 1 223 ? 6.072   23.503  -51.198 1.00 51.05  ? 223  HIS B NE2 1 
ATOM   5890 N N   . ARG B 1 224 ? 6.487   20.806  -45.179 1.00 34.88  ? 224  ARG B N   1 
ATOM   5891 C CA  . ARG B 1 224 ? 6.133   20.438  -43.809 1.00 33.45  ? 224  ARG B CA  1 
ATOM   5892 C C   . ARG B 1 224 ? 6.391   18.952  -43.558 1.00 44.57  ? 224  ARG B C   1 
ATOM   5893 O O   . ARG B 1 224 ? 6.404   18.138  -44.495 1.00 38.91  ? 224  ARG B O   1 
ATOM   5894 C CB  . ARG B 1 224 ? 4.660   20.774  -43.540 1.00 36.05  ? 224  ARG B CB  1 
ATOM   5895 C CG  . ARG B 1 224 ? 4.463   22.119  -42.893 1.00 54.87  ? 224  ARG B CG  1 
ATOM   5896 C CD  . ARG B 1 224 ? 3.016   22.581  -42.950 1.00 57.89  ? 224  ARG B CD  1 
ATOM   5897 N NE  . ARG B 1 224 ? 2.534   22.759  -44.319 1.00 65.10  ? 224  ARG B NE  1 
ATOM   5898 C CZ  . ARG B 1 224 ? 2.791   23.824  -45.073 1.00 61.47  ? 224  ARG B CZ  1 
ATOM   5899 N NH1 . ARG B 1 224 ? 3.544   24.810  -44.606 1.00 59.66  ? 224  ARG B NH1 1 
ATOM   5900 N NH2 . ARG B 1 224 ? 2.301   23.899  -46.303 1.00 60.02  ? 224  ARG B NH2 1 
ATOM   5901 N N   . ALA B 1 225 ? 6.579   18.583  -42.297 1.00 38.20  ? 225  ALA B N   1 
ATOM   5902 C CA  . ALA B 1 225 ? 6.819   17.182  -42.003 1.00 34.51  ? 225  ALA B CA  1 
ATOM   5903 C C   . ALA B 1 225 ? 6.129   16.717  -40.747 1.00 39.06  ? 225  ALA B C   1 
ATOM   5904 O O   . ALA B 1 225 ? 5.902   17.487  -39.821 1.00 43.46  ? 225  ALA B O   1 
ATOM   5905 C CB  . ALA B 1 225 ? 8.300   16.916  -41.908 1.00 47.44  ? 225  ALA B CB  1 
ATOM   5906 N N   . VAL B 1 226 ? 5.796   15.439  -40.734 1.00 34.44  ? 226  VAL B N   1 
ATOM   5907 C CA  . VAL B 1 226 ? 5.263   14.801  -39.554 1.00 32.01  ? 226  VAL B CA  1 
ATOM   5908 C C   . VAL B 1 226 ? 6.037   13.517  -39.392 1.00 41.81  ? 226  VAL B C   1 
ATOM   5909 O O   . VAL B 1 226 ? 6.093   12.684  -40.303 1.00 37.94  ? 226  VAL B O   1 
ATOM   5910 C CB  . VAL B 1 226 ? 3.776   14.435  -39.705 1.00 34.17  ? 226  VAL B CB  1 
ATOM   5911 C CG1 . VAL B 1 226 ? 3.220   13.961  -38.371 1.00 43.30  ? 226  VAL B CG1 1 
ATOM   5912 C CG2 . VAL B 1 226 ? 2.985   15.602  -40.227 1.00 40.90  ? 226  VAL B CG2 1 
ATOM   5913 N N   . LEU B 1 227 ? 6.626   13.353  -38.221 1.00 41.50  ? 227  LEU B N   1 
ATOM   5914 C CA  . LEU B 1 227 ? 7.413   12.176  -37.938 1.00 33.16  ? 227  LEU B CA  1 
ATOM   5915 C C   . LEU B 1 227 ? 6.758   11.442  -36.781 1.00 43.71  ? 227  LEU B C   1 
ATOM   5916 O O   . LEU B 1 227 ? 6.769   11.915  -35.639 1.00 36.95  ? 227  LEU B O   1 
ATOM   5917 C CB  . LEU B 1 227 ? 8.836   12.579  -37.557 1.00 40.75  ? 227  LEU B CB  1 
ATOM   5918 C CG  . LEU B 1 227 ? 9.694   13.379  -38.547 1.00 41.06  ? 227  LEU B CG  1 
ATOM   5919 C CD1 . LEU B 1 227 ? 9.195   14.807  -38.731 1.00 40.83  ? 227  LEU B CD1 1 
ATOM   5920 C CD2 . LEU B 1 227 ? 11.122  13.407  -38.063 1.00 39.48  ? 227  LEU B CD2 1 
ATOM   5921 N N   . GLN B 1 228 ? 6.194   10.276  -37.064 1.00 43.68  ? 228  GLN B N   1 
ATOM   5922 C CA  . GLN B 1 228 ? 5.511   9.539   -36.023 1.00 41.96  ? 228  GLN B CA  1 
ATOM   5923 C C   . GLN B 1 228 ? 6.330   8.346   -35.562 1.00 45.60  ? 228  GLN B C   1 
ATOM   5924 O O   . GLN B 1 228 ? 6.557   7.411   -36.326 1.00 45.42  ? 228  GLN B O   1 
ATOM   5925 C CB  . GLN B 1 228 ? 4.155   9.070   -36.529 1.00 43.24  ? 228  GLN B CB  1 
ATOM   5926 C CG  . GLN B 1 228 ? 3.280   10.188  -37.054 1.00 41.38  ? 228  GLN B CG  1 
ATOM   5927 C CD  . GLN B 1 228 ? 2.072   9.663   -37.808 1.00 47.32  ? 228  GLN B CD  1 
ATOM   5928 O OE1 . GLN B 1 228 ? 1.540   10.337  -38.694 1.00 44.02  ? 228  GLN B OE1 1 
ATOM   5929 N NE2 . GLN B 1 228 ? 1.649   8.447   -37.477 1.00 44.47  ? 228  GLN B NE2 1 
ATOM   5930 N N   . SER B 1 229 ? 6.766   8.371   -34.308 1.00 39.11  ? 229  SER B N   1 
ATOM   5931 C CA  . SER B 1 229 ? 7.397   7.189   -33.718 1.00 45.33  ? 229  SER B CA  1 
ATOM   5932 C C   . SER B 1 229 ? 8.690   6.785   -34.397 1.00 34.12  ? 229  SER B C   1 
ATOM   5933 O O   . SER B 1 229 ? 8.989   5.597   -34.512 1.00 55.06  ? 229  SER B O   1 
ATOM   5934 C CB  . SER B 1 229 ? 6.435   5.998   -33.742 1.00 48.41  ? 229  SER B CB  1 
ATOM   5935 O OG  . SER B 1 229 ? 5.433   6.163   -32.758 1.00 60.81  ? 229  SER B OG  1 
ATOM   5936 N N   . GLY B 1 230 ? 9.451   7.771   -34.845 1.00 30.33  ? 230  GLY B N   1 
ATOM   5937 C CA  . GLY B 1 230 ? 10.694  7.530   -35.554 1.00 32.51  ? 230  GLY B CA  1 
ATOM   5938 C C   . GLY B 1 230 ? 11.418  8.825   -35.877 1.00 47.57  ? 230  GLY B C   1 
ATOM   5939 O O   . GLY B 1 230 ? 10.779  9.881   -36.027 1.00 50.79  ? 230  GLY B O   1 
ATOM   5940 N N   . THR B 1 231 ? 12.750  8.737   -35.971 1.00 44.74  ? 231  THR B N   1 
ATOM   5941 C CA  . THR B 1 231 ? 13.633  9.882   -36.216 1.00 40.92  ? 231  THR B CA  1 
ATOM   5942 C C   . THR B 1 231 ? 14.831  9.461   -37.034 1.00 34.49  ? 231  THR B C   1 
ATOM   5943 O O   . THR B 1 231 ? 15.170  8.278   -37.041 1.00 55.12  ? 231  THR B O   1 
ATOM   5944 C CB  . THR B 1 231 ? 14.199  10.439  -34.907 1.00 56.09  ? 231  THR B CB  1 
ATOM   5945 O OG1 . THR B 1 231 ? 14.567  9.352   -34.047 1.00 42.60  ? 231  THR B OG1 1 
ATOM   5946 C CG2 . THR B 1 231 ? 13.182  11.336  -34.215 1.00 60.09  ? 231  THR B CG2 1 
ATOM   5947 N N   . PRO B 1 232 ? 15.484  10.418  -37.718 1.00 35.00  ? 232  PRO B N   1 
ATOM   5948 C CA  . PRO B 1 232 ? 16.729  10.121  -38.444 1.00 40.03  ? 232  PRO B CA  1 
ATOM   5949 C C   . PRO B 1 232 ? 17.867  9.844   -37.469 1.00 46.29  ? 232  PRO B C   1 
ATOM   5950 O O   . PRO B 1 232 ? 18.658  8.926   -37.690 1.00 52.44  ? 232  PRO B O   1 
ATOM   5951 C CB  . PRO B 1 232 ? 17.002  11.413  -39.238 1.00 38.86  ? 232  PRO B CB  1 
ATOM   5952 C CG  . PRO B 1 232 ? 16.306  12.485  -38.505 1.00 36.18  ? 232  PRO B CG  1 
ATOM   5953 C CD  . PRO B 1 232 ? 15.077  11.825  -37.884 1.00 39.74  ? 232  PRO B CD  1 
ATOM   5954 N N   . ASN B 1 233 ? 17.955  10.634  -36.401 1.00 49.91  ? 233  ASN B N   1 
ATOM   5955 C CA  . ASN B 1 233 ? 18.897  10.335  -35.330 1.00 36.38  ? 233  ASN B CA  1 
ATOM   5956 C C   . ASN B 1 233 ? 18.560  9.025   -34.622 1.00 46.11  ? 233  ASN B C   1 
ATOM   5957 O O   . ASN B 1 233 ? 17.496  8.433   -34.840 1.00 37.41  ? 233  ASN B O   1 
ATOM   5958 C CB  . ASN B 1 233 ? 18.962  11.472  -34.319 1.00 30.67  ? 233  ASN B CB  1 
ATOM   5959 C CG  . ASN B 1 233 ? 17.598  11.876  -33.789 1.00 41.48  ? 233  ASN B CG  1 
ATOM   5960 O OD1 . ASN B 1 233 ? 16.662  12.133  -34.551 1.00 34.50  ? 233  ASN B OD1 1 
ATOM   5961 N ND2 . ASN B 1 233 ? 17.484  11.948  -32.461 1.00 36.26  ? 233  ASN B ND2 1 
ATOM   5962 N N   . GLY B 1 234 ? 19.466  8.568   -33.769 1.00 45.45  ? 234  GLY B N   1 
ATOM   5963 C CA  . GLY B 1 234 ? 19.187  7.393   -32.975 1.00 53.15  ? 234  GLY B CA  1 
ATOM   5964 C C   . GLY B 1 234 ? 19.927  6.138   -33.390 1.00 56.10  ? 234  GLY B C   1 
ATOM   5965 O O   . GLY B 1 234 ? 20.567  6.096   -34.438 1.00 62.69  ? 234  GLY B O   1 
ATOM   5966 N N   . PRO B 1 235 ? 19.817  5.095   -32.560 1.00 54.86  ? 235  PRO B N   1 
ATOM   5967 C CA  . PRO B 1 235 ? 20.658  3.899   -32.616 1.00 54.49  ? 235  PRO B CA  1 
ATOM   5968 C C   . PRO B 1 235 ? 20.384  2.978   -33.797 1.00 54.74  ? 235  PRO B C   1 
ATOM   5969 O O   . PRO B 1 235 ? 21.263  2.182   -34.123 1.00 66.57  ? 235  PRO B O   1 
ATOM   5970 C CB  . PRO B 1 235 ? 20.326  3.189   -31.303 1.00 49.24  ? 235  PRO B CB  1 
ATOM   5971 C CG  . PRO B 1 235 ? 18.943  3.624   -30.991 1.00 40.76  ? 235  PRO B CG  1 
ATOM   5972 C CD  . PRO B 1 235 ? 18.854  5.039   -31.444 1.00 45.77  ? 235  PRO B CD  1 
ATOM   5973 N N   . TRP B 1 236 ? 19.218  3.089   -34.431 1.00 38.55  ? 236  TRP B N   1 
ATOM   5974 C CA  . TRP B 1 236 ? 18.819  2.113   -35.444 1.00 36.07  ? 236  TRP B CA  1 
ATOM   5975 C C   . TRP B 1 236 ? 18.626  2.603   -36.884 1.00 48.53  ? 236  TRP B C   1 
ATOM   5976 O O   . TRP B 1 236 ? 18.562  1.785   -37.805 1.00 42.73  ? 236  TRP B O   1 
ATOM   5977 C CB  . TRP B 1 236 ? 17.555  1.375   -35.007 1.00 27.09  ? 236  TRP B CB  1 
ATOM   5978 C CG  . TRP B 1 236 ? 16.384  2.262   -34.740 1.00 39.92  ? 236  TRP B CG  1 
ATOM   5979 C CD1 . TRP B 1 236 ? 15.962  2.709   -33.522 1.00 49.53  ? 236  TRP B CD1 1 
ATOM   5980 C CD2 . TRP B 1 236 ? 15.471  2.810   -35.705 1.00 49.39  ? 236  TRP B CD2 1 
ATOM   5981 N NE1 . TRP B 1 236 ? 14.856  3.503   -33.664 1.00 43.62  ? 236  TRP B NE1 1 
ATOM   5982 C CE2 . TRP B 1 236 ? 14.526  3.579   -34.991 1.00 46.40  ? 236  TRP B CE2 1 
ATOM   5983 C CE3 . TRP B 1 236 ? 15.357  2.722   -37.100 1.00 51.01  ? 236  TRP B CE3 1 
ATOM   5984 C CZ2 . TRP B 1 236 ? 13.476  4.258   -35.625 1.00 41.51  ? 236  TRP B CZ2 1 
ATOM   5985 C CZ3 . TRP B 1 236 ? 14.316  3.408   -37.732 1.00 39.41  ? 236  TRP B CZ3 1 
ATOM   5986 C CH2 . TRP B 1 236 ? 13.391  4.164   -36.991 1.00 37.01  ? 236  TRP B CH2 1 
ATOM   5987 N N   . ALA B 1 237 ? 18.515  3.911   -37.096 1.00 51.70  ? 237  ALA B N   1 
ATOM   5988 C CA  . ALA B 1 237 ? 18.052  4.382   -38.401 1.00 36.64  ? 237  ALA B CA  1 
ATOM   5989 C C   . ALA B 1 237 ? 19.170  4.564   -39.434 1.00 35.75  ? 237  ALA B C   1 
ATOM   5990 O O   . ALA B 1 237 ? 18.911  4.653   -40.636 1.00 45.60  ? 237  ALA B O   1 
ATOM   5991 C CB  . ALA B 1 237 ? 17.213  5.635   -38.260 1.00 26.98  ? 237  ALA B CB  1 
ATOM   5992 N N   . THR B 1 238 ? 20.411  4.574   -38.969 1.00 30.22  ? 238  THR B N   1 
ATOM   5993 C CA  . THR B 1 238 ? 21.560  4.681   -39.862 1.00 37.26  ? 238  THR B CA  1 
ATOM   5994 C C   . THR B 1 238 ? 22.737  3.799   -39.453 1.00 45.72  ? 238  THR B C   1 
ATOM   5995 O O   . THR B 1 238 ? 22.870  3.368   -38.303 1.00 43.92  ? 238  THR B O   1 
ATOM   5996 C CB  . THR B 1 238 ? 22.080  6.120   -39.937 1.00 26.33  ? 238  THR B CB  1 
ATOM   5997 O OG1 . THR B 1 238 ? 22.550  6.515   -38.637 1.00 46.17  ? 238  THR B OG1 1 
ATOM   5998 C CG2 . THR B 1 238 ? 20.959  7.040   -40.376 1.00 24.86  ? 238  THR B CG2 1 
ATOM   5999 N N   . VAL B 1 239 ? 23.603  3.551   -40.421 1.00 42.33  ? 239  VAL B N   1 
ATOM   6000 C CA  . VAL B 1 239 ? 24.871  2.944   -40.129 1.00 45.92  ? 239  VAL B CA  1 
ATOM   6001 C C   . VAL B 1 239 ? 25.970  3.805   -40.727 1.00 47.78  ? 239  VAL B C   1 
ATOM   6002 O O   . VAL B 1 239 ? 25.718  4.654   -41.583 1.00 45.31  ? 239  VAL B O   1 
ATOM   6003 C CB  . VAL B 1 239 ? 24.962  1.490   -40.663 1.00 39.52  ? 239  VAL B CB  1 
ATOM   6004 C CG1 . VAL B 1 239 ? 24.052  0.571   -39.858 1.00 40.91  ? 239  VAL B CG1 1 
ATOM   6005 C CG2 . VAL B 1 239 ? 24.604  1.442   -42.109 1.00 30.98  ? 239  VAL B CG2 1 
ATOM   6006 N N   . SER B 1 240 ? 27.185  3.579   -40.244 1.00 52.72  ? 240  SER B N   1 
ATOM   6007 C CA  . SER B 1 240 ? 28.379  4.153   -40.824 1.00 59.94  ? 240  SER B CA  1 
ATOM   6008 C C   . SER B 1 240 ? 28.705  3.437   -42.131 1.00 62.90  ? 240  SER B C   1 
ATOM   6009 O O   . SER B 1 240 ? 28.251  2.317   -42.368 1.00 49.11  ? 240  SER B O   1 
ATOM   6010 C CB  . SER B 1 240 ? 29.529  3.939   -39.873 1.00 49.62  ? 240  SER B CB  1 
ATOM   6011 O OG  . SER B 1 240 ? 29.699  2.550   -39.688 1.00 60.11  ? 240  SER B OG  1 
ATOM   6012 N N   . ALA B 1 241 ? 29.498  4.096   -42.968 1.00 57.77  ? 241  ALA B N   1 
ATOM   6013 C CA  . ALA B 1 241 ? 29.939  3.518   -44.226 1.00 57.79  ? 241  ALA B CA  1 
ATOM   6014 C C   . ALA B 1 241 ? 30.680  2.213   -43.974 1.00 64.62  ? 241  ALA B C   1 
ATOM   6015 O O   . ALA B 1 241 ? 30.572  1.260   -44.742 1.00 65.12  ? 241  ALA B O   1 
ATOM   6016 C CB  . ALA B 1 241 ? 30.836  4.492   -44.949 1.00 41.17  ? 241  ALA B CB  1 
ATOM   6017 N N   . GLY B 1 242 ? 31.440  2.184   -42.887 1.00 63.07  ? 242  GLY B N   1 
ATOM   6018 C CA  . GLY B 1 242 ? 32.252  1.032   -42.566 1.00 52.11  ? 242  GLY B CA  1 
ATOM   6019 C C   . GLY B 1 242 ? 31.389  -0.120  -42.115 1.00 60.18  ? 242  GLY B C   1 
ATOM   6020 O O   . GLY B 1 242 ? 31.705  -1.286  -42.362 1.00 66.60  ? 242  GLY B O   1 
ATOM   6021 N N   . GLU B 1 243 ? 30.289  0.200   -41.448 1.00 52.18  ? 243  GLU B N   1 
ATOM   6022 C CA  . GLU B 1 243 ? 29.397  -0.845  -40.978 1.00 54.13  ? 243  GLU B CA  1 
ATOM   6023 C C   . GLU B 1 243 ? 28.567  -1.388  -42.136 1.00 53.31  ? 243  GLU B C   1 
ATOM   6024 O O   . GLU B 1 243 ? 28.314  -2.592  -42.208 1.00 70.93  ? 243  GLU B O   1 
ATOM   6025 C CB  . GLU B 1 243 ? 28.515  -0.350  -39.825 1.00 48.73  ? 243  GLU B CB  1 
ATOM   6026 C CG  . GLU B 1 243 ? 27.595  -1.405  -39.234 1.00 53.38  ? 243  GLU B CG  1 
ATOM   6027 C CD  . GLU B 1 243 ? 28.328  -2.663  -38.771 1.00 60.30  ? 243  GLU B CD  1 
ATOM   6028 O OE1 . GLU B 1 243 ? 29.582  -2.668  -38.721 1.00 58.15  ? 243  GLU B OE1 1 
ATOM   6029 O OE2 . GLU B 1 243 ? 27.636  -3.653  -38.456 1.00 57.12  ? 243  GLU B OE2 1 
ATOM   6030 N N   . ALA B 1 244 ? 28.174  -0.509  -43.055 1.00 43.78  ? 244  ALA B N   1 
ATOM   6031 C CA  . ALA B 1 244 ? 27.406  -0.920  -44.232 1.00 49.57  ? 244  ALA B CA  1 
ATOM   6032 C C   . ALA B 1 244 ? 28.272  -1.844  -45.085 1.00 57.79  ? 244  ALA B C   1 
ATOM   6033 O O   . ALA B 1 244 ? 27.921  -2.996  -45.343 1.00 44.76  ? 244  ALA B O   1 
ATOM   6034 C CB  . ALA B 1 244 ? 26.961  0.285   -45.032 1.00 35.40  ? 244  ALA B CB  1 
ATOM   6035 N N   . ARG B 1 245 ? 29.425  -1.335  -45.497 1.00 56.27  ? 245  ARG B N   1 
ATOM   6036 C CA  . ARG B 1 245 ? 30.382  -2.137  -46.236 1.00 59.71  ? 245  ARG B CA  1 
ATOM   6037 C C   . ARG B 1 245 ? 30.566  -3.529  -45.618 1.00 61.55  ? 245  ARG B C   1 
ATOM   6038 O O   . ARG B 1 245 ? 30.727  -4.533  -46.332 1.00 59.04  ? 245  ARG B O   1 
ATOM   6039 C CB  . ARG B 1 245 ? 31.722  -1.402  -46.308 1.00 46.07  ? 245  ARG B CB  1 
ATOM   6040 C CG  . ARG B 1 245 ? 32.845  -2.220  -46.891 1.00 49.34  ? 245  ARG B CG  1 
ATOM   6041 C CD  . ARG B 1 245 ? 33.914  -1.308  -47.453 1.00 55.47  ? 245  ARG B CD  1 
ATOM   6042 N NE  . ARG B 1 245 ? 33.490  -0.609  -48.669 1.00 55.87  ? 245  ARG B NE  1 
ATOM   6043 C CZ  . ARG B 1 245 ? 33.610  -1.109  -49.898 1.00 61.49  ? 245  ARG B CZ  1 
ATOM   6044 N NH1 . ARG B 1 245 ? 34.141  -2.320  -50.076 1.00 60.01  ? 245  ARG B NH1 1 
ATOM   6045 N NH2 . ARG B 1 245 ? 33.203  -0.407  -50.950 1.00 59.28  ? 245  ARG B NH2 1 
ATOM   6046 N N   . ARG B 1 246 ? 30.531  -3.570  -44.289 1.00 57.73  ? 246  ARG B N   1 
ATOM   6047 C CA  . ARG B 1 246 ? 30.793  -4.781  -43.522 1.00 60.51  ? 246  ARG B CA  1 
ATOM   6048 C C   . ARG B 1 246 ? 29.714  -5.820  -43.780 1.00 57.72  ? 246  ARG B C   1 
ATOM   6049 O O   . ARG B 1 246 ? 29.989  -6.974  -44.093 1.00 59.71  ? 246  ARG B O   1 
ATOM   6050 C CB  . ARG B 1 246 ? 30.804  -4.435  -42.037 1.00 66.03  ? 246  ARG B CB  1 
ATOM   6051 C CG  . ARG B 1 246 ? 31.893  -5.107  -41.223 1.00 63.02  ? 246  ARG B CG  1 
ATOM   6052 C CD  . ARG B 1 246 ? 31.363  -6.219  -40.333 1.00 57.95  ? 246  ARG B CD  1 
ATOM   6053 N NE  . ARG B 1 246 ? 30.142  -5.854  -39.631 1.00 49.33  ? 246  ARG B NE  1 
ATOM   6054 C CZ  . ARG B 1 246 ? 29.240  -6.737  -39.214 1.00 57.81  ? 246  ARG B CZ  1 
ATOM   6055 N NH1 . ARG B 1 246 ? 29.441  -8.041  -39.407 1.00 59.86  ? 246  ARG B NH1 1 
ATOM   6056 N NH2 . ARG B 1 246 ? 28.136  -6.320  -38.604 1.00 47.72  ? 246  ARG B NH2 1 
ATOM   6057 N N   . ARG B 1 247 ? 28.472  -5.391  -43.643 1.00 59.94  ? 247  ARG B N   1 
ATOM   6058 C CA  . ARG B 1 247 ? 27.340  -6.282  -43.820 1.00 55.90  ? 247  ARG B CA  1 
ATOM   6059 C C   . ARG B 1 247 ? 27.184  -6.730  -45.272 1.00 58.87  ? 247  ARG B C   1 
ATOM   6060 O O   . ARG B 1 247 ? 26.963  -7.907  -45.538 1.00 74.35  ? 247  ARG B O   1 
ATOM   6061 C CB  . ARG B 1 247 ? 26.078  -5.593  -43.308 1.00 45.77  ? 247  ARG B CB  1 
ATOM   6062 C CG  . ARG B 1 247 ? 26.228  -5.079  -41.880 1.00 46.47  ? 247  ARG B CG  1 
ATOM   6063 C CD  . ARG B 1 247 ? 24.901  -4.597  -41.347 1.00 55.47  ? 247  ARG B CD  1 
ATOM   6064 N NE  . ARG B 1 247 ? 24.993  -4.052  -39.998 1.00 60.21  ? 247  ARG B NE  1 
ATOM   6065 C CZ  . ARG B 1 247 ? 23.957  -3.516  -39.361 1.00 61.22  ? 247  ARG B CZ  1 
ATOM   6066 N NH1 . ARG B 1 247 ? 22.779  -3.465  -39.969 1.00 50.94  ? 247  ARG B NH1 1 
ATOM   6067 N NH2 . ARG B 1 247 ? 24.092  -3.035  -38.131 1.00 53.00  ? 247  ARG B NH2 1 
ATOM   6068 N N   . ALA B 1 248 ? 27.299  -5.793  -46.208 1.00 56.66  ? 248  ALA B N   1 
ATOM   6069 C CA  . ALA B 1 248 ? 27.246  -6.119  -47.628 1.00 54.20  ? 248  ALA B CA  1 
ATOM   6070 C C   . ALA B 1 248 ? 28.230  -7.233  -47.892 1.00 58.58  ? 248  ALA B C   1 
ATOM   6071 O O   . ALA B 1 248 ? 27.875  -8.304  -48.384 1.00 59.89  ? 248  ALA B O   1 
ATOM   6072 C CB  . ALA B 1 248 ? 27.604  -4.911  -48.464 1.00 44.55  ? 248  ALA B CB  1 
ATOM   6073 N N   . THR B 1 249 ? 29.478  -6.972  -47.543 1.00 58.48  ? 249  THR B N   1 
ATOM   6074 C CA  . THR B 1 249 ? 30.517  -7.953  -47.733 1.00 57.73  ? 249  THR B CA  1 
ATOM   6075 C C   . THR B 1 249 ? 30.167  -9.264  -47.054 1.00 63.43  ? 249  THR B C   1 
ATOM   6076 O O   . THR B 1 249 ? 30.482  -10.333 -47.569 1.00 69.50  ? 249  THR B O   1 
ATOM   6077 C CB  . THR B 1 249 ? 31.836  -7.460  -47.166 1.00 53.76  ? 249  THR B CB  1 
ATOM   6078 O OG1 . THR B 1 249 ? 32.176  -6.216  -47.792 1.00 53.14  ? 249  THR B OG1 1 
ATOM   6079 C CG2 . THR B 1 249 ? 32.925  -8.492  -47.407 1.00 56.15  ? 249  THR B CG2 1 
ATOM   6080 N N   . LEU B 1 250 ? 29.524  -9.187  -45.893 1.00 57.25  ? 250  LEU B N   1 
ATOM   6081 C CA  . LEU B 1 250 ? 29.264  -10.397 -45.125 1.00 60.69  ? 250  LEU B CA  1 
ATOM   6082 C C   . LEU B 1 250 ? 28.204  -11.217 -45.822 1.00 59.10  ? 250  LEU B C   1 
ATOM   6083 O O   . LEU B 1 250 ? 28.336  -12.434 -45.982 1.00 61.68  ? 250  LEU B O   1 
ATOM   6084 C CB  . LEU B 1 250 ? 28.840  -10.078 -43.692 1.00 49.48  ? 250  LEU B CB  1 
ATOM   6085 C CG  . LEU B 1 250 ? 28.470  -11.318 -42.871 1.00 61.64  ? 250  LEU B CG  1 
ATOM   6086 C CD1 . LEU B 1 250 ? 29.518  -12.413 -43.026 1.00 54.51  ? 250  LEU B CD1 1 
ATOM   6087 C CD2 . LEU B 1 250 ? 28.286  -10.969 -41.413 1.00 50.10  ? 250  LEU B CD2 1 
ATOM   6088 N N   . LEU B 1 251 ? 27.158  -10.527 -46.251 1.00 54.64  ? 251  LEU B N   1 
ATOM   6089 C CA  . LEU B 1 251 ? 26.072  -11.143 -46.998 1.00 53.98  ? 251  LEU B CA  1 
ATOM   6090 C C   . LEU B 1 251 ? 26.618  -11.824 -48.243 1.00 64.50  ? 251  LEU B C   1 
ATOM   6091 O O   . LEU B 1 251 ? 26.375  -13.012 -48.481 1.00 63.06  ? 251  LEU B O   1 
ATOM   6092 C CB  . LEU B 1 251 ? 25.082  -10.072 -47.414 1.00 45.02  ? 251  LEU B CB  1 
ATOM   6093 C CG  . LEU B 1 251 ? 23.791  -10.582 -48.041 1.00 50.52  ? 251  LEU B CG  1 
ATOM   6094 C CD1 . LEU B 1 251 ? 22.732  -10.812 -46.974 1.00 41.07  ? 251  LEU B CD1 1 
ATOM   6095 C CD2 . LEU B 1 251 ? 23.306  -9.608  -49.119 1.00 44.39  ? 251  LEU B CD2 1 
ATOM   6096 N N   . ALA B 1 252 ? 27.363  -11.059 -49.035 1.00 66.83  ? 252  ALA B N   1 
ATOM   6097 C CA  . ALA B 1 252 ? 27.913  -11.578 -50.271 1.00 63.25  ? 252  ALA B CA  1 
ATOM   6098 C C   . ALA B 1 252 ? 28.654  -12.868 -49.966 1.00 69.07  ? 252  ALA B C   1 
ATOM   6099 O O   . ALA B 1 252 ? 28.534  -13.857 -50.683 1.00 81.60  ? 252  ALA B O   1 
ATOM   6100 C CB  . ALA B 1 252 ? 28.828  -10.566 -50.912 1.00 57.15  ? 252  ALA B CB  1 
ATOM   6101 N N   . ARG B 1 253 ? 29.408  -12.871 -48.882 1.00 67.70  ? 253  ARG B N   1 
ATOM   6102 C CA  . ARG B 1 253 ? 30.076  -14.094 -48.491 1.00 72.16  ? 253  ARG B CA  1 
ATOM   6103 C C   . ARG B 1 253 ? 29.021  -15.156 -48.220 1.00 70.07  ? 253  ARG B C   1 
ATOM   6104 O O   . ARG B 1 253 ? 29.169  -16.302 -48.618 1.00 64.19  ? 253  ARG B O   1 
ATOM   6105 C CB  . ARG B 1 253 ? 30.941  -13.862 -47.256 1.00 69.26  ? 253  ARG B CB  1 
ATOM   6106 C CG  . ARG B 1 253 ? 31.431  -15.136 -46.600 1.00 75.77  ? 253  ARG B CG  1 
ATOM   6107 C CD  . ARG B 1 253 ? 32.103  -14.859 -45.262 1.00 86.57  ? 253  ARG B CD  1 
ATOM   6108 N NE  . ARG B 1 253 ? 32.569  -16.095 -44.637 1.00 103.54 ? 253  ARG B NE  1 
ATOM   6109 C CZ  . ARG B 1 253 ? 31.987  -16.683 -43.596 1.00 111.97 ? 253  ARG B CZ  1 
ATOM   6110 N NH1 . ARG B 1 253 ? 30.912  -16.151 -43.035 1.00 104.41 ? 253  ARG B NH1 1 
ATOM   6111 N NH2 . ARG B 1 253 ? 32.491  -17.807 -43.106 1.00 126.62 ? 253  ARG B NH2 1 
ATOM   6112 N N   . LEU B 1 254 ? 27.939  -14.761 -47.560 1.00 65.10  ? 254  LEU B N   1 
ATOM   6113 C CA  . LEU B 1 254 ? 26.938  -15.732 -47.131 1.00 70.06  ? 254  LEU B CA  1 
ATOM   6114 C C   . LEU B 1 254 ? 26.190  -16.436 -48.268 1.00 65.46  ? 254  LEU B C   1 
ATOM   6115 O O   . LEU B 1 254 ? 25.653  -17.530 -48.076 1.00 61.23  ? 254  LEU B O   1 
ATOM   6116 C CB  . LEU B 1 254 ? 25.952  -15.107 -46.138 1.00 52.96  ? 254  LEU B CB  1 
ATOM   6117 C CG  . LEU B 1 254 ? 26.440  -14.972 -44.691 1.00 65.36  ? 254  LEU B CG  1 
ATOM   6118 C CD1 . LEU B 1 254 ? 25.337  -14.434 -43.793 1.00 59.33  ? 254  LEU B CD1 1 
ATOM   6119 C CD2 . LEU B 1 254 ? 26.941  -16.300 -44.164 1.00 56.94  ? 254  LEU B CD2 1 
ATOM   6120 N N   . VAL B 1 255 ? 26.145  -15.818 -49.443 1.00 61.85  ? 255  VAL B N   1 
ATOM   6121 C CA  . VAL B 1 255 ? 25.541  -16.477 -50.602 1.00 65.21  ? 255  VAL B CA  1 
ATOM   6122 C C   . VAL B 1 255 ? 26.601  -16.931 -51.591 1.00 67.87  ? 255  VAL B C   1 
ATOM   6123 O O   . VAL B 1 255 ? 26.283  -17.502 -52.631 1.00 73.07  ? 255  VAL B O   1 
ATOM   6124 C CB  . VAL B 1 255 ? 24.562  -15.573 -51.351 1.00 56.78  ? 255  VAL B CB  1 
ATOM   6125 C CG1 . VAL B 1 255 ? 23.530  -15.020 -50.392 1.00 52.19  ? 255  VAL B CG1 1 
ATOM   6126 C CG2 . VAL B 1 255 ? 25.325  -14.468 -52.056 1.00 59.92  ? 255  VAL B CG2 1 
ATOM   6127 N N   . GLY B 1 256 ? 27.857  -16.645 -51.270 1.00 61.54  ? 256  GLY B N   1 
ATOM   6128 C CA  . GLY B 1 256 ? 28.974  -17.153 -52.041 1.00 67.86  ? 256  GLY B CA  1 
ATOM   6129 C C   . GLY B 1 256 ? 29.512  -16.250 -53.130 1.00 59.20  ? 256  GLY B C   1 
ATOM   6130 O O   . GLY B 1 256 ? 29.634  -16.679 -54.259 1.00 69.39  ? 256  GLY B O   1 
ATOM   6131 N N   . CYS B 1 257 ? 29.867  -15.017 -52.796 1.00 72.16  ? 257  CYS B N   1 
ATOM   6132 C CA  . CYS B 1 257 ? 30.365  -14.082 -53.799 1.00 82.96  ? 257  CYS B CA  1 
ATOM   6133 C C   . CYS B 1 257 ? 31.717  -13.465 -53.425 1.00 89.01  ? 257  CYS B C   1 
ATOM   6134 O O   . CYS B 1 257 ? 32.686  -13.570 -54.181 1.00 90.37  ? 257  CYS B O   1 
ATOM   6135 C CB  . CYS B 1 257 ? 29.321  -12.993 -54.066 1.00 83.92  ? 257  CYS B CB  1 
ATOM   6136 S SG  . CYS B 1 257 ? 27.870  -13.546 -55.021 1.00 114.01 ? 257  CYS B SG  1 
ATOM   6137 N N   . ALA B 1 263 ? 34.942  -12.258 -52.706 1.00 105.97 ? 263  ALA B N   1 
ATOM   6138 C CA  . ALA B 1 263 ? 36.121  -11.975 -51.880 1.00 114.98 ? 263  ALA B CA  1 
ATOM   6139 C C   . ALA B 1 263 ? 37.121  -11.058 -52.588 1.00 125.77 ? 263  ALA B C   1 
ATOM   6140 O O   . ALA B 1 263 ? 38.277  -10.940 -52.158 1.00 115.08 ? 263  ALA B O   1 
ATOM   6141 C CB  . ALA B 1 263 ? 36.808  -13.279 -51.441 1.00 102.90 ? 263  ALA B CB  1 
ATOM   6142 N N   . ALA B 1 264 ? 36.662  -10.398 -53.654 1.00 134.59 ? 264  ALA B N   1 
ATOM   6143 C CA  . ALA B 1 264 ? 37.537  -9.614  -54.534 1.00 137.24 ? 264  ALA B CA  1 
ATOM   6144 C C   . ALA B 1 264 ? 37.211  -8.116  -54.604 1.00 130.66 ? 264  ALA B C   1 
ATOM   6145 O O   . ALA B 1 264 ? 37.439  -7.371  -53.652 1.00 121.91 ? 264  ALA B O   1 
ATOM   6146 C CB  . ALA B 1 264 ? 37.550  -10.221 -55.950 1.00 134.68 ? 264  ALA B CB  1 
ATOM   6147 N N   . ASN B 1 265 ? 36.685  -7.692  -55.751 1.00 133.15 ? 265  ASN B N   1 
ATOM   6148 C CA  . ASN B 1 265 ? 36.465  -6.279  -56.062 1.00 124.24 ? 265  ASN B CA  1 
ATOM   6149 C C   . ASN B 1 265 ? 35.014  -5.846  -55.833 1.00 105.44 ? 265  ASN B C   1 
ATOM   6150 O O   . ASN B 1 265 ? 34.112  -6.683  -55.865 1.00 104.50 ? 265  ASN B O   1 
ATOM   6151 C CB  . ASN B 1 265 ? 36.863  -6.034  -57.520 1.00 125.54 ? 265  ASN B CB  1 
ATOM   6152 C CG  . ASN B 1 265 ? 36.766  -4.584  -57.915 1.00 122.47 ? 265  ASN B CG  1 
ATOM   6153 O OD1 . ASN B 1 265 ? 36.391  -3.728  -57.104 1.00 123.70 ? 265  ASN B OD1 1 
ATOM   6154 N ND2 . ASN B 1 265 ? 37.120  -4.289  -59.165 1.00 111.06 ? 265  ASN B ND2 1 
ATOM   6155 N N   . ASP B 1 266 ? 34.781  -4.554  -55.597 1.00 89.18  ? 266  ASP B N   1 
ATOM   6156 C CA  . ASP B 1 266 ? 33.402  -4.055  -55.459 1.00 81.79  ? 266  ASP B CA  1 
ATOM   6157 C C   . ASP B 1 266 ? 32.545  -4.489  -56.644 1.00 77.46  ? 266  ASP B C   1 
ATOM   6158 O O   . ASP B 1 266 ? 31.495  -5.098  -56.480 1.00 76.05  ? 266  ASP B O   1 
ATOM   6159 C CB  . ASP B 1 266 ? 33.351  -2.526  -55.361 1.00 77.78  ? 266  ASP B CB  1 
ATOM   6160 C CG  . ASP B 1 266 ? 33.516  -2.023  -53.946 1.00 80.54  ? 266  ASP B CG  1 
ATOM   6161 O OD1 . ASP B 1 266 ? 33.593  -2.859  -53.021 1.00 78.36  ? 266  ASP B OD1 1 
ATOM   6162 O OD2 . ASP B 1 266 ? 33.560  -0.786  -53.758 1.00 80.30  ? 266  ASP B OD2 1 
ATOM   6163 N N   . THR B 1 267 ? 33.011  -4.160  -57.842 1.00 77.18  ? 267  THR B N   1 
ATOM   6164 C CA  . THR B 1 267 ? 32.297  -4.470  -59.069 1.00 71.11  ? 267  THR B CA  1 
ATOM   6165 C C   . THR B 1 267 ? 32.025  -5.958  -59.232 1.00 74.07  ? 267  THR B C   1 
ATOM   6166 O O   . THR B 1 267 ? 30.926  -6.363  -59.618 1.00 75.81  ? 267  THR B O   1 
ATOM   6167 C CB  . THR B 1 267 ? 33.086  -3.978  -60.287 1.00 69.83  ? 267  THR B CB  1 
ATOM   6168 O OG1 . THR B 1 267 ? 33.294  -2.567  -60.168 1.00 78.22  ? 267  THR B OG1 1 
ATOM   6169 C CG2 . THR B 1 267 ? 32.325  -4.266  -61.566 1.00 53.40  ? 267  THR B CG2 1 
ATOM   6170 N N   . GLU B 1 268 ? 33.030  -6.774  -58.953 1.00 81.60  ? 268  GLU B N   1 
ATOM   6171 C CA  . GLU B 1 268 ? 32.870  -8.208  -59.109 1.00 84.51  ? 268  GLU B CA  1 
ATOM   6172 C C   . GLU B 1 268 ? 31.808  -8.690  -58.128 1.00 71.80  ? 268  GLU B C   1 
ATOM   6173 O O   . GLU B 1 268 ? 30.880  -9.415  -58.497 1.00 74.52  ? 268  GLU B O   1 
ATOM   6174 C CB  . GLU B 1 268 ? 34.205  -8.936  -58.897 1.00 85.83  ? 268  GLU B CB  1 
ATOM   6175 N N   . LEU B 1 269 ? 31.933  -8.247  -56.884 1.00 64.13  ? 269  LEU B N   1 
ATOM   6176 C CA  . LEU B 1 269 ? 31.056  -8.699  -55.809 1.00 68.70  ? 269  LEU B CA  1 
ATOM   6177 C C   . LEU B 1 269 ? 29.590  -8.471  -56.133 1.00 65.94  ? 269  LEU B C   1 
ATOM   6178 O O   . LEU B 1 269 ? 28.792  -9.409  -56.134 1.00 73.76  ? 269  LEU B O   1 
ATOM   6179 C CB  . LEU B 1 269 ? 31.394  -7.977  -54.508 1.00 67.59  ? 269  LEU B CB  1 
ATOM   6180 C CG  . LEU B 1 269 ? 31.032  -8.749  -53.247 1.00 77.23  ? 269  LEU B CG  1 
ATOM   6181 C CD1 . LEU B 1 269 ? 31.826  -10.058 -53.183 1.00 89.17  ? 269  LEU B CD1 1 
ATOM   6182 C CD2 . LEU B 1 269 ? 31.322  -7.892  -52.047 1.00 70.35  ? 269  LEU B CD2 1 
ATOM   6183 N N   . ILE B 1 270 ? 29.255  -7.212  -56.404 1.00 50.35  ? 270  ILE B N   1 
ATOM   6184 C CA  . ILE B 1 270 ? 27.884  -6.787  -56.650 1.00 54.37  ? 270  ILE B CA  1 
ATOM   6185 C C   . ILE B 1 270 ? 27.349  -7.455  -57.905 1.00 60.33  ? 270  ILE B C   1 
ATOM   6186 O O   . ILE B 1 270 ? 26.143  -7.721  -58.028 1.00 56.34  ? 270  ILE B O   1 
ATOM   6187 C CB  . ILE B 1 270 ? 27.812  -5.261  -56.827 1.00 55.96  ? 270  ILE B CB  1 
ATOM   6188 C CG1 . ILE B 1 270 ? 28.130  -4.556  -55.516 1.00 58.48  ? 270  ILE B CG1 1 
ATOM   6189 C CG2 . ILE B 1 270 ? 26.449  -4.837  -57.311 1.00 53.75  ? 270  ILE B CG2 1 
ATOM   6190 C CD1 . ILE B 1 270 ? 28.745  -3.194  -55.728 1.00 71.77  ? 270  ILE B CD1 1 
ATOM   6191 N N   . ALA B 1 271 ? 28.260  -7.718  -58.836 1.00 47.87  ? 271  ALA B N   1 
ATOM   6192 C CA  . ALA B 1 271 ? 27.904  -8.394  -60.059 1.00 47.43  ? 271  ALA B CA  1 
ATOM   6193 C C   . ALA B 1 271 ? 27.297  -9.727  -59.688 1.00 49.30  ? 271  ALA B C   1 
ATOM   6194 O O   . ALA B 1 271 ? 26.252  -10.126 -60.210 1.00 51.47  ? 271  ALA B O   1 
ATOM   6195 C CB  . ALA B 1 271 ? 29.102  -8.590  -60.885 1.00 47.81  ? 271  ALA B CB  1 
ATOM   6196 N N   . CYS B 1 272 ? 27.948  -10.406 -58.757 1.00 49.12  ? 272  CYS B N   1 
ATOM   6197 C CA  . CYS B 1 272 ? 27.522  -11.738 -58.367 1.00 60.55  ? 272  CYS B CA  1 
ATOM   6198 C C   . CYS B 1 272 ? 26.205  -11.668 -57.581 1.00 62.22  ? 272  CYS B C   1 
ATOM   6199 O O   . CYS B 1 272 ? 25.262  -12.425 -57.832 1.00 54.14  ? 272  CYS B O   1 
ATOM   6200 C CB  . CYS B 1 272 ? 28.645  -12.429 -57.589 1.00 51.33  ? 272  CYS B CB  1 
ATOM   6201 S SG  . CYS B 1 272 ? 28.251  -14.068 -56.968 1.00 92.65  ? 272  CYS B SG  1 
ATOM   6202 N N   . LEU B 1 273 ? 26.138  -10.739 -56.641 1.00 67.98  ? 273  LEU B N   1 
ATOM   6203 C CA  . LEU B 1 273 ? 24.883  -10.456 -55.958 1.00 68.86  ? 273  LEU B CA  1 
ATOM   6204 C C   . LEU B 1 273 ? 23.719  -10.238 -56.935 1.00 69.97  ? 273  LEU B C   1 
ATOM   6205 O O   . LEU B 1 273 ? 22.660  -10.838 -56.774 1.00 66.20  ? 273  LEU B O   1 
ATOM   6206 C CB  . LEU B 1 273 ? 25.040  -9.261  -55.012 1.00 50.83  ? 273  LEU B CB  1 
ATOM   6207 C CG  . LEU B 1 273 ? 25.786  -9.557  -53.703 1.00 49.86  ? 273  LEU B CG  1 
ATOM   6208 C CD1 . LEU B 1 273 ? 25.945  -8.297  -52.837 1.00 55.69  ? 273  LEU B CD1 1 
ATOM   6209 C CD2 . LEU B 1 273 ? 25.110  -10.671 -52.899 1.00 41.40  ? 273  LEU B CD2 1 
ATOM   6210 N N   . ARG B 1 274 ? 23.921  -9.400  -57.949 1.00 70.73  ? 274  ARG B N   1 
ATOM   6211 C CA  . ARG B 1 274 ? 22.886  -9.133  -58.956 1.00 67.95  ? 274  ARG B CA  1 
ATOM   6212 C C   . ARG B 1 274 ? 22.347  -10.390 -59.636 1.00 61.13  ? 274  ARG B C   1 
ATOM   6213 O O   . ARG B 1 274 ? 21.257  -10.380 -60.209 1.00 68.13  ? 274  ARG B O   1 
ATOM   6214 C CB  . ARG B 1 274 ? 23.426  -8.215  -60.034 1.00 38.96  ? 274  ARG B CB  1 
ATOM   6215 C CG  . ARG B 1 274 ? 23.374  -6.772  -59.725 1.00 55.14  ? 274  ARG B CG  1 
ATOM   6216 C CD  . ARG B 1 274 ? 23.374  -6.037  -61.033 1.00 60.86  ? 274  ARG B CD  1 
ATOM   6217 N NE  . ARG B 1 274 ? 24.576  -5.245  -61.223 1.00 70.78  ? 274  ARG B NE  1 
ATOM   6218 C CZ  . ARG B 1 274 ? 24.794  -4.101  -60.583 1.00 86.00  ? 274  ARG B CZ  1 
ATOM   6219 N NH1 . ARG B 1 274 ? 23.900  -3.656  -59.704 1.00 61.93  ? 274  ARG B NH1 1 
ATOM   6220 N NH2 . ARG B 1 274 ? 25.910  -3.414  -60.804 1.00 102.81 ? 274  ARG B NH2 1 
ATOM   6221 N N   . THR B 1 275 ? 23.127  -11.460 -59.592 1.00 42.84  ? 275  THR B N   1 
ATOM   6222 C CA  . THR B 1 275 ? 22.748  -12.714 -60.228 1.00 58.39  ? 275  THR B CA  1 
ATOM   6223 C C   . THR B 1 275 ? 22.108  -13.669 -59.232 1.00 71.97  ? 275  THR B C   1 
ATOM   6224 O O   . THR B 1 275 ? 22.117  -14.879 -59.429 1.00 81.27  ? 275  THR B O   1 
ATOM   6225 C CB  . THR B 1 275 ? 23.980  -13.432 -60.814 1.00 61.55  ? 275  THR B CB  1 
ATOM   6226 O OG1 . THR B 1 275 ? 24.850  -13.843 -59.749 1.00 52.57  ? 275  THR B OG1 1 
ATOM   6227 C CG2 . THR B 1 275 ? 24.734  -12.519 -61.776 1.00 69.88  ? 275  THR B CG2 1 
ATOM   6228 N N   . ARG B 1 276 ? 21.568  -13.126 -58.150 1.00 76.25  ? 276  ARG B N   1 
ATOM   6229 C CA  . ARG B 1 276 ? 21.014  -13.943 -57.079 1.00 66.26  ? 276  ARG B CA  1 
ATOM   6230 C C   . ARG B 1 276 ? 19.500  -13.723 -56.910 1.00 62.10  ? 276  ARG B C   1 
ATOM   6231 O O   . ARG B 1 276 ? 19.041  -12.600 -56.728 1.00 49.77  ? 276  ARG B O   1 
ATOM   6232 C CB  . ARG B 1 276 ? 21.744  -13.622 -55.774 1.00 64.18  ? 276  ARG B CB  1 
ATOM   6233 C CG  . ARG B 1 276 ? 23.142  -14.203 -55.660 1.00 70.31  ? 276  ARG B CG  1 
ATOM   6234 C CD  . ARG B 1 276 ? 23.070  -15.675 -55.285 1.00 72.59  ? 276  ARG B CD  1 
ATOM   6235 N NE  . ARG B 1 276 ? 24.378  -16.280 -55.062 1.00 77.43  ? 276  ARG B NE  1 
ATOM   6236 C CZ  . ARG B 1 276 ? 25.271  -16.495 -56.022 1.00 80.53  ? 276  ARG B CZ  1 
ATOM   6237 N NH1 . ARG B 1 276 ? 25.006  -16.119 -57.268 1.00 77.76  ? 276  ARG B NH1 1 
ATOM   6238 N NH2 . ARG B 1 276 ? 26.436  -17.066 -55.736 1.00 81.32  ? 276  ARG B NH2 1 
ATOM   6239 N N   . PRO B 1 277 ? 18.717  -14.802 -56.978 1.00 63.14  ? 277  PRO B N   1 
ATOM   6240 C CA  . PRO B 1 277 ? 17.270  -14.688 -56.758 1.00 60.13  ? 277  PRO B CA  1 
ATOM   6241 C C   . PRO B 1 277 ? 16.957  -13.912 -55.481 1.00 55.46  ? 277  PRO B C   1 
ATOM   6242 O O   . PRO B 1 277 ? 17.693  -14.020 -54.503 1.00 62.84  ? 277  PRO B O   1 
ATOM   6243 C CB  . PRO B 1 277 ? 16.827  -16.151 -56.622 1.00 45.20  ? 277  PRO B CB  1 
ATOM   6244 C CG  . PRO B 1 277 ? 17.812  -16.894 -57.413 1.00 46.72  ? 277  PRO B CG  1 
ATOM   6245 C CD  . PRO B 1 277 ? 19.124  -16.173 -57.321 1.00 52.67  ? 277  PRO B CD  1 
ATOM   6246 N N   . ALA B 1 278 ? 15.871  -13.148 -55.487 1.00 59.25  ? 278  ALA B N   1 
ATOM   6247 C CA  . ALA B 1 278 ? 15.505  -12.306 -54.338 1.00 49.68  ? 278  ALA B CA  1 
ATOM   6248 C C   . ALA B 1 278 ? 15.532  -13.047 -52.994 1.00 44.65  ? 278  ALA B C   1 
ATOM   6249 O O   . ALA B 1 278 ? 16.163  -12.589 -52.048 1.00 40.02  ? 278  ALA B O   1 
ATOM   6250 C CB  . ALA B 1 278 ? 14.133  -11.646 -54.568 1.00 37.90  ? 278  ALA B CB  1 
ATOM   6251 N N   . GLN B 1 279 ? 14.864  -14.199 -52.926 1.00 54.97  ? 279  GLN B N   1 
ATOM   6252 C CA  . GLN B 1 279 ? 14.744  -14.966 -51.685 1.00 57.31  ? 279  GLN B CA  1 
ATOM   6253 C C   . GLN B 1 279 ? 16.089  -15.358 -51.096 1.00 62.83  ? 279  GLN B C   1 
ATOM   6254 O O   . GLN B 1 279 ? 16.219  -15.478 -49.877 1.00 54.37  ? 279  GLN B O   1 
ATOM   6255 C CB  . GLN B 1 279 ? 13.886  -16.224 -51.874 1.00 56.60  ? 279  GLN B CB  1 
ATOM   6256 C CG  . GLN B 1 279 ? 13.297  -16.728 -50.564 1.00 51.84  ? 279  GLN B CG  1 
ATOM   6257 C CD  . GLN B 1 279 ? 12.698  -15.601 -49.711 1.00 60.70  ? 279  GLN B CD  1 
ATOM   6258 O OE1 . GLN B 1 279 ? 12.117  -14.642 -50.231 1.00 57.00  ? 279  GLN B OE1 1 
ATOM   6259 N NE2 . GLN B 1 279 ? 12.847  -15.714 -48.395 1.00 67.32  ? 279  GLN B NE2 1 
ATOM   6260 N N   . ASP B 1 280 ? 17.089  -15.556 -51.949 1.00 43.56  ? 280  ASP B N   1 
ATOM   6261 C CA  . ASP B 1 280 ? 18.430  -15.824 -51.440 1.00 60.21  ? 280  ASP B CA  1 
ATOM   6262 C C   . ASP B 1 280 ? 18.949  -14.666 -50.599 1.00 54.64  ? 280  ASP B C   1 
ATOM   6263 O O   . ASP B 1 280 ? 19.370  -14.867 -49.470 1.00 63.36  ? 280  ASP B O   1 
ATOM   6264 C CB  . ASP B 1 280 ? 19.399  -16.172 -52.566 1.00 59.04  ? 280  ASP B CB  1 
ATOM   6265 C CG  . ASP B 1 280 ? 19.021  -17.449 -53.267 1.00 61.16  ? 280  ASP B CG  1 
ATOM   6266 O OD1 . ASP B 1 280 ? 18.098  -18.134 -52.767 1.00 61.56  ? 280  ASP B OD1 1 
ATOM   6267 O OD2 . ASP B 1 280 ? 19.635  -17.765 -54.310 1.00 59.15  ? 280  ASP B OD2 1 
ATOM   6268 N N   . LEU B 1 281 ? 18.898  -13.453 -51.136 1.00 59.00  ? 281  LEU B N   1 
ATOM   6269 C CA  . LEU B 1 281 ? 19.268  -12.263 -50.354 1.00 61.49  ? 281  LEU B CA  1 
ATOM   6270 C C   . LEU B 1 281 ? 18.509  -12.167 -49.023 1.00 53.90  ? 281  LEU B C   1 
ATOM   6271 O O   . LEU B 1 281 ? 19.112  -12.023 -47.969 1.00 53.02  ? 281  LEU B O   1 
ATOM   6272 C CB  . LEU B 1 281 ? 19.117  -10.978 -51.190 1.00 50.91  ? 281  LEU B CB  1 
ATOM   6273 C CG  . LEU B 1 281 ? 20.332  -10.641 -52.063 1.00 41.19  ? 281  LEU B CG  1 
ATOM   6274 C CD1 . LEU B 1 281 ? 21.093  -11.905 -52.412 1.00 56.64  ? 281  LEU B CD1 1 
ATOM   6275 C CD2 . LEU B 1 281 ? 19.936  -9.948  -53.331 1.00 41.44  ? 281  LEU B CD2 1 
ATOM   6276 N N   . VAL B 1 282 ? 17.187  -12.271 -49.079 1.00 53.89  ? 282  VAL B N   1 
ATOM   6277 C CA  . VAL B 1 282 ? 16.352  -12.223 -47.885 1.00 50.19  ? 282  VAL B CA  1 
ATOM   6278 C C   . VAL B 1 282 ? 16.658  -13.405 -46.910 1.00 56.46  ? 282  VAL B C   1 
ATOM   6279 O O   . VAL B 1 282 ? 16.758  -13.203 -45.694 1.00 53.14  ? 282  VAL B O   1 
ATOM   6280 C CB  . VAL B 1 282 ? 14.851  -12.093 -48.311 1.00 39.48  ? 282  VAL B CB  1 
ATOM   6281 C CG1 . VAL B 1 282 ? 13.879  -12.256 -47.143 1.00 40.77  ? 282  VAL B CG1 1 
ATOM   6282 C CG2 . VAL B 1 282 ? 14.636  -10.777 -49.002 1.00 40.78  ? 282  VAL B CG2 1 
ATOM   6283 N N   . ASP B 1 283 ? 16.836  -14.619 -47.441 1.00 50.77  ? 283  ASP B N   1 
ATOM   6284 C CA  . ASP B 1 283 ? 17.306  -15.784 -46.646 1.00 47.24  ? 283  ASP B CA  1 
ATOM   6285 C C   . ASP B 1 283 ? 18.424  -15.486 -45.624 1.00 55.77  ? 283  ASP B C   1 
ATOM   6286 O O   . ASP B 1 283 ? 18.497  -16.116 -44.565 1.00 56.99  ? 283  ASP B O   1 
ATOM   6287 C CB  . ASP B 1 283 ? 17.816  -16.890 -47.561 1.00 47.35  ? 283  ASP B CB  1 
ATOM   6288 C CG  . ASP B 1 283 ? 16.699  -17.743 -48.173 1.00 69.77  ? 283  ASP B CG  1 
ATOM   6289 O OD1 . ASP B 1 283 ? 15.524  -17.591 -47.782 1.00 49.76  ? 283  ASP B OD1 1 
ATOM   6290 O OD2 . ASP B 1 283 ? 17.019  -18.605 -49.037 1.00 73.71  ? 283  ASP B OD2 1 
ATOM   6291 N N   . HIS B 1 284 ? 19.307  -14.545 -45.949 1.00 61.69  ? 284  HIS B N   1 
ATOM   6292 C CA  . HIS B 1 284 ? 20.416  -14.203 -45.058 1.00 60.98  ? 284  HIS B CA  1 
ATOM   6293 C C   . HIS B 1 284 ? 20.334  -12.782 -44.482 1.00 59.43  ? 284  HIS B C   1 
ATOM   6294 O O   . HIS B 1 284 ? 21.100  -12.409 -43.596 1.00 54.65  ? 284  HIS B O   1 
ATOM   6295 C CB  . HIS B 1 284 ? 21.741  -14.388 -45.777 1.00 58.93  ? 284  HIS B CB  1 
ATOM   6296 C CG  . HIS B 1 284 ? 22.058  -15.816 -46.082 1.00 76.39  ? 284  HIS B CG  1 
ATOM   6297 N ND1 . HIS B 1 284 ? 21.882  -16.367 -47.335 1.00 73.10  ? 284  HIS B ND1 1 
ATOM   6298 C CD2 . HIS B 1 284 ? 22.529  -16.813 -45.294 1.00 75.36  ? 284  HIS B CD2 1 
ATOM   6299 C CE1 . HIS B 1 284 ? 22.241  -17.638 -47.307 1.00 71.84  ? 284  HIS B CE1 1 
ATOM   6300 N NE2 . HIS B 1 284 ? 22.636  -17.933 -46.082 1.00 79.53  ? 284  HIS B NE2 1 
ATOM   6301 N N   . GLU B 1 285 ? 19.395  -11.998 -44.980 1.00 55.25  ? 285  GLU B N   1 
ATOM   6302 C CA  . GLU B 1 285 ? 19.314  -10.607 -44.581 1.00 64.16  ? 285  GLU B CA  1 
ATOM   6303 C C   . GLU B 1 285 ? 19.648  -10.404 -43.096 1.00 69.09  ? 285  GLU B C   1 
ATOM   6304 O O   . GLU B 1 285 ? 20.335  -9.449  -42.712 1.00 53.66  ? 285  GLU B O   1 
ATOM   6305 C CB  . GLU B 1 285 ? 17.927  -10.053 -44.883 1.00 51.56  ? 285  GLU B CB  1 
ATOM   6306 C CG  . GLU B 1 285 ? 17.915  -8.562  -44.791 1.00 59.42  ? 285  GLU B CG  1 
ATOM   6307 C CD  . GLU B 1 285 ? 16.538  -7.994  -44.824 1.00 67.86  ? 285  GLU B CD  1 
ATOM   6308 O OE1 . GLU B 1 285 ? 15.753  -8.404  -45.708 1.00 74.63  ? 285  GLU B OE1 1 
ATOM   6309 O OE2 . GLU B 1 285 ? 16.251  -7.145  -43.954 1.00 73.55  ? 285  GLU B OE2 1 
ATOM   6310 N N   . TRP B 1 286 ? 19.165  -11.321 -42.265 1.00 69.81  ? 286  TRP B N   1 
ATOM   6311 C CA  . TRP B 1 286 ? 19.227  -11.139 -40.819 1.00 66.42  ? 286  TRP B CA  1 
ATOM   6312 C C   . TRP B 1 286 ? 20.551  -11.580 -40.214 1.00 73.62  ? 286  TRP B C   1 
ATOM   6313 O O   . TRP B 1 286 ? 20.912  -11.174 -39.108 1.00 71.28  ? 286  TRP B O   1 
ATOM   6314 C CB  . TRP B 1 286 ? 18.082  -11.901 -40.151 1.00 65.27  ? 286  TRP B CB  1 
ATOM   6315 C CG  . TRP B 1 286 ? 16.740  -11.311 -40.441 1.00 74.76  ? 286  TRP B CG  1 
ATOM   6316 C CD1 . TRP B 1 286 ? 15.773  -11.832 -41.246 1.00 71.29  ? 286  TRP B CD1 1 
ATOM   6317 C CD2 . TRP B 1 286 ? 16.219  -10.071 -39.938 1.00 75.98  ? 286  TRP B CD2 1 
ATOM   6318 N NE1 . TRP B 1 286 ? 14.679  -11.001 -41.268 1.00 64.37  ? 286  TRP B NE1 1 
ATOM   6319 C CE2 . TRP B 1 286 ? 14.929  -9.913  -40.476 1.00 62.12  ? 286  TRP B CE2 1 
ATOM   6320 C CE3 . TRP B 1 286 ? 16.720  -9.084  -39.084 1.00 77.14  ? 286  TRP B CE3 1 
ATOM   6321 C CZ2 . TRP B 1 286 ? 14.137  -8.810  -40.195 1.00 67.49  ? 286  TRP B CZ2 1 
ATOM   6322 C CZ3 . TRP B 1 286 ? 15.931  -7.993  -38.802 1.00 74.75  ? 286  TRP B CZ3 1 
ATOM   6323 C CH2 . TRP B 1 286 ? 14.654  -7.864  -39.354 1.00 73.68  ? 286  TRP B CH2 1 
ATOM   6324 N N   . HIS B 1 287 ? 21.276  -12.422 -40.936 1.00 73.72  ? 287  HIS B N   1 
ATOM   6325 C CA  . HIS B 1 287 ? 22.461  -13.041 -40.370 1.00 68.76  ? 287  HIS B CA  1 
ATOM   6326 C C   . HIS B 1 287 ? 23.646  -12.093 -40.231 1.00 67.78  ? 287  HIS B C   1 
ATOM   6327 O O   . HIS B 1 287 ? 24.634  -12.433 -39.584 1.00 68.25  ? 287  HIS B O   1 
ATOM   6328 C CB  . HIS B 1 287 ? 22.827  -14.284 -41.169 1.00 71.48  ? 287  HIS B CB  1 
ATOM   6329 C CG  . HIS B 1 287 ? 21.763  -15.332 -41.135 1.00 79.05  ? 287  HIS B CG  1 
ATOM   6330 N ND1 . HIS B 1 287 ? 21.828  -16.490 -41.877 1.00 81.02  ? 287  HIS B ND1 1 
ATOM   6331 C CD2 . HIS B 1 287 ? 20.601  -15.391 -40.443 1.00 82.56  ? 287  HIS B CD2 1 
ATOM   6332 C CE1 . HIS B 1 287 ? 20.751  -17.219 -41.641 1.00 83.43  ? 287  HIS B CE1 1 
ATOM   6333 N NE2 . HIS B 1 287 ? 19.993  -16.578 -40.771 1.00 80.92  ? 287  HIS B NE2 1 
ATOM   6334 N N   . VAL B 1 288 ? 23.533  -10.894 -40.798 1.00 67.41  ? 288  VAL B N   1 
ATOM   6335 C CA  . VAL B 1 288 ? 24.655  -9.958  -40.789 1.00 65.49  ? 288  VAL B CA  1 
ATOM   6336 C C   . VAL B 1 288 ? 24.649  -8.958  -39.640 1.00 66.35  ? 288  VAL B C   1 
ATOM   6337 O O   . VAL B 1 288 ? 25.541  -8.115  -39.550 1.00 70.37  ? 288  VAL B O   1 
ATOM   6338 C CB  . VAL B 1 288 ? 24.751  -9.160  -42.088 1.00 53.81  ? 288  VAL B CB  1 
ATOM   6339 C CG1 . VAL B 1 288 ? 24.859  -10.098 -43.263 1.00 49.84  ? 288  VAL B CG1 1 
ATOM   6340 C CG2 . VAL B 1 288 ? 23.559  -8.231  -42.208 1.00 47.96  ? 288  VAL B CG2 1 
ATOM   6341 N N   . LEU B 1 289 ? 23.661  -9.031  -38.761 1.00 62.37  ? 289  LEU B N   1 
ATOM   6342 C CA  . LEU B 1 289 ? 23.689  -8.141  -37.614 1.00 62.66  ? 289  LEU B CA  1 
ATOM   6343 C C   . LEU B 1 289 ? 24.899  -8.496  -36.773 1.00 67.06  ? 289  LEU B C   1 
ATOM   6344 O O   . LEU B 1 289 ? 25.256  -9.672  -36.669 1.00 70.37  ? 289  LEU B O   1 
ATOM   6345 C CB  . LEU B 1 289 ? 22.409  -8.242  -36.788 1.00 55.44  ? 289  LEU B CB  1 
ATOM   6346 C CG  . LEU B 1 289 ? 21.169  -7.625  -37.428 1.00 49.79  ? 289  LEU B CG  1 
ATOM   6347 C CD1 . LEU B 1 289 ? 19.945  -8.077  -36.658 1.00 43.26  ? 289  LEU B CD1 1 
ATOM   6348 C CD2 . LEU B 1 289 ? 21.264  -6.090  -37.478 1.00 43.65  ? 289  LEU B CD2 1 
ATOM   6349 N N   . PRO B 1 290 ? 25.542  -7.475  -36.184 1.00 66.77  ? 290  PRO B N   1 
ATOM   6350 C CA  . PRO B 1 290 ? 26.719  -7.615  -35.318 1.00 65.82  ? 290  PRO B CA  1 
ATOM   6351 C C   . PRO B 1 290 ? 26.411  -8.232  -33.949 1.00 67.16  ? 290  PRO B C   1 
ATOM   6352 O O   . PRO B 1 290 ? 27.266  -8.912  -33.382 1.00 65.97  ? 290  PRO B O   1 
ATOM   6353 C CB  . PRO B 1 290 ? 27.209  -6.171  -35.163 1.00 57.85  ? 290  PRO B CB  1 
ATOM   6354 C CG  . PRO B 1 290 ? 26.007  -5.338  -35.390 1.00 52.17  ? 290  PRO B CG  1 
ATOM   6355 C CD  . PRO B 1 290 ? 25.215  -6.063  -36.436 1.00 59.59  ? 290  PRO B CD  1 
ATOM   6356 N N   . GLN B 1 291 ? 25.210  -8.005  -33.427 1.00 72.50  ? 291  GLN B N   1 
ATOM   6357 C CA  . GLN B 1 291 ? 24.825  -8.599  -32.146 1.00 77.32  ? 291  GLN B CA  1 
ATOM   6358 C C   . GLN B 1 291 ? 23.415  -9.178  -32.182 1.00 76.02  ? 291  GLN B C   1 
ATOM   6359 O O   . GLN B 1 291 ? 22.568  -8.756  -32.974 1.00 73.49  ? 291  GLN B O   1 
ATOM   6360 C CB  . GLN B 1 291 ? 24.900  -7.575  -30.993 1.00 77.38  ? 291  GLN B CB  1 
ATOM   6361 C CG  . GLN B 1 291 ? 26.275  -6.989  -30.698 1.00 78.79  ? 291  GLN B CG  1 
ATOM   6362 C CD  . GLN B 1 291 ? 26.531  -5.688  -31.435 1.00 76.61  ? 291  GLN B CD  1 
ATOM   6363 O OE1 . GLN B 1 291 ? 25.610  -5.070  -31.978 1.00 84.11  ? 291  GLN B OE1 1 
ATOM   6364 N NE2 . GLN B 1 291 ? 27.790  -5.269  -31.465 1.00 65.85  ? 291  GLN B NE2 1 
ATOM   6365 N N   . GLU B 1 292 ? 23.175  -10.141 -31.298 1.00 80.13  ? 292  GLU B N   1 
ATOM   6366 C CA  . GLU B 1 292 ? 21.828  -10.600 -30.992 1.00 74.59  ? 292  GLU B CA  1 
ATOM   6367 C C   . GLU B 1 292 ? 21.046  -9.404  -30.432 1.00 61.65  ? 292  GLU B C   1 
ATOM   6368 O O   . GLU B 1 292 ? 21.204  -9.036  -29.263 1.00 60.73  ? 292  GLU B O   1 
ATOM   6369 C CB  . GLU B 1 292 ? 21.877  -11.750 -29.966 1.00 63.36  ? 292  GLU B CB  1 
ATOM   6370 C CG  . GLU B 1 292 ? 20.560  -12.524 -29.819 1.00 66.70  ? 292  GLU B CG  1 
ATOM   6371 C CD  . GLU B 1 292 ? 20.263  -12.939 -28.376 1.00 88.91  ? 292  GLU B CD  1 
ATOM   6372 O OE1 . GLU B 1 292 ? 21.164  -12.820 -27.517 1.00 94.20  ? 292  GLU B OE1 1 
ATOM   6373 O OE2 . GLU B 1 292 ? 19.121  -13.375 -28.095 1.00 99.55  ? 292  GLU B OE2 1 
ATOM   6374 N N   . SER B 1 293 ? 20.212  -8.789  -31.262 1.00 57.94  ? 293  SER B N   1 
ATOM   6375 C CA  . SER B 1 293 ? 19.514  -7.581  -30.842 1.00 66.67  ? 293  SER B CA  1 
ATOM   6376 C C   . SER B 1 293 ? 18.005  -7.576  -31.106 1.00 64.64  ? 293  SER B C   1 
ATOM   6377 O O   . SER B 1 293 ? 17.457  -8.487  -31.740 1.00 56.04  ? 293  SER B O   1 
ATOM   6378 C CB  . SER B 1 293 ? 20.170  -6.342  -31.472 1.00 68.73  ? 293  SER B CB  1 
ATOM   6379 O OG  . SER B 1 293 ? 20.910  -6.675  -32.637 1.00 62.77  ? 293  SER B OG  1 
ATOM   6380 N N   . ILE B 1 294 ? 17.342  -6.549  -30.575 1.00 51.86  ? 294  ILE B N   1 
ATOM   6381 C CA  . ILE B 1 294 ? 16.022  -6.185  -31.041 1.00 43.62  ? 294  ILE B CA  1 
ATOM   6382 C C   . ILE B 1 294 ? 16.028  -4.719  -31.403 1.00 48.71  ? 294  ILE B C   1 
ATOM   6383 O O   . ILE B 1 294 ? 16.866  -3.958  -30.940 1.00 58.07  ? 294  ILE B O   1 
ATOM   6384 C CB  . ILE B 1 294 ? 14.918  -6.464  -30.016 1.00 54.01  ? 294  ILE B CB  1 
ATOM   6385 C CG1 . ILE B 1 294 ? 15.266  -5.840  -28.671 1.00 58.91  ? 294  ILE B CG1 1 
ATOM   6386 C CG2 . ILE B 1 294 ? 14.655  -7.966  -29.894 1.00 72.97  ? 294  ILE B CG2 1 
ATOM   6387 C CD1 . ILE B 1 294 ? 14.102  -5.837  -27.685 1.00 63.43  ? 294  ILE B CD1 1 
ATOM   6388 N N   . PHE B 1 295 ? 15.075  -4.332  -32.235 1.00 47.90  ? 295  PHE B N   1 
ATOM   6389 C CA  . PHE B 1 295 ? 15.007  -2.986  -32.773 1.00 38.26  ? 295  PHE B CA  1 
ATOM   6390 C C   . PHE B 1 295 ? 16.282  -2.644  -33.505 1.00 43.81  ? 295  PHE B C   1 
ATOM   6391 O O   . PHE B 1 295 ? 16.725  -1.508  -33.491 1.00 50.33  ? 295  PHE B O   1 
ATOM   6392 C CB  . PHE B 1 295 ? 14.710  -1.965  -31.684 1.00 44.25  ? 295  PHE B CB  1 
ATOM   6393 C CG  . PHE B 1 295 ? 13.740  -0.886  -32.111 1.00 40.31  ? 295  PHE B CG  1 
ATOM   6394 C CD1 . PHE B 1 295 ? 13.848  -0.292  -33.346 1.00 38.21  ? 295  PHE B CD1 1 
ATOM   6395 C CD2 . PHE B 1 295 ? 12.705  -0.488  -31.275 1.00 52.03  ? 295  PHE B CD2 1 
ATOM   6396 C CE1 . PHE B 1 295 ? 12.961  0.694   -33.729 1.00 45.28  ? 295  PHE B CE1 1 
ATOM   6397 C CE2 . PHE B 1 295 ? 11.806  0.500   -31.653 1.00 39.28  ? 295  PHE B CE2 1 
ATOM   6398 C CZ  . PHE B 1 295 ? 11.939  1.093   -32.871 1.00 41.77  ? 295  PHE B CZ  1 
ATOM   6399 N N   . ARG B 1 296 ? 16.870  -3.655  -34.138 1.00 54.39  ? 296  ARG B N   1 
ATOM   6400 C CA  . ARG B 1 296 ? 18.012  -3.477  -35.026 1.00 37.24  ? 296  ARG B CA  1 
ATOM   6401 C C   . ARG B 1 296 ? 17.660  -4.068  -36.381 1.00 52.73  ? 296  ARG B C   1 
ATOM   6402 O O   . ARG B 1 296 ? 17.002  -5.099  -36.447 1.00 72.94  ? 296  ARG B O   1 
ATOM   6403 C CB  . ARG B 1 296 ? 19.234  -4.180  -34.467 1.00 34.55  ? 296  ARG B CB  1 
ATOM   6404 C CG  . ARG B 1 296 ? 19.836  -3.503  -33.277 1.00 41.54  ? 296  ARG B CG  1 
ATOM   6405 C CD  . ARG B 1 296 ? 20.126  -2.054  -33.590 1.00 46.85  ? 296  ARG B CD  1 
ATOM   6406 N NE  . ARG B 1 296 ? 19.541  -1.195  -32.570 1.00 60.14  ? 296  ARG B NE  1 
ATOM   6407 C CZ  . ARG B 1 296 ? 20.231  -0.622  -31.597 1.00 53.83  ? 296  ARG B CZ  1 
ATOM   6408 N NH1 . ARG B 1 296 ? 21.551  -0.794  -31.525 1.00 54.10  ? 296  ARG B NH1 1 
ATOM   6409 N NH2 . ARG B 1 296 ? 19.595  0.126   -30.710 1.00 41.52  ? 296  ARG B NH2 1 
ATOM   6410 N N   . PHE B 1 297 ? 18.102  -3.423  -37.457 1.00 44.94  ? 297  PHE B N   1 
ATOM   6411 C CA  . PHE B 1 297 ? 17.752  -3.855  -38.803 1.00 43.70  ? 297  PHE B CA  1 
ATOM   6412 C C   . PHE B 1 297 ? 18.980  -3.896  -39.688 1.00 53.13  ? 297  PHE B C   1 
ATOM   6413 O O   . PHE B 1 297 ? 19.841  -3.040  -39.562 1.00 52.32  ? 297  PHE B O   1 
ATOM   6414 C CB  . PHE B 1 297 ? 16.695  -2.928  -39.373 1.00 44.67  ? 297  PHE B CB  1 
ATOM   6415 C CG  . PHE B 1 297 ? 15.560  -2.716  -38.442 1.00 49.55  ? 297  PHE B CG  1 
ATOM   6416 C CD1 . PHE B 1 297 ? 14.754  -3.785  -38.075 1.00 45.79  ? 297  PHE B CD1 1 
ATOM   6417 C CD2 . PHE B 1 297 ? 15.326  -1.470  -37.886 1.00 41.12  ? 297  PHE B CD2 1 
ATOM   6418 C CE1 . PHE B 1 297 ? 13.710  -3.604  -37.198 1.00 50.19  ? 297  PHE B CE1 1 
ATOM   6419 C CE2 . PHE B 1 297 ? 14.290  -1.279  -37.007 1.00 37.56  ? 297  PHE B CE2 1 
ATOM   6420 C CZ  . PHE B 1 297 ? 13.472  -2.348  -36.662 1.00 41.07  ? 297  PHE B CZ  1 
ATOM   6421 N N   . SER B 1 298 ? 19.052  -4.885  -40.582 1.00 53.47  ? 298  SER B N   1 
ATOM   6422 C CA  . SER B 1 298 ? 20.290  -5.170  -41.307 1.00 50.06  ? 298  SER B CA  1 
ATOM   6423 C C   . SER B 1 298 ? 20.681  -4.127  -42.340 1.00 48.31  ? 298  SER B C   1 
ATOM   6424 O O   . SER B 1 298 ? 21.827  -3.701  -42.389 1.00 51.36  ? 298  SER B O   1 
ATOM   6425 C CB  . SER B 1 298 ? 20.238  -6.542  -41.968 1.00 54.09  ? 298  SER B CB  1 
ATOM   6426 O OG  . SER B 1 298 ? 20.403  -7.557  -41.002 1.00 65.51  ? 298  SER B OG  1 
ATOM   6427 N N   . PHE B 1 299 ? 19.748  -3.730  -43.190 1.00 40.61  ? 299  PHE B N   1 
ATOM   6428 C CA  . PHE B 1 299 ? 20.106  -2.771  -44.216 1.00 45.15  ? 299  PHE B CA  1 
ATOM   6429 C C   . PHE B 1 299 ? 19.286  -1.499  -44.111 1.00 50.24  ? 299  PHE B C   1 
ATOM   6430 O O   . PHE B 1 299 ? 18.110  -1.466  -44.438 1.00 50.31  ? 299  PHE B O   1 
ATOM   6431 C CB  . PHE B 1 299 ? 20.058  -3.427  -45.595 1.00 42.48  ? 299  PHE B CB  1 
ATOM   6432 C CG  . PHE B 1 299 ? 20.998  -4.594  -45.710 1.00 45.90  ? 299  PHE B CG  1 
ATOM   6433 C CD1 . PHE B 1 299 ? 22.324  -4.398  -46.060 1.00 36.72  ? 299  PHE B CD1 1 
ATOM   6434 C CD2 . PHE B 1 299 ? 20.574  -5.878  -45.383 1.00 47.28  ? 299  PHE B CD2 1 
ATOM   6435 C CE1 . PHE B 1 299 ? 23.206  -5.465  -46.132 1.00 46.96  ? 299  PHE B CE1 1 
ATOM   6436 C CE2 . PHE B 1 299 ? 21.441  -6.953  -45.450 1.00 44.37  ? 299  PHE B CE2 1 
ATOM   6437 C CZ  . PHE B 1 299 ? 22.760  -6.755  -45.836 1.00 49.04  ? 299  PHE B CZ  1 
ATOM   6438 N N   . VAL B 1 300 ? 19.937  -0.459  -43.608 1.00 46.64  ? 300  VAL B N   1 
ATOM   6439 C CA  . VAL B 1 300 ? 19.291  0.815   -43.350 1.00 43.84  ? 300  VAL B CA  1 
ATOM   6440 C C   . VAL B 1 300 ? 20.110  1.862   -44.054 1.00 35.17  ? 300  VAL B C   1 
ATOM   6441 O O   . VAL B 1 300 ? 21.179  1.572   -44.570 1.00 49.11  ? 300  VAL B O   1 
ATOM   6442 C CB  . VAL B 1 300 ? 19.268  1.131   -41.837 1.00 37.80  ? 300  VAL B CB  1 
ATOM   6443 C CG1 . VAL B 1 300 ? 18.598  0.003   -41.064 1.00 36.41  ? 300  VAL B CG1 1 
ATOM   6444 C CG2 . VAL B 1 300 ? 20.670  1.317   -41.318 1.00 37.63  ? 300  VAL B CG2 1 
ATOM   6445 N N   . PRO B 1 301 ? 19.611  3.090   -44.097 1.00 50.26  ? 301  PRO B N   1 
ATOM   6446 C CA  . PRO B 1 301 ? 20.370  4.191   -44.693 1.00 42.36  ? 301  PRO B CA  1 
ATOM   6447 C C   . PRO B 1 301 ? 21.796  4.215   -44.181 1.00 51.14  ? 301  PRO B C   1 
ATOM   6448 O O   . PRO B 1 301 ? 22.062  3.753   -43.067 1.00 59.04  ? 301  PRO B O   1 
ATOM   6449 C CB  . PRO B 1 301 ? 19.612  5.412   -44.200 1.00 34.83  ? 301  PRO B CB  1 
ATOM   6450 C CG  . PRO B 1 301 ? 18.224  4.944   -44.146 1.00 46.46  ? 301  PRO B CG  1 
ATOM   6451 C CD  . PRO B 1 301 ? 18.265  3.510   -43.694 1.00 48.25  ? 301  PRO B CD  1 
ATOM   6452 N N   . VAL B 1 302 ? 22.706  4.737   -44.995 1.00 58.24  ? 302  VAL B N   1 
ATOM   6453 C CA  . VAL B 1 302 ? 24.124  4.802   -44.641 1.00 51.47  ? 302  VAL B CA  1 
ATOM   6454 C C   . VAL B 1 302 ? 24.598  6.249   -44.691 1.00 50.33  ? 302  VAL B C   1 
ATOM   6455 O O   . VAL B 1 302 ? 24.183  7.014   -45.564 1.00 54.22  ? 302  VAL B O   1 
ATOM   6456 C CB  . VAL B 1 302 ? 24.976  3.951   -45.604 1.00 39.81  ? 302  VAL B CB  1 
ATOM   6457 C CG1 . VAL B 1 302 ? 24.709  4.360   -47.046 1.00 40.18  ? 302  VAL B CG1 1 
ATOM   6458 C CG2 . VAL B 1 302 ? 26.455  4.080   -45.278 1.00 42.56  ? 302  VAL B CG2 1 
ATOM   6459 N N   . VAL B 1 303 ? 25.452  6.629   -43.745 1.00 45.78  ? 303  VAL B N   1 
ATOM   6460 C CA  . VAL B 1 303 ? 26.042  7.964   -43.765 1.00 50.02  ? 303  VAL B CA  1 
ATOM   6461 C C   . VAL B 1 303 ? 27.140  7.996   -44.834 1.00 55.11  ? 303  VAL B C   1 
ATOM   6462 O O   . VAL B 1 303 ? 28.291  7.645   -44.565 1.00 68.15  ? 303  VAL B O   1 
ATOM   6463 C CB  . VAL B 1 303 ? 26.623  8.346   -42.388 1.00 44.79  ? 303  VAL B CB  1 
ATOM   6464 C CG1 . VAL B 1 303 ? 26.966  9.833   -42.336 1.00 45.90  ? 303  VAL B CG1 1 
ATOM   6465 C CG2 . VAL B 1 303 ? 25.643  8.009   -41.303 1.00 40.99  ? 303  VAL B CG2 1 
ATOM   6466 N N   . ASP B 1 304 ? 26.767  8.404   -46.045 1.00 52.36  ? 304  ASP B N   1 
ATOM   6467 C CA  . ASP B 1 304 ? 27.662  8.374   -47.204 1.00 57.57  ? 304  ASP B CA  1 
ATOM   6468 C C   . ASP B 1 304 ? 28.353  9.706   -47.523 1.00 61.69  ? 304  ASP B C   1 
ATOM   6469 O O   . ASP B 1 304 ? 29.194  9.773   -48.415 1.00 67.17  ? 304  ASP B O   1 
ATOM   6470 C CB  . ASP B 1 304 ? 26.900  7.888   -48.443 1.00 57.38  ? 304  ASP B CB  1 
ATOM   6471 C CG  . ASP B 1 304 ? 25.666  8.730   -48.745 1.00 61.42  ? 304  ASP B CG  1 
ATOM   6472 O OD1 . ASP B 1 304 ? 25.302  9.561   -47.883 1.00 49.75  ? 304  ASP B OD1 1 
ATOM   6473 O OD2 . ASP B 1 304 ? 25.052  8.540   -49.832 1.00 60.44  ? 304  ASP B OD2 1 
ATOM   6474 N N   . GLY B 1 305 ? 28.002  10.759  -46.795 1.00 57.56  ? 305  GLY B N   1 
ATOM   6475 C CA  . GLY B 1 305 ? 28.506  12.084  -47.095 1.00 56.60  ? 305  GLY B CA  1 
ATOM   6476 C C   . GLY B 1 305 ? 27.952  12.580  -48.417 1.00 64.35  ? 305  GLY B C   1 
ATOM   6477 O O   . GLY B 1 305 ? 28.527  13.452  -49.054 1.00 53.65  ? 305  GLY B O   1 
ATOM   6478 N N   . ASP B 1 306 ? 26.822  12.018  -48.827 1.00 65.62  ? 306  ASP B N   1 
ATOM   6479 C CA  . ASP B 1 306 ? 26.180  12.385  -50.082 1.00 62.72  ? 306  ASP B CA  1 
ATOM   6480 C C   . ASP B 1 306 ? 24.727  12.776  -49.806 1.00 64.90  ? 306  ASP B C   1 
ATOM   6481 O O   . ASP B 1 306 ? 24.380  13.965  -49.753 1.00 71.98  ? 306  ASP B O   1 
ATOM   6482 C CB  . ASP B 1 306 ? 26.237  11.193  -51.043 1.00 61.88  ? 306  ASP B CB  1 
ATOM   6483 C CG  . ASP B 1 306 ? 25.823  11.545  -52.462 1.00 76.17  ? 306  ASP B CG  1 
ATOM   6484 O OD1 . ASP B 1 306 ? 25.360  12.684  -52.706 1.00 81.47  ? 306  ASP B OD1 1 
ATOM   6485 O OD2 . ASP B 1 306 ? 25.954  10.656  -53.336 1.00 80.83  ? 306  ASP B OD2 1 
ATOM   6486 N N   . PHE B 1 307 ? 23.876  11.769  -49.638 1.00 54.22  ? 307  PHE B N   1 
ATOM   6487 C CA  . PHE B 1 307 ? 22.492  12.020  -49.291 1.00 61.52  ? 307  PHE B CA  1 
ATOM   6488 C C   . PHE B 1 307 ? 22.510  12.635  -47.911 1.00 56.81  ? 307  PHE B C   1 
ATOM   6489 O O   . PHE B 1 307 ? 21.766  13.568  -47.614 1.00 63.17  ? 307  PHE B O   1 
ATOM   6490 C CB  . PHE B 1 307 ? 21.693  10.716  -49.278 1.00 61.43  ? 307  PHE B CB  1 
ATOM   6491 C CG  . PHE B 1 307 ? 20.203  10.919  -49.205 1.00 64.69  ? 307  PHE B CG  1 
ATOM   6492 C CD1 . PHE B 1 307 ? 19.600  11.328  -48.024 1.00 54.59  ? 307  PHE B CD1 1 
ATOM   6493 C CD2 . PHE B 1 307 ? 19.402  10.699  -50.319 1.00 61.62  ? 307  PHE B CD2 1 
ATOM   6494 C CE1 . PHE B 1 307 ? 18.228  11.509  -47.954 1.00 52.07  ? 307  PHE B CE1 1 
ATOM   6495 C CE2 . PHE B 1 307 ? 18.036  10.883  -50.255 1.00 56.85  ? 307  PHE B CE2 1 
ATOM   6496 C CZ  . PHE B 1 307 ? 17.447  11.287  -49.071 1.00 57.55  ? 307  PHE B CZ  1 
ATOM   6497 N N   . LEU B 1 308 ? 23.391  12.097  -47.078 1.00 48.27  ? 308  LEU B N   1 
ATOM   6498 C CA  . LEU B 1 308 ? 23.618  12.582  -45.732 1.00 47.55  ? 308  LEU B CA  1 
ATOM   6499 C C   . LEU B 1 308 ? 25.048  13.106  -45.624 1.00 51.86  ? 308  LEU B C   1 
ATOM   6500 O O   . LEU B 1 308 ? 25.982  12.309  -45.589 1.00 52.79  ? 308  LEU B O   1 
ATOM   6501 C CB  . LEU B 1 308 ? 23.429  11.421  -44.759 1.00 52.48  ? 308  LEU B CB  1 
ATOM   6502 C CG  . LEU B 1 308 ? 22.001  10.891  -44.605 1.00 50.89  ? 308  LEU B CG  1 
ATOM   6503 C CD1 . LEU B 1 308 ? 21.974  9.573   -43.862 1.00 47.04  ? 308  LEU B CD1 1 
ATOM   6504 C CD2 . LEU B 1 308 ? 21.122  11.914  -43.895 1.00 45.91  ? 308  LEU B CD2 1 
ATOM   6505 N N   . SER B 1 309 ? 25.221  14.432  -45.592 1.00 52.99  ? 309  SER B N   1 
ATOM   6506 C CA  . SER B 1 309 ? 26.555  15.044  -45.491 1.00 53.86  ? 309  SER B CA  1 
ATOM   6507 C C   . SER B 1 309 ? 27.308  14.458  -44.317 1.00 62.40  ? 309  SER B C   1 
ATOM   6508 O O   . SER B 1 309 ? 28.493  14.155  -44.411 1.00 74.19  ? 309  SER B O   1 
ATOM   6509 C CB  . SER B 1 309 ? 26.467  16.550  -45.258 1.00 53.24  ? 309  SER B CB  1 
ATOM   6510 O OG  . SER B 1 309 ? 25.267  17.075  -45.775 1.00 79.65  ? 309  SER B OG  1 
ATOM   6511 N N   . ASP B 1 310 ? 26.600  14.316  -43.202 1.00 56.87  ? 310  ASP B N   1 
ATOM   6512 C CA  . ASP B 1 310 ? 27.186  13.854  -41.959 1.00 55.62  ? 310  ASP B CA  1 
ATOM   6513 C C   . ASP B 1 310 ? 26.161  13.001  -41.246 1.00 57.15  ? 310  ASP B C   1 
ATOM   6514 O O   . ASP B 1 310 ? 25.148  12.643  -41.828 1.00 61.99  ? 310  ASP B O   1 
ATOM   6515 C CB  . ASP B 1 310 ? 27.558  15.046  -41.089 1.00 66.31  ? 310  ASP B CB  1 
ATOM   6516 C CG  . ASP B 1 310 ? 28.680  14.738  -40.134 1.00 68.21  ? 310  ASP B CG  1 
ATOM   6517 O OD1 . ASP B 1 310 ? 28.691  13.624  -39.578 1.00 66.36  ? 310  ASP B OD1 1 
ATOM   6518 O OD2 . ASP B 1 310 ? 29.556  15.605  -39.954 1.00 65.52  ? 310  ASP B OD2 1 
ATOM   6519 N N   . THR B 1 311 ? 26.415  12.670  -39.989 1.00 64.20  ? 311  THR B N   1 
ATOM   6520 C CA  . THR B 1 311 ? 25.449  11.900  -39.215 1.00 59.37  ? 311  THR B CA  1 
ATOM   6521 C C   . THR B 1 311 ? 24.232  12.760  -38.908 1.00 53.28  ? 311  THR B C   1 
ATOM   6522 O O   . THR B 1 311 ? 24.336  13.981  -38.784 1.00 50.53  ? 311  THR B O   1 
ATOM   6523 C CB  . THR B 1 311 ? 26.066  11.381  -37.904 1.00 55.30  ? 311  THR B CB  1 
ATOM   6524 O OG1 . THR B 1 311 ? 26.350  12.481  -37.034 1.00 58.08  ? 311  THR B OG1 1 
ATOM   6525 C CG2 . THR B 1 311 ? 27.358  10.644  -38.190 1.00 54.51  ? 311  THR B CG2 1 
ATOM   6526 N N   . PRO B 1 312 ? 23.064  12.129  -38.790 1.00 59.57  ? 312  PRO B N   1 
ATOM   6527 C CA  . PRO B 1 312 ? 21.863  12.913  -38.490 1.00 57.25  ? 312  PRO B CA  1 
ATOM   6528 C C   . PRO B 1 312 ? 22.072  13.772  -37.241 1.00 53.01  ? 312  PRO B C   1 
ATOM   6529 O O   . PRO B 1 312 ? 21.567  14.887  -37.151 1.00 54.90  ? 312  PRO B O   1 
ATOM   6530 C CB  . PRO B 1 312 ? 20.805  11.839  -38.246 1.00 50.51  ? 312  PRO B CB  1 
ATOM   6531 C CG  . PRO B 1 312 ? 21.287  10.657  -39.040 1.00 52.99  ? 312  PRO B CG  1 
ATOM   6532 C CD  . PRO B 1 312 ? 22.779  10.691  -38.926 1.00 63.96  ? 312  PRO B CD  1 
ATOM   6533 N N   . GLU B 1 313 ? 22.842  13.254  -36.295 1.00 55.36  ? 313  GLU B N   1 
ATOM   6534 C CA  A GLU B 1 313 ? 23.082  13.957  -35.036 0.55 57.94  ? 313  GLU B CA  1 
ATOM   6535 C CA  B GLU B 1 313 ? 23.090  13.943  -35.041 0.45 57.66  ? 313  GLU B CA  1 
ATOM   6536 C C   . GLU B 1 313 ? 23.895  15.222  -35.281 1.00 58.23  ? 313  GLU B C   1 
ATOM   6537 O O   . GLU B 1 313 ? 23.536  16.293  -34.817 1.00 48.63  ? 313  GLU B O   1 
ATOM   6538 C CB  A GLU B 1 313 ? 23.809  13.062  -34.034 0.55 54.41  ? 313  GLU B CB  1 
ATOM   6539 C CB  B GLU B 1 313 ? 23.817  13.002  -34.084 0.45 55.56  ? 313  GLU B CB  1 
ATOM   6540 C CG  A GLU B 1 313 ? 23.436  11.596  -34.138 0.55 57.32  ? 313  GLU B CG  1 
ATOM   6541 C CG  B GLU B 1 313 ? 23.233  11.584  -34.081 0.45 57.27  ? 313  GLU B CG  1 
ATOM   6542 C CD  A GLU B 1 313 ? 22.330  11.183  -33.184 0.55 54.03  ? 313  GLU B CD  1 
ATOM   6543 C CD  B GLU B 1 313 ? 23.424  10.846  -35.409 0.45 53.00  ? 313  GLU B CD  1 
ATOM   6544 O OE1 A GLU B 1 313 ? 22.195  11.807  -32.107 0.55 55.96  ? 313  GLU B OE1 1 
ATOM   6545 O OE1 B GLU B 1 313 ? 24.584  10.639  -35.824 0.45 57.35  ? 313  GLU B OE1 1 
ATOM   6546 O OE2 A GLU B 1 313 ? 21.616  10.212  -33.509 0.55 41.37  ? 313  GLU B OE2 1 
ATOM   6547 O OE2 B GLU B 1 313 ? 22.416  10.463  -36.036 0.45 34.55  ? 313  GLU B OE2 1 
ATOM   6548 N N   . ALA B 1 314 ? 24.993  15.097  -36.014 1.00 55.21  ? 314  ALA B N   1 
ATOM   6549 C CA  . ALA B 1 314 ? 25.779  16.266  -36.370 1.00 52.78  ? 314  ALA B CA  1 
ATOM   6550 C C   . ALA B 1 314 ? 24.871  17.251  -37.080 1.00 66.02  ? 314  ALA B C   1 
ATOM   6551 O O   . ALA B 1 314 ? 24.961  18.465  -36.885 1.00 70.85  ? 314  ALA B O   1 
ATOM   6552 C CB  . ALA B 1 314 ? 26.940  15.877  -37.283 1.00 42.17  ? 314  ALA B CB  1 
ATOM   6553 N N   . LEU B 1 315 ? 23.983  16.706  -37.902 1.00 61.08  ? 315  LEU B N   1 
ATOM   6554 C CA  . LEU B 1 315 ? 23.208  17.513  -38.816 1.00 53.59  ? 315  LEU B CA  1 
ATOM   6555 C C   . LEU B 1 315 ? 22.118  18.253  -38.085 1.00 51.65  ? 315  LEU B C   1 
ATOM   6556 O O   . LEU B 1 315 ? 21.861  19.425  -38.368 1.00 59.01  ? 315  LEU B O   1 
ATOM   6557 C CB  . LEU B 1 315 ? 22.605  16.640  -39.907 1.00 51.32  ? 315  LEU B CB  1 
ATOM   6558 C CG  . LEU B 1 315 ? 23.596  16.112  -40.944 1.00 49.89  ? 315  LEU B CG  1 
ATOM   6559 C CD1 . LEU B 1 315 ? 22.844  15.368  -42.013 1.00 40.58  ? 315  LEU B CD1 1 
ATOM   6560 C CD2 . LEU B 1 315 ? 24.415  17.229  -41.562 1.00 42.12  ? 315  LEU B CD2 1 
ATOM   6561 N N   . ILE B 1 316 ? 21.474  17.579  -37.140 1.00 36.03  ? 316  ILE B N   1 
ATOM   6562 C CA  . ILE B 1 316 ? 20.447  18.260  -36.369 1.00 48.89  ? 316  ILE B CA  1 
ATOM   6563 C C   . ILE B 1 316 ? 21.107  19.159  -35.339 1.00 61.85  ? 316  ILE B C   1 
ATOM   6564 O O   . ILE B 1 316 ? 20.551  20.183  -34.955 1.00 69.05  ? 316  ILE B O   1 
ATOM   6565 C CB  . ILE B 1 316 ? 19.423  17.311  -35.697 1.00 34.56  ? 316  ILE B CB  1 
ATOM   6566 C CG1 . ILE B 1 316 ? 20.063  16.522  -34.566 1.00 45.57  ? 316  ILE B CG1 1 
ATOM   6567 C CG2 . ILE B 1 316 ? 18.822  16.379  -36.706 1.00 32.02  ? 316  ILE B CG2 1 
ATOM   6568 C CD1 . ILE B 1 316 ? 19.116  15.482  -33.945 1.00 52.84  ? 316  ILE B CD1 1 
ATOM   6569 N N   . ASN B 1 317 ? 22.304  18.792  -34.906 1.00 61.10  ? 317  ASN B N   1 
ATOM   6570 C CA  . ASN B 1 317 ? 22.992  19.601  -33.906 1.00 65.13  ? 317  ASN B CA  1 
ATOM   6571 C C   . ASN B 1 317 ? 23.366  20.975  -34.416 1.00 67.26  ? 317  ASN B C   1 
ATOM   6572 O O   . ASN B 1 317 ? 23.582  21.881  -33.625 1.00 69.97  ? 317  ASN B O   1 
ATOM   6573 C CB  . ASN B 1 317 ? 24.222  18.889  -33.338 1.00 64.11  ? 317  ASN B CB  1 
ATOM   6574 C CG  . ASN B 1 317 ? 23.869  17.887  -32.244 1.00 65.26  ? 317  ASN B CG  1 
ATOM   6575 O OD1 . ASN B 1 317 ? 22.693  17.660  -31.932 1.00 66.65  ? 317  ASN B OD1 1 
ATOM   6576 N ND2 . ASN B 1 317 ? 24.888  17.273  -31.663 1.00 64.14  ? 317  ASN B ND2 1 
ATOM   6577 N N   . THR B 1 318 ? 23.428  21.143  -35.732 1.00 67.02  ? 318  THR B N   1 
ATOM   6578 C CA  . THR B 1 318 ? 23.873  22.420  -36.283 1.00 63.77  ? 318  THR B CA  1 
ATOM   6579 C C   . THR B 1 318 ? 23.103  22.908  -37.497 1.00 68.73  ? 318  THR B C   1 
ATOM   6580 O O   . THR B 1 318 ? 23.525  23.871  -38.132 1.00 69.71  ? 318  THR B O   1 
ATOM   6581 C CB  . THR B 1 318 ? 25.316  22.348  -36.749 1.00 65.66  ? 318  THR B CB  1 
ATOM   6582 O OG1 . THR B 1 318 ? 25.378  21.535  -37.928 1.00 65.03  ? 318  THR B OG1 1 
ATOM   6583 C CG2 . THR B 1 318 ? 26.191  21.758  -35.668 1.00 74.33  ? 318  THR B CG2 1 
ATOM   6584 N N   . GLY B 1 319 ? 22.006  22.252  -37.851 1.00 62.75  ? 319  GLY B N   1 
ATOM   6585 C CA  . GLY B 1 319 ? 21.227  22.730  -38.975 1.00 68.12  ? 319  GLY B CA  1 
ATOM   6586 C C   . GLY B 1 319 ? 20.523  24.033  -38.632 1.00 74.70  ? 319  GLY B C   1 
ATOM   6587 O O   . GLY B 1 319 ? 20.365  24.364  -37.462 1.00 79.71  ? 319  GLY B O   1 
ATOM   6588 N N   . ASP B 1 320 ? 20.111  24.780  -39.652 1.00 77.60  ? 320  ASP B N   1 
ATOM   6589 C CA  . ASP B 1 320 ? 19.271  25.957  -39.450 1.00 74.40  ? 320  ASP B CA  1 
ATOM   6590 C C   . ASP B 1 320 ? 17.845  25.647  -39.926 1.00 74.08  ? 320  ASP B C   1 
ATOM   6591 O O   . ASP B 1 320 ? 17.595  25.451  -41.121 1.00 69.09  ? 320  ASP B O   1 
ATOM   6592 C CB  . ASP B 1 320 ? 19.863  27.187  -40.157 1.00 65.26  ? 320  ASP B CB  1 
ATOM   6593 C CG  . ASP B 1 320 ? 18.928  28.400  -40.136 1.00 73.88  ? 320  ASP B CG  1 
ATOM   6594 O OD1 . ASP B 1 320 ? 18.056  28.478  -39.248 1.00 64.48  ? 320  ASP B OD1 1 
ATOM   6595 O OD2 . ASP B 1 320 ? 19.074  29.286  -41.011 1.00 77.76  ? 320  ASP B OD2 1 
ATOM   6596 N N   . PHE B 1 321 ? 16.914  25.590  -38.978 1.00 46.96  ? 321  PHE B N   1 
ATOM   6597 C CA  . PHE B 1 321 ? 15.546  25.225  -39.297 1.00 48.21  ? 321  PHE B CA  1 
ATOM   6598 C C   . PHE B 1 321 ? 14.567  26.399  -39.222 1.00 50.95  ? 321  PHE B C   1 
ATOM   6599 O O   . PHE B 1 321 ? 13.361  26.206  -39.063 1.00 51.28  ? 321  PHE B O   1 
ATOM   6600 C CB  . PHE B 1 321 ? 15.107  24.012  -38.451 1.00 57.95  ? 321  PHE B CB  1 
ATOM   6601 C CG  . PHE B 1 321 ? 16.052  22.837  -38.563 1.00 52.00  ? 321  PHE B CG  1 
ATOM   6602 C CD1 . PHE B 1 321 ? 16.011  22.000  -39.668 1.00 60.01  ? 321  PHE B CD1 1 
ATOM   6603 C CD2 . PHE B 1 321 ? 17.013  22.609  -37.597 1.00 57.08  ? 321  PHE B CD2 1 
ATOM   6604 C CE1 . PHE B 1 321 ? 16.896  20.940  -39.794 1.00 56.90  ? 321  PHE B CE1 1 
ATOM   6605 C CE2 . PHE B 1 321 ? 17.892  21.553  -37.716 1.00 65.46  ? 321  PHE B CE2 1 
ATOM   6606 C CZ  . PHE B 1 321 ? 17.829  20.714  -38.818 1.00 60.75  ? 321  PHE B CZ  1 
ATOM   6607 N N   . GLN B 1 322 ? 15.108  27.608  -39.378 1.00 68.91  ? 322  GLN B N   1 
ATOM   6608 C CA  . GLN B 1 322 ? 14.336  28.848  -39.449 1.00 63.40  ? 322  GLN B CA  1 
ATOM   6609 C C   . GLN B 1 322 ? 12.957  28.678  -40.063 1.00 68.94  ? 322  GLN B C   1 
ATOM   6610 O O   . GLN B 1 322 ? 11.966  29.165  -39.521 1.00 74.58  ? 322  GLN B O   1 
ATOM   6611 C CB  . GLN B 1 322 ? 15.099  29.889  -40.264 1.00 92.11  ? 322  GLN B CB  1 
ATOM   6612 C CG  . GLN B 1 322 ? 16.142  30.671  -39.487 1.00 113.76 ? 322  GLN B CG  1 
ATOM   6613 C CD  . GLN B 1 322 ? 15.526  31.574  -38.434 1.00 125.94 ? 322  GLN B CD  1 
ATOM   6614 O OE1 . GLN B 1 322 ? 14.495  31.243  -37.837 1.00 124.63 ? 322  GLN B OE1 1 
ATOM   6615 N NE2 . GLN B 1 322 ? 16.154  32.727  -38.203 1.00 127.63 ? 322  GLN B NE2 1 
ATOM   6616 N N   . ASP B 1 323 ? 12.880  27.995  -41.199 1.00 72.67  ? 323  ASP B N   1 
ATOM   6617 C CA  . ASP B 1 323 ? 11.620  27.982  -41.936 1.00 82.24  ? 323  ASP B CA  1 
ATOM   6618 C C   . ASP B 1 323 ? 10.897  26.646  -41.932 1.00 72.50  ? 323  ASP B C   1 
ATOM   6619 O O   . ASP B 1 323 ? 10.077  26.374  -42.816 1.00 63.83  ? 323  ASP B O   1 
ATOM   6620 C CB  . ASP B 1 323 ? 11.819  28.501  -43.365 1.00 95.98  ? 323  ASP B CB  1 
ATOM   6621 C CG  . ASP B 1 323 ? 11.940  30.025  -43.421 1.00 103.73 ? 323  ASP B CG  1 
ATOM   6622 O OD1 . ASP B 1 323 ? 11.115  30.713  -42.772 1.00 86.31  ? 323  ASP B OD1 1 
ATOM   6623 O OD2 . ASP B 1 323 ? 12.867  30.530  -44.099 1.00 118.21 ? 323  ASP B OD2 1 
ATOM   6624 N N   . LEU B 1 324 ? 11.183  25.825  -40.925 1.00 64.20  ? 324  LEU B N   1 
ATOM   6625 C CA  . LEU B 1 324 ? 10.562  24.511  -40.839 1.00 50.70  ? 324  LEU B CA  1 
ATOM   6626 C C   . LEU B 1 324 ? 9.376   24.478  -39.869 1.00 60.48  ? 324  LEU B C   1 
ATOM   6627 O O   . LEU B 1 324 ? 9.279   25.295  -38.951 1.00 73.24  ? 324  LEU B O   1 
ATOM   6628 C CB  . LEU B 1 324 ? 11.585  23.416  -40.485 1.00 42.08  ? 324  LEU B CB  1 
ATOM   6629 C CG  . LEU B 1 324 ? 10.958  22.005  -40.589 1.00 50.35  ? 324  LEU B CG  1 
ATOM   6630 C CD1 . LEU B 1 324 ? 10.401  21.786  -41.984 1.00 40.88  ? 324  LEU B CD1 1 
ATOM   6631 C CD2 . LEU B 1 324 ? 11.889  20.857  -40.215 1.00 37.81  ? 324  LEU B CD2 1 
ATOM   6632 N N   . GLN B 1 325 ? 8.478   23.527  -40.103 1.00 41.80  ? 325  GLN B N   1 
ATOM   6633 C CA  . GLN B 1 325 ? 7.349   23.258  -39.233 1.00 50.08  ? 325  GLN B CA  1 
ATOM   6634 C C   . GLN B 1 325 ? 7.149   21.741  -39.153 1.00 39.42  ? 325  GLN B C   1 
ATOM   6635 O O   . GLN B 1 325 ? 7.069   21.066  -40.178 1.00 40.56  ? 325  GLN B O   1 
ATOM   6636 C CB  . GLN B 1 325 ? 6.108   23.950  -39.771 1.00 42.69  ? 325  GLN B CB  1 
ATOM   6637 C CG  . GLN B 1 325 ? 6.353   25.405  -40.107 1.00 63.66  ? 325  GLN B CG  1 
ATOM   6638 C CD  . GLN B 1 325 ? 5.324   25.956  -41.077 1.00 70.25  ? 325  GLN B CD  1 
ATOM   6639 O OE1 . GLN B 1 325 ? 4.869   25.254  -41.982 1.00 57.07  ? 325  GLN B OE1 1 
ATOM   6640 N NE2 . GLN B 1 325 ? 4.947   27.218  -40.890 1.00 84.07  ? 325  GLN B NE2 1 
ATOM   6641 N N   . VAL B 1 326 ? 7.055   21.214  -37.936 1.00 39.25  ? 326  VAL B N   1 
ATOM   6642 C CA  . VAL B 1 326 ? 7.162   19.778  -37.734 1.00 51.91  ? 326  VAL B CA  1 
ATOM   6643 C C   . VAL B 1 326 ? 6.249   19.282  -36.646 1.00 42.27  ? 326  VAL B C   1 
ATOM   6644 O O   . VAL B 1 326 ? 6.151   19.888  -35.592 1.00 52.65  ? 326  VAL B O   1 
ATOM   6645 C CB  . VAL B 1 326 ? 8.590   19.378  -37.294 1.00 57.02  ? 326  VAL B CB  1 
ATOM   6646 C CG1 . VAL B 1 326 ? 8.931   17.983  -37.785 1.00 52.49  ? 326  VAL B CG1 1 
ATOM   6647 C CG2 . VAL B 1 326 ? 9.597   20.371  -37.797 1.00 68.21  ? 326  VAL B CG2 1 
ATOM   6648 N N   . LEU B 1 327 ? 5.622   18.142  -36.897 1.00 43.32  ? 327  LEU B N   1 
ATOM   6649 C CA  . LEU B 1 327 ? 4.807   17.462  -35.906 1.00 35.20  ? 327  LEU B CA  1 
ATOM   6650 C C   . LEU B 1 327 ? 5.504   16.161  -35.542 1.00 44.95  ? 327  LEU B C   1 
ATOM   6651 O O   . LEU B 1 327 ? 5.801   15.334  -36.408 1.00 52.01  ? 327  LEU B O   1 
ATOM   6652 C CB  . LEU B 1 327 ? 3.402   17.215  -36.452 1.00 34.09  ? 327  LEU B CB  1 
ATOM   6653 C CG  . LEU B 1 327 ? 2.416   16.379  -35.626 1.00 40.95  ? 327  LEU B CG  1 
ATOM   6654 C CD1 . LEU B 1 327 ? 2.267   16.887  -34.209 1.00 46.19  ? 327  LEU B CD1 1 
ATOM   6655 C CD2 . LEU B 1 327 ? 1.077   16.332  -36.307 1.00 34.93  ? 327  LEU B CD2 1 
ATOM   6656 N N   . VAL B 1 328 ? 5.781   15.998  -34.254 1.00 38.45  ? 328  VAL B N   1 
ATOM   6657 C CA  . VAL B 1 328 ? 6.561   14.882  -33.783 1.00 31.87  ? 328  VAL B CA  1 
ATOM   6658 C C   . VAL B 1 328 ? 5.821   14.188  -32.662 1.00 45.26  ? 328  VAL B C   1 
ATOM   6659 O O   . VAL B 1 328 ? 5.135   14.833  -31.866 1.00 42.28  ? 328  VAL B O   1 
ATOM   6660 C CB  . VAL B 1 328 ? 7.932   15.340  -33.266 1.00 39.53  ? 328  VAL B CB  1 
ATOM   6661 C CG1 . VAL B 1 328 ? 8.654   16.171  -34.313 1.00 41.16  ? 328  VAL B CG1 1 
ATOM   6662 C CG2 . VAL B 1 328 ? 7.768   16.142  -32.018 1.00 47.83  ? 328  VAL B CG2 1 
ATOM   6663 N N   . GLY B 1 329 ? 5.948   12.867  -32.589 1.00 47.04  ? 329  GLY B N   1 
ATOM   6664 C CA  . GLY B 1 329 ? 5.205   12.154  -31.577 1.00 42.75  ? 329  GLY B CA  1 
ATOM   6665 C C   . GLY B 1 329 ? 5.556   10.711  -31.349 1.00 49.22  ? 329  GLY B C   1 
ATOM   6666 O O   . GLY B 1 329 ? 6.220   10.067  -32.165 1.00 50.19  ? 329  GLY B O   1 
ATOM   6667 N N   . VAL B 1 330 ? 5.084   10.201  -30.217 1.00 54.71  ? 330  VAL B N   1 
ATOM   6668 C CA  . VAL B 1 330 ? 5.199   8.786   -29.902 1.00 44.38  ? 330  VAL B CA  1 
ATOM   6669 C C   . VAL B 1 330 ? 3.891   8.225   -29.404 1.00 47.83  ? 330  VAL B C   1 
ATOM   6670 O O   . VAL B 1 330 ? 2.919   8.945   -29.189 1.00 53.37  ? 330  VAL B O   1 
ATOM   6671 C CB  . VAL B 1 330 ? 6.149   8.558   -28.752 1.00 34.50  ? 330  VAL B CB  1 
ATOM   6672 C CG1 . VAL B 1 330 ? 7.543   8.973   -29.132 1.00 42.71  ? 330  VAL B CG1 1 
ATOM   6673 C CG2 . VAL B 1 330 ? 5.644   9.318   -27.519 1.00 33.33  ? 330  VAL B CG2 1 
ATOM   6674 N N   . VAL B 1 331 ? 3.905   6.921   -29.181 1.00 37.49  ? 331  VAL B N   1 
ATOM   6675 C CA  . VAL B 1 331 ? 2.839   6.254   -28.470 1.00 40.50  ? 331  VAL B CA  1 
ATOM   6676 C C   . VAL B 1 331 ? 3.294   5.900   -27.047 1.00 52.64  ? 331  VAL B C   1 
ATOM   6677 O O   . VAL B 1 331 ? 4.454   6.134   -26.668 1.00 52.87  ? 331  VAL B O   1 
ATOM   6678 C CB  . VAL B 1 331 ? 2.331   5.014   -29.247 1.00 49.62  ? 331  VAL B CB  1 
ATOM   6679 C CG1 . VAL B 1 331 ? 1.846   5.448   -30.617 1.00 36.42  ? 331  VAL B CG1 1 
ATOM   6680 C CG2 . VAL B 1 331 ? 3.418   3.945   -29.378 1.00 33.29  ? 331  VAL B CG2 1 
ATOM   6681 N N   . LYS B 1 332 ? 2.365   5.350   -26.267 1.00 54.51  ? 332  LYS B N   1 
ATOM   6682 C CA  . LYS B 1 332 ? 2.579   5.084   -24.848 1.00 47.85  ? 332  LYS B CA  1 
ATOM   6683 C C   . LYS B 1 332 ? 3.501   3.880   -24.591 1.00 49.19  ? 332  LYS B C   1 
ATOM   6684 O O   . LYS B 1 332 ? 4.210   3.835   -23.585 1.00 61.71  ? 332  LYS B O   1 
ATOM   6685 C CB  . LYS B 1 332 ? 1.222   4.913   -24.136 1.00 54.65  ? 332  LYS B CB  1 
ATOM   6686 C CG  . LYS B 1 332 ? 1.272   4.708   -22.611 1.00 55.75  ? 332  LYS B CG  1 
ATOM   6687 C CD  . LYS B 1 332 ? -0.138  4.552   -22.024 1.00 68.10  ? 332  LYS B CD  1 
ATOM   6688 C CE  . LYS B 1 332 ? -0.199  3.485   -20.911 1.00 79.86  ? 332  LYS B CE  1 
ATOM   6689 N NZ  . LYS B 1 332 ? -0.075  2.066   -21.391 1.00 77.82  ? 332  LYS B NZ  1 
ATOM   6690 N N   . ASP B 1 333 ? 3.520   2.921   -25.508 1.00 47.34  ? 333  ASP B N   1 
ATOM   6691 C CA  . ASP B 1 333 ? 4.220   1.668   -25.244 1.00 42.76  ? 333  ASP B CA  1 
ATOM   6692 C C   . ASP B 1 333 ? 5.129   1.263   -26.393 1.00 37.13  ? 333  ASP B C   1 
ATOM   6693 O O   . ASP B 1 333 ? 5.047   0.155   -26.916 1.00 59.96  ? 333  ASP B O   1 
ATOM   6694 C CB  . ASP B 1 333 ? 3.211   0.569   -24.892 1.00 39.78  ? 333  ASP B CB  1 
ATOM   6695 C CG  . ASP B 1 333 ? 2.422   0.896   -23.630 1.00 57.79  ? 333  ASP B CG  1 
ATOM   6696 O OD1 . ASP B 1 333 ? 3.029   0.892   -22.531 1.00 47.57  ? 333  ASP B OD1 1 
ATOM   6697 O OD2 . ASP B 1 333 ? 1.203   1.177   -23.730 1.00 52.19  ? 333  ASP B OD2 1 
ATOM   6698 N N   . GLU B 1 334 ? 6.006   2.178   -26.771 1.00 42.56  ? 334  GLU B N   1 
ATOM   6699 C CA  . GLU B 1 334 ? 6.851   2.003   -27.944 1.00 42.05  ? 334  GLU B CA  1 
ATOM   6700 C C   . GLU B 1 334 ? 7.614   0.683   -27.966 1.00 46.02  ? 334  GLU B C   1 
ATOM   6701 O O   . GLU B 1 334 ? 7.894   0.158   -29.027 1.00 49.52  ? 334  GLU B O   1 
ATOM   6702 C CB  . GLU B 1 334 ? 7.824   3.177   -28.057 1.00 33.40  ? 334  GLU B CB  1 
ATOM   6703 C CG  . GLU B 1 334 ? 7.143   4.509   -28.416 1.00 44.33  ? 334  GLU B CG  1 
ATOM   6704 C CD  . GLU B 1 334 ? 6.790   4.615   -29.895 1.00 45.71  ? 334  GLU B CD  1 
ATOM   6705 O OE1 . GLU B 1 334 ? 7.217   3.737   -30.656 1.00 52.96  ? 334  GLU B OE1 1 
ATOM   6706 O OE2 . GLU B 1 334 ? 6.087   5.562   -30.302 1.00 49.24  ? 334  GLU B OE2 1 
ATOM   6707 N N   . GLY B 1 335 ? 7.940   0.144   -26.798 1.00 41.06  ? 335  GLY B N   1 
ATOM   6708 C CA  . GLY B 1 335 ? 8.815   -1.007  -26.735 1.00 41.85  ? 335  GLY B CA  1 
ATOM   6709 C C   . GLY B 1 335 ? 8.119   -2.359  -26.773 1.00 47.69  ? 335  GLY B C   1 
ATOM   6710 O O   . GLY B 1 335 ? 8.692   -3.340  -27.241 1.00 48.81  ? 335  GLY B O   1 
ATOM   6711 N N   . SER B 1 336 ? 6.882   -2.412  -26.292 1.00 45.64  ? 336  SER B N   1 
ATOM   6712 C CA  . SER B 1 336 ? 6.214   -3.689  -26.053 1.00 53.55  ? 336  SER B CA  1 
ATOM   6713 C C   . SER B 1 336 ? 6.314   -4.639  -27.250 1.00 58.26  ? 336  SER B C   1 
ATOM   6714 O O   . SER B 1 336 ? 6.864   -5.735  -27.134 1.00 49.25  ? 336  SER B O   1 
ATOM   6715 C CB  . SER B 1 336 ? 4.751   -3.476  -25.631 1.00 53.30  ? 336  SER B CB  1 
ATOM   6716 O OG  . SER B 1 336 ? 4.091   -2.590  -26.510 1.00 64.09  ? 336  SER B OG  1 
ATOM   6717 N N   . TYR B 1 337 ? 5.796   -4.188  -28.390 1.00 49.29  ? 337  TYR B N   1 
ATOM   6718 C CA  . TYR B 1 337 ? 5.748   -4.959  -29.621 1.00 48.18  ? 337  TYR B CA  1 
ATOM   6719 C C   . TYR B 1 337 ? 7.007   -5.797  -29.885 1.00 43.32  ? 337  TYR B C   1 
ATOM   6720 O O   . TYR B 1 337 ? 6.912   -6.963  -30.275 1.00 56.58  ? 337  TYR B O   1 
ATOM   6721 C CB  . TYR B 1 337 ? 5.445   -4.018  -30.796 1.00 53.28  ? 337  TYR B CB  1 
ATOM   6722 C CG  . TYR B 1 337 ? 5.019   -4.706  -32.067 1.00 58.35  ? 337  TYR B CG  1 
ATOM   6723 C CD1 . TYR B 1 337 ? 5.917   -5.456  -32.807 1.00 58.23  ? 337  TYR B CD1 1 
ATOM   6724 C CD2 . TYR B 1 337 ? 3.717   -4.605  -32.533 1.00 66.47  ? 337  TYR B CD2 1 
ATOM   6725 C CE1 . TYR B 1 337 ? 5.529   -6.092  -33.984 1.00 50.57  ? 337  TYR B CE1 1 
ATOM   6726 C CE2 . TYR B 1 337 ? 3.317   -5.239  -33.714 1.00 60.12  ? 337  TYR B CE2 1 
ATOM   6727 C CZ  . TYR B 1 337 ? 4.231   -5.984  -34.437 1.00 47.62  ? 337  TYR B CZ  1 
ATOM   6728 O OH  . TYR B 1 337 ? 3.858   -6.615  -35.614 1.00 44.99  ? 337  TYR B OH  1 
ATOM   6729 N N   . PHE B 1 338 ? 8.174   -5.223  -29.632 1.00 41.47  ? 338  PHE B N   1 
ATOM   6730 C CA  . PHE B 1 338 ? 9.452   -5.843  -30.012 1.00 47.42  ? 338  PHE B CA  1 
ATOM   6731 C C   . PHE B 1 338 ? 9.890   -6.991  -29.141 1.00 50.54  ? 338  PHE B C   1 
ATOM   6732 O O   . PHE B 1 338 ? 10.626  -7.875  -29.590 1.00 43.79  ? 338  PHE B O   1 
ATOM   6733 C CB  . PHE B 1 338 ? 10.562  -4.798  -29.992 1.00 36.71  ? 338  PHE B CB  1 
ATOM   6734 C CG  . PHE B 1 338 ? 10.352  -3.723  -30.979 1.00 58.55  ? 338  PHE B CG  1 
ATOM   6735 C CD1 . PHE B 1 338 ? 10.805  -3.871  -32.280 1.00 52.47  ? 338  PHE B CD1 1 
ATOM   6736 C CD2 . PHE B 1 338 ? 9.645   -2.580  -30.632 1.00 65.63  ? 338  PHE B CD2 1 
ATOM   6737 C CE1 . PHE B 1 338 ? 10.586  -2.879  -33.213 1.00 45.62  ? 338  PHE B CE1 1 
ATOM   6738 C CE2 . PHE B 1 338 ? 9.423   -1.583  -31.554 1.00 56.87  ? 338  PHE B CE2 1 
ATOM   6739 C CZ  . PHE B 1 338 ? 9.893   -1.732  -32.849 1.00 53.88  ? 338  PHE B CZ  1 
ATOM   6740 N N   . LEU B 1 339 ? 9.473   -6.947  -27.882 1.00 42.27  ? 339  LEU B N   1 
ATOM   6741 C CA  . LEU B 1 339 ? 9.918   -7.926  -26.910 1.00 53.37  ? 339  LEU B CA  1 
ATOM   6742 C C   . LEU B 1 339 ? 9.517   -9.356  -27.299 1.00 52.73  ? 339  LEU B C   1 
ATOM   6743 O O   . LEU B 1 339 ? 10.298  -10.280 -27.095 1.00 48.82  ? 339  LEU B O   1 
ATOM   6744 C CB  . LEU B 1 339 ? 9.419   -7.564  -25.504 1.00 52.40  ? 339  LEU B CB  1 
ATOM   6745 C CG  . LEU B 1 339 ? 9.611   -6.101  -25.086 1.00 50.84  ? 339  LEU B CG  1 
ATOM   6746 C CD1 . LEU B 1 339 ? 9.029   -5.821  -23.691 1.00 54.00  ? 339  LEU B CD1 1 
ATOM   6747 C CD2 . LEU B 1 339 ? 11.078  -5.729  -25.148 1.00 48.11  ? 339  LEU B CD2 1 
ATOM   6748 N N   . VAL B 1 340 ? 8.323   -9.545  -27.864 1.00 54.95  ? 340  VAL B N   1 
ATOM   6749 C CA  . VAL B 1 340 ? 7.858   -10.915 -28.156 1.00 70.06  ? 340  VAL B CA  1 
ATOM   6750 C C   . VAL B 1 340 ? 8.694   -11.540 -29.263 1.00 66.39  ? 340  VAL B C   1 
ATOM   6751 O O   . VAL B 1 340 ? 8.538   -12.721 -29.593 1.00 61.37  ? 340  VAL B O   1 
ATOM   6752 C CB  . VAL B 1 340 ? 6.344   -11.020 -28.547 1.00 61.91  ? 340  VAL B CB  1 
ATOM   6753 C CG1 . VAL B 1 340 ? 5.444   -10.354 -27.511 1.00 53.83  ? 340  VAL B CG1 1 
ATOM   6754 C CG2 . VAL B 1 340 ? 6.102   -10.454 -29.931 1.00 61.58  ? 340  VAL B CG2 1 
ATOM   6755 N N   . TYR B 1 341 ? 9.598   -10.744 -29.823 1.00 54.38  ? 341  TYR B N   1 
ATOM   6756 C CA  . TYR B 1 341 ? 10.373  -11.203 -30.964 1.00 60.13  ? 341  TYR B CA  1 
ATOM   6757 C C   . TYR B 1 341 ? 11.779  -11.639 -30.578 1.00 71.92  ? 341  TYR B C   1 
ATOM   6758 O O   . TYR B 1 341 ? 12.754  -11.265 -31.223 1.00 85.04  ? 341  TYR B O   1 
ATOM   6759 C CB  . TYR B 1 341 ? 10.399  -10.149 -32.078 1.00 45.16  ? 341  TYR B CB  1 
ATOM   6760 C CG  . TYR B 1 341 ? 9.132   -10.095 -32.939 1.00 56.35  ? 341  TYR B CG  1 
ATOM   6761 C CD1 . TYR B 1 341 ? 8.952   -10.981 -34.001 1.00 53.71  ? 341  TYR B CD1 1 
ATOM   6762 C CD2 . TYR B 1 341 ? 8.128   -9.141  -32.704 1.00 55.22  ? 341  TYR B CD2 1 
ATOM   6763 C CE1 . TYR B 1 341 ? 7.812   -10.935 -34.790 1.00 57.42  ? 341  TYR B CE1 1 
ATOM   6764 C CE2 . TYR B 1 341 ? 6.979   -9.089  -33.493 1.00 49.81  ? 341  TYR B CE2 1 
ATOM   6765 C CZ  . TYR B 1 341 ? 6.832   -9.991  -34.535 1.00 58.58  ? 341  TYR B CZ  1 
ATOM   6766 O OH  . TYR B 1 341 ? 5.710   -9.964  -35.331 1.00 61.93  ? 341  TYR B OH  1 
ATOM   6767 N N   . GLY B 1 342 ? 11.878  -12.433 -29.519 1.00 78.17  ? 342  GLY B N   1 
ATOM   6768 C CA  . GLY B 1 342 ? 13.141  -13.061 -29.186 1.00 85.13  ? 342  GLY B CA  1 
ATOM   6769 C C   . GLY B 1 342 ? 13.773  -12.637 -27.881 1.00 71.03  ? 342  GLY B C   1 
ATOM   6770 O O   . GLY B 1 342 ? 14.929  -12.954 -27.607 1.00 83.20  ? 342  GLY B O   1 
ATOM   6771 N N   . VAL B 1 343 ? 13.013  -11.919 -27.073 1.00 53.17  ? 343  VAL B N   1 
ATOM   6772 C CA  . VAL B 1 343 ? 13.473  -11.530 -25.752 1.00 47.06  ? 343  VAL B CA  1 
ATOM   6773 C C   . VAL B 1 343 ? 12.923  -12.561 -24.792 1.00 57.07  ? 343  VAL B C   1 
ATOM   6774 O O   . VAL B 1 343 ? 11.718  -12.618 -24.561 1.00 61.16  ? 343  VAL B O   1 
ATOM   6775 C CB  . VAL B 1 343 ? 12.990  -10.100 -25.375 1.00 54.69  ? 343  VAL B CB  1 
ATOM   6776 C CG1 . VAL B 1 343 ? 13.536  -9.678  -24.013 1.00 41.30  ? 343  VAL B CG1 1 
ATOM   6777 C CG2 . VAL B 1 343 ? 13.412  -9.103  -26.445 1.00 49.64  ? 343  VAL B CG2 1 
ATOM   6778 N N   . PRO B 1 344 ? 13.810  -13.413 -24.257 1.00 73.80  ? 344  PRO B N   1 
ATOM   6779 C CA  . PRO B 1 344 ? 13.477  -14.586 -23.437 1.00 70.25  ? 344  PRO B CA  1 
ATOM   6780 C C   . PRO B 1 344 ? 12.404  -14.246 -22.413 1.00 79.75  ? 344  PRO B C   1 
ATOM   6781 O O   . PRO B 1 344 ? 12.527  -13.225 -21.723 1.00 81.03  ? 344  PRO B O   1 
ATOM   6782 C CB  . PRO B 1 344 ? 14.786  -14.877 -22.719 1.00 65.81  ? 344  PRO B CB  1 
ATOM   6783 C CG  . PRO B 1 344 ? 15.827  -14.385 -23.649 1.00 64.48  ? 344  PRO B CG  1 
ATOM   6784 C CD  . PRO B 1 344 ? 15.262  -13.198 -24.351 1.00 70.50  ? 344  PRO B CD  1 
ATOM   6785 N N   . GLY B 1 345 ? 11.364  -15.070 -22.328 1.00 74.52  ? 345  GLY B N   1 
ATOM   6786 C CA  . GLY B 1 345 ? 10.318  -14.850 -21.345 1.00 75.89  ? 345  GLY B CA  1 
ATOM   6787 C C   . GLY B 1 345 ? 9.200   -13.909 -21.768 1.00 72.97  ? 345  GLY B C   1 
ATOM   6788 O O   . GLY B 1 345 ? 8.358   -13.535 -20.953 1.00 66.22  ? 345  GLY B O   1 
ATOM   6789 N N   . PHE B 1 346 ? 9.180   -13.520 -23.037 1.00 51.22  ? 346  PHE B N   1 
ATOM   6790 C CA  . PHE B 1 346 ? 8.092   -12.692 -23.528 1.00 61.65  ? 346  PHE B CA  1 
ATOM   6791 C C   . PHE B 1 346 ? 7.318   -13.425 -24.595 1.00 69.39  ? 346  PHE B C   1 
ATOM   6792 O O   . PHE B 1 346 ? 7.866   -14.253 -25.327 1.00 63.83  ? 346  PHE B O   1 
ATOM   6793 C CB  . PHE B 1 346 ? 8.590   -11.351 -24.068 1.00 45.12  ? 346  PHE B CB  1 
ATOM   6794 C CG  . PHE B 1 346 ? 9.016   -10.378 -22.997 1.00 43.57  ? 346  PHE B CG  1 
ATOM   6795 C CD1 . PHE B 1 346 ? 10.293  -10.414 -22.480 1.00 43.88  ? 346  PHE B CD1 1 
ATOM   6796 C CD2 . PHE B 1 346 ? 8.136   -9.417  -22.531 1.00 71.15  ? 346  PHE B CD2 1 
ATOM   6797 C CE1 . PHE B 1 346 ? 10.689  -9.526  -21.516 1.00 47.74  ? 346  PHE B CE1 1 
ATOM   6798 C CE2 . PHE B 1 346 ? 8.526   -8.515  -21.566 1.00 66.33  ? 346  PHE B CE2 1 
ATOM   6799 C CZ  . PHE B 1 346 ? 9.808   -8.570  -21.057 1.00 62.87  ? 346  PHE B CZ  1 
ATOM   6800 N N   . SER B 1 347 ? 6.033   -13.099 -24.669 1.00 71.82  ? 347  SER B N   1 
ATOM   6801 C CA  . SER B 1 347 ? 5.090   -13.755 -25.555 1.00 64.29  ? 347  SER B CA  1 
ATOM   6802 C C   . SER B 1 347 ? 3.822   -12.939 -25.487 1.00 58.87  ? 347  SER B C   1 
ATOM   6803 O O   . SER B 1 347 ? 3.570   -12.278 -24.472 1.00 59.82  ? 347  SER B O   1 
ATOM   6804 C CB  . SER B 1 347 ? 4.798   -15.183 -25.078 1.00 66.31  ? 347  SER B CB  1 
ATOM   6805 O OG  . SER B 1 347 ? 3.862   -15.827 -25.938 1.00 58.59  ? 347  SER B OG  1 
ATOM   6806 N N   . LYS B 1 348 ? 3.026   -12.971 -26.557 1.00 52.45  ? 348  LYS B N   1 
ATOM   6807 C CA  . LYS B 1 348 ? 1.736   -12.288 -26.556 1.00 52.22  ? 348  LYS B CA  1 
ATOM   6808 C C   . LYS B 1 348 ? 0.636   -13.195 -25.997 1.00 64.21  ? 348  LYS B C   1 
ATOM   6809 O O   . LYS B 1 348 ? -0.512  -12.776 -25.843 1.00 74.28  ? 348  LYS B O   1 
ATOM   6810 C CB  . LYS B 1 348 ? 1.361   -11.820 -27.961 1.00 50.11  ? 348  LYS B CB  1 
ATOM   6811 C CG  . LYS B 1 348 ? 0.966   -12.941 -28.890 1.00 63.18  ? 348  LYS B CG  1 
ATOM   6812 C CD  . LYS B 1 348 ? -0.030  -12.494 -29.948 1.00 66.41  ? 348  LYS B CD  1 
ATOM   6813 C CE  . LYS B 1 348 ? -0.585  -13.687 -30.696 1.00 52.03  ? 348  LYS B CE  1 
ATOM   6814 N NZ  . LYS B 1 348 ? -1.130  -14.677 -29.735 1.00 82.87  ? 348  LYS B NZ  1 
ATOM   6815 N N   . ASP B 1 349 ? 0.990   -14.436 -25.687 1.00 57.41  ? 349  ASP B N   1 
ATOM   6816 C CA  . ASP B 1 349 ? -0.010  -15.401 -25.227 1.00 79.21  ? 349  ASP B CA  1 
ATOM   6817 C C   . ASP B 1 349 ? -0.021  -15.610 -23.704 1.00 84.07  ? 349  ASP B C   1 
ATOM   6818 O O   . ASP B 1 349 ? -0.795  -16.417 -23.190 1.00 85.79  ? 349  ASP B O   1 
ATOM   6819 C CB  . ASP B 1 349 ? 0.109   -16.730 -25.995 1.00 62.60  ? 349  ASP B CB  1 
ATOM   6820 C CG  . ASP B 1 349 ? -0.285  -16.592 -27.464 1.00 77.23  ? 349  ASP B CG  1 
ATOM   6821 O OD1 . ASP B 1 349 ? -1.210  -15.797 -27.768 1.00 68.25  ? 349  ASP B OD1 1 
ATOM   6822 O OD2 . ASP B 1 349 ? 0.338   -17.270 -28.314 1.00 76.97  ? 349  ASP B OD2 1 
ATOM   6823 N N   . ASN B 1 350 ? 0.841   -14.882 -22.997 1.00 82.43  ? 350  ASN B N   1 
ATOM   6824 C CA  . ASN B 1 350 ? 0.807   -14.825 -21.534 1.00 77.27  ? 350  ASN B CA  1 
ATOM   6825 C C   . ASN B 1 350 ? 1.273   -13.450 -21.046 1.00 75.80  ? 350  ASN B C   1 
ATOM   6826 O O   . ASN B 1 350 ? 1.907   -12.700 -21.788 1.00 74.01  ? 350  ASN B O   1 
ATOM   6827 C CB  . ASN B 1 350 ? 1.586   -15.990 -20.876 1.00 79.53  ? 350  ASN B CB  1 
ATOM   6828 C CG  . ASN B 1 350 ? 3.095   -15.955 -21.159 1.00 87.92  ? 350  ASN B CG  1 
ATOM   6829 O OD1 . ASN B 1 350 ? 3.695   -14.884 -21.299 1.00 80.31  ? 350  ASN B OD1 1 
ATOM   6830 N ND2 . ASN B 1 350 ? 3.715   -17.139 -21.231 1.00 65.25  ? 350  ASN B ND2 1 
ATOM   6831 N N   . GLU B 1 351 ? 0.944   -13.105 -19.808 1.00 80.60  ? 351  GLU B N   1 
ATOM   6832 C CA  . GLU B 1 351 ? 1.237   -11.766 -19.305 1.00 78.64  ? 351  GLU B CA  1 
ATOM   6833 C C   . GLU B 1 351 ? 2.734   -11.465 -19.178 1.00 77.11  ? 351  GLU B C   1 
ATOM   6834 O O   . GLU B 1 351 ? 3.119   -10.412 -18.669 1.00 72.89  ? 351  GLU B O   1 
ATOM   6835 C CB  . GLU B 1 351 ? 0.506   -11.520 -17.989 1.00 71.96  ? 351  GLU B CB  1 
ATOM   6836 C CG  . GLU B 1 351 ? -0.977  -11.300 -18.168 1.00 83.59  ? 351  GLU B CG  1 
ATOM   6837 C CD  . GLU B 1 351 ? -1.812  -12.154 -17.225 1.00 114.96 ? 351  GLU B CD  1 
ATOM   6838 O OE1 . GLU B 1 351 ? -1.256  -12.634 -16.211 1.00 126.44 ? 351  GLU B OE1 1 
ATOM   6839 O OE2 . GLU B 1 351 ? -3.020  -12.352 -17.500 1.00 122.69 ? 351  GLU B OE2 1 
ATOM   6840 N N   . SER B 1 352 ? 3.567   -12.386 -19.653 1.00 53.98  ? 352  SER B N   1 
ATOM   6841 C CA  . SER B 1 352 ? 5.009   -12.169 -19.730 1.00 58.76  ? 352  SER B CA  1 
ATOM   6842 C C   . SER B 1 352 ? 5.588   -11.501 -18.479 1.00 70.77  ? 352  SER B C   1 
ATOM   6843 O O   . SER B 1 352 ? 6.226   -10.435 -18.568 1.00 65.51  ? 352  SER B O   1 
ATOM   6844 C CB  . SER B 1 352 ? 5.370   -11.323 -20.962 1.00 52.70  ? 352  SER B CB  1 
ATOM   6845 O OG  . SER B 1 352 ? 4.770   -11.806 -22.152 1.00 49.29  ? 352  SER B OG  1 
ATOM   6846 N N   . LEU B 1 353 ? 5.361   -12.116 -17.319 1.00 70.19  ? 353  LEU B N   1 
ATOM   6847 C CA  . LEU B 1 353 ? 5.999   -11.642 -16.092 1.00 74.01  ? 353  LEU B CA  1 
ATOM   6848 C C   . LEU B 1 353 ? 7.399   -12.232 -16.007 1.00 73.53  ? 353  LEU B C   1 
ATOM   6849 O O   . LEU B 1 353 ? 7.578   -13.434 -16.148 1.00 77.49  ? 353  LEU B O   1 
ATOM   6850 C CB  . LEU B 1 353 ? 5.193   -11.999 -14.841 1.00 69.44  ? 353  LEU B CB  1 
ATOM   6851 C CG  . LEU B 1 353 ? 3.764   -11.455 -14.729 1.00 66.22  ? 353  LEU B CG  1 
ATOM   6852 C CD1 . LEU B 1 353 ? 3.199   -11.687 -13.348 1.00 71.58  ? 353  LEU B CD1 1 
ATOM   6853 C CD2 . LEU B 1 353 ? 3.699   -10.001 -15.059 1.00 54.05  ? 353  LEU B CD2 1 
ATOM   6854 N N   . ILE B 1 354 ? 8.390   -11.379 -15.785 1.00 66.98  ? 354  ILE B N   1 
ATOM   6855 C CA  . ILE B 1 354 ? 9.776   -11.817 -15.829 1.00 62.40  ? 354  ILE B CA  1 
ATOM   6856 C C   . ILE B 1 354 ? 10.478  -11.678 -14.487 1.00 66.40  ? 354  ILE B C   1 
ATOM   6857 O O   . ILE B 1 354 ? 10.023  -10.942 -13.608 1.00 60.81  ? 354  ILE B O   1 
ATOM   6858 C CB  . ILE B 1 354 ? 10.576  -11.030 -16.873 1.00 50.75  ? 354  ILE B CB  1 
ATOM   6859 C CG1 . ILE B 1 354 ? 10.482  -9.528  -16.565 1.00 64.78  ? 354  ILE B CG1 1 
ATOM   6860 C CG2 . ILE B 1 354 ? 10.077  -11.346 -18.264 1.00 50.05  ? 354  ILE B CG2 1 
ATOM   6861 C CD1 . ILE B 1 354 ? 11.022  -8.645  -17.626 1.00 44.40  ? 354  ILE B CD1 1 
ATOM   6862 N N   . SER B 1 355 ? 11.585  -12.407 -14.351 1.00 68.96  ? 355  SER B N   1 
ATOM   6863 C CA  . SER B 1 355 ? 12.460  -12.316 -13.194 1.00 74.19  ? 355  SER B CA  1 
ATOM   6864 C C   . SER B 1 355 ? 13.519  -11.232 -13.396 1.00 78.21  ? 355  SER B C   1 
ATOM   6865 O O   . SER B 1 355 ? 13.684  -10.681 -14.495 1.00 70.90  ? 355  SER B O   1 
ATOM   6866 C CB  . SER B 1 355 ? 13.145  -13.657 -12.942 1.00 76.55  ? 355  SER B CB  1 
ATOM   6867 O OG  . SER B 1 355 ? 13.973  -14.021 -14.035 1.00 82.61  ? 355  SER B OG  1 
ATOM   6868 N N   . ARG B 1 356 ? 14.242  -10.930 -12.327 1.00 74.42  ? 356  ARG B N   1 
ATOM   6869 C CA  . ARG B 1 356 ? 15.283  -9.924  -12.404 1.00 76.53  ? 356  ARG B CA  1 
ATOM   6870 C C   . ARG B 1 356 ? 16.316  -10.343 -13.449 1.00 77.48  ? 356  ARG B C   1 
ATOM   6871 O O   . ARG B 1 356 ? 16.783  -9.524  -14.249 1.00 76.07  ? 356  ARG B O   1 
ATOM   6872 C CB  . ARG B 1 356 ? 15.929  -9.738  -11.032 1.00 70.80  ? 356  ARG B CB  1 
ATOM   6873 C CG  . ARG B 1 356 ? 16.875  -8.574  -10.964 1.00 66.55  ? 356  ARG B CG  1 
ATOM   6874 C CD  . ARG B 1 356 ? 16.483  -7.594  -9.874  1.00 74.21  ? 356  ARG B CD  1 
ATOM   6875 N NE  . ARG B 1 356 ? 17.469  -6.522  -9.783  1.00 77.84  ? 356  ARG B NE  1 
ATOM   6876 C CZ  . ARG B 1 356 ? 17.359  -5.353  -10.405 1.00 76.84  ? 356  ARG B CZ  1 
ATOM   6877 N NH1 . ARG B 1 356 ? 16.291  -5.094  -11.149 1.00 61.92  ? 356  ARG B NH1 1 
ATOM   6878 N NH2 . ARG B 1 356 ? 18.313  -4.440  -10.271 1.00 83.63  ? 356  ARG B NH2 1 
ATOM   6879 N N   . ALA B 1 357 ? 16.638  -11.635 -13.448 1.00 68.69  ? 357  ALA B N   1 
ATOM   6880 C CA  . ALA B 1 357 ? 17.640  -12.213 -14.339 1.00 65.24  ? 357  ALA B CA  1 
ATOM   6881 C C   . ALA B 1 357 ? 17.298  -11.987 -15.795 1.00 63.60  ? 357  ALA B C   1 
ATOM   6882 O O   . ALA B 1 357 ? 18.110  -11.469 -16.560 1.00 58.64  ? 357  ALA B O   1 
ATOM   6883 C CB  . ALA B 1 357 ? 17.780  -13.705 -14.071 1.00 71.23  ? 357  ALA B CB  1 
ATOM   6884 N N   . GLN B 1 358 ? 16.098  -12.409 -16.179 1.00 66.57  ? 358  GLN B N   1 
ATOM   6885 C CA  . GLN B 1 358 ? 15.639  -12.212 -17.541 1.00 70.66  ? 358  GLN B CA  1 
ATOM   6886 C C   . GLN B 1 358 ? 15.638  -10.711 -17.840 1.00 55.60  ? 358  GLN B C   1 
ATOM   6887 O O   . GLN B 1 358 ? 15.846  -10.295 -18.973 1.00 51.00  ? 358  GLN B O   1 
ATOM   6888 C CB  . GLN B 1 358 ? 14.241  -12.798 -17.741 1.00 54.33  ? 358  GLN B CB  1 
ATOM   6889 C CG  . GLN B 1 358 ? 13.981  -14.072 -17.002 1.00 58.48  ? 358  GLN B CG  1 
ATOM   6890 C CD  . GLN B 1 358 ? 12.545  -14.585 -17.183 1.00 83.93  ? 358  GLN B CD  1 
ATOM   6891 O OE1 . GLN B 1 358 ? 11.716  -14.491 -16.273 1.00 77.60  ? 358  GLN B OE1 1 
ATOM   6892 N NE2 . GLN B 1 358 ? 12.256  -15.143 -18.354 1.00 59.80  ? 358  GLN B NE2 1 
ATOM   6893 N N   . PHE B 1 359 ? 15.407  -9.894  -16.825 1.00 52.54  ? 359  PHE B N   1 
ATOM   6894 C CA  . PHE B 1 359 ? 15.452  -8.454  -17.054 1.00 71.41  ? 359  PHE B CA  1 
ATOM   6895 C C   . PHE B 1 359 ? 16.861  -8.000  -17.455 1.00 69.39  ? 359  PHE B C   1 
ATOM   6896 O O   . PHE B 1 359 ? 17.025  -7.230  -18.392 1.00 59.15  ? 359  PHE B O   1 
ATOM   6897 C CB  . PHE B 1 359 ? 14.942  -7.678  -15.846 1.00 71.45  ? 359  PHE B CB  1 
ATOM   6898 C CG  . PHE B 1 359 ? 15.091  -6.188  -15.977 1.00 64.84  ? 359  PHE B CG  1 
ATOM   6899 C CD1 . PHE B 1 359 ? 14.447  -5.500  -16.981 1.00 64.23  ? 359  PHE B CD1 1 
ATOM   6900 C CD2 . PHE B 1 359 ? 15.874  -5.471  -15.088 1.00 58.95  ? 359  PHE B CD2 1 
ATOM   6901 C CE1 . PHE B 1 359 ? 14.583  -4.117  -17.098 1.00 52.39  ? 359  PHE B CE1 1 
ATOM   6902 C CE2 . PHE B 1 359 ? 16.007  -4.105  -15.208 1.00 46.73  ? 359  PHE B CE2 1 
ATOM   6903 C CZ  . PHE B 1 359 ? 15.362  -3.429  -16.215 1.00 41.39  ? 359  PHE B CZ  1 
ATOM   6904 N N   . LEU B 1 360 ? 17.875  -8.497  -16.759 1.00 69.06  ? 360  LEU B N   1 
ATOM   6905 C CA  . LEU B 1 360 ? 19.253  -8.225  -17.144 1.00 64.85  ? 360  LEU B CA  1 
ATOM   6906 C C   . LEU B 1 360 ? 19.562  -8.801  -18.512 1.00 62.90  ? 360  LEU B C   1 
ATOM   6907 O O   . LEU B 1 360 ? 20.172  -8.150  -19.352 1.00 63.71  ? 360  LEU B O   1 
ATOM   6908 C CB  . LEU B 1 360 ? 20.217  -8.812  -16.120 1.00 80.28  ? 360  LEU B CB  1 
ATOM   6909 C CG  . LEU B 1 360 ? 20.523  -7.877  -14.954 1.00 98.01  ? 360  LEU B CG  1 
ATOM   6910 C CD1 . LEU B 1 360 ? 21.041  -6.563  -15.525 1.00 110.95 ? 360  LEU B CD1 1 
ATOM   6911 C CD2 . LEU B 1 360 ? 19.300  -7.652  -14.067 1.00 89.63  ? 360  LEU B CD2 1 
ATOM   6912 N N   . ALA B 1 361 ? 19.148  -10.039 -18.730 1.00 65.97  ? 361  ALA B N   1 
ATOM   6913 C CA  . ALA B 1 361 ? 19.435  -10.704 -19.984 1.00 60.14  ? 361  ALA B CA  1 
ATOM   6914 C C   . ALA B 1 361 ? 18.875  -9.871  -21.129 1.00 64.75  ? 361  ALA B C   1 
ATOM   6915 O O   . ALA B 1 361 ? 19.518  -9.689  -22.166 1.00 61.26  ? 361  ALA B O   1 
ATOM   6916 C CB  . ALA B 1 361 ? 18.834  -12.091 -19.984 1.00 59.69  ? 361  ALA B CB  1 
ATOM   6917 N N   . GLY B 1 362 ? 17.676  -9.344  -20.913 1.00 67.72  ? 362  GLY B N   1 
ATOM   6918 C CA  . GLY B 1 362 ? 16.967  -8.605  -21.937 1.00 63.90  ? 362  GLY B CA  1 
ATOM   6919 C C   . GLY B 1 362 ? 17.505  -7.221  -22.222 1.00 60.73  ? 362  GLY B C   1 
ATOM   6920 O O   . GLY B 1 362 ? 17.265  -6.673  -23.288 1.00 64.24  ? 362  GLY B O   1 
ATOM   6921 N N   . VAL B 1 363 ? 18.228  -6.642  -21.275 1.00 66.10  ? 363  VAL B N   1 
ATOM   6922 C CA  . VAL B 1 363 ? 18.795  -5.315  -21.482 1.00 58.00  ? 363  VAL B CA  1 
ATOM   6923 C C   . VAL B 1 363 ? 19.980  -5.375  -22.444 1.00 63.50  ? 363  VAL B C   1 
ATOM   6924 O O   . VAL B 1 363 ? 20.130  -4.503  -23.297 1.00 76.00  ? 363  VAL B O   1 
ATOM   6925 C CB  . VAL B 1 363 ? 19.209  -4.660  -20.151 1.00 52.55  ? 363  VAL B CB  1 
ATOM   6926 C CG1 . VAL B 1 363 ? 19.838  -3.291  -20.403 1.00 55.12  ? 363  VAL B CG1 1 
ATOM   6927 C CG2 . VAL B 1 363 ? 18.005  -4.521  -19.260 1.00 42.98  ? 363  VAL B CG2 1 
ATOM   6928 N N   . ARG B 1 364 ? 20.812  -6.407  -22.309 1.00 56.35  ? 364  ARG B N   1 
ATOM   6929 C CA  . ARG B 1 364 ? 21.953  -6.597  -23.207 1.00 56.21  ? 364  ARG B CA  1 
ATOM   6930 C C   . ARG B 1 364 ? 21.504  -6.811  -24.646 1.00 64.01  ? 364  ARG B C   1 
ATOM   6931 O O   . ARG B 1 364 ? 22.310  -6.802  -25.566 1.00 75.18  ? 364  ARG B O   1 
ATOM   6932 C CB  . ARG B 1 364 ? 22.806  -7.776  -22.755 1.00 57.02  ? 364  ARG B CB  1 
ATOM   6933 C CG  . ARG B 1 364 ? 23.323  -7.644  -21.339 1.00 79.33  ? 364  ARG B CG  1 
ATOM   6934 C CD  . ARG B 1 364 ? 23.965  -6.283  -21.101 1.00 91.85  ? 364  ARG B CD  1 
ATOM   6935 N NE  . ARG B 1 364 ? 25.293  -6.161  -21.697 1.00 96.68  ? 364  ARG B NE  1 
ATOM   6936 C CZ  . ARG B 1 364 ? 26.418  -6.534  -21.091 1.00 100.57 ? 364  ARG B CZ  1 
ATOM   6937 N NH1 . ARG B 1 364 ? 26.379  -7.068  -19.876 1.00 97.89  ? 364  ARG B NH1 1 
ATOM   6938 N NH2 . ARG B 1 364 ? 27.584  -6.381  -21.703 1.00 106.10 ? 364  ARG B NH2 1 
ATOM   6939 N N   . ILE B 1 365 ? 20.207  -7.001  -24.836 1.00 64.48  ? 365  ILE B N   1 
ATOM   6940 C CA  . ILE B 1 365 ? 19.653  -7.207  -26.161 1.00 63.83  ? 365  ILE B CA  1 
ATOM   6941 C C   . ILE B 1 365 ? 19.078  -5.919  -26.737 1.00 69.18  ? 365  ILE B C   1 
ATOM   6942 O O   . ILE B 1 365 ? 19.326  -5.582  -27.893 1.00 79.79  ? 365  ILE B O   1 
ATOM   6943 C CB  . ILE B 1 365 ? 18.532  -8.231  -26.113 1.00 60.95  ? 365  ILE B CB  1 
ATOM   6944 C CG1 . ILE B 1 365 ? 19.100  -9.647  -26.172 1.00 45.20  ? 365  ILE B CG1 1 
ATOM   6945 C CG2 . ILE B 1 365 ? 17.542  -7.988  -27.251 1.00 56.93  ? 365  ILE B CG2 1 
ATOM   6946 C CD1 . ILE B 1 365 ? 18.009  -10.691 -26.111 1.00 49.99  ? 365  ILE B CD1 1 
ATOM   6947 N N   . GLY B 1 366 ? 18.297  -5.212  -25.929 1.00 57.50  ? 366  GLY B N   1 
ATOM   6948 C CA  . GLY B 1 366 ? 17.685  -3.972  -26.362 1.00 62.83  ? 366  GLY B CA  1 
ATOM   6949 C C   . GLY B 1 366 ? 18.671  -2.817  -26.312 1.00 62.28  ? 366  GLY B C   1 
ATOM   6950 O O   . GLY B 1 366 ? 18.331  -1.657  -26.571 1.00 44.63  ? 366  GLY B O   1 
ATOM   6951 N N   . VAL B 1 367 ? 19.911  -3.133  -25.971 1.00 47.88  ? 367  VAL B N   1 
ATOM   6952 C CA  . VAL B 1 367 ? 20.941  -2.119  -25.975 1.00 49.42  ? 367  VAL B CA  1 
ATOM   6953 C C   . VAL B 1 367 ? 22.239  -2.824  -26.282 1.00 42.23  ? 367  VAL B C   1 
ATOM   6954 O O   . VAL B 1 367 ? 23.162  -2.824  -25.478 1.00 47.45  ? 367  VAL B O   1 
ATOM   6955 C CB  . VAL B 1 367 ? 21.011  -1.355  -24.635 1.00 53.39  ? 367  VAL B CB  1 
ATOM   6956 C CG1 . VAL B 1 367 ? 22.013  -0.224  -24.722 1.00 49.89  ? 367  VAL B CG1 1 
ATOM   6957 C CG2 . VAL B 1 367 ? 19.640  -0.811  -24.261 1.00 45.44  ? 367  VAL B CG2 1 
ATOM   6958 N N   . PRO B 1 368 ? 22.304  -3.413  -27.480 1.00 44.08  ? 368  PRO B N   1 
ATOM   6959 C CA  . PRO B 1 368 ? 23.340  -4.319  -27.997 1.00 47.56  ? 368  PRO B CA  1 
ATOM   6960 C C   . PRO B 1 368 ? 24.724  -3.689  -27.977 1.00 54.91  ? 368  PRO B C   1 
ATOM   6961 O O   . PRO B 1 368 ? 25.733  -4.399  -27.937 1.00 57.10  ? 368  PRO B O   1 
ATOM   6962 C CB  . PRO B 1 368 ? 22.912  -4.550  -29.450 1.00 55.03  ? 368  PRO B CB  1 
ATOM   6963 C CG  . PRO B 1 368 ? 21.478  -4.182  -29.516 1.00 55.25  ? 368  PRO B CG  1 
ATOM   6964 C CD  . PRO B 1 368 ? 21.269  -3.112  -28.485 1.00 47.06  ? 368  PRO B CD  1 
ATOM   6965 N N   . GLN B 1 369 ? 24.762  -2.360  -28.002 1.00 55.00  ? 369  GLN B N   1 
ATOM   6966 C CA  . GLN B 1 369 ? 26.012  -1.619  -28.105 1.00 54.67  ? 369  GLN B CA  1 
ATOM   6967 C C   . GLN B 1 369 ? 26.555  -1.325  -26.729 1.00 65.74  ? 369  GLN B C   1 
ATOM   6968 O O   . GLN B 1 369 ? 27.712  -0.938  -26.574 1.00 86.15  ? 369  GLN B O   1 
ATOM   6969 C CB  . GLN B 1 369 ? 25.782  -0.299  -28.836 1.00 68.38  ? 369  GLN B CB  1 
ATOM   6970 C CG  . GLN B 1 369 ? 24.717  0.602   -28.184 1.00 85.49  ? 369  GLN B CG  1 
ATOM   6971 C CD  . GLN B 1 369 ? 23.298  0.083   -28.381 1.00 93.68  ? 369  GLN B CD  1 
ATOM   6972 O OE1 . GLN B 1 369 ? 23.093  -1.048  -28.827 1.00 117.95 ? 369  GLN B OE1 1 
ATOM   6973 N NE2 . GLN B 1 369 ? 22.315  0.909   -28.062 1.00 66.70  ? 369  GLN B NE2 1 
ATOM   6974 N N   . ALA B 1 370 ? 25.714  -1.512  -25.723 1.00 62.76  ? 370  ALA B N   1 
ATOM   6975 C CA  . ALA B 1 370 ? 26.056  -1.095  -24.374 1.00 62.72  ? 370  ALA B CA  1 
ATOM   6976 C C   . ALA B 1 370 ? 27.169  -1.936  -23.783 1.00 61.25  ? 370  ALA B C   1 
ATOM   6977 O O   . ALA B 1 370 ? 27.104  -3.162  -23.828 1.00 64.15  ? 370  ALA B O   1 
ATOM   6978 C CB  . ALA B 1 370 ? 24.827  -1.152  -23.482 1.00 65.92  ? 370  ALA B CB  1 
ATOM   6979 N N   . SER B 1 371 ? 28.178  -1.267  -23.224 1.00 54.82  ? 371  SER B N   1 
ATOM   6980 C CA  . SER B 1 371 ? 29.210  -1.923  -22.425 1.00 50.44  ? 371  SER B CA  1 
ATOM   6981 C C   . SER B 1 371 ? 28.615  -2.617  -21.200 1.00 63.99  ? 371  SER B C   1 
ATOM   6982 O O   . SER B 1 371 ? 27.437  -2.453  -20.898 1.00 72.61  ? 371  SER B O   1 
ATOM   6983 C CB  . SER B 1 371 ? 30.262  -0.907  -21.974 1.00 64.84  ? 371  SER B CB  1 
ATOM   6984 O OG  . SER B 1 371 ? 29.723  0.045   -21.067 1.00 74.27  ? 371  SER B OG  1 
ATOM   6985 N N   . ASP B 1 372 ? 29.429  -3.394  -20.492 1.00 77.67  ? 372  ASP B N   1 
ATOM   6986 C CA  . ASP B 1 372 ? 28.962  -4.046  -19.276 1.00 76.23  ? 372  ASP B CA  1 
ATOM   6987 C C   . ASP B 1 372 ? 28.422  -2.975  -18.357 1.00 82.30  ? 372  ASP B C   1 
ATOM   6988 O O   . ASP B 1 372 ? 27.289  -3.061  -17.875 1.00 88.39  ? 372  ASP B O   1 
ATOM   6989 C CB  . ASP B 1 372 ? 30.096  -4.808  -18.581 1.00 79.66  ? 372  ASP B CB  1 
ATOM   6990 C CG  . ASP B 1 372 ? 30.349  -6.179  -19.198 1.00 91.65  ? 372  ASP B CG  1 
ATOM   6991 O OD1 . ASP B 1 372 ? 30.169  -6.329  -20.429 1.00 90.94  ? 372  ASP B OD1 1 
ATOM   6992 O OD2 . ASP B 1 372 ? 30.728  -7.110  -18.448 1.00 94.88  ? 372  ASP B OD2 1 
ATOM   6993 N N   . LEU B 1 373 ? 29.237  -1.947  -18.147 1.00 74.45  ? 373  LEU B N   1 
ATOM   6994 C CA  . LEU B 1 373 ? 28.898  -0.877  -17.221 1.00 63.10  ? 373  LEU B CA  1 
ATOM   6995 C C   . LEU B 1 373 ? 27.742  -0.027  -17.705 1.00 68.49  ? 373  LEU B C   1 
ATOM   6996 O O   . LEU B 1 373 ? 26.963  0.486   -16.894 1.00 71.05  ? 373  LEU B O   1 
ATOM   6997 C CB  . LEU B 1 373 ? 30.101  0.021   -16.978 1.00 64.61  ? 373  LEU B CB  1 
ATOM   6998 C CG  . LEU B 1 373 ? 29.819  1.230   -16.083 1.00 65.98  ? 373  LEU B CG  1 
ATOM   6999 C CD1 . LEU B 1 373 ? 29.491  0.804   -14.657 1.00 69.35  ? 373  LEU B CD1 1 
ATOM   7000 C CD2 . LEU B 1 373 ? 30.993  2.184   -16.101 1.00 56.75  ? 373  LEU B CD2 1 
ATOM   7001 N N   . ALA B 1 374 ? 27.644  0.144   -19.020 1.00 62.78  ? 374  ALA B N   1 
ATOM   7002 C CA  . ALA B 1 374 ? 26.576  0.946   -19.596 1.00 61.10  ? 374  ALA B CA  1 
ATOM   7003 C C   . ALA B 1 374 ? 25.250  0.259   -19.324 1.00 63.55  ? 374  ALA B C   1 
ATOM   7004 O O   . ALA B 1 374 ? 24.247  0.907   -19.027 1.00 65.31  ? 374  ALA B O   1 
ATOM   7005 C CB  . ALA B 1 374 ? 26.788  1.119   -21.075 1.00 56.02  ? 374  ALA B CB  1 
ATOM   7006 N N   . ALA B 1 375 ? 25.266  -1.065  -19.420 1.00 57.92  ? 375  ALA B N   1 
ATOM   7007 C CA  . ALA B 1 375 ? 24.080  -1.862  -19.199 1.00 59.47  ? 375  ALA B CA  1 
ATOM   7008 C C   . ALA B 1 375 ? 23.700  -1.800  -17.729 1.00 63.01  ? 375  ALA B C   1 
ATOM   7009 O O   . ALA B 1 375 ? 22.544  -1.605  -17.378 1.00 69.22  ? 375  ALA B O   1 
ATOM   7010 C CB  . ALA B 1 375 ? 24.330  -3.295  -19.623 1.00 61.43  ? 375  ALA B CB  1 
ATOM   7011 N N   . GLU B 1 376 ? 24.674  -1.967  -16.853 1.00 67.00  ? 376  GLU B N   1 
ATOM   7012 C CA  . GLU B 1 376 ? 24.378  -1.865  -15.430 1.00 75.78  ? 376  GLU B CA  1 
ATOM   7013 C C   . GLU B 1 376 ? 23.696  -0.527  -15.107 1.00 71.74  ? 376  GLU B C   1 
ATOM   7014 O O   . GLU B 1 376 ? 22.752  -0.479  -14.325 1.00 73.61  ? 376  GLU B O   1 
ATOM   7015 C CB  . GLU B 1 376 ? 25.647  -2.043  -14.593 1.00 77.43  ? 376  GLU B CB  1 
ATOM   7016 C CG  . GLU B 1 376 ? 25.360  -2.410  -13.157 1.00 100.68 ? 376  GLU B CG  1 
ATOM   7017 C CD  . GLU B 1 376 ? 24.480  -3.645  -13.054 1.00 116.21 ? 376  GLU B CD  1 
ATOM   7018 O OE1 . GLU B 1 376 ? 24.704  -4.590  -13.846 1.00 120.92 ? 376  GLU B OE1 1 
ATOM   7019 O OE2 . GLU B 1 376 ? 23.564  -3.665  -12.196 1.00 114.12 ? 376  GLU B OE2 1 
ATOM   7020 N N   . ALA B 1 377 ? 24.191  0.553   -15.708 1.00 64.54  ? 377  ALA B N   1 
ATOM   7021 C CA  . ALA B 1 377 ? 23.611  1.880   -15.544 1.00 51.44  ? 377  ALA B CA  1 
ATOM   7022 C C   . ALA B 1 377 ? 22.122  1.880   -15.883 1.00 53.17  ? 377  ALA B C   1 
ATOM   7023 O O   . ALA B 1 377 ? 21.303  2.415   -15.138 1.00 58.53  ? 377  ALA B O   1 
ATOM   7024 C CB  . ALA B 1 377 ? 24.344  2.873   -16.426 1.00 46.57  ? 377  ALA B CB  1 
ATOM   7025 N N   . VAL B 1 378 ? 21.789  1.294   -17.029 1.00 50.46  ? 378  VAL B N   1 
ATOM   7026 C CA  . VAL B 1 378 ? 20.408  1.146   -17.460 1.00 44.39  ? 378  VAL B CA  1 
ATOM   7027 C C   . VAL B 1 378 ? 19.596  0.361   -16.417 1.00 54.73  ? 378  VAL B C   1 
ATOM   7028 O O   . VAL B 1 378 ? 18.590  0.843   -15.898 1.00 62.13  ? 378  VAL B O   1 
ATOM   7029 C CB  . VAL B 1 378 ? 20.345  0.460   -18.846 1.00 42.08  ? 378  VAL B CB  1 
ATOM   7030 C CG1 . VAL B 1 378 ? 18.933  0.044   -19.201 1.00 50.88  ? 378  VAL B CG1 1 
ATOM   7031 C CG2 . VAL B 1 378 ? 20.893  1.375   -19.906 1.00 44.21  ? 378  VAL B CG2 1 
ATOM   7032 N N   . VAL B 1 379 ? 20.050  -0.842  -16.098 1.00 52.22  ? 379  VAL B N   1 
ATOM   7033 C CA  . VAL B 1 379 ? 19.379  -1.665  -15.098 1.00 55.24  ? 379  VAL B CA  1 
ATOM   7034 C C   . VAL B 1 379 ? 19.100  -0.916  -13.780 1.00 45.31  ? 379  VAL B C   1 
ATOM   7035 O O   . VAL B 1 379 ? 17.999  -0.982  -13.239 1.00 43.28  ? 379  VAL B O   1 
ATOM   7036 C CB  . VAL B 1 379 ? 20.178  -2.955  -14.820 1.00 49.13  ? 379  VAL B CB  1 
ATOM   7037 C CG1 . VAL B 1 379 ? 19.467  -3.803  -13.817 1.00 41.68  ? 379  VAL B CG1 1 
ATOM   7038 C CG2 . VAL B 1 379 ? 20.365  -3.735  -16.102 1.00 56.49  ? 379  VAL B CG2 1 
ATOM   7039 N N   . LEU B 1 380 ? 20.095  -0.205  -13.268 1.00 51.51  ? 380  LEU B N   1 
ATOM   7040 C CA  . LEU B 1 380 ? 19.939  0.502   -12.005 1.00 54.76  ? 380  LEU B CA  1 
ATOM   7041 C C   . LEU B 1 380 ? 18.921  1.631   -12.145 1.00 59.20  ? 380  LEU B C   1 
ATOM   7042 O O   . LEU B 1 380 ? 18.157  1.932   -11.218 1.00 60.12  ? 380  LEU B O   1 
ATOM   7043 C CB  . LEU B 1 380 ? 21.290  1.030   -11.515 1.00 50.87  ? 380  LEU B CB  1 
ATOM   7044 C CG  . LEU B 1 380 ? 22.330  -0.065  -11.229 1.00 62.60  ? 380  LEU B CG  1 
ATOM   7045 C CD1 . LEU B 1 380 ? 23.594  0.508   -10.604 1.00 79.34  ? 380  LEU B CD1 1 
ATOM   7046 C CD2 . LEU B 1 380 ? 21.770  -1.160  -10.337 1.00 52.71  ? 380  LEU B CD2 1 
ATOM   7047 N N   . HIS B 1 381 ? 18.900  2.237   -13.324 1.00 50.20  ? 381  HIS B N   1 
ATOM   7048 C CA  . HIS B 1 381 ? 18.030  3.368   -13.571 1.00 49.46  ? 381  HIS B CA  1 
ATOM   7049 C C   . HIS B 1 381 ? 16.571  2.970   -13.696 1.00 49.63  ? 381  HIS B C   1 
ATOM   7050 O O   . HIS B 1 381 ? 15.682  3.683   -13.243 1.00 53.33  ? 381  HIS B O   1 
ATOM   7051 C CB  . HIS B 1 381 ? 18.446  4.076   -14.843 1.00 53.37  ? 381  HIS B CB  1 
ATOM   7052 C CG  . HIS B 1 381 ? 17.549  5.212   -15.211 1.00 54.38  ? 381  HIS B CG  1 
ATOM   7053 N ND1 . HIS B 1 381 ? 17.743  6.493   -14.738 1.00 50.56  ? 381  HIS B ND1 1 
ATOM   7054 C CD2 . HIS B 1 381 ? 16.447  5.260   -15.996 1.00 50.57  ? 381  HIS B CD2 1 
ATOM   7055 C CE1 . HIS B 1 381 ? 16.805  7.283   -15.228 1.00 53.70  ? 381  HIS B CE1 1 
ATOM   7056 N NE2 . HIS B 1 381 ? 16.006  6.561   -15.996 1.00 57.21  ? 381  HIS B NE2 1 
ATOM   7057 N N   . TYR B 1 382 ? 16.315  1.837   -14.332 1.00 50.36  ? 382  TYR B N   1 
ATOM   7058 C CA  . TYR B 1 382 ? 14.936  1.453   -14.591 1.00 49.25  ? 382  TYR B CA  1 
ATOM   7059 C C   . TYR B 1 382 ? 14.363  0.515   -13.532 1.00 59.94  ? 382  TYR B C   1 
ATOM   7060 O O   . TYR B 1 382 ? 13.153  0.261   -13.513 1.00 68.03  ? 382  TYR B O   1 
ATOM   7061 C CB  . TYR B 1 382 ? 14.781  0.843   -15.982 1.00 45.57  ? 382  TYR B CB  1 
ATOM   7062 C CG  . TYR B 1 382 ? 14.697  1.825   -17.138 1.00 45.31  ? 382  TYR B CG  1 
ATOM   7063 C CD1 . TYR B 1 382 ? 13.469  2.312   -17.581 1.00 36.35  ? 382  TYR B CD1 1 
ATOM   7064 C CD2 . TYR B 1 382 ? 15.843  2.226   -17.817 1.00 48.57  ? 382  TYR B CD2 1 
ATOM   7065 C CE1 . TYR B 1 382 ? 13.389  3.170   -18.661 1.00 46.42  ? 382  TYR B CE1 1 
ATOM   7066 C CE2 . TYR B 1 382 ? 15.773  3.092   -18.894 1.00 43.03  ? 382  TYR B CE2 1 
ATOM   7067 C CZ  . TYR B 1 382 ? 14.550  3.562   -19.314 1.00 48.48  ? 382  TYR B CZ  1 
ATOM   7068 O OH  . TYR B 1 382 ? 14.491  4.429   -20.387 1.00 50.88  ? 382  TYR B OH  1 
ATOM   7069 N N   . THR B 1 383 ? 15.216  0.004   -12.650 1.00 52.44  ? 383  THR B N   1 
ATOM   7070 C CA  . THR B 1 383 ? 14.710  -0.802  -11.553 1.00 54.47  ? 383  THR B CA  1 
ATOM   7071 C C   . THR B 1 383 ? 13.930  0.076   -10.588 1.00 56.21  ? 383  THR B C   1 
ATOM   7072 O O   . THR B 1 383 ? 14.348  1.190   -10.266 1.00 47.68  ? 383  THR B O   1 
ATOM   7073 C CB  . THR B 1 383 ? 15.821  -1.502  -10.800 1.00 54.20  ? 383  THR B CB  1 
ATOM   7074 O OG1 . THR B 1 383 ? 16.564  -2.305  -11.716 1.00 55.64  ? 383  THR B OG1 1 
ATOM   7075 C CG2 . THR B 1 383 ? 15.238  -2.389  -9.705  1.00 52.15  ? 383  THR B CG2 1 
ATOM   7076 N N   . ASP B 1 384 ? 12.775  -0.422  -10.164 1.00 52.76  ? 384  ASP B N   1 
ATOM   7077 C CA  . ASP B 1 384 ? 11.995  0.248   -9.144  1.00 57.34  ? 384  ASP B CA  1 
ATOM   7078 C C   . ASP B 1 384 ? 12.472  -0.249  -7.795  1.00 58.65  ? 384  ASP B C   1 
ATOM   7079 O O   . ASP B 1 384 ? 12.051  -1.303  -7.323  1.00 54.97  ? 384  ASP B O   1 
ATOM   7080 C CB  . ASP B 1 384 ? 10.509  -0.040  -9.308  1.00 58.70  ? 384  ASP B CB  1 
ATOM   7081 C CG  . ASP B 1 384 ? 9.661   0.683   -8.284  1.00 77.34  ? 384  ASP B CG  1 
ATOM   7082 O OD1 . ASP B 1 384 ? 10.231  1.402   -7.433  1.00 81.73  ? 384  ASP B OD1 1 
ATOM   7083 O OD2 . ASP B 1 384 ? 8.421   0.519   -8.321  1.00 86.98  ? 384  ASP B OD2 1 
ATOM   7084 N N   . TRP B 1 385 ? 13.351  0.524   -7.174  1.00 55.62  ? 385  TRP B N   1 
ATOM   7085 C CA  . TRP B 1 385 ? 13.983  0.081   -5.939  1.00 67.47  ? 385  TRP B CA  1 
ATOM   7086 C C   . TRP B 1 385 ? 13.033  -0.143  -4.770  1.00 70.28  ? 385  TRP B C   1 
ATOM   7087 O O   . TRP B 1 385 ? 13.458  -0.521  -3.683  1.00 83.42  ? 385  TRP B O   1 
ATOM   7088 C CB  . TRP B 1 385 ? 15.181  0.975   -5.594  1.00 61.86  ? 385  TRP B CB  1 
ATOM   7089 C CG  . TRP B 1 385 ? 16.208  0.789   -6.646  1.00 58.38  ? 385  TRP B CG  1 
ATOM   7090 C CD1 . TRP B 1 385 ? 16.533  1.652   -7.646  1.00 54.86  ? 385  TRP B CD1 1 
ATOM   7091 C CD2 . TRP B 1 385 ? 16.968  -0.394  -6.872  1.00 56.27  ? 385  TRP B CD2 1 
ATOM   7092 N NE1 . TRP B 1 385 ? 17.480  1.090   -8.466  1.00 50.57  ? 385  TRP B NE1 1 
ATOM   7093 C CE2 . TRP B 1 385 ? 17.762  -0.170  -8.009  1.00 58.73  ? 385  TRP B CE2 1 
ATOM   7094 C CE3 . TRP B 1 385 ? 17.067  -1.618  -6.210  1.00 57.90  ? 385  TRP B CE3 1 
ATOM   7095 C CZ2 . TRP B 1 385 ? 18.647  -1.123  -8.499  1.00 59.80  ? 385  TRP B CZ2 1 
ATOM   7096 C CZ3 . TRP B 1 385 ? 17.944  -2.562  -6.696  1.00 66.96  ? 385  TRP B CZ3 1 
ATOM   7097 C CH2 . TRP B 1 385 ? 18.721  -2.311  -7.831  1.00 61.93  ? 385  TRP B CH2 1 
ATOM   7098 N N   . LEU B 1 386 ? 11.740  0.040   -5.005  1.00 68.46  ? 386  LEU B N   1 
ATOM   7099 C CA  . LEU B 1 386 ? 10.754  -0.312  -3.989  1.00 81.17  ? 386  LEU B CA  1 
ATOM   7100 C C   . LEU B 1 386 ? 10.254  -1.736  -4.210  1.00 77.64  ? 386  LEU B C   1 
ATOM   7101 O O   . LEU B 1 386 ? 9.818   -2.410  -3.277  1.00 77.88  ? 386  LEU B O   1 
ATOM   7102 C CB  . LEU B 1 386 ? 9.594   0.680   -4.007  1.00 88.59  ? 386  LEU B CB  1 
ATOM   7103 C CG  . LEU B 1 386 ? 9.994   2.071   -3.523  1.00 89.86  ? 386  LEU B CG  1 
ATOM   7104 C CD1 . LEU B 1 386 ? 9.027   3.140   -4.014  1.00 85.44  ? 386  LEU B CD1 1 
ATOM   7105 C CD2 . LEU B 1 386 ? 10.069  2.053   -2.008  1.00 99.92  ? 386  LEU B CD2 1 
ATOM   7106 N N   . HIS B 1 387 ? 10.340  -2.179  -5.458  1.00 73.56  ? 387  HIS B N   1 
ATOM   7107 C CA  . HIS B 1 387 ? 9.871   -3.486  -5.873  1.00 74.96  ? 387  HIS B CA  1 
ATOM   7108 C C   . HIS B 1 387 ? 10.831  -3.958  -6.940  1.00 71.86  ? 387  HIS B C   1 
ATOM   7109 O O   . HIS B 1 387 ? 10.470  -4.105  -8.110  1.00 82.86  ? 387  HIS B O   1 
ATOM   7110 C CB  . HIS B 1 387 ? 8.467   -3.374  -6.452  1.00 85.93  ? 387  HIS B CB  1 
ATOM   7111 C CG  . HIS B 1 387 ? 7.603   -2.381  -5.740  1.00 83.32  ? 387  HIS B CG  1 
ATOM   7112 N ND1 . HIS B 1 387 ? 7.234   -1.178  -6.302  1.00 82.27  ? 387  HIS B ND1 1 
ATOM   7113 C CD2 . HIS B 1 387 ? 7.047   -2.405  -4.505  1.00 89.43  ? 387  HIS B CD2 1 
ATOM   7114 C CE1 . HIS B 1 387 ? 6.484   -0.507  -5.447  1.00 84.82  ? 387  HIS B CE1 1 
ATOM   7115 N NE2 . HIS B 1 387 ? 6.357   -1.228  -4.347  1.00 85.03  ? 387  HIS B NE2 1 
ATOM   7116 N N   . PRO B 1 388 ? 12.076  -4.176  -6.535  1.00 57.59  ? 388  PRO B N   1 
ATOM   7117 C CA  . PRO B 1 388 ? 13.185  -4.472  -7.442  1.00 60.05  ? 388  PRO B CA  1 
ATOM   7118 C C   . PRO B 1 388 ? 13.038  -5.827  -8.105  1.00 73.00  ? 388  PRO B C   1 
ATOM   7119 O O   . PRO B 1 388 ? 13.733  -6.105  -9.084  1.00 79.51  ? 388  PRO B O   1 
ATOM   7120 C CB  . PRO B 1 388 ? 14.403  -4.465  -6.517  1.00 68.58  ? 388  PRO B CB  1 
ATOM   7121 C CG  . PRO B 1 388 ? 13.853  -4.682  -5.144  1.00 65.24  ? 388  PRO B CG  1 
ATOM   7122 C CD  . PRO B 1 388 ? 12.493  -4.086  -5.127  1.00 52.91  ? 388  PRO B CD  1 
ATOM   7123 N N   . GLU B 1 389 ? 12.143  -6.659  -7.586  1.00 81.44  ? 389  GLU B N   1 
ATOM   7124 C CA  . GLU B 1 389 ? 11.995  -8.013  -8.107  1.00 81.33  ? 389  GLU B CA  1 
ATOM   7125 C C   . GLU B 1 389 ? 10.567  -8.314  -8.506  1.00 82.46  ? 389  GLU B C   1 
ATOM   7126 O O   . GLU B 1 389 ? 10.236  -9.448  -8.884  1.00 86.03  ? 389  GLU B O   1 
ATOM   7127 C CB  . GLU B 1 389 ? 12.503  -9.031  -7.096  1.00 71.62  ? 389  GLU B CB  1 
ATOM   7128 C CG  . GLU B 1 389 ? 13.910  -8.719  -6.645  1.00 82.40  ? 389  GLU B CG  1 
ATOM   7129 C CD  . GLU B 1 389 ? 14.753  -9.954  -6.464  1.00 98.15  ? 389  GLU B CD  1 
ATOM   7130 O OE1 . GLU B 1 389 ? 15.272  -10.478 -7.475  1.00 94.84  ? 389  GLU B OE1 1 
ATOM   7131 O OE2 . GLU B 1 389 ? 14.894  -10.402 -5.305  1.00 115.08 ? 389  GLU B OE2 1 
ATOM   7132 N N   . ASP B 1 390 ? 9.730   -7.285  -8.426  1.00 68.69  ? 390  ASP B N   1 
ATOM   7133 C CA  . ASP B 1 390 ? 8.349   -7.398  -8.857  1.00 62.69  ? 390  ASP B CA  1 
ATOM   7134 C C   . ASP B 1 390 ? 8.282   -7.655  -10.350 1.00 66.99  ? 390  ASP B C   1 
ATOM   7135 O O   . ASP B 1 390 ? 8.619   -6.785  -11.152 1.00 64.34  ? 390  ASP B O   1 
ATOM   7136 C CB  . ASP B 1 390 ? 7.573   -6.131  -8.546  1.00 55.43  ? 390  ASP B CB  1 
ATOM   7137 C CG  . ASP B 1 390 ? 6.191   -6.146  -9.156  1.00 58.88  ? 390  ASP B CG  1 
ATOM   7138 O OD1 . ASP B 1 390 ? 5.322   -6.856  -8.606  1.00 73.89  ? 390  ASP B OD1 1 
ATOM   7139 O OD2 . ASP B 1 390 ? 5.973   -5.481  -10.188 1.00 49.70  ? 390  ASP B OD2 1 
ATOM   7140 N N   . PRO B 1 391 ? 7.814   -8.849  -10.723 1.00 63.77  ? 391  PRO B N   1 
ATOM   7141 C CA  . PRO B 1 391 ? 7.677   -9.357  -12.095 1.00 66.37  ? 391  PRO B CA  1 
ATOM   7142 C C   . PRO B 1 391 ? 6.889   -8.445  -13.056 1.00 63.67  ? 391  PRO B C   1 
ATOM   7143 O O   . PRO B 1 391 ? 7.253   -8.366  -14.226 1.00 65.06  ? 391  PRO B O   1 
ATOM   7144 C CB  . PRO B 1 391 ? 6.954   -10.694 -11.902 1.00 72.70  ? 391  PRO B CB  1 
ATOM   7145 C CG  . PRO B 1 391 ? 6.334   -10.601 -10.532 1.00 73.32  ? 391  PRO B CG  1 
ATOM   7146 C CD  . PRO B 1 391 ? 7.273   -9.785  -9.728  1.00 63.61  ? 391  PRO B CD  1 
ATOM   7147 N N   . THR B 1 392 ? 5.828   -7.788  -12.595 1.00 63.00  ? 392  THR B N   1 
ATOM   7148 C CA  . THR B 1 392 ? 5.089   -6.870  -13.462 1.00 61.00  ? 392  THR B CA  1 
ATOM   7149 C C   . THR B 1 392 ? 5.922   -5.624  -13.745 1.00 60.27  ? 392  THR B C   1 
ATOM   7150 O O   . THR B 1 392 ? 6.016   -5.168  -14.879 1.00 58.22  ? 392  THR B O   1 
ATOM   7151 C CB  . THR B 1 392 ? 3.745   -6.419  -12.848 1.00 56.35  ? 392  THR B CB  1 
ATOM   7152 O OG1 . THR B 1 392 ? 2.875   -7.540  -12.697 1.00 72.33  ? 392  THR B OG1 1 
ATOM   7153 C CG2 . THR B 1 392 ? 3.071   -5.422  -13.739 1.00 50.14  ? 392  THR B CG2 1 
ATOM   7154 N N   . HIS B 1 393 ? 6.527   -5.055  -12.715 1.00 56.30  ? 393  HIS B N   1 
ATOM   7155 C CA  . HIS B 1 393 ? 7.323   -3.877  -12.971 1.00 65.93  ? 393  HIS B CA  1 
ATOM   7156 C C   . HIS B 1 393 ? 8.451   -4.226  -13.931 1.00 57.58  ? 393  HIS B C   1 
ATOM   7157 O O   . HIS B 1 393 ? 8.731   -3.481  -14.867 1.00 58.46  ? 393  HIS B O   1 
ATOM   7158 C CB  . HIS B 1 393 ? 7.885   -3.238  -11.694 1.00 78.09  ? 393  HIS B CB  1 
ATOM   7159 C CG  . HIS B 1 393 ? 8.794   -2.080  -11.978 1.00 92.29  ? 393  HIS B CG  1 
ATOM   7160 N ND1 . HIS B 1 393 ? 8.371   -0.958  -12.659 1.00 94.54  ? 393  HIS B ND1 1 
ATOM   7161 C CD2 . HIS B 1 393 ? 10.113  -1.899  -11.737 1.00 96.73  ? 393  HIS B CD2 1 
ATOM   7162 C CE1 . HIS B 1 393 ? 9.383   -0.119  -12.795 1.00 93.04  ? 393  HIS B CE1 1 
ATOM   7163 N NE2 . HIS B 1 393 ? 10.451  -0.666  -12.242 1.00 97.36  ? 393  HIS B NE2 1 
ATOM   7164 N N   . LEU B 1 394 ? 9.095   -5.362  -13.691 1.00 60.05  ? 394  LEU B N   1 
ATOM   7165 C CA  . LEU B 1 394 ? 10.248  -5.777  -14.487 1.00 61.92  ? 394  LEU B CA  1 
ATOM   7166 C C   . LEU B 1 394 ? 9.895   -5.905  -15.969 1.00 65.93  ? 394  LEU B C   1 
ATOM   7167 O O   . LEU B 1 394 ? 10.634  -5.456  -16.857 1.00 43.39  ? 394  LEU B O   1 
ATOM   7168 C CB  . LEU B 1 394 ? 10.820  -7.081  -13.941 1.00 61.93  ? 394  LEU B CB  1 
ATOM   7169 C CG  . LEU B 1 394 ? 11.586  -6.851  -12.637 1.00 66.28  ? 394  LEU B CG  1 
ATOM   7170 C CD1 . LEU B 1 394 ? 12.187  -8.140  -12.102 1.00 66.97  ? 394  LEU B CD1 1 
ATOM   7171 C CD2 . LEU B 1 394 ? 12.665  -5.803  -12.854 1.00 44.18  ? 394  LEU B CD2 1 
ATOM   7172 N N   . ARG B 1 395 ? 8.743   -6.506  -16.231 1.00 68.73  ? 395  ARG B N   1 
ATOM   7173 C CA  . ARG B 1 395 ? 8.247   -6.599  -17.588 1.00 60.10  ? 395  ARG B CA  1 
ATOM   7174 C C   . ARG B 1 395 ? 8.034   -5.211  -18.205 1.00 55.40  ? 395  ARG B C   1 
ATOM   7175 O O   . ARG B 1 395 ? 8.618   -4.890  -19.232 1.00 57.41  ? 395  ARG B O   1 
ATOM   7176 C CB  . ARG B 1 395 ? 6.970   -7.421  -17.615 1.00 57.14  ? 395  ARG B CB  1 
ATOM   7177 C CG  . ARG B 1 395 ? 6.236   -7.302  -18.887 1.00 60.22  ? 395  ARG B CG  1 
ATOM   7178 C CD  . ARG B 1 395 ? 5.105   -6.375  -18.670 1.00 62.73  ? 395  ARG B CD  1 
ATOM   7179 N NE  . ARG B 1 395 ? 3.918   -7.140  -18.349 1.00 62.60  ? 395  ARG B NE  1 
ATOM   7180 C CZ  . ARG B 1 395 ? 2.829   -6.605  -17.828 1.00 57.14  ? 395  ARG B CZ  1 
ATOM   7181 N NH1 . ARG B 1 395 ? 2.805   -5.307  -17.562 1.00 44.13  ? 395  ARG B NH1 1 
ATOM   7182 N NH2 . ARG B 1 395 ? 1.779   -7.369  -17.570 1.00 52.88  ? 395  ARG B NH2 1 
ATOM   7183 N N   . ASP B 1 396 ? 7.204   -4.396  -17.565 1.00 55.03  ? 396  ASP B N   1 
ATOM   7184 C CA  . ASP B 1 396 ? 6.944   -3.033  -18.017 1.00 48.30  ? 396  ASP B CA  1 
ATOM   7185 C C   . ASP B 1 396 ? 8.222   -2.193  -18.176 1.00 51.99  ? 396  ASP B C   1 
ATOM   7186 O O   . ASP B 1 396 ? 8.269   -1.266  -18.997 1.00 55.75  ? 396  ASP B O   1 
ATOM   7187 C CB  . ASP B 1 396 ? 5.995   -2.322  -17.047 1.00 47.56  ? 396  ASP B CB  1 
ATOM   7188 C CG  . ASP B 1 396 ? 4.548   -2.714  -17.236 1.00 55.82  ? 396  ASP B CG  1 
ATOM   7189 O OD1 . ASP B 1 396 ? 4.100   -2.847  -18.400 1.00 63.64  ? 396  ASP B OD1 1 
ATOM   7190 O OD2 . ASP B 1 396 ? 3.857   -2.874  -16.207 1.00 63.10  ? 396  ASP B OD2 1 
ATOM   7191 N N   . ALA B 1 397 ? 9.241   -2.506  -17.377 1.00 48.98  ? 397  ALA B N   1 
ATOM   7192 C CA  . ALA B 1 397 ? 10.516  -1.794  -17.436 1.00 48.53  ? 397  ALA B CA  1 
ATOM   7193 C C   . ALA B 1 397 ? 11.227  -2.141  -18.730 1.00 52.09  ? 397  ALA B C   1 
ATOM   7194 O O   . ALA B 1 397 ? 11.715  -1.276  -19.450 1.00 58.96  ? 397  ALA B O   1 
ATOM   7195 C CB  . ALA B 1 397 ? 11.384  -2.169  -16.258 1.00 33.92  ? 397  ALA B CB  1 
ATOM   7196 N N   . MET B 1 398 ? 11.286  -3.431  -19.009 1.00 63.58  ? 398  MET B N   1 
ATOM   7197 C CA  . MET B 1 398 ? 11.924  -3.932  -20.208 1.00 54.23  ? 398  MET B CA  1 
ATOM   7198 C C   . MET B 1 398 ? 11.386  -3.206  -21.448 1.00 47.20  ? 398  MET B C   1 
ATOM   7199 O O   . MET B 1 398 ? 12.156  -2.801  -22.312 1.00 45.49  ? 398  MET B O   1 
ATOM   7200 C CB  . MET B 1 398 ? 11.711  -5.450  -20.289 1.00 50.08  ? 398  MET B CB  1 
ATOM   7201 C CG  . MET B 1 398 ? 12.555  -6.175  -21.321 1.00 52.24  ? 398  MET B CG  1 
ATOM   7202 S SD  . MET B 1 398 ? 14.305  -5.785  -21.216 1.00 59.58  ? 398  MET B SD  1 
ATOM   7203 C CE  . MET B 1 398 ? 14.410  -4.418  -22.371 1.00 88.26  ? 398  MET B CE  1 
ATOM   7204 N N   . SER B 1 399 ? 10.065  -3.042  -21.526 1.00 45.85  ? 399  SER B N   1 
ATOM   7205 C CA  . SER B 1 399 ? 9.441   -2.324  -22.632 1.00 43.76  ? 399  SER B CA  1 
ATOM   7206 C C   . SER B 1 399 ? 9.919   -0.883  -22.721 1.00 49.44  ? 399  SER B C   1 
ATOM   7207 O O   . SER B 1 399 ? 10.348  -0.426  -23.778 1.00 62.12  ? 399  SER B O   1 
ATOM   7208 C CB  . SER B 1 399 ? 7.929   -2.318  -22.463 1.00 51.43  ? 399  SER B CB  1 
ATOM   7209 O OG  . SER B 1 399 ? 7.364   -1.204  -23.134 1.00 53.84  ? 399  SER B OG  1 
ATOM   7210 N N   . ALA B 1 400 ? 9.825   -0.177  -21.595 1.00 40.76  ? 400  ALA B N   1 
ATOM   7211 C CA  . ALA B 1 400 ? 10.258  1.216   -21.452 1.00 40.41  ? 400  ALA B CA  1 
ATOM   7212 C C   . ALA B 1 400 ? 11.686  1.445   -21.939 1.00 45.04  ? 400  ALA B C   1 
ATOM   7213 O O   . ALA B 1 400 ? 11.961  2.357   -22.717 1.00 53.34  ? 400  ALA B O   1 
ATOM   7214 C CB  . ALA B 1 400 ? 10.126  1.648   -19.997 1.00 31.22  ? 400  ALA B CB  1 
ATOM   7215 N N   . VAL B 1 401 ? 12.597  0.614   -21.467 1.00 40.46  ? 401  VAL B N   1 
ATOM   7216 C CA  . VAL B 1 401 ? 13.975  0.673   -21.919 1.00 49.66  ? 401  VAL B CA  1 
ATOM   7217 C C   . VAL B 1 401 ? 14.057  0.689   -23.447 1.00 47.92  ? 401  VAL B C   1 
ATOM   7218 O O   . VAL B 1 401 ? 14.607  1.619   -24.031 1.00 48.06  ? 401  VAL B O   1 
ATOM   7219 C CB  . VAL B 1 401 ? 14.795  -0.496  -21.319 1.00 44.81  ? 401  VAL B CB  1 
ATOM   7220 C CG1 . VAL B 1 401 ? 16.101  -0.710  -22.081 1.00 34.02  ? 401  VAL B CG1 1 
ATOM   7221 C CG2 . VAL B 1 401 ? 15.058  -0.229  -19.842 1.00 32.07  ? 401  VAL B CG2 1 
ATOM   7222 N N   . VAL B 1 402 ? 13.486  -0.335  -24.076 1.00 35.74  ? 402  VAL B N   1 
ATOM   7223 C CA  . VAL B 1 402 ? 13.507  -0.501  -25.523 1.00 25.54  ? 402  VAL B CA  1 
ATOM   7224 C C   . VAL B 1 402 ? 12.800  0.626   -26.253 1.00 37.08  ? 402  VAL B C   1 
ATOM   7225 O O   . VAL B 1 402 ? 13.217  1.027   -27.328 1.00 42.33  ? 402  VAL B O   1 
ATOM   7226 C CB  . VAL B 1 402 ? 12.838  -1.838  -25.929 1.00 34.81  ? 402  VAL B CB  1 
ATOM   7227 C CG1 . VAL B 1 402 ? 12.701  -1.935  -27.428 1.00 27.76  ? 402  VAL B CG1 1 
ATOM   7228 C CG2 . VAL B 1 402 ? 13.636  -3.034  -25.378 1.00 33.67  ? 402  VAL B CG2 1 
ATOM   7229 N N   . GLY B 1 403 ? 11.712  1.126   -25.682 1.00 36.18  ? 403  GLY B N   1 
ATOM   7230 C CA  . GLY B 1 403 ? 10.978  2.202   -26.317 1.00 43.28  ? 403  GLY B CA  1 
ATOM   7231 C C   . GLY B 1 403 ? 11.706  3.534   -26.169 1.00 45.19  ? 403  GLY B C   1 
ATOM   7232 O O   . GLY B 1 403 ? 11.705  4.358   -27.072 1.00 40.11  ? 403  GLY B O   1 
ATOM   7233 N N   . ASP B 1 404 ? 12.330  3.735   -25.018 1.00 38.49  ? 404  ASP B N   1 
ATOM   7234 C CA  . ASP B 1 404 ? 12.981  4.997   -24.704 1.00 43.14  ? 404  ASP B CA  1 
ATOM   7235 C C   . ASP B 1 404 ? 14.281  5.071   -25.465 1.00 42.34  ? 404  ASP B C   1 
ATOM   7236 O O   . ASP B 1 404 ? 14.618  6.093   -26.069 1.00 31.13  ? 404  ASP B O   1 
ATOM   7237 C CB  . ASP B 1 404 ? 13.245  5.091   -23.196 1.00 33.23  ? 404  ASP B CB  1 
ATOM   7238 C CG  . ASP B 1 404 ? 11.965  5.200   -22.387 1.00 50.80  ? 404  ASP B CG  1 
ATOM   7239 O OD1 . ASP B 1 404 ? 10.859  5.105   -22.975 1.00 66.49  ? 404  ASP B OD1 1 
ATOM   7240 O OD2 . ASP B 1 404 ? 12.062  5.366   -21.157 1.00 62.00  ? 404  ASP B OD2 1 
ATOM   7241 N N   . HIS B 1 405 ? 14.992  3.952   -25.448 1.00 48.50  ? 405  HIS B N   1 
ATOM   7242 C CA  . HIS B 1 405 ? 16.250  3.817   -26.156 1.00 42.09  ? 405  HIS B CA  1 
ATOM   7243 C C   . HIS B 1 405 ? 16.046  4.126   -27.637 1.00 48.26  ? 405  HIS B C   1 
ATOM   7244 O O   . HIS B 1 405 ? 16.721  4.989   -28.182 1.00 63.24  ? 405  HIS B O   1 
ATOM   7245 C CB  . HIS B 1 405 ? 16.823  2.409   -25.945 1.00 42.52  ? 405  HIS B CB  1 
ATOM   7246 C CG  . HIS B 1 405 ? 18.080  2.149   -26.703 1.00 22.61  ? 405  HIS B CG  1 
ATOM   7247 N ND1 . HIS B 1 405 ? 19.297  2.663   -26.321 1.00 61.66  ? 405  HIS B ND1 1 
ATOM   7248 C CD2 . HIS B 1 405 ? 18.307  1.466   -27.846 1.00 30.82  ? 405  HIS B CD2 1 
ATOM   7249 C CE1 . HIS B 1 405 ? 20.224  2.298   -27.189 1.00 30.16  ? 405  HIS B CE1 1 
ATOM   7250 N NE2 . HIS B 1 405 ? 19.652  1.561   -28.118 1.00 31.77  ? 405  HIS B NE2 1 
ATOM   7251 N N   . ASN B 1 406 ? 15.088  3.460   -28.276 1.00 44.80  ? 406  ASN B N   1 
ATOM   7252 C CA  . ASN B 1 406 ? 14.947  3.569   -29.727 1.00 46.47  ? 406  ASN B CA  1 
ATOM   7253 C C   . ASN B 1 406 ? 14.005  4.651   -30.230 1.00 43.52  ? 406  ASN B C   1 
ATOM   7254 O O   . ASN B 1 406 ? 14.175  5.149   -31.332 1.00 45.75  ? 406  ASN B O   1 
ATOM   7255 C CB  . ASN B 1 406 ? 14.579  2.227   -30.365 1.00 31.31  ? 406  ASN B CB  1 
ATOM   7256 C CG  . ASN B 1 406 ? 15.630  1.168   -30.126 1.00 43.84  ? 406  ASN B CG  1 
ATOM   7257 O OD1 . ASN B 1 406 ? 16.661  1.124   -30.803 1.00 60.54  ? 406  ASN B OD1 1 
ATOM   7258 N ND2 . ASN B 1 406 ? 15.375  0.303   -29.158 1.00 42.06  ? 406  ASN B ND2 1 
ATOM   7259 N N   . VAL B 1 407 ? 13.010  5.026   -29.449 1.00 41.27  ? 407  VAL B N   1 
ATOM   7260 C CA  . VAL B 1 407 ? 12.100  6.037   -29.963 1.00 38.77  ? 407  VAL B CA  1 
ATOM   7261 C C   . VAL B 1 407 ? 11.957  7.312   -29.146 1.00 43.11  ? 407  VAL B C   1 
ATOM   7262 O O   . VAL B 1 407 ? 12.304  8.402   -29.618 1.00 43.06  ? 407  VAL B O   1 
ATOM   7263 C CB  . VAL B 1 407 ? 10.730  5.478   -30.198 1.00 36.50  ? 407  VAL B CB  1 
ATOM   7264 C CG1 . VAL B 1 407 ? 9.796   6.604   -30.586 1.00 34.25  ? 407  VAL B CG1 1 
ATOM   7265 C CG2 . VAL B 1 407 ? 10.796  4.410   -31.284 1.00 38.44  ? 407  VAL B CG2 1 
ATOM   7266 N N   . VAL B 1 408 ? 11.453  7.171   -27.925 1.00 35.21  ? 408  VAL B N   1 
ATOM   7267 C CA  . VAL B 1 408 ? 11.038  8.322   -27.138 1.00 35.09  ? 408  VAL B CA  1 
ATOM   7268 C C   . VAL B 1 408 ? 12.173  9.330   -26.961 1.00 48.22  ? 408  VAL B C   1 
ATOM   7269 O O   . VAL B 1 408 ? 11.989  10.533  -27.130 1.00 47.16  ? 408  VAL B O   1 
ATOM   7270 C CB  . VAL B 1 408 ? 10.466  7.907   -25.762 1.00 37.51  ? 408  VAL B CB  1 
ATOM   7271 C CG1 . VAL B 1 408 ? 9.859   9.114   -25.052 1.00 24.51  ? 408  VAL B CG1 1 
ATOM   7272 C CG2 . VAL B 1 408 ? 9.414   6.790   -25.922 1.00 35.35  ? 408  VAL B CG2 1 
ATOM   7273 N N   . CYS B 1 409 ? 13.360  8.842   -26.639 1.00 41.86  ? 409  CYS B N   1 
ATOM   7274 C CA  . CYS B 1 409 ? 14.429  9.760   -26.324 1.00 35.33  ? 409  CYS B CA  1 
ATOM   7275 C C   . CYS B 1 409 ? 15.021  10.400  -27.587 1.00 47.08  ? 409  CYS B C   1 
ATOM   7276 O O   . CYS B 1 409 ? 15.254  11.609  -27.625 1.00 42.64  ? 409  CYS B O   1 
ATOM   7277 C CB  . CYS B 1 409 ? 15.461  9.084   -25.409 1.00 27.57  ? 409  CYS B CB  1 
ATOM   7278 S SG  . CYS B 1 409 ? 14.792  8.765   -23.741 1.00 43.11  ? 409  CYS B SG  1 
ATOM   7279 N N   . PRO B 1 410 ? 15.230  9.596   -28.637 1.00 51.64  ? 410  PRO B N   1 
ATOM   7280 C CA  . PRO B 1 410 ? 15.611  10.156  -29.942 1.00 50.77  ? 410  PRO B CA  1 
ATOM   7281 C C   . PRO B 1 410 ? 14.638  11.248  -30.405 1.00 43.97  ? 410  PRO B C   1 
ATOM   7282 O O   . PRO B 1 410 ? 15.071  12.305  -30.870 1.00 46.39  ? 410  PRO B O   1 
ATOM   7283 C CB  . PRO B 1 410 ? 15.533  8.947   -30.867 1.00 40.62  ? 410  PRO B CB  1 
ATOM   7284 C CG  . PRO B 1 410 ? 15.806  7.784   -29.974 1.00 45.97  ? 410  PRO B CG  1 
ATOM   7285 C CD  . PRO B 1 410 ? 15.184  8.125   -28.655 1.00 43.95  ? 410  PRO B CD  1 
ATOM   7286 N N   . VAL B 1 411 ? 13.339  10.994  -30.269 1.00 34.41  ? 411  VAL B N   1 
ATOM   7287 C CA  . VAL B 1 411 ? 12.327  11.990  -30.598 1.00 31.99  ? 411  VAL B CA  1 
ATOM   7288 C C   . VAL B 1 411 ? 12.465  13.246  -29.735 1.00 48.02  ? 411  VAL B C   1 
ATOM   7289 O O   . VAL B 1 411 ? 12.350  14.371  -30.241 1.00 42.90  ? 411  VAL B O   1 
ATOM   7290 C CB  . VAL B 1 411 ? 10.903  11.455  -30.396 1.00 32.87  ? 411  VAL B CB  1 
ATOM   7291 C CG1 . VAL B 1 411 ? 9.911   12.586  -30.479 1.00 38.09  ? 411  VAL B CG1 1 
ATOM   7292 C CG2 . VAL B 1 411 ? 10.557  10.378  -31.412 1.00 27.13  ? 411  VAL B CG2 1 
ATOM   7293 N N   . ALA B 1 412 ? 12.685  13.051  -28.431 1.00 38.86  ? 412  ALA B N   1 
ATOM   7294 C CA  . ALA B 1 412 ? 12.830  14.172  -27.507 1.00 41.42  ? 412  ALA B CA  1 
ATOM   7295 C C   . ALA B 1 412 ? 14.022  15.004  -27.937 1.00 36.33  ? 412  ALA B C   1 
ATOM   7296 O O   . ALA B 1 412 ? 14.004  16.230  -27.920 1.00 44.89  ? 412  ALA B O   1 
ATOM   7297 C CB  . ALA B 1 412 ? 13.026  13.673  -26.097 1.00 39.67  ? 412  ALA B CB  1 
ATOM   7298 N N   . GLN B 1 413 ? 15.060  14.293  -28.327 1.00 32.53  ? 413  GLN B N   1 
ATOM   7299 C CA  . GLN B 1 413 ? 16.289  14.876  -28.804 1.00 44.83  ? 413  GLN B CA  1 
ATOM   7300 C C   . GLN B 1 413 ? 16.058  15.704  -30.068 1.00 47.22  ? 413  GLN B C   1 
ATOM   7301 O O   . GLN B 1 413 ? 16.577  16.808  -30.197 1.00 43.47  ? 413  GLN B O   1 
ATOM   7302 C CB  . GLN B 1 413 ? 17.288  13.738  -29.049 1.00 44.13  ? 413  GLN B CB  1 
ATOM   7303 C CG  . GLN B 1 413 ? 18.417  14.045  -30.003 1.00 61.21  ? 413  GLN B CG  1 
ATOM   7304 C CD  . GLN B 1 413 ? 19.599  14.687  -29.328 1.00 72.88  ? 413  GLN B CD  1 
ATOM   7305 O OE1 . GLN B 1 413 ? 19.598  14.896  -28.111 1.00 63.13  ? 413  GLN B OE1 1 
ATOM   7306 N NE2 . GLN B 1 413 ? 20.627  15.009  -30.119 1.00 90.81  ? 413  GLN B NE2 1 
ATOM   7307 N N   . LEU B 1 414 ? 15.285  15.169  -31.007 1.00 45.50  ? 414  LEU B N   1 
ATOM   7308 C CA  . LEU B 1 414 ? 15.040  15.893  -32.248 1.00 46.76  ? 414  LEU B CA  1 
ATOM   7309 C C   . LEU B 1 414 ? 14.202  17.152  -32.003 1.00 47.24  ? 414  LEU B C   1 
ATOM   7310 O O   . LEU B 1 414 ? 14.534  18.237  -32.482 1.00 50.66  ? 414  LEU B O   1 
ATOM   7311 C CB  . LEU B 1 414 ? 14.355  14.984  -33.260 1.00 48.66  ? 414  LEU B CB  1 
ATOM   7312 C CG  . LEU B 1 414 ? 14.132  15.601  -34.640 1.00 38.75  ? 414  LEU B CG  1 
ATOM   7313 C CD1 . LEU B 1 414 ? 15.429  15.717  -35.437 1.00 36.06  ? 414  LEU B CD1 1 
ATOM   7314 C CD2 . LEU B 1 414 ? 13.107  14.810  -35.392 1.00 31.34  ? 414  LEU B CD2 1 
ATOM   7315 N N   . ALA B 1 415 ? 13.120  16.998  -31.246 1.00 29.27  ? 415  ALA B N   1 
ATOM   7316 C CA  . ALA B 1 415 ? 12.260  18.109  -30.901 1.00 27.12  ? 415  ALA B CA  1 
ATOM   7317 C C   . ALA B 1 415 ? 13.090  19.217  -30.294 1.00 44.28  ? 415  ALA B C   1 
ATOM   7318 O O   . ALA B 1 415 ? 12.987  20.375  -30.682 1.00 42.01  ? 415  ALA B O   1 
ATOM   7319 C CB  . ALA B 1 415 ? 11.236  17.664  -29.920 1.00 33.58  ? 415  ALA B CB  1 
ATOM   7320 N N   . GLY B 1 416 ? 13.911  18.846  -29.322 1.00 44.93  ? 416  GLY B N   1 
ATOM   7321 C CA  . GLY B 1 416 ? 14.712  19.815  -28.616 1.00 39.74  ? 416  GLY B CA  1 
ATOM   7322 C C   . GLY B 1 416 ? 15.652  20.502  -29.585 1.00 47.12  ? 416  GLY B C   1 
ATOM   7323 O O   . GLY B 1 416 ? 15.800  21.725  -29.579 1.00 48.80  ? 416  GLY B O   1 
ATOM   7324 N N   . ARG B 1 417 ? 16.286  19.707  -30.434 1.00 43.26  ? 417  ARG B N   1 
ATOM   7325 C CA  . ARG B 1 417 ? 17.231  20.253  -31.385 1.00 47.01  ? 417  ARG B CA  1 
ATOM   7326 C C   . ARG B 1 417 ? 16.557  21.202  -32.370 1.00 51.36  ? 417  ARG B C   1 
ATOM   7327 O O   . ARG B 1 417 ? 16.998  22.339  -32.545 1.00 52.98  ? 417  ARG B O   1 
ATOM   7328 C CB  . ARG B 1 417 ? 17.984  19.134  -32.099 1.00 38.27  ? 417  ARG B CB  1 
ATOM   7329 C CG  . ARG B 1 417 ? 19.275  18.780  -31.391 1.00 45.91  ? 417  ARG B CG  1 
ATOM   7330 C CD  . ARG B 1 417 ? 19.580  19.807  -30.334 1.00 63.67  ? 417  ARG B CD  1 
ATOM   7331 N NE  . ARG B 1 417 ? 20.946  19.710  -29.835 1.00 81.44  ? 417  ARG B NE  1 
ATOM   7332 C CZ  . ARG B 1 417 ? 21.893  20.619  -30.061 1.00 83.35  ? 417  ARG B CZ  1 
ATOM   7333 N NH1 . ARG B 1 417 ? 21.623  21.705  -30.782 1.00 72.87  ? 417  ARG B NH1 1 
ATOM   7334 N NH2 . ARG B 1 417 ? 23.113  20.441  -29.561 1.00 85.13  ? 417  ARG B NH2 1 
ATOM   7335 N N   . LEU B 1 418 ? 15.472  20.742  -32.984 1.00 42.23  ? 418  LEU B N   1 
ATOM   7336 C CA  . LEU B 1 418 ? 14.730  21.562  -33.930 1.00 40.99  ? 418  LEU B CA  1 
ATOM   7337 C C   . LEU B 1 418 ? 14.220  22.877  -33.336 1.00 52.18  ? 418  LEU B C   1 
ATOM   7338 O O   . LEU B 1 418 ? 14.444  23.951  -33.906 1.00 52.95  ? 418  LEU B O   1 
ATOM   7339 C CB  . LEU B 1 418 ? 13.577  20.762  -34.507 1.00 32.12  ? 418  LEU B CB  1 
ATOM   7340 C CG  . LEU B 1 418 ? 14.051  19.699  -35.503 1.00 48.17  ? 418  LEU B CG  1 
ATOM   7341 C CD1 . LEU B 1 418 ? 13.072  18.523  -35.683 1.00 34.37  ? 418  LEU B CD1 1 
ATOM   7342 C CD2 . LEU B 1 418 ? 14.287  20.390  -36.814 1.00 58.61  ? 418  LEU B CD2 1 
ATOM   7343 N N   . ALA B 1 419 ? 13.537  22.782  -32.196 1.00 48.91  ? 419  ALA B N   1 
ATOM   7344 C CA  . ALA B 1 419 ? 12.901  23.934  -31.562 1.00 44.08  ? 419  ALA B CA  1 
ATOM   7345 C C   . ALA B 1 419 ? 13.933  24.997  -31.265 1.00 50.90  ? 419  ALA B C   1 
ATOM   7346 O O   . ALA B 1 419 ? 13.777  26.161  -31.633 1.00 45.65  ? 419  ALA B O   1 
ATOM   7347 C CB  . ALA B 1 419 ? 12.214  23.518  -30.289 1.00 45.15  ? 419  ALA B CB  1 
ATOM   7348 N N   . ALA B 1 420 ? 14.996  24.560  -30.602 1.00 49.66  ? 420  ALA B N   1 
ATOM   7349 C CA  . ALA B 1 420 ? 16.132  25.399  -30.278 1.00 47.98  ? 420  ALA B CA  1 
ATOM   7350 C C   . ALA B 1 420 ? 16.749  26.101  -31.489 1.00 61.65  ? 420  ALA B C   1 
ATOM   7351 O O   . ALA B 1 420 ? 17.338  27.168  -31.361 1.00 70.56  ? 420  ALA B O   1 
ATOM   7352 C CB  . ALA B 1 420 ? 17.182  24.578  -29.570 1.00 34.87  ? 420  ALA B CB  1 
ATOM   7353 N N   . GLN B 1 421 ? 16.622  25.509  -32.666 1.00 61.39  ? 421  GLN B N   1 
ATOM   7354 C CA  . GLN B 1 421 ? 17.296  26.064  -33.827 1.00 54.16  ? 421  GLN B CA  1 
ATOM   7355 C C   . GLN B 1 421 ? 16.346  26.667  -34.870 1.00 55.79  ? 421  GLN B C   1 
ATOM   7356 O O   . GLN B 1 421 ? 16.648  26.708  -36.067 1.00 47.59  ? 421  GLN B O   1 
ATOM   7357 C CB  . GLN B 1 421 ? 18.241  25.019  -34.420 1.00 55.51  ? 421  GLN B CB  1 
ATOM   7358 C CG  . GLN B 1 421 ? 19.514  24.871  -33.589 1.00 66.24  ? 421  GLN B CG  1 
ATOM   7359 C CD  . GLN B 1 421 ? 20.079  23.469  -33.581 1.00 66.57  ? 421  GLN B CD  1 
ATOM   7360 O OE1 . GLN B 1 421 ? 20.225  22.860  -32.523 1.00 71.35  ? 421  GLN B OE1 1 
ATOM   7361 N NE2 . GLN B 1 421 ? 20.411  22.953  -34.755 1.00 59.99  ? 421  GLN B NE2 1 
ATOM   7362 N N   . GLY B 1 422 ? 15.192  27.134  -34.401 1.00 48.53  ? 422  GLY B N   1 
ATOM   7363 C CA  . GLY B 1 422 ? 14.324  27.959  -35.220 1.00 44.05  ? 422  GLY B CA  1 
ATOM   7364 C C   . GLY B 1 422 ? 13.049  27.283  -35.647 1.00 50.71  ? 422  GLY B C   1 
ATOM   7365 O O   . GLY B 1 422 ? 12.079  27.951  -36.006 1.00 38.20  ? 422  GLY B O   1 
ATOM   7366 N N   . ALA B 1 423 ? 13.046  25.953  -35.603 1.00 56.57  ? 423  ALA B N   1 
ATOM   7367 C CA  . ALA B 1 423 ? 11.912  25.190  -36.102 1.00 46.02  ? 423  ALA B CA  1 
ATOM   7368 C C   . ALA B 1 423 ? 10.672  25.407  -35.238 1.00 45.85  ? 423  ALA B C   1 
ATOM   7369 O O   . ALA B 1 423 ? 10.767  25.663  -34.042 1.00 57.56  ? 423  ALA B O   1 
ATOM   7370 C CB  . ALA B 1 423 ? 12.257  23.726  -36.176 1.00 45.80  ? 423  ALA B CB  1 
ATOM   7371 N N   . ARG B 1 424 ? 9.507   25.320  -35.856 1.00 39.59  ? 424  ARG B N   1 
ATOM   7372 C CA  . ARG B 1 424 ? 8.267   25.366  -35.111 1.00 36.23  ? 424  ARG B CA  1 
ATOM   7373 C C   . ARG B 1 424 ? 7.742   23.922  -34.908 1.00 49.13  ? 424  ARG B C   1 
ATOM   7374 O O   . ARG B 1 424 ? 7.428   23.187  -35.869 1.00 31.12  ? 424  ARG B O   1 
ATOM   7375 C CB  . ARG B 1 424 ? 7.268   26.252  -35.838 1.00 31.00  ? 424  ARG B CB  1 
ATOM   7376 C CG  . ARG B 1 424 ? 5.946   26.361  -35.145 1.00 56.79  ? 424  ARG B CG  1 
ATOM   7377 C CD  . ARG B 1 424 ? 4.963   27.164  -35.974 1.00 67.09  ? 424  ARG B CD  1 
ATOM   7378 N NE  . ARG B 1 424 ? 3.880   27.682  -35.144 1.00 69.36  ? 424  ARG B NE  1 
ATOM   7379 C CZ  . ARG B 1 424 ? 4.047   28.572  -34.171 1.00 67.45  ? 424  ARG B CZ  1 
ATOM   7380 N NH1 . ARG B 1 424 ? 5.253   29.044  -33.890 1.00 61.84  ? 424  ARG B NH1 1 
ATOM   7381 N NH2 . ARG B 1 424 ? 3.006   28.986  -33.475 1.00 74.66  ? 424  ARG B NH2 1 
ATOM   7382 N N   . VAL B 1 425 ? 7.672   23.515  -33.648 1.00 34.48  ? 425  VAL B N   1 
ATOM   7383 C CA  . VAL B 1 425 ? 7.430   22.114  -33.324 1.00 29.85  ? 425  VAL B CA  1 
ATOM   7384 C C   . VAL B 1 425 ? 6.143   21.884  -32.526 1.00 31.83  ? 425  VAL B C   1 
ATOM   7385 O O   . VAL B 1 425 ? 5.823   22.608  -31.585 1.00 47.78  ? 425  VAL B O   1 
ATOM   7386 C CB  . VAL B 1 425 ? 8.636   21.521  -32.544 1.00 42.69  ? 425  VAL B CB  1 
ATOM   7387 C CG1 . VAL B 1 425 ? 8.558   19.994  -32.485 1.00 25.57  ? 425  VAL B CG1 1 
ATOM   7388 C CG2 . VAL B 1 425 ? 9.991   22.019  -33.155 1.00 21.63  ? 425  VAL B CG2 1 
ATOM   7389 N N   . TYR B 1 426 ? 5.402   20.867  -32.924 1.00 35.19  ? 426  TYR B N   1 
ATOM   7390 C CA  . TYR B 1 426 ? 4.278   20.383  -32.145 1.00 35.92  ? 426  TYR B CA  1 
ATOM   7391 C C   . TYR B 1 426 ? 4.533   18.920  -31.781 1.00 46.90  ? 426  TYR B C   1 
ATOM   7392 O O   . TYR B 1 426 ? 4.872   18.089  -32.644 1.00 33.82  ? 426  TYR B O   1 
ATOM   7393 C CB  . TYR B 1 426 ? 2.992   20.533  -32.944 1.00 35.45  ? 426  TYR B CB  1 
ATOM   7394 C CG  . TYR B 1 426 ? 2.618   21.974  -33.199 1.00 42.59  ? 426  TYR B CG  1 
ATOM   7395 C CD1 . TYR B 1 426 ? 1.864   22.687  -32.275 1.00 37.33  ? 426  TYR B CD1 1 
ATOM   7396 C CD2 . TYR B 1 426 ? 3.046   22.630  -34.350 1.00 35.50  ? 426  TYR B CD2 1 
ATOM   7397 C CE1 . TYR B 1 426 ? 1.534   24.008  -32.496 1.00 44.74  ? 426  TYR B CE1 1 
ATOM   7398 C CE2 . TYR B 1 426 ? 2.716   23.945  -34.583 1.00 34.52  ? 426  TYR B CE2 1 
ATOM   7399 C CZ  . TYR B 1 426 ? 1.959   24.625  -33.653 1.00 42.31  ? 426  TYR B CZ  1 
ATOM   7400 O OH  . TYR B 1 426 ? 1.631   25.927  -33.876 1.00 49.55  ? 426  TYR B OH  1 
ATOM   7401 N N   . ALA B 1 427 ? 4.389   18.617  -30.496 1.00 38.20  ? 427  ALA B N   1 
ATOM   7402 C CA  . ALA B 1 427 ? 4.669   17.275  -30.002 1.00 30.65  ? 427  ALA B CA  1 
ATOM   7403 C C   . ALA B 1 427 ? 3.481   16.642  -29.322 1.00 34.92  ? 427  ALA B C   1 
ATOM   7404 O O   . ALA B 1 427 ? 2.790   17.279  -28.539 1.00 39.56  ? 427  ALA B O   1 
ATOM   7405 C CB  . ALA B 1 427 ? 5.839   17.300  -29.061 1.00 27.76  ? 427  ALA B CB  1 
ATOM   7406 N N   . TYR B 1 428 ? 3.250   15.371  -29.622 1.00 42.27  ? 428  TYR B N   1 
ATOM   7407 C CA  . TYR B 1 428 ? 2.154   14.651  -28.997 1.00 40.86  ? 428  TYR B CA  1 
ATOM   7408 C C   . TYR B 1 428 ? 2.705   13.402  -28.378 1.00 40.58  ? 428  TYR B C   1 
ATOM   7409 O O   . TYR B 1 428 ? 3.831   13.016  -28.664 1.00 31.98  ? 428  TYR B O   1 
ATOM   7410 C CB  . TYR B 1 428 ? 1.091   14.253  -30.032 1.00 36.53  ? 428  TYR B CB  1 
ATOM   7411 C CG  . TYR B 1 428 ? 1.570   13.246  -31.057 1.00 41.03  ? 428  TYR B CG  1 
ATOM   7412 C CD1 . TYR B 1 428 ? 1.557   11.879  -30.785 1.00 47.96  ? 428  TYR B CD1 1 
ATOM   7413 C CD2 . TYR B 1 428 ? 2.032   13.660  -32.305 1.00 41.10  ? 428  TYR B CD2 1 
ATOM   7414 C CE1 . TYR B 1 428 ? 1.990   10.945  -31.730 1.00 44.33  ? 428  TYR B CE1 1 
ATOM   7415 C CE2 . TYR B 1 428 ? 2.465   12.740  -33.257 1.00 45.19  ? 428  TYR B CE2 1 
ATOM   7416 C CZ  . TYR B 1 428 ? 2.448   11.384  -32.960 1.00 51.48  ? 428  TYR B CZ  1 
ATOM   7417 O OH  . TYR B 1 428 ? 2.890   10.472  -33.896 1.00 50.57  ? 428  TYR B OH  1 
ATOM   7418 N N   . ILE B 1 429 ? 1.898   12.798  -27.514 1.00 47.14  ? 429  ILE B N   1 
ATOM   7419 C CA  . ILE B 1 429 ? 2.030   11.400  -27.127 1.00 44.94  ? 429  ILE B CA  1 
ATOM   7420 C C   . ILE B 1 429 ? 0.662   10.766  -27.299 1.00 41.91  ? 429  ILE B C   1 
ATOM   7421 O O   . ILE B 1 429 ? -0.340  11.320  -26.863 1.00 43.65  ? 429  ILE B O   1 
ATOM   7422 C CB  . ILE B 1 429 ? 2.421   11.234  -25.672 1.00 49.06  ? 429  ILE B CB  1 
ATOM   7423 C CG1 . ILE B 1 429 ? 2.650   9.755   -25.364 1.00 52.07  ? 429  ILE B CG1 1 
ATOM   7424 C CG2 . ILE B 1 429 ? 1.328   11.742  -24.785 1.00 44.92  ? 429  ILE B CG2 1 
ATOM   7425 C CD1 . ILE B 1 429 ? 3.061   9.518   -23.932 1.00 52.63  ? 429  ILE B CD1 1 
ATOM   7426 N N   . PHE B 1 430 ? 0.620   9.604   -27.937 1.00 42.18  ? 430  PHE B N   1 
ATOM   7427 C CA  . PHE B 1 430 ? -0.646  8.969   -28.269 1.00 39.54  ? 430  PHE B CA  1 
ATOM   7428 C C   . PHE B 1 430 ? -0.955  7.885   -27.247 1.00 36.02  ? 430  PHE B C   1 
ATOM   7429 O O   . PHE B 1 430 ? -0.193  6.934   -27.107 1.00 47.81  ? 430  PHE B O   1 
ATOM   7430 C CB  . PHE B 1 430 ? -0.567  8.376   -29.667 1.00 43.51  ? 430  PHE B CB  1 
ATOM   7431 C CG  . PHE B 1 430 ? -1.873  7.908   -30.179 1.00 48.33  ? 430  PHE B CG  1 
ATOM   7432 C CD1 . PHE B 1 430 ? -2.788  8.818   -30.689 1.00 48.11  ? 430  PHE B CD1 1 
ATOM   7433 C CD2 . PHE B 1 430 ? -2.211  6.553   -30.131 1.00 50.83  ? 430  PHE B CD2 1 
ATOM   7434 C CE1 . PHE B 1 430 ? -4.031  8.384   -31.164 1.00 55.54  ? 430  PHE B CE1 1 
ATOM   7435 C CE2 . PHE B 1 430 ? -3.441  6.113   -30.590 1.00 44.66  ? 430  PHE B CE2 1 
ATOM   7436 C CZ  . PHE B 1 430 ? -4.358  7.031   -31.112 1.00 45.87  ? 430  PHE B CZ  1 
ATOM   7437 N N   . GLU B 1 431 ? -2.068  8.025   -26.534 1.00 37.49  ? 431  GLU B N   1 
ATOM   7438 C CA  . GLU B 1 431 ? -2.323  7.195   -25.352 1.00 52.11  ? 431  GLU B CA  1 
ATOM   7439 C C   . GLU B 1 431 ? -3.536  6.263   -25.413 1.00 58.39  ? 431  GLU B C   1 
ATOM   7440 O O   . GLU B 1 431 ? -3.888  5.635   -24.412 1.00 57.89  ? 431  GLU B O   1 
ATOM   7441 C CB  . GLU B 1 431 ? -2.464  8.080   -24.108 1.00 51.39  ? 431  GLU B CB  1 
ATOM   7442 C CG  . GLU B 1 431 ? -1.187  8.710   -23.637 1.00 41.70  ? 431  GLU B CG  1 
ATOM   7443 C CD  . GLU B 1 431 ? -1.394  9.574   -22.422 1.00 53.43  ? 431  GLU B CD  1 
ATOM   7444 O OE1 . GLU B 1 431 ? -2.560  9.939   -22.133 1.00 63.43  ? 431  GLU B OE1 1 
ATOM   7445 O OE2 . GLU B 1 431 ? -0.386  9.888   -21.753 1.00 58.61  ? 431  GLU B OE2 1 
ATOM   7446 N N   . HIS B 1 432 ? -4.184  6.161   -26.564 1.00 57.90  ? 432  HIS B N   1 
ATOM   7447 C CA  . HIS B 1 432 ? -5.402  5.363   -26.630 1.00 52.17  ? 432  HIS B CA  1 
ATOM   7448 C C   . HIS B 1 432 ? -5.235  3.953   -27.220 1.00 50.49  ? 432  HIS B C   1 
ATOM   7449 O O   . HIS B 1 432 ? -4.850  3.789   -28.374 1.00 54.53  ? 432  HIS B O   1 
ATOM   7450 C CB  . HIS B 1 432 ? -6.463  6.106   -27.415 1.00 51.65  ? 432  HIS B CB  1 
ATOM   7451 C CG  . HIS B 1 432 ? -7.683  5.288   -27.666 1.00 53.87  ? 432  HIS B CG  1 
ATOM   7452 N ND1 . HIS B 1 432 ? -8.605  5.011   -26.680 1.00 56.29  ? 432  HIS B ND1 1 
ATOM   7453 C CD2 . HIS B 1 432 ? -8.122  4.659   -28.782 1.00 52.83  ? 432  HIS B CD2 1 
ATOM   7454 C CE1 . HIS B 1 432 ? -9.570  4.264   -27.183 1.00 63.64  ? 432  HIS B CE1 1 
ATOM   7455 N NE2 . HIS B 1 432 ? -9.298  4.030   -28.455 1.00 60.85  ? 432  HIS B NE2 1 
ATOM   7456 N N   . ARG B 1 433 ? -5.565  2.935   -26.438 1.00 58.06  ? 433  ARG B N   1 
ATOM   7457 C CA  . ARG B 1 433 ? -5.546  1.557   -26.937 1.00 52.40  ? 433  ARG B CA  1 
ATOM   7458 C C   . ARG B 1 433 ? -6.816  1.165   -27.705 1.00 45.67  ? 433  ARG B C   1 
ATOM   7459 O O   . ARG B 1 433 ? -7.907  1.192   -27.158 1.00 54.42  ? 433  ARG B O   1 
ATOM   7460 C CB  . ARG B 1 433 ? -5.366  0.594   -25.778 1.00 50.92  ? 433  ARG B CB  1 
ATOM   7461 C CG  . ARG B 1 433 ? -4.869  -0.750  -26.190 1.00 50.18  ? 433  ARG B CG  1 
ATOM   7462 C CD  . ARG B 1 433 ? -5.024  -1.683  -25.039 1.00 58.44  ? 433  ARG B CD  1 
ATOM   7463 N NE  . ARG B 1 433 ? -5.532  -2.988  -25.444 1.00 61.81  ? 433  ARG B NE  1 
ATOM   7464 C CZ  . ARG B 1 433 ? -4.754  -4.029  -25.682 1.00 53.97  ? 433  ARG B CZ  1 
ATOM   7465 N NH1 . ARG B 1 433 ? -3.434  -3.899  -25.570 1.00 39.86  ? 433  ARG B NH1 1 
ATOM   7466 N NH2 . ARG B 1 433 ? -5.296  -5.189  -26.037 1.00 55.87  ? 433  ARG B NH2 1 
ATOM   7467 N N   . ALA B 1 434 ? -6.659  0.784   -28.969 1.00 47.00  ? 434  ALA B N   1 
ATOM   7468 C CA  . ALA B 1 434 ? -7.773  0.351   -29.811 1.00 46.08  ? 434  ALA B CA  1 
ATOM   7469 C C   . ALA B 1 434 ? -8.688  -0.645  -29.121 1.00 55.35  ? 434  ALA B C   1 
ATOM   7470 O O   . ALA B 1 434 ? -8.233  -1.594  -28.478 1.00 59.90  ? 434  ALA B O   1 
ATOM   7471 C CB  . ALA B 1 434 ? -7.251  -0.250  -31.115 1.00 51.33  ? 434  ALA B CB  1 
ATOM   7472 N N   . SER B 1 435 ? -9.987  -0.429  -29.265 1.00 51.41  ? 435  SER B N   1 
ATOM   7473 C CA  . SER B 1 435 ? -10.950 -1.351  -28.714 1.00 46.61  ? 435  SER B CA  1 
ATOM   7474 C C   . SER B 1 435 ? -10.799 -2.745  -29.360 1.00 66.03  ? 435  SER B C   1 
ATOM   7475 O O   . SER B 1 435 ? -10.923 -3.775  -28.684 1.00 63.53  ? 435  SER B O   1 
ATOM   7476 C CB  . SER B 1 435 ? -12.372 -0.793  -28.861 1.00 47.68  ? 435  SER B CB  1 
ATOM   7477 O OG  . SER B 1 435 ? -12.678 -0.412  -30.195 1.00 52.65  ? 435  SER B OG  1 
ATOM   7478 N N   . THR B 1 436 ? -10.499 -2.772  -30.659 1.00 70.75  ? 436  THR B N   1 
ATOM   7479 C CA  . THR B 1 436 ? -10.373 -4.035  -31.393 1.00 66.25  ? 436  THR B CA  1 
ATOM   7480 C C   . THR B 1 436 ? -8.934  -4.471  -31.609 1.00 61.07  ? 436  THR B C   1 
ATOM   7481 O O   . THR B 1 436 ? -8.634  -5.176  -32.571 1.00 71.19  ? 436  THR B O   1 
ATOM   7482 C CB  . THR B 1 436 ? -11.011 -3.950  -32.775 1.00 67.71  ? 436  THR B CB  1 
ATOM   7483 O OG1 . THR B 1 436 ? -10.353 -2.929  -33.535 1.00 61.87  ? 436  THR B OG1 1 
ATOM   7484 C CG2 . THR B 1 436 ? -12.506 -3.648  -32.662 1.00 80.26  ? 436  THR B CG2 1 
ATOM   7485 N N   . LEU B 1 437 ? -8.045  -4.047  -30.722 1.00 51.55  ? 437  LEU B N   1 
ATOM   7486 C CA  . LEU B 1 437 ? -6.643  -4.392  -30.848 1.00 51.09  ? 437  LEU B CA  1 
ATOM   7487 C C   . LEU B 1 437 ? -6.506  -5.846  -30.431 1.00 64.41  ? 437  LEU B C   1 
ATOM   7488 O O   . LEU B 1 437 ? -7.132  -6.262  -29.455 1.00 72.92  ? 437  LEU B O   1 
ATOM   7489 C CB  . LEU B 1 437 ? -5.804  -3.480  -29.955 1.00 47.84  ? 437  LEU B CB  1 
ATOM   7490 C CG  . LEU B 1 437 ? -4.376  -3.223  -30.420 1.00 52.43  ? 437  LEU B CG  1 
ATOM   7491 C CD1 . LEU B 1 437 ? -3.739  -2.158  -29.566 1.00 60.05  ? 437  LEU B CD1 1 
ATOM   7492 C CD2 . LEU B 1 437 ? -3.574  -4.501  -30.369 1.00 60.27  ? 437  LEU B CD2 1 
ATOM   7493 N N   . THR B 1 438 ? -5.710  -6.621  -31.167 1.00 57.53  ? 438  THR B N   1 
ATOM   7494 C CA  . THR B 1 438 ? -5.658  -8.070  -30.951 1.00 58.47  ? 438  THR B CA  1 
ATOM   7495 C C   . THR B 1 438 ? -4.482  -8.551  -30.098 1.00 54.38  ? 438  THR B C   1 
ATOM   7496 O O   . THR B 1 438 ? -4.439  -9.712  -29.689 1.00 62.64  ? 438  THR B O   1 
ATOM   7497 C CB  . THR B 1 438 ? -5.623  -8.817  -32.274 1.00 62.13  ? 438  THR B CB  1 
ATOM   7498 O OG1 . THR B 1 438 ? -4.437  -8.447  -32.995 1.00 56.93  ? 438  THR B OG1 1 
ATOM   7499 C CG2 . THR B 1 438 ? -6.850  -8.469  -33.087 1.00 46.67  ? 438  THR B CG2 1 
ATOM   7500 N N   . TRP B 1 439 ? -3.532  -7.661  -29.849 1.00 43.20  ? 439  TRP B N   1 
ATOM   7501 C CA  . TRP B 1 439 ? -2.415  -7.928  -28.946 1.00 48.52  ? 439  TRP B CA  1 
ATOM   7502 C C   . TRP B 1 439 ? -2.879  -7.926  -27.497 1.00 55.94  ? 439  TRP B C   1 
ATOM   7503 O O   . TRP B 1 439 ? -3.918  -7.348  -27.175 1.00 61.09  ? 439  TRP B O   1 
ATOM   7504 C CB  . TRP B 1 439 ? -1.318  -6.867  -29.112 1.00 54.17  ? 439  TRP B CB  1 
ATOM   7505 C CG  . TRP B 1 439 ? -0.676  -6.853  -30.464 1.00 55.55  ? 439  TRP B CG  1 
ATOM   7506 C CD1 . TRP B 1 439 ? -0.993  -6.042  -31.516 1.00 58.65  ? 439  TRP B CD1 1 
ATOM   7507 C CD2 . TRP B 1 439 ? 0.390   -7.695  -30.911 1.00 58.76  ? 439  TRP B CD2 1 
ATOM   7508 N NE1 . TRP B 1 439 ? -0.192  -6.332  -32.591 1.00 65.15  ? 439  TRP B NE1 1 
ATOM   7509 C CE2 . TRP B 1 439 ? 0.666   -7.345  -32.246 1.00 64.81  ? 439  TRP B CE2 1 
ATOM   7510 C CE3 . TRP B 1 439 ? 1.138   -8.717  -30.311 1.00 58.00  ? 439  TRP B CE3 1 
ATOM   7511 C CZ2 . TRP B 1 439 ? 1.662   -7.979  -32.995 1.00 64.58  ? 439  TRP B CZ2 1 
ATOM   7512 C CZ3 . TRP B 1 439 ? 2.125   -9.341  -31.050 1.00 46.72  ? 439  TRP B CZ3 1 
ATOM   7513 C CH2 . TRP B 1 439 ? 2.381   -8.971  -32.378 1.00 53.56  ? 439  TRP B CH2 1 
ATOM   7514 N N   . PRO B 1 440 ? -2.101  -8.560  -26.608 1.00 56.97  ? 440  PRO B N   1 
ATOM   7515 C CA  . PRO B 1 440 ? -2.538  -8.635  -25.211 1.00 56.37  ? 440  PRO B CA  1 
ATOM   7516 C C   . PRO B 1 440 ? -2.516  -7.273  -24.541 1.00 59.50  ? 440  PRO B C   1 
ATOM   7517 O O   . PRO B 1 440 ? -1.922  -6.320  -25.057 1.00 62.62  ? 440  PRO B O   1 
ATOM   7518 C CB  . PRO B 1 440 ? -1.513  -9.573  -24.567 1.00 50.67  ? 440  PRO B CB  1 
ATOM   7519 C CG  . PRO B 1 440 ? -0.319  -9.501  -25.440 1.00 50.97  ? 440  PRO B CG  1 
ATOM   7520 C CD  . PRO B 1 440 ? -0.827  -9.262  -26.833 1.00 53.53  ? 440  PRO B CD  1 
ATOM   7521 N N   . LEU B 1 441 ? -3.156  -7.189  -23.386 1.00 58.02  ? 441  LEU B N   1 
ATOM   7522 C CA  . LEU B 1 441 ? -3.289  -5.912  -22.710 1.00 58.51  ? 441  LEU B CA  1 
ATOM   7523 C C   . LEU B 1 441 ? -1.967  -5.414  -22.153 1.00 55.96  ? 441  LEU B C   1 
ATOM   7524 O O   . LEU B 1 441 ? -1.762  -4.208  -21.998 1.00 58.11  ? 441  LEU B O   1 
ATOM   7525 C CB  . LEU B 1 441 ? -4.350  -5.991  -21.617 1.00 61.10  ? 441  LEU B CB  1 
ATOM   7526 C CG  . LEU B 1 441 ? -5.577  -5.150  -21.954 1.00 65.49  ? 441  LEU B CG  1 
ATOM   7527 C CD1 . LEU B 1 441 ? -6.806  -5.645  -21.203 1.00 64.59  ? 441  LEU B CD1 1 
ATOM   7528 C CD2 . LEU B 1 441 ? -5.282  -3.686  -21.645 1.00 72.96  ? 441  LEU B CD2 1 
ATOM   7529 N N   . TRP B 1 442 ? -1.059  -6.340  -21.878 1.00 54.29  ? 442  TRP B N   1 
ATOM   7530 C CA  . TRP B 1 442 ? 0.195   -5.956  -21.249 1.00 54.10  ? 442  TRP B CA  1 
ATOM   7531 C C   . TRP B 1 442 ? 1.097   -5.139  -22.157 1.00 49.67  ? 442  TRP B C   1 
ATOM   7532 O O   . TRP B 1 442 ? 2.063   -4.532  -21.683 1.00 52.73  ? 442  TRP B O   1 
ATOM   7533 C CB  . TRP B 1 442 ? 0.941   -7.162  -20.661 1.00 46.79  ? 442  TRP B CB  1 
ATOM   7534 C CG  . TRP B 1 442 ? 1.577   -8.087  -21.652 1.00 58.77  ? 442  TRP B CG  1 
ATOM   7535 C CD1 . TRP B 1 442 ? 1.127   -9.323  -22.025 1.00 73.08  ? 442  TRP B CD1 1 
ATOM   7536 C CD2 . TRP B 1 442 ? 2.803   -7.876  -22.358 1.00 57.07  ? 442  TRP B CD2 1 
ATOM   7537 N NE1 . TRP B 1 442 ? 1.990   -9.883  -22.934 1.00 77.44  ? 442  TRP B NE1 1 
ATOM   7538 C CE2 . TRP B 1 442 ? 3.026   -9.013  -23.158 1.00 65.43  ? 442  TRP B CE2 1 
ATOM   7539 C CE3 . TRP B 1 442 ? 3.731   -6.829  -22.400 1.00 57.06  ? 442  TRP B CE3 1 
ATOM   7540 C CZ2 . TRP B 1 442 ? 4.137   -9.135  -23.990 1.00 63.55  ? 442  TRP B CZ2 1 
ATOM   7541 C CZ3 . TRP B 1 442 ? 4.828   -6.947  -23.233 1.00 54.73  ? 442  TRP B CZ3 1 
ATOM   7542 C CH2 . TRP B 1 442 ? 5.024   -8.094  -24.014 1.00 59.95  ? 442  TRP B CH2 1 
ATOM   7543 N N   . MET B 1 443 ? 0.780   -5.113  -23.451 1.00 47.88  ? 443  MET B N   1 
ATOM   7544 C CA  . MET B 1 443 ? 1.579   -4.351  -24.415 1.00 54.67  ? 443  MET B CA  1 
ATOM   7545 C C   . MET B 1 443 ? 1.067   -2.905  -24.544 1.00 51.30  ? 443  MET B C   1 
ATOM   7546 O O   . MET B 1 443 ? 1.696   -2.067  -25.181 1.00 46.46  ? 443  MET B O   1 
ATOM   7547 C CB  . MET B 1 443 ? 1.594   -5.039  -25.785 1.00 54.25  ? 443  MET B CB  1 
ATOM   7548 C CG  . MET B 1 443 ? 1.901   -6.533  -25.758 1.00 58.15  ? 443  MET B CG  1 
ATOM   7549 S SD  . MET B 1 443 ? 2.095   -7.230  -27.421 1.00 60.10  ? 443  MET B SD  1 
ATOM   7550 C CE  . MET B 1 443 ? 3.851   -6.992  -27.696 1.00 40.41  ? 443  MET B CE  1 
ATOM   7551 N N   . GLY B 1 444 ? -0.084  -2.632  -23.938 1.00 48.15  ? 444  GLY B N   1 
ATOM   7552 C CA  . GLY B 1 444 ? -0.652  -1.295  -23.918 1.00 65.50  ? 444  GLY B CA  1 
ATOM   7553 C C   . GLY B 1 444 ? -1.019  -0.722  -25.276 1.00 65.34  ? 444  GLY B C   1 
ATOM   7554 O O   . GLY B 1 444 ? -1.879  -1.252  -25.974 1.00 66.71  ? 444  GLY B O   1 
ATOM   7555 N N   . VAL B 1 445 ? -0.379  0.391   -25.622 1.00 60.36  ? 445  VAL B N   1 
ATOM   7556 C CA  . VAL B 1 445 ? -0.510  1.023   -26.931 1.00 48.07  ? 445  VAL B CA  1 
ATOM   7557 C C   . VAL B 1 445 ? 0.792   0.834   -27.696 1.00 52.91  ? 445  VAL B C   1 
ATOM   7558 O O   . VAL B 1 445 ? 1.675   1.689   -27.624 1.00 65.85  ? 445  VAL B O   1 
ATOM   7559 C CB  . VAL B 1 445 ? -0.723  2.540   -26.791 1.00 44.87  ? 445  VAL B CB  1 
ATOM   7560 C CG1 . VAL B 1 445 ? -0.977  3.163   -28.152 1.00 42.88  ? 445  VAL B CG1 1 
ATOM   7561 C CG2 . VAL B 1 445 ? -1.864  2.836   -25.840 1.00 51.30  ? 445  VAL B CG2 1 
ATOM   7562 N N   . PRO B 1 446 ? 0.920   -0.281  -28.433 1.00 44.34  ? 446  PRO B N   1 
ATOM   7563 C CA  . PRO B 1 446 ? 2.190   -0.666  -29.072 1.00 50.21  ? 446  PRO B CA  1 
ATOM   7564 C C   . PRO B 1 446 ? 2.693   0.272   -30.180 1.00 50.64  ? 446  PRO B C   1 
ATOM   7565 O O   . PRO B 1 446 ? 2.010   1.206   -30.605 1.00 54.35  ? 446  PRO B O   1 
ATOM   7566 C CB  . PRO B 1 446 ? 1.884   -2.051  -29.675 1.00 37.78  ? 446  PRO B CB  1 
ATOM   7567 C CG  . PRO B 1 446 ? 0.632   -2.514  -29.001 1.00 45.13  ? 446  PRO B CG  1 
ATOM   7568 C CD  . PRO B 1 446 ? -0.142  -1.268  -28.678 1.00 45.74  ? 446  PRO B CD  1 
ATOM   7569 N N   . HIS B 1 447 ? 3.907   -0.009  -30.641 1.00 46.18  ? 447  HIS B N   1 
ATOM   7570 C CA  . HIS B 1 447 ? 4.513   0.675   -31.777 1.00 44.26  ? 447  HIS B CA  1 
ATOM   7571 C C   . HIS B 1 447 ? 3.670   0.480   -33.044 1.00 50.81  ? 447  HIS B C   1 
ATOM   7572 O O   . HIS B 1 447 ? 3.582   -0.628  -33.585 1.00 55.91  ? 447  HIS B O   1 
ATOM   7573 C CB  . HIS B 1 447 ? 5.938   0.148   -31.962 1.00 28.56  ? 447  HIS B CB  1 
ATOM   7574 C CG  . HIS B 1 447 ? 6.746   0.857   -33.009 1.00 45.84  ? 447  HIS B CG  1 
ATOM   7575 N ND1 . HIS B 1 447 ? 7.081   2.191   -32.922 1.00 51.69  ? 447  HIS B ND1 1 
ATOM   7576 C CD2 . HIS B 1 447 ? 7.327   0.399   -34.145 1.00 50.54  ? 447  HIS B CD2 1 
ATOM   7577 C CE1 . HIS B 1 447 ? 7.815   2.530   -33.966 1.00 47.92  ? 447  HIS B CE1 1 
ATOM   7578 N NE2 . HIS B 1 447 ? 7.981   1.460   -34.723 1.00 52.48  ? 447  HIS B NE2 1 
ATOM   7579 N N   . GLY B 1 448 ? 3.028   1.556   -33.495 1.00 41.62  ? 448  GLY B N   1 
ATOM   7580 C CA  . GLY B 1 448 ? 2.330   1.547   -34.769 1.00 32.44  ? 448  GLY B CA  1 
ATOM   7581 C C   . GLY B 1 448 ? 0.819   1.539   -34.710 1.00 48.37  ? 448  GLY B C   1 
ATOM   7582 O O   . GLY B 1 448 ? 0.156   1.391   -35.730 1.00 56.52  ? 448  GLY B O   1 
ATOM   7583 N N   . TYR B 1 449 ? 0.248   1.709   -33.529 1.00 52.59  ? 449  TYR B N   1 
ATOM   7584 C CA  . TYR B 1 449 ? -1.202  1.627   -33.453 1.00 46.30  ? 449  TYR B CA  1 
ATOM   7585 C C   . TYR B 1 449 ? -1.930  2.956   -33.276 1.00 47.49  ? 449  TYR B C   1 
ATOM   7586 O O   . TYR B 1 449 ? -3.106  2.985   -32.909 1.00 35.32  ? 449  TYR B O   1 
ATOM   7587 C CB  . TYR B 1 449 ? -1.620  0.582   -32.436 1.00 37.55  ? 449  TYR B CB  1 
ATOM   7588 C CG  . TYR B 1 449 ? -1.264  -0.769  -32.952 1.00 39.13  ? 449  TYR B CG  1 
ATOM   7589 C CD1 . TYR B 1 449 ? 0.041   -1.221  -32.906 1.00 39.21  ? 449  TYR B CD1 1 
ATOM   7590 C CD2 . TYR B 1 449 ? -2.212  -1.565  -33.546 1.00 44.48  ? 449  TYR B CD2 1 
ATOM   7591 C CE1 . TYR B 1 449 ? 0.376   -2.445  -33.406 1.00 40.28  ? 449  TYR B CE1 1 
ATOM   7592 C CE2 . TYR B 1 449 ? -1.886  -2.799  -34.049 1.00 49.33  ? 449  TYR B CE2 1 
ATOM   7593 C CZ  . TYR B 1 449 ? -0.590  -3.237  -33.974 1.00 45.82  ? 449  TYR B CZ  1 
ATOM   7594 O OH  . TYR B 1 449 ? -0.257  -4.472  -34.481 1.00 49.66  ? 449  TYR B OH  1 
ATOM   7595 N N   . GLU B 1 450 ? -1.223  4.048   -33.551 1.00 38.88  ? 450  GLU B N   1 
ATOM   7596 C CA  . GLU B 1 450 ? -1.874  5.328   -33.798 1.00 30.68  ? 450  GLU B CA  1 
ATOM   7597 C C   . GLU B 1 450 ? -2.324  5.391   -35.272 1.00 46.96  ? 450  GLU B C   1 
ATOM   7598 O O   . GLU B 1 450 ? -3.277  6.084   -35.620 1.00 39.97  ? 450  GLU B O   1 
ATOM   7599 C CB  . GLU B 1 450 ? -0.922  6.484   -33.462 1.00 33.70  ? 450  GLU B CB  1 
ATOM   7600 C CG  . GLU B 1 450 ? 0.045   6.914   -34.561 1.00 38.17  ? 450  GLU B CG  1 
ATOM   7601 C CD  . GLU B 1 450 ? 1.299   6.055   -34.660 1.00 51.12  ? 450  GLU B CD  1 
ATOM   7602 O OE1 . GLU B 1 450 ? 1.236   4.835   -34.359 1.00 48.04  ? 450  GLU B OE1 1 
ATOM   7603 O OE2 . GLU B 1 450 ? 2.348   6.613   -35.054 1.00 42.82  ? 450  GLU B OE2 1 
ATOM   7604 N N   . ILE B 1 451 ? -1.654  4.628   -36.135 1.00 45.03  ? 451  ILE B N   1 
ATOM   7605 C CA  . ILE B 1 451 ? -1.838  4.802   -37.567 1.00 41.29  ? 451  ILE B CA  1 
ATOM   7606 C C   . ILE B 1 451 ? -3.283  4.689   -38.018 1.00 49.07  ? 451  ILE B C   1 
ATOM   7607 O O   . ILE B 1 451 ? -3.794  5.577   -38.698 1.00 54.96  ? 451  ILE B O   1 
ATOM   7608 C CB  . ILE B 1 451 ? -0.946  3.866   -38.392 1.00 40.89  ? 451  ILE B CB  1 
ATOM   7609 C CG1 . ILE B 1 451 ? 0.532   4.157   -38.106 1.00 42.48  ? 451  ILE B CG1 1 
ATOM   7610 C CG2 . ILE B 1 451 ? -1.216  4.069   -39.871 1.00 30.40  ? 451  ILE B CG2 1 
ATOM   7611 C CD1 . ILE B 1 451 ? 1.472   3.070   -38.594 1.00 37.17  ? 451  ILE B CD1 1 
ATOM   7612 N N   . GLU B 1 452 ? -3.937  3.597   -37.641 1.00 50.68  ? 452  GLU B N   1 
ATOM   7613 C CA  . GLU B 1 452 ? -5.319  3.369   -38.022 1.00 44.92  ? 452  GLU B CA  1 
ATOM   7614 C C   . GLU B 1 452 ? -6.221  4.573   -37.733 1.00 49.30  ? 452  GLU B C   1 
ATOM   7615 O O   . GLU B 1 452 ? -7.142  4.877   -38.496 1.00 55.84  ? 452  GLU B O   1 
ATOM   7616 C CB  . GLU B 1 452 ? -5.843  2.111   -37.332 1.00 57.35  ? 452  GLU B CB  1 
ATOM   7617 C CG  . GLU B 1 452 ? -5.496  2.005   -35.854 1.00 57.87  ? 452  GLU B CG  1 
ATOM   7618 C CD  . GLU B 1 452 ? -5.496  0.562   -35.366 1.00 54.77  ? 452  GLU B CD  1 
ATOM   7619 O OE1 . GLU B 1 452 ? -6.559  0.045   -34.951 1.00 49.39  ? 452  GLU B OE1 1 
ATOM   7620 O OE2 . GLU B 1 452 ? -4.420  -0.062  -35.409 1.00 63.34  ? 452  GLU B OE2 1 
ATOM   7621 N N   . PHE B 1 453 ? -5.944  5.267   -36.637 1.00 47.03  ? 453  PHE B N   1 
ATOM   7622 C CA  . PHE B 1 453 ? -6.723  6.453   -36.270 1.00 41.00  ? 453  PHE B CA  1 
ATOM   7623 C C   . PHE B 1 453 ? -6.460  7.685   -37.138 1.00 36.32  ? 453  PHE B C   1 
ATOM   7624 O O   . PHE B 1 453 ? -7.396  8.305   -37.628 1.00 51.24  ? 453  PHE B O   1 
ATOM   7625 C CB  . PHE B 1 453 ? -6.552  6.762   -34.782 1.00 40.29  ? 453  PHE B CB  1 
ATOM   7626 C CG  . PHE B 1 453 ? -7.134  5.706   -33.893 1.00 38.87  ? 453  PHE B CG  1 
ATOM   7627 C CD1 . PHE B 1 453 ? -8.498  5.632   -33.696 1.00 49.07  ? 453  PHE B CD1 1 
ATOM   7628 C CD2 . PHE B 1 453 ? -6.324  4.767   -33.288 1.00 42.39  ? 453  PHE B CD2 1 
ATOM   7629 C CE1 . PHE B 1 453 ? -9.048  4.651   -32.890 1.00 53.70  ? 453  PHE B CE1 1 
ATOM   7630 C CE2 . PHE B 1 453 ? -6.862  3.782   -32.488 1.00 54.22  ? 453  PHE B CE2 1 
ATOM   7631 C CZ  . PHE B 1 453 ? -8.227  3.727   -32.282 1.00 54.86  ? 453  PHE B CZ  1 
ATOM   7632 N N   . ILE B 1 454 ? -5.191  8.031   -37.326 1.00 39.52  ? 454  ILE B N   1 
ATOM   7633 C CA  . ILE B 1 454 ? -4.788  9.062   -38.286 1.00 33.83  ? 454  ILE B CA  1 
ATOM   7634 C C   . ILE B 1 454 ? -5.403  8.823   -39.667 1.00 43.81  ? 454  ILE B C   1 
ATOM   7635 O O   . ILE B 1 454 ? -5.923  9.744   -40.279 1.00 55.73  ? 454  ILE B O   1 
ATOM   7636 C CB  . ILE B 1 454 ? -3.256  9.109   -38.435 1.00 46.32  ? 454  ILE B CB  1 
ATOM   7637 C CG1 . ILE B 1 454 ? -2.576  9.004   -37.066 1.00 50.90  ? 454  ILE B CG1 1 
ATOM   7638 C CG2 . ILE B 1 454 ? -2.814  10.375  -39.159 1.00 42.21  ? 454  ILE B CG2 1 
ATOM   7639 C CD1 . ILE B 1 454 ? -2.920  10.144  -36.148 1.00 49.86  ? 454  ILE B CD1 1 
ATOM   7640 N N   . PHE B 1 455 ? -5.362  7.580   -40.145 1.00 53.85  ? 455  PHE B N   1 
ATOM   7641 C CA  . PHE B 1 455 ? -5.857  7.246   -41.487 1.00 45.75  ? 455  PHE B CA  1 
ATOM   7642 C C   . PHE B 1 455 ? -7.381  7.142   -41.542 1.00 48.25  ? 455  PHE B C   1 
ATOM   7643 O O   . PHE B 1 455 ? -7.960  7.063   -42.624 1.00 48.85  ? 455  PHE B O   1 
ATOM   7644 C CB  . PHE B 1 455 ? -5.183  5.972   -42.039 1.00 44.99  ? 455  PHE B CB  1 
ATOM   7645 C CG  . PHE B 1 455 ? -3.903  6.242   -42.789 1.00 36.05  ? 455  PHE B CG  1 
ATOM   7646 C CD1 . PHE B 1 455 ? -2.715  6.435   -42.116 1.00 39.18  ? 455  PHE B CD1 1 
ATOM   7647 C CD2 . PHE B 1 455 ? -3.896  6.329   -44.166 1.00 43.60  ? 455  PHE B CD2 1 
ATOM   7648 C CE1 . PHE B 1 455 ? -1.549  6.713   -42.796 1.00 39.65  ? 455  PHE B CE1 1 
ATOM   7649 C CE2 . PHE B 1 455 ? -2.729  6.600   -44.851 1.00 33.01  ? 455  PHE B CE2 1 
ATOM   7650 C CZ  . PHE B 1 455 ? -1.553  6.794   -44.160 1.00 32.85  ? 455  PHE B CZ  1 
ATOM   7651 N N   . GLY B 1 456 ? -8.021  7.153   -40.374 1.00 52.66  ? 456  GLY B N   1 
ATOM   7652 C CA  . GLY B 1 456 ? -9.471  7.267   -40.286 1.00 45.46  ? 456  GLY B CA  1 
ATOM   7653 C C   . GLY B 1 456 ? -10.239 5.963   -40.372 1.00 55.83  ? 456  GLY B C   1 
ATOM   7654 O O   . GLY B 1 456 ? -11.427 5.945   -40.728 1.00 55.46  ? 456  GLY B O   1 
ATOM   7655 N N   . LEU B 1 457 ? -9.573  4.862   -40.035 1.00 51.78  ? 457  LEU B N   1 
ATOM   7656 C CA  . LEU B 1 457 ? -10.185 3.548   -40.215 1.00 46.37  ? 457  LEU B CA  1 
ATOM   7657 C C   . LEU B 1 457 ? -11.476 3.321   -39.432 1.00 53.12  ? 457  LEU B C   1 
ATOM   7658 O O   . LEU B 1 457 ? -12.408 2.708   -39.943 1.00 77.70  ? 457  LEU B O   1 
ATOM   7659 C CB  . LEU B 1 457 ? -9.177  2.438   -39.949 1.00 45.18  ? 457  LEU B CB  1 
ATOM   7660 C CG  . LEU B 1 457 ? -8.609  1.970   -41.291 1.00 46.89  ? 457  LEU B CG  1 
ATOM   7661 C CD1 . LEU B 1 457 ? -7.706  3.051   -41.913 1.00 36.87  ? 457  LEU B CD1 1 
ATOM   7662 C CD2 . LEU B 1 457 ? -7.897  0.647   -41.147 1.00 44.61  ? 457  LEU B CD2 1 
ATOM   7663 N N   . PRO B 1 458 ? -11.533 3.796   -38.184 1.00 49.94  ? 458  PRO B N   1 
ATOM   7664 C CA  . PRO B 1 458 ? -12.746 3.614   -37.380 1.00 54.26  ? 458  PRO B CA  1 
ATOM   7665 C C   . PRO B 1 458 ? -14.033 4.071   -38.071 1.00 66.63  ? 458  PRO B C   1 
ATOM   7666 O O   . PRO B 1 458 ? -15.114 3.659   -37.645 1.00 73.71  ? 458  PRO B O   1 
ATOM   7667 C CB  . PRO B 1 458 ? -12.453 4.441   -36.133 1.00 55.78  ? 458  PRO B CB  1 
ATOM   7668 C CG  . PRO B 1 458 ? -10.958 4.309   -35.970 1.00 47.02  ? 458  PRO B CG  1 
ATOM   7669 C CD  . PRO B 1 458 ? -10.404 4.293   -37.373 1.00 50.41  ? 458  PRO B CD  1 
ATOM   7670 N N   . LEU B 1 459 ? -13.926 4.885   -39.120 1.00 69.11  ? 459  LEU B N   1 
ATOM   7671 C CA  . LEU B 1 459 ? -15.106 5.263   -39.907 1.00 65.36  ? 459  LEU B CA  1 
ATOM   7672 C C   . LEU B 1 459 ? -15.589 4.115   -40.790 1.00 62.97  ? 459  LEU B C   1 
ATOM   7673 O O   . LEU B 1 459 ? -16.707 4.138   -41.310 1.00 65.06  ? 459  LEU B O   1 
ATOM   7674 C CB  . LEU B 1 459 ? -14.836 6.500   -40.759 1.00 56.83  ? 459  LEU B CB  1 
ATOM   7675 C CG  . LEU B 1 459 ? -14.671 7.811   -39.997 1.00 58.16  ? 459  LEU B CG  1 
ATOM   7676 C CD1 . LEU B 1 459 ? -13.524 7.694   -39.037 1.00 65.63  ? 459  LEU B CD1 1 
ATOM   7677 C CD2 . LEU B 1 459 ? -14.420 8.946   -40.961 1.00 55.56  ? 459  LEU B CD2 1 
ATOM   7678 N N   . ASP B 1 460 ? -14.734 3.116   -40.966 1.00 65.09  ? 460  ASP B N   1 
ATOM   7679 C CA  . ASP B 1 460 ? -15.157 1.890   -41.605 1.00 73.01  ? 460  ASP B CA  1 
ATOM   7680 C C   . ASP B 1 460 ? -16.133 1.169   -40.675 1.00 70.15  ? 460  ASP B C   1 
ATOM   7681 O O   . ASP B 1 460 ? -15.735 0.506   -39.717 1.00 69.17  ? 460  ASP B O   1 
ATOM   7682 C CB  . ASP B 1 460 ? -13.966 0.999   -41.949 1.00 73.18  ? 460  ASP B CB  1 
ATOM   7683 C CG  . ASP B 1 460 ? -14.366 -0.183  -42.822 1.00 80.61  ? 460  ASP B CG  1 
ATOM   7684 O OD1 . ASP B 1 460 ? -15.544 -0.596  -42.741 1.00 62.46  ? 460  ASP B OD1 1 
ATOM   7685 O OD2 . ASP B 1 460 ? -13.517 -0.690  -43.594 1.00 91.31  ? 460  ASP B OD2 1 
ATOM   7686 N N   . PRO B 1 461 ? -17.425 1.299   -40.969 1.00 73.98  ? 461  PRO B N   1 
ATOM   7687 C CA  . PRO B 1 461 ? -18.519 0.807   -40.126 1.00 79.92  ? 461  PRO B CA  1 
ATOM   7688 C C   . PRO B 1 461 ? -18.326 -0.643  -39.714 1.00 77.11  ? 461  PRO B C   1 
ATOM   7689 O O   . PRO B 1 461 ? -18.746 -1.046  -38.627 1.00 80.86  ? 461  PRO B O   1 
ATOM   7690 C CB  . PRO B 1 461 ? -19.737 0.920   -41.045 1.00 81.21  ? 461  PRO B CB  1 
ATOM   7691 C CG  . PRO B 1 461 ? -19.378 1.981   -42.023 1.00 80.35  ? 461  PRO B CG  1 
ATOM   7692 C CD  . PRO B 1 461 ? -17.907 1.833   -42.252 1.00 77.42  ? 461  PRO B CD  1 
ATOM   7693 N N   . SER B 1 462 ? -17.685 -1.409  -40.587 1.00 72.61  ? 462  SER B N   1 
ATOM   7694 C CA  . SER B 1 462 ? -17.530 -2.845  -40.411 1.00 68.61  ? 462  SER B CA  1 
ATOM   7695 C C   . SER B 1 462 ? -16.255 -3.227  -39.661 1.00 69.65  ? 462  SER B C   1 
ATOM   7696 O O   . SER B 1 462 ? -15.961 -4.419  -39.508 1.00 68.89  ? 462  SER B O   1 
ATOM   7697 C CB  . SER B 1 462 ? -17.512 -3.513  -41.779 1.00 68.53  ? 462  SER B CB  1 
ATOM   7698 O OG  . SER B 1 462 ? -16.356 -3.116  -42.497 1.00 56.95  ? 462  SER B OG  1 
ATOM   7699 N N   . LEU B 1 463 ? -15.490 -2.228  -39.214 1.00 64.42  ? 463  LEU B N   1 
ATOM   7700 C CA  . LEU B 1 463 ? -14.277 -2.494  -38.444 1.00 56.09  ? 463  LEU B CA  1 
ATOM   7701 C C   . LEU B 1 463 ? -14.605 -2.590  -36.952 1.00 69.15  ? 463  LEU B C   1 
ATOM   7702 O O   . LEU B 1 463 ? -13.735 -2.867  -36.122 1.00 76.81  ? 463  LEU B O   1 
ATOM   7703 C CB  . LEU B 1 463 ? -13.210 -1.436  -38.699 1.00 63.78  ? 463  LEU B CB  1 
ATOM   7704 C CG  . LEU B 1 463 ? -12.570 -1.308  -40.086 1.00 67.16  ? 463  LEU B CG  1 
ATOM   7705 C CD1 . LEU B 1 463 ? -11.380 -0.334  -40.051 1.00 57.53  ? 463  LEU B CD1 1 
ATOM   7706 C CD2 . LEU B 1 463 ? -12.140 -2.652  -40.605 1.00 44.61  ? 463  LEU B CD2 1 
ATOM   7707 N N   . ASN B 1 464 ? -15.872 -2.357  -36.627 1.00 72.53  ? 464  ASN B N   1 
ATOM   7708 C CA  . ASN B 1 464 ? -16.394 -2.604  -35.287 1.00 72.71  ? 464  ASN B CA  1 
ATOM   7709 C C   . ASN B 1 464 ? -15.743 -1.754  -34.175 1.00 74.73  ? 464  ASN B C   1 
ATOM   7710 O O   . ASN B 1 464 ? -15.743 -2.135  -33.002 1.00 72.19  ? 464  ASN B O   1 
ATOM   7711 C CB  . ASN B 1 464 ? -16.337 -4.105  -34.978 1.00 71.16  ? 464  ASN B CB  1 
ATOM   7712 C CG  . ASN B 1 464 ? -17.221 -4.934  -35.916 1.00 83.42  ? 464  ASN B CG  1 
ATOM   7713 O OD1 . ASN B 1 464 ? -18.376 -4.588  -36.170 1.00 86.69  ? 464  ASN B OD1 1 
ATOM   7714 N ND2 . ASN B 1 464 ? -16.673 -6.031  -36.434 1.00 85.99  ? 464  ASN B ND2 1 
ATOM   7715 N N   . TYR B 1 465 ? -15.196 -0.601  -34.554 1.00 64.87  ? 465  TYR B N   1 
ATOM   7716 C CA  . TYR B 1 465 ? -14.750 0.395   -33.581 1.00 61.98  ? 465  TYR B CA  1 
ATOM   7717 C C   . TYR B 1 465 ? -15.957 1.083   -32.903 1.00 57.25  ? 465  TYR B C   1 
ATOM   7718 O O   . TYR B 1 465 ? -17.007 1.241   -33.507 1.00 57.13  ? 465  TYR B O   1 
ATOM   7719 C CB  . TYR B 1 465 ? -13.872 1.461   -34.262 1.00 56.70  ? 465  TYR B CB  1 
ATOM   7720 C CG  . TYR B 1 465 ? -12.500 1.002   -34.722 1.00 50.67  ? 465  TYR B CG  1 
ATOM   7721 C CD1 . TYR B 1 465 ? -11.400 1.063   -33.865 1.00 57.66  ? 465  TYR B CD1 1 
ATOM   7722 C CD2 . TYR B 1 465 ? -12.294 0.536   -36.018 1.00 42.19  ? 465  TYR B CD2 1 
ATOM   7723 C CE1 . TYR B 1 465 ? -10.131 0.661   -34.282 1.00 53.12  ? 465  TYR B CE1 1 
ATOM   7724 C CE2 . TYR B 1 465 ? -11.035 0.128   -36.444 1.00 55.01  ? 465  TYR B CE2 1 
ATOM   7725 C CZ  . TYR B 1 465 ? -9.957  0.196   -35.571 1.00 62.30  ? 465  TYR B CZ  1 
ATOM   7726 O OH  . TYR B 1 465 ? -8.709  -0.205  -35.985 1.00 62.72  ? 465  TYR B OH  1 
ATOM   7727 N N   . THR B 1 466 ? -15.790 1.505   -31.655 1.00 66.19  ? 466  THR B N   1 
ATOM   7728 C CA  . THR B 1 466 ? -16.809 2.268   -30.928 1.00 63.33  ? 466  THR B CA  1 
ATOM   7729 C C   . THR B 1 466 ? -16.974 3.697   -31.468 1.00 64.32  ? 466  THR B C   1 
ATOM   7730 O O   . THR B 1 466 ? -16.068 4.241   -32.104 1.00 67.62  ? 466  THR B O   1 
ATOM   7731 C CB  . THR B 1 466 ? -16.427 2.396   -29.434 1.00 65.54  ? 466  THR B CB  1 
ATOM   7732 O OG1 . THR B 1 466 ? -15.642 3.585   -29.232 1.00 56.93  ? 466  THR B OG1 1 
ATOM   7733 C CG2 . THR B 1 466 ? -15.623 1.186   -28.982 1.00 61.00  ? 466  THR B CG2 1 
ATOM   7734 N N   . THR B 1 467 ? -18.121 4.308   -31.173 1.00 66.63  ? 467  THR B N   1 
ATOM   7735 C CA  . THR B 1 467 ? -18.448 5.668   -31.615 1.00 66.30  ? 467  THR B CA  1 
ATOM   7736 C C   . THR B 1 467 ? -17.463 6.699   -31.118 1.00 70.73  ? 467  THR B C   1 
ATOM   7737 O O   . THR B 1 467 ? -17.066 7.599   -31.854 1.00 66.99  ? 467  THR B O   1 
ATOM   7738 C CB  . THR B 1 467 ? -19.802 6.119   -31.080 1.00 66.78  ? 467  THR B CB  1 
ATOM   7739 O OG1 . THR B 1 467 ? -20.584 4.971   -30.730 1.00 83.39  ? 467  THR B OG1 1 
ATOM   7740 C CG2 . THR B 1 467 ? -20.525 6.961   -32.121 1.00 69.58  ? 467  THR B CG2 1 
ATOM   7741 N N   . GLU B 1 468 ? -17.111 6.578   -29.844 1.00 72.97  ? 468  GLU B N   1 
ATOM   7742 C CA  . GLU B 1 468 ? -16.121 7.438   -29.224 1.00 70.78  ? 468  GLU B CA  1 
ATOM   7743 C C   . GLU B 1 468 ? -14.873 7.517   -30.102 1.00 67.41  ? 468  GLU B C   1 
ATOM   7744 O O   . GLU B 1 468 ? -14.299 8.591   -30.306 1.00 65.44  ? 468  GLU B O   1 
ATOM   7745 C CB  . GLU B 1 468 ? -15.769 6.900   -27.830 1.00 75.82  ? 468  GLU B CB  1 
ATOM   7746 C CG  . GLU B 1 468 ? -16.898 7.009   -26.811 1.00 91.25  ? 468  GLU B CG  1 
ATOM   7747 C CD  . GLU B 1 468 ? -17.568 5.675   -26.515 1.00 104.19 ? 468  GLU B CD  1 
ATOM   7748 O OE1 . GLU B 1 468 ? -17.076 4.954   -25.619 1.00 118.79 ? 468  GLU B OE1 1 
ATOM   7749 O OE2 . GLU B 1 468 ? -18.588 5.353   -27.167 1.00 93.66  ? 468  GLU B OE2 1 
ATOM   7750 N N   . GLU B 1 469 ? -14.467 6.368   -30.627 1.00 61.36  ? 469  GLU B N   1 
ATOM   7751 C CA  . GLU B 1 469 ? -13.279 6.291   -31.460 1.00 62.59  ? 469  GLU B CA  1 
ATOM   7752 C C   . GLU B 1 469 ? -13.522 6.898   -32.830 1.00 62.41  ? 469  GLU B C   1 
ATOM   7753 O O   . GLU B 1 469 ? -12.646 7.548   -33.396 1.00 70.48  ? 469  GLU B O   1 
ATOM   7754 C CB  . GLU B 1 469 ? -12.836 4.846   -31.600 1.00 62.11  ? 469  GLU B CB  1 
ATOM   7755 C CG  . GLU B 1 469 ? -12.446 4.237   -30.287 1.00 59.25  ? 469  GLU B CG  1 
ATOM   7756 C CD  . GLU B 1 469 ? -12.182 2.761   -30.396 1.00 63.29  ? 469  GLU B CD  1 
ATOM   7757 O OE1 . GLU B 1 469 ? -13.026 2.063   -31.012 1.00 67.09  ? 469  GLU B OE1 1 
ATOM   7758 O OE2 . GLU B 1 469 ? -11.133 2.310   -29.864 1.00 51.81  ? 469  GLU B OE2 1 
ATOM   7759 N N   . ARG B 1 470 ? -14.709 6.683   -33.371 1.00 53.44  ? 470  ARG B N   1 
ATOM   7760 C CA  . ARG B 1 470 ? -15.037 7.326   -34.620 1.00 56.43  ? 470  ARG B CA  1 
ATOM   7761 C C   . ARG B 1 470 ? -14.834 8.832   -34.443 1.00 63.17  ? 470  ARG B C   1 
ATOM   7762 O O   . ARG B 1 470 ? -14.134 9.451   -35.237 1.00 69.98  ? 470  ARG B O   1 
ATOM   7763 C CB  . ARG B 1 470 ? -16.455 6.975   -35.073 1.00 60.91  ? 470  ARG B CB  1 
ATOM   7764 C CG  . ARG B 1 470 ? -16.771 7.428   -36.481 1.00 73.88  ? 470  ARG B CG  1 
ATOM   7765 C CD  . ARG B 1 470 ? -18.194 7.049   -36.901 1.00 95.84  ? 470  ARG B CD  1 
ATOM   7766 N NE  . ARG B 1 470 ? -19.197 7.697   -36.063 1.00 114.27 ? 470  ARG B NE  1 
ATOM   7767 C CZ  . ARG B 1 470 ? -19.489 8.994   -36.113 1.00 121.06 ? 470  ARG B CZ  1 
ATOM   7768 N NH1 . ARG B 1 470 ? -18.852 9.792   -36.961 1.00 115.80 ? 470  ARG B NH1 1 
ATOM   7769 N NH2 . ARG B 1 470 ? -20.415 9.493   -35.306 1.00 127.15 ? 470  ARG B NH2 1 
ATOM   7770 N N   . ILE B 1 471 ? -15.413 9.409   -33.386 1.00 65.18  ? 471  ILE B N   1 
ATOM   7771 C CA  . ILE B 1 471 ? -15.241 10.836  -33.085 1.00 59.75  ? 471  ILE B CA  1 
ATOM   7772 C C   . ILE B 1 471 ? -13.769 11.208  -32.898 1.00 61.35  ? 471  ILE B C   1 
ATOM   7773 O O   . ILE B 1 471 ? -13.334 12.291  -33.290 1.00 58.50  ? 471  ILE B O   1 
ATOM   7774 C CB  . ILE B 1 471 ? -15.988 11.279  -31.805 1.00 56.63  ? 471  ILE B CB  1 
ATOM   7775 C CG1 . ILE B 1 471 ? -17.492 11.359  -32.032 1.00 50.55  ? 471  ILE B CG1 1 
ATOM   7776 C CG2 . ILE B 1 471 ? -15.502 12.652  -31.367 1.00 53.97  ? 471  ILE B CG2 1 
ATOM   7777 C CD1 . ILE B 1 471 ? -18.178 10.014  -32.041 1.00 71.26  ? 471  ILE B CD1 1 
ATOM   7778 N N   . PHE B 1 472 ? -13.012 10.299  -32.296 1.00 59.61  ? 472  PHE B N   1 
ATOM   7779 C CA  . PHE B 1 472 ? -11.597 10.523  -32.016 1.00 50.19  ? 472  PHE B CA  1 
ATOM   7780 C C   . PHE B 1 472 ? -10.753 10.512  -33.280 1.00 52.74  ? 472  PHE B C   1 
ATOM   7781 O O   . PHE B 1 472 ? -9.885  11.363  -33.471 1.00 64.36  ? 472  PHE B O   1 
ATOM   7782 C CB  . PHE B 1 472 ? -11.104 9.453   -31.050 1.00 50.77  ? 472  PHE B CB  1 
ATOM   7783 C CG  . PHE B 1 472 ? -9.679  9.612   -30.648 1.00 51.88  ? 472  PHE B CG  1 
ATOM   7784 C CD1 . PHE B 1 472 ? -9.178  10.857  -30.311 1.00 56.83  ? 472  PHE B CD1 1 
ATOM   7785 C CD2 . PHE B 1 472 ? -8.842  8.511   -30.582 1.00 42.40  ? 472  PHE B CD2 1 
ATOM   7786 C CE1 . PHE B 1 472 ? -7.862  11.001  -29.943 1.00 56.90  ? 472  PHE B CE1 1 
ATOM   7787 C CE2 . PHE B 1 472 ? -7.530  8.647   -30.211 1.00 42.68  ? 472  PHE B CE2 1 
ATOM   7788 C CZ  . PHE B 1 472 ? -7.033  9.894   -29.895 1.00 48.32  ? 472  PHE B CZ  1 
ATOM   7789 N N   . ALA B 1 473 ? -11.003 9.538   -34.140 1.00 55.09  ? 473  ALA B N   1 
ATOM   7790 C CA  . ALA B 1 473 ? -10.313 9.467   -35.418 1.00 55.44  ? 473  ALA B CA  1 
ATOM   7791 C C   . ALA B 1 473 ? -10.541 10.765  -36.191 1.00 44.66  ? 473  ALA B C   1 
ATOM   7792 O O   . ALA B 1 473 ? -9.619  11.323  -36.785 1.00 46.21  ? 473  ALA B O   1 
ATOM   7793 C CB  . ALA B 1 473 ? -10.795 8.245   -36.220 1.00 48.69  ? 473  ALA B CB  1 
ATOM   7794 N N   . GLN B 1 474 ? -11.770 11.261  -36.156 1.00 43.91  ? 474  GLN B N   1 
ATOM   7795 C CA  . GLN B 1 474 ? -12.107 12.479  -36.887 1.00 48.69  ? 474  GLN B CA  1 
ATOM   7796 C C   . GLN B 1 474 ? -11.324 13.674  -36.348 1.00 54.42  ? 474  GLN B C   1 
ATOM   7797 O O   . GLN B 1 474 ? -10.957 14.584  -37.090 1.00 64.50  ? 474  GLN B O   1 
ATOM   7798 C CB  . GLN B 1 474 ? -13.620 12.748  -36.845 1.00 56.13  ? 474  GLN B CB  1 
ATOM   7799 C CG  . GLN B 1 474 ? -14.490 11.662  -37.498 1.00 62.44  ? 474  GLN B CG  1 
ATOM   7800 C CD  . GLN B 1 474 ? -15.949 12.096  -37.733 1.00 76.62  ? 474  GLN B CD  1 
ATOM   7801 O OE1 . GLN B 1 474 ? -16.849 11.776  -36.948 1.00 69.56  ? 474  GLN B OE1 1 
ATOM   7802 N NE2 . GLN B 1 474 ? -16.181 12.811  -38.830 1.00 82.68  ? 474  GLN B NE2 1 
ATOM   7803 N N   . ARG B 1 475 ? -11.054 13.656  -35.051 1.00 50.34  ? 475  ARG B N   1 
ATOM   7804 C CA  . ARG B 1 475 ? -10.345 14.748  -34.419 1.00 42.99  ? 475  ARG B CA  1 
ATOM   7805 C C   . ARG B 1 475 ? -8.899  14.769  -34.868 1.00 51.75  ? 475  ARG B C   1 
ATOM   7806 O O   . ARG B 1 475 ? -8.317  15.844  -35.030 1.00 54.16  ? 475  ARG B O   1 
ATOM   7807 C CB  . ARG B 1 475 ? -10.443 14.636  -32.900 1.00 51.59  ? 475  ARG B CB  1 
ATOM   7808 C CG  . ARG B 1 475 ? -10.078 15.911  -32.143 1.00 70.52  ? 475  ARG B CG  1 
ATOM   7809 C CD  . ARG B 1 475 ? -10.406 15.774  -30.642 1.00 83.36  ? 475  ARG B CD  1 
ATOM   7810 N NE  . ARG B 1 475 ? -9.221  15.604  -29.783 1.00 80.71  ? 475  ARG B NE  1 
ATOM   7811 C CZ  . ARG B 1 475 ? -9.137  14.725  -28.784 1.00 67.99  ? 475  ARG B CZ  1 
ATOM   7812 N NH1 . ARG B 1 475 ? -10.168 13.922  -28.519 1.00 55.81  ? 475  ARG B NH1 1 
ATOM   7813 N NH2 . ARG B 1 475 ? -8.027  14.647  -28.048 1.00 69.53  ? 475  ARG B NH2 1 
ATOM   7814 N N   . LEU B 1 476 ? -8.316  13.585  -35.073 1.00 46.20  ? 476  LEU B N   1 
ATOM   7815 C CA  . LEU B 1 476 ? -6.918  13.501  -35.491 1.00 43.37  ? 476  LEU B CA  1 
ATOM   7816 C C   . LEU B 1 476 ? -6.753  13.869  -36.967 1.00 42.38  ? 476  LEU B C   1 
ATOM   7817 O O   . LEU B 1 476 ? -5.775  14.508  -37.360 1.00 40.25  ? 476  LEU B O   1 
ATOM   7818 C CB  . LEU B 1 476 ? -6.373  12.093  -35.269 1.00 58.03  ? 476  LEU B CB  1 
ATOM   7819 C CG  . LEU B 1 476 ? -6.523  11.473  -33.884 1.00 54.23  ? 476  LEU B CG  1 
ATOM   7820 C CD1 . LEU B 1 476 ? -6.439  9.957   -33.984 1.00 52.30  ? 476  LEU B CD1 1 
ATOM   7821 C CD2 . LEU B 1 476 ? -5.466  11.988  -32.973 1.00 32.36  ? 476  LEU B CD2 1 
ATOM   7822 N N   . MET B 1 477 ? -7.696  13.448  -37.797 1.00 35.97  ? 477  MET B N   1 
ATOM   7823 C CA  . MET B 1 477 ? -7.555  13.708  -39.207 1.00 38.38  ? 477  MET B CA  1 
ATOM   7824 C C   . MET B 1 477 ? -7.559  15.220  -39.380 1.00 52.70  ? 477  MET B C   1 
ATOM   7825 O O   . MET B 1 477 ? -6.873  15.767  -40.244 1.00 60.28  ? 477  MET B O   1 
ATOM   7826 C CB  . MET B 1 477 ? -8.696  13.072  -39.991 1.00 46.41  ? 477  MET B CB  1 
ATOM   7827 C CG  . MET B 1 477 ? -8.797  11.565  -39.854 1.00 51.75  ? 477  MET B CG  1 
ATOM   7828 S SD  . MET B 1 477 ? -10.311 10.937  -40.616 1.00 59.68  ? 477  MET B SD  1 
ATOM   7829 C CE  . MET B 1 477 ? -9.970  11.215  -42.344 1.00 56.22  ? 477  MET B CE  1 
ATOM   7830 N N   . LYS B 1 478 ? -8.339  15.895  -38.543 1.00 45.48  ? 478  LYS B N   1 
ATOM   7831 C CA  . LYS B 1 478 ? -8.344  17.352  -38.507 1.00 34.82  ? 478  LYS B CA  1 
ATOM   7832 C C   . LYS B 1 478 ? -6.979  17.918  -38.119 1.00 30.37  ? 478  LYS B C   1 
ATOM   7833 O O   . LYS B 1 478 ? -6.384  18.677  -38.873 1.00 61.47  ? 478  LYS B O   1 
ATOM   7834 C CB  . LYS B 1 478 ? -9.420  17.858  -37.556 1.00 34.16  ? 478  LYS B CB  1 
ATOM   7835 C CG  . LYS B 1 478 ? -10.731 18.071  -38.215 1.00 57.17  ? 478  LYS B CG  1 
ATOM   7836 C CD  . LYS B 1 478 ? -11.046 19.548  -38.323 1.00 66.29  ? 478  LYS B CD  1 
ATOM   7837 C CE  . LYS B 1 478 ? -12.242 19.776  -39.256 1.00 78.66  ? 478  LYS B CE  1 
ATOM   7838 N NZ  . LYS B 1 478 ? -11.892 19.567  -40.708 1.00 79.23  ? 478  LYS B NZ  1 
ATOM   7839 N N   . TYR B 1 479 ? -6.485  17.546  -36.946 1.00 36.58  ? 479  TYR B N   1 
ATOM   7840 C CA  . TYR B 1 479 ? -5.152  17.969  -36.525 1.00 43.34  ? 479  TYR B CA  1 
ATOM   7841 C C   . TYR B 1 479 ? -4.162  17.823  -37.660 1.00 45.90  ? 479  TYR B C   1 
ATOM   7842 O O   . TYR B 1 479 ? -3.495  18.781  -38.058 1.00 57.27  ? 479  TYR B O   1 
ATOM   7843 C CB  . TYR B 1 479 ? -4.649  17.093  -35.384 1.00 55.92  ? 479  TYR B CB  1 
ATOM   7844 C CG  . TYR B 1 479 ? -5.355  17.318  -34.084 1.00 56.61  ? 479  TYR B CG  1 
ATOM   7845 C CD1 . TYR B 1 479 ? -5.780  18.595  -33.717 1.00 44.85  ? 479  TYR B CD1 1 
ATOM   7846 C CD2 . TYR B 1 479 ? -5.610  16.254  -33.218 1.00 54.33  ? 479  TYR B CD2 1 
ATOM   7847 C CE1 . TYR B 1 479 ? -6.448  18.807  -32.511 1.00 48.65  ? 479  TYR B CE1 1 
ATOM   7848 C CE2 . TYR B 1 479 ? -6.278  16.457  -32.009 1.00 57.34  ? 479  TYR B CE2 1 
ATOM   7849 C CZ  . TYR B 1 479 ? -6.693  17.734  -31.662 1.00 56.12  ? 479  TYR B CZ  1 
ATOM   7850 O OH  . TYR B 1 479 ? -7.358  17.937  -30.472 1.00 69.19  ? 479  TYR B OH  1 
ATOM   7851 N N   . TRP B 1 480 ? -4.063  16.599  -38.163 1.00 41.03  ? 480  TRP B N   1 
ATOM   7852 C CA  . TRP B 1 480 ? -3.083  16.284  -39.187 1.00 44.67  ? 480  TRP B CA  1 
ATOM   7853 C C   . TRP B 1 480 ? -3.226  17.148  -40.441 1.00 40.32  ? 480  TRP B C   1 
ATOM   7854 O O   . TRP B 1 480 ? -2.219  17.624  -40.973 1.00 35.41  ? 480  TRP B O   1 
ATOM   7855 C CB  . TRP B 1 480 ? -3.108  14.790  -39.524 1.00 35.99  ? 480  TRP B CB  1 
ATOM   7856 C CG  . TRP B 1 480 ? -2.031  13.980  -38.841 1.00 35.01  ? 480  TRP B CG  1 
ATOM   7857 C CD1 . TRP B 1 480 ? -1.037  13.266  -39.443 1.00 37.49  ? 480  TRP B CD1 1 
ATOM   7858 C CD2 . TRP B 1 480 ? -1.844  13.804  -37.426 1.00 51.02  ? 480  TRP B CD2 1 
ATOM   7859 N NE1 . TRP B 1 480 ? -0.237  12.662  -38.498 1.00 40.14  ? 480  TRP B NE1 1 
ATOM   7860 C CE2 . TRP B 1 480 ? -0.718  12.968  -37.253 1.00 47.16  ? 480  TRP B CE2 1 
ATOM   7861 C CE3 . TRP B 1 480 ? -2.520  14.271  -36.291 1.00 51.22  ? 480  TRP B CE3 1 
ATOM   7862 C CZ2 . TRP B 1 480 ? -0.260  12.586  -35.996 1.00 50.01  ? 480  TRP B CZ2 1 
ATOM   7863 C CZ3 . TRP B 1 480 ? -2.059  13.897  -35.045 1.00 46.49  ? 480  TRP B CZ3 1 
ATOM   7864 C CH2 . TRP B 1 480 ? -0.941  13.057  -34.907 1.00 50.38  ? 480  TRP B CH2 1 
ATOM   7865 N N   . THR B 1 481 ? -4.463  17.354  -40.898 1.00 33.92  ? 481  THR B N   1 
ATOM   7866 C CA  . THR B 1 481 ? -4.713  18.137  -42.106 1.00 33.81  ? 481  THR B CA  1 
ATOM   7867 C C   . THR B 1 481 ? -4.556  19.635  -41.843 1.00 60.11  ? 481  THR B C   1 
ATOM   7868 O O   . THR B 1 481 ? -3.982  20.350  -42.660 1.00 70.59  ? 481  THR B O   1 
ATOM   7869 C CB  . THR B 1 481 ? -6.121  17.886  -42.700 1.00 43.69  ? 481  THR B CB  1 
ATOM   7870 O OG1 . THR B 1 481 ? -7.116  18.215  -41.727 1.00 61.06  ? 481  THR B OG1 1 
ATOM   7871 C CG2 . THR B 1 481 ? -6.304  16.436  -43.150 1.00 34.10  ? 481  THR B CG2 1 
ATOM   7872 N N   . ASN B 1 482 ? -5.078  20.112  -40.714 1.00 61.76  ? 482  ASN B N   1 
ATOM   7873 C CA  . ASN B 1 482 ? -4.884  21.509  -40.338 1.00 55.82  ? 482  ASN B CA  1 
ATOM   7874 C C   . ASN B 1 482 ? -3.409  21.777  -40.324 1.00 56.77  ? 482  ASN B C   1 
ATOM   7875 O O   . ASN B 1 482 ? -2.961  22.879  -40.669 1.00 56.42  ? 482  ASN B O   1 
ATOM   7876 C CB  . ASN B 1 482 ? -5.441  21.817  -38.950 1.00 46.74  ? 482  ASN B CB  1 
ATOM   7877 C CG  . ASN B 1 482 ? -6.943  21.837  -38.922 1.00 54.68  ? 482  ASN B CG  1 
ATOM   7878 O OD1 . ASN B 1 482 ? -7.592  22.270  -39.877 1.00 53.76  ? 482  ASN B OD1 1 
ATOM   7879 N ND2 . ASN B 1 482 ? -7.515  21.357  -37.822 1.00 68.67  ? 482  ASN B ND2 1 
ATOM   7880 N N   . PHE B 1 483 ? -2.650  20.767  -39.908 1.00 44.54  ? 483  PHE B N   1 
ATOM   7881 C CA  . PHE B 1 483 ? -1.204  20.902  -39.924 1.00 49.16  ? 483  PHE B CA  1 
ATOM   7882 C C   . PHE B 1 483 ? -0.728  21.030  -41.375 1.00 55.64  ? 483  PHE B C   1 
ATOM   7883 O O   . PHE B 1 483 ? -0.086  22.022  -41.732 1.00 53.34  ? 483  PHE B O   1 
ATOM   7884 C CB  . PHE B 1 483 ? -0.497  19.759  -39.182 1.00 46.57  ? 483  PHE B CB  1 
ATOM   7885 C CG  . PHE B 1 483 ? 1.015   19.853  -39.231 1.00 49.49  ? 483  PHE B CG  1 
ATOM   7886 C CD1 . PHE B 1 483 ? 1.689   20.804  -38.472 1.00 37.52  ? 483  PHE B CD1 1 
ATOM   7887 C CD2 . PHE B 1 483 ? 1.759   19.004  -40.057 1.00 43.50  ? 483  PHE B CD2 1 
ATOM   7888 C CE1 . PHE B 1 483 ? 3.057   20.903  -38.529 1.00 44.50  ? 483  PHE B CE1 1 
ATOM   7889 C CE2 . PHE B 1 483 ? 3.136   19.096  -40.116 1.00 37.78  ? 483  PHE B CE2 1 
ATOM   7890 C CZ  . PHE B 1 483 ? 3.786   20.045  -39.354 1.00 51.68  ? 483  PHE B CZ  1 
ATOM   7891 N N   . ALA B 1 484 ? -1.066  20.048  -42.210 1.00 47.31  ? 484  ALA B N   1 
ATOM   7892 C CA  . ALA B 1 484 ? -0.737  20.102  -43.637 1.00 43.49  ? 484  ALA B CA  1 
ATOM   7893 C C   . ALA B 1 484 ? -1.077  21.457  -44.252 1.00 42.88  ? 484  ALA B C   1 
ATOM   7894 O O   . ALA B 1 484 ? -0.283  22.039  -44.989 1.00 39.08  ? 484  ALA B O   1 
ATOM   7895 C CB  . ALA B 1 484 ? -1.455  18.989  -44.400 1.00 35.42  ? 484  ALA B CB  1 
ATOM   7896 N N   . ARG B 1 485 ? -2.267  21.952  -43.957 1.00 30.55  ? 485  ARG B N   1 
ATOM   7897 C CA  . ARG B 1 485 ? -2.720  23.199  -44.548 1.00 45.87  ? 485  ARG B CA  1 
ATOM   7898 C C   . ARG B 1 485 ? -1.919  24.397  -44.050 1.00 46.51  ? 485  ARG B C   1 
ATOM   7899 O O   . ARG B 1 485 ? -1.525  25.244  -44.837 1.00 56.94  ? 485  ARG B O   1 
ATOM   7900 C CB  . ARG B 1 485 ? -4.209  23.417  -44.278 1.00 34.73  ? 485  ARG B CB  1 
ATOM   7901 C CG  . ARG B 1 485 ? -5.122  22.784  -45.293 1.00 58.38  ? 485  ARG B CG  1 
ATOM   7902 C CD  . ARG B 1 485 ? -6.581  23.030  -44.940 1.00 68.62  ? 485  ARG B CD  1 
ATOM   7903 N NE  . ARG B 1 485 ? -7.013  22.223  -43.797 1.00 76.86  ? 485  ARG B NE  1 
ATOM   7904 C CZ  . ARG B 1 485 ? -7.972  21.295  -43.840 1.00 83.05  ? 485  ARG B CZ  1 
ATOM   7905 N NH1 . ARG B 1 485 ? -8.629  21.043  -44.974 1.00 77.91  ? 485  ARG B NH1 1 
ATOM   7906 N NH2 . ARG B 1 485 ? -8.280  20.619  -42.738 1.00 86.29  ? 485  ARG B NH2 1 
ATOM   7907 N N   . THR B 1 486 ? -1.655  24.437  -42.747 1.00 45.62  ? 486  THR B N   1 
ATOM   7908 C CA  . THR B 1 486 ? -1.239  25.666  -42.084 1.00 42.38  ? 486  THR B CA  1 
ATOM   7909 C C   . THR B 1 486 ? 0.088   25.605  -41.356 1.00 47.69  ? 486  THR B C   1 
ATOM   7910 O O   . THR B 1 486 ? 0.642   26.644  -41.001 1.00 62.94  ? 486  THR B O   1 
ATOM   7911 C CB  . THR B 1 486 ? -2.283  26.082  -41.035 1.00 57.53  ? 486  THR B CB  1 
ATOM   7912 O OG1 . THR B 1 486 ? -2.590  24.954  -40.201 1.00 62.49  ? 486  THR B OG1 1 
ATOM   7913 C CG2 . THR B 1 486 ? -3.559  26.589  -41.708 1.00 37.42  ? 486  THR B CG2 1 
ATOM   7914 N N   . GLY B 1 487 ? 0.590   24.398  -41.111 1.00 45.83  ? 487  GLY B N   1 
ATOM   7915 C CA  . GLY B 1 487 ? 1.739   24.221  -40.239 1.00 36.59  ? 487  GLY B CA  1 
ATOM   7916 C C   . GLY B 1 487 ? 1.367   24.265  -38.763 1.00 45.22  ? 487  GLY B C   1 
ATOM   7917 O O   . GLY B 1 487 ? 2.230   24.233  -37.892 1.00 38.31  ? 487  GLY B O   1 
ATOM   7918 N N   . ASP B 1 488 ? 0.066   24.347  -38.491 1.00 62.37  ? 488  ASP B N   1 
ATOM   7919 C CA  . ASP B 1 488 ? -0.450  24.426  -37.131 1.00 56.03  ? 488  ASP B CA  1 
ATOM   7920 C C   . ASP B 1 488 ? -1.663  23.516  -37.027 1.00 44.80  ? 488  ASP B C   1 
ATOM   7921 O O   . ASP B 1 488 ? -2.635  23.714  -37.738 1.00 49.83  ? 488  ASP B O   1 
ATOM   7922 C CB  . ASP B 1 488 ? -0.852  25.869  -36.806 1.00 49.47  ? 488  ASP B CB  1 
ATOM   7923 C CG  . ASP B 1 488 ? -1.336  26.030  -35.380 1.00 56.55  ? 488  ASP B CG  1 
ATOM   7924 O OD1 . ASP B 1 488 ? -1.420  25.009  -34.664 1.00 70.09  ? 488  ASP B OD1 1 
ATOM   7925 O OD2 . ASP B 1 488 ? -1.647  27.164  -34.974 1.00 50.11  ? 488  ASP B OD2 1 
ATOM   7926 N N   . PRO B 1 489 ? -1.612  22.518  -36.137 1.00 40.48  ? 489  PRO B N   1 
ATOM   7927 C CA  . PRO B 1 489 ? -2.697  21.529  -36.067 1.00 54.47  ? 489  PRO B CA  1 
ATOM   7928 C C   . PRO B 1 489 ? -3.970  22.079  -35.426 1.00 65.88  ? 489  PRO B C   1 
ATOM   7929 O O   . PRO B 1 489 ? -4.987  21.387  -35.370 1.00 66.93  ? 489  PRO B O   1 
ATOM   7930 C CB  . PRO B 1 489 ? -2.105  20.424  -35.186 1.00 35.81  ? 489  PRO B CB  1 
ATOM   7931 C CG  . PRO B 1 489 ? -1.127  21.106  -34.325 1.00 34.11  ? 489  PRO B CG  1 
ATOM   7932 C CD  . PRO B 1 489 ? -0.558  22.252  -35.143 1.00 48.15  ? 489  PRO B CD  1 
ATOM   7933 N N   . ASN B 1 490 ? -3.910  23.316  -34.945 1.00 69.55  ? 490  ASN B N   1 
ATOM   7934 C CA  . ASN B 1 490 ? -5.047  23.900  -34.248 1.00 65.08  ? 490  ASN B CA  1 
ATOM   7935 C C   . ASN B 1 490 ? -6.106  24.357  -35.218 1.00 70.76  ? 490  ASN B C   1 
ATOM   7936 O O   . ASN B 1 490 ? -5.818  25.102  -36.151 1.00 76.48  ? 490  ASN B O   1 
ATOM   7937 C CB  . ASN B 1 490 ? -4.620  25.068  -33.350 1.00 47.92  ? 490  ASN B CB  1 
ATOM   7938 C CG  . ASN B 1 490 ? -3.870  24.608  -32.115 1.00 55.06  ? 490  ASN B CG  1 
ATOM   7939 O OD1 . ASN B 1 490 ? -4.471  24.108  -31.166 1.00 62.52  ? 490  ASN B OD1 1 
ATOM   7940 N ND2 . ASN B 1 490 ? -2.555  24.780  -32.114 1.00 60.89  ? 490  ASN B ND2 1 
ATOM   7941 N N   . ASP B 1 491 ? -7.327  23.883  -35.006 1.00 72.45  ? 491  ASP B N   1 
ATOM   7942 C CA  . ASP B 1 491 ? -8.465  24.394  -35.739 1.00 74.92  ? 491  ASP B CA  1 
ATOM   7943 C C   . ASP B 1 491 ? -8.414  25.920  -35.626 1.00 78.16  ? 491  ASP B C   1 
ATOM   7944 O O   . ASP B 1 491 ? -8.281  26.450  -34.522 1.00 88.22  ? 491  ASP B O   1 
ATOM   7945 C CB  . ASP B 1 491 ? -9.757  23.845  -35.125 1.00 82.56  ? 491  ASP B CB  1 
ATOM   7946 C CG  . ASP B 1 491 ? -10.763 23.387  -36.176 1.00 102.42 ? 491  ASP B CG  1 
ATOM   7947 O OD1 . ASP B 1 491 ? -10.707 23.873  -37.332 1.00 106.30 ? 491  ASP B OD1 1 
ATOM   7948 O OD2 . ASP B 1 491 ? -11.619 22.539  -35.838 1.00 105.63 ? 491  ASP B OD2 1 
ATOM   7949 N N   . PRO B 1 492 ? -8.492  26.631  -36.768 1.00 84.27  ? 492  PRO B N   1 
ATOM   7950 C CA  . PRO B 1 492 ? -8.535  28.101  -36.783 1.00 93.16  ? 492  PRO B CA  1 
ATOM   7951 C C   . PRO B 1 492 ? -9.950  28.630  -36.556 1.00 99.68  ? 492  PRO B C   1 
ATOM   7952 O O   . PRO B 1 492 ? -10.153 29.845  -36.570 1.00 100.01 ? 492  PRO B O   1 
ATOM   7953 C CB  . PRO B 1 492 ? -8.060  28.456  -38.196 1.00 90.15  ? 492  PRO B CB  1 
ATOM   7954 C CG  . PRO B 1 492 ? -8.305  27.221  -39.023 1.00 85.39  ? 492  PRO B CG  1 
ATOM   7955 C CD  . PRO B 1 492 ? -8.679  26.072  -38.116 1.00 86.52  ? 492  PRO B CD  1 
ATOM   7956 N N   . ARG B 1 493 ? -10.895 27.711  -36.344 1.00 104.63 ? 493  ARG B N   1 
ATOM   7957 C CA  . ARG B 1 493 ? -12.286 28.020  -36.011 1.00 104.16 ? 493  ARG B CA  1 
ATOM   7958 C C   . ARG B 1 493 ? -12.689 27.428  -34.650 1.00 107.68 ? 493  ARG B C   1 
ATOM   7959 O O   . ARG B 1 493 ? -13.725 27.780  -34.087 1.00 103.49 ? 493  ARG B O   1 
ATOM   7960 C CB  . ARG B 1 493 ? -13.221 27.499  -37.107 1.00 106.34 ? 493  ARG B CB  1 
ATOM   7961 N N   . ASP B 1 494 ? -11.870 26.514  -34.137 1.00 124.66 ? 494  ASP B N   1 
ATOM   7962 C CA  . ASP B 1 494 ? -12.016 26.022  -32.770 1.00 139.95 ? 494  ASP B CA  1 
ATOM   7963 C C   . ASP B 1 494 ? -11.466 27.068  -31.802 1.00 153.02 ? 494  ASP B C   1 
ATOM   7964 O O   . ASP B 1 494 ? -10.477 27.735  -32.113 1.00 153.15 ? 494  ASP B O   1 
ATOM   7965 C CB  . ASP B 1 494 ? -11.272 24.697  -32.589 1.00 135.24 ? 494  ASP B CB  1 
ATOM   7966 N N   . SER B 1 495 ? -12.062 27.192  -30.616 1.00 160.09 ? 495  SER B N   1 
ATOM   7967 C CA  . SER B 1 495 ? -13.039 26.244  -30.087 1.00 161.08 ? 495  SER B CA  1 
ATOM   7968 C C   . SER B 1 495 ? -12.291 25.152  -29.334 1.00 159.21 ? 495  SER B C   1 
ATOM   7969 O O   . SER B 1 495 ? -11.066 25.049  -29.444 1.00 152.80 ? 495  SER B O   1 
ATOM   7970 C CB  . SER B 1 495 ? -13.914 25.640  -31.191 1.00 156.66 ? 495  SER B CB  1 
ATOM   7971 N N   . LYS B 1 496 ? -13.020 24.351  -28.560 1.00 161.55 ? 496  LYS B N   1 
ATOM   7972 C CA  . LYS B 1 496 ? -12.410 23.243  -27.834 1.00 155.02 ? 496  LYS B CA  1 
ATOM   7973 C C   . LYS B 1 496 ? -11.392 22.549  -28.740 1.00 150.74 ? 496  LYS B C   1 
ATOM   7974 O O   . LYS B 1 496 ? -11.631 22.387  -29.943 1.00 145.77 ? 496  LYS B O   1 
ATOM   7975 C CB  . LYS B 1 496 ? -13.473 22.251  -27.355 1.00 151.12 ? 496  LYS B CB  1 
ATOM   7976 N N   . SER B 1 497 ? -10.259 22.144  -28.167 1.00 145.20 ? 497  SER B N   1 
ATOM   7977 C CA  . SER B 1 497 ? -10.019 22.251  -26.728 1.00 131.29 ? 497  SER B CA  1 
ATOM   7978 C C   . SER B 1 497 ? -8.967  23.316  -26.379 1.00 115.19 ? 497  SER B C   1 
ATOM   7979 O O   . SER B 1 497 ? -8.781  24.271  -27.133 1.00 107.17 ? 497  SER B O   1 
ATOM   7980 C CB  . SER B 1 497 ? -9.632  20.881  -26.165 1.00 124.43 ? 497  SER B CB  1 
ATOM   7981 N N   . PRO B 1 498 ? -8.282  23.154  -25.230 1.00 109.05 ? 498  PRO B N   1 
ATOM   7982 C CA  . PRO B 1 498 ? -7.363  24.166  -24.692 1.00 102.57 ? 498  PRO B CA  1 
ATOM   7983 C C   . PRO B 1 498 ? -6.284  24.663  -25.665 1.00 88.55  ? 498  PRO B C   1 
ATOM   7984 O O   . PRO B 1 498 ? -5.428  25.457  -25.259 1.00 95.93  ? 498  PRO B O   1 
ATOM   7985 C CB  . PRO B 1 498 ? -6.698  23.437  -23.517 1.00 97.64  ? 498  PRO B CB  1 
ATOM   7986 C CG  . PRO B 1 498 ? -7.684  22.439  -23.089 1.00 98.03  ? 498  PRO B CG  1 
ATOM   7987 C CD  . PRO B 1 498 ? -8.371  21.982  -24.340 1.00 103.96 ? 498  PRO B CD  1 
ATOM   7988 N N   . GLN B 1 499 ? -6.314  24.217  -26.915 1.00 61.48  ? 499  GLN B N   1 
ATOM   7989 C CA  . GLN B 1 499 ? -5.286  24.633  -27.879 1.00 56.96  ? 499  GLN B CA  1 
ATOM   7990 C C   . GLN B 1 499 ? -3.982  23.895  -27.648 1.00 54.94  ? 499  GLN B C   1 
ATOM   7991 O O   . GLN B 1 499 ? -3.515  23.763  -26.523 1.00 50.66  ? 499  GLN B O   1 
ATOM   7992 C CB  . GLN B 1 499 ? -5.020  26.143  -27.838 1.00 68.51  ? 499  GLN B CB  1 
ATOM   7993 C CG  . GLN B 1 499 ? -6.199  27.029  -28.257 1.00 83.84  ? 499  GLN B CG  1 
ATOM   7994 C CD  . GLN B 1 499 ? -6.476  27.015  -29.754 1.00 83.95  ? 499  GLN B CD  1 
ATOM   7995 O OE1 . GLN B 1 499 ? -5.658  27.477  -30.557 1.00 87.11  ? 499  GLN B OE1 1 
ATOM   7996 N NE2 . GLN B 1 499 ? -7.647  26.503  -30.135 1.00 82.30  ? 499  GLN B NE2 1 
ATOM   7997 N N   . TRP B 1 500 ? -3.408  23.415  -28.743 1.00 65.92  ? 500  TRP B N   1 
ATOM   7998 C CA  . TRP B 1 500 ? -2.175  22.656  -28.737 1.00 56.63  ? 500  TRP B CA  1 
ATOM   7999 C C   . TRP B 1 500 ? -0.992  23.615  -28.883 1.00 55.44  ? 500  TRP B C   1 
ATOM   8000 O O   . TRP B 1 500 ? -0.825  24.265  -29.917 1.00 53.65  ? 500  TRP B O   1 
ATOM   8001 C CB  . TRP B 1 500 ? -2.216  21.663  -29.899 1.00 50.18  ? 500  TRP B CB  1 
ATOM   8002 C CG  . TRP B 1 500 ? -1.050  20.744  -29.984 1.00 53.41  ? 500  TRP B CG  1 
ATOM   8003 C CD1 . TRP B 1 500 ? 0.155   20.882  -29.363 1.00 49.32  ? 500  TRP B CD1 1 
ATOM   8004 C CD2 . TRP B 1 500 ? -0.977  19.534  -30.745 1.00 51.06  ? 500  TRP B CD2 1 
ATOM   8005 N NE1 . TRP B 1 500 ? 0.974   19.831  -29.695 1.00 54.12  ? 500  TRP B NE1 1 
ATOM   8006 C CE2 . TRP B 1 500 ? 0.300   18.993  -30.546 1.00 49.42  ? 500  TRP B CE2 1 
ATOM   8007 C CE3 . TRP B 1 500 ? -1.871  18.861  -31.583 1.00 49.03  ? 500  TRP B CE3 1 
ATOM   8008 C CZ2 . TRP B 1 500 ? 0.706   17.808  -31.149 1.00 57.05  ? 500  TRP B CZ2 1 
ATOM   8009 C CZ3 . TRP B 1 500 ? -1.468  17.688  -32.180 1.00 45.91  ? 500  TRP B CZ3 1 
ATOM   8010 C CH2 . TRP B 1 500 ? -0.194  17.171  -31.958 1.00 55.73  ? 500  TRP B CH2 1 
ATOM   8011 N N   . PRO B 1 501 ? -0.170  23.716  -27.837 1.00 62.14  ? 501  PRO B N   1 
ATOM   8012 C CA  . PRO B 1 501 ? 0.921   24.679  -27.863 1.00 37.02  ? 501  PRO B CA  1 
ATOM   8013 C C   . PRO B 1 501 ? 2.162   24.078  -28.488 1.00 60.07  ? 501  PRO B C   1 
ATOM   8014 O O   . PRO B 1 501 ? 2.383   22.860  -28.438 1.00 46.40  ? 501  PRO B O   1 
ATOM   8015 C CB  . PRO B 1 501 ? 1.153   24.951  -26.383 1.00 38.71  ? 501  PRO B CB  1 
ATOM   8016 C CG  . PRO B 1 501 ? 0.813   23.670  -25.724 1.00 51.83  ? 501  PRO B CG  1 
ATOM   8017 C CD  . PRO B 1 501 ? -0.237  22.998  -26.552 1.00 60.63  ? 501  PRO B CD  1 
ATOM   8018 N N   . PRO B 1 502 ? 2.985   24.940  -29.088 1.00 59.04  ? 502  PRO B N   1 
ATOM   8019 C CA  . PRO B 1 502 ? 4.237   24.518  -29.713 1.00 55.86  ? 502  PRO B CA  1 
ATOM   8020 C C   . PRO B 1 502 ? 5.201   23.995  -28.669 1.00 50.80  ? 502  PRO B C   1 
ATOM   8021 O O   . PRO B 1 502 ? 5.297   24.545  -27.565 1.00 55.40  ? 502  PRO B O   1 
ATOM   8022 C CB  . PRO B 1 502 ? 4.786   25.816  -30.297 1.00 33.32  ? 502  PRO B CB  1 
ATOM   8023 C CG  . PRO B 1 502 ? 3.595   26.692  -30.462 1.00 48.28  ? 502  PRO B CG  1 
ATOM   8024 C CD  . PRO B 1 502 ? 2.712   26.366  -29.302 1.00 38.65  ? 502  PRO B CD  1 
ATOM   8025 N N   . TYR B 1 503 ? 5.920   22.940  -29.026 1.00 31.15  ? 503  TYR B N   1 
ATOM   8026 C CA  . TYR B 1 503 ? 7.023   22.478  -28.205 1.00 35.97  ? 503  TYR B CA  1 
ATOM   8027 C C   . TYR B 1 503 ? 8.180   23.482  -28.203 1.00 41.37  ? 503  TYR B C   1 
ATOM   8028 O O   . TYR B 1 503 ? 8.603   23.952  -29.259 1.00 40.95  ? 503  TYR B O   1 
ATOM   8029 C CB  . TYR B 1 503 ? 7.524   21.141  -28.726 1.00 38.42  ? 503  TYR B CB  1 
ATOM   8030 C CG  . TYR B 1 503 ? 8.593   20.540  -27.870 1.00 37.25  ? 503  TYR B CG  1 
ATOM   8031 C CD1 . TYR B 1 503 ? 9.929   20.851  -28.071 1.00 37.16  ? 503  TYR B CD1 1 
ATOM   8032 C CD2 . TYR B 1 503 ? 8.266   19.649  -26.856 1.00 42.41  ? 503  TYR B CD2 1 
ATOM   8033 C CE1 . TYR B 1 503 ? 10.912  20.281  -27.276 1.00 51.29  ? 503  TYR B CE1 1 
ATOM   8034 C CE2 . TYR B 1 503 ? 9.233   19.085  -26.056 1.00 43.21  ? 503  TYR B CE2 1 
ATOM   8035 C CZ  . TYR B 1 503 ? 10.552  19.399  -26.265 1.00 42.53  ? 503  TYR B CZ  1 
ATOM   8036 O OH  . TYR B 1 503 ? 11.509  18.830  -25.460 1.00 37.16  ? 503  TYR B OH  1 
ATOM   8037 N N   . THR B 1 504 ? 8.697   23.801  -27.018 1.00 43.65  ? 504  THR B N   1 
ATOM   8038 C CA  . THR B 1 504 ? 9.856   24.674  -26.914 1.00 46.12  ? 504  THR B CA  1 
ATOM   8039 C C   . THR B 1 504 ? 10.890  24.070  -25.997 1.00 53.15  ? 504  THR B C   1 
ATOM   8040 O O   . THR B 1 504 ? 10.672  23.002  -25.429 1.00 53.16  ? 504  THR B O   1 
ATOM   8041 C CB  . THR B 1 504 ? 9.507   26.086  -26.402 1.00 47.77  ? 504  THR B CB  1 
ATOM   8042 O OG1 . THR B 1 504 ? 9.027   26.010  -25.052 1.00 59.33  ? 504  THR B OG1 1 
ATOM   8043 C CG2 . THR B 1 504 ? 8.475   26.742  -27.301 1.00 36.27  ? 504  THR B CG2 1 
ATOM   8044 N N   . THR B 1 505 ? 12.027  24.743  -25.863 1.00 49.83  ? 505  THR B N   1 
ATOM   8045 C CA  . THR B 1 505 ? 13.085  24.207  -25.027 1.00 58.25  ? 505  THR B CA  1 
ATOM   8046 C C   . THR B 1 505 ? 12.867  24.664  -23.607 1.00 57.77  ? 505  THR B C   1 
ATOM   8047 O O   . THR B 1 505 ? 13.160  23.931  -22.668 1.00 62.00  ? 505  THR B O   1 
ATOM   8048 C CB  . THR B 1 505 ? 14.499  24.566  -25.533 1.00 56.39  ? 505  THR B CB  1 
ATOM   8049 O OG1 . THR B 1 505 ? 14.463  25.811  -26.245 1.00 65.95  ? 505  THR B OG1 1 
ATOM   8050 C CG2 . THR B 1 505 ? 14.978  23.490  -26.469 1.00 47.07  ? 505  THR B CG2 1 
ATOM   8051 N N   . ALA B 1 506 ? 12.322  25.865  -23.459 1.00 55.15  ? 506  ALA B N   1 
ATOM   8052 C CA  . ALA B 1 506 ? 11.984  26.376  -22.142 1.00 66.18  ? 506  ALA B CA  1 
ATOM   8053 C C   . ALA B 1 506 ? 10.871  25.543  -21.505 1.00 65.04  ? 506  ALA B C   1 
ATOM   8054 O O   . ALA B 1 506 ? 11.082  24.901  -20.465 1.00 63.53  ? 506  ALA B O   1 
ATOM   8055 C CB  . ALA B 1 506 ? 11.588  27.846  -22.214 1.00 46.27  ? 506  ALA B CB  1 
ATOM   8056 N N   . ALA B 1 507 ? 9.689   25.543  -22.120 1.00 46.68  ? 507  ALA B N   1 
ATOM   8057 C CA  . ALA B 1 507 ? 8.550   24.899  -21.469 1.00 59.46  ? 507  ALA B CA  1 
ATOM   8058 C C   . ALA B 1 507 ? 8.342   23.409  -21.833 1.00 55.11  ? 507  ALA B C   1 
ATOM   8059 O O   . ALA B 1 507 ? 7.889   22.620  -21.011 1.00 57.91  ? 507  ALA B O   1 
ATOM   8060 C CB  . ALA B 1 507 ? 7.282   25.723  -21.650 1.00 41.61  ? 507  ALA B CB  1 
ATOM   8061 N N   . GLN B 1 508 ? 8.689   23.023  -23.049 1.00 48.43  ? 508  GLN B N   1 
ATOM   8062 C CA  . GLN B 1 508 ? 8.674   21.612  -23.409 1.00 56.50  ? 508  GLN B CA  1 
ATOM   8063 C C   . GLN B 1 508 ? 7.290   21.002  -23.326 1.00 58.56  ? 508  GLN B C   1 
ATOM   8064 O O   . GLN B 1 508 ? 7.117   19.890  -22.828 1.00 61.02  ? 508  GLN B O   1 
ATOM   8065 C CB  . GLN B 1 508 ? 9.622   20.843  -22.511 1.00 50.45  ? 508  GLN B CB  1 
ATOM   8066 C CG  . GLN B 1 508 ? 10.978  21.459  -22.478 1.00 50.90  ? 508  GLN B CG  1 
ATOM   8067 C CD  . GLN B 1 508 ? 11.941  20.688  -21.625 1.00 53.33  ? 508  GLN B CD  1 
ATOM   8068 O OE1 . GLN B 1 508 ? 11.975  19.455  -21.657 1.00 53.73  ? 508  GLN B OE1 1 
ATOM   8069 N NE2 . GLN B 1 508 ? 12.740  21.409  -20.846 1.00 54.29  ? 508  GLN B NE2 1 
ATOM   8070 N N   . GLN B 1 509 ? 6.321   21.742  -23.848 1.00 49.32  ? 509  GLN B N   1 
ATOM   8071 C CA  . GLN B 1 509 ? 4.929   21.338  -23.849 1.00 45.81  ? 509  GLN B CA  1 
ATOM   8072 C C   . GLN B 1 509 ? 4.602   20.414  -25.005 1.00 44.65  ? 509  GLN B C   1 
ATOM   8073 O O   . GLN B 1 509 ? 4.928   20.692  -26.160 1.00 42.92  ? 509  GLN B O   1 
ATOM   8074 C CB  . GLN B 1 509 ? 4.020   22.574  -23.913 1.00 43.01  ? 509  GLN B CB  1 
ATOM   8075 C CG  . GLN B 1 509 ? 4.503   23.716  -23.046 1.00 44.95  ? 509  GLN B CG  1 
ATOM   8076 C CD  . GLN B 1 509 ? 3.438   24.746  -22.795 1.00 54.68  ? 509  GLN B CD  1 
ATOM   8077 O OE1 . GLN B 1 509 ? 2.552   24.532  -21.976 1.00 66.14  ? 509  GLN B OE1 1 
ATOM   8078 N NE2 . GLN B 1 509 ? 3.523   25.881  -23.483 1.00 55.30  ? 509  GLN B NE2 1 
ATOM   8079 N N   . TYR B 1 510 ? 3.947   19.311  -24.677 1.00 45.71  ? 510  TYR B N   1 
ATOM   8080 C CA  . TYR B 1 510 ? 3.352   18.434  -25.671 1.00 44.57  ? 510  TYR B CA  1 
ATOM   8081 C C   . TYR B 1 510 ? 1.929   18.111  -25.184 1.00 41.47  ? 510  TYR B C   1 
ATOM   8082 O O   . TYR B 1 510 ? 1.544   18.516  -24.088 1.00 56.20  ? 510  TYR B O   1 
ATOM   8083 C CB  . TYR B 1 510 ? 4.204   17.170  -25.833 1.00 39.64  ? 510  TYR B CB  1 
ATOM   8084 C CG  . TYR B 1 510 ? 4.292   16.376  -24.564 1.00 38.44  ? 510  TYR B CG  1 
ATOM   8085 C CD1 . TYR B 1 510 ? 5.131   16.776  -23.533 1.00 39.56  ? 510  TYR B CD1 1 
ATOM   8086 C CD2 . TYR B 1 510 ? 3.511   15.244  -24.376 1.00 38.97  ? 510  TYR B CD2 1 
ATOM   8087 C CE1 . TYR B 1 510 ? 5.201   16.060  -22.347 1.00 42.21  ? 510  TYR B CE1 1 
ATOM   8088 C CE2 . TYR B 1 510 ? 3.580   14.519  -23.194 1.00 44.85  ? 510  TYR B CE2 1 
ATOM   8089 C CZ  . TYR B 1 510 ? 4.424   14.937  -22.183 1.00 42.41  ? 510  TYR B CZ  1 
ATOM   8090 O OH  . TYR B 1 510 ? 4.496   14.219  -21.012 1.00 45.53  ? 510  TYR B OH  1 
ATOM   8091 N N   . VAL B 1 511 ? 1.135   17.417  -25.992 1.00 38.29  ? 511  VAL B N   1 
ATOM   8092 C CA  . VAL B 1 511 ? -0.222  17.062  -25.585 1.00 40.18  ? 511  VAL B CA  1 
ATOM   8093 C C   . VAL B 1 511 ? -0.463  15.553  -25.649 1.00 49.53  ? 511  VAL B C   1 
ATOM   8094 O O   . VAL B 1 511 ? 0.169   14.848  -26.437 1.00 47.86  ? 511  VAL B O   1 
ATOM   8095 C CB  . VAL B 1 511 ? -1.254  17.752  -26.476 1.00 42.24  ? 511  VAL B CB  1 
ATOM   8096 C CG1 . VAL B 1 511 ? -0.978  19.240  -26.537 1.00 44.71  ? 511  VAL B CG1 1 
ATOM   8097 C CG2 . VAL B 1 511 ? -1.221  17.154  -27.869 1.00 49.25  ? 511  VAL B CG2 1 
ATOM   8098 N N   . SER B 1 512 ? -1.381  15.057  -24.825 1.00 52.33  ? 512  SER B N   1 
ATOM   8099 C CA  . SER B 1 512 ? -1.778  13.654  -24.899 1.00 50.57  ? 512  SER B CA  1 
ATOM   8100 C C   . SER B 1 512 ? -2.943  13.495  -25.858 1.00 61.57  ? 512  SER B C   1 
ATOM   8101 O O   . SER B 1 512 ? -3.911  14.257  -25.809 1.00 74.15  ? 512  SER B O   1 
ATOM   8102 C CB  . SER B 1 512 ? -2.167  13.129  -23.525 1.00 52.82  ? 512  SER B CB  1 
ATOM   8103 O OG  . SER B 1 512 ? -3.096  13.995  -22.904 1.00 72.21  ? 512  SER B OG  1 
ATOM   8104 N N   . LEU B 1 513 ? -2.839  12.518  -26.751 1.00 52.66  ? 513  LEU B N   1 
ATOM   8105 C CA  . LEU B 1 513 ? -3.924  12.231  -27.668 1.00 46.16  ? 513  LEU B CA  1 
ATOM   8106 C C   . LEU B 1 513 ? -4.681  11.013  -27.166 1.00 57.27  ? 513  LEU B C   1 
ATOM   8107 O O   . LEU B 1 513 ? -4.202  9.886   -27.250 1.00 66.49  ? 513  LEU B O   1 
ATOM   8108 C CB  . LEU B 1 513 ? -3.387  11.979  -29.064 1.00 46.48  ? 513  LEU B CB  1 
ATOM   8109 C CG  . LEU B 1 513 ? -2.644  13.143  -29.702 1.00 42.45  ? 513  LEU B CG  1 
ATOM   8110 C CD1 . LEU B 1 513 ? -2.232  12.791  -31.123 1.00 38.57  ? 513  LEU B CD1 1 
ATOM   8111 C CD2 . LEU B 1 513 ? -3.506  14.384  -29.684 1.00 47.25  ? 513  LEU B CD2 1 
ATOM   8112 N N   . ASN B 1 514 ? -5.855  11.251  -26.610 1.00 51.70  ? 514  ASN B N   1 
ATOM   8113 C CA  . ASN B 1 514 ? -6.645  10.181  -26.041 1.00 53.33  ? 514  ASN B CA  1 
ATOM   8114 C C   . ASN B 1 514 ? -8.084  10.575  -26.234 1.00 60.92  ? 514  ASN B C   1 
ATOM   8115 O O   . ASN B 1 514 ? -8.364  11.523  -26.971 1.00 58.58  ? 514  ASN B O   1 
ATOM   8116 C CB  . ASN B 1 514 ? -6.312  9.963   -24.560 1.00 42.07  ? 514  ASN B CB  1 
ATOM   8117 C CG  . ASN B 1 514 ? -6.536  11.201  -23.722 1.00 59.06  ? 514  ASN B CG  1 
ATOM   8118 O OD1 . ASN B 1 514 ? -7.546  11.875  -23.863 1.00 78.83  ? 514  ASN B OD1 1 
ATOM   8119 N ND2 . ASN B 1 514 ? -5.593  11.506  -22.842 1.00 43.87  ? 514  ASN B ND2 1 
ATOM   8120 N N   . LEU B 1 515 ? -8.997  9.864   -25.582 1.00 64.83  ? 515  LEU B N   1 
ATOM   8121 C CA  . LEU B 1 515 ? -10.410 10.134  -25.789 1.00 60.30  ? 515  LEU B CA  1 
ATOM   8122 C C   . LEU B 1 515 ? -10.845 11.457  -25.167 1.00 65.95  ? 515  LEU B C   1 
ATOM   8123 O O   . LEU B 1 515 ? -11.687 12.155  -25.723 1.00 71.58  ? 515  LEU B O   1 
ATOM   8124 C CB  . LEU B 1 515 ? -11.259 8.974   -25.290 1.00 58.49  ? 515  LEU B CB  1 
ATOM   8125 C CG  . LEU B 1 515 ? -11.103 7.735   -26.172 1.00 60.31  ? 515  LEU B CG  1 
ATOM   8126 C CD1 . LEU B 1 515 ? -12.138 6.689   -25.824 1.00 53.72  ? 515  LEU B CD1 1 
ATOM   8127 C CD2 . LEU B 1 515 ? -11.210 8.109   -27.636 1.00 56.18  ? 515  LEU B CD2 1 
ATOM   8128 N N   . LYS B 1 516 ? -10.258 11.806  -24.025 1.00 57.12  ? 516  LYS B N   1 
ATOM   8129 C CA  . LYS B 1 516 ? -10.536 13.089  -23.392 1.00 55.86  ? 516  LYS B CA  1 
ATOM   8130 C C   . LYS B 1 516 ? -9.955  14.198  -24.260 1.00 65.17  ? 516  LYS B C   1 
ATOM   8131 O O   . LYS B 1 516 ? -9.027  13.959  -25.023 1.00 76.18  ? 516  LYS B O   1 
ATOM   8132 C CB  . LYS B 1 516 ? -9.933  13.120  -21.986 1.00 51.54  ? 516  LYS B CB  1 
ATOM   8133 C CG  . LYS B 1 516 ? -10.244 11.861  -21.161 1.00 64.62  ? 516  LYS B CG  1 
ATOM   8134 C CD  . LYS B 1 516 ? -9.525  11.832  -19.808 1.00 81.50  ? 516  LYS B CD  1 
ATOM   8135 C CE  . LYS B 1 516 ? -8.006  11.656  -19.975 1.00 92.11  ? 516  LYS B CE  1 
ATOM   8136 N NZ  . LYS B 1 516 ? -7.233  11.570  -18.685 1.00 85.79  ? 516  LYS B NZ  1 
ATOM   8137 N N   . PRO B 1 517 ? -10.513 15.414  -24.171 1.00 73.50  ? 517  PRO B N   1 
ATOM   8138 C CA  . PRO B 1 517 ? -9.947  16.531  -24.933 1.00 67.50  ? 517  PRO B CA  1 
ATOM   8139 C C   . PRO B 1 517 ? -8.486  16.758  -24.559 1.00 60.78  ? 517  PRO B C   1 
ATOM   8140 O O   . PRO B 1 517 ? -8.049  16.286  -23.517 1.00 53.53  ? 517  PRO B O   1 
ATOM   8141 C CB  . PRO B 1 517 ? -10.801 17.727  -24.492 1.00 67.15  ? 517  PRO B CB  1 
ATOM   8142 C CG  . PRO B 1 517 ? -11.447 17.309  -23.233 1.00 54.52  ? 517  PRO B CG  1 
ATOM   8143 C CD  . PRO B 1 517 ? -11.659 15.835  -23.354 1.00 65.35  ? 517  PRO B CD  1 
ATOM   8144 N N   . LEU B 1 518 ? -7.751  17.466  -25.409 1.00 64.59  ? 518  LEU B N   1 
ATOM   8145 C CA  . LEU B 1 518 ? -6.323  17.704  -25.218 1.00 55.28  ? 518  LEU B CA  1 
ATOM   8146 C C   . LEU B 1 518 ? -5.948  18.144  -23.830 1.00 53.36  ? 518  LEU B C   1 
ATOM   8147 O O   . LEU B 1 518 ? -6.508  19.105  -23.310 1.00 65.48  ? 518  LEU B O   1 
ATOM   8148 C CB  . LEU B 1 518 ? -5.850  18.823  -26.134 1.00 57.03  ? 518  LEU B CB  1 
ATOM   8149 C CG  . LEU B 1 518 ? -5.699  18.571  -27.618 1.00 54.52  ? 518  LEU B CG  1 
ATOM   8150 C CD1 . LEU B 1 518 ? -5.045  19.799  -28.211 1.00 65.82  ? 518  LEU B CD1 1 
ATOM   8151 C CD2 . LEU B 1 518 ? -4.861  17.344  -27.849 1.00 49.97  ? 518  LEU B CD2 1 
ATOM   8152 N N   . GLU B 1 519 ? -4.952  17.479  -23.259 1.00 51.23  ? 519  GLU B N   1 
ATOM   8153 C CA  . GLU B 1 519 ? -4.316  17.948  -22.035 1.00 54.28  ? 519  GLU B CA  1 
ATOM   8154 C C   . GLU B 1 519 ? -2.841  18.247  -22.330 1.00 56.49  ? 519  GLU B C   1 
ATOM   8155 O O   . GLU B 1 519 ? -2.178  17.482  -23.018 1.00 61.11  ? 519  GLU B O   1 
ATOM   8156 C CB  . GLU B 1 519 ? -4.480  16.916  -20.913 1.00 48.48  ? 519  GLU B CB  1 
ATOM   8157 C CG  . GLU B 1 519 ? -3.328  16.847  -19.938 1.00 63.11  ? 519  GLU B CG  1 
ATOM   8158 C CD  . GLU B 1 519 ? -3.542  15.797  -18.865 1.00 82.37  ? 519  GLU B CD  1 
ATOM   8159 O OE1 . GLU B 1 519 ? -4.709  15.596  -18.460 1.00 93.81  ? 519  GLU B OE1 1 
ATOM   8160 O OE2 . GLU B 1 519 ? -2.549  15.172  -18.429 1.00 81.84  ? 519  GLU B OE2 1 
ATOM   8161 N N   . VAL B 1 520 ? -2.347  19.374  -21.826 1.00 59.56  ? 520  VAL B N   1 
ATOM   8162 C CA  . VAL B 1 520 ? -0.964  19.795  -22.038 1.00 51.07  ? 520  VAL B CA  1 
ATOM   8163 C C   . VAL B 1 520 ? -0.042  19.300  -20.917 1.00 50.69  ? 520  VAL B C   1 
ATOM   8164 O O   . VAL B 1 520 ? -0.303  19.537  -19.736 1.00 50.51  ? 520  VAL B O   1 
ATOM   8165 C CB  . VAL B 1 520 ? -0.870  21.335  -22.108 1.00 48.20  ? 520  VAL B CB  1 
ATOM   8166 C CG1 . VAL B 1 520 ? 0.567   21.774  -22.256 1.00 64.20  ? 520  VAL B CG1 1 
ATOM   8167 C CG2 . VAL B 1 520 ? -1.703  21.866  -23.248 1.00 52.66  ? 520  VAL B CG2 1 
ATOM   8168 N N   . ARG B 1 521 ? 1.032   18.608  -21.285 1.00 45.96  ? 521  ARG B N   1 
ATOM   8169 C CA  . ARG B 1 521 ? 2.031   18.170  -20.318 1.00 44.84  ? 521  ARG B CA  1 
ATOM   8170 C C   . ARG B 1 521 ? 3.376   18.816  -20.610 1.00 44.66  ? 521  ARG B C   1 
ATOM   8171 O O   . ARG B 1 521 ? 3.636   19.251  -21.719 1.00 55.98  ? 521  ARG B O   1 
ATOM   8172 C CB  . ARG B 1 521 ? 2.162   16.654  -20.358 1.00 71.36  ? 521  ARG B CB  1 
ATOM   8173 C CG  . ARG B 1 521 ? 0.841   15.944  -20.541 1.00 59.90  ? 521  ARG B CG  1 
ATOM   8174 C CD  . ARG B 1 521 ? 0.851   14.588  -19.872 1.00 57.79  ? 521  ARG B CD  1 
ATOM   8175 N NE  . ARG B 1 521 ? -0.459  13.947  -19.931 1.00 57.00  ? 521  ARG B NE  1 
ATOM   8176 C CZ  . ARG B 1 521 ? -0.667  12.736  -20.435 1.00 61.35  ? 521  ARG B CZ  1 
ATOM   8177 N NH1 . ARG B 1 521 ? 0.357   12.041  -20.908 1.00 56.19  ? 521  ARG B NH1 1 
ATOM   8178 N NH2 . ARG B 1 521 ? -1.888  12.215  -20.459 1.00 68.76  ? 521  ARG B NH2 1 
ATOM   8179 N N   . ARG B 1 522 ? 4.235   18.907  -19.610 1.00 57.48  ? 522  ARG B N   1 
ATOM   8180 C CA  . ARG B 1 522 ? 5.544   19.511  -19.831 1.00 52.47  ? 522  ARG B CA  1 
ATOM   8181 C C   . ARG B 1 522 ? 6.615   18.476  -19.591 1.00 54.56  ? 522  ARG B C   1 
ATOM   8182 O O   . ARG B 1 522 ? 6.565   17.757  -18.603 1.00 71.27  ? 522  ARG B O   1 
ATOM   8183 C CB  . ARG B 1 522 ? 5.740   20.736  -18.948 1.00 48.02  ? 522  ARG B CB  1 
ATOM   8184 C CG  . ARG B 1 522 ? 4.864   21.887  -19.387 1.00 67.23  ? 522  ARG B CG  1 
ATOM   8185 C CD  . ARG B 1 522 ? 4.939   23.093  -18.472 1.00 52.55  ? 522  ARG B CD  1 
ATOM   8186 N NE  . ARG B 1 522 ? 6.306   23.557  -18.279 1.00 72.83  ? 522  ARG B NE  1 
ATOM   8187 C CZ  . ARG B 1 522 ? 6.632   24.777  -17.864 1.00 71.05  ? 522  ARG B CZ  1 
ATOM   8188 N NH1 . ARG B 1 522 ? 5.681   25.671  -17.612 1.00 60.91  ? 522  ARG B NH1 1 
ATOM   8189 N NH2 . ARG B 1 522 ? 7.913   25.102  -17.717 1.00 76.43  ? 522  ARG B NH2 1 
ATOM   8190 N N   . GLY B 1 523 ? 7.558   18.374  -20.520 1.00 57.50  ? 523  GLY B N   1 
ATOM   8191 C CA  . GLY B 1 523 ? 8.678   17.467  -20.356 1.00 55.97  ? 523  GLY B CA  1 
ATOM   8192 C C   . GLY B 1 523 ? 8.408   16.072  -20.854 1.00 49.77  ? 523  GLY B C   1 
ATOM   8193 O O   . GLY B 1 523 ? 7.582   15.346  -20.319 1.00 68.78  ? 523  GLY B O   1 
ATOM   8194 N N   . LEU B 1 524 ? 9.129   15.702  -21.896 1.00 53.73  ? 524  LEU B N   1 
ATOM   8195 C CA  . LEU B 1 524 ? 8.951   14.420  -22.562 1.00 57.02  ? 524  LEU B CA  1 
ATOM   8196 C C   . LEU B 1 524 ? 9.950   13.419  -21.998 1.00 58.03  ? 524  LEU B C   1 
ATOM   8197 O O   . LEU B 1 524 ? 11.055  13.277  -22.526 1.00 60.08  ? 524  LEU B O   1 
ATOM   8198 C CB  . LEU B 1 524 ? 9.219   14.618  -24.053 1.00 56.93  ? 524  LEU B CB  1 
ATOM   8199 C CG  . LEU B 1 524 ? 8.495   13.806  -25.121 1.00 63.71  ? 524  LEU B CG  1 
ATOM   8200 C CD1 . LEU B 1 524 ? 7.112   13.363  -24.661 1.00 70.44  ? 524  LEU B CD1 1 
ATOM   8201 C CD2 . LEU B 1 524 ? 8.386   14.667  -26.365 1.00 63.66  ? 524  LEU B CD2 1 
ATOM   8202 N N   . ARG B 1 525 ? 9.567   12.730  -20.927 1.00 50.48  ? 525  ARG B N   1 
ATOM   8203 C CA  . ARG B 1 525 ? 10.522  11.926  -20.165 1.00 49.04  ? 525  ARG B CA  1 
ATOM   8204 C C   . ARG B 1 525 ? 11.855  12.660  -19.926 1.00 52.32  ? 525  ARG B C   1 
ATOM   8205 O O   . ARG B 1 525 ? 12.947  12.105  -20.115 1.00 48.52  ? 525  ARG B O   1 
ATOM   8206 C CB  . ARG B 1 525 ? 10.749  10.575  -20.838 1.00 44.10  ? 525  ARG B CB  1 
ATOM   8207 C CG  . ARG B 1 525 ? 9.650   9.619   -20.577 1.00 51.07  ? 525  ARG B CG  1 
ATOM   8208 C CD  . ARG B 1 525 ? 10.054  8.219   -20.976 1.00 72.90  ? 525  ARG B CD  1 
ATOM   8209 N NE  . ARG B 1 525 ? 8.914   7.512   -21.550 1.00 70.51  ? 525  ARG B NE  1 
ATOM   8210 C CZ  . ARG B 1 525 ? 8.092   6.743   -20.854 1.00 79.15  ? 525  ARG B CZ  1 
ATOM   8211 N NH1 . ARG B 1 525 ? 8.294   6.553   -19.554 1.00 87.36  ? 525  ARG B NH1 1 
ATOM   8212 N NH2 . ARG B 1 525 ? 7.076   6.155   -21.465 1.00 90.14  ? 525  ARG B NH2 1 
ATOM   8213 N N   . ALA B 1 526 ? 11.743  13.908  -19.488 1.00 53.89  ? 526  ALA B N   1 
ATOM   8214 C CA  . ALA B 1 526 ? 12.885  14.797  -19.347 1.00 43.15  ? 526  ALA B CA  1 
ATOM   8215 C C   . ALA B 1 526 ? 14.036  14.164  -18.584 1.00 51.15  ? 526  ALA B C   1 
ATOM   8216 O O   . ALA B 1 526 ? 15.161  14.144  -19.085 1.00 67.50  ? 526  ALA B O   1 
ATOM   8217 C CB  . ALA B 1 526 ? 12.462  16.078  -18.702 1.00 45.56  ? 526  ALA B CB  1 
ATOM   8218 N N   . GLN B 1 527 ? 13.755  13.637  -17.392 1.00 56.19  ? 527  GLN B N   1 
ATOM   8219 C CA  . GLN B 1 527 ? 14.785  13.020  -16.542 1.00 56.80  ? 527  GLN B CA  1 
ATOM   8220 C C   . GLN B 1 527 ? 15.365  11.757  -17.157 1.00 50.23  ? 527  GLN B C   1 
ATOM   8221 O O   . GLN B 1 527 ? 16.574  11.565  -17.161 1.00 58.74  ? 527  GLN B O   1 
ATOM   8222 C CB  . GLN B 1 527 ? 14.246  12.663  -15.148 1.00 51.25  ? 527  GLN B CB  1 
ATOM   8223 C CG  . GLN B 1 527 ? 13.799  13.830  -14.297 1.00 52.81  ? 527  GLN B CG  1 
ATOM   8224 C CD  . GLN B 1 527 ? 14.831  14.915  -14.222 1.00 58.97  ? 527  GLN B CD  1 
ATOM   8225 O OE1 . GLN B 1 527 ? 14.629  15.999  -14.768 1.00 66.21  ? 527  GLN B OE1 1 
ATOM   8226 N NE2 . GLN B 1 527 ? 15.948  14.641  -13.532 1.00 54.08  ? 527  GLN B NE2 1 
ATOM   8227 N N   . THR B 1 528 ? 14.503  10.883  -17.659 1.00 42.71  ? 528  THR B N   1 
ATOM   8228 C CA  . THR B 1 528 ? 14.981  9.624   -18.209 1.00 46.04  ? 528  THR B CA  1 
ATOM   8229 C C   . THR B 1 528 ? 15.705  9.835   -19.532 1.00 51.73  ? 528  THR B C   1 
ATOM   8230 O O   . THR B 1 528 ? 16.678  9.142   -19.839 1.00 67.94  ? 528  THR B O   1 
ATOM   8231 C CB  . THR B 1 528 ? 13.852  8.581   -18.336 1.00 58.49  ? 528  THR B CB  1 
ATOM   8232 O OG1 . THR B 1 528 ? 13.570  8.031   -17.039 1.00 63.42  ? 528  THR B OG1 1 
ATOM   8233 C CG2 . THR B 1 528 ? 14.255  7.451   -19.292 1.00 52.75  ? 528  THR B CG2 1 
ATOM   8234 N N   . CYS B 1 529 ? 15.260  10.809  -20.310 1.00 44.04  ? 529  CYS B N   1 
ATOM   8235 C CA  . CYS B 1 529 ? 15.923  11.065  -21.583 1.00 43.79  ? 529  CYS B CA  1 
ATOM   8236 C C   . CYS B 1 529 ? 17.221  11.841  -21.414 1.00 41.33  ? 529  CYS B C   1 
ATOM   8237 O O   . CYS B 1 529 ? 18.139  11.687  -22.208 1.00 47.58  ? 529  CYS B O   1 
ATOM   8238 C CB  . CYS B 1 529 ? 14.967  11.723  -22.579 1.00 45.85  ? 529  CYS B CB  1 
ATOM   8239 S SG  . CYS B 1 529 ? 13.821  10.511  -23.237 1.00 60.96  ? 529  CYS B SG  1 
ATOM   8240 N N   . ALA B 1 530 ? 17.303  12.664  -20.377 1.00 42.27  ? 530  ALA B N   1 
ATOM   8241 C CA  . ALA B 1 530 ? 18.596  13.222  -19.967 1.00 57.16  ? 530  ALA B CA  1 
ATOM   8242 C C   . ALA B 1 530 ? 19.654  12.125  -19.817 1.00 59.44  ? 530  ALA B C   1 
ATOM   8243 O O   . ALA B 1 530 ? 20.792  12.279  -20.271 1.00 57.31  ? 530  ALA B O   1 
ATOM   8244 C CB  . ALA B 1 530 ? 18.462  13.990  -18.656 1.00 52.81  ? 530  ALA B CB  1 
ATOM   8245 N N   . PHE B 1 531 ? 19.268  11.030  -19.160 1.00 45.17  ? 531  PHE B N   1 
ATOM   8246 C CA  . PHE B 1 531 ? 20.137  9.873   -18.978 1.00 47.64  ? 531  PHE B CA  1 
ATOM   8247 C C   . PHE B 1 531 ? 20.571  9.236   -20.308 1.00 53.42  ? 531  PHE B C   1 
ATOM   8248 O O   . PHE B 1 531 ? 21.739  8.880   -20.483 1.00 56.08  ? 531  PHE B O   1 
ATOM   8249 C CB  . PHE B 1 531 ? 19.457  8.832   -18.078 1.00 44.96  ? 531  PHE B CB  1 
ATOM   8250 C CG  . PHE B 1 531 ? 20.124  7.474   -18.090 1.00 51.38  ? 531  PHE B CG  1 
ATOM   8251 C CD1 . PHE B 1 531 ? 21.339  7.270   -17.453 1.00 59.57  ? 531  PHE B CD1 1 
ATOM   8252 C CD2 . PHE B 1 531 ? 19.527  6.398   -18.730 1.00 54.98  ? 531  PHE B CD2 1 
ATOM   8253 C CE1 . PHE B 1 531 ? 21.949  6.018   -17.459 1.00 57.09  ? 531  PHE B CE1 1 
ATOM   8254 C CE2 . PHE B 1 531 ? 20.132  5.144   -18.742 1.00 52.47  ? 531  PHE B CE2 1 
ATOM   8255 C CZ  . PHE B 1 531 ? 21.341  4.957   -18.104 1.00 57.65  ? 531  PHE B CZ  1 
ATOM   8256 N N   . TRP B 1 532 ? 19.634  9.095   -21.239 1.00 46.08  ? 532  TRP B N   1 
ATOM   8257 C CA  . TRP B 1 532 ? 19.949  8.524   -22.550 1.00 49.56  ? 532  TRP B CA  1 
ATOM   8258 C C   . TRP B 1 532 ? 20.660  9.502   -23.442 1.00 51.21  ? 532  TRP B C   1 
ATOM   8259 O O   . TRP B 1 532 ? 21.609  9.143   -24.121 1.00 60.54  ? 532  TRP B O   1 
ATOM   8260 C CB  . TRP B 1 532 ? 18.688  8.085   -23.273 1.00 55.19  ? 532  TRP B CB  1 
ATOM   8261 C CG  . TRP B 1 532 ? 18.103  6.854   -22.741 1.00 42.96  ? 532  TRP B CG  1 
ATOM   8262 C CD1 . TRP B 1 532 ? 17.012  6.756   -21.960 1.00 43.63  ? 532  TRP B CD1 1 
ATOM   8263 C CD2 . TRP B 1 532 ? 18.583  5.527   -22.938 1.00 55.97  ? 532  TRP B CD2 1 
ATOM   8264 N NE1 . TRP B 1 532 ? 16.758  5.446   -21.660 1.00 49.44  ? 532  TRP B NE1 1 
ATOM   8265 C CE2 . TRP B 1 532 ? 17.710  4.667   -22.251 1.00 53.15  ? 532  TRP B CE2 1 
ATOM   8266 C CE3 . TRP B 1 532 ? 19.661  4.978   -23.640 1.00 52.10  ? 532  TRP B CE3 1 
ATOM   8267 C CZ2 . TRP B 1 532 ? 17.874  3.287   -22.240 1.00 45.38  ? 532  TRP B CZ2 1 
ATOM   8268 C CZ3 . TRP B 1 532 ? 19.825  3.598   -23.629 1.00 53.44  ? 532  TRP B CZ3 1 
ATOM   8269 C CH2 . TRP B 1 532 ? 18.937  2.772   -22.931 1.00 58.24  ? 532  TRP B CH2 1 
ATOM   8270 N N   . ASN B 1 533 ? 20.190  10.740  -23.448 1.00 56.96  ? 533  ASN B N   1 
ATOM   8271 C CA  . ASN B 1 533 ? 20.695  11.729  -24.389 1.00 61.02  ? 533  ASN B CA  1 
ATOM   8272 C C   . ASN B 1 533 ? 21.916  12.472  -23.902 1.00 62.55  ? 533  ASN B C   1 
ATOM   8273 O O   . ASN B 1 533 ? 22.650  13.048  -24.705 1.00 59.24  ? 533  ASN B O   1 
ATOM   8274 C CB  . ASN B 1 533 ? 19.616  12.752  -24.729 1.00 67.12  ? 533  ASN B CB  1 
ATOM   8275 C CG  . ASN B 1 533 ? 18.434  12.134  -25.412 1.00 59.32  ? 533  ASN B CG  1 
ATOM   8276 O OD1 . ASN B 1 533 ? 18.565  11.097  -26.055 1.00 50.55  ? 533  ASN B OD1 1 
ATOM   8277 N ND2 . ASN B 1 533 ? 17.266  12.763  -25.277 1.00 50.02  ? 533  ASN B ND2 1 
ATOM   8278 N N   . ARG B 1 534 ? 22.128  12.480  -22.591 1.00 57.86  ? 534  ARG B N   1 
ATOM   8279 C CA  . ARG B 1 534 ? 23.225  13.261  -22.034 1.00 59.04  ? 534  ARG B CA  1 
ATOM   8280 C C   . ARG B 1 534 ? 24.295  12.446  -21.323 1.00 58.52  ? 534  ARG B C   1 
ATOM   8281 O O   . ARG B 1 534 ? 25.472  12.740  -21.460 1.00 53.34  ? 534  ARG B O   1 
ATOM   8282 C CB  . ARG B 1 534 ? 22.699  14.338  -21.086 1.00 63.33  ? 534  ARG B CB  1 
ATOM   8283 C CG  . ARG B 1 534 ? 21.915  15.419  -21.776 1.00 61.92  ? 534  ARG B CG  1 
ATOM   8284 C CD  . ARG B 1 534 ? 21.407  16.443  -20.796 1.00 61.68  ? 534  ARG B CD  1 
ATOM   8285 N NE  . ARG B 1 534 ? 20.343  17.239  -21.394 1.00 75.18  ? 534  ARG B NE  1 
ATOM   8286 C CZ  . ARG B 1 534 ? 20.494  18.480  -21.846 1.00 68.90  ? 534  ARG B CZ  1 
ATOM   8287 N NH1 . ARG B 1 534 ? 21.679  19.088  -21.760 1.00 51.26  ? 534  ARG B NH1 1 
ATOM   8288 N NH2 . ARG B 1 534 ? 19.451  19.112  -22.372 1.00 55.95  ? 534  ARG B NH2 1 
ATOM   8289 N N   . PHE B 1 535 ? 23.899  11.446  -20.544 1.00 55.70  ? 535  PHE B N   1 
ATOM   8290 C CA  . PHE B 1 535 ? 24.888  10.742  -19.748 1.00 53.49  ? 535  PHE B CA  1 
ATOM   8291 C C   . PHE B 1 535 ? 25.497  9.506   -20.405 1.00 64.72  ? 535  PHE B C   1 
ATOM   8292 O O   . PHE B 1 535 ? 26.723  9.388   -20.490 1.00 68.18  ? 535  PHE B O   1 
ATOM   8293 C CB  . PHE B 1 535 ? 24.370  10.380  -18.364 1.00 53.61  ? 535  PHE B CB  1 
ATOM   8294 C CG  . PHE B 1 535 ? 25.366  9.613   -17.570 1.00 58.59  ? 535  PHE B CG  1 
ATOM   8295 C CD1 . PHE B 1 535 ? 26.501  10.235  -17.095 1.00 48.04  ? 535  PHE B CD1 1 
ATOM   8296 C CD2 . PHE B 1 535 ? 25.207  8.259   -17.359 1.00 59.30  ? 535  PHE B CD2 1 
ATOM   8297 C CE1 . PHE B 1 535 ? 27.435  9.529   -16.402 1.00 49.41  ? 535  PHE B CE1 1 
ATOM   8298 C CE2 . PHE B 1 535 ? 26.143  7.554   -16.662 1.00 53.76  ? 535  PHE B CE2 1 
ATOM   8299 C CZ  . PHE B 1 535 ? 27.254  8.186   -16.184 1.00 49.85  ? 535  PHE B CZ  1 
ATOM   8300 N N   . LEU B 1 536 ? 24.655  8.581   -20.851 1.00 58.76  ? 536  LEU B N   1 
ATOM   8301 C CA  . LEU B 1 536 ? 25.148  7.351   -21.476 1.00 57.72  ? 536  LEU B CA  1 
ATOM   8302 C C   . LEU B 1 536 ? 26.262  7.539   -22.505 1.00 65.38  ? 536  LEU B C   1 
ATOM   8303 O O   . LEU B 1 536 ? 27.186  6.723   -22.568 1.00 79.61  ? 536  LEU B O   1 
ATOM   8304 C CB  . LEU B 1 536 ? 24.006  6.568   -22.104 1.00 58.47  ? 536  LEU B CB  1 
ATOM   8305 C CG  . LEU B 1 536 ? 23.363  5.602   -21.122 1.00 73.91  ? 536  LEU B CG  1 
ATOM   8306 C CD1 . LEU B 1 536 ? 22.379  4.739   -21.861 1.00 74.20  ? 536  LEU B CD1 1 
ATOM   8307 C CD2 . LEU B 1 536 ? 24.431  4.759   -20.421 1.00 78.36  ? 536  LEU B CD2 1 
ATOM   8308 N N   . PRO B 1 537 ? 26.171  8.598   -23.331 1.00 62.82  ? 537  PRO B N   1 
ATOM   8309 C CA  . PRO B 1 537 ? 27.208  8.828   -24.349 1.00 65.50  ? 537  PRO B CA  1 
ATOM   8310 C C   . PRO B 1 537 ? 28.577  9.063   -23.710 1.00 81.29  ? 537  PRO B C   1 
ATOM   8311 O O   . PRO B 1 537 ? 29.578  8.534   -24.193 1.00 88.88  ? 537  PRO B O   1 
ATOM   8312 C CB  . PRO B 1 537 ? 26.720  10.091  -25.070 1.00 53.64  ? 537  PRO B CB  1 
ATOM   8313 C CG  . PRO B 1 537 ? 25.232  10.091  -24.857 1.00 51.42  ? 537  PRO B CG  1 
ATOM   8314 C CD  . PRO B 1 537 ? 25.064  9.565   -23.449 1.00 56.64  ? 537  PRO B CD  1 
ATOM   8315 N N   . LYS B 1 538 ? 28.616  9.849   -22.637 1.00 79.23  ? 538  LYS B N   1 
ATOM   8316 C CA  . LYS B 1 538 ? 29.837  10.030  -21.874 1.00 71.46  ? 538  LYS B CA  1 
ATOM   8317 C C   . LYS B 1 538 ? 30.345  8.661   -21.442 1.00 74.95  ? 538  LYS B C   1 
ATOM   8318 O O   . LYS B 1 538 ? 31.526  8.348   -21.574 1.00 78.30  ? 538  LYS B O   1 
ATOM   8319 C CB  . LYS B 1 538 ? 29.567  10.887  -20.641 1.00 68.72  ? 538  LYS B CB  1 
ATOM   8320 C CG  . LYS B 1 538 ? 29.209  12.333  -20.926 1.00 78.74  ? 538  LYS B CG  1 
ATOM   8321 C CD  . LYS B 1 538 ? 28.966  13.098  -19.617 1.00 93.29  ? 538  LYS B CD  1 
ATOM   8322 C CE  . LYS B 1 538 ? 28.818  14.601  -19.856 1.00 109.97 ? 538  LYS B CE  1 
ATOM   8323 N NZ  . LYS B 1 538 ? 30.044  15.217  -20.461 1.00 116.01 ? 538  LYS B NZ  1 
ATOM   8324 N N   . LEU B 1 539 ? 29.429  7.843   -20.938 1.00 75.48  ? 539  LEU B N   1 
ATOM   8325 C CA  . LEU B 1 539 ? 29.758  6.520   -20.427 1.00 79.61  ? 539  LEU B CA  1 
ATOM   8326 C C   . LEU B 1 539 ? 30.445  5.633   -21.454 1.00 90.04  ? 539  LEU B C   1 
ATOM   8327 O O   . LEU B 1 539 ? 31.156  4.702   -21.097 1.00 101.72 ? 539  LEU B O   1 
ATOM   8328 C CB  . LEU B 1 539 ? 28.498  5.824   -19.924 1.00 78.02  ? 539  LEU B CB  1 
ATOM   8329 C CG  . LEU B 1 539 ? 28.736  4.479   -19.246 1.00 74.54  ? 539  LEU B CG  1 
ATOM   8330 C CD1 . LEU B 1 539 ? 29.780  4.674   -18.182 1.00 82.88  ? 539  LEU B CD1 1 
ATOM   8331 C CD2 . LEU B 1 539 ? 27.456  3.914   -18.641 1.00 72.25  ? 539  LEU B CD2 1 
ATOM   8332 N N   . LEU B 1 540 ? 30.229  5.903   -22.731 1.00 93.30  ? 540  LEU B N   1 
ATOM   8333 C CA  . LEU B 1 540 ? 30.858  5.082   -23.757 1.00 103.48 ? 540  LEU B CA  1 
ATOM   8334 C C   . LEU B 1 540 ? 31.985  5.835   -24.475 1.00 110.97 ? 540  LEU B C   1 
ATOM   8335 O O   . LEU B 1 540 ? 32.838  5.229   -25.125 1.00 120.93 ? 540  LEU B O   1 
ATOM   8336 C CB  . LEU B 1 540 ? 29.804  4.527   -24.726 1.00 99.35  ? 540  LEU B CB  1 
ATOM   8337 C CG  . LEU B 1 540 ? 28.729  3.685   -24.016 1.00 87.55  ? 540  LEU B CG  1 
ATOM   8338 C CD1 . LEU B 1 540 ? 27.831  2.947   -25.003 1.00 75.55  ? 540  LEU B CD1 1 
ATOM   8339 C CD2 . LEU B 1 540 ? 29.364  2.713   -23.006 1.00 76.89  ? 540  LEU B CD2 1 
ATOM   8340 N N   . SER B 1 541 ? 31.994  7.157   -24.324 1.00 102.96 ? 541  SER B N   1 
ATOM   8341 C CA  . SER B 1 541 ? 33.058  7.993   -24.868 1.00 100.14 ? 541  SER B CA  1 
ATOM   8342 C C   . SER B 1 541 ? 34.276  8.002   -23.942 1.00 110.93 ? 541  SER B C   1 
ATOM   8343 O O   . SER B 1 541 ? 34.179  7.681   -22.753 1.00 113.38 ? 541  SER B O   1 
ATOM   8344 C CB  . SER B 1 541 ? 32.559  9.423   -25.085 1.00 91.43  ? 541  SER B CB  1 
HETATM 8345 C C1  . NAG C 2 .   ? 11.796  34.574  25.719  1.00 96.63  ? 701  NAG A C1  1 
HETATM 8346 C C2  . NAG C 2 .   ? 13.135  35.337  25.605  1.00 99.65  ? 701  NAG A C2  1 
HETATM 8347 C C3  . NAG C 2 .   ? 13.214  36.590  26.483  1.00 104.02 ? 701  NAG A C3  1 
HETATM 8348 C C4  . NAG C 2 .   ? 12.002  37.466  26.225  1.00 107.97 ? 701  NAG A C4  1 
HETATM 8349 C C5  . NAG C 2 .   ? 10.726  36.656  26.476  1.00 106.60 ? 701  NAG A C5  1 
HETATM 8350 C C6  . NAG C 2 .   ? 9.498   37.513  26.157  1.00 108.33 ? 701  NAG A C6  1 
HETATM 8351 C C7  . NAG C 2 .   ? 14.799  33.727  24.939  1.00 94.33  ? 701  NAG A C7  1 
HETATM 8352 C C8  . NAG C 2 .   ? 15.607  32.533  25.359  1.00 76.65  ? 701  NAG A C8  1 
HETATM 8353 N N2  . NAG C 2 .   ? 14.254  34.463  25.904  1.00 94.63  ? 701  NAG A N2  1 
HETATM 8354 O O3  . NAG C 2 .   ? 14.384  37.347  26.224  1.00 98.15  ? 701  NAG A O3  1 
HETATM 8355 O O4  . NAG C 2 .   ? 12.077  38.616  27.046  1.00 109.13 ? 701  NAG A O4  1 
HETATM 8356 O O5  . NAG C 2 .   ? 10.679  35.463  25.695  1.00 103.22 ? 701  NAG A O5  1 
HETATM 8357 O O6  . NAG C 2 .   ? 8.298   36.778  26.291  1.00 102.53 ? 701  NAG A O6  1 
HETATM 8358 O O7  . NAG C 2 .   ? 14.649  33.987  23.743  1.00 105.35 ? 701  NAG A O7  1 
HETATM 8359 O O3  . P3G D 3 .   ? 11.128  3.284   -15.237 1.00 68.05  ? 1542 P3G A O3  1 
HETATM 8360 C C7  . P3G D 3 .   ? 11.958  4.305   -14.816 1.00 66.53  ? 1542 P3G A C7  1 
HETATM 8361 C C8  . P3G D 3 .   ? 12.367  4.331   -13.376 1.00 64.48  ? 1542 P3G A C8  1 
HETATM 8362 O O4  . P3G D 3 .   ? 11.419  4.678   -12.431 1.00 71.54  ? 1542 P3G A O4  1 
HETATM 8363 C C9  . P3G D 3 .   ? 11.592  4.328   -11.108 1.00 67.47  ? 1542 P3G A C9  1 
HETATM 8364 C C10 . P3G D 3 .   ? 10.489  4.677   -10.168 1.00 72.81  ? 1542 P3G A C10 1 
HETATM 8365 O O5  . P3G D 3 .   ? 9.916   5.925   -10.300 1.00 78.79  ? 1542 P3G A O5  1 
HETATM 8366 C C11 . P3G D 3 .   ? 8.621   6.134   -9.871  1.00 72.05  ? 1542 P3G A C11 1 
HETATM 8367 C C12 . P3G D 3 .   ? 8.192   7.543   -9.626  1.00 61.38  ? 1542 P3G A C12 1 
HETATM 8368 O O3  . P3G E 3 .   ? 16.670  13.914  -4.673  1.00 80.90  ? 1543 P3G A O3  1 
HETATM 8369 C C7  . P3G E 3 .   ? 16.268  14.631  -5.785  1.00 68.80  ? 1543 P3G A C7  1 
HETATM 8370 C C8  . P3G E 3 .   ? 16.609  14.105  -7.144  1.00 69.66  ? 1543 P3G A C8  1 
HETATM 8371 O O4  . P3G E 3 .   ? 15.598  14.125  -8.088  1.00 71.31  ? 1543 P3G A O4  1 
HETATM 8372 C C9  . P3G E 3 .   ? 15.877  14.203  -9.434  1.00 61.45  ? 1543 P3G A C9  1 
HETATM 8373 C C10 . P3G E 3 .   ? 15.667  15.532  -10.091 1.00 60.33  ? 1543 P3G A C10 1 
HETATM 8374 O O5  . P3G E 3 .   ? 14.483  16.207  -9.859  1.00 58.78  ? 1543 P3G A O5  1 
HETATM 8375 C C11 . P3G E 3 .   ? 13.410  16.034  -10.714 1.00 63.89  ? 1543 P3G A C11 1 
HETATM 8376 C C12 . P3G E 3 .   ? 12.022  16.225  -10.189 1.00 57.20  ? 1543 P3G A C12 1 
HETATM 8377 S S   . SO4 F 4 .   ? 15.648  23.839  33.553  1.00 88.62  ? 1544 SO4 A S   1 
HETATM 8378 O O1  . SO4 F 4 .   ? 16.923  23.947  32.845  1.00 78.86  ? 1544 SO4 A O1  1 
HETATM 8379 O O2  . SO4 F 4 .   ? 14.626  23.390  32.612  1.00 92.26  ? 1544 SO4 A O2  1 
HETATM 8380 O O3  . SO4 F 4 .   ? 15.771  22.844  34.610  1.00 100.01 ? 1544 SO4 A O3  1 
HETATM 8381 O O4  . SO4 F 4 .   ? 15.276  25.123  34.154  1.00 78.29  ? 1544 SO4 A O4  1 
HETATM 8382 C C5  . P3G G 3 .   ? 42.124  -5.306  5.485   1.00 70.48  ? 1545 P3G A C5  1 
HETATM 8383 C C6  . P3G G 3 .   ? 42.176  -4.222  6.565   1.00 59.57  ? 1545 P3G A C6  1 
HETATM 8384 O O3  . P3G G 3 .   ? 43.319  -3.415  6.648   1.00 59.59  ? 1545 P3G A O3  1 
HETATM 8385 C C7  . P3G G 3 .   ? 44.180  -3.541  7.743   1.00 57.63  ? 1545 P3G A C7  1 
HETATM 8386 C C8  . P3G G 3 .   ? 45.564  -2.906  7.641   1.00 62.40  ? 1545 P3G A C8  1 
HETATM 8387 O O4  . P3G G 3 .   ? 46.633  -3.616  8.210   1.00 69.98  ? 1545 P3G A O4  1 
HETATM 8388 O O01 . Z5K H 5 .   ? 30.688  18.714  12.024  1.00 71.61  ? 1546 Z5K A O01 1 
HETATM 8389 S S02 . Z5K H 5 .   ? 29.886  19.895  12.073  1.00 63.30  ? 1546 Z5K A S02 1 
HETATM 8390 N N03 . Z5K H 5 .   ? 29.963  20.626  13.610  1.00 62.06  ? 1546 Z5K A N03 1 
HETATM 8391 C C04 . Z5K H 5 .   ? 28.770  21.428  13.893  1.00 51.96  ? 1546 Z5K A C04 1 
HETATM 8392 C C05 . Z5K H 5 .   ? 27.837  20.880  14.936  1.00 46.23  ? 1546 Z5K A C05 1 
HETATM 8393 N N06 . Z5K H 5 .   ? 26.916  19.797  14.531  1.00 58.28  ? 1546 Z5K A N06 1 
HETATM 8394 C C07 . Z5K H 5 .   ? 25.561  20.256  14.202  1.00 59.90  ? 1546 Z5K A C07 1 
HETATM 8395 C C08 . Z5K H 5 .   ? 25.278  20.548  12.754  1.00 56.09  ? 1546 Z5K A C08 1 
HETATM 8396 C C09 . Z5K H 5 .   ? 26.922  18.659  15.451  1.00 55.21  ? 1546 Z5K A C09 1 
HETATM 8397 C C10 . Z5K H 5 .   ? 27.623  17.434  14.956  1.00 67.46  ? 1546 Z5K A C10 1 
HETATM 8398 C C11 . Z5K H 5 .   ? 30.293  21.049  10.822  1.00 92.59  ? 1546 Z5K A C11 1 
HETATM 8399 C C12 . Z5K H 5 .   ? 31.529  21.021  10.173  1.00 105.43 ? 1546 Z5K A C12 1 
HETATM 8400 C C13 . Z5K H 5 .   ? 31.818  21.953  9.165   1.00 110.55 ? 1546 Z5K A C13 1 
HETATM 8401 C C14 . Z5K H 5 .   ? 33.144  21.941  8.433   1.00 120.20 ? 1546 Z5K A C14 1 
HETATM 8402 F F15 . Z5K H 5 .   ? 33.806  23.054  8.795   1.00 121.88 ? 1546 Z5K A F15 1 
HETATM 8403 F F16 . Z5K H 5 .   ? 32.950  21.885  7.099   1.00 116.38 ? 1546 Z5K A F16 1 
HETATM 8404 F F17 . Z5K H 5 .   ? 33.840  20.867  8.797   1.00 120.99 ? 1546 Z5K A F17 1 
HETATM 8405 C C18 . Z5K H 5 .   ? 30.861  22.926  8.819   1.00 99.30  ? 1546 Z5K A C18 1 
HETATM 8406 C C19 . Z5K H 5 .   ? 29.628  22.951  9.471   1.00 95.29  ? 1546 Z5K A C19 1 
HETATM 8407 C C20 . Z5K H 5 .   ? 29.343  22.016  10.468  1.00 92.15  ? 1546 Z5K A C20 1 
HETATM 8408 O O21 . Z5K H 5 .   ? 28.607  19.309  11.777  1.00 61.02  ? 1546 Z5K A O21 1 
HETATM 8409 O O3  . P3G I 3 .   ? 32.614  14.117  -42.253 1.00 76.88  ? 1542 P3G B O3  1 
HETATM 8410 C C7  . P3G I 3 .   ? 32.151  13.240  -43.249 1.00 83.38  ? 1542 P3G B C7  1 
HETATM 8411 C C8  . P3G I 3 .   ? 31.228  12.080  -42.850 1.00 78.86  ? 1542 P3G B C8  1 
HETATM 8412 O O4  . P3G I 3 .   ? 30.825  11.176  -43.847 1.00 75.65  ? 1542 P3G B O4  1 
HETATM 8413 C C9  . P3G I 3 .   ? 31.718  10.814  -44.871 1.00 73.58  ? 1542 P3G B C9  1 
HETATM 8414 C C10 . P3G I 3 .   ? 31.759  9.361   -45.365 1.00 60.99  ? 1542 P3G B C10 1 
HETATM 8415 O O5  . P3G I 3 .   ? 32.442  9.113   -46.568 1.00 55.12  ? 1542 P3G B O5  1 
HETATM 8416 O O01 . Z5K J 5 .   ? 9.392   -3.349  -38.300 1.00 82.89  ? 1543 Z5K B O01 1 
HETATM 8417 S S02 . Z5K J 5 .   ? 8.791   -3.435  -37.008 1.00 72.25  ? 1543 Z5K B S02 1 
HETATM 8418 N N03 . Z5K J 5 .   ? 7.138   -3.771  -37.056 1.00 77.11  ? 1543 Z5K B N03 1 
HETATM 8419 C C04 . Z5K J 5 .   ? 6.605   -3.926  -38.390 1.00 68.33  ? 1543 Z5K B C04 1 
HETATM 8420 C C05 . Z5K J 5 .   ? 5.798   -2.728  -38.789 1.00 70.57  ? 1543 Z5K B C05 1 
HETATM 8421 N N06 . Z5K J 5 .   ? 5.468   -1.829  -37.671 1.00 61.22  ? 1543 Z5K B N06 1 
HETATM 8422 C C07 . Z5K J 5 .   ? 4.505   -2.488  -36.800 1.00 57.31  ? 1543 Z5K B C07 1 
HETATM 8423 C C08 . Z5K J 5 .   ? 4.354   -1.935  -35.419 1.00 50.17  ? 1543 Z5K B C08 1 
HETATM 8424 C C09 . Z5K J 5 .   ? 5.039   -0.480  -38.074 1.00 57.44  ? 1543 Z5K B C09 1 
HETATM 8425 C C10 . Z5K J 5 .   ? 4.997   -0.138  -39.546 1.00 62.85  ? 1543 Z5K B C10 1 
HETATM 8426 C C11 . Z5K J 5 .   ? 9.325   -4.822  -36.055 1.00 81.62  ? 1543 Z5K B C11 1 
HETATM 8427 C C12 . Z5K J 5 .   ? 10.272  -5.754  -36.516 1.00 85.70  ? 1543 Z5K B C12 1 
HETATM 8428 C C13 . Z5K J 5 .   ? 10.644  -6.861  -35.727 1.00 96.58  ? 1543 Z5K B C13 1 
HETATM 8429 C C14 . Z5K J 5 .   ? 11.688  -7.873  -36.182 1.00 115.54 ? 1543 Z5K B C14 1 
HETATM 8430 F F15 . Z5K J 5 .   ? 11.072  -8.950  -36.708 1.00 112.06 ? 1543 Z5K B F15 1 
HETATM 8431 F F16 . Z5K J 5 .   ? 12.444  -8.249  -35.148 1.00 123.76 ? 1543 Z5K B F16 1 
HETATM 8432 F F17 . Z5K J 5 .   ? 12.504  -7.338  -37.082 1.00 120.40 ? 1543 Z5K B F17 1 
HETATM 8433 C C18 . Z5K J 5 .   ? 10.033  -7.050  -34.469 1.00 91.77  ? 1543 Z5K B C18 1 
HETATM 8434 C C19 . Z5K J 5 .   ? 9.072   -6.143  -34.014 1.00 88.53  ? 1543 Z5K B C19 1 
HETATM 8435 C C20 . Z5K J 5 .   ? 8.712   -5.041  -34.805 1.00 79.84  ? 1543 Z5K B C20 1 
HETATM 8436 O O21 . Z5K J 5 .   ? 9.073   -2.103  -36.517 1.00 68.86  ? 1543 Z5K B O21 1 
HETATM 8437 S S   . SO4 K 4 .   ? -15.188 1.466   -46.487 1.00 87.54  ? 1544 SO4 B S   1 
HETATM 8438 O O1  . SO4 K 4 .   ? -14.054 0.670   -46.960 1.00 60.97  ? 1544 SO4 B O1  1 
HETATM 8439 O O2  . SO4 K 4 .   ? -16.459 0.833   -46.854 1.00 86.74  ? 1544 SO4 B O2  1 
HETATM 8440 O O3  . SO4 K 4 .   ? -15.102 1.581   -45.032 1.00 90.26  ? 1544 SO4 B O3  1 
HETATM 8441 O O4  . SO4 K 4 .   ? -15.136 2.803   -47.082 1.00 96.05  ? 1544 SO4 B O4  1 
HETATM 8442 O O01 . Z5K L 5 .   ? -5.043  -7.359  -44.245 1.00 86.58  ? 1545 Z5K B O01 1 
HETATM 8443 S S02 . Z5K L 5 .   ? -5.276  -8.088  -43.022 1.00 82.37  ? 1545 Z5K B S02 1 
HETATM 8444 N N03 . Z5K L 5 .   ? -6.578  -7.504  -42.104 1.00 93.18  ? 1545 Z5K B N03 1 
HETATM 8445 C C04 . Z5K L 5 .   ? -7.278  -6.388  -42.740 1.00 89.23  ? 1545 Z5K B C04 1 
HETATM 8446 C C05 . Z5K L 5 .   ? -7.086  -5.003  -42.175 1.00 90.90  ? 1545 Z5K B C05 1 
HETATM 8447 N N06 . Z5K L 5 .   ? -7.031  -4.868  -40.704 1.00 88.61  ? 1545 Z5K B N06 1 
HETATM 8448 C C07 . Z5K L 5 .   ? -8.324  -5.005  -40.006 1.00 87.60  ? 1545 Z5K B C07 1 
HETATM 8449 C C08 . Z5K L 5 .   ? -9.573  -4.487  -40.676 1.00 84.78  ? 1545 Z5K B C08 1 
HETATM 8450 C C09 . Z5K L 5 .   ? -6.349  -3.628  -40.328 1.00 78.79  ? 1545 Z5K B C09 1 
HETATM 8451 C C10 . Z5K L 5 .   ? -6.871  -2.332  -40.869 1.00 68.04  ? 1545 Z5K B C10 1 
HETATM 8452 C C11 . Z5K L 5 .   ? -5.436  -9.803  -43.322 1.00 132.50 ? 1545 Z5K B C11 1 
HETATM 8453 C C12 . Z5K L 5 .   ? -5.366  -10.660 -42.225 1.00 131.79 ? 1545 Z5K B C12 1 
HETATM 8454 C C13 . Z5K L 5 .   ? -5.478  -12.038 -42.401 1.00 132.78 ? 1545 Z5K B C13 1 
HETATM 8455 C C14 . Z5K L 5 .   ? -5.401  -12.938 -41.182 1.00 131.20 ? 1545 Z5K B C14 1 
HETATM 8456 F F15 . Z5K L 5 .   ? -6.520  -12.821 -40.459 1.00 121.39 ? 1545 Z5K B F15 1 
HETATM 8457 F F16 . Z5K L 5 .   ? -4.390  -12.559 -40.407 1.00 134.30 ? 1545 Z5K B F16 1 
HETATM 8458 F F17 . Z5K L 5 .   ? -5.217  -14.204 -41.545 1.00 137.93 ? 1545 Z5K B F17 1 
HETATM 8459 C C18 . Z5K L 5 .   ? -5.664  -12.563 -43.707 1.00 132.13 ? 1545 Z5K B C18 1 
HETATM 8460 C C19 . Z5K L 5 .   ? -5.733  -11.700 -44.816 1.00 130.09 ? 1545 Z5K B C19 1 
HETATM 8461 C C20 . Z5K L 5 .   ? -5.618  -10.315 -44.627 1.00 132.12 ? 1545 Z5K B C20 1 
HETATM 8462 O O21 . Z5K L 5 .   ? -4.042  -7.847  -42.316 1.00 97.66  ? 1545 Z5K B O21 1 
HETATM 8463 C C3  . P6G M 6 .   ? 17.775  10.529  -13.120 1.00 84.58  ? 1546 P6G B C3  1 
HETATM 8464 O O4  . P6G M 6 .   ? 18.663  10.135  -14.115 1.00 94.55  ? 1546 P6G B O4  1 
HETATM 8465 C C5  . P6G M 6 .   ? 19.720  10.961  -14.484 1.00 99.22  ? 1546 P6G B C5  1 
HETATM 8466 C C6  . P6G M 6 .   ? 20.995  10.371  -15.016 1.00 92.10  ? 1546 P6G B C6  1 
HETATM 8467 O O7  . P6G M 6 .   ? 21.976  10.016  -14.101 1.00 80.33  ? 1546 P6G B O7  1 
HETATM 8468 C C8  . P6G M 6 .   ? 23.099  9.344   -14.525 1.00 63.06  ? 1546 P6G B C8  1 
HETATM 8469 C C9  . P6G M 6 .   ? 23.551  8.193   -13.701 1.00 51.80  ? 1546 P6G B C9  1 
HETATM 8470 O O10 . P6G M 6 .   ? 22.913  6.982   -13.861 1.00 56.07  ? 1546 P6G B O10 1 
HETATM 8471 C C11 . P6G M 6 .   ? 22.603  6.310   -12.703 1.00 64.62  ? 1546 P6G B C11 1 
HETATM 8472 C C12 . P6G M 6 .   ? 21.732  5.103   -12.747 1.00 69.94  ? 1546 P6G B C12 1 
HETATM 8473 O O13 . P6G M 6 .   ? 21.370  4.605   -11.512 1.00 71.19  ? 1546 P6G B O13 1 
HETATM 8474 C C14 . P6G M 6 .   ? 20.042  4.617   -11.127 1.00 70.32  ? 1546 P6G B C14 1 
HETATM 8475 C C15 . P6G M 6 .   ? 19.383  5.941   -10.898 1.00 63.07  ? 1546 P6G B C15 1 
HETATM 8476 O O16 . P6G M 6 .   ? 18.108  5.968   -10.388 1.00 57.31  ? 1546 P6G B O16 1 
HETATM 8477 C C17 . P6G M 6 .   ? 17.263  7.019   -10.708 1.00 60.85  ? 1546 P6G B C17 1 
HETATM 8478 C C18 . P6G M 6 .   ? 16.283  6.934   -11.844 1.00 56.55  ? 1546 P6G B C18 1 
HETATM 8479 O O19 . P6G M 6 .   ? 15.159  6.131   -11.742 1.00 57.68  ? 1546 P6G B O19 1 
HETATM 8480 O O   . HOH N 7 .   ? 31.433  12.652  51.660  1.00 57.37  ? 2001 HOH A O   1 
HETATM 8481 O O   . HOH N 7 .   ? 41.524  0.899   39.417  1.00 44.61  ? 2002 HOH A O   1 
HETATM 8482 O O   . HOH N 7 .   ? 46.082  2.091   39.778  1.00 72.49  ? 2003 HOH A O   1 
HETATM 8483 O O   . HOH N 7 .   ? 23.991  8.570   48.087  1.00 40.61  ? 2004 HOH A O   1 
HETATM 8484 O O   . HOH N 7 .   ? 14.143  13.515  48.717  1.00 47.55  ? 2005 HOH A O   1 
HETATM 8485 O O   . HOH N 7 .   ? 36.502  3.187   45.840  1.00 59.68  ? 2006 HOH A O   1 
HETATM 8486 O O   . HOH N 7 .   ? 36.926  7.660   50.429  1.00 49.30  ? 2007 HOH A O   1 
HETATM 8487 O O   . HOH N 7 .   ? 27.903  3.705   46.577  1.00 57.13  ? 2008 HOH A O   1 
HETATM 8488 O O   . HOH N 7 .   ? 29.849  2.086   46.038  1.00 47.02  ? 2009 HOH A O   1 
HETATM 8489 O O   . HOH N 7 .   ? 39.760  15.230  39.067  1.00 32.84  ? 2010 HOH A O   1 
HETATM 8490 O O   . HOH N 7 .   ? 43.475  0.325   40.996  1.00 51.67  ? 2011 HOH A O   1 
HETATM 8491 O O   . HOH N 7 .   ? 53.572  19.503  25.896  1.00 55.17  ? 2012 HOH A O   1 
HETATM 8492 O O   . HOH N 7 .   ? 38.044  8.505   47.583  1.00 43.29  ? 2013 HOH A O   1 
HETATM 8493 O O   . HOH N 7 .   ? 29.950  21.113  46.261  1.00 53.82  ? 2014 HOH A O   1 
HETATM 8494 O O   . HOH N 7 .   ? 26.669  20.077  46.045  1.00 43.07  ? 2015 HOH A O   1 
HETATM 8495 O O   . HOH N 7 .   ? 12.241  16.406  46.294  1.00 57.37  ? 2016 HOH A O   1 
HETATM 8496 O O   . HOH N 7 .   ? 19.526  23.184  38.733  1.00 48.58  ? 2017 HOH A O   1 
HETATM 8497 O O   . HOH N 7 .   ? 12.786  24.975  37.483  1.00 62.69  ? 2018 HOH A O   1 
HETATM 8498 O O   . HOH N 7 .   ? 11.556  17.971  34.357  1.00 48.20  ? 2019 HOH A O   1 
HETATM 8499 O O   . HOH N 7 .   ? 8.034   21.479  40.688  1.00 59.30  ? 2020 HOH A O   1 
HETATM 8500 O O   . HOH N 7 .   ? 33.572  18.534  39.003  1.00 55.40  ? 2021 HOH A O   1 
HETATM 8501 O O   . HOH N 7 .   ? 32.505  17.031  32.722  1.00 47.63  ? 2022 HOH A O   1 
HETATM 8502 O O   . HOH N 7 .   ? 37.016  16.051  38.410  1.00 52.48  ? 2023 HOH A O   1 
HETATM 8503 O O   . HOH N 7 .   ? 36.897  6.208   38.236  1.00 46.53  ? 2024 HOH A O   1 
HETATM 8504 O O   . HOH N 7 .   ? 40.658  12.175  33.578  1.00 43.07  ? 2025 HOH A O   1 
HETATM 8505 O O   . HOH N 7 .   ? 45.615  8.409   29.417  1.00 41.93  ? 2026 HOH A O   1 
HETATM 8506 O O   . HOH N 7 .   ? 46.576  14.417  24.278  1.00 41.86  ? 2027 HOH A O   1 
HETATM 8507 O O   . HOH N 7 .   ? 50.975  17.243  26.147  1.00 45.31  ? 2028 HOH A O   1 
HETATM 8508 O O   . HOH N 7 .   ? 52.551  16.122  24.361  1.00 48.62  ? 2029 HOH A O   1 
HETATM 8509 O O   . HOH N 7 .   ? 46.876  8.592   27.102  1.00 55.06  ? 2030 HOH A O   1 
HETATM 8510 O O   . HOH N 7 .   ? 46.023  12.615  22.446  1.00 42.41  ? 2031 HOH A O   1 
HETATM 8511 O O   . HOH N 7 .   ? 47.238  7.557   17.866  1.00 43.52  ? 2032 HOH A O   1 
HETATM 8512 O O   . HOH N 7 .   ? 48.785  4.067   27.121  1.00 41.63  ? 2033 HOH A O   1 
HETATM 8513 O O   . HOH N 7 .   ? 51.095  1.902   30.322  1.00 67.69  ? 2034 HOH A O   1 
HETATM 8514 O O   . HOH N 7 .   ? 49.954  6.377   27.678  1.00 47.60  ? 2035 HOH A O   1 
HETATM 8515 O O   . HOH N 7 .   ? 9.554   6.820   35.773  1.00 60.89  ? 2036 HOH A O   1 
HETATM 8516 O O   . HOH N 7 .   ? 42.170  13.280  35.866  1.00 47.92  ? 2037 HOH A O   1 
HETATM 8517 O O   . HOH N 7 .   ? 39.754  14.899  45.992  1.00 57.59  ? 2038 HOH A O   1 
HETATM 8518 O O   . HOH N 7 .   ? 35.984  18.275  40.238  1.00 58.52  ? 2039 HOH A O   1 
HETATM 8519 O O   . HOH N 7 .   ? 32.892  19.284  29.065  1.00 32.68  ? 2040 HOH A O   1 
HETATM 8520 O O   . HOH N 7 .   ? 36.711  23.594  33.337  1.00 53.60  ? 2041 HOH A O   1 
HETATM 8521 O O   . HOH N 7 .   ? 42.919  22.936  33.467  1.00 63.67  ? 2042 HOH A O   1 
HETATM 8522 O O   . HOH N 7 .   ? 35.088  17.299  24.395  1.00 36.29  ? 2043 HOH A O   1 
HETATM 8523 O O   . HOH N 7 .   ? 41.193  16.785  21.821  1.00 43.33  ? 2044 HOH A O   1 
HETATM 8524 O O   . HOH N 7 .   ? 41.584  19.216  17.853  1.00 31.67  ? 2045 HOH A O   1 
HETATM 8525 O O   . HOH N 7 .   ? 32.430  21.401  21.571  1.00 33.11  ? 2046 HOH A O   1 
HETATM 8526 O O   . HOH N 7 .   ? 39.971  20.282  16.284  1.00 28.19  ? 2047 HOH A O   1 
HETATM 8527 O O   . HOH N 7 .   ? 40.399  27.992  16.811  1.00 42.53  ? 2048 HOH A O   1 
HETATM 8528 O O   . HOH N 7 .   ? 29.368  25.696  13.336  1.00 46.68  ? 2049 HOH A O   1 
HETATM 8529 O O   . HOH N 7 .   ? 22.094  34.671  17.570  1.00 60.00  ? 2050 HOH A O   1 
HETATM 8530 O O   . HOH N 7 .   ? 20.745  25.740  23.286  1.00 59.75  ? 2051 HOH A O   1 
HETATM 8531 O O   . HOH N 7 .   ? 29.948  26.271  15.957  1.00 44.05  ? 2052 HOH A O   1 
HETATM 8532 O O   . HOH N 7 .   ? 27.864  26.031  24.152  1.00 49.44  ? 2053 HOH A O   1 
HETATM 8533 O O   . HOH N 7 .   ? 24.194  23.699  23.484  1.00 48.18  ? 2054 HOH A O   1 
HETATM 8534 O O   . HOH N 7 .   ? 29.639  20.537  19.132  1.00 35.06  ? 2055 HOH A O   1 
HETATM 8535 O O   . HOH N 7 .   ? 42.364  6.638   0.063   1.00 38.85  ? 2056 HOH A O   1 
HETATM 8536 O O   . HOH N 7 .   ? 51.363  4.621   3.373   1.00 58.28  ? 2057 HOH A O   1 
HETATM 8537 O O   . HOH N 7 .   ? 53.252  11.369  2.247   1.00 55.98  ? 2058 HOH A O   1 
HETATM 8538 O O   . HOH N 7 .   ? 26.189  24.832  25.768  1.00 41.06  ? 2059 HOH A O   1 
HETATM 8539 O O   . HOH N 7 .   ? 36.342  27.084  26.017  1.00 59.16  ? 2060 HOH A O   1 
HETATM 8540 O O   . HOH N 7 .   ? 36.449  26.583  32.662  1.00 56.92  ? 2061 HOH A O   1 
HETATM 8541 O O   . HOH N 7 .   ? 39.083  28.258  26.927  1.00 52.79  ? 2062 HOH A O   1 
HETATM 8542 O O   . HOH N 7 .   ? 41.931  13.612  31.521  1.00 48.50  ? 2063 HOH A O   1 
HETATM 8543 O O   . HOH N 7 .   ? 43.971  15.579  36.432  1.00 42.75  ? 2064 HOH A O   1 
HETATM 8544 O O   . HOH N 7 .   ? 48.919  26.188  23.861  1.00 59.17  ? 2065 HOH A O   1 
HETATM 8545 O O   . HOH N 7 .   ? 41.619  16.465  37.454  1.00 48.75  ? 2066 HOH A O   1 
HETATM 8546 O O   . HOH N 7 .   ? 32.185  16.788  29.716  1.00 33.23  ? 2067 HOH A O   1 
HETATM 8547 O O   . HOH N 7 .   ? 44.787  24.093  2.631   1.00 51.85  ? 2068 HOH A O   1 
HETATM 8548 O O   . HOH N 7 .   ? 14.972  -6.174  26.456  1.00 53.10  ? 2069 HOH A O   1 
HETATM 8549 O O   . HOH N 7 .   ? 29.529  12.600  24.665  1.00 39.39  ? 2070 HOH A O   1 
HETATM 8550 O O   . HOH N 7 .   ? 26.197  15.371  18.588  1.00 36.80  ? 2071 HOH A O   1 
HETATM 8551 O O   . HOH N 7 .   ? 28.841  17.833  20.056  1.00 38.02  ? 2072 HOH A O   1 
HETATM 8552 O O   . HOH N 7 .   ? 33.189  14.668  17.272  1.00 39.52  ? 2073 HOH A O   1 
HETATM 8553 O O   . HOH N 7 .   ? 38.789  15.510  12.698  1.00 38.63  ? 2074 HOH A O   1 
HETATM 8554 O O   . HOH N 7 .   ? 31.157  21.637  16.483  1.00 44.40  ? 2075 HOH A O   1 
HETATM 8555 O O   . HOH N 7 .   ? 28.030  37.219  1.029   1.00 55.68  ? 2076 HOH A O   1 
HETATM 8556 O O   . HOH N 7 .   ? 11.877  27.504  2.173   1.00 46.50  ? 2077 HOH A O   1 
HETATM 8557 O O   . HOH N 7 .   ? 25.765  15.827  27.871  1.00 29.08  ? 2078 HOH A O   1 
HETATM 8558 O O   . HOH N 7 .   ? 25.086  18.912  29.010  1.00 30.53  ? 2079 HOH A O   1 
HETATM 8559 O O   . HOH N 7 .   ? 25.316  22.246  29.994  1.00 30.79  ? 2080 HOH A O   1 
HETATM 8560 O O   . HOH N 7 .   ? 20.181  22.030  29.748  1.00 53.67  ? 2081 HOH A O   1 
HETATM 8561 O O   . HOH N 7 .   ? 17.242  15.446  29.104  1.00 50.57  ? 2082 HOH A O   1 
HETATM 8562 O O   . HOH N 7 .   ? 9.394   9.609   36.473  1.00 51.31  ? 2083 HOH A O   1 
HETATM 8563 O O   . HOH N 7 .   ? 13.350  4.157   32.914  1.00 56.09  ? 2084 HOH A O   1 
HETATM 8564 O O   . HOH N 7 .   ? 8.210   11.960  27.675  1.00 50.59  ? 2085 HOH A O   1 
HETATM 8565 O O   . HOH N 7 .   ? 43.824  18.697  16.269  1.00 42.61  ? 2086 HOH A O   1 
HETATM 8566 O O   . HOH N 7 .   ? 11.898  13.142  1.370   1.00 58.69  ? 2087 HOH A O   1 
HETATM 8567 O O   . HOH N 7 .   ? 42.486  7.426   13.941  1.00 53.49  ? 2088 HOH A O   1 
HETATM 8568 O O   . HOH N 7 .   ? 43.351  10.121  11.242  1.00 43.46  ? 2089 HOH A O   1 
HETATM 8569 O O   . HOH N 7 .   ? 46.580  10.777  10.883  1.00 40.19  ? 2090 HOH A O   1 
HETATM 8570 O O   . HOH N 7 .   ? 53.356  -1.578  18.166  1.00 69.04  ? 2091 HOH A O   1 
HETATM 8571 O O   . HOH N 7 .   ? 50.208  2.203   21.596  1.00 47.39  ? 2092 HOH A O   1 
HETATM 8572 O O   . HOH N 7 .   ? 57.854  8.594   20.233  1.00 53.84  ? 2093 HOH A O   1 
HETATM 8573 O O   . HOH N 7 .   ? 44.475  1.729   17.013  1.00 52.71  ? 2094 HOH A O   1 
HETATM 8574 O O   . HOH N 7 .   ? 39.701  0.949   26.260  1.00 57.69  ? 2095 HOH A O   1 
HETATM 8575 O O   . HOH N 7 .   ? 40.090  -3.410  19.170  1.00 71.52  ? 2096 HOH A O   1 
HETATM 8576 O O   . HOH N 7 .   ? 40.433  -2.565  23.934  1.00 47.95  ? 2097 HOH A O   1 
HETATM 8577 O O   . HOH N 7 .   ? 28.415  -0.544  29.696  1.00 42.17  ? 2098 HOH A O   1 
HETATM 8578 O O   . HOH N 7 .   ? 34.505  -2.973  32.617  1.00 38.03  ? 2099 HOH A O   1 
HETATM 8579 O O   . HOH N 7 .   ? 26.546  -6.188  31.895  1.00 55.10  ? 2100 HOH A O   1 
HETATM 8580 O O   . HOH N 7 .   ? 32.133  0.259   41.566  1.00 44.29  ? 2101 HOH A O   1 
HETATM 8581 O O   . HOH N 7 .   ? 34.328  -5.352  37.600  1.00 59.44  ? 2102 HOH A O   1 
HETATM 8582 O O   . HOH N 7 .   ? 16.222  -3.412  29.888  1.00 39.63  ? 2103 HOH A O   1 
HETATM 8583 O O   . HOH N 7 .   ? 21.356  15.060  13.068  1.00 45.83  ? 2104 HOH A O   1 
HETATM 8584 O O   . HOH N 7 .   ? 36.307  -4.969  13.720  1.00 51.21  ? 2105 HOH A O   1 
HETATM 8585 O O   . HOH N 7 .   ? 18.802  12.267  13.360  1.00 35.57  ? 2106 HOH A O   1 
HETATM 8586 O O   . HOH N 7 .   ? 27.078  9.340   7.609   1.00 48.97  ? 2107 HOH A O   1 
HETATM 8587 O O   . HOH N 7 .   ? 33.881  4.897   6.358   1.00 50.47  ? 2108 HOH A O   1 
HETATM 8588 O O   . HOH N 7 .   ? 30.622  8.303   6.577   1.00 37.79  ? 2109 HOH A O   1 
HETATM 8589 O O   . HOH N 7 .   ? 37.597  10.686  4.412   1.00 26.54  ? 2110 HOH A O   1 
HETATM 8590 O O   . HOH N 7 .   ? 36.780  12.687  6.992   1.00 47.77  ? 2111 HOH A O   1 
HETATM 8591 O O   . HOH N 7 .   ? 41.078  6.995   2.741   1.00 48.04  ? 2112 HOH A O   1 
HETATM 8592 O O   . HOH N 7 .   ? 45.874  2.123   2.626   1.00 56.96  ? 2113 HOH A O   1 
HETATM 8593 O O   . HOH N 7 .   ? 43.531  0.838   5.812   1.00 47.45  ? 2114 HOH A O   1 
HETATM 8594 O O   . HOH N 7 .   ? 50.998  7.515   2.967   1.00 46.61  ? 2115 HOH A O   1 
HETATM 8595 O O   . HOH N 7 .   ? 46.013  9.090   -2.425  1.00 55.01  ? 2116 HOH A O   1 
HETATM 8596 O O   . HOH N 7 .   ? 50.523  3.350   7.004   1.00 62.50  ? 2117 HOH A O   1 
HETATM 8597 O O   . HOH N 7 .   ? 52.395  13.493  3.278   1.00 51.29  ? 2118 HOH A O   1 
HETATM 8598 O O   . HOH N 7 .   ? 50.676  14.319  1.563   1.00 42.80  ? 2119 HOH A O   1 
HETATM 8599 O O   . HOH N 7 .   ? 54.894  19.649  2.849   1.00 51.54  ? 2120 HOH A O   1 
HETATM 8600 O O   . HOH N 7 .   ? 12.315  38.386  23.142  1.00 67.89  ? 2121 HOH A O   1 
HETATM 8601 O O   . HOH N 7 .   ? 62.566  17.916  12.814  1.00 62.66  ? 2122 HOH A O   1 
HETATM 8602 O O   . HOH N 7 .   ? 59.088  13.712  23.061  1.00 42.86  ? 2123 HOH A O   1 
HETATM 8603 O O   . HOH N 7 .   ? 56.732  14.345  25.575  1.00 53.66  ? 2124 HOH A O   1 
HETATM 8604 O O   . HOH N 7 .   ? 57.359  25.134  19.126  1.00 24.04  ? 2125 HOH A O   1 
HETATM 8605 O O   . HOH N 7 .   ? 53.704  22.380  25.241  1.00 46.05  ? 2126 HOH A O   1 
HETATM 8606 O O   . HOH N 7 .   ? 49.738  23.199  24.999  1.00 46.20  ? 2127 HOH A O   1 
HETATM 8607 O O   . HOH N 7 .   ? 50.350  27.714  14.914  1.00 43.82  ? 2128 HOH A O   1 
HETATM 8608 O O   . HOH N 7 .   ? 42.719  27.721  15.094  1.00 53.02  ? 2129 HOH A O   1 
HETATM 8609 O O   . HOH N 7 .   ? 39.291  18.644  10.503  1.00 42.71  ? 2130 HOH A O   1 
HETATM 8610 O O   . HOH N 7 .   ? 47.072  18.722  1.237   1.00 50.01  ? 2131 HOH A O   1 
HETATM 8611 O O   . HOH N 7 .   ? 41.695  27.143  7.940   1.00 61.82  ? 2132 HOH A O   1 
HETATM 8612 O O   . HOH N 7 .   ? 42.286  21.965  2.028   1.00 67.61  ? 2133 HOH A O   1 
HETATM 8613 O O   . HOH N 7 .   ? 38.730  15.786  1.167   1.00 41.40  ? 2134 HOH A O   1 
HETATM 8614 O O   . HOH N 7 .   ? 39.885  13.127  -6.509  1.00 50.73  ? 2135 HOH A O   1 
HETATM 8615 O O   . HOH N 7 .   ? 37.214  19.836  -5.035  1.00 42.45  ? 2136 HOH A O   1 
HETATM 8616 O O   . HOH N 7 .   ? 38.780  22.513  2.828   1.00 59.01  ? 2137 HOH A O   1 
HETATM 8617 O O   . HOH N 7 .   ? 35.768  24.781  1.433   1.00 53.85  ? 2138 HOH A O   1 
HETATM 8618 O O   . HOH N 7 .   ? 35.891  22.945  5.265   1.00 51.11  ? 2139 HOH A O   1 
HETATM 8619 O O   . HOH N 7 .   ? 30.512  16.153  1.141   1.00 41.90  ? 2140 HOH A O   1 
HETATM 8620 O O   . HOH N 7 .   ? 44.219  11.351  9.280   1.00 43.26  ? 2141 HOH A O   1 
HETATM 8621 O O   . HOH N 7 .   ? 46.894  -4.708  12.776  1.00 60.17  ? 2142 HOH A O   1 
HETATM 8622 O O   . HOH N 7 .   ? 35.029  4.048   1.821   1.00 60.29  ? 2143 HOH A O   1 
HETATM 8623 O O   . HOH N 7 .   ? 14.538  -7.781  23.467  1.00 64.13  ? 2144 HOH A O   1 
HETATM 8624 O O   . HOH N 7 .   ? 18.130  14.886  4.256   1.00 49.03  ? 2145 HOH A O   1 
HETATM 8625 O O   . HOH N 7 .   ? 22.270  20.624  7.211   1.00 29.66  ? 2146 HOH A O   1 
HETATM 8626 O O   . HOH N 7 .   ? 13.912  18.847  1.791   1.00 40.46  ? 2147 HOH A O   1 
HETATM 8627 O O   . HOH N 7 .   ? 14.012  22.469  1.257   1.00 43.72  ? 2148 HOH A O   1 
HETATM 8628 O O   . HOH N 7 .   ? 19.869  18.184  2.532   1.00 46.43  ? 2149 HOH A O   1 
HETATM 8629 O O   . HOH N 7 .   ? 29.355  27.537  -6.235  1.00 43.17  ? 2150 HOH A O   1 
HETATM 8630 O O   . HOH N 7 .   ? 29.970  32.772  -1.183  1.00 46.57  ? 2151 HOH A O   1 
HETATM 8631 O O   . HOH N 7 .   ? 20.464  33.405  10.560  1.00 41.53  ? 2152 HOH A O   1 
HETATM 8632 O O   . HOH N 7 .   ? 23.662  36.362  -2.422  1.00 55.98  ? 2153 HOH A O   1 
HETATM 8633 O O   . HOH N 7 .   ? 26.641  35.176  -1.120  1.00 65.80  ? 2154 HOH A O   1 
HETATM 8634 O O   . HOH N 7 .   ? 12.441  29.860  1.979   1.00 50.16  ? 2155 HOH A O   1 
HETATM 8635 O O   . HOH N 7 .   ? 23.815  33.931  -8.448  1.00 58.85  ? 2156 HOH A O   1 
HETATM 8636 O O   . HOH N 7 .   ? 25.204  20.346  -17.138 1.00 64.77  ? 2157 HOH A O   1 
HETATM 8637 O O   . HOH N 7 .   ? 25.469  29.505  -14.775 1.00 49.33  ? 2158 HOH A O   1 
HETATM 8638 O O   . HOH N 7 .   ? 30.438  19.283  -11.898 1.00 45.44  ? 2159 HOH A O   1 
HETATM 8639 O O   . HOH N 7 .   ? 34.442  23.781  -7.505  1.00 50.57  ? 2160 HOH A O   1 
HETATM 8640 O O   . HOH N 7 .   ? 34.971  16.317  -7.513  1.00 41.49  ? 2161 HOH A O   1 
HETATM 8641 O O   . HOH N 7 .   ? 39.243  12.865  -8.860  1.00 55.68  ? 2162 HOH A O   1 
HETATM 8642 O O   . HOH N 7 .   ? 36.353  10.458  -15.496 1.00 52.17  ? 2163 HOH A O   1 
HETATM 8643 O O   . HOH N 7 .   ? 20.220  7.739   -13.018 1.00 47.36  ? 2164 HOH A O   1 
HETATM 8644 O O   . HOH N 7 .   ? 17.671  21.717  -11.875 1.00 43.82  ? 2165 HOH A O   1 
HETATM 8645 O O   . HOH N 7 .   ? 6.037   23.947  -14.213 1.00 59.07  ? 2166 HOH A O   1 
HETATM 8646 O O   . HOH N 7 .   ? 13.775  30.240  -8.366  1.00 35.69  ? 2167 HOH A O   1 
HETATM 8647 O O   . HOH N 7 .   ? 16.620  18.309  -5.541  1.00 61.44  ? 2168 HOH A O   1 
HETATM 8648 O O   . HOH N 7 .   ? 16.838  19.942  -0.426  1.00 46.69  ? 2169 HOH A O   1 
HETATM 8649 O O   . HOH N 7 .   ? 17.589  23.526  1.037   1.00 57.29  ? 2170 HOH A O   1 
HETATM 8650 O O   . HOH N 7 .   ? 19.556  14.844  1.973   1.00 39.80  ? 2171 HOH A O   1 
HETATM 8651 O O   . HOH N 7 .   ? 26.513  6.148   0.561   1.00 46.87  ? 2172 HOH A O   1 
HETATM 8652 O O   . HOH N 7 .   ? 23.765  -2.454  -1.042  1.00 56.51  ? 2173 HOH A O   1 
HETATM 8653 O O   . HOH N 7 .   ? 26.748  -7.001  -2.094  1.00 56.38  ? 2174 HOH A O   1 
HETATM 8654 O O   . HOH N 7 .   ? 11.244  1.483   10.533  1.00 50.06  ? 2175 HOH A O   1 
HETATM 8655 O O   . HOH N 7 .   ? 11.131  14.268  3.426   1.00 55.84  ? 2176 HOH A O   1 
HETATM 8656 O O   . HOH N 7 .   ? 14.168  21.766  14.640  1.00 40.95  ? 2177 HOH A O   1 
HETATM 8657 O O   . HOH N 7 .   ? 12.156  29.032  12.298  1.00 58.97  ? 2178 HOH A O   1 
HETATM 8658 O O   . HOH N 7 .   ? 8.672   29.270  19.816  1.00 56.40  ? 2179 HOH A O   1 
HETATM 8659 O O   . HOH N 7 .   ? 16.268  26.055  17.970  1.00 47.02  ? 2180 HOH A O   1 
HETATM 8660 O O   . HOH N 7 .   ? 14.195  32.075  10.816  1.00 70.99  ? 2181 HOH A O   1 
HETATM 8661 O O   . HOH N 7 .   ? 14.654  32.706  6.930   1.00 53.76  ? 2182 HOH A O   1 
HETATM 8662 O O   . HOH N 7 .   ? 12.022  25.671  6.277   1.00 52.18  ? 2183 HOH A O   1 
HETATM 8663 O O   . HOH N 7 .   ? 12.979  24.524  2.289   1.00 43.34  ? 2184 HOH A O   1 
HETATM 8664 O O   . HOH N 7 .   ? 19.335  20.549  18.386  1.00 36.54  ? 2185 HOH A O   1 
HETATM 8665 O O   . HOH N 7 .   ? 10.476  26.027  25.861  1.00 48.70  ? 2186 HOH A O   1 
HETATM 8666 O O   . HOH N 7 .   ? 4.767   24.326  17.295  1.00 48.25  ? 2187 HOH A O   1 
HETATM 8667 O O   . HOH N 7 .   ? 2.964   18.342  19.098  1.00 58.35  ? 2188 HOH A O   1 
HETATM 8668 O O   . HOH N 7 .   ? 2.956   15.712  18.795  1.00 49.68  ? 2189 HOH A O   1 
HETATM 8669 O O   . HOH N 7 .   ? 5.366   11.832  14.088  1.00 55.22  ? 2190 HOH A O   1 
HETATM 8670 O O   . HOH N 7 .   ? 0.420   12.776  18.505  1.00 62.77  ? 2191 HOH A O   1 
HETATM 8671 O O   . HOH N 7 .   ? 3.063   7.199   18.419  1.00 45.65  ? 2192 HOH A O   1 
HETATM 8672 O O   . HOH N 7 .   ? 9.341   -2.258  6.647   1.00 51.03  ? 2193 HOH A O   1 
HETATM 8673 O O   . HOH N 7 .   ? 14.953  1.831   1.540   1.00 57.23  ? 2194 HOH A O   1 
HETATM 8674 O O   . HOH N 7 .   ? 3.512   1.125   5.047   1.00 44.41  ? 2195 HOH A O   1 
HETATM 8675 O O   . HOH N 7 .   ? 9.368   7.167   1.135   1.00 44.08  ? 2196 HOH A O   1 
HETATM 8676 O O   . HOH N 7 .   ? 9.980   11.211  3.430   1.00 39.40  ? 2197 HOH A O   1 
HETATM 8677 O O   . HOH N 7 .   ? 12.514  9.656   0.971   1.00 65.11  ? 2198 HOH A O   1 
HETATM 8678 O O   . HOH N 7 .   ? 3.831   12.742  11.257  1.00 30.45  ? 2199 HOH A O   1 
HETATM 8679 O O   . HOH N 7 .   ? 5.228   19.005  12.018  1.00 58.69  ? 2200 HOH A O   1 
HETATM 8680 O O   . HOH N 7 .   ? 1.525   8.846   17.053  1.00 60.86  ? 2201 HOH A O   1 
HETATM 8681 O O   . HOH N 7 .   ? 0.645   6.259   8.245   1.00 60.13  ? 2202 HOH A O   1 
HETATM 8682 O O   . HOH N 7 .   ? 5.871   5.949   0.940   1.00 53.06  ? 2203 HOH A O   1 
HETATM 8683 O O   . HOH N 7 .   ? 14.311  9.701   3.166   1.00 46.14  ? 2204 HOH A O   1 
HETATM 8684 O O   . HOH N 7 .   ? 14.558  8.357   -4.505  1.00 50.13  ? 2205 HOH A O   1 
HETATM 8685 O O   . HOH N 7 .   ? 14.282  13.490  3.380   1.00 60.66  ? 2206 HOH A O   1 
HETATM 8686 O O   . HOH N 7 .   ? 13.735  40.932  26.282  1.00 73.92  ? 2207 HOH A O   1 
HETATM 8687 O O   . HOH N 7 .   ? 10.124  39.601  24.115  1.00 63.86  ? 2208 HOH A O   1 
HETATM 8688 O O   . HOH N 7 .   ? 8.882   2.433   -16.569 1.00 58.94  ? 2209 HOH A O   1 
HETATM 8689 O O   . HOH O 7 .   ? -14.931 -0.210  -55.990 1.00 70.42  ? 2001 HOH B O   1 
HETATM 8690 O O   . HOH O 7 .   ? -0.598  7.554   -73.103 1.00 36.33  ? 2002 HOH B O   1 
HETATM 8691 O O   . HOH O 7 .   ? -15.097 0.860   -52.914 1.00 65.24  ? 2003 HOH B O   1 
HETATM 8692 O O   . HOH O 7 .   ? -4.799  -9.197  -47.917 1.00 55.11  ? 2004 HOH B O   1 
HETATM 8693 O O   . HOH O 7 .   ? -2.865  -0.436  -61.348 1.00 52.33  ? 2005 HOH B O   1 
HETATM 8694 O O   . HOH O 7 .   ? 0.441   0.376   -55.985 1.00 47.17  ? 2006 HOH B O   1 
HETATM 8695 O O   . HOH O 7 .   ? 4.901   8.959   -64.382 1.00 34.47  ? 2007 HOH B O   1 
HETATM 8696 O O   . HOH O 7 .   ? 9.287   9.917   -62.883 1.00 47.66  ? 2008 HOH B O   1 
HETATM 8697 O O   . HOH O 7 .   ? 7.871   1.152   -61.974 1.00 39.09  ? 2009 HOH B O   1 
HETATM 8698 O O   . HOH O 7 .   ? 15.595  2.309   -61.888 1.00 46.00  ? 2010 HOH B O   1 
HETATM 8699 O O   . HOH O 7 .   ? 12.099  -0.414  -68.165 1.00 43.44  ? 2011 HOH B O   1 
HETATM 8700 O O   . HOH O 7 .   ? 9.188   1.409   -68.439 1.00 43.01  ? 2012 HOH B O   1 
HETATM 8701 O O   . HOH O 7 .   ? 16.959  -3.797  -66.032 1.00 44.15  ? 2013 HOH B O   1 
HETATM 8702 O O   . HOH O 7 .   ? 16.959  -8.184  -60.106 1.00 58.69  ? 2014 HOH B O   1 
HETATM 8703 O O   . HOH O 7 .   ? 19.901  -6.776  -66.721 1.00 57.12  ? 2015 HOH B O   1 
HETATM 8704 O O   . HOH O 7 .   ? 19.731  -3.877  -67.589 1.00 53.13  ? 2016 HOH B O   1 
HETATM 8705 O O   . HOH O 7 .   ? 17.659  -2.934  -55.951 1.00 46.62  ? 2017 HOH B O   1 
HETATM 8706 O O   . HOH O 7 .   ? -10.227 -2.287  -43.976 1.00 51.37  ? 2018 HOH B O   1 
HETATM 8707 O O   . HOH O 7 .   ? 16.430  10.858  -61.339 1.00 56.03  ? 2019 HOH B O   1 
HETATM 8708 O O   . HOH O 7 .   ? 16.282  0.176   -66.137 1.00 63.53  ? 2020 HOH B O   1 
HETATM 8709 O O   . HOH O 7 .   ? 18.350  8.388   -65.210 1.00 63.34  ? 2021 HOH B O   1 
HETATM 8710 O O   . HOH O 7 .   ? -7.117  23.898  -47.849 1.00 51.35  ? 2022 HOH B O   1 
HETATM 8711 O O   . HOH O 7 .   ? 7.241   9.126   -65.202 1.00 54.49  ? 2023 HOH B O   1 
HETATM 8712 O O   . HOH O 7 .   ? 4.716   2.041   -69.578 1.00 52.10  ? 2024 HOH B O   1 
HETATM 8713 O O   . HOH O 7 .   ? 6.091   2.044   -72.160 1.00 53.40  ? 2025 HOH B O   1 
HETATM 8714 O O   . HOH O 7 .   ? -0.181  6.874   -77.252 1.00 57.59  ? 2026 HOH B O   1 
HETATM 8715 O O   . HOH O 7 .   ? -4.968  -0.965  -70.502 1.00 48.39  ? 2027 HOH B O   1 
HETATM 8716 O O   . HOH O 7 .   ? -2.787  -0.495  -68.951 1.00 46.70  ? 2028 HOH B O   1 
HETATM 8717 O O   . HOH O 7 .   ? -21.117 -10.153 -33.957 1.00 74.15  ? 2029 HOH B O   1 
HETATM 8718 O O   . HOH O 7 .   ? -3.885  -5.093  -56.799 1.00 53.47  ? 2030 HOH B O   1 
HETATM 8719 O O   . HOH O 7 .   ? -5.999  -3.536  -55.741 1.00 45.96  ? 2031 HOH B O   1 
HETATM 8720 O O   . HOH O 7 .   ? -1.679  -3.683  -60.627 1.00 58.96  ? 2032 HOH B O   1 
HETATM 8721 O O   . HOH O 7 .   ? 1.578   -2.721  -52.886 1.00 50.00  ? 2033 HOH B O   1 
HETATM 8722 O O   . HOH O 7 .   ? 5.151   -5.618  -60.861 1.00 69.55  ? 2034 HOH B O   1 
HETATM 8723 O O   . HOH O 7 .   ? 6.726   -2.367  -50.740 1.00 52.65  ? 2035 HOH B O   1 
HETATM 8724 O O   . HOH O 7 .   ? 12.713  -4.077  -51.478 1.00 43.95  ? 2036 HOH B O   1 
HETATM 8725 O O   . HOH O 7 .   ? 14.305  -7.129  -48.576 1.00 49.89  ? 2037 HOH B O   1 
HETATM 8726 O O   . HOH O 7 .   ? 9.812   -13.389 -48.482 1.00 44.28  ? 2038 HOH B O   1 
HETATM 8727 O O   . HOH O 7 .   ? 13.231  -7.676  -46.016 1.00 50.48  ? 2039 HOH B O   1 
HETATM 8728 O O   . HOH O 7 .   ? 10.522  -14.191 -45.824 1.00 49.56  ? 2040 HOH B O   1 
HETATM 8729 O O   . HOH O 7 .   ? 5.062   -19.849 -36.808 1.00 65.32  ? 2041 HOH B O   1 
HETATM 8730 O O   . HOH O 7 .   ? 8.703   -17.383 -37.092 1.00 61.30  ? 2042 HOH B O   1 
HETATM 8731 O O   . HOH O 7 .   ? -2.033  -6.828  -44.743 1.00 40.85  ? 2043 HOH B O   1 
HETATM 8732 O O   . HOH O 7 .   ? -2.332  -10.559 -45.420 1.00 62.37  ? 2044 HOH B O   1 
HETATM 8733 O O   . HOH O 7 .   ? -2.772  -14.174 -44.848 1.00 59.33  ? 2045 HOH B O   1 
HETATM 8734 O O   . HOH O 7 .   ? -3.141  -3.333  -43.251 1.00 57.23  ? 2046 HOH B O   1 
HETATM 8735 O O   . HOH O 7 .   ? 6.332   -7.227  -40.980 1.00 60.68  ? 2047 HOH B O   1 
HETATM 8736 O O   . HOH O 7 .   ? 33.187  5.422   -47.964 1.00 57.07  ? 2048 HOH B O   1 
HETATM 8737 O O   . HOH O 7 .   ? -3.703  -4.907  -45.561 1.00 53.31  ? 2049 HOH B O   1 
HETATM 8738 O O   . HOH O 7 .   ? -5.486  -6.140  -47.471 1.00 40.07  ? 2050 HOH B O   1 
HETATM 8739 O O   . HOH O 7 .   ? 3.011   -11.294 -50.921 1.00 55.29  ? 2051 HOH B O   1 
HETATM 8740 O O   . HOH O 7 .   ? 4.618   -12.662 -53.449 1.00 60.57  ? 2052 HOH B O   1 
HETATM 8741 O O   . HOH O 7 .   ? 8.870   -0.928  -60.514 1.00 47.39  ? 2053 HOH B O   1 
HETATM 8742 O O   . HOH O 7 .   ? 10.138  -6.477  -64.143 1.00 42.28  ? 2054 HOH B O   1 
HETATM 8743 O O   . HOH O 7 .   ? 1.665   0.036   -53.212 1.00 35.43  ? 2055 HOH B O   1 
HETATM 8744 O O   . HOH O 7 .   ? 13.469  -11.589 -36.887 1.00 71.60  ? 2056 HOH B O   1 
HETATM 8745 O O   . HOH O 7 .   ? 25.821  10.747  -29.497 1.00 46.97  ? 2057 HOH B O   1 
HETATM 8746 O O   . HOH O 7 .   ? -3.463  24.354  -51.564 1.00 39.45  ? 2058 HOH B O   1 
HETATM 8747 O O   . HOH O 7 .   ? 0.415   20.104  -47.587 1.00 34.36  ? 2059 HOH B O   1 
HETATM 8748 O O   . HOH O 7 .   ? 4.513   4.884   -48.520 1.00 36.14  ? 2060 HOH B O   1 
HETATM 8749 O O   . HOH O 7 .   ? 4.271   2.581   -40.853 1.00 39.95  ? 2061 HOH B O   1 
HETATM 8750 O O   . HOH O 7 .   ? 4.686   -0.499  -43.622 1.00 46.87  ? 2062 HOH B O   1 
HETATM 8751 O O   . HOH O 7 .   ? 10.638  0.488   -43.963 1.00 38.09  ? 2063 HOH B O   1 
HETATM 8752 O O   . HOH O 7 .   ? -3.198  1.288   -48.334 1.00 47.44  ? 2064 HOH B O   1 
HETATM 8753 O O   . HOH O 7 .   ? -0.965  4.291   -48.932 1.00 46.91  ? 2065 HOH B O   1 
HETATM 8754 O O   . HOH O 7 .   ? -5.605  -0.966  -48.894 1.00 50.95  ? 2066 HOH B O   1 
HETATM 8755 O O   . HOH O 7 .   ? -8.953  0.312   -45.304 1.00 64.33  ? 2067 HOH B O   1 
HETATM 8756 O O   . HOH O 7 .   ? -7.898  7.754   -45.198 1.00 60.70  ? 2068 HOH B O   1 
HETATM 8757 O O   . HOH O 7 .   ? -11.419 -1.916  -47.606 1.00 69.41  ? 2069 HOH B O   1 
HETATM 8758 O O   . HOH O 7 .   ? -12.853 -1.570  -51.979 1.00 57.19  ? 2070 HOH B O   1 
HETATM 8759 O O   . HOH O 7 .   ? -8.616  20.817  -47.827 1.00 67.11  ? 2071 HOH B O   1 
HETATM 8760 O O   . HOH O 7 .   ? 16.760  -8.144  -48.497 1.00 53.62  ? 2072 HOH B O   1 
HETATM 8761 O O   . HOH O 7 .   ? 23.040  -0.693  -45.104 1.00 47.29  ? 2073 HOH B O   1 
HETATM 8762 O O   . HOH O 7 .   ? 21.838  2.413   -47.977 1.00 44.58  ? 2074 HOH B O   1 
HETATM 8763 O O   . HOH O 7 .   ? 29.773  6.733   -49.757 1.00 66.30  ? 2075 HOH B O   1 
HETATM 8764 O O   . HOH O 7 .   ? 33.254  1.205   -58.116 1.00 52.14  ? 2076 HOH B O   1 
HETATM 8765 O O   . HOH O 7 .   ? 25.482  5.446   -58.346 1.00 49.81  ? 2077 HOH B O   1 
HETATM 8766 O O   . HOH O 7 .   ? -20.146 -8.311  -35.976 1.00 58.83  ? 2078 HOH B O   1 
HETATM 8767 O O   . HOH O 7 .   ? -16.955 -8.505  -39.295 1.00 62.29  ? 2079 HOH B O   1 
HETATM 8768 O O   . HOH O 7 .   ? 18.763  12.673  -55.327 1.00 51.20  ? 2080 HOH B O   1 
HETATM 8769 O O   . HOH O 7 .   ? 21.390  13.071  -52.223 1.00 50.09  ? 2081 HOH B O   1 
HETATM 8770 O O   . HOH O 7 .   ? 11.231  17.496  -59.469 1.00 60.96  ? 2082 HOH B O   1 
HETATM 8771 O O   . HOH O 7 .   ? 1.824   19.630  -60.337 1.00 46.92  ? 2083 HOH B O   1 
HETATM 8772 O O   . HOH O 7 .   ? 3.041   16.765  -16.821 1.00 57.63  ? 2084 HOH B O   1 
HETATM 8773 O O   . HOH O 7 .   ? 9.305   12.383  -61.971 1.00 71.22  ? 2085 HOH B O   1 
HETATM 8774 O O   . HOH O 7 .   ? 11.785  13.247  -62.593 1.00 70.04  ? 2086 HOH B O   1 
HETATM 8775 O O   . HOH O 7 .   ? 0.983   17.683  -65.722 1.00 49.92  ? 2087 HOH B O   1 
HETATM 8776 O O   . HOH O 7 .   ? 2.762   25.395  -48.369 1.00 43.01  ? 2088 HOH B O   1 
HETATM 8777 O O   . HOH O 7 .   ? 0.235   26.733  -48.612 1.00 47.38  ? 2089 HOH B O   1 
HETATM 8778 O O   . HOH O 7 .   ? 3.715   4.372   -33.851 1.00 33.78  ? 2090 HOH B O   1 
HETATM 8779 O O   . HOH O 7 .   ? 22.862  15.673  -46.024 1.00 59.66  ? 2091 HOH B O   1 
HETATM 8780 O O   . HOH O 7 .   ? 22.126  17.650  -48.206 1.00 50.48  ? 2092 HOH B O   1 
HETATM 8781 O O   . HOH O 7 .   ? 10.090  23.980  -49.540 1.00 73.04  ? 2093 HOH B O   1 
HETATM 8782 O O   . HOH O 7 .   ? 2.972   28.201  -43.899 1.00 64.70  ? 2094 HOH B O   1 
HETATM 8783 O O   . HOH O 7 .   ? 3.580   8.077   -33.192 1.00 40.22  ? 2095 HOH B O   1 
HETATM 8784 O O   . HOH O 7 .   ? 13.757  6.657   -33.455 1.00 36.36  ? 2096 HOH B O   1 
HETATM 8785 O O   . HOH O 7 .   ? 17.302  5.248   -34.961 1.00 37.60  ? 2097 HOH B O   1 
HETATM 8786 O O   . HOH O 7 .   ? 19.840  11.210  -30.508 1.00 59.18  ? 2098 HOH B O   1 
HETATM 8787 O O   . HOH O 7 .   ? 24.367  5.744   -35.040 1.00 57.62  ? 2099 HOH B O   1 
HETATM 8788 O O   . HOH O 7 .   ? 22.290  0.281   -36.620 1.00 43.69  ? 2100 HOH B O   1 
HETATM 8789 O O   . HOH O 7 .   ? 25.368  3.425   -33.696 1.00 52.17  ? 2101 HOH B O   1 
HETATM 8790 O O   . HOH O 7 .   ? 19.188  -0.800  -37.556 1.00 54.78  ? 2102 HOH B O   1 
HETATM 8791 O O   . HOH O 7 .   ? 29.514  7.506   -40.429 1.00 54.75  ? 2103 HOH B O   1 
HETATM 8792 O O   . HOH O 7 .   ? 27.159  1.948   -37.371 1.00 50.86  ? 2104 HOH B O   1 
HETATM 8793 O O   . HOH O 7 .   ? 30.360  1.267   -36.504 1.00 58.91  ? 2105 HOH B O   1 
HETATM 8794 O O   . HOH O 7 .   ? 32.627  -1.863  -38.847 1.00 42.89  ? 2106 HOH B O   1 
HETATM 8795 O O   . HOH O 7 .   ? 31.879  -1.993  -36.671 1.00 57.94  ? 2107 HOH B O   1 
HETATM 8796 O O   . HOH O 7 .   ? 33.455  1.881   -47.468 1.00 59.54  ? 2108 HOH B O   1 
HETATM 8797 O O   . HOH O 7 .   ? 27.660  -10.788 -38.064 1.00 60.21  ? 2109 HOH B O   1 
HETATM 8798 O O   . HOH O 7 .   ? 22.906  -18.511 -52.076 1.00 48.61  ? 2110 HOH B O   1 
HETATM 8799 O O   . HOH O 7 .   ? 38.224  -5.705  -61.945 1.00 65.63  ? 2111 HOH B O   1 
HETATM 8800 O O   . HOH O 7 .   ? 9.636   -17.499 -49.051 1.00 51.67  ? 2112 HOH B O   1 
HETATM 8801 O O   . HOH O 7 .   ? 16.906  -4.290  -43.203 1.00 37.83  ? 2113 HOH B O   1 
HETATM 8802 O O   . HOH O 7 .   ? 23.034  -13.488 -36.414 1.00 59.86  ? 2114 HOH B O   1 
HETATM 8803 O O   . HOH O 7 .   ? 23.384  -4.480  -33.741 1.00 46.67  ? 2115 HOH B O   1 
HETATM 8804 O O   . HOH O 7 .   ? 23.784  -8.145  -27.252 1.00 49.14  ? 2116 HOH B O   1 
HETATM 8805 O O   . HOH O 7 .   ? 16.612  -11.285 -30.674 1.00 66.48  ? 2117 HOH B O   1 
HETATM 8806 O O   . HOH O 7 .   ? 16.241  -6.534  -34.237 1.00 66.52  ? 2118 HOH B O   1 
HETATM 8807 O O   . HOH O 7 .   ? 15.979  -9.676  -34.762 1.00 63.57  ? 2119 HOH B O   1 
HETATM 8808 O O   . HOH O 7 .   ? 18.575  -10.835 -33.863 1.00 69.67  ? 2120 HOH B O   1 
HETATM 8809 O O   . HOH O 7 .   ? 17.110  -2.030  -28.544 1.00 45.27  ? 2121 HOH B O   1 
HETATM 8810 O O   . HOH O 7 .   ? 13.278  -6.386  -33.681 1.00 63.72  ? 2122 HOH B O   1 
HETATM 8811 O O   . HOH O 7 .   ? 30.499  9.837   -52.308 1.00 54.37  ? 2123 HOH B O   1 
HETATM 8812 O O   . HOH O 7 .   ? 22.531  9.686   -53.055 1.00 56.69  ? 2124 HOH B O   1 
HETATM 8813 O O   . HOH O 7 .   ? 25.419  13.145  -31.651 1.00 56.90  ? 2125 HOH B O   1 
HETATM 8814 O O   . HOH O 7 .   ? 16.450  28.070  -43.344 1.00 75.60  ? 2126 HOH B O   1 
HETATM 8815 O O   . HOH O 7 .   ? 6.842   4.515   -24.965 1.00 58.04  ? 2127 HOH B O   1 
HETATM 8816 O O   . HOH O 7 .   ? -3.083  0.873   -22.442 1.00 48.77  ? 2128 HOH B O   1 
HETATM 8817 O O   . HOH O 7 .   ? 0.953   -0.742  -19.759 1.00 62.07  ? 2129 HOH B O   1 
HETATM 8818 O O   . HOH O 7 .   ? 5.770   -1.522  -29.061 1.00 41.91  ? 2130 HOH B O   1 
HETATM 8819 O O   . HOH O 7 .   ? 5.095   -0.898  -22.176 1.00 57.88  ? 2131 HOH B O   1 
HETATM 8820 O O   . HOH O 7 .   ? 10.456  -13.686 -26.969 1.00 61.45  ? 2132 HOH B O   1 
HETATM 8821 O O   . HOH O 7 .   ? -2.627  -11.482 -28.451 1.00 58.70  ? 2133 HOH B O   1 
HETATM 8822 O O   . HOH O 7 .   ? 6.343   -17.870 -21.991 1.00 53.69  ? 2134 HOH B O   1 
HETATM 8823 O O   . HOH O 7 .   ? 28.790  -4.417  -27.019 1.00 63.03  ? 2135 HOH B O   1 
HETATM 8824 O O   . HOH O 7 .   ? 8.925   -12.617 -7.101  1.00 53.65  ? 2136 HOH B O   1 
HETATM 8825 O O   . HOH O 7 .   ? 8.257   -9.376  -5.697  1.00 51.24  ? 2137 HOH B O   1 
HETATM 8826 O O   . HOH O 7 .   ? 19.422  5.187   -27.016 1.00 32.60  ? 2138 HOH B O   1 
HETATM 8827 O O   . HOH O 7 .   ? 22.126  16.911  -26.339 1.00 54.05  ? 2139 HOH B O   1 
HETATM 8828 O O   . HOH O 7 .   ? 11.697  27.938  -32.782 1.00 50.57  ? 2140 HOH B O   1 
HETATM 8829 O O   . HOH O 7 .   ? 8.626   24.773  -31.671 1.00 42.21  ? 2141 HOH B O   1 
HETATM 8830 O O   . HOH O 7 .   ? 0.202   27.638  -32.316 1.00 44.75  ? 2142 HOH B O   1 
HETATM 8831 O O   . HOH O 7 .   ? 3.770   20.244  -28.594 1.00 39.49  ? 2143 HOH B O   1 
HETATM 8832 O O   . HOH O 7 .   ? -5.117  -5.942  -34.157 1.00 68.79  ? 2144 HOH B O   1 
HETATM 8833 O O   . HOH O 7 .   ? -4.044  -9.409  -22.825 1.00 58.09  ? 2145 HOH B O   1 
HETATM 8834 O O   . HOH O 7 .   ? -2.483  1.397   -36.875 1.00 51.71  ? 2146 HOH B O   1 
HETATM 8835 O O   . HOH O 7 .   ? -5.437  -3.021  -35.122 1.00 54.60  ? 2147 HOH B O   1 
HETATM 8836 O O   . HOH O 7 .   ? -15.169 0.870   -37.002 1.00 48.83  ? 2148 HOH B O   1 
HETATM 8837 O O   . HOH O 7 .   ? -18.016 -7.959  -36.984 1.00 62.65  ? 2149 HOH B O   1 
HETATM 8838 O O   . HOH O 7 .   ? -9.204  18.892  -34.484 1.00 62.65  ? 2150 HOH B O   1 
HETATM 8839 O O   . HOH O 7 .   ? -9.235  18.576  -27.433 1.00 62.20  ? 2151 HOH B O   1 
HETATM 8840 O O   . HOH O 7 .   ? -4.737  25.735  -38.073 1.00 66.49  ? 2152 HOH B O   1 
HETATM 8841 O O   . HOH O 7 .   ? -9.876  26.820  -25.966 1.00 50.85  ? 2153 HOH B O   1 
HETATM 8842 O O   . HOH O 7 .   ? -1.358  27.195  -29.496 1.00 40.09  ? 2154 HOH B O   1 
HETATM 8843 O O   . HOH O 7 .   ? 6.490   24.738  -24.930 1.00 49.89  ? 2155 HOH B O   1 
HETATM 8844 O O   . HOH O 7 .   ? 10.948  17.614  -22.857 1.00 45.20  ? 2156 HOH B O   1 
HETATM 8845 O O   . HOH O 7 .   ? 12.259  26.895  -27.887 1.00 55.55  ? 2157 HOH B O   1 
HETATM 8846 O O   . HOH O 7 .   ? 11.839  28.513  -25.380 1.00 40.73  ? 2158 HOH B O   1 
HETATM 8847 O O   . HOH O 7 .   ? 5.358   14.881  -18.665 1.00 39.86  ? 2159 HOH B O   1 
HETATM 8848 O O   . HOH O 7 .   ? -6.025  14.872  -23.130 1.00 49.69  ? 2160 HOH B O   1 
HETATM 8849 O O   . HOH O 7 .   ? -5.448  13.263  -20.489 1.00 49.64  ? 2161 HOH B O   1 
HETATM 8850 O O   . HOH O 7 .   ? -8.748  7.671   -24.033 1.00 50.28  ? 2162 HOH B O   1 
HETATM 8851 O O   . HOH O 7 .   ? -8.178  16.072  -20.583 1.00 49.15  ? 2163 HOH B O   1 
HETATM 8852 O O   . HOH O 7 .   ? -0.701  17.874  -17.066 1.00 54.69  ? 2164 HOH B O   1 
HETATM 8853 O O   . HOH O 7 .   ? -4.084  22.392  -20.652 1.00 50.47  ? 2165 HOH B O   1 
HETATM 8854 O O   . HOH O 7 .   ? 2.278   20.180  -16.629 1.00 49.43  ? 2166 HOH B O   1 
HETATM 8855 O O   . HOH O 7 .   ? 4.912   19.342  -15.501 1.00 69.98  ? 2167 HOH B O   1 
HETATM 8856 O O   . HOH O 7 .   ? 5.917   21.244  -14.400 1.00 65.30  ? 2168 HOH B O   1 
HETATM 8857 O O   . HOH O 7 .   ? 12.704  15.492  -22.941 1.00 41.28  ? 2169 HOH B O   1 
HETATM 8858 O O   . HOH O 7 .   ? 15.724  16.797  -21.308 1.00 44.47  ? 2170 HOH B O   1 
HETATM 8859 O O   . HOH O 7 .   ? 18.775  8.014   -27.553 1.00 30.22  ? 2171 HOH B O   1 
HETATM 8860 O O   . HOH O 7 .   ? 24.555  17.895  -20.775 1.00 57.37  ? 2172 HOH B O   1 
HETATM 8861 O O   . HOH O 7 .   ? -19.130 1.977   -47.617 1.00 53.15  ? 2173 HOH B O   1 
HETATM 8862 O O   . HOH O 7 .   ? 44.797  7.784   -4.706  1.00 59.12  ? 2174 HOH B O   1 
HETATM 8863 O O   . HOH O 7 .   ? -13.977 8.146   -22.282 1.00 58.42  ? 2175 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.4688 1.2837 0.9943 0.0800  -0.0739 -0.0806 1   GLU A N   
2    C CA  . GLU A 1   ? 1.3760 1.1603 0.8954 0.0834  -0.0512 -0.0739 1   GLU A CA  
3    C C   . GLU A 1   ? 1.4149 1.1940 0.8991 0.0955  -0.0395 -0.0753 1   GLU A C   
4    O O   . GLU A 1   ? 1.5457 1.3439 1.0089 0.1009  -0.0500 -0.0805 1   GLU A O   
5    C CB  . GLU A 1   ? 1.3247 1.0995 0.8512 0.0885  -0.0386 -0.0486 1   GLU A CB  
6    C CG  . GLU A 1   ? 1.2791 1.0578 0.7825 0.1045  -0.0314 -0.0290 1   GLU A CG  
7    C CD  . GLU A 1   ? 1.1774 0.9418 0.6905 0.1053  -0.0166 -0.0060 1   GLU A CD  
8    O OE1 . GLU A 1   ? 1.1264 0.8945 0.6601 0.0995  -0.0257 -0.0030 1   GLU A OE1 
9    O OE2 . GLU A 1   ? 1.1675 0.9174 0.6690 0.1102  0.0051  0.0084  1   GLU A OE2 
10   N N   . GLY A 2   ? 1.3875 1.1443 0.8651 0.1002  -0.0173 -0.0696 2   GLY A N   
11   C CA  . GLY A 2   ? 1.2382 0.9901 0.6840 0.1131  -0.0028 -0.0682 2   GLY A CA  
12   C C   . GLY A 2   ? 1.1237 0.8548 0.5684 0.1138  0.0154  -0.0774 2   GLY A C   
13   O O   . GLY A 2   ? 0.9739 0.6987 0.4015 0.1255  0.0357  -0.0675 2   GLY A O   
14   N N   . ARG A 3   ? 1.2497 0.9702 0.7148 0.1022  0.0099  -0.0949 3   ARG A N   
15   C CA  . ARG A 3   ? 1.2071 0.9050 0.6735 0.1055  0.0287  -0.1033 3   ARG A CA  
16   C C   . ARG A 3   ? 1.1874 0.8743 0.6869 0.0995  0.0368  -0.0959 3   ARG A C   
17   O O   . ARG A 3   ? 1.2904 0.9602 0.7967 0.1046  0.0546  -0.0986 3   ARG A O   
18   C CB  . ARG A 3   ? 1.0963 0.7850 0.5511 0.0997  0.0208  -0.1333 3   ARG A CB  
19   N N   . GLU A 4   ? 1.0479 0.7462 0.5675 0.0902  0.0251  -0.0854 4   GLU A N   
20   C CA  . GLU A 4   ? 0.9857 0.6849 0.5445 0.0818  0.0307  -0.0753 4   GLU A CA  
21   C C   . GLU A 4   ? 0.7904 0.5033 0.3644 0.0868  0.0529  -0.0495 4   GLU A C   
22   O O   . GLU A 4   ? 0.7983 0.5095 0.3423 0.0986  0.0669  -0.0418 4   GLU A O   
23   C CB  . GLU A 4   ? 1.2042 0.9204 0.7896 0.0672  0.0087  -0.0723 4   GLU A CB  
24   C CG  . GLU A 4   ? 1.2957 1.0083 0.8770 0.0581  -0.0142 -0.0959 4   GLU A CG  
25   C CD  . GLU A 4   ? 1.4758 1.2112 1.0726 0.0499  -0.0349 -0.0905 4   GLU A CD  
26   O OE1 . GLU A 4   ? 1.5037 1.2518 1.0819 0.0585  -0.0383 -0.0796 4   GLU A OE1 
27   O OE2 . GLU A 4   ? 1.5812 1.3243 1.2137 0.0361  -0.0453 -0.0944 4   GLU A OE2 
28   N N   . ASP A 5   ? 0.7162 0.4461 0.3372 0.0765  0.0561  -0.0364 5   ASP A N   
29   C CA  . ASP A 5   ? 0.8026 0.5541 0.4444 0.0749  0.0735  -0.0135 5   ASP A CA  
30   C C   . ASP A 5   ? 0.9670 0.7254 0.6056 0.0658  0.0667  -0.0024 5   ASP A C   
31   O O   . ASP A 5   ? 0.9916 0.7555 0.6497 0.0541  0.0506  -0.0038 5   ASP A O   
32   C CB  . ASP A 5   ? 0.7279 0.5004 0.4192 0.0668  0.0770  -0.0051 5   ASP A CB  
33   C CG  . ASP A 5   ? 0.8668 0.6700 0.5823 0.0633  0.0948  0.0160  5   ASP A CG  
34   O OD1 . ASP A 5   ? 0.9221 0.7280 0.6229 0.0602  0.1018  0.0251  5   ASP A OD1 
35   O OD2 . ASP A 5   ? 0.9367 0.7634 0.6871 0.0632  0.1021  0.0244  5   ASP A OD2 
36   N N   . PRO A 6   ? 0.9448 0.7005 0.5581 0.0724  0.0814  0.0095  6   PRO A N   
37   C CA  . PRO A 6   ? 0.9730 0.7260 0.5794 0.0660  0.0787  0.0212  6   PRO A CA  
38   C C   . PRO A 6   ? 0.9372 0.7073 0.5866 0.0462  0.0815  0.0318  6   PRO A C   
39   O O   . PRO A 6   ? 1.0538 0.8167 0.7008 0.0386  0.0822  0.0405  6   PRO A O   
40   C CB  . PRO A 6   ? 1.0433 0.7885 0.6163 0.0772  0.1003  0.0343  6   PRO A CB  
41   C CG  . PRO A 6   ? 0.9359 0.6936 0.5199 0.0824  0.1182  0.0351  6   PRO A CG  
42   C CD  . PRO A 6   ? 0.8482 0.6022 0.4396 0.0864  0.1043  0.0152  6   PRO A CD  
43   N N   . GLN A 7   ? 0.8047 0.5967 0.4911 0.0387  0.0836  0.0310  7   GLN A N   
44   C CA  A GLN A 7   ? 0.8105 0.6269 0.5364 0.0193  0.0861  0.0398  7   GLN A CA  
45   C CA  B GLN A 7   ? 0.8087 0.6249 0.5345 0.0191  0.0860  0.0398  7   GLN A CA  
46   C C   . GLN A 7   ? 0.7966 0.6211 0.5484 0.0105  0.0665  0.0311  7   GLN A C   
47   O O   . GLN A 7   ? 0.9006 0.7476 0.6833 -0.0052 0.0656  0.0355  7   GLN A O   
48   C CB  A GLN A 7   ? 0.7978 0.6449 0.5481 0.0181  0.1046  0.0500  7   GLN A CB  
49   C CB  B GLN A 7   ? 0.7831 0.6308 0.5345 0.0169  0.1044  0.0504  7   GLN A CB  
50   C CG  A GLN A 7   ? 0.8129 0.6580 0.5442 0.0210  0.1270  0.0623  7   GLN A CG  
51   C CG  B GLN A 7   ? 0.6679 0.5528 0.4635 -0.0038 0.1036  0.0567  7   GLN A CG  
52   C CD  A GLN A 7   ? 0.7766 0.6511 0.5238 0.0293  0.1464  0.0712  7   GLN A CD  
53   C CD  B GLN A 7   ? 0.5761 0.4568 0.3733 -0.0253 0.1060  0.0605  7   GLN A CD  
54   O OE1 A GLN A 7   ? 0.7426 0.6210 0.4942 0.0446  0.1454  0.0656  7   GLN A OE1 
55   O OE1 B GLN A 7   ? 0.5951 0.4848 0.4115 -0.0408 0.0948  0.0560  7   GLN A OE1 
56   N NE2 A GLN A 7   ? 0.6496 0.5438 0.4057 0.0196  0.1662  0.0859  7   GLN A NE2 
57   N NE2 B GLN A 7   ? 0.4868 0.3518 0.2628 -0.0262 0.1227  0.0689  7   GLN A NE2 
58   N N   . LEU A 8   ? 0.8123 0.6203 0.5504 0.0196  0.0512  0.0182  8   LEU A N   
59   C CA  . LEU A 8   ? 0.7324 0.5471 0.4938 0.0125  0.0340  0.0105  8   LEU A CA  
60   C C   . LEU A 8   ? 0.8157 0.6148 0.5588 0.0137  0.0174  0.0028  8   LEU A C   
61   O O   . LEU A 8   ? 0.8188 0.6217 0.5759 0.0101  0.0021  -0.0055 8   LEU A O   
62   C CB  . LEU A 8   ? 0.6249 0.4371 0.3937 0.0205  0.0323  0.0020  8   LEU A CB  
63   C CG  . LEU A 8   ? 0.5614 0.3929 0.3518 0.0243  0.0494  0.0124  8   LEU A CG  
64   C CD1 . LEU A 8   ? 0.7031 0.5167 0.4861 0.0383  0.0539  0.0038  8   LEU A CD1 
65   C CD2 . LEU A 8   ? 0.6335 0.4972 0.4641 0.0118  0.0460  0.0217  8   LEU A CD2 
66   N N   . LEU A 9   ? 0.7564 0.5404 0.4692 0.0201  0.0217  0.0077  9   LEU A N   
67   C CA  . LEU A 9   ? 0.7466 0.5203 0.4403 0.0260  0.0077  0.0045  9   LEU A CA  
68   C C   . LEU A 9   ? 0.7496 0.5160 0.4443 0.0203  0.0150  0.0165  9   LEU A C   
69   O O   . LEU A 9   ? 0.7509 0.5039 0.4284 0.0219  0.0318  0.0277  9   LEU A O   
70   C CB  . LEU A 9   ? 0.7131 0.4737 0.3638 0.0432  0.0053  0.0004  9   LEU A CB  
71   C CG  . LEU A 9   ? 0.8058 0.5649 0.4454 0.0489  0.0017  -0.0151 9   LEU A CG  
72   C CD1 . LEU A 9   ? 0.7977 0.5454 0.3879 0.0657  0.0026  -0.0183 9   LEU A CD1 
73   C CD2 . LEU A 9   ? 0.8341 0.6009 0.4932 0.0417  -0.0180 -0.0314 9   LEU A CD2 
74   N N   . VAL A 10  ? 0.7689 0.5415 0.4833 0.0134  0.0044  0.0138  10  VAL A N   
75   C CA  . VAL A 10  ? 0.7517 0.5119 0.4667 0.0080  0.0117  0.0217  10  VAL A CA  
76   C C   . VAL A 10  ? 0.8787 0.6360 0.5874 0.0190  -0.0025 0.0198  10  VAL A C   
77   O O   . VAL A 10  ? 0.7177 0.4932 0.4362 0.0226  -0.0203 0.0105  10  VAL A O   
78   C CB  . VAL A 10  ? 0.7763 0.5520 0.5252 -0.0131 0.0166  0.0201  10  VAL A CB  
79   C CG1 . VAL A 10  ? 0.7055 0.4671 0.4555 -0.0193 0.0198  0.0214  10  VAL A CG1 
80   C CG2 . VAL A 10  ? 0.8764 0.6585 0.6313 -0.0241 0.0339  0.0261  10  VAL A CG2 
81   N N   . ARG A 11  ? 0.7900 0.5242 0.4831 0.0246  0.0070  0.0294  11  ARG A N   
82   C CA  . ARG A 11  ? 0.6528 0.3860 0.3427 0.0377  -0.0030 0.0307  11  ARG A CA  
83   C C   . ARG A 11  ? 0.6832 0.4085 0.3918 0.0263  0.0038  0.0295  11  ARG A C   
84   O O   . ARG A 11  ? 0.8611 0.5656 0.5692 0.0124  0.0214  0.0320  11  ARG A O   
85   C CB  . ARG A 11  ? 0.7268 0.4370 0.3794 0.0606  0.0034  0.0448  11  ARG A CB  
86   C CG  . ARG A 11  ? 0.7951 0.5042 0.4456 0.0776  -0.0026 0.0502  11  ARG A CG  
87   C CD  . ARG A 11  ? 0.9015 0.5959 0.5142 0.1059  0.0013  0.0669  11  ARG A CD  
88   N NE  . ARG A 11  ? 0.8796 0.6046 0.4799 0.1163  -0.0161 0.0623  11  ARG A NE  
89   C CZ  . ARG A 11  ? 0.8929 0.6550 0.4994 0.1296  -0.0369 0.0582  11  ARG A CZ  
90   N NH1 . ARG A 11  ? 0.9135 0.6855 0.5347 0.1384  -0.0424 0.0619  11  ARG A NH1 
91   N NH2 . ARG A 11  ? 0.8580 0.6490 0.4577 0.1328  -0.0510 0.0497  11  ARG A NH2 
92   N N   . VAL A 12  ? 0.7165 0.4593 0.4407 0.0314  -0.0095 0.0246  12  VAL A N   
93   C CA  . VAL A 12  ? 0.7190 0.4545 0.4567 0.0242  -0.0032 0.0220  12  VAL A CA  
94   C C   . VAL A 12  ? 0.7876 0.5167 0.5145 0.0480  -0.0058 0.0290  12  VAL A C   
95   O O   . VAL A 12  ? 0.7471 0.4859 0.4597 0.0683  -0.0156 0.0357  12  VAL A O   
96   C CB  . VAL A 12  ? 0.6883 0.4576 0.4601 0.0079  -0.0141 0.0109  12  VAL A CB  
97   C CG1 . VAL A 12  ? 0.6249 0.4016 0.4087 -0.0134 -0.0079 0.0072  12  VAL A CG1 
98   C CG2 . VAL A 12  ? 0.7526 0.5538 0.5372 0.0162  -0.0344 0.0074  12  VAL A CG2 
99   N N   . ARG A 13  ? 0.6460 0.3617 0.3784 0.0472  0.0031  0.0273  13  ARG A N   
100  C CA  . ARG A 13  ? 0.6977 0.4081 0.4207 0.0739  0.0032  0.0361  13  ARG A CA  
101  C C   . ARG A 13  ? 0.7207 0.4813 0.4609 0.0872  -0.0209 0.0357  13  ARG A C   
102  O O   . ARG A 13  ? 0.6706 0.4394 0.4006 0.1133  -0.0255 0.0464  13  ARG A O   
103  C CB  . ARG A 13  ? 0.6339 0.3225 0.3609 0.0711  0.0176  0.0316  13  ARG A CB  
104  C CG  . ARG A 13  ? 0.7048 0.3912 0.4254 0.1021  0.0196  0.0416  13  ARG A CG  
105  C CD  . ARG A 13  ? 0.8225 0.4652 0.5084 0.1265  0.0358  0.0593  13  ARG A CD  
106  N NE  . ARG A 13  ? 0.8467 0.4877 0.5265 0.1607  0.0402  0.0719  13  ARG A NE  
107  C CZ  . ARG A 13  ? 0.9244 0.6133 0.6124 0.1856  0.0212  0.0818  13  ARG A CZ  
108  N NH1 . ARG A 13  ? 0.8416 0.5786 0.5425 0.1769  -0.0033 0.0771  13  ARG A NH1 
109  N NH2 . ARG A 13  ? 1.0207 0.7141 0.7068 0.2170  0.0274  0.0943  13  ARG A NH2 
110  N N   . GLY A 14  ? 0.7763 0.5715 0.5433 0.0688  -0.0357 0.0242  14  GLY A N   
111  C CA  . GLY A 14  ? 0.6933 0.5345 0.4801 0.0746  -0.0573 0.0212  14  GLY A CA  
112  C C   . GLY A 14  ? 0.7319 0.5882 0.5070 0.0782  -0.0717 0.0197  14  GLY A C   
113  O O   . GLY A 14  ? 0.7955 0.6892 0.5815 0.0843  -0.0900 0.0168  14  GLY A O   
114  N N   . GLY A 15  ? 0.6419 0.4716 0.3952 0.0727  -0.0632 0.0202  15  GLY A N   
115  C CA  . GLY A 15  ? 0.6304 0.4689 0.3652 0.0775  -0.0737 0.0177  15  GLY A CA  
116  C C   . GLY A 15  ? 0.7394 0.5610 0.4690 0.0611  -0.0659 0.0116  15  GLY A C   
117  O O   . GLY A 15  ? 0.7265 0.5295 0.4639 0.0476  -0.0510 0.0126  15  GLY A O   
118  N N   . GLN A 16  ? 0.6899 0.5213 0.4064 0.0625  -0.0760 0.0044  16  GLN A N   
119  C CA  . GLN A 16  ? 0.7274 0.5434 0.4365 0.0519  -0.0668 -0.0002 16  GLN A CA  
120  C C   . GLN A 16  ? 0.8147 0.6429 0.5567 0.0323  -0.0705 -0.0121 16  GLN A C   
121  O O   . GLN A 16  ? 0.8773 0.7277 0.6389 0.0271  -0.0858 -0.0219 16  GLN A O   
122  C CB  . GLN A 16  ? 0.7102 0.5262 0.3848 0.0640  -0.0726 -0.0035 16  GLN A CB  
123  C CG  . GLN A 16  ? 0.8135 0.6100 0.4507 0.0837  -0.0612 0.0133  16  GLN A CG  
124  C CD  . GLN A 16  ? 1.0010 0.7990 0.6056 0.0941  -0.0625 0.0107  16  GLN A CD  
125  O OE1 . GLN A 16  ? 0.9709 0.7982 0.5748 0.1007  -0.0784 0.0032  16  GLN A OE1 
126  N NE2 . GLN A 16  ? 1.1904 0.9642 0.7775 0.0926  -0.0435 0.0163  16  GLN A NE2 
127  N N   . LEU A 17  ? 0.6597 0.4751 0.4083 0.0219  -0.0555 -0.0095 17  LEU A N   
128  C CA  . LEU A 17  ? 0.6782 0.5035 0.4540 0.0080  -0.0555 -0.0164 17  LEU A CA  
129  C C   . LEU A 17  ? 0.7199 0.5342 0.4822 0.0092  -0.0472 -0.0195 17  LEU A C   
130  O O   . LEU A 17  ? 0.8008 0.6011 0.5395 0.0156  -0.0351 -0.0127 17  LEU A O   
131  C CB  . LEU A 17  ? 0.5922 0.4217 0.3913 -0.0039 -0.0449 -0.0096 17  LEU A CB  
132  C CG  . LEU A 17  ? 0.5124 0.3471 0.3227 -0.0062 -0.0460 -0.0062 17  LEU A CG  
133  C CD1 . LEU A 17  ? 0.4971 0.3358 0.3231 -0.0205 -0.0339 -0.0026 17  LEU A CD1 
134  C CD2 . LEU A 17  ? 0.5184 0.3750 0.3509 -0.0070 -0.0611 -0.0117 17  LEU A CD2 
135  N N   . ARG A 18  ? 0.8089 0.6276 0.5865 0.0035  -0.0512 -0.0289 18  ARG A N   
136  C CA  . ARG A 18  ? 0.6921 0.4999 0.4637 0.0053  -0.0390 -0.0305 18  ARG A CA  
137  C C   . ARG A 18  ? 0.7593 0.5783 0.5659 -0.0036 -0.0320 -0.0250 18  ARG A C   
138  O O   . ARG A 18  ? 0.7573 0.5827 0.5862 -0.0101 -0.0398 -0.0295 18  ARG A O   
139  C CB  . ARG A 18  ? 0.7337 0.5295 0.4863 0.0095  -0.0463 -0.0469 18  ARG A CB  
140  C CG  . ARG A 18  ? 0.8846 0.6648 0.6289 0.0148  -0.0302 -0.0486 18  ARG A CG  
141  C CD  . ARG A 18  ? 0.8494 0.6108 0.5714 0.0175  -0.0351 -0.0689 18  ARG A CD  
142  N NE  . ARG A 18  ? 0.9639 0.7277 0.7068 0.0049  -0.0496 -0.0817 18  ARG A NE  
143  C CZ  . ARG A 18  ? 1.1638 0.9361 0.8965 -0.0002 -0.0690 -0.0956 18  ARG A CZ  
144  N NH1 . ARG A 18  ? 1.0907 0.8700 0.7896 0.0097  -0.0768 -0.0970 18  ARG A NH1 
145  N NH2 . ARG A 18  ? 1.2667 1.0440 1.0240 -0.0149 -0.0801 -0.1064 18  ARG A NH2 
146  N N   . GLY A 19  ? 0.7703 0.5953 0.5826 -0.0039 -0.0169 -0.0137 19  GLY A N   
147  C CA  . GLY A 19  ? 0.6421 0.4862 0.4862 -0.0095 -0.0102 -0.0054 19  GLY A CA  
148  C C   . GLY A 19  ? 0.7310 0.5682 0.5764 -0.0005 0.0013  -0.0049 19  GLY A C   
149  O O   . GLY A 19  ? 0.7092 0.5224 0.5309 0.0080  0.0024  -0.0155 19  GLY A O   
150  N N   . ILE A 20  ? 0.6554 0.5153 0.5271 -0.0008 0.0107  0.0077  20  ILE A N   
151  C CA  . ILE A 20  ? 0.6185 0.4733 0.4957 0.0116  0.0241  0.0118  20  ILE A CA  
152  C C   . ILE A 20  ? 0.6906 0.5787 0.5836 0.0156  0.0390  0.0288  20  ILE A C   
153  O O   . ILE A 20  ? 0.7406 0.6636 0.6546 0.0050  0.0364  0.0385  20  ILE A O   
154  C CB  . ILE A 20  ? 0.6165 0.4654 0.5149 0.0115  0.0207  0.0119  20  ILE A CB  
155  C CG1 . ILE A 20  ? 0.5482 0.3833 0.4505 0.0277  0.0380  0.0172  20  ILE A CG1 
156  C CG2 . ILE A 20  ? 0.3713 0.2558 0.2997 0.0017  0.0148  0.0244  20  ILE A CG2 
157  C CD1 . ILE A 20  ? 0.4576 0.2785 0.3792 0.0281  0.0386  0.0193  20  ILE A CD1 
158  N N   . ARG A 21  ? 0.6510 0.5309 0.5334 0.0305  0.0547  0.0314  21  ARG A N   
159  C CA  . ARG A 21  ? 0.6183 0.5357 0.5188 0.0366  0.0702  0.0486  21  ARG A CA  
160  C C   . ARG A 21  ? 0.7148 0.6493 0.6432 0.0485  0.0769  0.0616  21  ARG A C   
161  O O   . ARG A 21  ? 0.9269 0.8300 0.8476 0.0649  0.0861  0.0585  21  ARG A O   
162  C CB  . ARG A 21  ? 0.6707 0.5725 0.5461 0.0505  0.0866  0.0469  21  ARG A CB  
163  C CG  . ARG A 21  ? 0.5830 0.5259 0.4786 0.0604  0.1058  0.0654  21  ARG A CG  
164  C CD  . ARG A 21  ? 0.5956 0.5174 0.4648 0.0799  0.1251  0.0633  21  ARG A CD  
165  N NE  . ARG A 21  ? 0.9209 0.8720 0.8130 0.1001  0.1448  0.0802  21  ARG A NE  
166  C CZ  . ARG A 21  ? 1.1845 1.1692 1.0835 0.1081  0.1633  0.0935  21  ARG A CZ  
167  N NH1 . ARG A 21  ? 1.3082 1.2963 1.1909 0.0960  0.1661  0.0918  21  ARG A NH1 
168  N NH2 . ARG A 21  ? 1.1476 1.1634 1.0707 0.1298  0.1809  0.1107  21  ARG A NH2 
169  N N   . LEU A 22  ? 0.5789 0.5614 0.5377 0.0407  0.0729  0.0759  22  LEU A N   
170  C CA  . LEU A 22  ? 0.4663 0.4718 0.4520 0.0545  0.0791  0.0929  22  LEU A CA  
171  C C   . LEU A 22  ? 0.5579 0.6119 0.5628 0.0678  0.0948  0.1123  22  LEU A C   
172  O O   . LEU A 22  ? 0.6302 0.7133 0.6358 0.0573  0.0967  0.1128  22  LEU A O   
173  C CB  . LEU A 22  ? 0.3959 0.4325 0.4025 0.0404  0.0647  0.0987  22  LEU A CB  
174  C CG  . LEU A 22  ? 0.4935 0.4943 0.4890 0.0276  0.0495  0.0834  22  LEU A CG  
175  C CD1 . LEU A 22  ? 0.3850 0.4243 0.4015 0.0169  0.0391  0.0922  22  LEU A CD1 
176  C CD2 . LEU A 22  ? 0.4187 0.3691 0.4056 0.0399  0.0548  0.0775  22  LEU A CD2 
177  N N   . LYS A 23  ? 0.4725 0.5363 0.4945 0.0912  0.1073  0.1295  23  LYS A N   
178  C CA  . LYS A 23  ? 0.5043 0.6264 0.5511 0.1081  0.1221  0.1525  23  LYS A CA  
179  C C   . LYS A 23  ? 0.4894 0.6829 0.5696 0.1021  0.1126  0.1715  23  LYS A C   
180  O O   . LYS A 23  ? 0.5313 0.7190 0.6178 0.1027  0.1047  0.1761  23  LYS A O   
181  C CB  . LYS A 23  ? 0.7038 0.7968 0.7478 0.1431  0.1453  0.1628  23  LYS A CB  
182  C CG  . LYS A 23  ? 0.9444 0.9988 0.9600 0.1532  0.1606  0.1498  23  LYS A CG  
183  C CD  . LYS A 23  ? 1.0779 1.0883 1.0836 0.1873  0.1846  0.1543  23  LYS A CD  
184  C CE  . LYS A 23  ? 1.1546 1.0823 1.1328 0.1839  0.1806  0.1320  23  LYS A CE  
185  N NZ  . LYS A 23  ? 1.2299 1.1068 1.1977 0.2152  0.2063  0.1346  23  LYS A NZ  
186  N N   . ALA A 24  ? 0.4519 0.7153 0.5526 0.0941  0.1129  0.1815  24  ALA A N   
187  C CA  . ALA A 24  ? 0.3812 0.7250 0.5144 0.0926  0.1059  0.2014  24  ALA A CA  
188  C C   . ALA A 24  ? 0.3746 0.7723 0.5292 0.1136  0.1188  0.2222  24  ALA A C   
189  O O   . ALA A 24  ? 0.4070 0.7907 0.5546 0.1212  0.1334  0.2194  24  ALA A O   
190  C CB  . ALA A 24  ? 0.3795 0.7599 0.5160 0.0553  0.0870  0.1884  24  ALA A CB  
191  N N   . PRO A 25  ? 0.3072 0.7548 0.4778 0.1219  0.1089  0.2405  25  PRO A N   
192  C CA  . PRO A 25  ? 0.3217 0.8113 0.5038 0.1412  0.1157  0.2600  25  PRO A CA  
193  C C   . PRO A 25  ? 0.4223 0.9285 0.6074 0.1283  0.1201  0.2499  25  PRO A C   
194  O O   . PRO A 25  ? 0.5675 1.0721 0.7548 0.1525  0.1375  0.2614  25  PRO A O   
195  C CB  . PRO A 25  ? 0.3161 0.8687 0.5066 0.1302  0.0960  0.2706  25  PRO A CB  
196  C CG  . PRO A 25  ? 0.3039 0.8285 0.4863 0.1291  0.0895  0.2699  25  PRO A CG  
197  C CD  . PRO A 25  ? 0.2836 0.7513 0.4567 0.1136  0.0918  0.2454  25  PRO A CD  
198  N N   . GLY A 26  ? 0.3539 0.8708 0.5370 0.0908  0.1069  0.2288  26  GLY A N   
199  C CA  . GLY A 26  ? 0.3097 0.8500 0.4986 0.0740  0.1105  0.2215  26  GLY A CA  
200  C C   . GLY A 26  ? 0.5171 1.0023 0.6866 0.0678  0.1253  0.2061  26  GLY A C   
201  O O   . GLY A 26  ? 0.4576 0.9548 0.6298 0.0574  0.1330  0.2024  26  GLY A O   
202  N N   . GLY A 27  ? 0.4434 0.8681 0.5907 0.0742  0.1302  0.1981  27  GLY A N   
203  C CA  . GLY A 27  ? 0.4680 0.8353 0.5860 0.0680  0.1425  0.1835  27  GLY A CA  
204  C C   . GLY A 27  ? 0.5714 0.8732 0.6608 0.0589  0.1314  0.1663  27  GLY A C   
205  O O   . GLY A 27  ? 0.6369 0.9427 0.7338 0.0564  0.1174  0.1671  27  GLY A O   
206  N N   . PRO A 28  ? 0.4791 0.7162 0.5329 0.0544  0.1341  0.1487  28  PRO A N   
207  C CA  . PRO A 28  ? 0.3324 0.5018 0.3552 0.0454  0.1195  0.1283  28  PRO A CA  
208  C C   . PRO A 28  ? 0.6670 0.8433 0.6901 0.0127  0.1014  0.1173  28  PRO A C   
209  O O   . PRO A 28  ? 0.7420 0.9552 0.7765 -0.0086 0.1029  0.1188  28  PRO A O   
210  C CB  . PRO A 28  ? 0.3721 0.4872 0.3580 0.0529  0.1305  0.1166  28  PRO A CB  
211  C CG  . PRO A 28  ? 0.3721 0.5309 0.3707 0.0533  0.1485  0.1293  28  PRO A CG  
212  C CD  . PRO A 28  ? 0.3579 0.5844 0.3979 0.0657  0.1544  0.1504  28  PRO A CD  
213  N N   . VAL A 29  ? 0.5501 0.6890 0.5604 0.0084  0.0863  0.1057  29  VAL A N   
214  C CA  . VAL A 29  ? 0.5671 0.6992 0.5708 -0.0180 0.0712  0.0932  29  VAL A CA  
215  C C   . VAL A 29  ? 0.5916 0.6580 0.5635 -0.0157 0.0634  0.0771  29  VAL A C   
216  O O   . VAL A 29  ? 0.6375 0.6710 0.5987 0.0024  0.0645  0.0744  29  VAL A O   
217  C CB  . VAL A 29  ? 0.5092 0.6803 0.5359 -0.0270 0.0581  0.0974  29  VAL A CB  
218  C CG1 . VAL A 29  ? 0.4565 0.7044 0.5157 -0.0304 0.0625  0.1133  29  VAL A CG1 
219  C CG2 . VAL A 29  ? 0.5568 0.7047 0.5839 -0.0078 0.0543  0.1008  29  VAL A CG2 
220  N N   . SER A 30  ? 0.5980 0.6463 0.5550 -0.0343 0.0559  0.0660  30  SER A N   
221  C CA  . SER A 30  ? 0.5668 0.5636 0.4969 -0.0323 0.0462  0.0525  30  SER A CA  
222  C C   . SER A 30  ? 0.6004 0.6020 0.5421 -0.0388 0.0311  0.0484  30  SER A C   
223  O O   . SER A 30  ? 0.5178 0.5500 0.4746 -0.0543 0.0267  0.0497  30  SER A O   
224  C CB  . SER A 30  ? 0.5633 0.5359 0.4699 -0.0439 0.0488  0.0462  30  SER A CB  
225  O OG  . SER A 30  ? 0.6682 0.6311 0.5593 -0.0361 0.0639  0.0507  30  SER A OG  
226  N N   . ALA A 31  ? 0.5469 0.5206 0.4819 -0.0282 0.0237  0.0427  31  ALA A N   
227  C CA  . ALA A 31  ? 0.4372 0.4156 0.3834 -0.0343 0.0112  0.0401  31  ALA A CA  
228  C C   . ALA A 31  ? 0.6355 0.5759 0.5626 -0.0330 0.0009  0.0270  31  ALA A C   
229  O O   . ALA A 31  ? 0.4973 0.4089 0.4086 -0.0228 0.0013  0.0206  31  ALA A O   
230  C CB  . ALA A 31  ? 0.5562 0.5542 0.5257 -0.0250 0.0130  0.0511  31  ALA A CB  
231  N N   . PHE A 32  ? 0.5491 0.4927 0.4769 -0.0432 -0.0080 0.0225  32  PHE A N   
232  C CA  . PHE A 32  ? 0.5407 0.4602 0.4560 -0.0416 -0.0188 0.0126  32  PHE A CA  
233  C C   . PHE A 32  ? 0.5232 0.4598 0.4592 -0.0463 -0.0268 0.0137  32  PHE A C   
234  O O   . PHE A 32  ? 0.4344 0.3924 0.3792 -0.0549 -0.0268 0.0165  32  PHE A O   
235  C CB  . PHE A 32  ? 0.5748 0.4793 0.4690 -0.0454 -0.0180 0.0084  32  PHE A CB  
236  C CG  . PHE A 32  ? 0.5947 0.4823 0.4674 -0.0408 -0.0081 0.0098  32  PHE A CG  
237  C CD1 . PHE A 32  ? 0.6283 0.4904 0.4765 -0.0287 -0.0110 0.0047  32  PHE A CD1 
238  C CD2 . PHE A 32  ? 0.5980 0.4992 0.4748 -0.0493 0.0042  0.0162  32  PHE A CD2 
239  C CE1 . PHE A 32  ? 0.6729 0.5203 0.4982 -0.0227 -0.0003 0.0075  32  PHE A CE1 
240  C CE2 . PHE A 32  ? 0.6138 0.5009 0.4719 -0.0452 0.0158  0.0194  32  PHE A CE2 
241  C CZ  . PHE A 32  ? 0.6276 0.4860 0.4582 -0.0306 0.0143  0.0159  32  PHE A CZ  
242  N N   . LEU A 33  ? 0.5521 0.4793 0.4950 -0.0420 -0.0327 0.0109  33  LEU A N   
243  C CA  . LEU A 33  ? 0.5453 0.4910 0.5120 -0.0455 -0.0357 0.0167  33  LEU A CA  
244  C C   . LEU A 33  ? 0.5751 0.5124 0.5439 -0.0474 -0.0464 0.0084  33  LEU A C   
245  O O   . LEU A 33  ? 0.5503 0.4671 0.5075 -0.0447 -0.0518 -0.0013 33  LEU A O   
246  C CB  . LEU A 33  ? 0.4219 0.3683 0.4037 -0.0394 -0.0278 0.0259  33  LEU A CB  
247  C CG  . LEU A 33  ? 0.4150 0.3775 0.4001 -0.0334 -0.0161 0.0374  33  LEU A CG  
248  C CD1 . LEU A 33  ? 0.5239 0.4825 0.5246 -0.0229 -0.0069 0.0487  33  LEU A CD1 
249  C CD2 . LEU A 33  ? 0.2259 0.2290 0.2197 -0.0408 -0.0157 0.0453  33  LEU A CD2 
250  N N   . GLY A 34  ? 0.4751 0.4326 0.4583 -0.0520 -0.0496 0.0120  34  GLY A N   
251  C CA  . GLY A 34  ? 0.5568 0.5146 0.5455 -0.0535 -0.0590 0.0058  34  GLY A CA  
252  C C   . GLY A 34  ? 0.6003 0.5481 0.5681 -0.0489 -0.0653 -0.0029 34  GLY A C   
253  O O   . GLY A 34  ? 0.5453 0.4897 0.5116 -0.0467 -0.0745 -0.0099 34  GLY A O   
254  N N   . ILE A 35  ? 0.5571 0.5010 0.5088 -0.0477 -0.0597 -0.0020 35  ILE A N   
255  C CA  . ILE A 35  ? 0.6085 0.5397 0.5404 -0.0407 -0.0620 -0.0065 35  ILE A CA  
256  C C   . ILE A 35  ? 0.6384 0.5851 0.5806 -0.0389 -0.0645 -0.0061 35  ILE A C   
257  O O   . ILE A 35  ? 0.6675 0.6229 0.6130 -0.0439 -0.0578 -0.0044 35  ILE A O   
258  C CB  . ILE A 35  ? 0.5831 0.4988 0.4950 -0.0424 -0.0514 -0.0057 35  ILE A CB  
259  C CG1 . ILE A 35  ? 0.5564 0.4635 0.4615 -0.0437 -0.0462 -0.0039 35  ILE A CG1 
260  C CG2 . ILE A 35  ? 0.3828 0.2778 0.2723 -0.0325 -0.0503 -0.0074 35  ILE A CG2 
261  C CD1 . ILE A 35  ? 0.4099 0.3120 0.3049 -0.0510 -0.0343 -0.0015 35  ILE A CD1 
262  N N   . PRO A 36  ? 0.6058 0.5598 0.5529 -0.0317 -0.0740 -0.0083 36  PRO A N   
263  C CA  . PRO A 36  ? 0.5500 0.5236 0.5099 -0.0273 -0.0752 -0.0064 36  PRO A CA  
264  C C   . PRO A 36  ? 0.5284 0.4858 0.4671 -0.0175 -0.0665 -0.0064 36  PRO A C   
265  O O   . PRO A 36  ? 0.5985 0.5345 0.5148 -0.0070 -0.0659 -0.0065 36  PRO A O   
266  C CB  . PRO A 36  ? 0.5921 0.5807 0.5611 -0.0214 -0.0884 -0.0088 36  PRO A CB  
267  C CG  . PRO A 36  ? 0.5645 0.5310 0.5091 -0.0172 -0.0928 -0.0134 36  PRO A CG  
268  C CD  . PRO A 36  ? 0.5611 0.5102 0.5016 -0.0272 -0.0843 -0.0133 36  PRO A CD  
269  N N   . PHE A 37  ? 0.5444 0.5094 0.4877 -0.0201 -0.0585 -0.0062 37  PHE A N   
270  C CA  . PHE A 37  ? 0.6640 0.6055 0.5848 -0.0125 -0.0471 -0.0089 37  PHE A CA  
271  C C   . PHE A 37  ? 0.6325 0.5882 0.5606 0.0008  -0.0448 -0.0073 37  PHE A C   
272  O O   . PHE A 37  ? 0.8067 0.7403 0.7163 0.0092  -0.0327 -0.0102 37  PHE A O   
273  C CB  . PHE A 37  ? 0.6831 0.6151 0.5945 -0.0280 -0.0366 -0.0142 37  PHE A CB  
274  C CG  . PHE A 37  ? 0.7727 0.7365 0.7020 -0.0367 -0.0365 -0.0141 37  PHE A CG  
275  C CD1 . PHE A 37  ? 0.5518 0.5420 0.5027 -0.0452 -0.0433 -0.0080 37  PHE A CD1 
276  C CD2 . PHE A 37  ? 0.8636 0.8288 0.7856 -0.0346 -0.0276 -0.0194 37  PHE A CD2 
277  C CE1 . PHE A 37  ? 0.6213 0.6417 0.5869 -0.0509 -0.0417 -0.0044 37  PHE A CE1 
278  C CE2 . PHE A 37  ? 0.6972 0.6947 0.6322 -0.0414 -0.0270 -0.0183 37  PHE A CE2 
279  C CZ  . PHE A 37  ? 0.5443 0.5710 0.5015 -0.0491 -0.0343 -0.0094 37  PHE A CZ  
280  N N   . ALA A 38  ? 0.4646 0.4561 0.4202 0.0024  -0.0546 -0.0030 38  ALA A N   
281  C CA  . ALA A 38  ? 0.4849 0.4994 0.4531 0.0157  -0.0522 0.0004  38  ALA A CA  
282  C C   . ALA A 38  ? 0.5679 0.6203 0.5656 0.0176  -0.0666 0.0054  38  ALA A C   
283  O O   . ALA A 38  ? 0.5286 0.5880 0.5388 0.0038  -0.0765 0.0042  38  ALA A O   
284  C CB  . ALA A 38  ? 0.4031 0.4314 0.3783 0.0076  -0.0427 -0.0011 38  ALA A CB  
285  N N   . GLU A 39  ? 0.4949 0.5716 0.5036 0.0347  -0.0670 0.0103  39  GLU A N   
286  C CA  . GLU A 39  ? 0.5548 0.6765 0.5962 0.0329  -0.0811 0.0140  39  GLU A CA  
287  C C   . GLU A 39  ? 0.6176 0.7653 0.6891 0.0148  -0.0790 0.0160  39  GLU A C   
288  O O   . GLU A 39  ? 0.6191 0.7665 0.6885 0.0160  -0.0659 0.0182  39  GLU A O   
289  C CB  . GLU A 39  ? 0.5105 0.6601 0.5593 0.0576  -0.0809 0.0211  39  GLU A CB  
290  C CG  . GLU A 39  ? 0.5823 0.7176 0.6072 0.0772  -0.0870 0.0233  39  GLU A CG  
291  C CD  . GLU A 39  ? 0.6381 0.7996 0.6749 0.0679  -0.1083 0.0201  39  GLU A CD  
292  O OE1 . GLU A 39  ? 0.8138 1.0256 0.8866 0.0591  -0.1194 0.0203  39  GLU A OE1 
293  O OE2 . GLU A 39  ? 0.5845 0.7171 0.5943 0.0679  -0.1134 0.0164  39  GLU A OE2 
294  N N   . PRO A 40  ? 0.5949 0.7617 0.6914 -0.0024 -0.0905 0.0150  40  PRO A N   
295  C CA  . PRO A 40  ? 0.4828 0.6685 0.6081 -0.0205 -0.0865 0.0196  40  PRO A CA  
296  C C   . PRO A 40  ? 0.4657 0.6870 0.6113 -0.0128 -0.0766 0.0285  40  PRO A C   
297  O O   . PRO A 40  ? 0.6788 0.9360 0.8444 -0.0036 -0.0811 0.0315  40  PRO A O   
298  C CB  . PRO A 40  ? 0.4245 0.6286 0.5755 -0.0361 -0.1008 0.0156  40  PRO A CB  
299  C CG  . PRO A 40  ? 0.3574 0.5401 0.4830 -0.0304 -0.1121 0.0063  40  PRO A CG  
300  C CD  . PRO A 40  ? 0.4073 0.5779 0.5044 -0.0055 -0.1070 0.0090  40  PRO A CD  
301  N N   . PRO A 41  ? 0.3058 0.5217 0.4457 -0.0152 -0.0629 0.0330  41  PRO A N   
302  C CA  . PRO A 41  ? 0.3601 0.6066 0.5118 -0.0051 -0.0508 0.0405  41  PRO A CA  
303  C C   . PRO A 41  ? 0.3945 0.6842 0.5897 -0.0176 -0.0505 0.0510  41  PRO A C   
304  O O   . PRO A 41  ? 0.2615 0.5634 0.4644 -0.0224 -0.0384 0.0600  41  PRO A O   
305  C CB  . PRO A 41  ? 0.2767 0.5023 0.4025 -0.0068 -0.0382 0.0398  41  PRO A CB  
306  C CG  . PRO A 41  ? 0.2582 0.4613 0.3795 -0.0233 -0.0439 0.0388  41  PRO A CG  
307  C CD  . PRO A 41  ? 0.2579 0.4430 0.3771 -0.0248 -0.0577 0.0315  41  PRO A CD  
308  N N   . VAL A 42  ? 0.2923 0.6066 0.5150 -0.0235 -0.0632 0.0499  42  VAL A N   
309  C CA  . VAL A 42  ? 0.2576 0.6116 0.5256 -0.0413 -0.0634 0.0580  42  VAL A CA  
310  C C   . VAL A 42  ? 0.3453 0.7431 0.6357 -0.0292 -0.0613 0.0615  42  VAL A C   
311  O O   . VAL A 42  ? 0.4051 0.8186 0.6859 -0.0051 -0.0618 0.0624  42  VAL A O   
312  C CB  . VAL A 42  ? 0.3453 0.6790 0.6197 -0.0615 -0.0758 0.0467  42  VAL A CB  
313  C CG1 . VAL A 42  ? 0.2725 0.5609 0.5255 -0.0718 -0.0758 0.0445  42  VAL A CG1 
314  C CG2 . VAL A 42  ? 0.1878 0.5315 0.4569 -0.0528 -0.0928 0.0357  42  VAL A CG2 
315  N N   . GLY A 43  ? 0.2815 0.6979 0.6018 -0.0451 -0.0574 0.0640  43  GLY A N   
316  C CA  . GLY A 43  ? 0.2752 0.7367 0.6215 -0.0372 -0.0536 0.0691  43  GLY A CA  
317  C C   . GLY A 43  ? 0.4196 0.9006 0.7559 -0.0101 -0.0394 0.0794  43  GLY A C   
318  O O   . GLY A 43  ? 0.4967 0.9692 0.8212 -0.0071 -0.0244 0.0870  43  GLY A O   
319  N N   . SER A 44  ? 0.5273 1.0338 0.8657 0.0116  -0.0436 0.0792  44  SER A N   
320  C CA  . SER A 44  ? 0.4408 0.9654 0.7696 0.0424  -0.0283 0.0875  44  SER A CA  
321  C C   . SER A 44  ? 0.3717 0.8655 0.6628 0.0631  -0.0210 0.0849  44  SER A C   
322  O O   . SER A 44  ? 0.4263 0.9234 0.7022 0.0902  -0.0044 0.0881  44  SER A O   
323  C CB  . SER A 44  ? 0.3268 0.8816 0.6661 0.0612  -0.0357 0.0884  44  SER A CB  
324  O OG  . SER A 44  ? 0.4768 1.0098 0.7985 0.0635  -0.0534 0.0796  44  SER A OG  
325  N N   . ARG A 45  ? 0.3152 0.7644 0.5826 0.0496  -0.0314 0.0754  45  ARG A N   
326  C CA  . ARG A 45  ? 0.3956 0.7844 0.6118 0.0584  -0.0227 0.0660  45  ARG A CA  
327  C C   . ARG A 45  ? 0.4158 0.7878 0.6216 0.0412  -0.0127 0.0666  45  ARG A C   
328  O O   . ARG A 45  ? 0.3553 0.6854 0.5218 0.0436  -0.0061 0.0580  45  ARG A O   
329  C CB  . ARG A 45  ? 0.4836 0.8282 0.6738 0.0542  -0.0373 0.0554  45  ARG A CB  
330  C CG  . ARG A 45  ? 0.4968 0.8485 0.6839 0.0751  -0.0467 0.0553  45  ARG A CG  
331  C CD  . ARG A 45  ? 0.8055 1.1016 0.9546 0.0735  -0.0546 0.0454  45  ARG A CD  
332  N NE  . ARG A 45  ? 1.0233 1.3284 1.1691 0.0909  -0.0666 0.0473  45  ARG A NE  
333  C CZ  . ARG A 45  ? 1.1557 1.4721 1.3105 0.0780  -0.0866 0.0437  45  ARG A CZ  
334  N NH1 . ARG A 45  ? 1.0890 1.4020 1.2569 0.0473  -0.0948 0.0371  45  ARG A NH1 
335  N NH2 . ARG A 45  ? 1.2589 1.5887 1.4069 0.0971  -0.0973 0.0467  45  ARG A NH2 
336  N N   . ARG A 46  ? 0.4825 0.8015 0.6568 0.0396  -0.0345 0.0659  46  ARG A N   
337  C CA  . ARG A 46  ? 0.4503 0.7656 0.6124 0.0372  -0.0216 0.0704  46  ARG A CA  
338  C C   . ARG A 46  ? 0.3215 0.6575 0.4836 0.0516  -0.0100 0.0671  46  ARG A C   
339  O O   . ARG A 46  ? 0.3308 0.6963 0.5150 0.0576  -0.0075 0.0664  46  ARG A O   
340  C CB  . ARG A 46  ? 0.4327 0.7615 0.6129 0.0217  -0.0173 0.0822  46  ARG A CB  
341  C CG  . ARG A 46  ? 0.2728 0.6006 0.4418 0.0192  -0.0044 0.0909  46  ARG A CG  
342  C CD  . ARG A 46  ? 0.3442 0.6934 0.5378 0.0048  0.0019  0.1060  46  ARG A CD  
343  N NE  . ARG A 46  ? 0.2731 0.5962 0.4690 -0.0109 -0.0057 0.1111  46  ARG A NE  
344  C CZ  . ARG A 46  ? 0.4080 0.7404 0.6279 -0.0268 -0.0041 0.1237  46  ARG A CZ  
345  N NH1 . ARG A 46  ? 0.2842 0.6553 0.5278 -0.0299 0.0058  0.1342  46  ARG A NH1 
346  N NH2 . ARG A 46  ? 0.3725 0.6756 0.5940 -0.0398 -0.0122 0.1253  46  ARG A NH2 
347  N N   . PHE A 47  ? 0.3996 0.7212 0.5376 0.0574  -0.0035 0.0637  47  PHE A N   
348  C CA  . PHE A 47  ? 0.3923 0.7295 0.5245 0.0715  0.0068  0.0568  47  PHE A CA  
349  C C   . PHE A 47  ? 0.4471 0.7740 0.5766 0.0858  0.0008  0.0436  47  PHE A C   
350  O O   . PHE A 47  ? 0.4406 0.7722 0.5626 0.0977  0.0073  0.0342  47  PHE A O   
351  C CB  . PHE A 47  ? 0.3768 0.7563 0.5301 0.0734  0.0187  0.0617  47  PHE A CB  
352  C CG  . PHE A 47  ? 0.3602 0.7530 0.5198 0.0589  0.0259  0.0776  47  PHE A CG  
353  C CD1 . PHE A 47  ? 0.4771 0.8527 0.6156 0.0528  0.0293  0.0846  47  PHE A CD1 
354  C CD2 . PHE A 47  ? 0.2771 0.7008 0.4666 0.0513  0.0291  0.0868  47  PHE A CD2 
355  C CE1 . PHE A 47  ? 0.2642 0.6497 0.4103 0.0396  0.0354  0.1015  47  PHE A CE1 
356  C CE2 . PHE A 47  ? 0.3486 0.7829 0.5464 0.0364  0.0357  0.1034  47  PHE A CE2 
357  C CZ  . PHE A 47  ? 0.2729 0.6862 0.4484 0.0308  0.0387  0.1112  47  PHE A CZ  
358  N N   . MET A 48  ? 0.4777 0.7909 0.6138 0.0845  -0.0120 0.0430  48  MET A N   
359  C CA  . MET A 48  ? 0.4284 0.7303 0.5649 0.0972  -0.0190 0.0342  48  MET A CA  
360  C C   . MET A 48  ? 0.4456 0.7118 0.5561 0.0973  -0.0235 0.0298  48  MET A C   
361  O O   . MET A 48  ? 0.4502 0.6991 0.5447 0.0867  -0.0251 0.0340  48  MET A O   
362  C CB  . MET A 48  ? 0.4363 0.7424 0.5911 0.0959  -0.0317 0.0381  48  MET A CB  
363  C CG  . MET A 48  ? 0.4763 0.8208 0.6624 0.0980  -0.0286 0.0411  48  MET A CG  
364  S SD  . MET A 48  ? 0.7033 1.0720 0.9022 0.1180  -0.0165 0.0305  48  MET A SD  
365  C CE  . MET A 48  ? 0.3517 0.7068 0.5619 0.1332  -0.0306 0.0252  48  MET A CE  
366  N N   . PRO A 49  ? 0.4885 0.7436 0.5972 0.1096  -0.0256 0.0211  49  PRO A N   
367  C CA  . PRO A 49  ? 0.3609 0.5832 0.4498 0.1096  -0.0308 0.0178  49  PRO A CA  
368  C C   . PRO A 49  ? 0.3748 0.5798 0.4568 0.1002  -0.0419 0.0260  49  PRO A C   
369  O O   . PRO A 49  ? 0.3760 0.5917 0.4721 0.0991  -0.0493 0.0313  49  PRO A O   
370  C CB  . PRO A 49  ? 0.4256 0.6435 0.5249 0.1243  -0.0333 0.0093  49  PRO A CB  
371  C CG  . PRO A 49  ? 0.5587 0.8087 0.6765 0.1337  -0.0244 0.0035  49  PRO A CG  
372  C CD  . PRO A 49  ? 0.4846 0.7590 0.6135 0.1244  -0.0230 0.0139  49  PRO A CD  
373  N N   . PRO A 50  ? 0.4330 0.6143 0.4935 0.0935  -0.0432 0.0265  50  PRO A N   
374  C CA  . PRO A 50  ? 0.4303 0.5980 0.4811 0.0846  -0.0523 0.0328  50  PRO A CA  
375  C C   . PRO A 50  ? 0.6151 0.7738 0.6689 0.0899  -0.0627 0.0361  50  PRO A C   
376  O O   . PRO A 50  ? 0.6090 0.7559 0.6633 0.0983  -0.0629 0.0334  50  PRO A O   
377  C CB  . PRO A 50  ? 0.4502 0.5976 0.4790 0.0790  -0.0487 0.0309  50  PRO A CB  
378  C CG  . PRO A 50  ? 0.6187 0.7626 0.6469 0.0872  -0.0427 0.0238  50  PRO A CG  
379  C CD  . PRO A 50  ? 0.4306 0.5988 0.4755 0.0943  -0.0369 0.0204  50  PRO A CD  
380  N N   . GLU A 51  ? 0.6314 0.7957 0.6879 0.0848  -0.0722 0.0421  51  GLU A N   
381  C CA  . GLU A 51  ? 0.6169 0.7721 0.6700 0.0874  -0.0840 0.0484  51  GLU A CA  
382  C C   . GLU A 51  ? 0.7348 0.8698 0.7609 0.0784  -0.0862 0.0510  51  GLU A C   
383  O O   . GLU A 51  ? 0.6858 0.8211 0.7012 0.0686  -0.0844 0.0486  51  GLU A O   
384  C CB  . GLU A 51  ? 0.6152 0.7914 0.6848 0.0870  -0.0944 0.0530  51  GLU A CB  
385  C CG  . GLU A 51  ? 0.9181 1.1190 1.0178 0.0967  -0.0918 0.0510  51  GLU A CG  
386  C CD  . GLU A 51  ? 1.1194 1.3450 1.2391 0.0953  -0.1028 0.0558  51  GLU A CD  
387  O OE1 . GLU A 51  ? 1.1989 1.4220 1.3073 0.0857  -0.1129 0.0594  51  GLU A OE1 
388  O OE2 . GLU A 51  ? 1.0709 1.3204 1.2183 0.1041  -0.1016 0.0549  51  GLU A OE2 
389  N N   . PRO A 52  ? 0.7616 0.8792 0.7779 0.0819  -0.0897 0.0560  52  PRO A N   
390  C CA  . PRO A 52  ? 0.7394 0.8407 0.7305 0.0743  -0.0910 0.0601  52  PRO A CA  
391  C C   . PRO A 52  ? 0.6570 0.7666 0.6365 0.0667  -0.0996 0.0628  52  PRO A C   
392  O O   . PRO A 52  ? 0.5774 0.6995 0.5668 0.0695  -0.1103 0.0677  52  PRO A O   
393  C CB  . PRO A 52  ? 0.5205 0.6074 0.5118 0.0808  -0.0962 0.0692  52  PRO A CB  
394  C CG  . PRO A 52  ? 0.6131 0.7022 0.6281 0.0920  -0.0937 0.0646  52  PRO A CG  
395  C CD  . PRO A 52  ? 0.4986 0.6121 0.5302 0.0940  -0.0931 0.0590  52  PRO A CD  
396  N N   . LYS A 53  ? 0.5424 0.6460 0.5022 0.0578  -0.0955 0.0586  53  LYS A N   
397  C CA  . LYS A 53  ? 0.4756 0.5858 0.4222 0.0503  -0.1032 0.0572  53  LYS A CA  
398  C C   . LYS A 53  ? 0.6271 0.7396 0.5622 0.0515  -0.1154 0.0672  53  LYS A C   
399  O O   . LYS A 53  ? 0.7630 0.8643 0.6873 0.0543  -0.1149 0.0764  53  LYS A O   
400  C CB  . LYS A 53  ? 0.4232 0.5238 0.3492 0.0430  -0.0956 0.0500  53  LYS A CB  
401  C CG  . LYS A 53  ? 0.6081 0.7137 0.5167 0.0360  -0.1035 0.0459  53  LYS A CG  
402  C CD  . LYS A 53  ? 0.6662 0.7830 0.5899 0.0314  -0.1091 0.0381  53  LYS A CD  
403  C CE  . LYS A 53  ? 0.7328 0.8499 0.6381 0.0235  -0.1146 0.0283  53  LYS A CE  
404  N NZ  . LYS A 53  ? 0.7143 0.8402 0.6365 0.0169  -0.1214 0.0200  53  LYS A NZ  
405  N N   . ARG A 54  ? 0.5671 0.6948 0.5046 0.0487  -0.1269 0.0662  54  ARG A N   
406  C CA  . ARG A 54  ? 0.5621 0.6962 0.4884 0.0503  -0.1407 0.0765  54  ARG A CA  
407  C C   . ARG A 54  ? 0.7037 0.8354 0.5968 0.0422  -0.1422 0.0734  54  ARG A C   
408  O O   . ARG A 54  ? 0.7069 0.8406 0.5937 0.0348  -0.1398 0.0599  54  ARG A O   
409  C CB  . ARG A 54  ? 0.4818 0.6377 0.4289 0.0518  -0.1542 0.0766  54  ARG A CB  
410  C CG  . ARG A 54  ? 0.5283 0.6909 0.5080 0.0624  -0.1537 0.0814  54  ARG A CG  
411  C CD  . ARG A 54  ? 0.6074 0.7942 0.6068 0.0660  -0.1696 0.0860  54  ARG A CD  
412  N NE  . ARG A 54  ? 0.8946 1.0981 0.8983 0.0552  -0.1750 0.0756  54  ARG A NE  
413  C CZ  . ARG A 54  ? 1.1409 1.3583 1.1720 0.0525  -0.1706 0.0684  54  ARG A CZ  
414  N NH1 . ARG A 54  ? 1.1375 1.3570 1.1917 0.0609  -0.1603 0.0697  54  ARG A NH1 
415  N NH2 . ARG A 54  ? 1.1789 1.4088 1.2145 0.0408  -0.1766 0.0597  54  ARG A NH2 
416  N N   . PRO A 55  ? 0.7068 0.8344 0.5790 0.0439  -0.1461 0.0863  55  PRO A N   
417  C CA  . PRO A 55  ? 0.6898 0.8170 0.5273 0.0372  -0.1448 0.0847  55  PRO A CA  
418  C C   . PRO A 55  ? 0.6814 0.8228 0.5088 0.0305  -0.1531 0.0701  55  PRO A C   
419  O O   . PRO A 55  ? 0.6877 0.8430 0.5309 0.0308  -0.1658 0.0684  55  PRO A O   
420  C CB  . PRO A 55  ? 0.4761 0.6049 0.2995 0.0410  -0.1536 0.1051  55  PRO A CB  
421  C CG  . PRO A 55  ? 0.8328 0.9506 0.6831 0.0497  -0.1523 0.1164  55  PRO A CG  
422  C CD  . PRO A 55  ? 0.6939 0.8185 0.5752 0.0527  -0.1527 0.1042  55  PRO A CD  
423  N N   . TRP A 56  ? 0.7055 0.8438 0.5088 0.0245  -0.1461 0.0586  56  TRP A N   
424  C CA  . TRP A 56  ? 0.6356 0.7844 0.4272 0.0179  -0.1540 0.0416  56  TRP A CA  
425  C C   . TRP A 56  ? 0.7433 0.9015 0.4961 0.0158  -0.1589 0.0436  56  TRP A C   
426  O O   . TRP A 56  ? 0.8133 0.9676 0.5491 0.0183  -0.1525 0.0585  56  TRP A O   
427  C CB  . TRP A 56  ? 0.5091 0.6466 0.3055 0.0137  -0.1420 0.0227  56  TRP A CB  
428  C CG  . TRP A 56  ? 0.7119 0.8385 0.4908 0.0148  -0.1261 0.0226  56  TRP A CG  
429  C CD1 . TRP A 56  ? 0.7017 0.8311 0.4500 0.0124  -0.1215 0.0143  56  TRP A CD1 
430  C CD2 . TRP A 56  ? 0.7114 0.8253 0.5032 0.0187  -0.1124 0.0305  56  TRP A CD2 
431  N NE1 . TRP A 56  ? 0.6180 0.7383 0.3622 0.0143  -0.1053 0.0175  56  TRP A NE1 
432  C CE2 . TRP A 56  ? 0.4562 0.5665 0.2269 0.0177  -0.1004 0.0274  56  TRP A CE2 
433  C CE3 . TRP A 56  ? 0.6083 0.7156 0.4276 0.0229  -0.1094 0.0384  56  TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.5025 0.6029 0.2805 0.0198  -0.0868 0.0328  56  TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.6457 0.7418 0.4696 0.0254  -0.0961 0.0423  56  TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.5578 0.6505 0.3621 0.0233  -0.0855 0.0398  56  TRP A CH2 
437  N N   . SER A 57  ? 0.7657 0.9360 0.5055 0.0105  -0.1697 0.0282  57  SER A N   
438  C CA  . SER A 57  ? 0.7938 0.9651 0.4996 0.0081  -0.1705 0.0252  57  SER A CA  
439  C C   . SER A 57  ? 0.8050 0.9733 0.4923 0.0039  -0.1605 0.0024  57  SER A C   
440  O O   . SER A 57  ? 0.7912 0.9579 0.4935 0.0015  -0.1596 -0.0150 57  SER A O   
441  C CB  . SER A 57  ? 0.8637 1.0466 0.5681 0.0060  -0.1896 0.0223  57  SER A CB  
442  O OG  . SER A 57  ? 0.9119 1.1008 0.6311 -0.0002 -0.1975 0.0009  57  SER A OG  
443  N N   . GLY A 58  ? 0.7553 0.9232 0.4115 0.0036  -0.1531 0.0024  58  GLY A N   
444  C CA  . GLY A 58  ? 0.6390 0.8048 0.2773 0.0014  -0.1422 -0.0193 58  GLY A CA  
445  C C   . GLY A 58  ? 0.6780 0.8360 0.3231 0.0045  -0.1238 -0.0183 58  GLY A C   
446  O O   . GLY A 58  ? 0.6604 0.8141 0.3237 0.0073  -0.1203 -0.0016 58  GLY A O   
447  N N   . VAL A 59  ? 0.7639 0.9203 0.3951 0.0046  -0.1120 -0.0368 59  VAL A N   
448  C CA  . VAL A 59  ? 0.6377 0.7883 0.2772 0.0082  -0.0950 -0.0387 59  VAL A CA  
449  C C   . VAL A 59  ? 0.7655 0.9001 0.4366 0.0085  -0.0959 -0.0538 59  VAL A C   
450  O O   . VAL A 59  ? 0.8716 1.0029 0.5427 0.0066  -0.1012 -0.0765 59  VAL A O   
451  C CB  . VAL A 59  ? 0.6209 0.7747 0.2382 0.0093  -0.0800 -0.0513 59  VAL A CB  
452  C CG1 . VAL A 59  ? 0.6523 0.8032 0.2798 0.0134  -0.0620 -0.0488 59  VAL A CG1 
453  C CG2 . VAL A 59  ? 0.6414 0.8048 0.2320 0.0072  -0.0793 -0.0372 59  VAL A CG2 
454  N N   . LEU A 60  ? 0.6414 0.7639 0.3410 0.0103  -0.0906 -0.0404 60  LEU A N   
455  C CA  . LEU A 60  ? 0.6628 0.7693 0.3936 0.0105  -0.0890 -0.0496 60  LEU A CA  
456  C C   . LEU A 60  ? 0.7742 0.8719 0.5061 0.0142  -0.0743 -0.0635 60  LEU A C   
457  O O   . LEU A 60  ? 0.6983 0.7985 0.4249 0.0175  -0.0615 -0.0556 60  LEU A O   
458  C CB  . LEU A 60  ? 0.6503 0.7508 0.4074 0.0122  -0.0878 -0.0304 60  LEU A CB  
459  C CG  . LEU A 60  ? 0.6536 0.7412 0.4433 0.0124  -0.0860 -0.0339 60  LEU A CG  
460  C CD1 . LEU A 60  ? 0.6587 0.7481 0.4687 0.0135  -0.0903 -0.0167 60  LEU A CD1 
461  C CD2 . LEU A 60  ? 0.7428 0.8200 0.5397 0.0165  -0.0710 -0.0377 60  LEU A CD2 
462  N N   . ASP A 61  ? 0.7816 0.8689 0.5226 0.0135  -0.0766 -0.0840 61  ASP A N   
463  C CA  . ASP A 61  ? 0.6505 0.7272 0.3981 0.0187  -0.0639 -0.0972 61  ASP A CA  
464  C C   . ASP A 61  ? 0.6911 0.7576 0.4663 0.0217  -0.0560 -0.0837 61  ASP A C   
465  O O   . ASP A 61  ? 0.7168 0.7728 0.5161 0.0195  -0.0615 -0.0804 61  ASP A O   
466  C CB  . ASP A 61  ? 0.7794 0.8429 0.5349 0.0172  -0.0701 -0.1212 61  ASP A CB  
467  C CG  . ASP A 61  ? 0.9534 1.0044 0.7184 0.0245  -0.0579 -0.1349 61  ASP A CG  
468  O OD1 . ASP A 61  ? 0.9380 0.9774 0.7283 0.0273  -0.0523 -0.1255 61  ASP A OD1 
469  O OD2 . ASP A 61  ? 1.0485 1.1026 0.7954 0.0282  -0.0540 -0.1553 61  ASP A OD2 
470  N N   . ALA A 62  ? 0.7385 0.8101 0.5099 0.0263  -0.0430 -0.0762 62  ALA A N   
471  C CA  . ALA A 62  ? 0.6177 0.6824 0.4124 0.0295  -0.0358 -0.0650 62  ALA A CA  
472  C C   . ALA A 62  ? 0.6571 0.7166 0.4595 0.0362  -0.0248 -0.0768 62  ALA A C   
473  O O   . ALA A 62  ? 0.5932 0.6584 0.4003 0.0400  -0.0145 -0.0697 62  ALA A O   
474  C CB  . ALA A 62  ? 0.5226 0.5972 0.3126 0.0288  -0.0315 -0.0457 62  ALA A CB  
475  N N   . THR A 63  ? 0.7127 0.7612 0.5189 0.0379  -0.0278 -0.0952 63  THR A N   
476  C CA  . THR A 63  ? 0.7152 0.7582 0.5285 0.0461  -0.0183 -0.1087 63  THR A CA  
477  C C   . THR A 63  ? 0.6751 0.6986 0.5177 0.0491  -0.0201 -0.1087 63  THR A C   
478  O O   . THR A 63  ? 0.7319 0.7487 0.5847 0.0572  -0.0135 -0.1180 63  THR A O   
479  C CB  . THR A 63  ? 0.7826 0.8272 0.5772 0.0485  -0.0179 -0.1331 63  THR A CB  
480  O OG1 . THR A 63  ? 0.7520 0.7775 0.5569 0.0456  -0.0290 -0.1471 63  THR A OG1 
481  C CG2 . THR A 63  ? 0.6990 0.7639 0.4610 0.0439  -0.0191 -0.1319 63  THR A CG2 
482  N N   . THR A 64  ? 0.6907 0.7064 0.5474 0.0430  -0.0287 -0.0971 64  THR A N   
483  C CA  . THR A 64  ? 0.4867 0.4852 0.3698 0.0446  -0.0303 -0.0939 64  THR A CA  
484  C C   . THR A 64  ? 0.6060 0.6082 0.5018 0.0411  -0.0322 -0.0731 64  THR A C   
485  O O   . THR A 64  ? 0.6639 0.6780 0.5511 0.0364  -0.0352 -0.0637 64  THR A O   
486  C CB  . THR A 64  ? 0.5592 0.5401 0.4511 0.0394  -0.0402 -0.1065 64  THR A CB  
487  O OG1 . THR A 64  ? 0.8732 0.8596 0.7643 0.0293  -0.0501 -0.0988 64  THR A OG1 
488  C CG2 . THR A 64  ? 0.5606 0.5391 0.4359 0.0419  -0.0404 -0.1311 64  THR A CG2 
489  N N   . PHE A 65  ? 0.5763 0.5688 0.4928 0.0442  -0.0304 -0.0657 65  PHE A N   
490  C CA  . PHE A 65  ? 0.5386 0.5366 0.4663 0.0415  -0.0314 -0.0473 65  PHE A CA  
491  C C   . PHE A 65  ? 0.5800 0.5756 0.5153 0.0322  -0.0405 -0.0437 65  PHE A C   
492  O O   . PHE A 65  ? 0.7725 0.7549 0.7158 0.0277  -0.0463 -0.0526 65  PHE A O   
493  C CB  . PHE A 65  ? 0.3679 0.3599 0.3128 0.0476  -0.0270 -0.0388 65  PHE A CB  
494  C CG  . PHE A 65  ? 0.5948 0.5981 0.5354 0.0556  -0.0189 -0.0362 65  PHE A CG  
495  C CD1 . PHE A 65  ? 0.4085 0.4279 0.3413 0.0544  -0.0167 -0.0274 65  PHE A CD1 
496  C CD2 . PHE A 65  ? 0.5953 0.5933 0.5419 0.0645  -0.0141 -0.0432 65  PHE A CD2 
497  C CE1 . PHE A 65  ? 0.5033 0.5337 0.4347 0.0600  -0.0101 -0.0255 65  PHE A CE1 
498  C CE2 . PHE A 65  ? 0.5748 0.5869 0.5202 0.0712  -0.0071 -0.0409 65  PHE A CE2 
499  C CZ  . PHE A 65  ? 0.5830 0.6116 0.5209 0.0680  -0.0053 -0.0320 65  PHE A CZ  
500  N N   . GLN A 66  ? 0.5273 0.5365 0.4624 0.0295  -0.0416 -0.0312 66  GLN A N   
501  C CA  . GLN A 66  ? 0.4989 0.5116 0.4458 0.0218  -0.0488 -0.0246 66  GLN A CA  
502  C C   . GLN A 66  ? 0.6194 0.6286 0.5882 0.0202  -0.0471 -0.0128 66  GLN A C   
503  O O   . GLN A 66  ? 0.5332 0.5361 0.5076 0.0257  -0.0412 -0.0081 66  GLN A O   
504  C CB  . GLN A 66  ? 0.5423 0.5720 0.4818 0.0215  -0.0501 -0.0165 66  GLN A CB  
505  C CG  . GLN A 66  ? 0.6716 0.7063 0.5959 0.0180  -0.0575 -0.0240 66  GLN A CG  
506  C CD  . GLN A 66  ? 0.7685 0.8039 0.7038 0.0095  -0.0681 -0.0275 66  GLN A CD  
507  O OE1 . GLN A 66  ? 0.8950 0.9270 0.8513 0.0052  -0.0690 -0.0230 66  GLN A OE1 
508  N NE2 . GLN A 66  ? 0.7211 0.7626 0.6424 0.0062  -0.0765 -0.0348 66  GLN A NE2 
509  N N   . ASN A 67  ? 0.6701 0.6860 0.6514 0.0124  -0.0525 -0.0068 67  ASN A N   
510  C CA  . ASN A 67  ? 0.6039 0.6212 0.6060 0.0088  -0.0507 0.0066  67  ASN A CA  
511  C C   . ASN A 67  ? 0.6531 0.6817 0.6545 0.0159  -0.0423 0.0196  67  ASN A C   
512  O O   . ASN A 67  ? 0.5451 0.5858 0.5345 0.0213  -0.0397 0.0200  67  ASN A O   
513  C CB  . ASN A 67  ? 0.5867 0.6169 0.6017 -0.0004 -0.0571 0.0104  67  ASN A CB  
514  C CG  . ASN A 67  ? 0.5343 0.5531 0.5568 -0.0101 -0.0669 -0.0012 67  ASN A CG  
515  O OD1 . ASN A 67  ? 0.5278 0.5258 0.5557 -0.0119 -0.0676 -0.0077 67  ASN A OD1 
516  N ND2 . ASN A 67  ? 0.5855 0.6177 0.6097 -0.0160 -0.0752 -0.0046 67  ASN A ND2 
517  N N   . VAL A 68  ? 0.5956 0.6197 0.6100 0.0157  -0.0386 0.0305  68  VAL A N   
518  C CA  . VAL A 68  ? 0.4083 0.4467 0.4222 0.0214  -0.0316 0.0436  68  VAL A CA  
519  C C   . VAL A 68  ? 0.4594 0.5174 0.4844 0.0162  -0.0305 0.0541  68  VAL A C   
520  O O   . VAL A 68  ? 0.6324 0.6900 0.6732 0.0067  -0.0342 0.0571  68  VAL A O   
521  C CB  . VAL A 68  ? 0.4313 0.4590 0.4514 0.0250  -0.0281 0.0525  68  VAL A CB  
522  C CG1 . VAL A 68  ? 0.3519 0.3983 0.3686 0.0307  -0.0219 0.0655  68  VAL A CG1 
523  C CG2 . VAL A 68  ? 0.3633 0.3746 0.3749 0.0321  -0.0284 0.0407  68  VAL A CG2 
524  N N   . CYS A 69  ? 0.3942 0.4708 0.4121 0.0225  -0.0256 0.0582  69  CYS A N   
525  C CA  . CYS A 69  ? 0.3712 0.4703 0.3981 0.0205  -0.0232 0.0656  69  CYS A CA  
526  C C   . CYS A 69  ? 0.3736 0.4787 0.4148 0.0154  -0.0187 0.0812  69  CYS A C   
527  O O   . CYS A 69  ? 0.4766 0.5748 0.5141 0.0187  -0.0153 0.0885  69  CYS A O   
528  C CB  . CYS A 69  ? 0.4900 0.6045 0.5051 0.0300  -0.0186 0.0639  69  CYS A CB  
529  S SG  . CYS A 69  ? 0.5616 0.6725 0.5649 0.0341  -0.0237 0.0502  69  CYS A SG  
530  N N   . TYR A 70  ? 0.3183 0.4376 0.3766 0.0074  -0.0187 0.0876  70  TYR A N   
531  C CA  . TYR A 70  ? 0.3454 0.4699 0.4202 -0.0004 -0.0143 0.1047  70  TYR A CA  
532  C C   . TYR A 70  ? 0.4755 0.6140 0.5415 0.0066  -0.0051 0.1178  70  TYR A C   
533  O O   . TYR A 70  ? 0.4776 0.6381 0.5335 0.0145  0.0000  0.1156  70  TYR A O   
534  C CB  . TYR A 70  ? 0.4368 0.5817 0.5333 -0.0101 -0.0145 0.1095  70  TYR A CB  
535  C CG  . TYR A 70  ? 0.5417 0.6735 0.6605 -0.0246 -0.0181 0.1180  70  TYR A CG  
536  C CD1 . TYR A 70  ? 0.5629 0.6915 0.6899 -0.0290 -0.0121 0.1368  70  TYR A CD1 
537  C CD2 . TYR A 70  ? 0.4768 0.5984 0.6085 -0.0342 -0.0283 0.1073  70  TYR A CD2 
538  C CE1 . TYR A 70  ? 0.5087 0.6219 0.6586 -0.0430 -0.0157 0.1454  70  TYR A CE1 
539  C CE2 . TYR A 70  ? 0.4099 0.5176 0.5643 -0.0485 -0.0325 0.1132  70  TYR A CE2 
540  C CZ  . TYR A 70  ? 0.5721 0.6738 0.7366 -0.0531 -0.0260 0.1325  70  TYR A CZ  
541  O OH  . TYR A 70  ? 0.7272 0.8113 0.9169 -0.0682 -0.0304 0.1396  70  TYR A OH  
542  N N   . GLN A 71  ? 0.4704 0.5957 0.5399 0.0042  -0.0037 0.1310  71  GLN A N   
543  C CA  . GLN A 71  ? 0.4825 0.6201 0.5403 0.0117  0.0032  0.1441  71  GLN A CA  
544  C C   . GLN A 71  ? 0.5558 0.6848 0.6248 0.0056  0.0052  0.1663  71  GLN A C   
545  O O   . GLN A 71  ? 0.4329 0.5373 0.5188 -0.0032 0.0002  0.1690  71  GLN A O   
546  C CB  . GLN A 71  ? 0.4876 0.6152 0.5250 0.0237  0.0007  0.1324  71  GLN A CB  
547  C CG  . GLN A 71  ? 0.3299 0.4250 0.3694 0.0243  -0.0057 0.1271  71  GLN A CG  
548  C CD  . GLN A 71  ? 0.6041 0.6938 0.6266 0.0350  -0.0078 0.1124  71  GLN A CD  
549  O OE1 . GLN A 71  ? 0.4864 0.5701 0.5036 0.0420  -0.0081 0.1166  71  GLN A OE1 
550  N NE2 . GLN A 71  ? 0.4095 0.5025 0.4247 0.0360  -0.0096 0.0962  71  GLN A NE2 
551  N N   . TYR A 72  ? 0.5613 0.7104 0.6206 0.0105  0.0122  0.1822  72  TYR A N   
552  C CA  . TYR A 72  ? 0.6071 0.7496 0.6746 0.0062  0.0143  0.2070  72  TYR A CA  
553  C C   . TYR A 72  ? 0.6151 0.7259 0.6785 0.0133  0.0070  0.2035  72  TYR A C   
554  O O   . TYR A 72  ? 0.7357 0.8444 0.7830 0.0241  0.0041  0.1871  72  TYR A O   
555  C CB  . TYR A 72  ? 0.4875 0.6646 0.5411 0.0107  0.0236  0.2244  72  TYR A CB  
556  C CG  . TYR A 72  ? 0.4725 0.6438 0.5258 0.0109  0.0245  0.2511  72  TYR A CG  
557  C CD1 . TYR A 72  ? 0.5509 0.7134 0.5880 0.0231  0.0199  0.2512  72  TYR A CD1 
558  C CD2 . TYR A 72  ? 0.5713 0.7474 0.6417 -0.0013 0.0297  0.2777  72  TYR A CD2 
559  C CE1 . TYR A 72  ? 0.6169 0.7746 0.6542 0.0247  0.0195  0.2773  72  TYR A CE1 
560  C CE2 . TYR A 72  ? 0.5466 0.7164 0.6168 -0.0009 0.0302  0.3054  72  TYR A CE2 
561  C CZ  . TYR A 72  ? 0.6988 0.8591 0.7517 0.0128  0.0246  0.3051  72  TYR A CZ  
562  O OH  . TYR A 72  ? 0.7938 0.9478 0.8469 0.0145  0.0236  0.3339  72  TYR A OH  
563  N N   . VAL A 73  ? 0.5129 0.5986 0.5933 0.0072  0.0039  0.2184  73  VAL A N   
564  C CA  . VAL A 73  ? 0.6426 0.6973 0.7233 0.0153  -0.0029 0.2149  73  VAL A CA  
565  C C   . VAL A 73  ? 0.5511 0.6056 0.6319 0.0194  -0.0016 0.2424  73  VAL A C   
566  O O   . VAL A 73  ? 0.6189 0.6740 0.7137 0.0095  0.0015  0.2664  73  VAL A O   
567  C CB  . VAL A 73  ? 0.5431 0.5605 0.6451 0.0074  -0.0102 0.2041  73  VAL A CB  
568  C CG1 . VAL A 73  ? 0.4915 0.4779 0.5976 0.0168  -0.0158 0.2040  73  VAL A CG1 
569  C CG2 . VAL A 73  ? 0.4143 0.4314 0.5112 0.0061  -0.0133 0.1756  73  VAL A CG2 
570  N N   . ASP A 74  ? 0.5051 0.5600 0.5711 0.0338  -0.0044 0.2399  74  ASP A N   
571  C CA  . ASP A 74  ? 0.7328 0.7900 0.7963 0.0405  -0.0050 0.2656  74  ASP A CA  
572  C C   . ASP A 74  ? 0.7664 0.7862 0.8549 0.0366  -0.0099 0.2824  74  ASP A C   
573  O O   . ASP A 74  ? 0.8612 0.8482 0.9630 0.0388  -0.0161 0.2663  74  ASP A O   
574  C CB  . ASP A 74  ? 0.7568 0.8221 0.8025 0.0568  -0.0090 0.2551  74  ASP A CB  
575  C CG  . ASP A 74  ? 0.9217 1.0157 0.9508 0.0638  -0.0074 0.2774  74  ASP A CG  
576  O OD1 . ASP A 74  ? 1.1245 1.2530 1.1344 0.0637  -0.0018 0.2741  74  ASP A OD1 
577  O OD2 . ASP A 74  ? 0.6527 0.7349 0.6879 0.0700  -0.0120 0.2977  74  ASP A OD2 
578  N N   . THR A 75  ? 0.7917 0.8165 0.8866 0.0311  -0.0070 0.3151  75  THR A N   
579  C CA  . THR A 75  ? 0.9735 0.9608 1.0944 0.0270  -0.0120 0.3348  75  THR A CA  
580  C C   . THR A 75  ? 0.9555 0.9460 1.0713 0.0369  -0.0140 0.3648  75  THR A C   
581  O O   . THR A 75  ? 0.8647 0.8259 1.0003 0.0342  -0.0180 0.3780  75  THR A O   
582  C CB  . THR A 75  ? 0.9464 0.9272 1.0898 0.0065  -0.0078 0.3500  75  THR A CB  
583  O OG1 . THR A 75  ? 0.8353 0.8607 0.9642 -0.0004 0.0024  0.3601  75  THR A OG1 
584  C CG2 . THR A 75  ? 0.7973 0.7522 0.9586 -0.0026 -0.0121 0.3213  75  THR A CG2 
585  N N   . LEU A 76  ? 0.8712 0.8991 0.9585 0.0471  -0.0116 0.3622  76  LEU A N   
586  C CA  . LEU A 76  ? 0.7062 0.7470 0.7825 0.0542  -0.0130 0.3776  76  LEU A CA  
587  C C   . LEU A 76  ? 0.8890 0.8919 0.9826 0.0637  -0.0227 0.3805  76  LEU A C   
588  O O   . LEU A 76  ? 1.0400 1.0295 1.1440 0.0615  -0.0246 0.4012  76  LEU A O   
589  C CB  . LEU A 76  ? 0.6256 0.7063 0.6709 0.0653  -0.0121 0.3658  76  LEU A CB  
590  C CG  . LEU A 76  ? 0.8528 0.9470 0.8858 0.0749  -0.0163 0.3777  76  LEU A CG  
591  C CD1 . LEU A 76  ? 0.9133 1.0118 0.9506 0.0654  -0.0119 0.4061  76  LEU A CD1 
592  C CD2 . LEU A 76  ? 0.8085 0.9432 0.8124 0.0831  -0.0155 0.3631  76  LEU A CD2 
593  N N   . TYR A 77  ? 0.8455 0.8318 0.9432 0.0750  -0.0287 0.3593  77  TYR A N   
594  C CA  . TYR A 77  ? 0.7977 0.7518 0.9118 0.0874  -0.0375 0.3571  77  TYR A CA  
595  C C   . TYR A 77  ? 0.8964 0.8109 1.0351 0.0871  -0.0407 0.3390  77  TYR A C   
596  O O   . TYR A 77  ? 0.8535 0.7703 0.9876 0.0955  -0.0420 0.3128  77  TYR A O   
597  C CB  . TYR A 77  ? 0.6697 0.6470 0.7661 0.1046  -0.0419 0.3466  77  TYR A CB  
598  C CG  . TYR A 77  ? 0.7399 0.7515 0.8146 0.1064  -0.0413 0.3629  77  TYR A CG  
599  C CD1 . TYR A 77  ? 0.6763 0.6771 0.7580 0.1064  -0.0443 0.3871  77  TYR A CD1 
600  C CD2 . TYR A 77  ? 0.6625 0.7162 0.7099 0.1087  -0.0385 0.3528  77  TYR A CD2 
601  C CE1 . TYR A 77  ? 0.8325 0.8654 0.8938 0.1087  -0.0444 0.4022  77  TYR A CE1 
602  C CE2 . TYR A 77  ? 0.6741 0.7590 0.7018 0.1106  -0.0386 0.3650  77  TYR A CE2 
603  C CZ  . TYR A 77  ? 0.8839 0.9593 0.9180 0.1108  -0.0415 0.3904  77  TYR A CZ  
604  O OH  . TYR A 77  ? 0.7945 0.9017 0.8082 0.1131  -0.0421 0.4033  77  TYR A OH  
605  N N   . PRO A 78  ? 1.0748 0.9543 1.2386 0.0753  -0.0416 0.3475  78  PRO A N   
606  C CA  . PRO A 78  ? 0.9961 0.8345 1.1858 0.0704  -0.0450 0.3294  78  PRO A CA  
607  C C   . PRO A 78  ? 0.8828 0.6924 1.0852 0.0878  -0.0520 0.3082  78  PRO A C   
608  O O   . PRO A 78  ? 0.8503 0.6416 1.0635 0.0964  -0.0567 0.3186  78  PRO A O   
609  C CB  . PRO A 78  ? 1.0265 0.8394 1.2381 0.0542  -0.0451 0.3486  78  PRO A CB  
610  C CG  . PRO A 78  ? 1.0164 0.8675 1.2099 0.0464  -0.0382 0.3751  78  PRO A CG  
611  C CD  . PRO A 78  ? 1.0535 0.9345 1.2211 0.0641  -0.0390 0.3756  78  PRO A CD  
612  N N   . GLY A 79  ? 0.8701 0.6815 1.0648 0.0908  -0.0510 0.2707  79  GLY A N   
613  C CA  . GLY A 79  ? 0.9581 0.7452 1.1648 0.1064  -0.0556 0.2464  79  GLY A CA  
614  C C   . GLY A 79  ? 0.9345 0.7447 1.1306 0.1270  -0.0570 0.2459  79  GLY A C   
615  O O   . GLY A 79  ? 0.8915 0.6857 1.1002 0.1424  -0.0604 0.2294  79  GLY A O   
616  N N   . PHE A 80  ? 0.8585 0.7085 1.0323 0.1270  -0.0545 0.2630  80  PHE A N   
617  C CA  . PHE A 80  ? 0.6580 0.5368 0.8202 0.1439  -0.0569 0.2645  80  PHE A CA  
618  C C   . PHE A 80  ? 0.5879 0.4941 0.7300 0.1437  -0.0520 0.2334  80  PHE A C   
619  O O   . PHE A 80  ? 0.6594 0.5841 0.7834 0.1305  -0.0466 0.2276  80  PHE A O   
620  C CB  . PHE A 80  ? 0.7098 0.6182 0.8547 0.1411  -0.0570 0.2950  80  PHE A CB  
621  C CG  . PHE A 80  ? 0.6933 0.6361 0.8215 0.1541  -0.0601 0.2926  80  PHE A CG  
622  C CD1 . PHE A 80  ? 0.7757 0.7095 0.9163 0.1694  -0.0672 0.2923  80  PHE A CD1 
623  C CD2 . PHE A 80  ? 0.6405 0.6250 0.7418 0.1505  -0.0566 0.2896  80  PHE A CD2 
624  C CE1 . PHE A 80  ? 0.7592 0.7259 0.8870 0.1799  -0.0714 0.2901  80  PHE A CE1 
625  C CE2 . PHE A 80  ? 0.6724 0.6877 0.7602 0.1603  -0.0607 0.2855  80  PHE A CE2 
626  C CZ  . PHE A 80  ? 0.7680 0.7753 0.8696 0.1745  -0.0683 0.2863  80  PHE A CZ  
627  N N   . GLU A 81  ? 0.6132 0.5214 0.7605 0.1585  -0.0538 0.2141  81  GLU A N   
628  C CA  . GLU A 81  ? 0.5690 0.4980 0.7018 0.1586  -0.0491 0.1842  81  GLU A CA  
629  C C   . GLU A 81  ? 0.6754 0.6460 0.7828 0.1543  -0.0470 0.1890  81  GLU A C   
630  O O   . GLU A 81  ? 0.7187 0.7035 0.8103 0.1453  -0.0418 0.1709  81  GLU A O   
631  C CB  . GLU A 81  ? 0.7837 0.7121 0.9303 0.1766  -0.0511 0.1683  81  GLU A CB  
632  C CG  . GLU A 81  ? 0.9857 0.9408 1.1183 0.1773  -0.0460 0.1418  81  GLU A CG  
633  C CD  . GLU A 81  ? 1.0894 1.0252 1.2238 0.1725  -0.0407 0.1133  81  GLU A CD  
634  O OE1 . GLU A 81  ? 1.0772 0.9790 1.2303 0.1763  -0.0424 0.1085  81  GLU A OE1 
635  O OE2 . GLU A 81  ? 1.0370 0.9915 1.1542 0.1651  -0.0353 0.0959  81  GLU A OE2 
636  N N   . GLY A 82  ? 0.6435 0.6331 0.7471 0.1612  -0.0516 0.2132  82  GLY A N   
637  C CA  . GLY A 82  ? 0.6620 0.6916 0.7414 0.1583  -0.0509 0.2179  82  GLY A CA  
638  C C   . GLY A 82  ? 0.6863 0.7236 0.7485 0.1416  -0.0439 0.2131  82  GLY A C   
639  O O   . GLY A 82  ? 0.7192 0.7812 0.7643 0.1382  -0.0410 0.1978  82  GLY A O   
640  N N   . THR A 83  ? 0.5934 0.6092 0.6627 0.1312  -0.0416 0.2261  83  THR A N   
641  C CA  . THR A 83  ? 0.5201 0.5434 0.5779 0.1156  -0.0350 0.2226  83  THR A CA  
642  C C   . THR A 83  ? 0.6849 0.6866 0.7495 0.1075  -0.0321 0.1971  83  THR A C   
643  O O   . THR A 83  ? 0.5034 0.5201 0.5545 0.1005  -0.0280 0.1809  83  THR A O   
644  C CB  . THR A 83  ? 0.6453 0.6653 0.7067 0.1064  -0.0332 0.2527  83  THR A CB  
645  O OG1 . THR A 83  ? 0.7567 0.7374 0.8435 0.1045  -0.0363 0.2616  83  THR A OG1 
646  C CG2 . THR A 83  ? 0.5023 0.5495 0.5507 0.1136  -0.0355 0.2787  83  THR A CG2 
647  N N   . GLU A 84  ? 0.5881 0.5551 0.6736 0.1093  -0.0350 0.1929  84  GLU A N   
648  C CA  . GLU A 84  ? 0.5661 0.5124 0.6572 0.1013  -0.0334 0.1692  84  GLU A CA  
649  C C   . GLU A 84  ? 0.5463 0.5102 0.6215 0.1028  -0.0304 0.1426  84  GLU A C   
650  O O   . GLU A 84  ? 0.6875 0.6523 0.7557 0.0925  -0.0278 0.1292  84  GLU A O   
651  C CB  . GLU A 84  ? 0.6979 0.6062 0.8122 0.1070  -0.0376 0.1631  84  GLU A CB  
652  C CG  . GLU A 84  ? 0.8966 0.7795 1.0310 0.1025  -0.0411 0.1890  84  GLU A CG  
653  C CD  . GLU A 84  ? 1.0515 0.9289 1.1889 0.0830  -0.0389 0.1951  84  GLU A CD  
654  O OE1 . GLU A 84  ? 1.0338 0.9217 1.1603 0.0743  -0.0360 0.1755  84  GLU A OE1 
655  O OE2 . GLU A 84  ? 1.0923 0.9563 1.2445 0.0762  -0.0403 0.2208  84  GLU A OE2 
656  N N   . MET A 85  ? 0.5491 0.5278 0.6199 0.1153  -0.0312 0.1365  85  MET A N   
657  C CA  . MET A 85  ? 0.4707 0.4653 0.5293 0.1168  -0.0282 0.1133  85  MET A CA  
658  C C   . MET A 85  ? 0.5849 0.6021 0.6244 0.1067  -0.0247 0.1098  85  MET A C   
659  O O   . MET A 85  ? 0.6532 0.6792 0.6833 0.1050  -0.0222 0.0918  85  MET A O   
660  C CB  . MET A 85  ? 0.4128 0.4253 0.4729 0.1307  -0.0300 0.1126  85  MET A CB  
661  C CG  . MET A 85  ? 0.4114 0.4504 0.4627 0.1336  -0.0329 0.1323  85  MET A CG  
662  S SD  . MET A 85  ? 0.6297 0.6942 0.6844 0.1489  -0.0373 0.1313  85  MET A SD  
663  C CE  . MET A 85  ? 0.5298 0.6121 0.5732 0.1436  -0.0322 0.1041  85  MET A CE  
664  N N   . TRP A 86  ? 0.4810 0.5082 0.5155 0.1005  -0.0242 0.1275  86  TRP A N   
665  C CA  . TRP A 86  ? 0.3632 0.4112 0.3822 0.0925  -0.0207 0.1236  86  TRP A CA  
666  C C   . TRP A 86  ? 0.3650 0.4013 0.3884 0.0799  -0.0188 0.1237  86  TRP A C   
667  O O   . TRP A 86  ? 0.4712 0.5202 0.4855 0.0735  -0.0162 0.1162  86  TRP A O   
668  C CB  . TRP A 86  ? 0.4080 0.4827 0.4163 0.0951  -0.0205 0.1403  86  TRP A CB  
669  C CG  . TRP A 86  ? 0.4416 0.5304 0.4471 0.1070  -0.0244 0.1416  86  TRP A CG  
670  C CD1 . TRP A 86  ? 0.4741 0.5644 0.4854 0.1152  -0.0286 0.1603  86  TRP A CD1 
671  C CD2 . TRP A 86  ? 0.5169 0.6213 0.5155 0.1115  -0.0252 0.1243  86  TRP A CD2 
672  N NE1 . TRP A 86  ? 0.5462 0.6541 0.5545 0.1251  -0.0326 0.1548  86  TRP A NE1 
673  C CE2 . TRP A 86  ? 0.5448 0.6617 0.5462 0.1223  -0.0303 0.1324  86  TRP A CE2 
674  C CE3 . TRP A 86  ? 0.3974 0.5063 0.3891 0.1070  -0.0225 0.1042  86  TRP A CE3 
675  C CZ2 . TRP A 86  ? 0.5155 0.6509 0.5148 0.1277  -0.0327 0.1196  86  TRP A CZ2 
676  C CZ3 . TRP A 86  ? 0.3171 0.4420 0.3061 0.1118  -0.0243 0.0929  86  TRP A CZ3 
677  C CH2 . TRP A 86  ? 0.5136 0.6524 0.5072 0.1216  -0.0293 0.0999  86  TRP A CH2 
678  N N   . ASN A 87  ? 0.5717 0.5833 0.6115 0.0766  -0.0209 0.1319  87  ASN A N   
679  C CA  . ASN A 87  ? 0.3917 0.3912 0.4402 0.0636  -0.0205 0.1322  87  ASN A CA  
680  C C   . ASN A 87  ? 0.5288 0.5181 0.5752 0.0597  -0.0217 0.1075  87  ASN A C   
681  O O   . ASN A 87  ? 0.5096 0.4881 0.5549 0.0669  -0.0231 0.0922  87  ASN A O   
682  C CB  . ASN A 87  ? 0.5271 0.5003 0.5965 0.0607  -0.0235 0.1475  87  ASN A CB  
683  C CG  . ASN A 87  ? 0.5595 0.5454 0.6310 0.0591  -0.0214 0.1773  87  ASN A CG  
684  O OD1 . ASN A 87  ? 0.6018 0.6173 0.6599 0.0566  -0.0169 0.1849  87  ASN A OD1 
685  N ND2 . ASN A 87  ? 0.5317 0.4954 0.6199 0.0608  -0.0246 0.1945  87  ASN A ND2 
686  N N   . PRO A 88  ? 0.5797 0.5747 0.6256 0.0486  -0.0212 0.1041  88  PRO A N   
687  C CA  . PRO A 88  ? 0.5762 0.5644 0.6183 0.0439  -0.0236 0.0829  88  PRO A CA  
688  C C   . PRO A 88  ? 0.5676 0.5264 0.6195 0.0446  -0.0279 0.0701  88  PRO A C   
689  O O   . PRO A 88  ? 0.5986 0.5370 0.6682 0.0415  -0.0305 0.0788  88  PRO A O   
690  C CB  . PRO A 88  ? 0.4997 0.4959 0.5487 0.0312  -0.0241 0.0884  88  PRO A CB  
691  C CG  . PRO A 88  ? 0.5124 0.5293 0.5615 0.0311  -0.0192 0.1089  88  PRO A CG  
692  C CD  . PRO A 88  ? 0.5222 0.5317 0.5732 0.0397  -0.0185 0.1218  88  PRO A CD  
693  N N   . ASN A 89  ? 0.4863 0.4431 0.5271 0.0486  -0.0283 0.0495  89  ASN A N   
694  C CA  . ASN A 89  ? 0.4043 0.3369 0.4507 0.0515  -0.0313 0.0329  89  ASN A CA  
695  C C   . ASN A 89  ? 0.4105 0.3394 0.4503 0.0430  -0.0351 0.0145  89  ASN A C   
696  O O   . ASN A 89  ? 0.5135 0.4303 0.5491 0.0466  -0.0364 -0.0046 89  ASN A O   
697  C CB  . ASN A 89  ? 0.4023 0.3374 0.4422 0.0654  -0.0277 0.0245  89  ASN A CB  
698  C CG  . ASN A 89  ? 0.6844 0.6429 0.7042 0.0673  -0.0238 0.0160  89  ASN A CG  
699  O OD1 . ASN A 89  ? 0.3641 0.3365 0.3749 0.0599  -0.0240 0.0186  89  ASN A OD1 
700  N ND2 . ASN A 89  ? 0.6260 0.5893 0.6411 0.0774  -0.0202 0.0065  89  ASN A ND2 
701  N N   . ARG A 90  ? 0.4455 0.3877 0.4838 0.0327  -0.0369 0.0203  90  ARG A N   
702  C CA  A ARG A 90  ? 0.4461 0.3859 0.4823 0.0230  -0.0430 0.0065  90  ARG A CA  
703  C CA  B ARG A 90  ? 0.4437 0.3841 0.4795 0.0230  -0.0429 0.0066  90  ARG A CA  
704  C C   . ARG A 90  ? 0.4904 0.4380 0.5410 0.0109  -0.0457 0.0203  90  ARG A C   
705  O O   . ARG A 90  ? 0.5407 0.5016 0.5962 0.0112  -0.0411 0.0390  90  ARG A O   
706  C CB  A ARG A 90  ? 0.4420 0.3993 0.4556 0.0254  -0.0421 -0.0047 90  ARG A CB  
707  C CB  B ARG A 90  ? 0.4297 0.3887 0.4431 0.0254  -0.0418 -0.0034 90  ARG A CB  
708  C CG  A ARG A 90  ? 0.5075 0.4608 0.5068 0.0354  -0.0386 -0.0195 90  ARG A CG  
709  C CG  B ARG A 90  ? 0.4855 0.4430 0.4841 0.0359  -0.0375 -0.0160 90  ARG A CG  
710  C CD  A ARG A 90  ? 0.6009 0.5323 0.6036 0.0353  -0.0427 -0.0385 90  ARG A CD  
711  C CD  B ARG A 90  ? 0.5729 0.5091 0.5741 0.0373  -0.0406 -0.0345 90  ARG A CD  
712  N NE  A ARG A 90  ? 0.5978 0.5295 0.5880 0.0462  -0.0373 -0.0524 90  ARG A NE  
713  N NE  B ARG A 90  ? 0.6316 0.5724 0.6155 0.0337  -0.0441 -0.0520 90  ARG A NE  
714  C CZ  A ARG A 90  ? 0.5818 0.5031 0.5816 0.0567  -0.0330 -0.0533 90  ARG A CZ  
715  C CZ  B ARG A 90  ? 0.6847 0.6101 0.6678 0.0320  -0.0489 -0.0714 90  ARG A CZ  
716  N NH1 A ARG A 90  ? 0.4398 0.3470 0.4603 0.0577  -0.0344 -0.0397 90  ARG A NH1 
717  N NH1 B ARG A 90  ? 0.6811 0.5820 0.6827 0.0338  -0.0507 -0.0763 90  ARG A NH1 
718  N NH2 A ARG A 90  ? 0.5640 0.4906 0.5536 0.0665  -0.0272 -0.0667 90  ARG A NH2 
719  N NH2 B ARG A 90  ? 0.6992 0.6333 0.6628 0.0289  -0.0524 -0.0861 90  ARG A NH2 
720  N N   . GLU A 91  ? 0.5113 0.4530 0.5690 0.0002  -0.0533 0.0105  91  GLU A N   
721  C CA  . GLU A 91  ? 0.4112 0.3626 0.4864 -0.0125 -0.0563 0.0222  91  GLU A CA  
722  C C   . GLU A 91  ? 0.6317 0.6137 0.7021 -0.0111 -0.0507 0.0369  91  GLU A C   
723  O O   . GLU A 91  ? 0.5165 0.5135 0.5679 -0.0041 -0.0488 0.0314  91  GLU A O   
724  C CB  . GLU A 91  ? 0.4232 0.3722 0.5011 -0.0227 -0.0665 0.0057  91  GLU A CB  
725  C CG  . GLU A 91  ? 0.5405 0.5042 0.6390 -0.0363 -0.0703 0.0163  91  GLU A CG  
726  C CD  . GLU A 91  ? 0.7228 0.6894 0.8220 -0.0456 -0.0820 -0.0010 91  GLU A CD  
727  O OE1 . GLU A 91  ? 0.8347 0.7942 0.9134 -0.0403 -0.0861 -0.0204 91  GLU A OE1 
728  O OE2 . GLU A 91  ? 0.7889 0.7676 0.9090 -0.0581 -0.0870 0.0051  91  GLU A OE2 
729  N N   . LEU A 92  ? 0.4466 0.4374 0.5352 -0.0182 -0.0479 0.0554  92  LEU A N   
730  C CA  . LEU A 92  ? 0.4525 0.4736 0.5397 -0.0171 -0.0420 0.0683  92  LEU A CA  
731  C C   . LEU A 92  ? 0.4606 0.4997 0.5541 -0.0248 -0.0474 0.0624  92  LEU A C   
732  O O   . LEU A 92  ? 0.4192 0.4533 0.5314 -0.0371 -0.0542 0.0604  92  LEU A O   
733  C CB  . LEU A 92  ? 0.4685 0.4961 0.5718 -0.0213 -0.0355 0.0912  92  LEU A CB  
734  C CG  . LEU A 92  ? 0.4692 0.4907 0.5634 -0.0110 -0.0291 0.1024  92  LEU A CG  
735  C CD1 . LEU A 92  ? 0.3820 0.4138 0.4907 -0.0167 -0.0232 0.1271  92  LEU A CD1 
736  C CD2 . LEU A 92  ? 0.5894 0.6291 0.6602 0.0017  -0.0246 0.0973  92  LEU A CD2 
737  N N   . SER A 93  ? 0.4961 0.5557 0.5758 -0.0176 -0.0455 0.0595  93  SER A N   
738  C CA  . SER A 93  ? 0.3768 0.4558 0.4636 -0.0226 -0.0511 0.0557  93  SER A CA  
739  C C   . SER A 93  ? 0.5145 0.6175 0.5921 -0.0129 -0.0459 0.0588  93  SER A C   
740  O O   . SER A 93  ? 0.6199 0.7201 0.6792 -0.0024 -0.0406 0.0575  93  SER A O   
741  C CB  . SER A 93  ? 0.3728 0.4391 0.4509 -0.0253 -0.0622 0.0376  93  SER A CB  
742  O OG  . SER A 93  ? 0.4588 0.5453 0.5395 -0.0271 -0.0688 0.0342  93  SER A OG  
743  N N   . GLU A 94  ? 0.4232 0.5501 0.5159 -0.0165 -0.0476 0.0624  94  GLU A N   
744  C CA  . GLU A 94  ? 0.4516 0.6007 0.5396 -0.0067 -0.0436 0.0636  94  GLU A CA  
745  C C   . GLU A 94  ? 0.3899 0.5315 0.4603 -0.0006 -0.0511 0.0514  94  GLU A C   
746  O O   . GLU A 94  ? 0.5822 0.7322 0.6435 0.0093  -0.0486 0.0503  94  GLU A O   
747  C CB  . GLU A 94  ? 0.4502 0.6288 0.5631 -0.0115 -0.0434 0.0705  94  GLU A CB  
748  C CG  . GLU A 94  ? 0.3359 0.5323 0.4636 -0.0144 -0.0320 0.0855  94  GLU A CG  
749  C CD  . GLU A 94  ? 0.4921 0.7232 0.6450 -0.0173 -0.0301 0.0912  94  GLU A CD  
750  O OE1 . GLU A 94  ? 0.5761 0.8138 0.7530 -0.0309 -0.0345 0.0957  94  GLU A OE1 
751  O OE2 . GLU A 94  ? 0.4675 0.7199 0.6180 -0.0061 -0.0242 0.0904  94  GLU A OE2 
752  N N   . ASP A 95  ? 0.4259 0.5516 0.4917 -0.0068 -0.0604 0.0423  95  ASP A N   
753  C CA  . ASP A 95  ? 0.4593 0.5761 0.5040 -0.0020 -0.0668 0.0319  95  ASP A CA  
754  C C   . ASP A 95  ? 0.4225 0.5187 0.4475 0.0031  -0.0613 0.0276  95  ASP A C   
755  O O   . ASP A 95  ? 0.5663 0.6450 0.5872 -0.0013 -0.0638 0.0204  95  ASP A O   
756  C CB  . ASP A 95  ? 0.5200 0.6330 0.5667 -0.0110 -0.0796 0.0226  95  ASP A CB  
757  C CG  . ASP A 95  ? 0.5785 0.6854 0.6006 -0.0062 -0.0859 0.0136  95  ASP A CG  
758  O OD1 . ASP A 95  ? 0.6280 0.7284 0.6323 0.0025  -0.0794 0.0143  95  ASP A OD1 
759  O OD2 . ASP A 95  ? 0.5800 0.6899 0.6004 -0.0119 -0.0975 0.0063  95  ASP A OD2 
760  N N   . CYS A 96  ? 0.5410 0.6400 0.5554 0.0125  -0.0540 0.0308  96  CYS A N   
761  C CA  . CYS A 96  ? 0.4313 0.5163 0.4317 0.0177  -0.0476 0.0289  96  CYS A CA  
762  C C   . CYS A 96  ? 0.4720 0.5582 0.4565 0.0262  -0.0447 0.0270  96  CYS A C   
763  O O   . CYS A 96  ? 0.5478 0.6261 0.5227 0.0304  -0.0394 0.0254  96  CYS A O   
764  C CB  . CYS A 96  ? 0.5359 0.6241 0.5464 0.0186  -0.0396 0.0385  96  CYS A CB  
765  S SG  . CYS A 96  ? 0.4522 0.5654 0.4687 0.0249  -0.0332 0.0470  96  CYS A SG  
766  N N   . LEU A 97  ? 0.4557 0.5518 0.4397 0.0287  -0.0484 0.0277  97  LEU A N   
767  C CA  . LEU A 97  ? 0.4047 0.4992 0.3766 0.0355  -0.0464 0.0269  97  LEU A CA  
768  C C   . LEU A 97  ? 0.5272 0.6098 0.4803 0.0345  -0.0490 0.0216  97  LEU A C   
769  O O   . LEU A 97  ? 0.4023 0.4860 0.3489 0.0334  -0.0557 0.0215  97  LEU A O   
770  C CB  . LEU A 97  ? 0.4671 0.5742 0.4477 0.0398  -0.0495 0.0305  97  LEU A CB  
771  C CG  . LEU A 97  ? 0.4547 0.5777 0.4526 0.0419  -0.0444 0.0347  97  LEU A CG  
772  C CD1 . LEU A 97  ? 0.3390 0.4758 0.3478 0.0485  -0.0462 0.0361  97  LEU A CD1 
773  C CD2 . LEU A 97  ? 0.3368 0.4584 0.3303 0.0451  -0.0354 0.0352  97  LEU A CD2 
774  N N   . TYR A 98  ? 0.5329 0.6062 0.4774 0.0352  -0.0434 0.0179  98  TYR A N   
775  C CA  . TYR A 98  ? 0.4965 0.5620 0.4241 0.0341  -0.0436 0.0122  98  TYR A CA  
776  C C   . TYR A 98  ? 0.4679 0.5309 0.3909 0.0382  -0.0356 0.0120  98  TYR A C   
777  O O   . TYR A 98  ? 0.6030 0.6672 0.5346 0.0409  -0.0312 0.0135  98  TYR A O   
778  C CB  . TYR A 98  ? 0.5405 0.5983 0.4662 0.0299  -0.0458 0.0040  98  TYR A CB  
779  C CG  . TYR A 98  ? 0.4549 0.5162 0.3872 0.0240  -0.0552 0.0026  98  TYR A CG  
780  C CD1 . TYR A 98  ? 0.3193 0.3840 0.2714 0.0207  -0.0567 0.0066  98  TYR A CD1 
781  C CD2 . TYR A 98  ? 0.3297 0.3934 0.2488 0.0211  -0.0629 -0.0018 98  TYR A CD2 
782  C CE1 . TYR A 98  ? 0.3604 0.4309 0.3220 0.0142  -0.0657 0.0053  98  TYR A CE1 
783  C CE2 . TYR A 98  ? 0.4030 0.4726 0.3295 0.0154  -0.0731 -0.0037 98  TYR A CE2 
784  C CZ  . TYR A 98  ? 0.3681 0.4410 0.3174 0.0116  -0.0745 -0.0006 98  TYR A CZ  
785  O OH  . TYR A 98  ? 0.5442 0.6253 0.5042 0.0047  -0.0850 -0.0026 98  TYR A OH  
786  N N   . LEU A 99  ? 0.4905 0.5523 0.4005 0.0383  -0.0340 0.0113  99  LEU A N   
787  C CA  . LEU A 99  ? 0.5124 0.5741 0.4206 0.0408  -0.0267 0.0104  99  LEU A CA  
788  C C   . LEU A 99  ? 0.4800 0.5399 0.3768 0.0400  -0.0227 0.0037  99  LEU A C   
789  O O   . LEU A 99  ? 0.4116 0.4697 0.2977 0.0374  -0.0259 -0.0008 99  LEU A O   
790  C CB  . LEU A 99  ? 0.5130 0.5768 0.4215 0.0415  -0.0259 0.0160  99  LEU A CB  
791  C CG  . LEU A 99  ? 0.5589 0.6211 0.4583 0.0389  -0.0304 0.0214  99  LEU A CG  
792  C CD1 . LEU A 99  ? 0.4386 0.5012 0.3240 0.0358  -0.0258 0.0212  99  LEU A CD1 
793  C CD2 . LEU A 99  ? 0.3835 0.4441 0.2917 0.0410  -0.0327 0.0274  99  LEU A CD2 
794  N N   . ASN A 100 ? 0.3818 0.4442 0.2816 0.0428  -0.0158 0.0019  100 ASN A N   
795  C CA  . ASN A 100 ? 0.4852 0.5494 0.3777 0.0439  -0.0100 -0.0052 100 ASN A CA  
796  C C   . ASN A 100 ? 0.5314 0.6041 0.4212 0.0427  -0.0039 -0.0019 100 ASN A C   
797  O O   . ASN A 100 ? 0.4876 0.5628 0.3864 0.0425  -0.0036 0.0035  100 ASN A O   
798  C CB  . ASN A 100 ? 0.5311 0.5923 0.4347 0.0492  -0.0074 -0.0107 100 ASN A CB  
799  C CG  . ASN A 100 ? 0.4575 0.5095 0.3687 0.0489  -0.0132 -0.0106 100 ASN A CG  
800  O OD1 . ASN A 100 ? 0.5554 0.6012 0.4612 0.0457  -0.0176 -0.0158 100 ASN A OD1 
801  N ND2 . ASN A 100 ? 0.3933 0.4458 0.3172 0.0513  -0.0135 -0.0043 100 ASN A ND2 
802  N N   . VAL A 101 ? 0.5643 0.6425 0.4421 0.0414  0.0013  -0.0058 101 VAL A N   
803  C CA  . VAL A 101 ? 0.5888 0.6773 0.4656 0.0386  0.0083  -0.0014 101 VAL A CA  
804  C C   . VAL A 101 ? 0.5969 0.6958 0.4719 0.0419  0.0173  -0.0103 101 VAL A C   
805  O O   . VAL A 101 ? 0.6626 0.7610 0.5253 0.0437  0.0184  -0.0190 101 VAL A O   
806  C CB  . VAL A 101 ? 0.4951 0.5844 0.3573 0.0320  0.0067  0.0079  101 VAL A CB  
807  C CG1 . VAL A 101 ? 0.5010 0.5993 0.3669 0.0271  0.0138  0.0155  101 VAL A CG1 
808  C CG2 . VAL A 101 ? 0.4636 0.5425 0.3288 0.0309  -0.0029 0.0152  101 VAL A CG2 
809  N N   . TRP A 102 ? 0.5727 0.6821 0.4612 0.0432  0.0234  -0.0097 102 TRP A N   
810  C CA  . TRP A 102 ? 0.5895 0.7139 0.4795 0.0466  0.0334  -0.0170 102 TRP A CA  
811  C C   . TRP A 102 ? 0.6179 0.7576 0.5098 0.0393  0.0405  -0.0087 102 TRP A C   
812  O O   . TRP A 102 ? 0.5142 0.6529 0.4178 0.0346  0.0373  -0.0005 102 TRP A O   
813  C CB  . TRP A 102 ? 0.4990 0.6267 0.4090 0.0550  0.0345  -0.0228 102 TRP A CB  
814  C CG  . TRP A 102 ? 0.5617 0.6753 0.4748 0.0627  0.0295  -0.0301 102 TRP A CG  
815  C CD1 . TRP A 102 ? 0.5233 0.6350 0.4364 0.0703  0.0330  -0.0423 102 TRP A CD1 
816  C CD2 . TRP A 102 ? 0.4876 0.5872 0.4070 0.0635  0.0206  -0.0254 102 TRP A CD2 
817  N NE1 . TRP A 102 ? 0.6100 0.7044 0.5303 0.0749  0.0259  -0.0443 102 TRP A NE1 
818  C CE2 . TRP A 102 ? 0.5943 0.6827 0.5182 0.0704  0.0188  -0.0329 102 TRP A CE2 
819  C CE3 . TRP A 102 ? 0.5848 0.6809 0.5073 0.0593  0.0145  -0.0159 102 TRP A CE3 
820  C CZ2 . TRP A 102 ? 0.6670 0.7418 0.5982 0.0717  0.0114  -0.0285 102 TRP A CZ2 
821  C CZ3 . TRP A 102 ? 0.5540 0.6395 0.4822 0.0619  0.0081  -0.0132 102 TRP A CZ3 
822  C CH2 . TRP A 102 ? 0.5774 0.6528 0.5099 0.0672  0.0068  -0.0182 102 TRP A CH2 
823  N N   . THR A 103 ? 0.5194 0.6741 0.4008 0.0382  0.0502  -0.0115 103 THR A N   
824  C CA  . THR A 103 ? 0.4714 0.6442 0.3557 0.0303  0.0592  -0.0026 103 THR A CA  
825  C C   . THR A 103 ? 0.5165 0.7123 0.3996 0.0347  0.0724  -0.0118 103 THR A C   
826  O O   . THR A 103 ? 0.5296 0.7242 0.4021 0.0430  0.0741  -0.0251 103 THR A O   
827  C CB  . THR A 103 ? 0.6335 0.8025 0.4981 0.0204  0.0581  0.0108  103 THR A CB  
828  O OG1 . THR A 103 ? 0.6935 0.8629 0.5329 0.0232  0.0589  0.0046  103 THR A OG1 
829  C CG2 . THR A 103 ? 0.6503 0.7979 0.5179 0.0169  0.0457  0.0200  103 THR A CG2 
830  N N   . PRO A 104 ? 0.4979 0.7155 0.3933 0.0289  0.0820  -0.0055 104 PRO A N   
831  C CA  . PRO A 104 ? 0.5020 0.7476 0.3970 0.0318  0.0969  -0.0121 104 PRO A CA  
832  C C   . PRO A 104 ? 0.5707 0.8190 0.4345 0.0334  0.1019  -0.0177 104 PRO A C   
833  O O   . PRO A 104 ? 0.6927 0.9238 0.5351 0.0293  0.0937  -0.0121 104 PRO A O   
834  C CB  . PRO A 104 ? 0.5263 0.7902 0.4330 0.0187  0.1041  0.0033  104 PRO A CB  
835  C CG  . PRO A 104 ? 0.3651 0.6143 0.2933 0.0152  0.0928  0.0087  104 PRO A CG  
836  C CD  . PRO A 104 ? 0.4139 0.6323 0.3290 0.0197  0.0790  0.0066  104 PRO A CD  
837  N N   . TYR A 105 ? 0.5244 0.7964 0.3860 0.0402  0.1151  -0.0298 105 TYR A N   
838  C CA  . TYR A 105 ? 0.5764 0.8554 0.4065 0.0424  0.1208  -0.0380 105 TYR A CA  
839  C C   . TYR A 105 ? 0.6367 0.9536 0.4635 0.0408  0.1400  -0.0380 105 TYR A C   
840  O O   . TYR A 105 ? 0.7301 1.0660 0.5745 0.0505  0.1499  -0.0515 105 TYR A O   
841  C CB  . TYR A 105 ? 0.5887 0.8532 0.4147 0.0565  0.1159  -0.0612 105 TYR A CB  
842  C CG  . TYR A 105 ? 0.5110 0.7833 0.3043 0.0595  0.1208  -0.0742 105 TYR A CG  
843  C CD1 . TYR A 105 ? 0.5412 0.8376 0.3312 0.0619  0.1354  -0.0815 105 TYR A CD1 
844  C CD2 . TYR A 105 ? 0.5058 0.7562 0.2759 0.0580  0.1082  -0.0780 105 TYR A CD2 
845  C CE1 . TYR A 105 ? 0.6889 0.9843 0.4523 0.0629  0.1366  -0.0924 105 TYR A CE1 
846  C CE2 . TYR A 105 ? 0.5446 0.7986 0.2870 0.0592  0.1098  -0.0901 105 TYR A CE2 
847  C CZ  . TYR A 105 ? 0.5571 0.8312 0.2968 0.0614  0.1235  -0.0968 105 TYR A CZ  
848  O OH  . TYR A 105 ? 0.7441 1.0189 0.4578 0.0622  0.1237  -0.1085 105 TYR A OH  
849  N N   . PRO A 106 ? 0.7461 1.0727 0.5515 0.0286  0.1447  -0.0218 106 PRO A N   
850  C CA  . PRO A 106 ? 0.8085 1.1145 0.5916 0.0193  0.1328  -0.0058 106 PRO A CA  
851  C C   . PRO A 106 ? 0.7275 1.0151 0.5327 0.0095  0.1230  0.0132  106 PRO A C   
852  O O   . PRO A 106 ? 0.6827 0.9809 0.5166 0.0060  0.1281  0.0178  106 PRO A O   
853  C CB  . PRO A 106 ? 0.8351 1.1546 0.5963 0.0101  0.1408  0.0067  106 PRO A CB  
854  C CG  . PRO A 106 ? 0.7789 1.1272 0.5618 0.0086  0.1574  0.0072  106 PRO A CG  
855  C CD  . PRO A 106 ? 0.6503 1.0026 0.4547 0.0236  0.1597  -0.0169 106 PRO A CD  
856  N N   . ARG A 107 ? 0.7760 1.0375 0.5685 0.0054  0.1088  0.0228  107 ARG A N   
857  C CA  . ARG A 107 ? 0.7483 0.9901 0.5583 -0.0031 0.0988  0.0397  107 ARG A CA  
858  C C   . ARG A 107 ? 0.8960 1.1536 0.7201 -0.0162 0.1083  0.0584  107 ARG A C   
859  O O   . ARG A 107 ? 1.0244 1.3057 0.8343 -0.0220 0.1210  0.0669  107 ARG A O   
860  C CB  . ARG A 107 ? 0.6689 0.8879 0.4583 -0.0058 0.0853  0.0498  107 ARG A CB  
861  C CG  . ARG A 107 ? 0.8035 1.0059 0.5837 0.0048  0.0743  0.0325  107 ARG A CG  
862  C CD  . ARG A 107 ? 0.6939 0.8751 0.4627 0.0021  0.0594  0.0431  107 ARG A CD  
863  N NE  . ARG A 107 ? 0.6732 0.8636 0.4140 -0.0043 0.0607  0.0578  107 ARG A NE  
864  C CZ  . ARG A 107 ? 0.7395 0.9411 0.4508 -0.0011 0.0613  0.0495  107 ARG A CZ  
865  N NH1 . ARG A 107 ? 0.8236 1.0258 0.5321 0.0080  0.0610  0.0254  107 ARG A NH1 
866  N NH2 . ARG A 107 ? 0.8086 1.0206 0.4930 -0.0071 0.0617  0.0654  107 ARG A NH2 
867  N N   . PRO A 108 ? 0.8560 1.1008 0.7082 -0.0214 0.1019  0.0648  108 PRO A N   
868  C CA  . PRO A 108 ? 0.8127 1.0693 0.6861 -0.0351 0.1088  0.0806  108 PRO A CA  
869  C C   . PRO A 108 ? 0.9792 1.2329 0.8358 -0.0479 0.1106  0.1050  108 PRO A C   
870  O O   . PRO A 108 ? 1.0881 1.3228 0.9217 -0.0461 0.1012  0.1115  108 PRO A O   
871  C CB  . PRO A 108 ? 0.7205 0.9542 0.6209 -0.0361 0.0958  0.0790  108 PRO A CB  
872  C CG  . PRO A 108 ? 0.5281 0.7475 0.4249 -0.0216 0.0863  0.0607  108 PRO A CG  
873  C CD  . PRO A 108 ? 0.7209 0.9382 0.5852 -0.0153 0.0866  0.0574  108 PRO A CD  
874  N N   . ALA A 109 ? 1.0095 1.2826 0.8794 -0.0610 0.1220  0.1201  109 ALA A N   
875  C CA  . ALA A 109 ? 1.0176 1.2879 0.8748 -0.0747 0.1244  0.1473  109 ALA A CA  
876  C C   . ALA A 109 ? 1.0655 1.3079 0.9489 -0.0856 0.1135  0.1614  109 ALA A C   
877  O O   . ALA A 109 ? 1.1027 1.3232 0.9759 -0.0914 0.1058  0.1806  109 ALA A O   
878  C CB  . ALA A 109 ? 1.0847 1.3936 0.9400 -0.0841 0.1445  0.1578  109 ALA A CB  
879  N N   . SER A 110 ? 0.9849 1.2282 0.9028 -0.0878 0.1120  0.1512  110 SER A N   
880  C CA  . SER A 110 ? 0.8222 1.0371 0.7660 -0.0959 0.0998  0.1575  110 SER A CA  
881  C C   . SER A 110 ? 0.7835 0.9721 0.7277 -0.0821 0.0840  0.1393  110 SER A C   
882  O O   . SER A 110 ? 0.7705 0.9676 0.7068 -0.0685 0.0839  0.1202  110 SER A O   
883  C CB  . SER A 110 ? 0.7980 1.0307 0.7792 -0.1071 0.1057  0.1555  110 SER A CB  
884  O OG  . SER A 110 ? 0.8622 1.1208 0.8510 -0.0964 0.1112  0.1339  110 SER A OG  
885  N N   . PRO A 111 ? 0.7932 0.9498 0.7474 -0.0852 0.0708  0.1453  111 PRO A N   
886  C CA  . PRO A 111 ? 0.7307 0.8659 0.6859 -0.0721 0.0572  0.1281  111 PRO A CA  
887  C C   . PRO A 111 ? 0.7134 0.8605 0.6889 -0.0663 0.0562  0.1065  111 PRO A C   
888  O O   . PRO A 111 ? 0.6927 0.8480 0.6949 -0.0753 0.0576  0.1049  111 PRO A O   
889  C CB  . PRO A 111 ? 0.6769 0.7795 0.6447 -0.0782 0.0456  0.1390  111 PRO A CB  
890  C CG  . PRO A 111 ? 0.7189 0.8207 0.6777 -0.0902 0.0514  0.1655  111 PRO A CG  
891  C CD  . PRO A 111 ? 0.6786 0.8158 0.6402 -0.0990 0.0679  0.1688  111 PRO A CD  
892  N N   . THR A 112 ? 0.6904 0.8387 0.6539 -0.0516 0.0529  0.0907  112 THR A N   
893  C CA  . THR A 112 ? 0.5355 0.6949 0.5149 -0.0444 0.0513  0.0726  112 THR A CA  
894  C C   . THR A 112 ? 0.4863 0.6240 0.4715 -0.0373 0.0377  0.0626  112 THR A C   
895  O O   . THR A 112 ? 0.6523 0.7724 0.6213 -0.0298 0.0312  0.0623  112 THR A O   
896  C CB  . THR A 112 ? 0.4765 0.6534 0.4417 -0.0322 0.0576  0.0613  112 THR A CB  
897  O OG1 . THR A 112 ? 0.6675 0.8660 0.6228 -0.0367 0.0712  0.0686  112 THR A OG1 
898  C CG2 . THR A 112 ? 0.4444 0.6361 0.4297 -0.0256 0.0567  0.0465  112 THR A CG2 
899  N N   . PRO A 113 ? 0.4179 0.5601 0.4263 -0.0396 0.0334  0.0538  113 PRO A N   
900  C CA  . PRO A 113 ? 0.4873 0.6174 0.5008 -0.0315 0.0222  0.0411  113 PRO A CA  
901  C C   . PRO A 113 ? 0.6149 0.7444 0.6102 -0.0167 0.0207  0.0334  113 PRO A C   
902  O O   . PRO A 113 ? 0.6302 0.7753 0.6180 -0.0113 0.0277  0.0310  113 PRO A O   
903  C CB  . PRO A 113 ? 0.4354 0.5854 0.4726 -0.0348 0.0216  0.0316  113 PRO A CB  
904  C CG  . PRO A 113 ? 0.4937 0.6541 0.5458 -0.0501 0.0289  0.0421  113 PRO A CG  
905  C CD  . PRO A 113 ? 0.4751 0.6392 0.5069 -0.0504 0.0395  0.0548  113 PRO A CD  
906  N N   . VAL A 114 ? 0.6081 0.7197 0.5984 -0.0103 0.0117  0.0291  114 VAL A N   
907  C CA  . VAL A 114 ? 0.4868 0.5946 0.4612 0.0014  0.0096  0.0247  114 VAL A CA  
908  C C   . VAL A 114 ? 0.4319 0.5428 0.4123 0.0097  0.0037  0.0134  114 VAL A C   
909  O O   . VAL A 114 ? 0.4870 0.5923 0.4770 0.0085  -0.0026 0.0086  114 VAL A O   
910  C CB  . VAL A 114 ? 0.4902 0.5777 0.4516 0.0027  0.0049  0.0316  114 VAL A CB  
911  C CG1 . VAL A 114 ? 0.4380 0.5228 0.3878 0.0133  0.0017  0.0262  114 VAL A CG1 
912  C CG2 . VAL A 114 ? 0.4907 0.5773 0.4405 -0.0042 0.0104  0.0447  114 VAL A CG2 
913  N N   . LEU A 115 ? 0.6306 0.7501 0.6047 0.0183  0.0056  0.0094  115 LEU A N   
914  C CA  . LEU A 115 ? 0.5817 0.7054 0.5589 0.0266  0.0005  0.0021  115 LEU A CA  
915  C C   . LEU A 115 ? 0.5063 0.6182 0.4704 0.0334  -0.0021 0.0032  115 LEU A C   
916  O O   . LEU A 115 ? 0.6004 0.7099 0.5549 0.0357  0.0012  0.0055  115 LEU A O   
917  C CB  . LEU A 115 ? 0.5232 0.6655 0.5071 0.0317  0.0040  -0.0014 115 LEU A CB  
918  C CG  . LEU A 115 ? 0.7640 0.9243 0.7661 0.0265  0.0043  -0.0045 115 LEU A CG  
919  C CD1 . LEU A 115 ? 0.7151 0.8947 0.7255 0.0344  0.0058  -0.0078 115 LEU A CD1 
920  C CD2 . LEU A 115 ? 0.8860 1.0437 0.8955 0.0232  -0.0042 -0.0096 115 LEU A CD2 
921  N N   . ILE A 116 ? 0.4511 0.5575 0.4158 0.0364  -0.0079 0.0004  116 ILE A N   
922  C CA  . ILE A 116 ? 0.5447 0.6443 0.5006 0.0425  -0.0100 0.0017  116 ILE A CA  
923  C C   . ILE A 116 ? 0.5847 0.6941 0.5420 0.0496  -0.0118 -0.0013 116 ILE A C   
924  O O   . ILE A 116 ? 0.4650 0.5812 0.4267 0.0512  -0.0152 -0.0062 116 ILE A O   
925  C CB  . ILE A 116 ? 0.6302 0.7181 0.5853 0.0420  -0.0142 0.0024  116 ILE A CB  
926  C CG1 . ILE A 116 ? 0.6739 0.7508 0.6272 0.0351  -0.0134 0.0087  116 ILE A CG1 
927  C CG2 . ILE A 116 ? 0.6103 0.6955 0.5591 0.0474  -0.0156 0.0044  116 ILE A CG2 
928  C CD1 . ILE A 116 ? 0.6151 0.6789 0.5708 0.0357  -0.0184 0.0103  116 ILE A CD1 
929  N N   . TRP A 117 ? 0.4956 0.6055 0.4488 0.0537  -0.0097 0.0017  117 TRP A N   
930  C CA  . TRP A 117 ? 0.4193 0.5370 0.3737 0.0601  -0.0111 0.0029  117 TRP A CA  
931  C C   . TRP A 117 ? 0.4801 0.5932 0.4299 0.0625  -0.0127 0.0064  117 TRP A C   
932  O O   . TRP A 117 ? 0.5175 0.6205 0.4637 0.0603  -0.0124 0.0087  117 TRP A O   
933  C CB  . TRP A 117 ? 0.5007 0.6205 0.4576 0.0637  -0.0084 0.0047  117 TRP A CB  
934  C CG  . TRP A 117 ? 0.4626 0.5869 0.4212 0.0703  -0.0103 0.0095  117 TRP A CG  
935  C CD1 . TRP A 117 ? 0.3869 0.5021 0.3437 0.0723  -0.0101 0.0149  117 TRP A CD1 
936  C CD2 . TRP A 117 ? 0.4154 0.5548 0.3781 0.0750  -0.0132 0.0107  117 TRP A CD2 
937  N NE1 . TRP A 117 ? 0.4170 0.5395 0.3769 0.0779  -0.0119 0.0213  117 TRP A NE1 
938  C CE2 . TRP A 117 ? 0.4449 0.5834 0.4071 0.0802  -0.0141 0.0190  117 TRP A CE2 
939  C CE3 . TRP A 117 ? 0.4647 0.6192 0.4322 0.0747  -0.0159 0.0057  117 TRP A CE3 
940  C CZ2 . TRP A 117 ? 0.3552 0.5080 0.3190 0.0860  -0.0175 0.0243  117 TRP A CZ2 
941  C CZ3 . TRP A 117 ? 0.5140 0.6840 0.4832 0.0805  -0.0201 0.0086  117 TRP A CZ3 
942  C CH2 . TRP A 117 ? 0.4720 0.6414 0.4382 0.0866  -0.0207 0.0186  117 TRP A CH2 
943  N N   . ILE A 118 ? 0.5802 0.7039 0.5303 0.0667  -0.0144 0.0071  118 ILE A N   
944  C CA  . ILE A 118 ? 0.4502 0.5753 0.3977 0.0689  -0.0144 0.0113  118 ILE A CA  
945  C C   . ILE A 118 ? 0.4866 0.6215 0.4338 0.0734  -0.0141 0.0186  118 ILE A C   
946  O O   . ILE A 118 ? 0.3208 0.4700 0.2663 0.0769  -0.0158 0.0172  118 ILE A O   
947  C CB  . ILE A 118 ? 0.4387 0.5710 0.3852 0.0703  -0.0159 0.0050  118 ILE A CB  
948  C CG1 . ILE A 118 ? 0.4654 0.5871 0.4147 0.0662  -0.0175 -0.0017 118 ILE A CG1 
949  C CG2 . ILE A 118 ? 0.3128 0.4496 0.2583 0.0726  -0.0144 0.0091  118 ILE A CG2 
950  C CD1 . ILE A 118 ? 0.2525 0.3740 0.2036 0.0682  -0.0193 -0.0085 118 ILE A CD1 
951  N N   . TYR A 119 ? 0.4282 0.2777 0.3597 0.0374  0.0184  0.0277  119 TYR A N   
952  C CA  . TYR A 119 ? 0.3573 0.2135 0.2905 0.0369  0.0202  0.0251  119 TYR A CA  
953  C C   . TYR A 119 ? 0.4726 0.3303 0.4111 0.0365  0.0200  0.0209  119 TYR A C   
954  O O   . TYR A 119 ? 0.4708 0.3252 0.4115 0.0385  0.0184  0.0192  119 TYR A O   
955  C CB  . TYR A 119 ? 0.7216 0.5788 0.6510 0.0391  0.0197  0.0243  119 TYR A CB  
956  C CG  . TYR A 119 ? 0.5851 0.4416 0.5153 0.0404  0.0162  0.0231  119 TYR A CG  
957  C CD1 . TYR A 119 ? 0.3923 0.2528 0.3286 0.0408  0.0150  0.0202  119 TYR A CD1 
958  C CD2 . TYR A 119 ? 0.3839 0.2384 0.3089 0.0414  0.0140  0.0255  119 TYR A CD2 
959  C CE1 . TYR A 119 ? 0.2958 0.1600 0.2343 0.0424  0.0119  0.0203  119 TYR A CE1 
960  C CE2 . TYR A 119 ? 0.3910 0.2485 0.3175 0.0425  0.0104  0.0255  119 TYR A CE2 
961  C CZ  . TYR A 119 ? 0.3017 0.1649 0.2355 0.0431  0.0093  0.0232  119 TYR A CZ  
962  O OH  . TYR A 119 ? 0.3739 0.2443 0.3104 0.0445  0.0057  0.0243  119 TYR A OH  
963  N N   . GLY A 120 ? 0.5191 0.3828 0.4593 0.0346  0.0219  0.0198  120 GLY A N   
964  C CA  . GLY A 120 ? 0.5031 0.3705 0.4474 0.0343  0.0220  0.0159  120 GLY A CA  
965  C C   . GLY A 120 ? 0.5854 0.4566 0.5300 0.0358  0.0219  0.0151  120 GLY A C   
966  O O   . GLY A 120 ? 0.4402 0.3086 0.3808 0.0368  0.0212  0.0166  120 GLY A O   
967  N N   . GLY A 121 ? 0.6019 0.4785 0.5498 0.0349  0.0226  0.0128  121 GLY A N   
968  C CA  . GLY A 121 ? 0.7114 0.5913 0.6598 0.0347  0.0222  0.0122  121 GLY A CA  
969  C C   . GLY A 121 ? 0.5711 0.4573 0.5249 0.0351  0.0215  0.0095  121 GLY A C   
970  O O   . GLY A 121 ? 0.5430 0.4334 0.4984 0.0347  0.0200  0.0095  121 GLY A O   
971  N N   . GLY A 122 ? 0.3085 0.1962 0.2644 0.0355  0.0228  0.0071  122 GLY A N   
972  C CA  . GLY A 122 ? 0.3888 0.2834 0.3487 0.0370  0.0235  0.0040  122 GLY A CA  
973  C C   . GLY A 122 ? 0.5082 0.4044 0.4714 0.0418  0.0223  0.0033  122 GLY A C   
974  O O   . GLY A 122 ? 0.6322 0.5360 0.5990 0.0445  0.0235  0.0012  122 GLY A O   
975  N N   . PHE A 123 ? 0.5616 0.4521 0.5235 0.0435  0.0202  0.0057  123 PHE A N   
976  C CA  . PHE A 123 ? 0.4510 0.3461 0.4165 0.0483  0.0184  0.0070  123 PHE A CA  
977  C C   . PHE A 123 ? 0.3745 0.2825 0.3435 0.0454  0.0165  0.0088  123 PHE A C   
978  O O   . PHE A 123 ? 0.5034 0.4205 0.4765 0.0482  0.0144  0.0108  123 PHE A O   
979  C CB  . PHE A 123 ? 0.4955 0.3914 0.4636 0.0549  0.0206  0.0041  123 PHE A CB  
980  C CG  . PHE A 123 ? 0.3557 0.2352 0.3180 0.0563  0.0222  0.0018  123 PHE A CG  
981  C CD1 . PHE A 123 ? 0.4059 0.2735 0.3647 0.0588  0.0208  0.0045  123 PHE A CD1 
982  C CD2 . PHE A 123 ? 0.5212 0.3970 0.4803 0.0540  0.0248  -0.0027 123 PHE A CD2 
983  C CE1 . PHE A 123 ? 0.4208 0.2713 0.3729 0.0582  0.0221  0.0027  123 PHE A CE1 
984  C CE2 . PHE A 123 ? 0.4390 0.2988 0.3910 0.0529  0.0258  -0.0051 123 PHE A CE2 
985  C CZ  . PHE A 123 ? 0.3644 0.2107 0.3129 0.0547  0.0245  -0.0023 123 PHE A CZ  
986  N N   . TYR A 124 ? 0.6538 0.5628 0.6206 0.0394  0.0169  0.0088  124 TYR A N   
987  C CA  . TYR A 124 ? 0.5399 0.4577 0.5076 0.0343  0.0149  0.0105  124 TYR A CA  
988  C C   . TYR A 124 ? 0.5201 0.4279 0.4799 0.0301  0.0127  0.0121  124 TYR A C   
989  O O   . TYR A 124 ? 0.5445 0.4556 0.5021 0.0248  0.0100  0.0133  124 TYR A O   
990  C CB  . TYR A 124 ? 0.3688 0.2930 0.3380 0.0304  0.0171  0.0099  124 TYR A CB  
991  C CG  . TYR A 124 ? 0.4709 0.3843 0.4332 0.0266  0.0185  0.0103  124 TYR A CG  
992  C CD1 . TYR A 124 ? 0.6597 0.5671 0.6157 0.0210  0.0171  0.0122  124 TYR A CD1 
993  C CD2 . TYR A 124 ? 0.4756 0.3848 0.4368 0.0288  0.0213  0.0092  124 TYR A CD2 
994  C CE1 . TYR A 124 ? 0.7446 0.6407 0.6935 0.0198  0.0192  0.0131  124 TYR A CE1 
995  C CE2 . TYR A 124 ? 0.4742 0.3765 0.4300 0.0269  0.0228  0.0109  124 TYR A CE2 
996  C CZ  . TYR A 124 ? 0.7128 0.6080 0.6625 0.0235  0.0221  0.0130  124 TYR A CZ  
997  O OH  . TYR A 124 ? 0.6461 0.5328 0.5894 0.0237  0.0243  0.0152  124 TYR A OH  
998  N N   . SER A 125 ? 0.4893 0.3848 0.4438 0.0322  0.0138  0.0120  125 SER A N   
999  C CA  . SER A 125 ? 0.5913 0.4765 0.5366 0.0296  0.0130  0.0130  125 SER A CA  
1000 C C   . SER A 125 ? 0.4980 0.3750 0.4399 0.0334  0.0140  0.0139  125 SER A C   
1001 O O   . SER A 125 ? 0.5028 0.3805 0.4490 0.0367  0.0147  0.0138  125 SER A O   
1002 C CB  . SER A 125 ? 0.5794 0.4585 0.5191 0.0260  0.0152  0.0128  125 SER A CB  
1003 O OG  . SER A 125 ? 0.5765 0.4559 0.5187 0.0285  0.0186  0.0127  125 SER A OG  
1004 N N   . GLY A 126 ? 0.4688 0.3371 0.4017 0.0325  0.0141  0.0147  126 GLY A N   
1005 C CA  . GLY A 126 ? 0.3491 0.2118 0.2784 0.0355  0.0153  0.0165  126 GLY A CA  
1006 C C   . GLY A 126 ? 0.3587 0.2182 0.2814 0.0355  0.0127  0.0178  126 GLY A C   
1007 O O   . GLY A 126 ? 0.4948 0.3596 0.4196 0.0345  0.0090  0.0181  126 GLY A O   
1008 N N   . ALA A 127 ? 0.4273 0.2802 0.3420 0.0368  0.0148  0.0190  127 ALA A N   
1009 C CA  . ALA A 127 ? 0.4892 0.3391 0.3960 0.0370  0.0128  0.0204  127 ALA A CA  
1010 C C   . ALA A 127 ? 0.6305 0.4781 0.5341 0.0400  0.0158  0.0235  127 ALA A C   
1011 O O   . ALA A 127 ? 0.7040 0.5504 0.6063 0.0417  0.0200  0.0240  127 ALA A O   
1012 C CB  . ALA A 127 ? 0.5691 0.4120 0.4641 0.0338  0.0122  0.0178  127 ALA A CB  
1013 N N   . ALA A 128 ? 0.6543 0.5028 0.5565 0.0408  0.0137  0.0266  128 ALA A N   
1014 C CA  . ALA A 128 ? 0.7363 0.5840 0.6350 0.0426  0.0166  0.0304  128 ALA A CA  
1015 C C   . ALA A 128 ? 0.5067 0.3504 0.3928 0.0441  0.0197  0.0296  128 ALA A C   
1016 O O   . ALA A 128 ? 0.6685 0.5138 0.5510 0.0461  0.0230  0.0330  128 ALA A O   
1017 C CB  . ALA A 128 ? 0.3994 0.2478 0.2991 0.0429  0.0139  0.0350  128 ALA A CB  
1018 N N   . SER A 129 ? 0.6138 0.4516 0.4923 0.0429  0.0189  0.0253  129 SER A N   
1019 C CA  . SER A 129 ? 0.6175 0.4471 0.4804 0.0449  0.0220  0.0234  129 SER A CA  
1020 C C   . SER A 129 ? 0.4593 0.2833 0.3184 0.0489  0.0278  0.0219  129 SER A C   
1021 O O   . SER A 129 ? 0.5472 0.3634 0.3928 0.0529  0.0318  0.0208  129 SER A O   
1022 C CB  . SER A 129 ? 0.4330 0.2557 0.2850 0.0404  0.0179  0.0193  129 SER A CB  
1023 O OG  . SER A 129 ? 0.5012 0.3224 0.3580 0.0364  0.0157  0.0163  129 SER A OG  
1024 N N   . LEU A 130 ? 0.4087 0.2366 0.2786 0.0488  0.0285  0.0221  130 LEU A N   
1025 C CA  . LEU A 130 ? 0.3607 0.1858 0.2284 0.0536  0.0340  0.0224  130 LEU A CA  
1026 C C   . LEU A 130 ? 0.5074 0.3383 0.3723 0.0603  0.0396  0.0266  130 LEU A C   
1027 O O   . LEU A 130 ? 0.6311 0.4726 0.5020 0.0593  0.0392  0.0306  130 LEU A O   
1028 C CB  . LEU A 130 ? 0.4353 0.2683 0.3168 0.0520  0.0335  0.0233  130 LEU A CB  
1029 C CG  . LEU A 130 ? 0.4196 0.2522 0.3073 0.0461  0.0287  0.0203  130 LEU A CG  
1030 C CD1 . LEU A 130 ? 0.4873 0.3273 0.3856 0.0459  0.0297  0.0212  130 LEU A CD1 
1031 C CD2 . LEU A 130 ? 0.5249 0.3446 0.4011 0.0432  0.0273  0.0164  130 LEU A CD2 
1032 N N   . ASP A 131 ? 0.6264 0.4510 0.4824 0.0672  0.0452  0.0265  131 ASP A N   
1033 C CA  . ASP A 131 ? 0.6706 0.5035 0.5238 0.0749  0.0514  0.0311  131 ASP A CA  
1034 C C   . ASP A 131 ? 0.6442 0.4980 0.5135 0.0738  0.0519  0.0374  131 ASP A C   
1035 O O   . ASP A 131 ? 0.5806 0.4459 0.4512 0.0749  0.0538  0.0420  131 ASP A O   
1036 C CB  . ASP A 131 ? 0.4790 0.3014 0.3206 0.0845  0.0580  0.0303  131 ASP A CB  
1037 C CG  . ASP A 131 ? 0.8292 0.6284 0.6498 0.0856  0.0586  0.0239  131 ASP A CG  
1038 O OD1 . ASP A 131 ? 0.8906 0.6866 0.7069 0.0790  0.0539  0.0210  131 ASP A OD1 
1039 O OD2 . ASP A 131 ? 0.7756 0.5589 0.5829 0.0930  0.0638  0.0219  131 ASP A OD2 
1040 N N   . VAL A 132 ? 0.4491 0.3080 0.3295 0.0707  0.0500  0.0377  132 VAL A N   
1041 C CA  . VAL A 132 ? 0.3750 0.2527 0.2688 0.0682  0.0500  0.0429  132 VAL A CA  
1042 C C   . VAL A 132 ? 0.6565 0.5398 0.5565 0.0603  0.0459  0.0444  132 VAL A C   
1043 O O   . VAL A 132 ? 0.5496 0.4470 0.4580 0.0566  0.0460  0.0491  132 VAL A O   
1044 C CB  . VAL A 132 ? 0.3528 0.2337 0.2553 0.0659  0.0484  0.0421  132 VAL A CB  
1045 C CG1 . VAL A 132 ? 0.5041 0.3848 0.4024 0.0746  0.0536  0.0442  132 VAL A CG1 
1046 C CG2 . VAL A 132 ? 0.4473 0.3157 0.3502 0.0601  0.0433  0.0360  132 VAL A CG2 
1047 N N   . TYR A 133 ? 0.5198 0.3920 0.4151 0.0573  0.0421  0.0411  133 TYR A N   
1048 C CA  . TYR A 133 ? 0.4295 0.3041 0.3287 0.0515  0.0387  0.0434  133 TYR A CA  
1049 C C   . TYR A 133 ? 0.3825 0.2567 0.2726 0.0537  0.0403  0.0462  133 TYR A C   
1050 O O   . TYR A 133 ? 0.6125 0.4820 0.5010 0.0504  0.0366  0.0466  133 TYR A O   
1051 C CB  . TYR A 133 ? 0.3498 0.2154 0.2524 0.0470  0.0329  0.0392  133 TYR A CB  
1052 C CG  . TYR A 133 ? 0.4289 0.2941 0.3387 0.0454  0.0315  0.0356  133 TYR A CG  
1053 C CD1 . TYR A 133 ? 0.4013 0.2757 0.3178 0.0443  0.0335  0.0373  133 TYR A CD1 
1054 C CD2 . TYR A 133 ? 0.5275 0.3855 0.4372 0.0446  0.0282  0.0309  133 TYR A CD2 
1055 C CE1 . TYR A 133 ? 0.2960 0.1709 0.2180 0.0427  0.0323  0.0342  133 TYR A CE1 
1056 C CE2 . TYR A 133 ? 0.3244 0.1838 0.2405 0.0431  0.0274  0.0281  133 TYR A CE2 
1057 C CZ  . TYR A 133 ? 0.3938 0.2608 0.3154 0.0424  0.0296  0.0295  133 TYR A CZ  
1058 O OH  . TYR A 133 ? 0.4019 0.2713 0.3289 0.0409  0.0290  0.0270  133 TYR A OH  
1059 N N   . ASP A 134 ? 0.3753 0.2554 0.2591 0.0599  0.0460  0.0488  134 ASP A N   
1060 C CA  . ASP A 134 ? 0.4688 0.3490 0.3421 0.0628  0.0483  0.0510  134 ASP A CA  
1061 C C   . ASP A 134 ? 0.5754 0.4702 0.4543 0.0588  0.0490  0.0588  134 ASP A C   
1062 O O   . ASP A 134 ? 0.6026 0.5131 0.4878 0.0594  0.0527  0.0640  134 ASP A O   
1063 C CB  . ASP A 134 ? 0.4272 0.3062 0.2891 0.0728  0.0551  0.0500  134 ASP A CB  
1064 C CG  . ASP A 134 ? 0.6402 0.5181 0.4886 0.0763  0.0579  0.0511  134 ASP A CG  
1065 O OD1 . ASP A 134 ? 0.7791 0.6634 0.6299 0.0710  0.0554  0.0553  134 ASP A OD1 
1066 O OD2 . ASP A 134 ? 0.7362 0.6055 0.5702 0.0845  0.0628  0.0477  134 ASP A OD2 
1067 N N   . GLY A 135 ? 0.4888 0.3794 0.3650 0.0543  0.0455  0.0606  135 GLY A N   
1068 C CA  . GLY A 135 ? 0.5858 0.4872 0.4662 0.0487  0.0457  0.0685  135 GLY A CA  
1069 C C   . GLY A 135 ? 0.5481 0.4624 0.4214 0.0532  0.0517  0.0741  135 GLY A C   
1070 O O   . GLY A 135 ? 0.6430 0.5683 0.5189 0.0480  0.0524  0.0818  135 GLY A O   
1071 N N   . ARG A 136 ? 0.5837 0.4961 0.4469 0.0627  0.0565  0.0704  136 ARG A N   
1072 C CA  . ARG A 136 ? 0.5037 0.4267 0.3574 0.0685  0.0626  0.0748  136 ARG A CA  
1073 C C   . ARG A 136 ? 0.6335 0.5813 0.4966 0.0680  0.0675  0.0839  136 ARG A C   
1074 O O   . ARG A 136 ? 0.6238 0.5850 0.4840 0.0673  0.0706  0.0908  136 ARG A O   
1075 C CB  . ARG A 136 ? 0.4205 0.3327 0.2584 0.0795  0.0674  0.0681  136 ARG A CB  
1076 C CG  . ARG A 136 ? 0.6806 0.6008 0.5187 0.0900  0.0749  0.0685  136 ARG A CG  
1077 C CD  . ARG A 136 ? 0.5374 0.4410 0.3555 0.1013  0.0801  0.0614  136 ARG A CD  
1078 N NE  . ARG A 136 ? 0.6046 0.4836 0.4153 0.0970  0.0740  0.0522  136 ARG A NE  
1079 C CZ  . ARG A 136 ? 0.6057 0.4659 0.3967 0.0998  0.0744  0.0451  136 ARG A CZ  
1080 N NH1 . ARG A 136 ? 0.4510 0.3119 0.2261 0.1082  0.0813  0.0452  136 ARG A NH1 
1081 N NH2 . ARG A 136 ? 0.5334 0.3749 0.3200 0.0936  0.0680  0.0378  136 ARG A NH2 
1082 N N   . PHE A 137 ? 0.6274 0.5833 0.5021 0.0673  0.0677  0.0844  137 PHE A N   
1083 C CA  . PHE A 137 ? 0.4788 0.4622 0.3629 0.0671  0.0723  0.0933  137 PHE A CA  
1084 C C   . PHE A 137 ? 0.5850 0.5790 0.4793 0.0524  0.0679  0.1004  137 PHE A C   
1085 O O   . PHE A 137 ? 0.6622 0.6786 0.5599 0.0491  0.0712  0.1096  137 PHE A O   
1086 C CB  . PHE A 137 ? 0.4006 0.3902 0.2922 0.0722  0.0740  0.0918  137 PHE A CB  
1087 C CG  . PHE A 137 ? 0.5287 0.5033 0.4096 0.0857  0.0780  0.0849  137 PHE A CG  
1088 C CD1 . PHE A 137 ? 0.4930 0.4742 0.3638 0.0992  0.0864  0.0868  137 PHE A CD1 
1089 C CD2 . PHE A 137 ? 0.5873 0.5400 0.4667 0.0850  0.0736  0.0764  137 PHE A CD2 
1090 C CE1 . PHE A 137 ? 0.4884 0.4510 0.3464 0.1115  0.0904  0.0799  137 PHE A CE1 
1091 C CE2 . PHE A 137 ? 0.5108 0.4470 0.3786 0.0959  0.0771  0.0702  137 PHE A CE2 
1092 C CZ  . PHE A 137 ? 0.5189 0.4581 0.3751 0.1090  0.0855  0.0717  137 PHE A CZ  
1093 N N   . LEU A 138 ? 0.5974 0.5750 0.4961 0.0433  0.0608  0.0962  138 LEU A N   
1094 C CA  . LEU A 138 ? 0.4343 0.4141 0.3393 0.0290  0.0564  0.1014  138 LEU A CA  
1095 C C   . LEU A 138 ? 0.5780 0.5556 0.4755 0.0259  0.0564  0.1068  138 LEU A C   
1096 O O   . LEU A 138 ? 0.6009 0.5918 0.5014 0.0165  0.0567  0.1158  138 LEU A O   
1097 C CB  . LEU A 138 ? 0.5138 0.4713 0.4214 0.0233  0.0496  0.0943  138 LEU A CB  
1098 C CG  . LEU A 138 ? 0.5869 0.5469 0.5023 0.0235  0.0487  0.0897  138 LEU A CG  
1099 C CD1 . LEU A 138 ? 0.5972 0.5340 0.5127 0.0211  0.0431  0.0817  138 LEU A CD1 
1100 C CD2 . LEU A 138 ? 0.6510 0.6308 0.5753 0.0130  0.0485  0.0963  138 LEU A CD2 
1101 N N   . ALA A 139 ? 0.6156 0.5772 0.5028 0.0330  0.0559  0.1019  139 ALA A N   
1102 C CA  . ALA A 139 ? 0.5541 0.5135 0.4325 0.0315  0.0559  0.1068  139 ALA A CA  
1103 C C   . ALA A 139 ? 0.6883 0.6724 0.5641 0.0344  0.0631  0.1152  139 ALA A C   
1104 O O   . ALA A 139 ? 0.7079 0.7035 0.5859 0.0253  0.0632  0.1247  139 ALA A O   
1105 C CB  . ALA A 139 ? 0.3796 0.3212 0.2468 0.0391  0.0542  0.0996  139 ALA A CB  
1106 N N   . GLN A 140 ? 0.6837 0.6756 0.5542 0.0472  0.0694  0.1118  140 GLN A N   
1107 C CA  . GLN A 140 ? 0.6856 0.7023 0.5528 0.0536  0.0776  0.1190  140 GLN A CA  
1108 C C   . GLN A 140 ? 0.7319 0.7776 0.6125 0.0462  0.0799  0.1294  140 GLN A C   
1109 O O   . GLN A 140 ? 0.8044 0.8702 0.6850 0.0421  0.0831  0.1393  140 GLN A O   
1110 C CB  . GLN A 140 ? 0.6789 0.6948 0.5376 0.0702  0.0844  0.1125  140 GLN A CB  
1111 C CG  . GLN A 140 ? 0.6461 0.6756 0.4926 0.0807  0.0930  0.1161  140 GLN A CG  
1112 C CD  . GLN A 140 ? 0.7342 0.7998 0.5896 0.0828  0.1002  0.1275  140 GLN A CD  
1113 O OE1 . GLN A 140 ? 0.6429 0.7239 0.5122 0.0813  0.1005  0.1308  140 GLN A OE1 
1114 N NE2 . GLN A 140 ? 0.5941 0.6758 0.4412 0.0865  0.1063  0.1339  140 GLN A NE2 
1115 N N   . VAL A 141 ? 0.6206 0.6703 0.5126 0.0438  0.0779  0.1276  141 VAL A N   
1116 C CA  . VAL A 141 ? 0.5495 0.6308 0.4540 0.0384  0.0804  0.1370  141 VAL A CA  
1117 C C   . VAL A 141 ? 0.6143 0.6984 0.5265 0.0182  0.0742  0.1435  141 VAL A C   
1118 O O   . VAL A 141 ? 0.7165 0.8283 0.6348 0.0101  0.0763  0.1544  141 VAL A O   
1119 C CB  . VAL A 141 ? 0.6066 0.6943 0.5188 0.0460  0.0818  0.1331  141 VAL A CB  
1120 C CG1 . VAL A 141 ? 0.4366 0.5624 0.3615 0.0422  0.0848  0.1438  141 VAL A CG1 
1121 C CG2 . VAL A 141 ? 0.5062 0.5854 0.4080 0.0658  0.0881  0.1266  141 VAL A CG2 
1122 N N   . GLU A 142 ? 0.6651 0.7204 0.5761 0.0099  0.0667  0.1371  142 GLU A N   
1123 C CA  . GLU A 142 ? 0.5579 0.6083 0.4728 -0.0089 0.0608  0.1419  142 GLU A CA  
1124 C C   . GLU A 142 ? 0.5400 0.5702 0.4457 -0.0146 0.0579  0.1444  142 GLU A C   
1125 O O   . GLU A 142 ? 0.6717 0.6940 0.5779 -0.0298 0.0536  0.1492  142 GLU A O   
1126 C CB  . GLU A 142 ? 0.6735 0.7063 0.5935 -0.0148 0.0548  0.1340  142 GLU A CB  
1127 C CG  . GLU A 142 ? 0.6728 0.7286 0.6032 -0.0151 0.0561  0.1346  142 GLU A CG  
1128 C CD  . GLU A 142 ? 0.7707 0.8576 0.7083 -0.0287 0.0569  0.1464  142 GLU A CD  
1129 O OE1 . GLU A 142 ? 0.7988 0.8821 0.7333 -0.0427 0.0545  0.1528  142 GLU A OE1 
1130 O OE2 . GLU A 142 ? 0.6637 0.7796 0.6101 -0.0256 0.0598  0.1499  142 GLU A OE2 
1131 N N   . GLY A 143 ? 0.5870 0.6072 0.4830 -0.0028 0.0600  0.1411  143 GLY A N   
1132 C CA  . GLY A 143 ? 0.4317 0.4337 0.3185 -0.0065 0.0570  0.1437  143 GLY A CA  
1133 C C   . GLY A 143 ? 0.5623 0.5322 0.4478 -0.0101 0.0497  0.1370  143 GLY A C   
1134 O O   . GLY A 143 ? 0.7538 0.7078 0.6339 -0.0160 0.0462  0.1410  143 GLY A O   
1135 N N   . ALA A 144 ? 0.7155 0.6767 0.6061 -0.0058 0.0478  0.1274  144 ALA A N   
1136 C CA  . ALA A 144 ? 0.7005 0.6341 0.5909 -0.0076 0.0417  0.1204  144 ALA A CA  
1137 C C   . ALA A 144 ? 0.6508 0.5682 0.5330 0.0020  0.0399  0.1160  144 ALA A C   
1138 O O   . ALA A 144 ? 0.5003 0.4252 0.3777 0.0120  0.0431  0.1131  144 ALA A O   
1139 C CB  . ALA A 144 ? 0.5713 0.5044 0.4694 -0.0055 0.0409  0.1119  144 ALA A CB  
1140 N N   . VAL A 145 ? 0.6458 0.5412 0.5256 -0.0010 0.0348  0.1157  145 VAL A N   
1141 C CA  . VAL A 145 ? 0.6113 0.4920 0.4866 0.0078  0.0317  0.1099  145 VAL A CA  
1142 C C   . VAL A 145 ? 0.7889 0.6602 0.6709 0.0106  0.0293  0.1000  145 VAL A C   
1143 O O   . VAL A 145 ? 0.6601 0.5200 0.5463 0.0047  0.0269  0.0989  145 VAL A O   
1144 C CB  . VAL A 145 ? 0.6329 0.4965 0.5027 0.0053  0.0276  0.1157  145 VAL A CB  
1145 C CG1 . VAL A 145 ? 0.5509 0.4051 0.4174 0.0148  0.0242  0.1105  145 VAL A CG1 
1146 C CG2 . VAL A 145 ? 0.7523 0.6250 0.6153 0.0011  0.0298  0.1267  145 VAL A CG2 
1147 N N   . LEU A 146 ? 0.6286 0.5038 0.5100 0.0192  0.0303  0.0928  146 LEU A N   
1148 C CA  . LEU A 146 ? 0.5536 0.4226 0.4410 0.0219  0.0285  0.0840  146 LEU A CA  
1149 C C   . LEU A 146 ? 0.7021 0.5599 0.5868 0.0280  0.0246  0.0791  146 LEU A C   
1150 O O   . LEU A 146 ? 0.7218 0.5821 0.5992 0.0327  0.0246  0.0786  146 LEU A O   
1151 C CB  . LEU A 146 ? 0.5093 0.3917 0.3996 0.0255  0.0327  0.0800  146 LEU A CB  
1152 C CG  . LEU A 146 ? 0.5681 0.4470 0.4667 0.0239  0.0313  0.0740  146 LEU A CG  
1153 C CD1 . LEU A 146 ? 0.5380 0.4331 0.4422 0.0216  0.0350  0.0756  146 LEU A CD1 
1154 C CD2 . LEU A 146 ? 0.4601 0.3318 0.3580 0.0307  0.0297  0.0659  146 LEU A CD2 
1155 N N   . VAL A 147 ? 0.5674 0.4138 0.4574 0.0274  0.0213  0.0757  147 VAL A N   
1156 C CA  . VAL A 147 ? 0.6545 0.4941 0.5444 0.0330  0.0175  0.0716  147 VAL A CA  
1157 C C   . VAL A 147 ? 0.6619 0.5013 0.5586 0.0347  0.0172  0.0635  147 VAL A C   
1158 O O   . VAL A 147 ? 0.6962 0.5317 0.5984 0.0316  0.0177  0.0616  147 VAL A O   
1159 C CB  . VAL A 147 ? 0.6293 0.4558 0.5190 0.0333  0.0141  0.0761  147 VAL A CB  
1160 C CG1 . VAL A 147 ? 0.7182 0.5428 0.6096 0.0399  0.0104  0.0727  147 VAL A CG1 
1161 C CG2 . VAL A 147 ? 0.5197 0.3457 0.4021 0.0315  0.0140  0.0852  147 VAL A CG2 
1162 N N   . SER A 148 ? 0.5816 0.4248 0.4767 0.0388  0.0163  0.0587  148 SER A N   
1163 C CA  . SER A 148 ? 0.4473 0.2907 0.3483 0.0401  0.0158  0.0518  148 SER A CA  
1164 C C   . SER A 148 ? 0.3418 0.1846 0.2425 0.0434  0.0116  0.0497  148 SER A C   
1165 O O   . SER A 148 ? 0.5736 0.4184 0.4675 0.0446  0.0096  0.0522  148 SER A O   
1166 C CB  . SER A 148 ? 0.4173 0.2669 0.3168 0.0404  0.0194  0.0481  148 SER A CB  
1167 O OG  . SER A 148 ? 0.6029 0.4527 0.4950 0.0430  0.0186  0.0453  148 SER A OG  
1168 N N   . MET A 149 ? 0.4805 0.3226 0.3883 0.0446  0.0102  0.0458  149 MET A N   
1169 C CA  . MET A 149 ? 0.5802 0.4254 0.4899 0.0477  0.0060  0.0453  149 MET A CA  
1170 C C   . MET A 149 ? 0.4315 0.2819 0.3471 0.0478  0.0054  0.0395  149 MET A C   
1171 O O   . MET A 149 ? 0.4791 0.3281 0.3998 0.0469  0.0078  0.0361  149 MET A O   
1172 C CB  . MET A 149 ? 0.4284 0.2681 0.3412 0.0516  0.0042  0.0501  149 MET A CB  
1173 C CG  . MET A 149 ? 0.4400 0.2777 0.3611 0.0548  0.0044  0.0468  149 MET A CG  
1174 S SD  . MET A 149 ? 0.6415 0.4698 0.5650 0.0511  0.0085  0.0429  149 MET A SD  
1175 C CE  . MET A 149 ? 0.4478 0.2603 0.3659 0.0499  0.0092  0.0490  149 MET A CE  
1176 N N   . ASN A 150 ? 0.3300 0.1876 0.2445 0.0479  0.0017  0.0390  150 ASN A N   
1177 C CA  . ASN A 150 ? 0.3792 0.2443 0.2998 0.0472  0.0003  0.0352  150 ASN A CA  
1178 C C   . ASN A 150 ? 0.5519 0.4210 0.4819 0.0525  -0.0008 0.0369  150 ASN A C   
1179 O O   . ASN A 150 ? 0.5970 0.4655 0.5273 0.0572  -0.0026 0.0419  150 ASN A O   
1180 C CB  . ASN A 150 ? 0.4264 0.2988 0.3412 0.0435  -0.0037 0.0347  150 ASN A CB  
1181 C CG  . ASN A 150 ? 0.4811 0.3468 0.3855 0.0385  -0.0016 0.0304  150 ASN A CG  
1182 O OD1 . ASN A 150 ? 0.3280 0.1862 0.2307 0.0392  0.0029  0.0291  150 ASN A OD1 
1183 N ND2 . ASN A 150 ? 0.5635 0.4318 0.4601 0.0335  -0.0050 0.0286  150 ASN A ND2 
1184 N N   . TYR A 151 ? 0.5427 0.4153 0.4798 0.0528  0.0007  0.0330  151 TYR A N   
1185 C CA  . TYR A 151 ? 0.5481 0.4258 0.4934 0.0592  0.0004  0.0339  151 TYR A CA  
1186 C C   . TYR A 151 ? 0.5515 0.4422 0.5033 0.0574  0.0001  0.0305  151 TYR A C   
1187 O O   . TYR A 151 ? 0.6416 0.5311 0.5918 0.0517  0.0017  0.0266  151 TYR A O   
1188 C CB  . TYR A 151 ? 0.4992 0.3628 0.4449 0.0631  0.0040  0.0334  151 TYR A CB  
1189 C CG  . TYR A 151 ? 0.3162 0.1749 0.2622 0.0587  0.0075  0.0280  151 TYR A CG  
1190 C CD1 . TYR A 151 ? 0.3141 0.1666 0.2547 0.0530  0.0091  0.0276  151 TYR A CD1 
1191 C CD2 . TYR A 151 ? 0.3915 0.2539 0.3430 0.0609  0.0094  0.0240  151 TYR A CD2 
1192 C CE1 . TYR A 151 ? 0.3087 0.1598 0.2502 0.0493  0.0120  0.0238  151 TYR A CE1 
1193 C CE2 . TYR A 151 ? 0.3696 0.2294 0.3209 0.0565  0.0123  0.0196  151 TYR A CE2 
1194 C CZ  . TYR A 151 ? 0.4064 0.2610 0.3529 0.0507  0.0133  0.0198  151 TYR A CZ  
1195 O OH  . TYR A 151 ? 0.3884 0.2433 0.3354 0.0469  0.0157  0.0165  151 TYR A OH  
1196 N N   . ARG A 152 ? 0.6736 0.5781 0.6326 0.0624  -0.0018 0.0329  152 ARG A N   
1197 C CA  . ARG A 152 ? 0.5478 0.4689 0.5135 0.0597  -0.0025 0.0310  152 ARG A CA  
1198 C C   . ARG A 152 ? 0.5418 0.4593 0.5107 0.0596  0.0020  0.0260  152 ARG A C   
1199 O O   . ARG A 152 ? 0.5541 0.4630 0.5242 0.0659  0.0054  0.0245  152 ARG A O   
1200 C CB  . ARG A 152 ? 0.5430 0.4834 0.5173 0.0667  -0.0049 0.0358  152 ARG A CB  
1201 C CG  . ARG A 152 ? 0.5277 0.4810 0.5002 0.0635  -0.0108 0.0409  152 ARG A CG  
1202 C CD  . ARG A 152 ? 0.4653 0.4405 0.4478 0.0724  -0.0129 0.0471  152 ARG A CD  
1203 N NE  . ARG A 152 ? 0.4407 0.4052 0.4235 0.0853  -0.0106 0.0508  152 ARG A NE  
1204 C CZ  . ARG A 152 ? 0.5870 0.5648 0.5775 0.0975  -0.0105 0.0564  152 ARG A CZ  
1205 N NH1 . ARG A 152 ? 0.5786 0.5853 0.5791 0.0981  -0.0126 0.0593  152 ARG A NH1 
1206 N NH2 . ARG A 152 ? 0.3680 0.3300 0.3559 0.1093  -0.0081 0.0597  152 ARG A NH2 
1207 N N   . VAL A 153 ? 0.4868 0.4101 0.4557 0.0519  0.0019  0.0234  153 VAL A N   
1208 C CA  . VAL A 153 ? 0.4817 0.4040 0.4530 0.0505  0.0057  0.0194  153 VAL A CA  
1209 C C   . VAL A 153 ? 0.5330 0.4754 0.5122 0.0491  0.0052  0.0198  153 VAL A C   
1210 O O   . VAL A 153 ? 0.6410 0.5989 0.6240 0.0483  0.0016  0.0235  153 VAL A O   
1211 C CB  . VAL A 153 ? 0.5335 0.4449 0.4974 0.0429  0.0068  0.0170  153 VAL A CB  
1212 C CG1 . VAL A 153 ? 0.4785 0.3743 0.4362 0.0444  0.0082  0.0170  153 VAL A CG1 
1213 C CG2 . VAL A 153 ? 0.5766 0.4911 0.5355 0.0351  0.0033  0.0181  153 VAL A CG2 
1214 N N   . GLY A 154 ? 0.4453 0.3891 0.4267 0.0482  0.0087  0.0167  154 GLY A N   
1215 C CA  . GLY A 154 ? 0.3267 0.2899 0.3151 0.0456  0.0089  0.0174  154 GLY A CA  
1216 C C   . GLY A 154 ? 0.5674 0.5488 0.5649 0.0547  0.0090  0.0201  154 GLY A C   
1217 O O   . GLY A 154 ? 0.5266 0.5013 0.5246 0.0653  0.0114  0.0195  154 GLY A O   
1218 N N   . THR A 155 ? 0.3939 0.3984 0.3981 0.0504  0.0067  0.0235  155 THR A N   
1219 C CA  . THR A 155 ? 0.4118 0.4391 0.4260 0.0595  0.0069  0.0275  155 THR A CA  
1220 C C   . THR A 155 ? 0.4546 0.4783 0.4681 0.0670  0.0041  0.0311  155 THR A C   
1221 O O   . THR A 155 ? 0.7761 0.8012 0.7932 0.0806  0.0068  0.0324  155 THR A O   
1222 C CB  . THR A 155 ? 0.4162 0.4728 0.4381 0.0510  0.0040  0.0319  155 THR A CB  
1223 O OG1 . THR A 155 ? 0.4809 0.5337 0.4964 0.0373  -0.0018 0.0334  155 THR A OG1 
1224 C CG2 . THR A 155 ? 0.3467 0.4101 0.3710 0.0468  0.0079  0.0296  155 THR A CG2 
1225 N N   . PHE A 156 ? 0.3615 0.3785 0.3686 0.0585  -0.0009 0.0326  156 PHE A N   
1226 C CA  . PHE A 156 ? 0.3910 0.4087 0.3971 0.0634  -0.0046 0.0373  156 PHE A CA  
1227 C C   . PHE A 156 ? 0.4873 0.4836 0.4896 0.0751  -0.0012 0.0362  156 PHE A C   
1228 O O   . PHE A 156 ? 0.5531 0.5532 0.5577 0.0850  -0.0022 0.0411  156 PHE A O   
1229 C CB  . PHE A 156 ? 0.3985 0.4085 0.3950 0.0510  -0.0098 0.0374  156 PHE A CB  
1230 C CG  . PHE A 156 ? 0.5315 0.5530 0.5272 0.0366  -0.0128 0.0368  156 PHE A CG  
1231 C CD1 . PHE A 156 ? 0.5602 0.6087 0.5616 0.0311  -0.0181 0.0420  156 PHE A CD1 
1232 C CD2 . PHE A 156 ? 0.4851 0.4904 0.4737 0.0281  -0.0105 0.0317  156 PHE A CD2 
1233 C CE1 . PHE A 156 ? 0.5469 0.6038 0.5457 0.0156  -0.0211 0.0416  156 PHE A CE1 
1234 C CE2 . PHE A 156 ? 0.4861 0.4980 0.4719 0.0145  -0.0131 0.0316  156 PHE A CE2 
1235 C CZ  . PHE A 156 ? 0.3999 0.4366 0.3904 0.0074  -0.0185 0.0362  156 PHE A CZ  
1236 N N   . GLY A 157 ? 0.5204 0.4945 0.5163 0.0736  0.0027  0.0304  157 GLY A N   
1237 C CA  . GLY A 157 ? 0.3802 0.3323 0.3709 0.0816  0.0057  0.0291  157 GLY A CA  
1238 C C   . GLY A 157 ? 0.4916 0.4404 0.4850 0.0921  0.0111  0.0261  157 GLY A C   
1239 O O   . GLY A 157 ? 0.5487 0.4829 0.5386 0.1018  0.0132  0.0269  157 GLY A O   
1240 N N   . PHE A 158 ? 0.4755 0.4363 0.4734 0.0902  0.0137  0.0229  158 PHE A N   
1241 C CA  . PHE A 158 ? 0.3107 0.2651 0.3079 0.0987  0.0196  0.0182  158 PHE A CA  
1242 C C   . PHE A 158 ? 0.4184 0.3969 0.4244 0.1048  0.0227  0.0184  158 PHE A C   
1243 O O   . PHE A 158 ? 0.5043 0.4768 0.5082 0.1141  0.0281  0.0144  158 PHE A O   
1244 C CB  . PHE A 158 ? 0.3691 0.3041 0.3583 0.0910  0.0219  0.0117  158 PHE A CB  
1245 C CG  . PHE A 158 ? 0.3912 0.3045 0.3723 0.0863  0.0198  0.0119  158 PHE A CG  
1246 C CD1 . PHE A 158 ? 0.4952 0.3873 0.4695 0.0924  0.0216  0.0111  158 PHE A CD1 
1247 C CD2 . PHE A 158 ? 0.5628 0.4764 0.5420 0.0758  0.0164  0.0134  158 PHE A CD2 
1248 C CE1 . PHE A 158 ? 0.5046 0.3794 0.4719 0.0870  0.0198  0.0123  158 PHE A CE1 
1249 C CE2 . PHE A 158 ? 0.4984 0.3952 0.4706 0.0722  0.0152  0.0141  158 PHE A CE2 
1250 C CZ  . PHE A 158 ? 0.4502 0.3292 0.4172 0.0773  0.0167  0.0140  158 PHE A CZ  
1251 N N   . LEU A 159 ? 0.4351 0.4408 0.4499 0.0997  0.0195  0.0230  159 LEU A N   
1252 C CA  . LEU A 159 ? 0.4084 0.4419 0.4331 0.1068  0.0224  0.0251  159 LEU A CA  
1253 C C   . LEU A 159 ? 0.3745 0.4108 0.4020 0.1258  0.0257  0.0280  159 LEU A C   
1254 O O   . LEU A 159 ? 0.5352 0.5723 0.5640 0.1309  0.0223  0.0337  159 LEU A O   
1255 C CB  . LEU A 159 ? 0.3037 0.3673 0.3373 0.0968  0.0174  0.0311  159 LEU A CB  
1256 C CG  . LEU A 159 ? 0.5094 0.6076 0.5549 0.1022  0.0202  0.0347  159 LEU A CG  
1257 C CD1 . LEU A 159 ? 0.3884 0.5096 0.4390 0.0855  0.0163  0.0378  159 LEU A CD1 
1258 C CD2 . LEU A 159 ? 0.4649 0.5832 0.5188 0.1173  0.0200  0.0419  159 LEU A CD2 
1259 N N   . ALA A 160 ? 0.3874 0.4251 0.4149 0.1369  0.0325  0.0243  160 ALA A N   
1260 C CA  . ALA A 160 ? 0.4997 0.5352 0.5274 0.1570  0.0369  0.0263  160 ALA A CA  
1261 C C   . ALA A 160 ? 0.4850 0.5457 0.5200 0.1696  0.0433  0.0266  160 ALA A C   
1262 O O   . ALA A 160 ? 0.5506 0.6131 0.5834 0.1666  0.0476  0.0206  160 ALA A O   
1263 C CB  . ALA A 160 ? 0.5028 0.4961 0.5153 0.1626  0.0402  0.0197  160 ALA A CB  
1264 N N   . LEU A 161 ? 0.5654 0.6477 0.6092 0.1843  0.0439  0.0345  161 LEU A N   
1265 C CA  . LEU A 161 ? 0.5242 0.6245 0.5726 0.2027  0.0517  0.0351  161 LEU A CA  
1266 C C   . LEU A 161 ? 0.5755 0.6437 0.6126 0.2225  0.0568  0.0332  161 LEU A C   
1267 O O   . LEU A 161 ? 0.5046 0.5797 0.5462 0.2358  0.0559  0.0415  161 LEU A O   
1268 C CB  . LEU A 161 ? 0.4426 0.5925 0.5091 0.2059  0.0492  0.0463  161 LEU A CB  
1269 C CG  . LEU A 161 ? 0.7282 0.9015 0.8015 0.1839  0.0450  0.0463  161 LEU A CG  
1270 C CD1 . LEU A 161 ? 0.8520 1.0641 0.9395 0.1751  0.0373  0.0572  161 LEU A CD1 
1271 C CD2 . LEU A 161 ? 0.6366 0.8268 0.7124 0.1875  0.0525  0.0423  161 LEU A CD2 
1272 N N   . PRO A 162 ? 0.5359 0.5672 0.5572 0.2232  0.0619  0.0224  162 PRO A N   
1273 C CA  . PRO A 162 ? 0.6091 0.5992 0.6147 0.2373  0.0664  0.0184  162 PRO A CA  
1274 C C   . PRO A 162 ? 0.5719 0.5707 0.5794 0.2559  0.0705  0.0233  162 PRO A C   
1275 O O   . PRO A 162 ? 0.6573 0.6814 0.6708 0.2639  0.0755  0.0234  162 PRO A O   
1276 C CB  . PRO A 162 ? 0.5195 0.4837 0.5103 0.2326  0.0718  0.0054  162 PRO A CB  
1277 C CG  . PRO A 162 ? 0.4624 0.4407 0.4589 0.2095  0.0662  0.0036  162 PRO A CG  
1278 C CD  . PRO A 162 ? 0.4737 0.4994 0.4898 0.2077  0.0628  0.0134  162 PRO A CD  
1279 N N   . GLY A 163 ? 0.7517 0.7302 0.7540 0.2607  0.0680  0.0280  163 GLY A N   
1280 C CA  . GLY A 163 ? 0.6775 0.6587 0.6790 0.2771  0.0717  0.0326  163 GLY A CA  
1281 C C   . GLY A 163 ? 0.8062 0.8248 0.8243 0.2828  0.0668  0.0466  163 GLY A C   
1282 O O   . GLY A 163 ? 0.9099 0.9299 0.9278 0.2958  0.0681  0.0531  163 GLY A O   
1283 N N   . SER A 164 ? 0.6815 0.7307 0.7135 0.2725  0.0609  0.0516  164 SER A N   
1284 C CA  . SER A 164 ? 0.5536 0.6449 0.6025 0.2748  0.0552  0.0650  164 SER A CA  
1285 C C   . SER A 164 ? 0.7147 0.7908 0.7608 0.2698  0.0477  0.0711  164 SER A C   
1286 O O   . SER A 164 ? 0.7965 0.8325 0.8293 0.2621  0.0466  0.0649  164 SER A O   
1287 C CB  . SER A 164 ? 0.5686 0.7055 0.6345 0.2649  0.0521  0.0681  164 SER A CB  
1288 O OG  . SER A 164 ? 0.4383 0.5655 0.5024 0.2434  0.0446  0.0655  164 SER A OG  
1289 N N   . ARG A 165 ? 0.6918 0.8018 0.7502 0.2732  0.0425  0.0834  165 ARG A N   
1290 C CA  . ARG A 165 ? 0.7322 0.8330 0.7883 0.2694  0.0352  0.0906  165 ARG A CA  
1291 C C   . ARG A 165 ? 0.6278 0.7470 0.6912 0.2526  0.0264  0.0934  165 ARG A C   
1292 O O   . ARG A 165 ? 0.5129 0.6088 0.5676 0.2419  0.0210  0.0934  165 ARG A O   
1293 C CB  . ARG A 165 ? 0.9453 1.0724 1.0090 0.2811  0.0336  0.1027  165 ARG A CB  
1294 C CG  . ARG A 165 ? 1.2261 1.3197 1.2779 0.2869  0.0327  0.1060  165 ARG A CG  
1295 C CD  . ARG A 165 ? 1.3765 1.5039 1.4383 0.2921  0.0272  0.1203  165 ARG A CD  
1296 N NE  . ARG A 165 ? 1.4157 1.5670 1.4851 0.2772  0.0171  0.1261  165 ARG A NE  
1297 C CZ  . ARG A 165 ? 1.3365 1.5377 1.4217 0.2702  0.0118  0.1322  165 ARG A CZ  
1298 N NH1 . ARG A 165 ? 1.3395 1.5740 1.4357 0.2771  0.0162  0.1339  165 ARG A NH1 
1299 N NH2 . ARG A 165 ? 1.2114 1.4296 1.3004 0.2552  0.0019  0.1367  165 ARG A NH2 
1300 N N   . GLU A 166 ? 0.5284 0.6846 0.6037 0.2411  0.0245  0.0930  166 GLU A N   
1301 C CA  . GLU A 166 ? 0.5080 0.6800 0.5866 0.2157  0.0153  0.0932  166 GLU A CA  
1302 C C   . GLU A 166 ? 0.5845 0.7251 0.6519 0.1963  0.0152  0.0809  166 GLU A C   
1303 O O   . GLU A 166 ? 0.5292 0.6690 0.5940 0.1770  0.0081  0.0801  166 GLU A O   
1304 C CB  . GLU A 166 ? 0.6393 0.8654 0.7349 0.2099  0.0124  0.0997  166 GLU A CB  
1305 C CG  . GLU A 166 ? 0.7884 1.0543 0.8973 0.2270  0.0111  0.1138  166 GLU A CG  
1306 C CD  . GLU A 166 ? 0.9466 1.2212 1.0603 0.2517  0.0214  0.1150  166 GLU A CD  
1307 O OE1 . GLU A 166 ? 0.8752 1.1146 0.9780 0.2582  0.0296  0.1044  166 GLU A OE1 
1308 O OE2 . GLU A 166 ? 1.0534 1.3637 1.1768 0.2580  0.0213  0.1239  166 GLU A OE2 
1309 N N   . ALA A 167 ? 0.6923 0.8081 0.7525 0.2017  0.0230  0.0715  167 ALA A N   
1310 C CA  . ALA A 167 ? 0.6076 0.6949 0.6574 0.1852  0.0234  0.0604  167 ALA A CA  
1311 C C   . ALA A 167 ? 0.6436 0.6927 0.6808 0.1958  0.0312  0.0520  167 ALA A C   
1312 O O   . ALA A 167 ? 0.6820 0.7298 0.7178 0.1968  0.0369  0.0450  167 ALA A O   
1313 C CB  . ALA A 167 ? 0.4569 0.5693 0.5141 0.1719  0.0232  0.0574  167 ALA A CB  
1314 N N   . PRO A 168 ? 0.5351 0.5528 0.5622 0.2027  0.0312  0.0531  168 PRO A N   
1315 C CA  . PRO A 168 ? 0.5256 0.5030 0.5382 0.2129  0.0378  0.0463  168 PRO A CA  
1316 C C   . PRO A 168 ? 0.7150 0.6663 0.7170 0.1973  0.0389  0.0350  168 PRO A C   
1317 O O   . PRO A 168 ? 0.6294 0.5533 0.6199 0.2034  0.0450  0.0274  168 PRO A O   
1318 C CB  . PRO A 168 ? 0.6883 0.6433 0.6939 0.2174  0.0347  0.0526  168 PRO A CB  
1319 C CG  . PRO A 168 ? 0.5414 0.5152 0.5533 0.2006  0.0257  0.0578  168 PRO A CG  
1320 C CD  . PRO A 168 ? 0.4648 0.4840 0.4924 0.1993  0.0241  0.0614  168 PRO A CD  
1321 N N   . GLY A 169 ? 0.6651 0.6246 0.6700 0.1779  0.0331  0.0341  169 GLY A N   
1322 C CA  . GLY A 169 ? 0.5476 0.4855 0.5436 0.1632  0.0335  0.0252  169 GLY A CA  
1323 C C   . GLY A 169 ? 0.4888 0.3978 0.4747 0.1555  0.0301  0.0255  169 GLY A C   
1324 O O   . GLY A 169 ? 0.5915 0.4912 0.5749 0.1634  0.0288  0.0315  169 GLY A O   
1325 N N   . ASN A 170 ? 0.5371 0.4342 0.5176 0.1402  0.0288  0.0199  170 ASN A N   
1326 C CA  . ASN A 170 ? 0.5937 0.4646 0.5643 0.1318  0.0265  0.0196  170 ASN A CA  
1327 C C   . ASN A 170 ? 0.4695 0.3443 0.4417 0.1284  0.0208  0.0276  170 ASN A C   
1328 O O   . ASN A 170 ? 0.5367 0.3903 0.5005 0.1238  0.0197  0.0284  170 ASN A O   
1329 C CB  . ASN A 170 ? 0.5806 0.4182 0.5385 0.1392  0.0308  0.0163  170 ASN A CB  
1330 C CG  . ASN A 170 ? 0.6321 0.4603 0.5842 0.1401  0.0362  0.0069  170 ASN A CG  
1331 O OD1 . ASN A 170 ? 0.6179 0.4541 0.5713 0.1291  0.0360  0.0019  170 ASN A OD1 
1332 N ND2 . ASN A 170 ? 0.6531 0.4629 0.5971 0.1538  0.0414  0.0045  170 ASN A ND2 
1333 N N   . VAL A 171 ? 0.5197 0.4219 0.5016 0.1297  0.0171  0.0335  171 VAL A N   
1334 C CA  . VAL A 171 ? 0.4638 0.3693 0.4452 0.1274  0.0117  0.0409  171 VAL A CA  
1335 C C   . VAL A 171 ? 0.6608 0.5554 0.6357 0.1123  0.0091  0.0386  171 VAL A C   
1336 O O   . VAL A 171 ? 0.4803 0.3645 0.4494 0.1104  0.0065  0.0430  171 VAL A O   
1337 C CB  . VAL A 171 ? 0.5807 0.5202 0.5730 0.1290  0.0074  0.0474  171 VAL A CB  
1338 C CG1 . VAL A 171 ? 0.3607 0.3155 0.3609 0.1455  0.0107  0.0508  171 VAL A CG1 
1339 C CG2 . VAL A 171 ? 0.3331 0.2907 0.3296 0.1145  0.0049  0.0439  171 VAL A CG2 
1340 N N   . GLY A 172 ? 0.4418 0.3398 0.4174 0.1024  0.0100  0.0324  172 GLY A N   
1341 C CA  . GLY A 172 ? 0.4366 0.3218 0.4054 0.0908  0.0093  0.0297  172 GLY A CA  
1342 C C   . GLY A 172 ? 0.3446 0.2040 0.3043 0.0915  0.0111  0.0298  172 GLY A C   
1343 O O   . GLY A 172 ? 0.5190 0.3714 0.4736 0.0861  0.0090  0.0326  172 GLY A O   
1344 N N   . LEU A 173 ? 0.6980 0.5427 0.6547 0.0975  0.0150  0.0265  173 LEU A N   
1345 C CA  . LEU A 173 ? 0.5789 0.3967 0.5256 0.0969  0.0165  0.0267  173 LEU A CA  
1346 C C   . LEU A 173 ? 0.4248 0.2353 0.3686 0.1034  0.0144  0.0348  173 LEU A C   
1347 O O   . LEU A 173 ? 0.6393 0.4355 0.5761 0.0981  0.0134  0.0379  173 LEU A O   
1348 C CB  . LEU A 173 ? 0.3887 0.1898 0.3302 0.1017  0.0212  0.0206  173 LEU A CB  
1349 C CG  . LEU A 173 ? 0.5130 0.3189 0.4550 0.0934  0.0231  0.0128  173 LEU A CG  
1350 C CD1 . LEU A 173 ? 0.3942 0.1869 0.3306 0.0994  0.0277  0.0062  173 LEU A CD1 
1351 C CD2 . LEU A 173 ? 0.3720 0.1710 0.3093 0.0798  0.0218  0.0119  173 LEU A CD2 
1352 N N   . LEU A 174 ? 0.4812 0.3045 0.4309 0.1150  0.0137  0.0392  174 LEU A N   
1353 C CA  . LEU A 174 ? 0.4019 0.2223 0.3498 0.1222  0.0113  0.0483  174 LEU A CA  
1354 C C   . LEU A 174 ? 0.5270 0.3585 0.4747 0.1135  0.0063  0.0533  174 LEU A C   
1355 O O   . LEU A 174 ? 0.5197 0.3409 0.4616 0.1148  0.0047  0.0599  174 LEU A O   
1356 C CB  . LEU A 174 ? 0.4666 0.3027 0.4220 0.1374  0.0116  0.0527  174 LEU A CB  
1357 C CG  . LEU A 174 ? 0.5702 0.3925 0.5233 0.1507  0.0175  0.0492  174 LEU A CG  
1358 C CD1 . LEU A 174 ? 0.4275 0.2749 0.3909 0.1659  0.0176  0.0549  174 LEU A CD1 
1359 C CD2 . LEU A 174 ? 0.6018 0.3863 0.5411 0.1556  0.0203  0.0507  174 LEU A CD2 
1360 N N   . ASP A 175 ? 0.6173 0.4686 0.5702 0.1050  0.0040  0.0502  175 ASP A N   
1361 C CA  . ASP A 175 ? 0.5613 0.4192 0.5109 0.0962  0.0001  0.0532  175 ASP A CA  
1362 C C   . ASP A 175 ? 0.5905 0.4270 0.5309 0.0897  0.0019  0.0529  175 ASP A C   
1363 O O   . ASP A 175 ? 0.5864 0.4186 0.5210 0.0881  -0.0001 0.0587  175 ASP A O   
1364 C CB  . ASP A 175 ? 0.6531 0.5277 0.6062 0.0869  -0.0013 0.0482  175 ASP A CB  
1365 C CG  . ASP A 175 ? 0.8285 0.7273 0.7908 0.0903  -0.0036 0.0490  175 ASP A CG  
1366 O OD1 . ASP A 175 ? 0.7394 0.6471 0.7062 0.1002  -0.0049 0.0548  175 ASP A OD1 
1367 O OD2 . ASP A 175 ? 0.8725 0.7823 0.8376 0.0828  -0.0041 0.0445  175 ASP A OD2 
1368 N N   . GLN A 176 ? 0.4776 0.3025 0.4165 0.0854  0.0055  0.0466  176 GLN A N   
1369 C CA  . GLN A 176 ? 0.3891 0.1983 0.3206 0.0775  0.0069  0.0466  176 GLN A CA  
1370 C C   . GLN A 176 ? 0.6137 0.4038 0.5383 0.0817  0.0072  0.0528  176 GLN A C   
1371 O O   . GLN A 176 ? 0.7303 0.5157 0.6494 0.0772  0.0061  0.0581  176 GLN A O   
1372 C CB  . GLN A 176 ? 0.4247 0.2270 0.3560 0.0722  0.0102  0.0392  176 GLN A CB  
1373 C CG  . GLN A 176 ? 0.4747 0.2939 0.4120 0.0683  0.0105  0.0336  176 GLN A CG  
1374 C CD  . GLN A 176 ? 0.6842 0.4973 0.6208 0.0634  0.0135  0.0274  176 GLN A CD  
1375 O OE1 . GLN A 176 ? 0.7692 0.5652 0.7003 0.0623  0.0152  0.0264  176 GLN A OE1 
1376 N NE2 . GLN A 176 ? 0.4586 0.2845 0.3994 0.0596  0.0140  0.0234  176 GLN A NE2 
1377 N N   . ARG A 177 ? 0.6409 0.4193 0.5652 0.0910  0.0090  0.0523  177 ARG A N   
1378 C CA  . ARG A 177 ? 0.6850 0.4405 0.6011 0.0961  0.0097  0.0582  177 ARG A CA  
1379 C C   . ARG A 177 ? 0.7343 0.4973 0.6497 0.0994  0.0061  0.0682  177 ARG A C   
1380 O O   . ARG A 177 ? 0.7314 0.4787 0.6386 0.0967  0.0059  0.0744  177 ARG A O   
1381 C CB  . ARG A 177 ? 0.7105 0.4546 0.6263 0.1090  0.0126  0.0563  177 ARG A CB  
1382 C CG  . ARG A 177 ? 0.6352 0.3545 0.5424 0.1135  0.0136  0.0614  177 ARG A CG  
1383 C CD  . ARG A 177 ? 0.6894 0.4024 0.5979 0.1246  0.0167  0.0572  177 ARG A CD  
1384 N NE  . ARG A 177 ? 0.6810 0.3802 0.5846 0.1182  0.0201  0.0468  177 ARG A NE  
1385 C CZ  . ARG A 177 ? 0.7121 0.4067 0.6154 0.1263  0.0238  0.0405  177 ARG A CZ  
1386 N NH1 . ARG A 177 ? 0.6475 0.3514 0.5562 0.1417  0.0247  0.0441  177 ARG A NH1 
1387 N NH2 . ARG A 177 ? 0.6493 0.3312 0.5463 0.1192  0.0265  0.0310  177 ARG A NH2 
1388 N N   . LEU A 178 ? 0.6669 0.4548 0.5902 0.1040  0.0031  0.0700  178 LEU A N   
1389 C CA  . LEU A 178 ? 0.5785 0.3776 0.5007 0.1061  -0.0010 0.0790  178 LEU A CA  
1390 C C   . LEU A 178 ? 0.6498 0.4490 0.5657 0.0942  -0.0022 0.0805  178 LEU A C   
1391 O O   . LEU A 178 ? 0.6712 0.4663 0.5811 0.0949  -0.0039 0.0888  178 LEU A O   
1392 C CB  . LEU A 178 ? 0.5423 0.3705 0.4737 0.1105  -0.0046 0.0797  178 LEU A CB  
1393 C CG  . LEU A 178 ? 0.5590 0.4031 0.4893 0.1120  -0.0097 0.0885  178 LEU A CG  
1394 C CD1 . LEU A 178 ? 0.5944 0.4213 0.5177 0.1191  -0.0096 0.0983  178 LEU A CD1 
1395 C CD2 . LEU A 178 ? 0.4078 0.2790 0.3480 0.1187  -0.0130 0.0904  178 LEU A CD2 
1396 N N   . ALA A 179 ? 0.4772 0.2816 0.3941 0.0844  -0.0009 0.0731  179 ALA A N   
1397 C CA  . ALA A 179 ? 0.3994 0.2047 0.3103 0.0747  -0.0008 0.0741  179 ALA A CA  
1398 C C   . ALA A 179 ? 0.7303 0.5152 0.6342 0.0702  0.0016  0.0777  179 ALA A C   
1399 O O   . ALA A 179 ? 0.7390 0.5233 0.6367 0.0660  0.0012  0.0838  179 ALA A O   
1400 C CB  . ALA A 179 ? 0.3808 0.1970 0.2944 0.0671  0.0005  0.0658  179 ALA A CB  
1401 N N   . LEU A 180 ? 0.4217 0.1899 0.3254 0.0703  0.0043  0.0740  180 LEU A N   
1402 C CA  . LEU A 180 ? 0.7866 0.5324 0.6820 0.0650  0.0061  0.0780  180 LEU A CA  
1403 C C   . LEU A 180 ? 0.7318 0.4659 0.6210 0.0714  0.0045  0.0885  180 LEU A C   
1404 O O   . LEU A 180 ? 0.6335 0.3587 0.5154 0.0649  0.0046  0.0952  180 LEU A O   
1405 C CB  . LEU A 180 ? 0.7223 0.4492 0.6161 0.0639  0.0088  0.0715  180 LEU A CB  
1406 C CG  . LEU A 180 ? 0.6555 0.3927 0.5551 0.0587  0.0104  0.0616  180 LEU A CG  
1407 C CD1 . LEU A 180 ? 0.5540 0.2697 0.4479 0.0542  0.0129  0.0564  180 LEU A CD1 
1408 C CD2 . LEU A 180 ? 0.5677 0.3227 0.4696 0.0493  0.0103  0.0614  180 LEU A CD2 
1409 N N   . GLN A 181 ? 0.6033 0.3394 0.4957 0.0842  0.0031  0.0907  181 GLN A N   
1410 C CA  . GLN A 181 ? 0.6615 0.3895 0.5487 0.0921  0.0013  0.1018  181 GLN A CA  
1411 C C   . GLN A 181 ? 0.7235 0.4684 0.6086 0.0876  -0.0018 0.1088  181 GLN A C   
1412 O O   . GLN A 181 ? 0.6745 0.4088 0.5514 0.0860  -0.0023 0.1182  181 GLN A O   
1413 C CB  . GLN A 181 ? 0.5706 0.3068 0.4647 0.1071  0.0001  0.1029  181 GLN A CB  
1414 C CG  . GLN A 181 ? 0.8286 0.5473 0.7238 0.1116  0.0030  0.0981  181 GLN A CG  
1415 C CD  . GLN A 181 ? 0.7466 0.4783 0.6504 0.1254  0.0033  0.0956  181 GLN A CD  
1416 O OE1 . GLN A 181 ? 0.8694 0.6246 0.7792 0.1311  0.0007  0.0986  181 GLN A OE1 
1417 N NE2 . GLN A 181 ? 0.6182 0.3353 0.5220 0.1307  0.0067  0.0904  181 GLN A NE2 
1418 N N   . TRP A 182 ? 0.6609 0.4309 0.5519 0.0851  -0.0036 0.1039  182 TRP A N   
1419 C CA  . TRP A 182 ? 0.5879 0.3740 0.4751 0.0803  -0.0061 0.1080  182 TRP A CA  
1420 C C   . TRP A 182 ? 0.6063 0.3837 0.4858 0.0697  -0.0035 0.1107  182 TRP A C   
1421 O O   . TRP A 182 ? 0.6027 0.3833 0.4753 0.0679  -0.0047 0.1188  182 TRP A O   
1422 C CB  . TRP A 182 ? 0.5805 0.3891 0.4729 0.0774  -0.0075 0.1000  182 TRP A CB  
1423 C CG  . TRP A 182 ? 0.6321 0.4557 0.5180 0.0739  -0.0102 0.1036  182 TRP A CG  
1424 C CD1 . TRP A 182 ? 0.4544 0.2927 0.3390 0.0784  -0.0150 0.1087  182 TRP A CD1 
1425 C CD2 . TRP A 182 ? 0.5325 0.3583 0.4112 0.0653  -0.0080 0.1026  182 TRP A CD2 
1426 N NE1 . TRP A 182 ? 0.6190 0.4665 0.4946 0.0724  -0.0161 0.1100  182 TRP A NE1 
1427 C CE2 . TRP A 182 ? 0.4910 0.3308 0.3628 0.0652  -0.0114 0.1062  182 TRP A CE2 
1428 C CE3 . TRP A 182 ? 0.5451 0.3641 0.4223 0.0581  -0.0035 0.0994  182 TRP A CE3 
1429 C CZ2 . TRP A 182 ? 0.5528 0.3978 0.4153 0.0591  -0.0096 0.1059  182 TRP A CZ2 
1430 C CZ3 . TRP A 182 ? 0.5445 0.3714 0.4142 0.0526  -0.0017 0.1001  182 TRP A CZ3 
1431 C CH2 . TRP A 182 ? 0.5432 0.3818 0.4051 0.0537  -0.0044 0.1029  182 TRP A CH2 
1432 N N   . VAL A 183 ? 0.4988 0.2672 0.3795 0.0625  -0.0001 0.1045  183 VAL A N   
1433 C CA  . VAL A 183 ? 0.5946 0.3604 0.4698 0.0517  0.0024  0.1072  183 VAL A CA  
1434 C C   . VAL A 183 ? 0.7312 0.4765 0.5985 0.0503  0.0025  0.1172  183 VAL A C   
1435 O O   . VAL A 183 ? 0.7854 0.5325 0.6463 0.0443  0.0030  0.1249  183 VAL A O   
1436 C CB  . VAL A 183 ? 0.6250 0.3895 0.5041 0.0439  0.0055  0.0989  183 VAL A CB  
1437 C CG1 . VAL A 183 ? 0.5171 0.2775 0.3908 0.0324  0.0079  0.1039  183 VAL A CG1 
1438 C CG2 . VAL A 183 ? 0.5002 0.2850 0.3852 0.0443  0.0059  0.0907  183 VAL A CG2 
1439 N N   . GLN A 184 ? 0.7660 0.4907 0.6327 0.0564  0.0025  0.1174  184 GLN A N   
1440 C CA  . GLN A 184 ? 0.6764 0.3776 0.5350 0.0553  0.0027  0.1261  184 GLN A CA  
1441 C C   . GLN A 184 ? 0.7212 0.4300 0.5768 0.0605  -0.0002 0.1371  184 GLN A C   
1442 O O   . GLN A 184 ? 0.7199 0.4201 0.5696 0.0543  -0.0004 0.1455  184 GLN A O   
1443 C CB  . GLN A 184 ? 0.5812 0.2658 0.4438 0.0611  0.0030  0.1204  184 GLN A CB  
1444 C CG  . GLN A 184 ? 0.5949 0.2674 0.4569 0.0521  0.0059  0.1112  184 GLN A CG  
1445 C CD  . GLN A 184 ? 0.8351 0.4891 0.6892 0.0385  0.0069  0.1152  184 GLN A CD  
1446 O OE1 . GLN A 184 ? 0.8010 0.4377 0.6516 0.0397  0.0064  0.1195  184 GLN A OE1 
1447 N NE2 . GLN A 184 ? 0.7897 0.4480 0.6408 0.0253  0.0084  0.1143  184 GLN A NE2 
1448 N N   . GLU A 185 ? 0.6577 0.3837 0.5165 0.0709  -0.0029 0.1378  185 GLU A N   
1449 C CA  . GLU A 185 ? 0.7596 0.4948 0.6146 0.0752  -0.0062 0.1487  185 GLU A CA  
1450 C C   . GLU A 185 ? 0.6265 0.3791 0.4755 0.0677  -0.0063 0.1522  185 GLU A C   
1451 O O   . GLU A 185 ? 0.8341 0.5872 0.6753 0.0672  -0.0075 0.1631  185 GLU A O   
1452 C CB  . GLU A 185 ? 0.7238 0.4726 0.5848 0.0889  -0.0099 0.1499  185 GLU A CB  
1453 C CG  . GLU A 185 ? 0.7524 0.4998 0.6115 0.0946  -0.0131 0.1611  185 GLU A CG  
1454 C CD  . GLU A 185 ? 0.9398 0.7083 0.8036 0.1066  -0.0175 0.1649  185 GLU A CD  
1455 O OE1 . GLU A 185 ? 1.0038 0.7834 0.8747 0.1122  -0.0177 0.1580  185 GLU A OE1 
1456 O OE2 . GLU A 185 ? 0.9543 0.7298 0.8147 0.1099  -0.0210 0.1752  185 GLU A OE2 
1457 N N   . ASN A 186 ? 0.6293 0.3977 0.4826 0.0616  -0.0049 0.1422  186 ASN A N   
1458 C CA  . ASN A 186 ? 0.6161 0.4058 0.4652 0.0575  -0.0054 0.1427  186 ASN A CA  
1459 C C   . ASN A 186 ? 0.6903 0.4840 0.5367 0.0468  -0.0011 0.1404  186 ASN A C   
1460 O O   . ASN A 186 ? 0.8127 0.6200 0.6525 0.0437  -0.0003 0.1437  186 ASN A O   
1461 C CB  . ASN A 186 ? 0.4719 0.2806 0.3261 0.0619  -0.0081 0.1340  186 ASN A CB  
1462 C CG  . ASN A 186 ? 0.6855 0.4974 0.5430 0.0724  -0.0128 0.1380  186 ASN A CG  
1463 O OD1 . ASN A 186 ? 0.6149 0.4319 0.4668 0.0762  -0.0160 0.1480  186 ASN A OD1 
1464 N ND2 . ASN A 186 ? 0.5279 0.3391 0.3950 0.0774  -0.0132 0.1310  186 ASN A ND2 
1465 N N   . ILE A 187 ? 0.6228 0.4064 0.4739 0.0413  0.0020  0.1351  187 ILE A N   
1466 C CA  . ILE A 187 ? 0.4810 0.2744 0.3323 0.0323  0.0060  0.1320  187 ILE A CA  
1467 C C   . ILE A 187 ? 0.5736 0.3701 0.4168 0.0250  0.0081  0.1427  187 ILE A C   
1468 O O   . ILE A 187 ? 0.7639 0.5768 0.6056 0.0206  0.0115  0.1419  187 ILE A O   
1469 C CB  . ILE A 187 ? 0.4931 0.2782 0.3515 0.0272  0.0083  0.1243  187 ILE A CB  
1470 C CG1 . ILE A 187 ? 0.5994 0.4033 0.4611 0.0226  0.0119  0.1183  187 ILE A CG1 
1471 C CG2 . ILE A 187 ? 0.4829 0.2469 0.3379 0.0193  0.0091  0.1306  187 ILE A CG2 
1472 C CD1 . ILE A 187 ? 0.5068 0.3257 0.3697 0.0296  0.0113  0.1107  187 ILE A CD1 
1473 N N   . ALA A 188 ? 0.6428 0.4240 0.4802 0.0244  0.0065  0.1533  188 ALA A N   
1474 C CA  . ALA A 188 ? 0.6906 0.4754 0.5197 0.0171  0.0083  0.1649  188 ALA A CA  
1475 C C   . ALA A 188 ? 0.6614 0.4686 0.4845 0.0204  0.0085  0.1673  188 ALA A C   
1476 O O   . ALA A 188 ? 0.6982 0.5168 0.5157 0.0142  0.0116  0.1736  188 ALA A O   
1477 C CB  . ALA A 188 ? 0.5449 0.3057 0.3674 0.0164  0.0063  0.1765  188 ALA A CB  
1478 N N   . ALA A 189 ? 0.6214 0.4355 0.4446 0.0298  0.0051  0.1625  189 ALA A N   
1479 C CA  . ALA A 189 ? 0.6848 0.5187 0.5003 0.0323  0.0049  0.1626  189 ALA A CA  
1480 C C   . ALA A 189 ? 0.8172 0.6667 0.6326 0.0291  0.0100  0.1542  189 ALA A C   
1481 O O   . ALA A 189 ? 0.9493 0.8135 0.7555 0.0298  0.0118  0.1547  189 ALA A O   
1482 C CB  . ALA A 189 ? 0.4987 0.3369 0.3146 0.0411  -0.0005 0.1582  189 ALA A CB  
1483 N N   . PHE A 190 ? 0.7002 0.5465 0.5248 0.0265  0.0125  0.1466  190 PHE A N   
1484 C CA  . PHE A 190 ? 0.6426 0.5035 0.4675 0.0252  0.0177  0.1399  190 PHE A CA  
1485 C C   . PHE A 190 ? 0.7294 0.5950 0.5571 0.0167  0.0225  0.1457  190 PHE A C   
1486 O O   . PHE A 190 ? 0.8184 0.6986 0.6471 0.0160  0.0275  0.1422  190 PHE A O   
1487 C CB  . PHE A 190 ? 0.6071 0.4660 0.4401 0.0287  0.0172  0.1273  190 PHE A CB  
1488 C CG  . PHE A 190 ? 0.5857 0.4424 0.4172 0.0353  0.0123  0.1215  190 PHE A CG  
1489 C CD1 . PHE A 190 ? 0.5231 0.3687 0.3591 0.0380  0.0072  0.1241  190 PHE A CD1 
1490 C CD2 . PHE A 190 ? 0.6614 0.5273 0.4867 0.0386  0.0129  0.1136  190 PHE A CD2 
1491 C CE1 . PHE A 190 ? 0.6892 0.5374 0.5253 0.0436  0.0024  0.1197  190 PHE A CE1 
1492 C CE2 . PHE A 190 ? 0.6366 0.5020 0.4603 0.0424  0.0078  0.1085  190 PHE A CE2 
1493 C CZ  . PHE A 190 ? 0.6524 0.5112 0.4826 0.0446  0.0024  0.1119  190 PHE A CZ  
1494 N N   . GLY A 191 ? 0.5567 0.4098 0.3849 0.0101  0.0210  0.1550  191 GLY A N   
1495 C CA  . GLY A 191 ? 0.4851 0.3423 0.3155 -0.0007 0.0246  0.1616  191 GLY A CA  
1496 C C   . GLY A 191 ? 0.5937 0.4391 0.4334 -0.0064 0.0240  0.1565  191 GLY A C   
1497 O O   . GLY A 191 ? 0.6374 0.4872 0.4797 -0.0171 0.0263  0.1609  191 GLY A O   
1498 N N   . GLY A 192 ? 0.4728 0.3049 0.3172 -0.0001 0.0207  0.1474  192 GLY A N   
1499 C CA  . GLY A 192 ? 0.7691 0.5876 0.6204 -0.0051 0.0199  0.1422  192 GLY A CA  
1500 C C   . GLY A 192 ? 0.7851 0.5773 0.6321 -0.0111 0.0173  0.1489  192 GLY A C   
1501 O O   . GLY A 192 ? 0.7083 0.4890 0.5488 -0.0066 0.0150  0.1557  192 GLY A O   
1502 N N   . ASP A 193 ? 0.7856 0.5673 0.6351 -0.0211 0.0176  0.1471  193 ASP A N   
1503 C CA  . ASP A 193 ? 0.6556 0.4074 0.4983 -0.0283 0.0157  0.1523  193 ASP A CA  
1504 C C   . ASP A 193 ? 0.6488 0.3779 0.4932 -0.0209 0.0135  0.1430  193 ASP A C   
1505 O O   . ASP A 193 ? 0.6606 0.3914 0.5106 -0.0234 0.0140  0.1338  193 ASP A O   
1506 C CB  . ASP A 193 ? 0.6576 0.4109 0.4998 -0.0462 0.0172  0.1558  193 ASP A CB  
1507 C CG  . ASP A 193 ? 0.9323 0.6520 0.7637 -0.0568 0.0154  0.1629  193 ASP A CG  
1508 O OD1 . ASP A 193 ? 0.6563 0.3492 0.4812 -0.0482 0.0134  0.1643  193 ASP A OD1 
1509 O OD2 . ASP A 193 ? 0.7896 0.5110 0.6190 -0.0741 0.0160  0.1671  193 ASP A OD2 
1510 N N   . PRO A 194 ? 0.7755 0.4844 0.6146 -0.0110 0.0113  0.1461  194 PRO A N   
1511 C CA  . PRO A 194 ? 0.6540 0.3426 0.4945 -0.0026 0.0100  0.1377  194 PRO A CA  
1512 C C   . PRO A 194 ? 0.7347 0.3965 0.5701 -0.0126 0.0104  0.1358  194 PRO A C   
1513 O O   . PRO A 194 ? 0.6877 0.3379 0.5259 -0.0077 0.0102  0.1261  194 PRO A O   
1514 C CB  . PRO A 194 ? 0.5554 0.2370 0.3940 0.0114  0.0077  0.1429  194 PRO A CB  
1515 C CG  . PRO A 194 ? 0.5658 0.2536 0.3988 0.0069  0.0074  0.1552  194 PRO A CG  
1516 C CD  . PRO A 194 ? 0.5541 0.2620 0.3868 -0.0052 0.0100  0.1570  194 PRO A CD  
1517 N N   . MET A 195 ? 0.7918 0.4486 0.6222 -0.0268 0.0108  0.1434  195 MET A N   
1518 C CA  . MET A 195 ? 0.8925 0.5285 0.7195 -0.0384 0.0109  0.1396  195 MET A CA  
1519 C C   . MET A 195 ? 0.8295 0.4739 0.6576 -0.0498 0.0117  0.1323  195 MET A C   
1520 O O   . MET A 195 ? 0.8391 0.4688 0.6637 -0.0608 0.0114  0.1273  195 MET A O   
1521 C CB  . MET A 195 ? 1.0770 0.7060 0.8984 -0.0513 0.0111  0.1502  195 MET A CB  
1522 C CG  . MET A 195 ? 1.2863 0.9108 1.1061 -0.0417 0.0105  0.1601  195 MET A CG  
1523 S SD  . MET A 195 ? 1.1194 0.7074 0.9332 -0.0404 0.0099  0.1615  195 MET A SD  
1524 C CE  . MET A 195 ? 0.9638 0.5384 0.7810 -0.0267 0.0093  0.1461  195 MET A CE  
1525 N N   . SER A 196 ? 0.7026 0.3766 0.5390 -0.0460 0.0127  0.1301  196 SER A N   
1526 C CA  . SER A 196 ? 0.5554 0.2510 0.3997 -0.0547 0.0136  0.1232  196 SER A CA  
1527 C C   . SER A 196 ? 0.7662 0.4851 0.6224 -0.0414 0.0144  0.1140  196 SER A C   
1528 O O   . SER A 196 ? 0.6452 0.3933 0.5084 -0.0382 0.0159  0.1157  196 SER A O   
1529 C CB  . SER A 196 ? 0.6348 0.3553 0.4811 -0.0684 0.0149  0.1322  196 SER A CB  
1530 O OG  . SER A 196 ? 0.7054 0.4525 0.5611 -0.0735 0.0160  0.1268  196 SER A OG  
1531 N N   . VAL A 197 ? 0.7053 0.4098 0.5623 -0.0339 0.0137  0.1043  197 VAL A N   
1532 C CA  . VAL A 197 ? 0.7530 0.4753 0.6200 -0.0219 0.0141  0.0960  197 VAL A CA  
1533 C C   . VAL A 197 ? 0.8248 0.5488 0.6955 -0.0262 0.0144  0.0860  197 VAL A C   
1534 O O   . VAL A 197 ? 0.6561 0.3560 0.5200 -0.0303 0.0138  0.0816  197 VAL A O   
1535 C CB  . VAL A 197 ? 0.8559 0.5659 0.7222 -0.0060 0.0130  0.0943  197 VAL A CB  
1536 C CG1 . VAL A 197 ? 0.7627 0.4892 0.6388 0.0039  0.0131  0.0849  197 VAL A CG1 
1537 C CG2 . VAL A 197 ? 0.6256 0.3394 0.4888 -0.0010 0.0122  0.1044  197 VAL A CG2 
1538 N N   . THR A 198 ? 0.6920 0.4439 0.5722 -0.0249 0.0156  0.0827  198 THR A N   
1539 C CA  . THR A 198 ? 0.5410 0.3012 0.4257 -0.0296 0.0160  0.0750  198 THR A CA  
1540 C C   . THR A 198 ? 0.7354 0.5087 0.6284 -0.0169 0.0166  0.0677  198 THR A C   
1541 O O   . THR A 198 ? 0.7888 0.5819 0.6870 -0.0111 0.0178  0.0695  198 THR A O   
1542 C CB  . THR A 198 ? 0.6793 0.4629 0.5674 -0.0424 0.0170  0.0798  198 THR A CB  
1543 O OG1 . THR A 198 ? 0.6861 0.4552 0.5660 -0.0582 0.0156  0.0840  198 THR A OG1 
1544 C CG2 . THR A 198 ? 0.5694 0.3719 0.4653 -0.0427 0.0176  0.0731  198 THR A CG2 
1545 N N   . LEU A 199 ? 0.6196 0.3801 0.5123 -0.0130 0.0161  0.0595  199 LEU A N   
1546 C CA  . LEU A 199 ? 0.6325 0.4045 0.5326 -0.0032 0.0166  0.0526  199 LEU A CA  
1547 C C   . LEU A 199 ? 0.6525 0.4444 0.5583 -0.0086 0.0176  0.0495  199 LEU A C   
1548 O O   . LEU A 199 ? 0.6485 0.4394 0.5519 -0.0197 0.0173  0.0490  199 LEU A O   
1549 C CB  . LEU A 199 ? 0.6545 0.4078 0.5519 0.0025  0.0162  0.0456  199 LEU A CB  
1550 C CG  . LEU A 199 ? 0.5921 0.3220 0.4828 0.0091  0.0156  0.0483  199 LEU A CG  
1551 C CD1 . LEU A 199 ? 0.5197 0.2377 0.4099 0.0186  0.0163  0.0408  199 LEU A CD1 
1552 C CD2 . LEU A 199 ? 0.5965 0.3355 0.4898 0.0165  0.0147  0.0551  199 LEU A CD2 
1553 N N   . PHE A 200 ? 0.4846 0.2939 0.3972 -0.0011 0.0186  0.0477  200 PHE A N   
1554 C CA  . PHE A 200 ? 0.5200 0.3459 0.4380 -0.0035 0.0198  0.0443  200 PHE A CA  
1555 C C   . PHE A 200 ? 0.6317 0.4665 0.5549 0.0065  0.0205  0.0403  200 PHE A C   
1556 O O   . PHE A 200 ? 0.5323 0.3653 0.4552 0.0141  0.0202  0.0411  200 PHE A O   
1557 C CB  . PHE A 200 ? 0.6206 0.4653 0.5405 -0.0112 0.0211  0.0506  200 PHE A CB  
1558 C CG  . PHE A 200 ? 0.6570 0.5169 0.5793 -0.0044 0.0234  0.0553  200 PHE A CG  
1559 C CD1 . PHE A 200 ? 0.6044 0.4569 0.5230 0.0012  0.0232  0.0580  200 PHE A CD1 
1560 C CD2 . PHE A 200 ? 0.4889 0.3705 0.4159 -0.0033 0.0260  0.0573  200 PHE A CD2 
1561 C CE1 . PHE A 200 ? 0.4471 0.3119 0.3651 0.0070  0.0256  0.0615  200 PHE A CE1 
1562 C CE2 . PHE A 200 ? 0.4460 0.3387 0.3728 0.0039  0.0289  0.0611  200 PHE A CE2 
1563 C CZ  . PHE A 200 ? 0.4883 0.3719 0.4098 0.0087  0.0288  0.0626  200 PHE A CZ  
1564 N N   . GLY A 201 ? 0.5365 0.3806 0.4635 0.0054  0.0212  0.0362  201 GLY A N   
1565 C CA  . GLY A 201 ? 0.3202 0.1685 0.2510 0.0130  0.0216  0.0315  201 GLY A CA  
1566 C C   . GLY A 201 ? 0.5227 0.3806 0.4566 0.0098  0.0223  0.0282  201 GLY A C   
1567 O O   . GLY A 201 ? 0.4237 0.2821 0.3561 0.0015  0.0218  0.0278  201 GLY A O   
1568 N N   . GLU A 202 ? 0.5899 0.4556 0.5274 0.0155  0.0233  0.0261  202 GLU A N   
1569 C CA  . GLU A 202 ? 0.4517 0.3281 0.3921 0.0135  0.0240  0.0241  202 GLU A CA  
1570 C C   . GLU A 202 ? 0.4773 0.3499 0.4192 0.0178  0.0238  0.0183  202 GLU A C   
1571 O O   . GLU A 202 ? 0.4590 0.3245 0.4010 0.0231  0.0231  0.0167  202 GLU A O   
1572 C CB  . GLU A 202 ? 0.5341 0.4255 0.4767 0.0161  0.0263  0.0291  202 GLU A CB  
1573 C CG  . GLU A 202 ? 0.5633 0.4674 0.5091 0.0157  0.0272  0.0287  202 GLU A CG  
1574 C CD  . GLU A 202 ? 0.6853 0.5866 0.6318 0.0222  0.0279  0.0259  202 GLU A CD  
1575 O OE1 . GLU A 202 ? 0.6362 0.5267 0.5811 0.0258  0.0272  0.0236  202 GLU A OE1 
1576 O OE2 . GLU A 202 ? 0.7914 0.7020 0.7397 0.0232  0.0291  0.0266  202 GLU A OE2 
1577 N N   . SER A 203 ? 0.3237 0.2032 0.2668 0.0149  0.0241  0.0156  203 SER A N   
1578 C CA  . SER A 203 ? 0.4792 0.3567 0.4232 0.0176  0.0242  0.0100  203 SER A CA  
1579 C C   . SER A 203 ? 0.5660 0.4296 0.5084 0.0216  0.0235  0.0063  203 SER A C   
1580 O O   . SER A 203 ? 0.5950 0.4468 0.5327 0.0189  0.0231  0.0043  203 SER A O   
1581 C CB  . SER A 203 ? 0.5387 0.4258 0.4864 0.0219  0.0253  0.0111  203 SER A CB  
1582 O OG  . SER A 203 ? 0.8564 0.7386 0.8047 0.0270  0.0249  0.0117  203 SER A OG  
1583 N N   . ALA A 204 ? 0.5711 0.4360 0.5166 0.0278  0.0235  0.0060  204 ALA A N   
1584 C CA  . ALA A 204 ? 0.4998 0.3562 0.4453 0.0333  0.0229  0.0039  204 ALA A CA  
1585 C C   . ALA A 204 ? 0.5447 0.3896 0.4868 0.0339  0.0217  0.0073  204 ALA A C   
1586 O O   . ALA A 204 ? 0.6418 0.4756 0.5816 0.0376  0.0215  0.0060  204 ALA A O   
1587 C CB  . ALA A 204 ? 0.3962 0.2612 0.3467 0.0381  0.0224  0.0044  204 ALA A CB  
1588 N N   . GLY A 205 ? 0.4900 0.3378 0.4314 0.0312  0.0212  0.0120  205 GLY A N   
1589 C CA  . GLY A 205 ? 0.5311 0.3699 0.4687 0.0302  0.0203  0.0160  205 GLY A CA  
1590 C C   . GLY A 205 ? 0.6284 0.4563 0.5610 0.0241  0.0205  0.0149  205 GLY A C   
1591 O O   . GLY A 205 ? 0.4622 0.2750 0.3903 0.0253  0.0199  0.0152  205 GLY A O   
1592 N N   . ALA A 206 ? 0.3234 0.1586 0.2559 0.0172  0.0212  0.0138  206 ALA A N   
1593 C CA  . ALA A 206 ? 0.5564 0.3822 0.4829 0.0091  0.0209  0.0117  206 ALA A CA  
1594 C C   . ALA A 206 ? 0.6306 0.4394 0.5521 0.0127  0.0213  0.0053  206 ALA A C   
1595 O O   . ALA A 206 ? 0.5727 0.3622 0.4863 0.0102  0.0210  0.0047  206 ALA A O   
1596 C CB  . ALA A 206 ? 0.4791 0.3198 0.4072 0.0019  0.0211  0.0110  206 ALA A CB  
1597 N N   . ALA A 207 ? 0.4657 0.2811 0.3911 0.0191  0.0224  0.0009  207 ALA A N   
1598 C CA  . ALA A 207 ? 0.4625 0.2650 0.3836 0.0248  0.0239  -0.0050 207 ALA A CA  
1599 C C   . ALA A 207 ? 0.6586 0.4461 0.5776 0.0323  0.0237  -0.0024 207 ALA A C   
1600 O O   . ALA A 207 ? 0.5828 0.3492 0.4931 0.0339  0.0246  -0.0049 207 ALA A O   
1601 C CB  . ALA A 207 ? 0.4063 0.2233 0.3339 0.0311  0.0252  -0.0081 207 ALA A CB  
1602 N N   . SER A 208 ? 0.6689 0.4665 0.5947 0.0369  0.0224  0.0030  208 SER A N   
1603 C CA  . SER A 208 ? 0.6306 0.4182 0.5552 0.0439  0.0215  0.0073  208 SER A CA  
1604 C C   . SER A 208 ? 0.6779 0.4445 0.5931 0.0389  0.0211  0.0099  208 SER A C   
1605 O O   . SER A 208 ? 0.5957 0.3443 0.5054 0.0450  0.0217  0.0105  208 SER A O   
1606 C CB  . SER A 208 ? 0.5004 0.3030 0.4315 0.0457  0.0195  0.0129  208 SER A CB  
1607 O OG  . SER A 208 ? 0.5576 0.3756 0.4959 0.0509  0.0195  0.0111  208 SER A OG  
1608 N N   . VAL A 209 ? 0.3816 0.1513 0.2951 0.0279  0.0203  0.0123  209 VAL A N   
1609 C CA  . VAL A 209 ? 0.4954 0.2479 0.4002 0.0204  0.0196  0.0157  209 VAL A CA  
1610 C C   . VAL A 209 ? 0.6741 0.4027 0.5681 0.0185  0.0209  0.0094  209 VAL A C   
1611 O O   . VAL A 209 ? 0.4982 0.2026 0.3834 0.0210  0.0212  0.0109  209 VAL A O   
1612 C CB  . VAL A 209 ? 0.5197 0.2855 0.4259 0.0083  0.0188  0.0192  209 VAL A CB  
1613 C CG1 . VAL A 209 ? 0.4586 0.2074 0.3551 -0.0028 0.0180  0.0226  209 VAL A CG1 
1614 C CG2 . VAL A 209 ? 0.6250 0.4096 0.5387 0.0119  0.0184  0.0251  209 VAL A CG2 
1615 N N   . GLY A 210 ? 0.5970 0.3317 0.4908 0.0148  0.0218  0.0024  210 GLY A N   
1616 C CA  . GLY A 210 ? 0.6387 0.3516 0.5206 0.0130  0.0234  -0.0052 210 GLY A CA  
1617 C C   . GLY A 210 ? 0.6187 0.3117 0.4960 0.0272  0.0257  -0.0068 210 GLY A C   
1618 O O   . GLY A 210 ? 0.7175 0.3808 0.5812 0.0270  0.0269  -0.0089 210 GLY A O   
1619 N N   . MET A 211 ? 0.4448 0.1546 0.3331 0.0396  0.0263  -0.0051 211 MET A N   
1620 C CA  . MET A 211 ? 0.5059 0.2054 0.3930 0.0551  0.0287  -0.0060 211 MET A CA  
1621 C C   . MET A 211 ? 0.7896 0.4691 0.6712 0.0602  0.0281  0.0009  211 MET A C   
1622 O O   . MET A 211 ? 0.4987 0.1581 0.3731 0.0715  0.0307  -0.0003 211 MET A O   
1623 C CB  . MET A 211 ? 0.4513 0.1790 0.3527 0.0650  0.0289  -0.0051 211 MET A CB  
1624 C CG  . MET A 211 ? 0.4974 0.2333 0.3992 0.0669  0.0318  -0.0134 211 MET A CG  
1625 S SD  . MET A 211 ? 0.9480 0.7199 0.8660 0.0712  0.0315  -0.0127 211 MET A SD  
1626 C CE  . MET A 211 ? 1.8245 1.6110 1.7462 0.0557  0.0286  -0.0112 211 MET A CE  
1627 N N   . HIS A 212 ? 0.4671 0.1521 0.3516 0.0527  0.0250  0.0085  212 HIS A N   
1628 C CA  . HIS A 212 ? 0.5490 0.2143 0.4268 0.0557  0.0242  0.0159  212 HIS A CA  
1629 C C   . HIS A 212 ? 0.7327 0.3658 0.5944 0.0464  0.0250  0.0137  212 HIS A C   
1630 O O   . HIS A 212 ? 0.7923 0.4103 0.6497 0.0510  0.0251  0.0162  212 HIS A O   
1631 C CB  . HIS A 212 ? 0.5702 0.2521 0.4548 0.0503  0.0211  0.0246  212 HIS A CB  
1632 C CG  . HIS A 212 ? 0.7689 0.4781 0.6665 0.0590  0.0198  0.0272  212 HIS A CG  
1633 N ND1 . HIS A 212 ? 0.6289 0.3395 0.5297 0.0733  0.0198  0.0304  212 HIS A ND1 
1634 C CD2 . HIS A 212 ? 0.4180 0.1533 0.3251 0.0550  0.0184  0.0272  212 HIS A CD2 
1635 C CE1 . HIS A 212 ? 0.5339 0.2714 0.4457 0.0759  0.0179  0.0319  212 HIS A CE1 
1636 N NE2 . HIS A 212 ? 0.5270 0.2773 0.4417 0.0651  0.0172  0.0297  212 HIS A NE2 
1637 N N   . ILE A 213 ? 0.6856 0.3188 0.5429 0.0314  0.0245  0.0091  213 ILE A N   
1638 C CA  . ILE A 213 ? 0.7843 0.3877 0.6250 0.0199  0.0248  0.0059  213 ILE A CA  
1639 C C   . ILE A 213 ? 0.8704 0.4596 0.7057 0.0303  0.0276  -0.0018 213 ILE A C   
1640 O O   . ILE A 213 ? 0.8408 0.4070 0.6657 0.0284  0.0279  -0.0024 213 ILE A O   
1641 C CB  . ILE A 213 ? 0.7609 0.3760 0.6007 0.0030  0.0234  0.0010  213 ILE A CB  
1642 C CG1 . ILE A 213 ? 0.6717 0.3159 0.5235 -0.0060 0.0205  0.0091  213 ILE A CG1 
1643 C CG2 . ILE A 213 ? 0.5802 0.1625 0.4002 -0.0109 0.0233  -0.0036 213 ILE A CG2 
1644 C CD1 . ILE A 213 ? 0.7874 0.4473 0.6398 -0.0222 0.0188  0.0067  213 ILE A CD1 
1645 N N   . LEU A 214 ? 0.8622 0.4651 0.7039 0.0416  0.0299  -0.0073 214 LEU A N   
1646 C CA  . LEU A 214 ? 0.7414 0.3337 0.5773 0.0511  0.0334  -0.0155 214 LEU A CA  
1647 C C   . LEU A 214 ? 0.6534 0.2472 0.4955 0.0694  0.0350  -0.0111 214 LEU A C   
1648 O O   . LEU A 214 ? 0.8172 0.3989 0.6532 0.0786  0.0383  -0.0162 214 LEU A O   
1649 C CB  . LEU A 214 ? 0.8018 0.4092 0.6406 0.0537  0.0358  -0.0237 214 LEU A CB  
1650 C CG  . LEU A 214 ? 0.7917 0.3934 0.6203 0.0359  0.0349  -0.0303 214 LEU A CG  
1651 C CD1 . LEU A 214 ? 0.6992 0.3229 0.5335 0.0385  0.0368  -0.0376 214 LEU A CD1 
1652 C CD2 . LEU A 214 ? 0.8401 0.4133 0.6512 0.0256  0.0347  -0.0353 214 LEU A CD2 
1653 N N   . SER A 215 ? 0.5644 0.1731 0.4177 0.0747  0.0327  -0.0015 215 SER A N   
1654 C CA  . SER A 215 ? 0.5789 0.1941 0.4393 0.0922  0.0338  0.0035  215 SER A CA  
1655 C C   . SER A 215 ? 0.7533 0.3534 0.6099 0.0920  0.0319  0.0119  215 SER A C   
1656 O O   . SER A 215 ? 0.6916 0.2987 0.5522 0.0855  0.0285  0.0197  215 SER A O   
1657 C CB  . SER A 215 ? 0.6581 0.3045 0.5342 0.1003  0.0326  0.0080  215 SER A CB  
1658 O OG  . SER A 215 ? 0.6171 0.2732 0.5001 0.1174  0.0340  0.0117  215 SER A OG  
1659 N N   . LEU A 216 ? 0.8599 0.4393 0.7083 0.0999  0.0344  0.0107  216 LEU A N   
1660 C CA  . LEU A 216 ? 0.8877 0.4446 0.7281 0.0978  0.0332  0.0173  216 LEU A CA  
1661 C C   . LEU A 216 ? 0.9799 0.5502 0.8293 0.1002  0.0296  0.0296  216 LEU A C   
1662 O O   . LEU A 216 ? 0.9148 0.4748 0.7594 0.0889  0.0271  0.0353  216 LEU A O   
1663 C CB  . LEU A 216 ? 1.1245 0.6606 0.9564 0.1110  0.0371  0.0147  216 LEU A CB  
1664 C CG  . LEU A 216 ? 1.3292 0.8382 1.1512 0.1103  0.0365  0.0213  216 LEU A CG  
1665 C CD1 . LEU A 216 ? 1.1575 0.6405 0.9647 0.0901  0.0353  0.0180  216 LEU A CD1 
1666 C CD2 . LEU A 216 ? 1.4833 0.9764 1.2993 0.1279  0.0409  0.0202  216 LEU A CD2 
1667 N N   . PRO A 217 ? 1.0470 0.6417 0.9090 0.1144  0.0293  0.0340  217 PRO A N   
1668 C CA  . PRO A 217 ? 0.8760 0.4862 0.7461 0.1174  0.0256  0.0454  217 PRO A CA  
1669 C C   . PRO A 217 ? 0.8342 0.4558 0.7069 0.1031  0.0222  0.0484  217 PRO A C   
1670 O O   . PRO A 217 ? 0.8517 0.4810 0.7273 0.1028  0.0192  0.0579  217 PRO A O   
1671 C CB  . PRO A 217 ? 0.6230 0.2606 0.5057 0.1331  0.0261  0.0468  217 PRO A CB  
1672 C CG  . PRO A 217 ? 0.7174 0.3487 0.5974 0.1417  0.0307  0.0383  217 PRO A CG  
1673 C CD  . PRO A 217 ? 0.9084 0.5192 0.7773 0.1277  0.0323  0.0286  217 PRO A CD  
1674 N N   . SER A 218 ? 0.6876 0.3110 0.5588 0.0919  0.0228  0.0410  218 SER A N   
1675 C CA  . SER A 218 ? 0.6599 0.2946 0.5332 0.0795  0.0203  0.0442  218 SER A CA  
1676 C C   . SER A 218 ? 0.8775 0.4925 0.7401 0.0635  0.0196  0.0460  218 SER A C   
1677 O O   . SER A 218 ? 0.8377 0.4611 0.7008 0.0533  0.0178  0.0506  218 SER A O   
1678 C CB  . SER A 218 ? 0.6796 0.3301 0.5578 0.0761  0.0211  0.0370  218 SER A CB  
1679 O OG  . SER A 218 ? 0.6869 0.3611 0.5761 0.0874  0.0207  0.0382  218 SER A OG  
1680 N N   . ARG A 219 ? 0.8484 0.4376 0.7006 0.0610  0.0211  0.0426  219 ARG A N   
1681 C CA  . ARG A 219 ? 1.0308 0.6023 0.8719 0.0427  0.0205  0.0420  219 ARG A CA  
1682 C C   . ARG A 219 ? 1.0387 0.5992 0.8754 0.0373  0.0187  0.0526  219 ARG A C   
1683 O O   . ARG A 219 ? 1.1810 0.7219 1.0071 0.0237  0.0184  0.0531  219 ARG A O   
1684 C CB  . ARG A 219 ? 1.6018 1.1516 1.4315 0.0373  0.0228  0.0313  219 ARG A CB  
1685 C CG  . ARG A 219 ? 2.4728 2.0164 2.2939 0.0154  0.0215  0.0280  219 ARG A CG  
1686 C CD  . ARG A 219 ? 1.4790 1.0041 1.2878 0.0092  0.0233  0.0160  219 ARG A CD  
1687 N NE  . ARG A 219 ? 1.2693 0.7857 1.0676 -0.0134 0.0213  0.0143  219 ARG A NE  
1688 C CZ  . ARG A 219 ? 1.0949 0.5930 0.8795 -0.0229 0.0218  0.0050  219 ARG A CZ  
1689 N NH1 . ARG A 219 ? 1.1129 0.5976 0.8918 -0.0110 0.0250  -0.0038 219 ARG A NH1 
1690 N NH2 . ARG A 219 ? 0.8567 0.3510 0.6327 -0.0449 0.0192  0.0045  219 ARG A NH2 
1691 N N   . SER A 220 ? 0.8078 0.3821 0.6522 0.0472  0.0172  0.0614  220 SER A N   
1692 C CA  . SER A 220 ? 0.8544 0.4233 0.6958 0.0425  0.0153  0.0727  220 SER A CA  
1693 C C   . SER A 220 ? 0.8686 0.4635 0.7177 0.0414  0.0133  0.0796  220 SER A C   
1694 O O   . SER A 220 ? 0.9585 0.5557 0.8064 0.0386  0.0117  0.0898  220 SER A O   
1695 C CB  . SER A 220 ? 0.9377 0.4954 0.7784 0.0567  0.0155  0.0781  220 SER A CB  
1696 O OG  . SER A 220 ? 0.8931 0.4706 0.7441 0.0734  0.0153  0.0782  220 SER A OG  
1697 N N   . LEU A 221 ? 0.8091 0.4232 0.6652 0.0437  0.0137  0.0740  221 LEU A N   
1698 C CA  . LEU A 221 ? 0.7041 0.3421 0.5662 0.0444  0.0122  0.0791  221 LEU A CA  
1699 C C   . LEU A 221 ? 0.7114 0.3551 0.5705 0.0292  0.0127  0.0790  221 LEU A C   
1700 O O   . LEU A 221 ? 0.7752 0.4400 0.6387 0.0279  0.0119  0.0832  221 LEU A O   
1701 C CB  . LEU A 221 ? 0.7051 0.3617 0.5767 0.0578  0.0122  0.0745  221 LEU A CB  
1702 C CG  . LEU A 221 ? 0.7434 0.3970 0.6185 0.0732  0.0120  0.0753  221 LEU A CG  
1703 C CD1 . LEU A 221 ? 0.6323 0.3082 0.5172 0.0847  0.0118  0.0721  221 LEU A CD1 
1704 C CD2 . LEU A 221 ? 0.5473 0.1974 0.4200 0.0769  0.0099  0.0865  221 LEU A CD2 
1705 N N   . PHE A 222 ? 0.6171 0.2465 0.4700 0.0172  0.0137  0.0739  222 PHE A N   
1706 C CA  . PHE A 222 ? 0.7189 0.3599 0.5715 0.0013  0.0139  0.0736  222 PHE A CA  
1707 C C   . PHE A 222 ? 0.7885 0.4052 0.6290 -0.0145 0.0141  0.0721  222 PHE A C   
1708 O O   . PHE A 222 ? 0.8774 0.4735 0.7130 -0.0119 0.0143  0.0678  222 PHE A O   
1709 C CB  . PHE A 222 ? 0.5004 0.1693 0.3652 0.0039  0.0143  0.0652  222 PHE A CB  
1710 C CG  . PHE A 222 ? 0.5050 0.1629 0.3682 0.0062  0.0155  0.0547  222 PHE A CG  
1711 C CD1 . PHE A 222 ? 0.5361 0.1820 0.3987 0.0213  0.0165  0.0510  222 PHE A CD1 
1712 C CD2 . PHE A 222 ? 0.5030 0.1646 0.3651 -0.0061 0.0157  0.0488  222 PHE A CD2 
1713 C CE1 . PHE A 222 ? 0.5177 0.1541 0.3779 0.0244  0.0183  0.0410  222 PHE A CE1 
1714 C CE2 . PHE A 222 ? 0.6356 0.2872 0.4947 -0.0042 0.0169  0.0387  222 PHE A CE2 
1715 C CZ  . PHE A 222 ? 0.5163 0.1547 0.3741 0.0114  0.0185  0.0345  222 PHE A CZ  
1716 N N   . HIS A 223 ? 0.6524 0.2858 0.4950 -0.0306 0.0134  0.0739  223 HIS A N   
1717 C CA  . HIS A 223 ? 0.7910 0.4042 0.6215 -0.0490 0.0127  0.0750  223 HIS A CA  
1718 C C   . HIS A 223 ? 0.8429 0.4722 0.6767 -0.0618 0.0122  0.0678  223 HIS A C   
1719 O O   . HIS A 223 ? 0.9194 0.5304 0.7419 -0.0775 0.0112  0.0653  223 HIS A O   
1720 C CB  . HIS A 223 ? 0.8082 0.4257 0.6359 -0.0596 0.0119  0.0879  223 HIS A CB  
1721 C CG  . HIS A 223 ? 0.7547 0.3678 0.5835 -0.0463 0.0120  0.0953  223 HIS A CG  
1722 N ND1 . HIS A 223 ? 0.9032 0.5396 0.7395 -0.0374 0.0123  0.1013  223 HIS A ND1 
1723 C CD2 . HIS A 223 ? 0.6571 0.2498 0.4823 -0.0393 0.0117  0.0969  223 HIS A CD2 
1724 C CE1 . HIS A 223 ? 0.8367 0.4641 0.6714 -0.0271 0.0117  0.1072  223 HIS A CE1 
1725 N NE2 . HIS A 223 ? 0.6477 0.2507 0.4775 -0.0276 0.0114  0.1049  223 HIS A NE2 
1726 N N   . ARG A 224 ? 0.6064 0.2692 0.4546 -0.0553 0.0128  0.0648  224 ARG A N   
1727 C CA  . ARG A 224 ? 0.6459 0.3311 0.4997 -0.0654 0.0124  0.0601  224 ARG A CA  
1728 C C   . ARG A 224 ? 0.7986 0.5069 0.6651 -0.0517 0.0136  0.0538  224 ARG A C   
1729 O O   . ARG A 224 ? 0.6730 0.3884 0.5460 -0.0372 0.0145  0.0551  224 ARG A O   
1730 C CB  . ARG A 224 ? 0.7053 0.4160 0.5637 -0.0791 0.0118  0.0696  224 ARG A CB  
1731 C CG  . ARG A 224 ? 0.8631 0.5555 0.7089 -0.0996 0.0099  0.0741  224 ARG A CG  
1732 C CD  . ARG A 224 ? 0.7908 0.5119 0.6422 -0.1123 0.0097  0.0853  224 ARG A CD  
1733 N NE  . ARG A 224 ? 0.9572 0.6817 0.8107 -0.1038 0.0112  0.0945  224 ARG A NE  
1734 C CZ  . ARG A 224 ? 1.1048 0.8030 0.9471 -0.1082 0.0106  0.1014  224 ARG A CZ  
1735 N NH1 . ARG A 224 ? 1.1819 0.8458 1.0094 -0.1208 0.0088  0.0996  224 ARG A NH1 
1736 N NH2 . ARG A 224 ? 1.1167 0.8214 0.9611 -0.1000 0.0119  0.1100  224 ARG A NH2 
1737 N N   . ALA A 225 ? 0.6997 0.4198 0.5689 -0.0573 0.0133  0.0471  225 ALA A N   
1738 C CA  . ALA A 225 ? 0.5364 0.2731 0.4153 -0.0455 0.0145  0.0407  225 ALA A CA  
1739 C C   . ALA A 225 ? 0.6173 0.3854 0.5049 -0.0520 0.0144  0.0409  225 ALA A C   
1740 O O   . ALA A 225 ? 0.5293 0.3013 0.4131 -0.0671 0.0129  0.0414  225 ALA A O   
1741 C CB  . ALA A 225 ? 0.6445 0.3586 0.5162 -0.0408 0.0149  0.0306  225 ALA A CB  
1742 N N   . VAL A 226 ? 0.6004 0.3907 0.4989 -0.0409 0.0158  0.0410  226 VAL A N   
1743 C CA  . VAL A 226 ? 0.5098 0.3272 0.4162 -0.0431 0.0163  0.0400  226 VAL A CA  
1744 C C   . VAL A 226 ? 0.5536 0.3735 0.4643 -0.0321 0.0172  0.0325  226 VAL A C   
1745 O O   . VAL A 226 ? 0.6959 0.5121 0.6095 -0.0199 0.0182  0.0313  226 VAL A O   
1746 C CB  . VAL A 226 ? 0.5715 0.4155 0.4860 -0.0408 0.0179  0.0481  226 VAL A CB  
1747 C CG1 . VAL A 226 ? 0.6615 0.5318 0.5837 -0.0407 0.0188  0.0474  226 VAL A CG1 
1748 C CG2 . VAL A 226 ? 0.3869 0.2338 0.2982 -0.0523 0.0174  0.0566  226 VAL A CG2 
1749 N N   . LEU A 227 ? 0.5650 0.3928 0.4760 -0.0374 0.0167  0.0278  227 LEU A N   
1750 C CA  . LEU A 227 ? 0.4456 0.2763 0.3600 -0.0287 0.0177  0.0210  227 LEU A CA  
1751 C C   . LEU A 227 ? 0.4765 0.3345 0.3985 -0.0296 0.0182  0.0228  227 LEU A C   
1752 O O   . LEU A 227 ? 0.5395 0.4057 0.4595 -0.0394 0.0169  0.0216  227 LEU A O   
1753 C CB  . LEU A 227 ? 0.5334 0.3438 0.4386 -0.0321 0.0170  0.0124  227 LEU A CB  
1754 C CG  . LEU A 227 ? 0.5224 0.3034 0.4198 -0.0259 0.0176  0.0094  227 LEU A CG  
1755 C CD1 . LEU A 227 ? 0.5195 0.2805 0.4066 -0.0363 0.0162  0.0126  227 LEU A CD1 
1756 C CD2 . LEU A 227 ? 0.5016 0.2699 0.3936 -0.0212 0.0188  0.0000  227 LEU A CD2 
1757 N N   . GLN A 228 ? 0.5536 0.4247 0.4830 -0.0194 0.0200  0.0259  228 GLN A N   
1758 C CA  . GLN A 228 ? 0.4879 0.3831 0.4240 -0.0176 0.0212  0.0288  228 GLN A CA  
1759 C C   . GLN A 228 ? 0.6039 0.5001 0.5420 -0.0113 0.0218  0.0232  228 GLN A C   
1760 O O   . GLN A 228 ? 0.5778 0.4671 0.5174 -0.0020 0.0228  0.0211  228 GLN A O   
1761 C CB  . GLN A 228 ? 0.4221 0.3285 0.3627 -0.0101 0.0235  0.0356  228 GLN A CB  
1762 C CG  . GLN A 228 ? 0.4312 0.3436 0.3710 -0.0162 0.0236  0.0429  228 GLN A CG  
1763 C CD  . GLN A 228 ? 0.4619 0.3790 0.4031 -0.0072 0.0264  0.0480  228 GLN A CD  
1764 O OE1 . GLN A 228 ? 0.5345 0.4458 0.4726 -0.0090 0.0264  0.0516  228 GLN A OE1 
1765 N NE2 . GLN A 228 ? 0.6643 0.5903 0.6084 0.0026  0.0289  0.0482  228 GLN A NE2 
1766 N N   . SER A 229 ? 0.5085 0.4145 0.4462 -0.0174 0.0209  0.0211  229 SER A N   
1767 C CA  . SER A 229 ? 0.4441 0.3558 0.3839 -0.0124 0.0218  0.0174  229 SER A CA  
1768 C C   . SER A 229 ? 0.5934 0.4873 0.5306 -0.0063 0.0222  0.0102  229 SER A C   
1769 O O   . SER A 229 ? 0.5418 0.4386 0.4829 0.0016  0.0236  0.0096  229 SER A O   
1770 C CB  . SER A 229 ? 0.5861 0.5131 0.5325 -0.0040 0.0239  0.0232  229 SER A CB  
1771 O OG  . SER A 229 ? 0.5577 0.5037 0.5073 -0.0067 0.0244  0.0309  229 SER A OG  
1772 N N   . GLY A 230 ? 0.5310 0.4067 0.4614 -0.0101 0.0213  0.0054  230 GLY A N   
1773 C CA  . GLY A 230 ? 0.4877 0.3477 0.4155 -0.0031 0.0222  -0.0009 230 GLY A CA  
1774 C C   . GLY A 230 ? 0.6950 0.5326 0.6126 -0.0074 0.0217  -0.0059 230 GLY A C   
1775 O O   . GLY A 230 ? 0.5714 0.4022 0.4842 -0.0159 0.0202  -0.0034 230 GLY A O   
1776 N N   . THR A 231 ? 0.7035 0.5289 0.6171 -0.0013 0.0233  -0.0127 231 THR A N   
1777 C CA  . THR A 231 ? 0.5457 0.3456 0.4473 -0.0029 0.0238  -0.0184 231 THR A CA  
1778 C C   . THR A 231 ? 0.5136 0.3026 0.4146 0.0104  0.0265  -0.0228 231 THR A C   
1779 O O   . THR A 231 ? 0.6492 0.4528 0.5574 0.0175  0.0279  -0.0238 231 THR A O   
1780 C CB  . THR A 231 ? 0.7570 0.5541 0.6483 -0.0139 0.0233  -0.0246 231 THR A CB  
1781 O OG1 . THR A 231 ? 0.6023 0.4141 0.4965 -0.0101 0.0248  -0.0287 231 THR A OG1 
1782 C CG2 . THR A 231 ? 0.8239 0.6345 0.7161 -0.0278 0.0202  -0.0193 231 THR A CG2 
1783 N N   . PRO A 232 ? 0.6429 0.4065 0.5349 0.0139  0.0274  -0.0249 232 PRO A N   
1784 C CA  . PRO A 232 ? 0.5278 0.2828 0.4193 0.0282  0.0305  -0.0283 232 PRO A CA  
1785 C C   . PRO A 232 ? 0.6346 0.3884 0.5193 0.0300  0.0335  -0.0374 232 PRO A C   
1786 O O   . PRO A 232 ? 0.6253 0.3873 0.5146 0.0414  0.0364  -0.0396 232 PRO A O   
1787 C CB  . PRO A 232 ? 0.6366 0.3620 0.5178 0.0306  0.0308  -0.0275 232 PRO A CB  
1788 C CG  . PRO A 232 ? 0.5136 0.2261 0.3840 0.0144  0.0286  -0.0283 232 PRO A CG  
1789 C CD  . PRO A 232 ? 0.6917 0.4325 0.5720 0.0044  0.0260  -0.0244 232 PRO A CD  
1790 N N   . ASN A 233 ? 0.6859 0.4314 0.5593 0.0180  0.0328  -0.0425 233 ASN A N   
1791 C CA  . ASN A 233 ? 0.7502 0.4974 0.6159 0.0172  0.0352  -0.0512 233 ASN A CA  
1792 C C   . ASN A 233 ? 0.6167 0.3970 0.4946 0.0138  0.0340  -0.0483 233 ASN A C   
1793 O O   . ASN A 233 ? 0.7156 0.5125 0.6050 0.0109  0.0314  -0.0404 233 ASN A O   
1794 C CB  . ASN A 233 ? 0.4781 0.2037 0.3255 0.0035  0.0341  -0.0576 233 ASN A CB  
1795 C CG  . ASN A 233 ? 0.6541 0.3905 0.5043 -0.0128 0.0292  -0.0516 233 ASN A CG  
1796 O OD1 . ASN A 233 ? 0.5800 0.3148 0.4360 -0.0142 0.0272  -0.0440 233 ASN A OD1 
1797 N ND2 . ASN A 233 ? 0.5518 0.3027 0.3989 -0.0247 0.0273  -0.0542 233 ASN A ND2 
1798 N N   . GLY A 234 ? 0.5964 0.3850 0.4705 0.0146  0.0363  -0.0545 234 GLY A N   
1799 C CA  . GLY A 234 ? 0.7103 0.5285 0.5949 0.0127  0.0356  -0.0512 234 GLY A CA  
1800 C C   . GLY A 234 ? 0.7400 0.5724 0.6331 0.0250  0.0390  -0.0512 234 GLY A C   
1801 O O   . GLY A 234 ? 0.7477 0.5704 0.6407 0.0364  0.0420  -0.0530 234 GLY A O   
1802 N N   . PRO A 235 ? 0.7496 0.6064 0.6507 0.0228  0.0386  -0.0480 235 PRO A N   
1803 C CA  . PRO A 235 ? 0.5642 0.4371 0.4718 0.0313  0.0419  -0.0481 235 PRO A CA  
1804 C C   . PRO A 235 ? 0.5102 0.3922 0.4315 0.0391  0.0416  -0.0413 235 PRO A C   
1805 O O   . PRO A 235 ? 0.6375 0.5289 0.5633 0.0474  0.0446  -0.0418 235 PRO A O   
1806 C CB  . PRO A 235 ? 0.5856 0.4789 0.4949 0.0234  0.0408  -0.0459 235 PRO A CB  
1807 C CG  . PRO A 235 ? 0.5968 0.4913 0.5086 0.0145  0.0365  -0.0401 235 PRO A CG  
1808 C CD  . PRO A 235 ? 0.7212 0.5926 0.6253 0.0120  0.0352  -0.0430 235 PRO A CD  
1809 N N   . TRP A 236 ? 0.4790 0.3591 0.4063 0.0364  0.0383  -0.0349 236 TRP A N   
1810 C CA  . TRP A 236 ? 0.5776 0.4686 0.5165 0.0411  0.0373  -0.0284 236 TRP A CA  
1811 C C   . TRP A 236 ? 0.6154 0.4945 0.5563 0.0468  0.0362  -0.0261 236 TRP A C   
1812 O O   . TRP A 236 ? 0.5292 0.4171 0.4782 0.0516  0.0356  -0.0220 236 TRP A O   
1813 C CB  . TRP A 236 ? 0.5608 0.4629 0.5049 0.0342  0.0347  -0.0220 236 TRP A CB  
1814 C CG  . TRP A 236 ? 0.5017 0.3943 0.4422 0.0281  0.0323  -0.0202 236 TRP A CG  
1815 C CD1 . TRP A 236 ? 0.4715 0.3644 0.4061 0.0203  0.0315  -0.0215 236 TRP A CD1 
1816 C CD2 . TRP A 236 ? 0.5480 0.4314 0.4902 0.0289  0.0303  -0.0163 236 TRP A CD2 
1817 N NE1 . TRP A 236 ? 0.4940 0.3798 0.4276 0.0159  0.0293  -0.0182 236 TRP A NE1 
1818 C CE2 . TRP A 236 ? 0.4840 0.3631 0.4217 0.0214  0.0288  -0.0151 236 TRP A CE2 
1819 C CE3 . TRP A 236 ? 0.4509 0.3312 0.3977 0.0347  0.0296  -0.0133 236 TRP A CE3 
1820 C CZ2 . TRP A 236 ? 0.4138 0.2856 0.3518 0.0199  0.0271  -0.0109 236 TRP A CZ2 
1821 C CZ3 . TRP A 236 ? 0.4162 0.2880 0.3623 0.0334  0.0276  -0.0095 236 TRP A CZ3 
1822 C CH2 . TRP A 236 ? 0.4940 0.3614 0.4357 0.0263  0.0267  -0.0083 236 TRP A CH2 
1823 N N   . ALA A 237 ? 0.7026 0.5620 0.6355 0.0453  0.0356  -0.0283 237 ALA A N   
1824 C CA  . ALA A 237 ? 0.5668 0.4143 0.5008 0.0496  0.0341  -0.0246 237 ALA A CA  
1825 C C   . ALA A 237 ? 0.4396 0.2822 0.3742 0.0620  0.0365  -0.0259 237 ALA A C   
1826 O O   . ALA A 237 ? 0.4251 0.2645 0.3634 0.0670  0.0349  -0.0212 237 ALA A O   
1827 C CB  . ALA A 237 ? 0.6105 0.4389 0.5357 0.0426  0.0325  -0.0250 237 ALA A CB  
1828 N N   . THR A 238 ? 0.4552 0.2990 0.3863 0.0678  0.0404  -0.0317 238 THR A N   
1829 C CA  . THR A 238 ? 0.4566 0.2965 0.3878 0.0819  0.0437  -0.0326 238 THR A CA  
1830 C C   . THR A 238 ? 0.6353 0.4926 0.5693 0.0882  0.0479  -0.0360 238 THR A C   
1831 O O   . THR A 238 ? 0.7597 0.6238 0.6906 0.0816  0.0489  -0.0400 238 THR A O   
1832 C CB  . THR A 238 ? 0.5791 0.3876 0.4957 0.0864  0.0460  -0.0375 238 THR A CB  
1833 O OG1 . THR A 238 ? 0.5804 0.3790 0.4846 0.0828  0.0490  -0.0464 238 THR A OG1 
1834 C CG2 . THR A 238 ? 0.5786 0.3691 0.4908 0.0783  0.0421  -0.0342 238 THR A CG2 
1835 N N   . VAL A 239 ? 0.6253 0.4920 0.5654 0.1012  0.0504  -0.0337 239 VAL A N   
1836 C CA  . VAL A 239 ? 0.5738 0.4576 0.5160 0.1090  0.0554  -0.0368 239 VAL A CA  
1837 C C   . VAL A 239 ? 0.4472 0.3189 0.3836 0.1261  0.0607  -0.0395 239 VAL A C   
1838 O O   . VAL A 239 ? 0.6230 0.4826 0.5597 0.1329  0.0594  -0.0356 239 VAL A O   
1839 C CB  . VAL A 239 ? 0.3764 0.2949 0.3349 0.1081  0.0540  -0.0299 239 VAL A CB  
1840 C CG1 . VAL A 239 ? 0.4209 0.3487 0.3825 0.0931  0.0502  -0.0279 239 VAL A CG1 
1841 C CG2 . VAL A 239 ? 0.3772 0.3039 0.3459 0.1142  0.0510  -0.0219 239 VAL A CG2 
1842 N N   . SER A 240 ? 0.4716 0.3467 0.4020 0.1337  0.0669  -0.0459 240 SER A N   
1843 C CA  . SER A 240 ? 0.5209 0.3873 0.4458 0.1526  0.0733  -0.0483 240 SER A CA  
1844 C C   . SER A 240 ? 0.5584 0.4504 0.5002 0.1635  0.0726  -0.0384 240 SER A C   
1845 O O   . SER A 240 ? 0.6182 0.5372 0.5749 0.1553  0.0678  -0.0312 240 SER A O   
1846 C CB  . SER A 240 ? 0.4834 0.3565 0.4006 0.1590  0.0805  -0.0563 240 SER A CB  
1847 O OG  . SER A 240 ? 0.6371 0.5505 0.5699 0.1606  0.0817  -0.0513 240 SER A OG  
1848 N N   . ALA A 241 ? 0.6795 0.5623 0.6179 0.1821  0.0773  -0.0378 241 ALA A N   
1849 C CA  . ALA A 241 ? 0.6466 0.5567 0.6007 0.1948  0.0772  -0.0280 241 ALA A CA  
1850 C C   . ALA A 241 ? 0.6434 0.5949 0.6103 0.1969  0.0802  -0.0259 241 ALA A C   
1851 O O   . ALA A 241 ? 0.5019 0.4867 0.4859 0.1943  0.0764  -0.0167 241 ALA A O   
1852 C CB  . ALA A 241 ? 0.5365 0.4269 0.4825 0.2153  0.0825  -0.0280 241 ALA A CB  
1853 N N   . GLY A 242 ? 0.6970 0.6461 0.6544 0.2005  0.0869  -0.0344 242 GLY A N   
1854 C CA  . GLY A 242 ? 0.6889 0.6765 0.6566 0.2029  0.0907  -0.0326 242 GLY A CA  
1855 C C   . GLY A 242 ? 0.5686 0.5809 0.5487 0.1827  0.0839  -0.0275 242 GLY A C   
1856 O O   . GLY A 242 ? 0.6023 0.6520 0.5981 0.1818  0.0830  -0.0197 242 GLY A O   
1857 N N   . GLU A 243 ? 0.4642 0.4549 0.4365 0.1663  0.0791  -0.0314 243 GLU A N   
1858 C CA  . GLU A 243 ? 0.4913 0.4994 0.4721 0.1478  0.0734  -0.0273 243 GLU A CA  
1859 C C   . GLU A 243 ? 0.6444 0.6634 0.6381 0.1416  0.0660  -0.0176 243 GLU A C   
1860 O O   . GLU A 243 ? 0.5310 0.5736 0.5350 0.1305  0.0622  -0.0118 243 GLU A O   
1861 C CB  . GLU A 243 ? 0.5861 0.5689 0.5538 0.1343  0.0713  -0.0343 243 GLU A CB  
1862 C CG  . GLU A 243 ? 0.5650 0.5577 0.5387 0.1163  0.0653  -0.0300 243 GLU A CG  
1863 C CD  . GLU A 243 ? 0.6674 0.6913 0.6489 0.1113  0.0669  -0.0269 243 GLU A CD  
1864 O OE1 . GLU A 243 ? 0.5417 0.5827 0.5243 0.1211  0.0730  -0.0284 243 GLU A OE1 
1865 O OE2 . GLU A 243 ? 0.7989 0.8299 0.7848 0.0975  0.0624  -0.0225 243 GLU A OE2 
1866 N N   . ALA A 244 ? 0.6076 0.6083 0.5992 0.1483  0.0639  -0.0158 244 ALA A N   
1867 C CA  . ALA A 244 ? 0.5114 0.5216 0.5133 0.1429  0.0570  -0.0072 244 ALA A CA  
1868 C C   . ALA A 244 ? 0.5563 0.6046 0.5735 0.1497  0.0572  0.0011  244 ALA A C   
1869 O O   . ALA A 244 ? 0.7330 0.8024 0.7601 0.1387  0.0517  0.0076  244 ALA A O   
1870 C CB  . ALA A 244 ? 0.4394 0.4214 0.4345 0.1490  0.0551  -0.0068 244 ALA A CB  
1871 N N   . ARG A 245 ? 0.3963 0.4531 0.4143 0.1678  0.0638  0.0006  245 ARG A N   
1872 C CA  . ARG A 245 ? 0.5055 0.6025 0.5383 0.1768  0.0656  0.0085  245 ARG A CA  
1873 C C   . ARG A 245 ? 0.5145 0.6423 0.5554 0.1644  0.0656  0.0102  245 ARG A C   
1874 O O   . ARG A 245 ? 0.5298 0.6903 0.5842 0.1572  0.0614  0.0188  245 ARG A O   
1875 C CB  . ARG A 245 ? 0.3745 0.4701 0.4034 0.2009  0.0746  0.0061  245 ARG A CB  
1876 C CG  . ARG A 245 ? 0.3727 0.5145 0.4176 0.2128  0.0779  0.0147  245 ARG A CG  
1877 C CD  . ARG A 245 ? 0.5104 0.6478 0.5501 0.2401  0.0876  0.0128  245 ARG A CD  
1878 N NE  . ARG A 245 ? 0.5128 0.6262 0.5481 0.2523  0.0861  0.0157  245 ARG A NE  
1879 C CZ  . ARG A 245 ? 0.5796 0.7159 0.6281 0.2562  0.0811  0.0272  245 ARG A CZ  
1880 N NH1 . ARG A 245 ? 0.5496 0.7345 0.6169 0.2500  0.0776  0.0366  245 ARG A NH1 
1881 N NH2 . ARG A 245 ? 0.8545 0.9647 0.8963 0.2628  0.0786  0.0296  245 ARG A NH2 
1882 N N   . ARG A 246 ? 0.4994 0.6162 0.5307 0.1613  0.0701  0.0021  246 ARG A N   
1883 C CA  . ARG A 246 ? 0.4271 0.5673 0.4631 0.1488  0.0705  0.0032  246 ARG A CA  
1884 C C   . ARG A 246 ? 0.5832 0.7294 0.6255 0.1285  0.0616  0.0092  246 ARG A C   
1885 O O   . ARG A 246 ? 0.5664 0.7445 0.6198 0.1203  0.0597  0.0164  246 ARG A O   
1886 C CB  . ARG A 246 ? 0.5361 0.6528 0.5572 0.1460  0.0746  -0.0070 246 ARG A CB  
1887 C CG  . ARG A 246 ? 0.6142 0.7549 0.6361 0.1452  0.0804  -0.0084 246 ARG A CG  
1888 C CD  . ARG A 246 ? 0.5459 0.6947 0.5698 0.1246  0.0759  -0.0056 246 ARG A CD  
1889 N NE  . ARG A 246 ? 0.5365 0.6536 0.5509 0.1124  0.0707  -0.0094 246 ARG A NE  
1890 C CZ  . ARG A 246 ? 0.5954 0.7143 0.6115 0.0956  0.0657  -0.0055 246 ARG A CZ  
1891 N NH1 . ARG A 246 ? 0.4244 0.5726 0.4502 0.0875  0.0649  0.0019  246 ARG A NH1 
1892 N NH2 . ARG A 246 ? 0.4433 0.5350 0.4511 0.0869  0.0617  -0.0084 246 ARG A NH2 
1893 N N   . ARG A 247 ? 0.4678 0.5832 0.5022 0.1201  0.0565  0.0066  247 ARG A N   
1894 C CA  . ARG A 247 ? 0.5076 0.6239 0.5449 0.1020  0.0490  0.0112  247 ARG A CA  
1895 C C   . ARG A 247 ? 0.5956 0.7284 0.6427 0.1004  0.0433  0.0194  247 ARG A C   
1896 O O   . ARG A 247 ? 0.4850 0.6303 0.5364 0.0858  0.0381  0.0244  247 ARG A O   
1897 C CB  . ARG A 247 ? 0.3310 0.4119 0.3568 0.0941  0.0459  0.0062  247 ARG A CB  
1898 C CG  . ARG A 247 ? 0.4075 0.4722 0.4229 0.0930  0.0500  -0.0013 247 ARG A CG  
1899 C CD  . ARG A 247 ? 0.4481 0.4825 0.4541 0.0855  0.0465  -0.0045 247 ARG A CD  
1900 N NE  . ARG A 247 ? 0.6207 0.6385 0.6158 0.0854  0.0500  -0.0120 247 ARG A NE  
1901 C CZ  . ARG A 247 ? 0.7211 0.7177 0.7083 0.0778  0.0476  -0.0146 247 ARG A CZ  
1902 N NH1 . ARG A 247 ? 0.8689 0.8572 0.8575 0.0709  0.0424  -0.0106 247 ARG A NH1 
1903 N NH2 . ARG A 247 ? 0.5658 0.5508 0.5432 0.0768  0.0503  -0.0210 247 ARG A NH2 
1904 N N   . ALA A 248 ? 0.4697 0.6009 0.5188 0.1148  0.0439  0.0209  248 ALA A N   
1905 C CA  . ALA A 248 ? 0.3647 0.5147 0.4231 0.1142  0.0383  0.0293  248 ALA A CA  
1906 C C   . ALA A 248 ? 0.4682 0.6623 0.5403 0.1120  0.0387  0.0366  248 ALA A C   
1907 O O   . ALA A 248 ? 0.5343 0.7474 0.6126 0.0980  0.0324  0.0429  248 ALA A O   
1908 C CB  . ALA A 248 ? 0.5131 0.6543 0.5709 0.1324  0.0399  0.0304  248 ALA A CB  
1909 N N   . THR A 249 ? 0.5128 0.7232 0.5886 0.1257  0.0463  0.0356  249 THR A N   
1910 C CA  . THR A 249 ? 0.5320 0.7876 0.6213 0.1250  0.0480  0.0428  249 THR A CA  
1911 C C   . THR A 249 ? 0.4693 0.7344 0.5592 0.1027  0.0447  0.0443  249 THR A C   
1912 O O   . THR A 249 ? 0.4014 0.6996 0.5019 0.0920  0.0408  0.0526  249 THR A O   
1913 C CB  . THR A 249 ? 0.5299 0.7971 0.6198 0.1432  0.0582  0.0397  249 THR A CB  
1914 O OG1 . THR A 249 ? 0.6072 0.8541 0.6916 0.1644  0.0624  0.0364  249 THR A OG1 
1915 C CG2 . THR A 249 ? 0.4697 0.7894 0.5760 0.1451  0.0599  0.0493  249 THR A CG2 
1916 N N   . LEU A 250 ? 0.4649 0.7015 0.5432 0.0954  0.0461  0.0368  250 LEU A N   
1917 C CA  . LEU A 250 ? 0.4561 0.6989 0.5336 0.0761  0.0439  0.0386  250 LEU A CA  
1918 C C   . LEU A 250 ? 0.5040 0.7427 0.5814 0.0584  0.0347  0.0434  250 LEU A C   
1919 O O   . LEU A 250 ? 0.4486 0.7095 0.5314 0.0436  0.0314  0.0497  250 LEU A O   
1920 C CB  . LEU A 250 ? 0.3875 0.6012 0.4522 0.0731  0.0472  0.0305  250 LEU A CB  
1921 C CG  . LEU A 250 ? 0.3992 0.6177 0.4623 0.0540  0.0450  0.0336  250 LEU A CG  
1922 C CD1 . LEU A 250 ? 0.2920 0.5527 0.3673 0.0470  0.0450  0.0425  250 LEU A CD1 
1923 C CD2 . LEU A 250 ? 0.3482 0.5522 0.4020 0.0546  0.0501  0.0275  250 LEU A CD2 
1924 N N   . LEU A 251 ? 0.6037 0.8137 0.6742 0.0597  0.0308  0.0403  251 LEU A N   
1925 C CA  . LEU A 251 ? 0.5570 0.7603 0.6250 0.0448  0.0226  0.0436  251 LEU A CA  
1926 C C   . LEU A 251 ? 0.5333 0.7740 0.6133 0.0406  0.0181  0.0527  251 LEU A C   
1927 O O   . LEU A 251 ? 0.5844 0.8331 0.6640 0.0224  0.0122  0.0569  251 LEU A O   
1928 C CB  . LEU A 251 ? 0.5943 0.7659 0.6541 0.0505  0.0201  0.0395  251 LEU A CB  
1929 C CG  . LEU A 251 ? 0.5725 0.7326 0.6263 0.0346  0.0123  0.0414  251 LEU A CG  
1930 C CD1 . LEU A 251 ? 0.5406 0.6678 0.5815 0.0255  0.0126  0.0360  251 LEU A CD1 
1931 C CD2 . LEU A 251 ? 0.5922 0.7463 0.6455 0.0412  0.0084  0.0428  251 LEU A CD2 
1932 N N   . ALA A 252 ? 0.4508 0.7137 0.5407 0.0576  0.0209  0.0558  252 ALA A N   
1933 C CA  . ALA A 252 ? 0.4187 0.7227 0.5218 0.0560  0.0169  0.0656  252 ALA A CA  
1934 C C   . ALA A 252 ? 0.5023 0.8390 0.6128 0.0407  0.0164  0.0714  252 ALA A C   
1935 O O   . ALA A 252 ? 0.4706 0.8274 0.5850 0.0241  0.0092  0.0780  252 ALA A O   
1936 C CB  . ALA A 252 ? 0.4026 0.7269 0.5155 0.0805  0.0221  0.0685  252 ALA A CB  
1937 N N   . ARG A 253 ? 0.4387 0.7809 0.5502 0.0451  0.0238  0.0689  253 ARG A N   
1938 C CA  . ARG A 253 ? 0.4328 0.8080 0.5515 0.0311  0.0241  0.0753  253 ARG A CA  
1939 C C   . ARG A 253 ? 0.4693 0.8255 0.5782 0.0055  0.0175  0.0754  253 ARG A C   
1940 O O   . ARG A 253 ? 0.5251 0.9051 0.6387 -0.0122 0.0116  0.0830  253 ARG A O   
1941 C CB  . ARG A 253 ? 0.4411 0.8227 0.5604 0.0409  0.0337  0.0721  253 ARG A CB  
1942 C CG  . ARG A 253 ? 0.6588 1.0652 0.7876 0.0660  0.0416  0.0729  253 ARG A CG  
1943 C CD  . ARG A 253 ? 0.8161 1.2381 0.9459 0.0716  0.0507  0.0713  253 ARG A CD  
1944 N NE  . ARG A 253 ? 0.9626 1.3838 1.0919 0.0984  0.0600  0.0661  253 ARG A NE  
1945 C CZ  . ARG A 253 ? 0.9315 1.3163 1.0469 0.1082  0.0654  0.0552  253 ARG A CZ  
1946 N NH1 . ARG A 253 ? 0.6660 1.0158 0.7687 0.0942  0.0626  0.0490  253 ARG A NH1 
1947 N NH2 . ARG A 253 ? 0.9111 1.2945 1.0244 0.1321  0.0739  0.0505  253 ARG A NH2 
1948 N N   . LEU A 254 ? 0.3764 0.6889 0.4708 0.0035  0.0183  0.0673  254 LEU A N   
1949 C CA  . LEU A 254 ? 0.3569 0.6451 0.4396 -0.0178 0.0130  0.0668  254 LEU A CA  
1950 C C   . LEU A 254 ? 0.4903 0.7823 0.5719 -0.0320 0.0039  0.0711  254 LEU A C   
1951 O O   . LEU A 254 ? 0.6118 0.8977 0.6862 -0.0527 -0.0008 0.0735  254 LEU A O   
1952 C CB  . LEU A 254 ? 0.2828 0.5242 0.3510 -0.0139 0.0148  0.0579  254 LEU A CB  
1953 C CG  . LEU A 254 ? 0.4272 0.6664 0.4952 -0.0022 0.0231  0.0537  254 LEU A CG  
1954 C CD1 . LEU A 254 ? 0.4636 0.6612 0.5182 0.0010  0.0246  0.0458  254 LEU A CD1 
1955 C CD2 . LEU A 254 ? 0.3251 0.5874 0.3966 -0.0132 0.0254  0.0590  254 LEU A CD2 
1956 N N   . VAL A 255 ? 0.5533 0.8541 0.6404 -0.0212 0.0014  0.0720  255 VAL A N   
1957 C CA  . VAL A 255 ? 0.5677 0.8737 0.6528 -0.0347 -0.0078 0.0759  255 VAL A CA  
1958 C C   . VAL A 255 ? 0.5573 0.9151 0.6587 -0.0358 -0.0111 0.0859  255 VAL A C   
1959 O O   . VAL A 255 ? 0.7100 1.0768 0.8112 -0.0436 -0.0188 0.0895  255 VAL A O   
1960 C CB  . VAL A 255 ? 0.4456 0.7186 0.5210 -0.0271 -0.0106 0.0703  255 VAL A CB  
1961 C CG1 . VAL A 255 ? 0.3621 0.5882 0.4205 -0.0324 -0.0095 0.0623  255 VAL A CG1 
1962 C CG2 . VAL A 255 ? 0.4234 0.7005 0.5065 -0.0019 -0.0058 0.0690  255 VAL A CG2 
1963 N N   . GLY A 256 ? 0.4644 0.8828 0.8389 -0.0001 0.0289  0.2903  256 GLY A N   
1964 C CA  . GLY A 256 ? 0.4771 0.9010 0.8869 -0.0037 0.0191  0.3204  256 GLY A CA  
1965 C C   . GLY A 256 ? 0.3919 0.8164 0.8041 0.0034  0.0296  0.3008  256 GLY A C   
1966 O O   . GLY A 256 ? 0.4184 0.8472 0.8638 0.0012  0.0216  0.3255  256 GLY A O   
1967 N N   . CYS A 257 ? 0.4540 0.8747 0.8319 0.0114  0.0470  0.2583  257 CYS A N   
1968 C CA  . CYS A 257 ? 0.4875 0.9060 0.8660 0.0184  0.0569  0.2384  257 CYS A CA  
1969 C C   . CYS A 257 ? 0.5854 1.0373 0.9490 0.0362  0.0826  0.2258  257 CYS A C   
1970 O O   . CYS A 257 ? 0.7833 1.2351 1.1056 0.0423  0.0999  0.1921  257 CYS A O   
1971 C CB  . CYS A 257 ? 0.5104 0.9003 0.8604 0.0136  0.0592  0.2020  257 CYS A CB  
1972 S SG  . CYS A 257 ? 0.5199 0.8614 0.8969 -0.0109 0.0260  0.2179  257 CYS A SG  
1973 N N   . PRO A 258 ? 0.7123 1.1902 1.1100 0.0426  0.0843  0.2553  258 PRO A N   
1974 C CA  . PRO A 258 ? 0.7566 1.2666 1.1448 0.0597  0.1097  0.2474  258 PRO A CA  
1975 C C   . PRO A 258 ? 0.7395 1.2461 1.1329 0.0724  0.1228  0.2300  258 PRO A C   
1976 O O   . PRO A 258 ? 0.6775 1.1564 1.0740 0.0669  0.1121  0.2186  258 PRO A O   
1977 C CB  . PRO A 258 ? 0.5777 1.1236 1.0010 0.0621  0.1088  0.2894  258 PRO A CB  
1978 N N   . ALA A 264 ? 1.1520 1.4623 1.5377 0.2218  0.1826  0.0828  264 ALA A N   
1979 C CA  . ALA A 264 ? 1.1460 1.4764 1.5716 0.1866  0.1514  0.1109  264 ALA A CA  
1980 C C   . ALA A 264 ? 0.9803 1.3629 1.3904 0.1784  0.1710  0.1164  264 ALA A C   
1981 O O   . ALA A 264 ? 0.8014 1.2059 1.2494 0.1551  0.1490  0.1465  264 ALA A O   
1982 C CB  . ALA A 264 ? 0.9669 1.3238 1.5003 0.1828  0.1204  0.1655  264 ALA A CB  
1983 N N   . ASN A 265 ? 1.0943 1.4723 1.4300 0.1877  0.2010  0.0825  265 ASN A N   
1984 C CA  . ASN A 265 ? 1.1014 1.5048 1.4087 0.1728  0.2091  0.0818  265 ASN A CA  
1985 C C   . ASN A 265 ? 0.8884 1.2774 1.1590 0.1443  0.1949  0.0679  265 ASN A C   
1986 O O   . ASN A 265 ? 0.8537 1.2653 1.1533 0.1278  0.1799  0.0925  265 ASN A O   
1987 C CB  . ASN A 265 ? 1.3104 1.7050 1.5579 0.1856  0.2385  0.0538  265 ASN A CB  
1988 C CG  . ASN A 265 ? 1.4539 1.7895 1.6214 0.1852  0.2451  0.0072  265 ASN A CG  
1989 O OD1 . ASN A 265 ? 1.5168 1.8191 1.6804 0.1911  0.2355  -0.0033 265 ASN A OD1 
1990 N ND2 . ASN A 265 ? 1.4495 1.7654 1.5513 0.1751  0.2587  -0.0194 265 ASN A ND2 
1991 N N   . ASP A 266 ? 0.6493 0.9946 0.8497 0.1381  0.1993  0.0277  266 ASP A N   
1992 C CA  . ASP A 266 ? 0.4922 0.8189 0.6563 0.1121  0.1862  0.0129  266 ASP A CA  
1993 C C   . ASP A 266 ? 0.5320 0.8411 0.7356 0.1004  0.1583  0.0278  266 ASP A C   
1994 O O   . ASP A 266 ? 0.6733 0.9701 0.8720 0.0757  0.1390  0.0298  266 ASP A O   
1995 C CB  . ASP A 266 ? 0.5926 0.8602 0.6633 0.1012  0.1915  -0.0337 266 ASP A CB  
1996 C CG  . ASP A 266 ? 0.6938 0.9483 0.7212 0.0915  0.2043  -0.0444 266 ASP A CG  
1997 O OD1 . ASP A 266 ? 0.6531 0.9488 0.7129 0.0943  0.2098  -0.0231 266 ASP A OD1 
1998 O OD2 . ASP A 266 ? 0.7822 0.9778 0.7409 0.0796  0.2072  -0.0702 266 ASP A OD2 
1999 N N   . THR A 267 ? 0.5889 0.8653 0.8178 0.1071  0.1430  0.0327  267 THR A N   
2000 C CA  . THR A 267 ? 0.5762 0.7975 0.8245 0.0812  0.0991  0.0416  267 THR A CA  
2001 C C   . THR A 267 ? 0.4035 0.6602 0.7223 0.0669  0.0794  0.0868  267 THR A C   
2002 O O   . THR A 267 ? 0.3540 0.5660 0.6571 0.0379  0.0504  0.0855  267 THR A O   
2003 C CB  . THR A 267 ? 0.6191 0.8140 0.8989 0.0939  0.0861  0.0501  267 THR A CB  
2004 O OG1 . THR A 267 ? 0.6109 0.7729 0.8256 0.1115  0.1067  0.0103  267 THR A OG1 
2005 C CG2 . THR A 267 ? 0.6343 0.7575 0.9142 0.0611  0.0374  0.0535  267 THR A CG2 
2006 N N   . GLU A 268 ? 0.4697 0.8033 0.8634 0.0875  0.0958  0.1276  268 GLU A N   
2007 C CA  . GLU A 268 ? 0.4524 0.8256 0.9186 0.0740  0.0763  0.1768  268 GLU A CA  
2008 C C   . GLU A 268 ? 0.5564 0.9326 0.9850 0.0578  0.0788  0.1682  268 GLU A C   
2009 O O   . GLU A 268 ? 0.5910 0.9481 1.0381 0.0334  0.0498  0.1881  268 GLU A O   
2010 C CB  . GLU A 268 ? 0.4275 0.8418 0.9192 0.0919  0.0917  0.2023  268 GLU A CB  
2011 C CG  . GLU A 268 ? 0.7405 1.1664 1.2711 0.0737  0.0693  0.2466  268 GLU A CG  
2012 C CD  . GLU A 268 ? 0.8825 1.3494 1.4478 0.0910  0.0848  0.2750  268 GLU A CD  
2013 O OE1 . GLU A 268 ? 1.0105 1.4880 1.5859 0.1150  0.1032  0.2658  268 GLU A OE1 
2014 O OE2 . GLU A 268 ? 0.7256 1.2135 1.3089 0.0818  0.0793  0.3072  268 GLU A OE2 
2015 N N   . LEU A 269 ? 0.5659 0.9543 0.9335 0.0696  0.1096  0.1364  269 LEU A N   
2016 C CA  . LEU A 269 ? 0.4984 0.8869 0.8269 0.0570  0.1111  0.1266  269 LEU A CA  
2017 C C   . LEU A 269 ? 0.4969 0.8498 0.8076 0.0362  0.0958  0.1128  269 LEU A C   
2018 O O   . LEU A 269 ? 0.6362 0.9824 0.9598 0.0199  0.0786  0.1293  269 LEU A O   
2019 C CB  . LEU A 269 ? 0.5248 0.9166 0.7906 0.0672  0.1377  0.0935  269 LEU A CB  
2020 C CG  . LEU A 269 ? 0.6018 0.9874 0.8289 0.0542  0.1369  0.0819  269 LEU A CG  
2021 C CD1 . LEU A 269 ? 0.7288 1.1398 0.9912 0.0516  0.1260  0.1166  269 LEU A CD1 
2022 C CD2 . LEU A 269 ? 0.6202 0.9938 0.7914 0.0579  0.1561  0.0533  269 LEU A CD2 
2023 N N   . ILE A 270 ? 0.4296 0.7231 0.6797 0.0324  0.0937  0.0720  270 ILE A N   
2024 C CA  . ILE A 270 ? 0.4966 0.7194 0.6906 0.0086  0.0746  0.0429  270 ILE A CA  
2025 C C   . ILE A 270 ? 0.5519 0.7202 0.7710 -0.0130 0.0360  0.0631  270 ILE A C   
2026 O O   . ILE A 270 ? 0.5259 0.6581 0.7265 -0.0308 0.0217  0.0615  270 ILE A O   
2027 C CB  . ILE A 270 ? 0.4355 0.6075 0.5597 0.0071  0.0795  -0.0023 270 ILE A CB  
2028 C CG1 . ILE A 270 ? 0.5053 0.7163 0.5849 0.0196  0.1128  -0.0258 270 ILE A CG1 
2029 C CG2 . ILE A 270 ? 0.3661 0.4595 0.4391 -0.0196 0.0567  -0.0278 270 ILE A CG2 
2030 C CD1 . ILE A 270 ? 0.6558 0.8512 0.6980 0.0337  0.1268  -0.0502 270 ILE A CD1 
2031 N N   . ALA A 271 ? 0.4115 0.5712 0.6713 -0.0112 0.0192  0.0834  271 ALA A N   
2032 C CA  . ALA A 271 ? 0.4017 0.5079 0.6844 -0.0352 -0.0217 0.1069  271 ALA A CA  
2033 C C   . ALA A 271 ? 0.4920 0.6190 0.8093 -0.0454 -0.0323 0.1408  271 ALA A C   
2034 O O   . ALA A 271 ? 0.6568 0.7174 0.9510 -0.0701 -0.0604 0.1426  271 ALA A O   
2035 C CB  . ALA A 271 ? 0.4429 0.5653 0.7857 -0.0277 -0.0353 0.1364  271 ALA A CB  
2036 N N   . CYS A 272 ? 0.4874 0.7013 0.8550 -0.0271 -0.0099 0.1678  272 CYS A N   
2037 C CA  . CYS A 272 ? 0.3960 0.6310 0.7977 -0.0372 -0.0216 0.2030  272 CYS A CA  
2038 C C   . CYS A 272 ? 0.3570 0.5543 0.7000 -0.0452 -0.0169 0.1752  272 CYS A C   
2039 O O   . CYS A 272 ? 0.5169 0.6559 0.8474 -0.0653 -0.0433 0.1841  272 CYS A O   
2040 C CB  . CYS A 272 ? 0.2256 0.5421 0.6665 -0.0161 0.0011  0.2320  272 CYS A CB  
2041 S SG  . CYS A 272 ? 0.7668 1.0868 1.2034 -0.0233 -0.0070 0.2584  272 CYS A SG  
2042 N N   . LEU A 273 ? 0.3100 0.5374 0.6155 -0.0296 0.0162  0.1429  273 LEU A N   
2043 C CA  . LEU A 273 ? 0.3614 0.5594 0.6146 -0.0349 0.0233  0.1156  273 LEU A CA  
2044 C C   . LEU A 273 ? 0.4641 0.5606 0.6679 -0.0562 -0.0011 0.0939  273 LEU A C   
2045 O O   . LEU A 273 ? 0.4177 0.4796 0.6025 -0.0638 -0.0070 0.0930  273 LEU A O   
2046 C CB  . LEU A 273 ? 0.3359 0.5676 0.5471 -0.0211 0.0563  0.0803  273 LEU A CB  
2047 C CG  . LEU A 273 ? 0.3541 0.6767 0.5888 -0.0029 0.0851  0.0940  273 LEU A CG  
2048 C CD1 . LEU A 273 ? 0.2195 0.5367 0.3893 0.0031  0.1056  0.0524  273 LEU A CD1 
2049 C CD2 . LEU A 273 ? 0.4500 0.7807 0.6966 -0.0043 0.0772  0.1139  273 LEU A CD2 
2050 N N   . ARG A 274 ? 0.5062 0.5522 0.6865 -0.0653 -0.0144 0.0766  274 ARG A N   
2051 C CA  A ARG A 274 ? 0.4627 0.4077 0.5899 -0.0887 -0.0382 0.0563  274 ARG A CA  
2052 C CA  B ARG A 274 ? 0.4644 0.4096 0.5915 -0.0886 -0.0380 0.0562  274 ARG A CA  
2053 C C   . ARG A 274 ? 0.5652 0.4615 0.7111 -0.1075 -0.0714 0.0893  274 ARG A C   
2054 O O   . ARG A 274 ? 0.8082 0.6264 0.8974 -0.1195 -0.0849 0.0706  274 ARG A O   
2055 C CB  A ARG A 274 ? 0.4540 0.3563 0.5586 -0.0970 -0.0510 0.0383  274 ARG A CB  
2056 C CB  B ARG A 274 ? 0.4457 0.3481 0.5481 -0.0967 -0.0499 0.0367  274 ARG A CB  
2057 C CG  A ARG A 274 ? 0.4040 0.3222 0.4658 -0.0857 -0.0244 -0.0018 274 ARG A CG  
2058 C CG  B ARG A 274 ? 0.3803 0.3105 0.4479 -0.0825 -0.0211 0.0002  274 ARG A CG  
2059 C CD  A ARG A 274 ? 0.4352 0.2811 0.4570 -0.1016 -0.0444 -0.0233 274 ARG A CD  
2060 C CD  B ARG A 274 ? 0.4381 0.2889 0.4451 -0.1000 -0.0351 -0.0331 274 ARG A CD  
2061 N NE  A ARG A 274 ? 0.4832 0.3296 0.5581 -0.1026 -0.0691 0.0086  274 ARG A NE  
2062 N NE  B ARG A 274 ? 0.4815 0.3492 0.4420 -0.0915 -0.0092 -0.0703 274 ARG A NE  
2063 C CZ  A ARG A 274 ? 0.4986 0.3838 0.6016 -0.0842 -0.0602 0.0116  274 ARG A CZ  
2064 C CZ  B ARG A 274 ? 0.4205 0.2893 0.3696 -0.0843 -0.0061 -0.0843 274 ARG A CZ  
2065 N NH1 A ARG A 274 ? 0.4444 0.3612 0.5165 -0.0660 -0.0289 -0.0181 274 ARG A NH1 
2066 N NH1 B ARG A 274 ? 0.4398 0.2986 0.4277 -0.0818 -0.0257 -0.0634 274 ARG A NH1 
2067 N NH2 A ARG A 274 ? 0.3747 0.2646 0.5349 -0.0841 -0.0830 0.0453  274 ARG A NH2 
2068 N NH2 B ARG A 274 ? 0.3686 0.2466 0.2676 -0.0803 0.0151  -0.1173 274 ARG A NH2 
2069 N N   . THR A 275 ? 0.3409 0.2934 0.5542 -0.1025 -0.0788 0.1334  275 THR A N   
2070 C CA  . THR A 275 ? 0.3756 0.2895 0.5918 -0.1146 -0.1102 0.1579  275 THR A CA  
2071 C C   . THR A 275 ? 0.5597 0.4781 0.7758 -0.1119 -0.1037 0.1689  275 THR A C   
2072 O O   . THR A 275 ? 0.4869 0.3782 0.6888 -0.1153 -0.1237 0.1761  275 THR A O   
2073 C CB  . THR A 275 ? 0.4411 0.4018 0.7219 -0.1136 -0.1324 0.1971  275 THR A CB  
2074 O OG1 . THR A 275 ? 0.4786 0.5238 0.8322 -0.1044 -0.1208 0.2390  275 THR A OG1 
2075 C CG2 . THR A 275 ? 0.4018 0.3722 0.7010 -0.1117 -0.1299 0.1928  275 THR A CG2 
2076 N N   . ARG A 276 ? 0.4475 0.4131 0.6666 -0.0974 -0.0709 0.1577  276 ARG A N   
2077 C CA  . ARG A 276 ? 0.3841 0.3601 0.6041 -0.0900 -0.0625 0.1669  276 ARG A CA  
2078 C C   . ARG A 276 ? 0.3862 0.2784 0.5382 -0.0936 -0.0588 0.1338  276 ARG A C   
2079 O O   . ARG A 276 ? 0.5812 0.4511 0.6873 -0.0917 -0.0428 0.0944  276 ARG A O   
2080 C CB  . ARG A 276 ? 0.3173 0.3977 0.5666 -0.0660 -0.0278 0.1664  276 ARG A CB  
2081 C CG  . ARG A 276 ? 0.3512 0.5152 0.6664 -0.0598 -0.0265 0.2029  276 ARG A CG  
2082 C CD  . ARG A 276 ? 0.3769 0.5562 0.7357 -0.0664 -0.0451 0.2492  276 ARG A CD  
2083 N NE  . ARG A 276 ? 0.3817 0.6253 0.7934 -0.0611 -0.0477 0.2839  276 ARG A NE  
2084 C CZ  . ARG A 276 ? 0.5727 0.7925 1.0059 -0.0718 -0.0756 0.3062  276 ARG A CZ  
2085 N NH1 . ARG A 276 ? 0.6611 0.7990 1.0657 -0.0911 -0.1059 0.2914  276 ARG A NH1 
2086 N NH2 . ARG A 276 ? 0.5079 0.7703 0.9653 -0.0609 -0.0698 0.3331  276 ARG A NH2 
2087 N N   . PRO A 277 ? 0.7049 0.5502 0.8496 -0.0981 -0.0725 0.1512  277 PRO A N   
2088 C CA  . PRO A 277 ? 0.6545 0.4277 0.7400 -0.0943 -0.0618 0.1231  277 PRO A CA  
2089 C C   . PRO A 277 ? 0.6242 0.4632 0.7059 -0.0712 -0.0220 0.0946  277 PRO A C   
2090 O O   . PRO A 277 ? 0.6483 0.5851 0.7771 -0.0576 -0.0070 0.1083  277 PRO A O   
2091 C CB  . PRO A 277 ? 0.5324 0.2961 0.6312 -0.0891 -0.0729 0.1503  277 PRO A CB  
2092 C CG  . PRO A 277 ? 0.5469 0.3510 0.6829 -0.0971 -0.0975 0.1762  277 PRO A CG  
2093 C CD  . PRO A 277 ? 0.4248 0.3035 0.6130 -0.0977 -0.0910 0.1899  277 PRO A CD  
2094 N N   . ALA A 278 ? 0.6569 0.4449 0.6824 -0.0689 -0.0053 0.0575  278 ALA A N   
2095 C CA  . ALA A 278 ? 0.5402 0.3942 0.5636 -0.0516 0.0293  0.0329  278 ALA A CA  
2096 C C   . ALA A 278 ? 0.5152 0.4355 0.5821 -0.0310 0.0428  0.0560  278 ALA A C   
2097 O O   . ALA A 278 ? 0.4321 0.4434 0.5272 -0.0192 0.0622  0.0571  278 ALA A O   
2098 C CB  . ALA A 278 ? 0.4526 0.2413 0.4125 -0.0537 0.0448  -0.0056 278 ALA A CB  
2099 N N   . GLN A 279 ? 0.6375 0.5058 0.7061 -0.0290 0.0291  0.0764  279 GLN A N   
2100 C CA  . GLN A 279 ? 0.4223 0.3352 0.5269 -0.0095 0.0383  0.0991  279 GLN A CA  
2101 C C   . GLN A 279 ? 0.4820 0.4921 0.6500 -0.0070 0.0328  0.1347  279 GLN A C   
2102 O O   . GLN A 279 ? 0.4773 0.5553 0.6778 0.0087  0.0465  0.1488  279 GLN A O   
2103 C CB  . GLN A 279 ? 0.6592 0.4781 0.7424 -0.0095 0.0214  0.1125  279 GLN A CB  
2104 C CG  . GLN A 279 ? 0.4901 0.3445 0.6030 0.0143  0.0343  0.1299  279 GLN A CG  
2105 C CD  . GLN A 279 ? 0.6267 0.5225 0.7341 0.0349  0.0703  0.1033  279 GLN A CD  
2106 O OE1 . GLN A 279 ? 0.5110 0.3435 0.5691 0.0379  0.0855  0.0719  279 GLN A OE1 
2107 N NE2 . GLN A 279 ? 0.4223 0.4256 0.5790 0.0471  0.0838  0.1174  279 GLN A NE2 
2108 N N   . ASP A 280 ? 0.4937 0.5112 0.6803 -0.0229 0.0128  0.1517  280 ASP A N   
2109 C CA  . ASP A 280 ? 0.5942 0.7063 0.8375 -0.0205 0.0124  0.1836  280 ASP A CA  
2110 C C   . ASP A 280 ? 0.4299 0.6261 0.6776 -0.0113 0.0403  0.1646  280 ASP A C   
2111 O O   . ASP A 280 ? 0.4415 0.7204 0.7238 -0.0033 0.0509  0.1842  280 ASP A O   
2112 C CB  . ASP A 280 ? 0.6360 0.7355 0.9047 -0.0387 -0.0157 0.2120  280 ASP A CB  
2113 C CG  . ASP A 280 ? 0.7028 0.7433 0.9790 -0.0497 -0.0462 0.2454  280 ASP A CG  
2114 O OD1 . ASP A 280 ? 0.7973 0.8213 1.0669 -0.0385 -0.0422 0.2497  280 ASP A OD1 
2115 O OD2 . ASP A 280 ? 0.7124 0.7213 1.0006 -0.0698 -0.0754 0.2688  280 ASP A OD2 
2116 N N   . LEU A 281 ? 0.4464 0.6162 0.6525 -0.0144 0.0510  0.1266  281 LEU A N   
2117 C CA  . LEU A 281 ? 0.4311 0.6682 0.6301 -0.0084 0.0748  0.1069  281 LEU A CA  
2118 C C   . LEU A 281 ? 0.5070 0.7879 0.7080 0.0040  0.0936  0.1044  281 LEU A C   
2119 O O   . LEU A 281 ? 0.5829 0.9097 0.7843 0.0088  0.0958  0.1057  281 LEU A O   
2120 C CB  . LEU A 281 ? 0.5406 0.7319 0.6904 -0.0172 0.0786  0.0676  281 LEU A CB  
2121 C CG  . LEU A 281 ? 0.4489 0.6083 0.6011 -0.0287 0.0603  0.0707  281 LEU A CG  
2122 C CD1 . LEU A 281 ? 0.3600 0.5037 0.4700 -0.0341 0.0685  0.0345  281 LEU A CD1 
2123 C CD2 . LEU A 281 ? 0.2615 0.4900 0.4690 -0.0233 0.0581  0.1069  281 LEU A CD2 
2124 N N   . VAL A 282 ? 0.5629 0.7906 0.7411 0.0083  0.0964  0.0903  282 VAL A N   
2125 C CA  . VAL A 282 ? 0.4344 0.7019 0.6224 0.0224  0.1135  0.0917  282 VAL A CA  
2126 C C   . VAL A 282 ? 0.4506 0.7760 0.6896 0.0314  0.1081  0.1320  282 VAL A C   
2127 O O   . VAL A 282 ? 0.5115 0.8657 0.7380 0.0333  0.1053  0.1259  282 VAL A O   
2128 C CB  . VAL A 282 ? 0.4296 0.6218 0.5892 0.0295  0.1187  0.0743  282 VAL A CB  
2129 C CG1 . VAL A 282 ? 0.3345 0.5662 0.5228 0.0497  0.1327  0.0889  282 VAL A CG1 
2130 C CG2 . VAL A 282 ? 0.3799 0.5373 0.4883 0.0200  0.1306  0.0336  282 VAL A CG2 
2131 N N   . ASP A 283 ? 0.3624 0.6494 0.6204 0.0297  0.0874  0.1581  283 ASP A N   
2132 C CA  . ASP A 283 ? 0.3621 0.6954 0.6658 0.0358  0.0789  0.1984  283 ASP A CA  
2133 C C   . ASP A 283 ? 0.4378 0.8178 0.7265 0.0308  0.0740  0.1986  283 ASP A C   
2134 O O   . ASP A 283 ? 0.3753 0.7792 0.6739 0.0344  0.0673  0.2206  283 ASP A O   
2135 C CB  . ASP A 283 ? 0.4509 0.7232 0.7654 0.0279  0.0511  0.2250  283 ASP A CB  
2136 C CG  . ASP A 283 ? 0.6188 0.7922 0.9044 0.0349  0.0442  0.2164  283 ASP A CG  
2137 O OD1 . ASP A 283 ? 0.4016 0.5663 0.6697 0.0505  0.0645  0.1942  283 ASP A OD1 
2138 O OD2 . ASP A 283 ? 0.8166 0.9196 1.0952 0.0247  0.0189  0.2333  283 ASP A OD2 
2139 N N   . HIS A 284 ? 0.3914 0.7684 0.6480 0.0229  0.0766  0.1720  284 HIS A N   
2140 C CA  . HIS A 284 ? 0.3051 0.7046 0.5412 0.0203  0.0734  0.1689  284 HIS A CA  
2141 C C   . HIS A 284 ? 0.3552 0.7557 0.5519 0.0180  0.0824  0.1348  284 HIS A C   
2142 O O   . HIS A 284 ? 0.3906 0.8067 0.5711 0.0163  0.0818  0.1329  284 HIS A O   
2143 C CB  . HIS A 284 ? 0.4056 0.8017 0.6498 0.0151  0.0675  0.1777  284 HIS A CB  
2144 C CG  . HIS A 284 ? 0.5067 0.9065 0.7901 0.0129  0.0528  0.2201  284 HIS A CG  
2145 N ND1 . HIS A 284 ? 0.4960 0.8693 0.8131 0.0058  0.0412  0.2392  284 HIS A ND1 
2146 C CD2 . HIS A 284 ? 0.5176 0.9409 0.8132 0.0133  0.0451  0.2501  284 HIS A CD2 
2147 C CE1 . HIS A 284 ? 0.5712 0.9486 0.9192 0.0007  0.0244  0.2792  284 HIS A CE1 
2148 N NE2 . HIS A 284 ? 0.6129 1.0227 0.9467 0.0061  0.0288  0.2861  284 HIS A NE2 
2149 N N   . GLU A 285 ? 0.3638 0.7464 0.5466 0.0174  0.0907  0.1113  285 GLU A N   
2150 C CA  . GLU A 285 ? 0.4223 0.7969 0.5701 0.0118  0.0962  0.0833  285 GLU A CA  
2151 C C   . GLU A 285 ? 0.5007 0.9054 0.6400 0.0119  0.0917  0.0921  285 GLU A C   
2152 O O   . GLU A 285 ? 0.4410 0.8494 0.5546 0.0070  0.0913  0.0815  285 GLU A O   
2153 C CB  . GLU A 285 ? 0.3611 0.7131 0.4987 0.0109  0.1055  0.0632  285 GLU A CB  
2154 C CG  . GLU A 285 ? 0.6359 0.9763 0.7397 0.0040  0.1077  0.0418  285 GLU A CG  
2155 C CD  . GLU A 285 ? 0.7149 1.0349 0.8097 0.0034  0.1172  0.0268  285 GLU A CD  
2156 O OE1 . GLU A 285 ? 0.5053 0.8117 0.6131 0.0080  0.1261  0.0255  285 GLU A OE1 
2157 O OE2 . GLU A 285 ? 0.7587 1.0799 0.8327 -0.0014 0.1157  0.0182  285 GLU A OE2 
2158 N N   . TRP A 286 ? 0.3325 0.7623 0.4938 0.0179  0.0878  0.1149  286 TRP A N   
2159 C CA  . TRP A 286 ? 0.2400 0.7039 0.3950 0.0169  0.0828  0.1266  286 TRP A CA  
2160 C C   . TRP A 286 ? 0.3703 0.8597 0.5219 0.0152  0.0764  0.1445  286 TRP A C   
2161 O O   . TRP A 286 ? 0.4878 1.0095 0.6319 0.0126  0.0715  0.1559  286 TRP A O   
2162 C CB  . TRP A 286 ? 0.2449 0.7287 0.4270 0.0249  0.0819  0.1473  286 TRP A CB  
2163 C CG  . TRP A 286 ? 0.2865 0.7554 0.4701 0.0274  0.0910  0.1293  286 TRP A CG  
2164 C CD1 . TRP A 286 ? 0.3948 0.8396 0.5952 0.0352  0.1000  0.1234  286 TRP A CD1 
2165 C CD2 . TRP A 286 ? 0.3709 0.8492 0.5377 0.0219  0.0931  0.1160  286 TRP A CD2 
2166 N NE1 . TRP A 286 ? 0.4520 0.8898 0.6463 0.0357  0.1100  0.1051  286 TRP A NE1 
2167 C CE2 . TRP A 286 ? 0.3077 0.7662 0.4834 0.0268  0.1049  0.1016  286 TRP A CE2 
2168 C CE3 . TRP A 286 ? 0.4695 0.9748 0.6151 0.0128  0.0857  0.1174  286 TRP A CE3 
2169 C CZ2 . TRP A 286 ? 0.3474 0.8119 0.5142 0.0227  0.1097  0.0901  286 TRP A CZ2 
2170 C CZ3 . TRP A 286 ? 0.4189 0.9354 0.5552 0.0082  0.0874  0.1086  286 TRP A CZ3 
2171 C CH2 . TRP A 286 ? 0.5122 1.0063 0.6605 0.0129  0.0996  0.0950  286 TRP A CH2 
2172 N N   . HIS A 287 ? 0.4501 0.9291 0.6083 0.0162  0.0766  0.1488  287 HIS A N   
2173 C CA  . HIS A 287 ? 0.4692 0.9747 0.6283 0.0159  0.0731  0.1678  287 HIS A CA  
2174 C C   . HIS A 287 ? 0.4843 0.9970 0.6150 0.0124  0.0784  0.1515  287 HIS A C   
2175 O O   . HIS A 287 ? 0.5628 1.1048 0.6901 0.0121  0.0783  0.1648  287 HIS A O   
2176 C CB  . HIS A 287 ? 0.3410 0.8426 0.5275 0.0193  0.0695  0.1902  287 HIS A CB  
2177 C CG  . HIS A 287 ? 0.4470 0.9491 0.6631 0.0230  0.0629  0.2156  287 HIS A CG  
2178 N ND1 . HIS A 287 ? 0.4556 0.9423 0.6998 0.0238  0.0579  0.2345  287 HIS A ND1 
2179 C CD2 . HIS A 287 ? 0.6408 1.1569 0.8661 0.0261  0.0604  0.2280  287 HIS A CD2 
2180 C CE1 . HIS A 287 ? 0.4849 0.9728 0.7543 0.0276  0.0531  0.2571  287 HIS A CE1 
2181 N NE2 . HIS A 287 ? 0.6002 1.1067 0.8592 0.0304  0.0559  0.2529  287 HIS A NE2 
2182 N N   . VAL A 288 ? 0.4360 0.9237 0.5463 0.0097  0.0839  0.1238  288 VAL A N   
2183 C CA  . VAL A 288 ? 0.4013 0.8920 0.4853 0.0072  0.0902  0.1088  288 VAL A CA  
2184 C C   . VAL A 288 ? 0.4778 0.9931 0.5366 -0.0003 0.0873  0.1034  288 VAL A C   
2185 O O   . VAL A 288 ? 0.6276 1.1436 0.6618 -0.0039 0.0937  0.0907  288 VAL A O   
2186 C CB  . VAL A 288 ? 0.2872 0.7380 0.3594 0.0067  0.0970  0.0838  288 VAL A CB  
2187 C CG1 . VAL A 288 ? 0.2744 0.7062 0.3749 0.0110  0.0982  0.0913  288 VAL A CG1 
2188 C CG2 . VAL A 288 ? 0.2620 0.6927 0.3185 0.0009  0.0941  0.0649  288 VAL A CG2 
2189 N N   . LEU A 289 ? 0.5140 0.7150 0.6507 -0.0499 0.0947  0.1011  289 LEU A N   
2190 C CA  . LEU A 289 ? 0.5711 0.7773 0.6751 -0.0535 0.1022  0.1102  289 LEU A CA  
2191 C C   . LEU A 289 ? 0.5408 0.8038 0.6472 -0.0654 0.1148  0.1237  289 LEU A C   
2192 O O   . LEU A 289 ? 0.6423 0.9251 0.7766 -0.0776 0.1141  0.1409  289 LEU A O   
2193 C CB  . LEU A 289 ? 0.4726 0.6527 0.5770 -0.0612 0.0977  0.1297  289 LEU A CB  
2194 C CG  . LEU A 289 ? 0.4830 0.6128 0.5739 -0.0497 0.0876  0.1156  289 LEU A CG  
2195 C CD1 . LEU A 289 ? 0.3906 0.5046 0.4917 -0.0585 0.0840  0.1365  289 LEU A CD1 
2196 C CD2 . LEU A 289 ? 0.4424 0.5563 0.4898 -0.0371 0.0899  0.0959  289 LEU A CD2 
2197 N N   . PRO A 290 ? 0.3753 0.6551 0.4487 -0.0596 0.1225  0.1097  290 PRO A N   
2198 C CA  . PRO A 290 ? 0.3848 0.7019 0.4494 -0.0637 0.1275  0.1062  290 PRO A CA  
2199 C C   . PRO A 290 ? 0.5377 0.8545 0.6006 -0.0753 0.1219  0.1279  290 PRO A C   
2200 O O   . PRO A 290 ? 0.5609 0.9125 0.6325 -0.0821 0.1240  0.1362  290 PRO A O   
2201 C CB  . PRO A 290 ? 0.5314 0.8479 0.5618 -0.0522 0.1326  0.0807  290 PRO A CB  
2202 C CG  . PRO A 290 ? 0.4369 0.7088 0.4509 -0.0466 0.1289  0.0796  290 PRO A CG  
2203 C CD  . PRO A 290 ? 0.4375 0.6777 0.4770 -0.0443 0.1189  0.0858  290 PRO A CD  
2204 N N   . GLN A 291 ? 0.6666 0.9482 0.7193 -0.0762 0.1147  0.1370  291 GLN A N   
2205 C CA  . GLN A 291 ? 0.6176 0.9018 0.6716 -0.0838 0.1082  0.1569  291 GLN A CA  
2206 C C   . GLN A 291 ? 0.6647 0.9112 0.7345 -0.0856 0.0985  0.1717  291 GLN A C   
2207 O O   . GLN A 291 ? 0.7979 1.0119 0.8671 -0.0802 0.0964  0.1637  291 GLN A O   
2208 C CB  . GLN A 291 ? 0.6328 0.9260 0.6553 -0.0813 0.1088  0.1483  291 GLN A CB  
2209 C CG  . GLN A 291 ? 0.6416 0.9706 0.6482 -0.0778 0.1173  0.1283  291 GLN A CG  
2210 C CD  . GLN A 291 ? 0.7596 1.0681 0.7465 -0.0673 0.1218  0.1020  291 GLN A CD  
2211 O OE1 . GLN A 291 ? 0.8696 1.1379 0.8484 -0.0637 0.1184  0.1006  291 GLN A OE1 
2212 N NE2 . GLN A 291 ? 0.7627 1.0995 0.7425 -0.0616 0.1291  0.0802  291 GLN A NE2 
2213 N N   . GLU A 292 ? 0.6491 0.9030 0.7345 -0.0923 0.0924  0.1937  292 GLU A N   
2214 C CA  . GLU A 292 ? 0.6511 0.8740 0.7517 -0.0921 0.0825  0.2065  292 GLU A CA  
2215 C C   . GLU A 292 ? 0.6068 0.8090 0.6770 -0.0849 0.0813  0.1929  292 GLU A C   
2216 O O   . GLU A 292 ? 0.6483 0.8691 0.6936 -0.0842 0.0840  0.1874  292 GLU A O   
2217 C CB  . GLU A 292 ? 0.6338 0.8768 0.7519 -0.0988 0.0769  0.2330  292 GLU A CB  
2218 C CG  . GLU A 292 ? 0.8023 1.0190 0.9512 -0.0991 0.0666  0.2498  292 GLU A CG  
2219 C CD  . GLU A 292 ? 1.0798 1.3214 1.2508 -0.1059 0.0615  0.2798  292 GLU A CD  
2220 O OE1 . GLU A 292 ? 1.0467 1.3086 1.2018 -0.1054 0.0594  0.2889  292 GLU A OE1 
2221 O OE2 . GLU A 292 ? 1.1802 1.4233 1.3865 -0.1124 0.0594  0.2952  292 GLU A OE2 
2222 N N   . SER A 293 ? 0.5206 0.6866 0.5936 -0.0799 0.0771  0.1863  293 SER A N   
2223 C CA  . SER A 293 ? 0.6201 0.7670 0.6631 -0.0739 0.0769  0.1724  293 SER A CA  
2224 C C   . SER A 293 ? 0.5168 0.6291 0.5683 -0.0697 0.0701  0.1715  293 SER A C   
2225 O O   . SER A 293 ? 0.4561 0.5571 0.5397 -0.0705 0.0650  0.1804  293 SER A O   
2226 C CB  . SER A 293 ? 0.5496 0.6968 0.5653 -0.0695 0.0855  0.1512  293 SER A CB  
2227 O OG  . SER A 293 ? 0.6024 0.7410 0.6310 -0.0672 0.0882  0.1467  293 SER A OG  
2228 N N   . ILE A 294 ? 0.3126 0.4100 0.3375 -0.0654 0.0700  0.1599  294 ILE A N   
2229 C CA  . ILE A 294 ? 0.3174 0.3847 0.3426 -0.0606 0.0655  0.1546  294 ILE A CA  
2230 C C   . ILE A 294 ? 0.5277 0.5808 0.5169 -0.0565 0.0707  0.1355  294 ILE A C   
2231 O O   . ILE A 294 ? 0.4888 0.5538 0.4557 -0.0574 0.0759  0.1277  294 ILE A O   
2232 C CB  . ILE A 294 ? 0.4511 0.5171 0.4866 -0.0603 0.0584  0.1651  294 ILE A CB  
2233 C CG1 . ILE A 294 ? 0.5390 0.6208 0.5489 -0.0615 0.0604  0.1621  294 ILE A CG1 
2234 C CG2 . ILE A 294 ? 0.3540 0.4311 0.4301 -0.0635 0.0522  0.1869  294 ILE A CG2 
2235 C CD1 . ILE A 294 ? 0.6639 0.7532 0.6876 -0.0614 0.0534  0.1763  294 ILE A CD1 
2236 N N   . PHE A 295 ? 0.3892 0.4174 0.3757 -0.0518 0.0690  0.1288  295 PHE A N   
2237 C CA  . PHE A 295 ? 0.4872 0.4988 0.4415 -0.0480 0.0724  0.1136  295 PHE A CA  
2238 C C   . PHE A 295 ? 0.6193 0.6391 0.5614 -0.0461 0.0799  0.1067  295 PHE A C   
2239 O O   . PHE A 295 ? 0.5715 0.5848 0.4866 -0.0443 0.0840  0.0947  295 PHE A O   
2240 C CB  . PHE A 295 ? 0.4165 0.4251 0.3494 -0.0497 0.0726  0.1069  295 PHE A CB  
2241 C CG  . PHE A 295 ? 0.5041 0.4890 0.4180 -0.0475 0.0710  0.0970  295 PHE A CG  
2242 C CD1 . PHE A 295 ? 0.4521 0.4292 0.3528 -0.0455 0.0699  0.0898  295 PHE A CD1 
2243 C CD2 . PHE A 295 ? 0.4204 0.4008 0.3348 -0.0476 0.0678  0.0980  295 PHE A CD2 
2244 C CE1 . PHE A 295 ? 0.3795 0.3517 0.2756 -0.0401 0.0651  0.0864  295 PHE A CE1 
2245 C CE2 . PHE A 295 ? 0.4398 0.4051 0.3393 -0.0468 0.0653  0.0889  295 PHE A CE2 
2246 C CZ  . PHE A 295 ? 0.4792 0.4547 0.3785 -0.0442 0.0593  0.0869  295 PHE A CZ  
2247 N N   . ARG A 296 ? 0.5407 0.5765 0.5071 -0.0465 0.0819  0.1152  296 ARG A N   
2248 C CA  . ARG A 296 ? 0.5417 0.5854 0.5051 -0.0406 0.0883  0.1074  296 ARG A CA  
2249 C C   . ARG A 296 ? 0.6298 0.6565 0.6175 -0.0332 0.0800  0.1002  296 ARG A C   
2250 O O   . ARG A 296 ? 0.6708 0.6998 0.6911 -0.0385 0.0754  0.1121  296 ARG A O   
2251 C CB  . ARG A 296 ? 0.4609 0.5442 0.4331 -0.0474 0.0947  0.1124  296 ARG A CB  
2252 C CG  . ARG A 296 ? 0.4822 0.5776 0.4314 -0.0507 0.0972  0.1039  296 ARG A CG  
2253 C CD  . ARG A 296 ? 0.6310 0.7102 0.5490 -0.0445 0.1016  0.0867  296 ARG A CD  
2254 N NE  . ARG A 296 ? 0.6362 0.7291 0.5405 -0.0472 0.1041  0.0790  296 ARG A NE  
2255 C CZ  . ARG A 296 ? 0.6345 0.7138 0.5292 -0.0486 0.1004  0.0792  296 ARG A CZ  
2256 N NH1 . ARG A 296 ? 0.7145 0.7648 0.6096 -0.0480 0.0947  0.0840  296 ARG A NH1 
2257 N NH2 . ARG A 296 ? 0.6125 0.7121 0.4988 -0.0505 0.1021  0.0734  296 ARG A NH2 
2258 N N   . PHE A 297 ? 0.4382 0.4496 0.4128 -0.0211 0.0774  0.0808  297 PHE A N   
2259 C CA  . PHE A 297 ? 0.4956 0.4955 0.4879 -0.0122 0.0687  0.0699  297 PHE A CA  
2260 C C   . PHE A 297 ? 0.5437 0.5552 0.5389 -0.0035 0.0688  0.0568  297 PHE A C   
2261 O O   . PHE A 297 ? 0.4692 0.4804 0.4421 0.0022  0.0734  0.0488  297 PHE A O   
2262 C CB  . PHE A 297 ? 0.5394 0.5101 0.5117 -0.0035 0.0625  0.0603  297 PHE A CB  
2263 C CG  . PHE A 297 ? 0.5546 0.5154 0.5126 -0.0099 0.0647  0.0694  297 PHE A CG  
2264 C CD1 . PHE A 297 ? 0.3945 0.3563 0.3763 -0.0159 0.0613  0.0787  297 PHE A CD1 
2265 C CD2 . PHE A 297 ? 0.5752 0.5259 0.4997 -0.0098 0.0698  0.0679  297 PHE A CD2 
2266 C CE1 . PHE A 297 ? 0.4469 0.4028 0.4180 -0.0205 0.0629  0.0866  297 PHE A CE1 
2267 C CE2 . PHE A 297 ? 0.6523 0.5978 0.5657 -0.0164 0.0717  0.0756  297 PHE A CE2 
2268 C CZ  . PHE A 297 ? 0.3902 0.3400 0.3262 -0.0211 0.0682  0.0852  297 PHE A CZ  
2269 N N   . SER A 298 ? 0.4657 0.4872 0.4914 -0.0019 0.0631  0.0527  298 SER A N   
2270 C CA  . SER A 298 ? 0.3921 0.4349 0.4291 0.0039  0.0641  0.0431  298 SER A CA  
2271 C C   . SER A 298 ? 0.4184 0.4469 0.4318 0.0213  0.0604  0.0260  298 SER A C   
2272 O O   . SER A 298 ? 0.5073 0.5506 0.5183 0.0274  0.0646  0.0183  298 SER A O   
2273 C CB  . SER A 298 ? 0.3849 0.4411 0.4626 0.0009  0.0574  0.0413  298 SER A CB  
2274 O OG  . SER A 298 ? 0.4588 0.5336 0.5657 -0.0158 0.0618  0.0599  298 SER A OG  
2275 N N   . PHE A 299 ? 0.5357 0.5378 0.5338 0.0298  0.0524  0.0207  299 PHE A N   
2276 C CA  . PHE A 299 ? 0.5055 0.4952 0.4863 0.0466  0.0465  0.0092  299 PHE A CA  
2277 C C   . PHE A 299 ? 0.4408 0.3996 0.3868 0.0508  0.0458  0.0121  299 PHE A C   
2278 O O   . PHE A 299 ? 0.5259 0.4727 0.4639 0.0526  0.0396  0.0127  299 PHE A O   
2279 C CB  . PHE A 299 ? 0.3142 0.3147 0.3163 0.0546  0.0354  -0.0007 299 PHE A CB  
2280 C CG  . PHE A 299 ? 0.3073 0.3396 0.3434 0.0517  0.0367  -0.0049 299 PHE A CG  
2281 C CD1 . PHE A 299 ? 0.4764 0.5232 0.5129 0.0610  0.0395  -0.0118 299 PHE A CD1 
2282 C CD2 . PHE A 299 ? 0.4874 0.5360 0.5581 0.0390  0.0357  -0.0015 299 PHE A CD2 
2283 C CE1 . PHE A 299 ? 0.5620 0.6435 0.6303 0.0575  0.0418  -0.0157 299 PHE A CE1 
2284 C CE2 . PHE A 299 ? 0.4513 0.5313 0.5550 0.0339  0.0378  -0.0031 299 PHE A CE2 
2285 C CZ  . PHE A 299 ? 0.2963 0.3951 0.3976 0.0429  0.0413  -0.0102 299 PHE A CZ  
2286 N N   . VAL A 300 ? 0.5236 0.4726 0.4510 0.0514  0.0526  0.0127  300 VAL A N   
2287 C CA  . VAL A 300 ? 0.7443 0.6643 0.6421 0.0520  0.0534  0.0169  300 VAL A CA  
2288 C C   . VAL A 300 ? 0.3692 0.2736 0.2564 0.0659  0.0513  0.0106  300 VAL A C   
2289 O O   . VAL A 300 ? 0.5365 0.4550 0.4392 0.0752  0.0500  0.0017  300 VAL A O   
2290 C CB  . VAL A 300 ? 0.5841 0.5045 0.4729 0.0375  0.0633  0.0231  300 VAL A CB  
2291 C CG1 . VAL A 300 ? 0.4454 0.3831 0.3514 0.0249  0.0645  0.0322  300 VAL A CG1 
2292 C CG2 . VAL A 300 ? 0.4645 0.3997 0.3566 0.0371  0.0711  0.0154  300 VAL A CG2 
2293 N N   . PRO A 301 ? 0.7083 0.5837 0.5721 0.0675  0.0507  0.0158  301 PRO A N   
2294 C CA  . PRO A 301 ? 0.4287 0.2830 0.2865 0.0811  0.0475  0.0125  301 PRO A CA  
2295 C C   . PRO A 301 ? 0.4158 0.2797 0.2871 0.0838  0.0537  -0.0012 301 PRO A C   
2296 O O   . PRO A 301 ? 0.5006 0.3779 0.3728 0.0714  0.0631  -0.0054 301 PRO A O   
2297 C CB  . PRO A 301 ? 0.5054 0.3292 0.3395 0.0746  0.0494  0.0223  301 PRO A CB  
2298 C CG  . PRO A 301 ? 0.6753 0.5070 0.5006 0.0654  0.0482  0.0315  301 PRO A CG  
2299 C CD  . PRO A 301 ? 0.6673 0.5287 0.5126 0.0583  0.0512  0.0261  301 PRO A CD  
2300 N N   . VAL A 302 ? 0.6670 0.5291 0.5499 0.1009  0.0480  -0.0089 302 VAL A N   
2301 C CA  . VAL A 302 ? 0.5604 0.4327 0.4581 0.1065  0.0535  -0.0260 302 VAL A CA  
2302 C C   . VAL A 302 ? 0.6599 0.4948 0.5512 0.1138  0.0525  -0.0298 302 VAL A C   
2303 O O   . VAL A 302 ? 0.7239 0.5277 0.6071 0.1228  0.0437  -0.0178 302 VAL A O   
2304 C CB  . VAL A 302 ? 0.5244 0.4234 0.4466 0.1218  0.0485  -0.0361 302 VAL A CB  
2305 C CG1 . VAL A 302 ? 0.4559 0.3349 0.3773 0.1400  0.0350  -0.0288 302 VAL A CG1 
2306 C CG2 . VAL A 302 ? 0.4465 0.3611 0.3852 0.1282  0.0550  -0.0565 302 VAL A CG2 
2307 N N   . VAL A 303 ? 0.7068 0.5471 0.6037 0.1092  0.0612  -0.0465 303 VAL A N   
2308 C CA  . VAL A 303 ? 0.6285 0.4371 0.5308 0.1180  0.0602  -0.0582 303 VAL A CA  
2309 C C   . VAL A 303 ? 0.7067 0.5176 0.6329 0.1416  0.0528  -0.0691 303 VAL A C   
2310 O O   . VAL A 303 ? 0.7800 0.6245 0.7252 0.1473  0.0577  -0.0901 303 VAL A O   
2311 C CB  . VAL A 303 ? 0.6566 0.4811 0.5613 0.1067  0.0716  -0.0793 303 VAL A CB  
2312 C CG1 . VAL A 303 ? 0.6013 0.3883 0.5151 0.1137  0.0702  -0.0947 303 VAL A CG1 
2313 C CG2 . VAL A 303 ? 0.7624 0.5952 0.6457 0.0842  0.0783  -0.0672 303 VAL A CG2 
2314 N N   . ASP A 304 ? 0.8197 0.5986 0.7452 0.1555  0.0410  -0.0537 304 ASP A N   
2315 C CA  . ASP A 304 ? 0.7760 0.5573 0.7241 0.1800  0.0311  -0.0590 304 ASP A CA  
2316 C C   . ASP A 304 ? 0.7750 0.5171 0.7411 0.1962  0.0259  -0.0672 304 ASP A C   
2317 O O   . ASP A 304 ? 0.8751 0.6183 0.8640 0.2187  0.0172  -0.0727 304 ASP A O   
2318 C CB  . ASP A 304 ? 0.9587 0.7393 0.8970 0.1875  0.0191  -0.0351 304 ASP A CB  
2319 C CG  . ASP A 304 ? 0.9897 0.7305 0.9034 0.1814  0.0142  -0.0087 304 ASP A CG  
2320 O OD1 . ASP A 304 ? 0.8607 0.5752 0.7641 0.1676  0.0210  -0.0075 304 ASP A OD1 
2321 O OD2 . ASP A 304 ? 0.9520 0.6928 0.8568 0.1896  0.0035  0.0106  304 ASP A OD2 
2322 N N   . GLY A 305 ? 0.7866 0.4945 0.7463 0.1852  0.0305  -0.0688 305 GLY A N   
2323 C CA  . GLY A 305 ? 0.6704 0.3309 0.6491 0.1981  0.0240  -0.0717 305 GLY A CA  
2324 C C