data_4B92
# 
_entry.id   4B92 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4B92         
PDBE  EBI-53859    
WWPDB D_1290053859 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4B90 unspecified 'CRYSTAL STRUCTURE OF WT HUMAN CRMP-5'        
PDB 4B91 unspecified 'CRYSTAL STRUCTURE OF TRUNCATED HUMAN CRMP-5' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4B92 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-08-31 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ponnusamy, R.' 1 
'Lohkamp, B.'   2 
# 
_citation.id                        primary 
_citation.title                     
'Insights Into the Oligomerization of Crmps: Crystal Structure of Human Collapsin Response Mediator Protein 5.' 
_citation.journal_abbrev            J.Neurochem. 
_citation.journal_volume            125 
_citation.page_first                855 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-3042 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23373749 
_citation.pdbx_database_id_DOI      10.1111/JNC.12188 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ponnusamy, R.' 1 
primary 'Lohkamp, B.'   2 
# 
_cell.entry_id           4B92 
_cell.length_a           89.500 
_cell.length_b           89.500 
_cell.length_c           246.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4B92 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DIHYDROPYRIMIDINASE-RELATED PROTEIN 5' 52953.496 2 ? ? 'RESIDUES 1-483' ? 
2 non-polymer syn 'ZINC ION'                              65.409    4 ? ? ?                ? 
3 water       nat water                                   18.015    3 ? ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'DRP-5, CRMP3-ASSOCIATED MOLECULE, CRAM, COLLAPSIN RESPONSE MEDIATOR PROTEIN 5, CRMP-5, UNC33-LIKE PHOSPHOPROTEIN 6, ULIP-6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCV
DDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQM
FMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRT
HCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTL
NIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGAD
ADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQRE
KTLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCV
DDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQM
FMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRT
HCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTL
NIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGAD
ADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQRE
KTLK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   LEU n 
1 4   ALA n 
1 5   ASN n 
1 6   SER n 
1 7   ALA n 
1 8   SER n 
1 9   VAL n 
1 10  ARG n 
1 11  ILE n 
1 12  LEU n 
1 13  ILE n 
1 14  LYS n 
1 15  GLY n 
1 16  GLY n 
1 17  LYS n 
1 18  VAL n 
1 19  VAL n 
1 20  ASN n 
1 21  ASP n 
1 22  ASP n 
1 23  CYS n 
1 24  THR n 
1 25  HIS n 
1 26  GLU n 
1 27  ALA n 
1 28  ASP n 
1 29  VAL n 
1 30  TYR n 
1 31  ILE n 
1 32  GLU n 
1 33  ASN n 
1 34  GLY n 
1 35  ILE n 
1 36  ILE n 
1 37  GLN n 
1 38  GLN n 
1 39  VAL n 
1 40  GLY n 
1 41  ARG n 
1 42  GLU n 
1 43  LEU n 
1 44  MET n 
1 45  ILE n 
1 46  PRO n 
1 47  GLY n 
1 48  GLY n 
1 49  ALA n 
1 50  LYS n 
1 51  VAL n 
1 52  ILE n 
1 53  ASP n 
1 54  ALA n 
1 55  THR n 
1 56  GLY n 
1 57  LYS n 
1 58  LEU n 
1 59  VAL n 
1 60  ILE n 
1 61  PRO n 
1 62  GLY n 
1 63  GLY n 
1 64  ILE n 
1 65  ASP n 
1 66  THR n 
1 67  SER n 
1 68  THR n 
1 69  HIS n 
1 70  PHE n 
1 71  HIS n 
1 72  GLN n 
1 73  THR n 
1 74  PHE n 
1 75  MET n 
1 76  ASN n 
1 77  ALA n 
1 78  THR n 
1 79  CYS n 
1 80  VAL n 
1 81  ASP n 
1 82  ASP n 
1 83  PHE n 
1 84  TYR n 
1 85  HIS n 
1 86  GLY n 
1 87  THR n 
1 88  LYS n 
1 89  ALA n 
1 90  ALA n 
1 91  LEU n 
1 92  VAL n 
1 93  GLY n 
1 94  GLY n 
1 95  THR n 
1 96  THR n 
1 97  MET n 
1 98  ILE n 
1 99  ILE n 
1 100 GLY n 
1 101 HIS n 
1 102 VAL n 
1 103 LEU n 
1 104 PRO n 
1 105 ASP n 
1 106 LYS n 
1 107 GLU n 
1 108 THR n 
1 109 SER n 
1 110 LEU n 
1 111 VAL n 
1 112 ASP n 
1 113 ALA n 
1 114 TYR n 
1 115 GLU n 
1 116 LYS n 
1 117 CYS n 
1 118 ARG n 
1 119 GLY n 
1 120 LEU n 
1 121 ALA n 
1 122 ASP n 
1 123 PRO n 
1 124 LYS n 
1 125 VAL n 
1 126 CYS n 
1 127 CYS n 
1 128 ASP n 
1 129 TYR n 
1 130 ALA n 
1 131 LEU n 
1 132 HIS n 
1 133 VAL n 
1 134 GLY n 
1 135 ILE n 
1 136 THR n 
1 137 TRP n 
1 138 TRP n 
1 139 ALA n 
1 140 PRO n 
1 141 LYS n 
1 142 VAL n 
1 143 LYS n 
1 144 ALA n 
1 145 GLU n 
1 146 MET n 
1 147 GLU n 
1 148 THR n 
1 149 LEU n 
1 150 VAL n 
1 151 ARG n 
1 152 GLU n 
1 153 LYS n 
1 154 GLY n 
1 155 VAL n 
1 156 ASN n 
1 157 SER n 
1 158 PHE n 
1 159 GLN n 
1 160 MET n 
1 161 PHE n 
1 162 MET n 
1 163 THR n 
1 164 TYR n 
1 165 LYS n 
1 166 ASP n 
1 167 LEU n 
1 168 TYR n 
1 169 MET n 
1 170 LEU n 
1 171 ARG n 
1 172 ASP n 
1 173 SER n 
1 174 GLU n 
1 175 LEU n 
1 176 TYR n 
1 177 GLN n 
1 178 VAL n 
1 179 LEU n 
1 180 HIS n 
1 181 ALA n 
1 182 CYS n 
1 183 LYS n 
1 184 ASP n 
1 185 ILE n 
1 186 GLY n 
1 187 ALA n 
1 188 ILE n 
1 189 ALA n 
1 190 ARG n 
1 191 VAL n 
1 192 HIS n 
1 193 ALA n 
1 194 GLU n 
1 195 ASN n 
1 196 GLY n 
1 197 GLU n 
1 198 LEU n 
1 199 VAL n 
1 200 ALA n 
1 201 GLU n 
1 202 GLY n 
1 203 ALA n 
1 204 LYS n 
1 205 GLU n 
1 206 ALA n 
1 207 LEU n 
1 208 ASP n 
1 209 LEU n 
1 210 GLY n 
1 211 ILE n 
1 212 THR n 
1 213 GLY n 
1 214 PRO n 
1 215 GLU n 
1 216 GLY n 
1 217 ILE n 
1 218 GLU n 
1 219 ILE n 
1 220 SER n 
1 221 ARG n 
1 222 PRO n 
1 223 GLU n 
1 224 GLU n 
1 225 LEU n 
1 226 GLU n 
1 227 ALA n 
1 228 GLU n 
1 229 ALA n 
1 230 THR n 
1 231 HIS n 
1 232 ARG n 
1 233 VAL n 
1 234 ILE n 
1 235 THR n 
1 236 ILE n 
1 237 ALA n 
1 238 ASN n 
1 239 ARG n 
1 240 THR n 
1 241 HIS n 
1 242 CYS n 
1 243 PRO n 
1 244 ILE n 
1 245 TYR n 
1 246 LEU n 
1 247 VAL n 
1 248 ASN n 
1 249 VAL n 
1 250 SER n 
1 251 SER n 
1 252 ILE n 
1 253 SER n 
1 254 ALA n 
1 255 GLY n 
1 256 ASP n 
1 257 VAL n 
1 258 ILE n 
1 259 ALA n 
1 260 ALA n 
1 261 ALA n 
1 262 LYS n 
1 263 MET n 
1 264 GLN n 
1 265 GLY n 
1 266 LYS n 
1 267 VAL n 
1 268 VAL n 
1 269 LEU n 
1 270 ALA n 
1 271 GLU n 
1 272 THR n 
1 273 THR n 
1 274 THR n 
1 275 ALA n 
1 276 HIS n 
1 277 ALA n 
1 278 THR n 
1 279 LEU n 
1 280 THR n 
1 281 GLY n 
1 282 LEU n 
1 283 HIS n 
1 284 TYR n 
1 285 TYR n 
1 286 HIS n 
1 287 GLN n 
1 288 ASP n 
1 289 TRP n 
1 290 SER n 
1 291 HIS n 
1 292 ALA n 
1 293 ALA n 
1 294 ALA n 
1 295 TYR n 
1 296 VAL n 
1 297 THR n 
1 298 VAL n 
1 299 PRO n 
1 300 PRO n 
1 301 LEU n 
1 302 ARG n 
1 303 LEU n 
1 304 ASP n 
1 305 THR n 
1 306 ASN n 
1 307 THR n 
1 308 SER n 
1 309 THR n 
1 310 TYR n 
1 311 LEU n 
1 312 MET n 
1 313 SER n 
1 314 LEU n 
1 315 LEU n 
1 316 ALA n 
1 317 ASN n 
1 318 ASP n 
1 319 THR n 
1 320 LEU n 
1 321 ASN n 
1 322 ILE n 
1 323 VAL n 
1 324 ALA n 
1 325 SER n 
1 326 ASP n 
1 327 HIS n 
1 328 ARG n 
1 329 PRO n 
1 330 PHE n 
1 331 THR n 
1 332 THR n 
1 333 LYS n 
1 334 GLN n 
1 335 LYS n 
1 336 ALA n 
1 337 MET n 
1 338 GLY n 
1 339 LYS n 
1 340 GLU n 
1 341 ASP n 
1 342 PHE n 
1 343 THR n 
1 344 LYS n 
1 345 ILE n 
1 346 PRO n 
1 347 HIS n 
1 348 GLY n 
1 349 VAL n 
1 350 SER n 
1 351 GLY n 
1 352 VAL n 
1 353 GLN n 
1 354 ASP n 
1 355 ARG n 
1 356 MET n 
1 357 SER n 
1 358 VAL n 
1 359 ILE n 
1 360 TRP n 
1 361 GLU n 
1 362 ARG n 
1 363 GLY n 
1 364 VAL n 
1 365 VAL n 
1 366 GLY n 
1 367 GLY n 
1 368 LYS n 
1 369 MET n 
1 370 ASP n 
1 371 GLU n 
1 372 ASN n 
1 373 ARG n 
1 374 PHE n 
1 375 VAL n 
1 376 ALA n 
1 377 VAL n 
1 378 THR n 
1 379 SER n 
1 380 SER n 
1 381 ASN n 
1 382 ALA n 
1 383 ALA n 
1 384 LYS n 
1 385 LEU n 
1 386 LEU n 
1 387 ASN n 
1 388 LEU n 
1 389 TYR n 
1 390 PRO n 
1 391 ARG n 
1 392 LYS n 
1 393 GLY n 
1 394 ARG n 
1 395 ILE n 
1 396 ILE n 
1 397 PRO n 
1 398 GLY n 
1 399 ALA n 
1 400 ASP n 
1 401 ALA n 
1 402 ASP n 
1 403 VAL n 
1 404 VAL n 
1 405 VAL n 
1 406 TRP n 
1 407 ASP n 
1 408 PRO n 
1 409 GLU n 
1 410 ALA n 
1 411 THR n 
1 412 LYS n 
1 413 THR n 
1 414 ILE n 
1 415 SER n 
1 416 ALA n 
1 417 SER n 
1 418 THR n 
1 419 GLN n 
1 420 VAL n 
1 421 GLN n 
1 422 GLY n 
1 423 GLY n 
1 424 ASP n 
1 425 PHE n 
1 426 ASN n 
1 427 LEU n 
1 428 TYR n 
1 429 GLU n 
1 430 ASN n 
1 431 MET n 
1 432 ARG n 
1 433 CYS n 
1 434 HIS n 
1 435 GLY n 
1 436 VAL n 
1 437 PRO n 
1 438 LEU n 
1 439 VAL n 
1 440 THR n 
1 441 ILE n 
1 442 SER n 
1 443 ARG n 
1 444 GLY n 
1 445 ARG n 
1 446 VAL n 
1 447 VAL n 
1 448 TYR n 
1 449 GLU n 
1 450 ASN n 
1 451 GLY n 
1 452 VAL n 
1 453 PHE n 
1 454 MET n 
1 455 CYS n 
1 456 ALA n 
1 457 GLU n 
1 458 GLY n 
1 459 THR n 
1 460 GLY n 
1 461 LYS n 
1 462 PHE n 
1 463 CYS n 
1 464 PRO n 
1 465 LEU n 
1 466 ARG n 
1 467 SER n 
1 468 PHE n 
1 469 PRO n 
1 470 ASP n 
1 471 THR n 
1 472 VAL n 
1 473 TYR n 
1 474 LYS n 
1 475 LYS n 
1 476 LEU n 
1 477 VAL n 
1 478 GLN n 
1 479 ARG n 
1 480 GLU n 
1 481 LYS n 
1 482 THR n 
1 483 LEU n 
1 484 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ROSETTA 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'MAMMALIAN GENE COLLECTION (MGC)' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPYL5_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q9BPU6 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4B92 A 2 ? 484 ? Q9BPU6 1 ? 483 ? 1 483 
2 1 4B92 B 2 ? 484 ? Q9BPU6 1 ? 483 ? 1 483 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4B92 SER A 1 ? UNP Q9BPU6 ? ? 'expression tag' 0 1 
2 4B92 SER B 1 ? UNP Q9BPU6 ? ? 'expression tag' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          4B92 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.08 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '23% (V/V) PEG 400 MMT PH 5.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03873 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             1.03873 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4B92 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.30 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   23108 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.10 
_reflns.B_iso_Wilson_estimate        70.549 
_reflns.pdbx_redundancy              7.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.06 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.65 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.60 
_reflns_shell.pdbx_redundancy        7.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4B92 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     21826 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.92 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    99.63 
_refine.ls_R_factor_obs                          0.19377 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19077 
_refine.ls_R_factor_R_free                       0.25009 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1180 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.correlation_coeff_Fo_to_Fc_free          0.877 
_refine.B_iso_mean                               47.298 
_refine.aniso_B[1][1]                            -2.19 
_refine.aniso_B[2][2]                            -2.19 
_refine.aniso_B[3][3]                            4.37 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'PDB ENTRY 4B91' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.428 
_refine.overall_SU_ML                            0.306 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             16.594 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7300 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               7307 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        38.92 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.019  ? 7452  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 7166  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.459  1.952  ? 10102 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.014  3.000  ? 16490 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.414  5.000  ? 949   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.011 24.065 ? 310   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.949 15.000 ? 1267  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.570 15.000 ? 42    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 1167  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 8401  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.005  0.020  ? 1637  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 29976 0.10 0.05 'interatomic distance' 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 29976 0.10 0.05 'interatomic distance' 1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.900 
_refine_ls_shell.d_res_low                        2.975 
_refine_ls_shell.number_reflns_R_work             1547 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.percent_reflns_obs               99.88 
_refine_ls_shell.R_factor_R_free                  0.341 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             98 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 8 A 481 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 8 B 481 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4B92 
_struct.title                     'Crystal structure of truncated human CRMP-5 soaked with Zn' 
_struct.pdbx_descriptor           'DIHYDROPYRIMIDINASE-RELATED PROTEIN 5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4B92 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'SIGNALING PROTEIN, NEUROGENESIS, PHOSPHOPROTEIN, CRMP, TIM BARREL, AXONAL OUTGROWTH, DEVELOPMENTAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 82  ? GLY A 93  ? ASP A 81  GLY A 92  1 ? 12 
HELX_P HELX_P2  2  SER A 109 ? ASP A 122 ? SER A 108 ASP A 121 1 ? 14 
HELX_P HELX_P3  3  ALA A 139 ? LYS A 153 ? ALA A 138 LYS A 152 1 ? 15 
HELX_P HELX_P4  4  ARG A 171 ? GLY A 186 ? ARG A 170 GLY A 185 1 ? 16 
HELX_P HELX_P5  5  ASN A 195 ? LEU A 209 ? ASN A 194 LEU A 208 1 ? 15 
HELX_P HELX_P6  6  GLU A 215 ? SER A 220 ? GLU A 214 SER A 219 1 ? 6  
HELX_P HELX_P7  7  GLU A 223 ? HIS A 241 ? GLU A 222 HIS A 240 1 ? 19 
HELX_P HELX_P8  8  SER A 251 ? GLN A 264 ? SER A 250 GLN A 263 1 ? 14 
HELX_P HELX_P9  9  THR A 274 ? LEU A 279 ? THR A 273 LEU A 278 1 ? 6  
HELX_P HELX_P10 10 THR A 280 ? HIS A 286 ? THR A 279 HIS A 285 5 ? 7  
HELX_P HELX_P11 11 ASP A 288 ? TYR A 295 ? ASP A 287 TYR A 294 1 ? 8  
HELX_P HELX_P12 12 ASN A 306 ? ASP A 318 ? ASN A 305 ASP A 317 1 ? 13 
HELX_P HELX_P13 13 THR A 331 ? ALA A 336 ? THR A 330 ALA A 335 1 ? 6  
HELX_P HELX_P14 14 MET A 337 ? LYS A 339 ? MET A 336 LYS A 338 5 ? 3  
HELX_P HELX_P15 15 ASP A 341 ? ILE A 345 ? ASP A 340 ILE A 344 5 ? 5  
HELX_P HELX_P16 16 ASP A 354 ? VAL A 364 ? ASP A 353 VAL A 363 1 ? 11 
HELX_P HELX_P17 17 ASP A 370 ? SER A 379 ? ASP A 369 SER A 378 1 ? 10 
HELX_P HELX_P18 18 SER A 379 ? LEU A 386 ? SER A 378 LEU A 385 1 ? 8  
HELX_P HELX_P19 19 SER A 415 ? GLN A 419 ? SER A 414 GLN A 418 5 ? 5  
HELX_P HELX_P20 20 PRO A 469 ? LYS A 481 ? PRO A 468 LYS A 480 1 ? 13 
HELX_P HELX_P21 21 ASP B 82  ? GLY B 93  ? ASP B 81  GLY B 92  1 ? 12 
HELX_P HELX_P22 22 SER B 109 ? ASP B 122 ? SER B 108 ASP B 121 1 ? 14 
HELX_P HELX_P23 23 ALA B 139 ? LYS B 153 ? ALA B 138 LYS B 152 1 ? 15 
HELX_P HELX_P24 24 ARG B 171 ? GLY B 186 ? ARG B 170 GLY B 185 1 ? 16 
HELX_P HELX_P25 25 ASN B 195 ? LEU B 209 ? ASN B 194 LEU B 208 1 ? 15 
HELX_P HELX_P26 26 GLU B 215 ? SER B 220 ? GLU B 214 SER B 219 1 ? 6  
HELX_P HELX_P27 27 GLU B 223 ? HIS B 241 ? GLU B 222 HIS B 240 1 ? 19 
HELX_P HELX_P28 28 SER B 251 ? GLN B 264 ? SER B 250 GLN B 263 1 ? 14 
HELX_P HELX_P29 29 THR B 274 ? LEU B 279 ? THR B 273 LEU B 278 1 ? 6  
HELX_P HELX_P30 30 THR B 280 ? HIS B 286 ? THR B 279 HIS B 285 5 ? 7  
HELX_P HELX_P31 31 ASP B 288 ? TYR B 295 ? ASP B 287 TYR B 294 1 ? 8  
HELX_P HELX_P32 32 ASN B 306 ? ASP B 318 ? ASN B 305 ASP B 317 1 ? 13 
HELX_P HELX_P33 33 THR B 331 ? ALA B 336 ? THR B 330 ALA B 335 1 ? 6  
HELX_P HELX_P34 34 MET B 337 ? LYS B 339 ? MET B 336 LYS B 338 5 ? 3  
HELX_P HELX_P35 35 ASP B 341 ? ILE B 345 ? ASP B 340 ILE B 344 5 ? 5  
HELX_P HELX_P36 36 ASP B 354 ? VAL B 364 ? ASP B 353 VAL B 363 1 ? 11 
HELX_P HELX_P37 37 ASP B 370 ? SER B 379 ? ASP B 369 SER B 378 1 ? 10 
HELX_P HELX_P38 38 SER B 379 ? LEU B 386 ? SER B 378 LEU B 385 1 ? 8  
HELX_P HELX_P39 39 SER B 415 ? GLN B 419 ? SER B 414 GLN B 418 5 ? 5  
HELX_P HELX_P40 40 PRO B 469 ? LEU B 483 ? PRO B 468 LEU B 482 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 180 NE2 ? ? A ZN 1483 A HIS 179  1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc2 metalc ? ? C ZN . ZN ? ? ? 1_555 A ASP 184 OD2 ? ? A ZN 1483 A ASP 183  1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 G HOH .   O   ? ? A ZN 1483 A HOH 2001 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc4 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 291 NE2 ? ? A ZN 1484 A HIS 290  1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc5 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 283 ND1 ? ? A ZN 1484 A HIS 282  1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc6 metalc ? ? E ZN . ZN ? ? ? 1_555 B HIS 180 NE2 ? ? B ZN 1483 B HIS 179  1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc7 metalc ? ? E ZN . ZN ? ? ? 1_555 B ASP 184 OD2 ? ? B ZN 1483 B ASP 183  1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc8 metalc ? ? F ZN . ZN ? ? ? 1_555 B HIS 283 ND1 ? ? B ZN 1484 B HIS 282  1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc9 metalc ? ? F ZN . ZN ? ? ? 1_555 B HIS 291 NE2 ? ? B ZN 1484 B HIS 290  1_555 ? ? ? ? ? ? ? 2.153 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 298 A . ? VAL 297 A PRO 299 A ? PRO 298 A 1 -5.88 
2 TYR 389 A . ? TYR 388 A PRO 390 A ? PRO 389 A 1 1.46  
3 VAL 298 B . ? VAL 297 B PRO 299 B ? PRO 298 B 1 -7.52 
4 TYR 389 B . ? TYR 388 B PRO 390 B ? PRO 389 B 1 1.24  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 7 ? 
AC ? 8 ? 
AD ? 2 ? 
BA ? 4 ? 
BB ? 7 ? 
BC ? 8 ? 
BD ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
AC 6 7 ? parallel      
AC 7 8 ? parallel      
AD 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? parallel      
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BB 6 7 ? anti-parallel 
BC 1 2 ? parallel      
BC 2 3 ? parallel      
BC 3 4 ? parallel      
BC 4 5 ? parallel      
BC 5 6 ? parallel      
BC 6 7 ? parallel      
BC 7 8 ? parallel      
BD 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 35  ? GLY A 40  ? ILE A 34  GLY A 39  
AA 2 ASP A 28  ? GLU A 32  ? ASP A 27  GLU A 31  
AA 3 ARG A 10  ? LYS A 14  ? ARG A 9   LYS A 13  
AA 4 LYS A 50  ? ASP A 53  ? LYS A 49  ASP A 52  
AB 1 THR A 24  ? GLU A 26  ? THR A 23  GLU A 25  
AB 2 LYS A 17  ? VAL A 19  ? LYS A 16  VAL A 18  
AB 3 LEU A 58  ? PRO A 61  ? LEU A 57  PRO A 60  
AB 4 VAL A 403 ? THR A 413 ? VAL A 402 THR A 412 
AB 5 ARG A 432 ? SER A 442 ? ARG A 431 SER A 441 
AB 6 ARG A 445 ? GLU A 449 ? ARG A 444 GLU A 448 
AB 7 VAL A 452 ? PHE A 453 ? VAL A 451 PHE A 452 
AC 1 GLY A 63  ? THR A 68  ? GLY A 62  THR A 67  
AC 2 THR A 95  ? VAL A 102 ? THR A 94  VAL A 101 
AC 3 ASP A 128 ? GLY A 134 ? ASP A 127 GLY A 133 
AC 4 SER A 157 ? PHE A 161 ? SER A 156 PHE A 160 
AC 5 ILE A 188 ? HIS A 192 ? ILE A 187 HIS A 191 
AC 6 ILE A 244 ? LEU A 246 ? ILE A 243 LEU A 245 
AC 7 VAL A 268 ? THR A 273 ? VAL A 267 THR A 272 
AC 8 ILE A 322 ? ALA A 324 ? ILE A 321 ALA A 323 
AD 1 THR A 73  ? PHE A 74  ? THR A 72  PHE A 73  
AD 2 ALA A 77  ? THR A 78  ? ALA A 76  THR A 77  
BA 1 ILE B 35  ? GLY B 40  ? ILE B 34  GLY B 39  
BA 2 ASP B 28  ? GLU B 32  ? ASP B 27  GLU B 31  
BA 3 ARG B 10  ? LYS B 14  ? ARG B 9   LYS B 13  
BA 4 LYS B 50  ? ASP B 53  ? LYS B 49  ASP B 52  
BB 1 THR B 24  ? GLU B 26  ? THR B 23  GLU B 25  
BB 2 LYS B 17  ? VAL B 19  ? LYS B 16  VAL B 18  
BB 3 LEU B 58  ? PRO B 61  ? LEU B 57  PRO B 60  
BB 4 VAL B 403 ? ASP B 407 ? VAL B 402 ASP B 406 
BB 5 VAL B 436 ? SER B 442 ? VAL B 435 SER B 441 
BB 6 ARG B 445 ? GLU B 449 ? ARG B 444 GLU B 448 
BB 7 VAL B 452 ? PHE B 453 ? VAL B 451 PHE B 452 
BC 1 GLY B 63  ? THR B 68  ? GLY B 62  THR B 67  
BC 2 THR B 95  ? VAL B 102 ? THR B 94  VAL B 101 
BC 3 ASP B 128 ? GLY B 134 ? ASP B 127 GLY B 133 
BC 4 SER B 157 ? PHE B 161 ? SER B 156 PHE B 160 
BC 5 ILE B 188 ? HIS B 192 ? ILE B 187 HIS B 191 
BC 6 ILE B 244 ? LEU B 246 ? ILE B 243 LEU B 245 
BC 7 VAL B 268 ? THR B 273 ? VAL B 267 THR B 272 
BC 8 ILE B 322 ? ALA B 324 ? ILE B 321 ALA B 323 
BD 1 THR B 73  ? PHE B 74  ? THR B 72  PHE B 73  
BD 2 ALA B 77  ? THR B 78  ? ALA B 76  THR B 77  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 40  ? N GLY A 39  O ASP A 28  ? O ASP A 27  
AA 2 3 N ILE A 31  ? N ILE A 30  O ILE A 11  ? O ILE A 10  
AA 3 4 N LEU A 12  ? N LEU A 11  O LYS A 50  ? O LYS A 49  
AB 1 2 N HIS A 25  ? N HIS A 24  O VAL A 18  ? O VAL A 17  
AB 2 3 N VAL A 19  ? N VAL A 18  O VAL A 59  ? O VAL A 58  
AB 3 4 N ILE A 60  ? N ILE A 59  O VAL A 404 ? O VAL A 403 
AB 4 5 N LYS A 412 ? N LYS A 411 O CYS A 433 ? O CYS A 432 
AB 5 6 N SER A 442 ? N SER A 441 O ARG A 445 ? O ARG A 444 
AB 6 7 N GLU A 449 ? N GLU A 448 O VAL A 452 ? O VAL A 451 
AC 1 2 O GLY A 63  ? O GLY A 62  N THR A 96  ? N THR A 95  
AC 2 3 N ILE A 98  ? N ILE A 97  O ASP A 128 ? O ASP A 127 
AC 3 4 N VAL A 133 ? N VAL A 132 O SER A 157 ? O SER A 156 
AC 4 5 N PHE A 158 ? N PHE A 157 O ILE A 188 ? O ILE A 187 
AC 5 6 N VAL A 191 ? N VAL A 190 O TYR A 245 ? O TYR A 244 
AC 6 7 N LEU A 246 ? N LEU A 245 O LEU A 269 ? O LEU A 268 
AC 7 8 N THR A 272 ? N THR A 271 O ILE A 322 ? O ILE A 321 
AD 1 2 N PHE A 74  ? N PHE A 73  O ALA A 77  ? O ALA A 76  
BA 1 2 N GLY B 40  ? N GLY B 39  O ASP B 28  ? O ASP B 27  
BA 2 3 N ILE B 31  ? N ILE B 30  O ILE B 11  ? O ILE B 10  
BA 3 4 N LEU B 12  ? N LEU B 11  O LYS B 50  ? O LYS B 49  
BB 1 2 N HIS B 25  ? N HIS B 24  O VAL B 18  ? O VAL B 17  
BB 2 3 N VAL B 19  ? N VAL B 18  O VAL B 59  ? O VAL B 58  
BB 3 4 N ILE B 60  ? N ILE B 59  O VAL B 404 ? O VAL B 403 
BB 4 5 N ASP B 407 ? N ASP B 406 O VAL B 436 ? O VAL B 435 
BB 5 6 N SER B 442 ? N SER B 441 O ARG B 445 ? O ARG B 444 
BB 6 7 N GLU B 449 ? N GLU B 448 O VAL B 452 ? O VAL B 451 
BC 1 2 O GLY B 63  ? O GLY B 62  N THR B 96  ? N THR B 95  
BC 2 3 N ILE B 98  ? N ILE B 97  O ASP B 128 ? O ASP B 127 
BC 3 4 N VAL B 133 ? N VAL B 132 O SER B 157 ? O SER B 156 
BC 4 5 N PHE B 158 ? N PHE B 157 O ILE B 188 ? O ILE B 187 
BC 5 6 N VAL B 191 ? N VAL B 190 O TYR B 245 ? O TYR B 244 
BC 6 7 N LEU B 246 ? N LEU B 245 O LEU B 269 ? O LEU B 268 
BC 7 8 N THR B 272 ? N THR B 271 O ILE B 322 ? O ILE B 321 
BD 1 2 N PHE B 74  ? N PHE B 73  O ALA B 77  ? O ALA B 76  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN A 1483' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1484' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ZN B 1483' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1484' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 HIS A 180 ? HIS A 179  . ? 1_555 ? 
2  AC1 3 ASP A 184 ? ASP A 183  . ? 1_555 ? 
3  AC1 3 HOH G .   ? HOH A 2001 . ? 1_555 ? 
4  AC2 4 HIS A 283 ? HIS A 282  . ? 1_555 ? 
5  AC2 4 HIS A 286 ? HIS A 285  . ? 1_555 ? 
6  AC2 4 HIS A 291 ? HIS A 290  . ? 1_555 ? 
7  AC2 4 HOH G .   ? HOH A 2002 . ? 1_555 ? 
8  AC3 2 HIS B 180 ? HIS B 179  . ? 1_555 ? 
9  AC3 2 ASP B 184 ? ASP B 183  . ? 1_555 ? 
10 AC4 4 HIS B 283 ? HIS B 282  . ? 1_555 ? 
11 AC4 4 HIS B 286 ? HIS B 285  . ? 1_555 ? 
12 AC4 4 HIS B 291 ? HIS B 290  . ? 1_555 ? 
13 AC4 4 HOH H .   ? HOH B 2001 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4B92 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4B92 
_atom_sites.fract_transf_matrix[1][1]   0.011173 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011173 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004057 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 8   ? -23.135 20.225  41.085  1.00 97.75  ? 7    SER A N   1 
ATOM   2    C  CA  . SER A 1 8   ? -23.452 19.619  42.409  1.00 95.57  ? 7    SER A CA  1 
ATOM   3    C  C   . SER A 1 8   ? -24.147 18.247  42.273  1.00 93.54  ? 7    SER A C   1 
ATOM   4    O  O   . SER A 1 8   ? -25.381 18.203  42.191  1.00 91.98  ? 7    SER A O   1 
ATOM   5    C  CB  . SER A 1 8   ? -24.332 20.599  43.207  1.00 92.30  ? 7    SER A CB  1 
ATOM   6    O  OG  . SER A 1 8   ? -24.694 20.075  44.472  1.00 96.02  ? 7    SER A OG  1 
ATOM   7    N  N   . VAL A 1 9   ? -23.377 17.147  42.232  1.00 81.46  ? 8    VAL A N   1 
ATOM   8    C  CA  . VAL A 1 9   ? -23.980 15.805  42.431  1.00 74.11  ? 8    VAL A CA  1 
ATOM   9    C  C   . VAL A 1 9   ? -23.925 15.493  43.918  1.00 62.27  ? 8    VAL A C   1 
ATOM   10   O  O   . VAL A 1 9   ? -22.913 15.751  44.578  1.00 53.10  ? 8    VAL A O   1 
ATOM   11   C  CB  . VAL A 1 9   ? -23.296 14.637  41.682  1.00 72.58  ? 8    VAL A CB  1 
ATOM   12   C  CG1 . VAL A 1 9   ? -23.976 13.310  42.039  1.00 68.02  ? 8    VAL A CG1 1 
ATOM   13   C  CG2 . VAL A 1 9   ? -23.297 14.858  40.171  1.00 76.11  ? 8    VAL A CG2 1 
ATOM   14   N  N   . ARG A 1 10  ? -25.039 14.979  44.430  1.00 57.40  ? 9    ARG A N   1 
ATOM   15   C  CA  . ARG A 1 10  ? -25.196 14.671  45.837  1.00 54.22  ? 9    ARG A CA  1 
ATOM   16   C  C   . ARG A 1 10  ? -25.408 13.207  46.047  1.00 46.59  ? 9    ARG A C   1 
ATOM   17   O  O   . ARG A 1 10  ? -26.233 12.636  45.376  1.00 52.31  ? 9    ARG A O   1 
ATOM   18   C  CB  . ARG A 1 10  ? -26.414 15.382  46.365  1.00 57.60  ? 9    ARG A CB  1 
ATOM   19   C  CG  . ARG A 1 10  ? -26.205 16.851  46.560  1.00 65.70  ? 9    ARG A CG  1 
ATOM   20   C  CD  . ARG A 1 10  ? -27.467 17.325  47.279  1.00 78.33  ? 9    ARG A CD  1 
ATOM   21   N  NE  . ARG A 1 10  ? -27.668 18.765  47.260  1.00 84.89  ? 9    ARG A NE  1 
ATOM   22   C  CZ  . ARG A 1 10  ? -27.859 19.487  46.162  1.00 86.24  ? 9    ARG A CZ  1 
ATOM   23   N  NH1 . ARG A 1 10  ? -27.879 18.916  44.956  1.00 88.89  ? 9    ARG A NH1 1 
ATOM   24   N  NH2 . ARG A 1 10  ? -28.026 20.799  46.275  1.00 87.95  ? 9    ARG A NH2 1 
ATOM   25   N  N   . ILE A 1 11  ? -24.686 12.586  46.965  1.00 39.99  ? 10   ILE A N   1 
ATOM   26   C  CA  . ILE A 1 11  ? -24.925 11.172  47.263  1.00 39.11  ? 10   ILE A CA  1 
ATOM   27   C  C   . ILE A 1 11  ? -24.979 10.917  48.754  1.00 36.79  ? 10   ILE A C   1 
ATOM   28   O  O   . ILE A 1 11  ? -24.144 11.396  49.510  1.00 37.20  ? 10   ILE A O   1 
ATOM   29   C  CB  . ILE A 1 11  ? -23.848 10.253  46.638  1.00 39.08  ? 10   ILE A CB  1 
ATOM   30   C  CG1 . ILE A 1 11  ? -23.527 10.701  45.220  1.00 39.76  ? 10   ILE A CG1 1 
ATOM   31   C  CG2 . ILE A 1 11  ? -24.337 8.812   46.584  1.00 38.79  ? 10   ILE A CG2 1 
ATOM   32   C  CD1 . ILE A 1 11  ? -22.383 9.960   44.562  1.00 43.09  ? 10   ILE A CD1 1 
ATOM   33   N  N   . LEU A 1 12  ? -25.956 10.126  49.159  1.00 36.11  ? 11   LEU A N   1 
ATOM   34   C  CA  . LEU A 1 12  ? -25.999 9.625   50.517  1.00 37.62  ? 11   LEU A CA  1 
ATOM   35   C  C   . LEU A 1 12  ? -25.964 8.091   50.568  1.00 37.52  ? 11   LEU A C   1 
ATOM   36   O  O   . LEU A 1 12  ? -26.812 7.401   49.987  1.00 35.41  ? 11   LEU A O   1 
ATOM   37   C  CB  . LEU A 1 12  ? -27.233 10.134  51.247  1.00 37.75  ? 11   LEU A CB  1 
ATOM   38   C  CG  . LEU A 1 12  ? -27.386 9.587   52.681  1.00 35.38  ? 11   LEU A CG  1 
ATOM   39   C  CD1 . LEU A 1 12  ? -26.589 10.454  53.649  1.00 36.06  ? 11   LEU A CD1 1 
ATOM   40   C  CD2 . LEU A 1 12  ? -28.853 9.517   53.059  1.00 35.55  ? 11   LEU A CD2 1 
ATOM   41   N  N   . ILE A 1 13  ? -24.976 7.586   51.312  1.00 40.05  ? 12   ILE A N   1 
ATOM   42   C  CA  . ILE A 1 13  ? -24.784 6.146   51.555  1.00 38.17  ? 12   ILE A CA  1 
ATOM   43   C  C   . ILE A 1 13  ? -25.319 5.865   52.954  1.00 38.66  ? 12   ILE A C   1 
ATOM   44   O  O   . ILE A 1 13  ? -24.658 6.123   53.969  1.00 38.45  ? 12   ILE A O   1 
ATOM   45   C  CB  . ILE A 1 13  ? -23.301 5.709   51.394  1.00 35.15  ? 12   ILE A CB  1 
ATOM   46   C  CG1 . ILE A 1 13  ? -22.787 6.111   50.011  1.00 36.77  ? 12   ILE A CG1 1 
ATOM   47   C  CG2 . ILE A 1 13  ? -23.161 4.213   51.535  1.00 33.27  ? 12   ILE A CG2 1 
ATOM   48   C  CD1 . ILE A 1 13  ? -21.292 6.000   49.873  1.00 41.47  ? 12   ILE A CD1 1 
ATOM   49   N  N   . LYS A 1 14  ? -26.539 5.349   52.969  1.00 38.60  ? 13   LYS A N   1 
ATOM   50   C  CA  . LYS A 1 14  ? -27.314 5.159   54.172  1.00 41.19  ? 13   LYS A CA  1 
ATOM   51   C  C   . LYS A 1 14  ? -27.122 3.743   54.710  1.00 41.05  ? 13   LYS A C   1 
ATOM   52   O  O   . LYS A 1 14  ? -27.093 2.762   53.960  1.00 40.85  ? 13   LYS A O   1 
ATOM   53   C  CB  . LYS A 1 14  ? -28.796 5.415   53.859  1.00 48.38  ? 13   LYS A CB  1 
ATOM   54   C  CG  . LYS A 1 14  ? -29.734 5.369   55.053  1.00 60.62  ? 13   LYS A CG  1 
ATOM   55   C  CD  . LYS A 1 14  ? -31.064 6.101   54.794  1.00 70.42  ? 13   LYS A CD  1 
ATOM   56   C  CE  . LYS A 1 14  ? -31.933 6.412   56.037  1.00 76.26  ? 13   LYS A CE  1 
ATOM   57   N  NZ  . LYS A 1 14  ? -31.679 7.696   56.801  1.00 72.70  ? 13   LYS A NZ  1 
ATOM   58   N  N   . GLY A 1 15  ? -26.939 3.645   56.023  1.00 42.18  ? 14   GLY A N   1 
ATOM   59   C  CA  . GLY A 1 15  ? -26.993 2.366   56.723  1.00 39.17  ? 14   GLY A CA  1 
ATOM   60   C  C   . GLY A 1 15  ? -25.824 1.419   56.567  1.00 39.15  ? 14   GLY A C   1 
ATOM   61   O  O   . GLY A 1 15  ? -25.932 0.230   56.862  1.00 40.68  ? 14   GLY A O   1 
ATOM   62   N  N   . GLY A 1 16  ? -24.685 1.940   56.154  1.00 42.95  ? 15   GLY A N   1 
ATOM   63   C  CA  . GLY A 1 16  ? -23.472 1.115   56.086  1.00 40.66  ? 15   GLY A CA  1 
ATOM   64   C  C   . GLY A 1 16  ? -22.646 1.090   57.361  1.00 34.77  ? 15   GLY A C   1 
ATOM   65   O  O   . GLY A 1 16  ? -22.909 1.815   58.312  1.00 29.19  ? 15   GLY A O   1 
ATOM   66   N  N   . LYS A 1 17  ? -21.653 0.221   57.361  1.00 34.57  ? 16   LYS A N   1 
ATOM   67   C  CA  . LYS A 1 17  ? -20.585 0.245   58.349  1.00 38.79  ? 16   LYS A CA  1 
ATOM   68   C  C   . LYS A 1 17  ? -19.347 0.800   57.641  1.00 36.84  ? 16   LYS A C   1 
ATOM   69   O  O   . LYS A 1 17  ? -18.818 0.187   56.739  1.00 37.27  ? 16   LYS A O   1 
ATOM   70   C  CB  . LYS A 1 17  ? -20.306 -1.156  58.912  1.00 43.37  ? 16   LYS A CB  1 
ATOM   71   C  CG  . LYS A 1 17  ? -21.182 -1.612  60.083  1.00 47.40  ? 16   LYS A CG  1 
ATOM   72   C  CD  . LYS A 1 17  ? -20.988 -3.122  60.323  1.00 55.62  ? 16   LYS A CD  1 
ATOM   73   C  CE  . LYS A 1 17  ? -21.899 -3.736  61.417  1.00 60.13  ? 16   LYS A CE  1 
ATOM   74   N  NZ  . LYS A 1 17  ? -21.195 -4.038  62.707  1.00 62.94  ? 16   LYS A NZ  1 
ATOM   75   N  N   . VAL A 1 18  ? -18.889 1.971   58.043  1.00 36.14  ? 17   VAL A N   1 
ATOM   76   C  CA  . VAL A 1 18  ? -17.697 2.543   57.462  1.00 35.54  ? 17   VAL A CA  1 
ATOM   77   C  C   . VAL A 1 18  ? -16.489 1.776   57.987  1.00 36.32  ? 17   VAL A C   1 
ATOM   78   O  O   . VAL A 1 18  ? -16.257 1.716   59.181  1.00 38.24  ? 17   VAL A O   1 
ATOM   79   C  CB  . VAL A 1 18  ? -17.559 4.047   57.765  1.00 34.06  ? 17   VAL A CB  1 
ATOM   80   C  CG1 . VAL A 1 18  ? -16.172 4.547   57.477  1.00 34.50  ? 17   VAL A CG1 1 
ATOM   81   C  CG2 . VAL A 1 18  ? -18.532 4.827   56.920  1.00 35.61  ? 17   VAL A CG2 1 
ATOM   82   N  N   . VAL A 1 19  ? -15.712 1.218   57.064  1.00 33.93  ? 18   VAL A N   1 
ATOM   83   C  CA  . VAL A 1 19  ? -14.472 0.574   57.399  1.00 33.53  ? 18   VAL A CA  1 
ATOM   84   C  C   . VAL A 1 19  ? -13.272 1.375   56.906  1.00 32.43  ? 18   VAL A C   1 
ATOM   85   O  O   . VAL A 1 19  ? -13.149 1.643   55.740  1.00 31.63  ? 18   VAL A O   1 
ATOM   86   C  CB  . VAL A 1 19  ? -14.394 -0.791  56.759  1.00 35.15  ? 18   VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 19  ? -13.221 -1.564  57.328  1.00 37.48  ? 18   VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 19  ? -15.670 -1.550  57.015  1.00 36.44  ? 18   VAL A CG2 1 
ATOM   89   N  N   . ASN A 1 20  ? -12.404 1.741   57.832  1.00 32.55  ? 19   ASN A N   1 
ATOM   90   C  CA  . ASN A 1 20  ? -11.165 2.420   57.540  1.00 34.74  ? 19   ASN A CA  1 
ATOM   91   C  C   . ASN A 1 20  ? -10.096 1.510   58.091  1.00 35.94  ? 19   ASN A C   1 
ATOM   92   O  O   . ASN A 1 20  ? -10.439 0.461   58.605  1.00 39.90  ? 19   ASN A O   1 
ATOM   93   C  CB  . ASN A 1 20  ? -11.115 3.763   58.240  1.00 33.64  ? 19   ASN A CB  1 
ATOM   94   C  CG  . ASN A 1 20  ? -11.798 4.837   57.460  1.00 31.31  ? 19   ASN A CG  1 
ATOM   95   O  OD1 . ASN A 1 20  ? -11.926 4.728   56.267  1.00 30.44  ? 19   ASN A OD1 1 
ATOM   96   N  ND2 . ASN A 1 20  ? -12.213 5.888   58.122  1.00 31.40  ? 19   ASN A ND2 1 
ATOM   97   N  N   . ASP A 1 21  ? -8.822  1.818   57.904  1.00 37.51  ? 20   ASP A N   1 
ATOM   98   C  CA  . ASP A 1 21  ? -7.804  0.868   58.371  1.00 41.81  ? 20   ASP A CA  1 
ATOM   99   C  C   . ASP A 1 21  ? -7.639  0.836   59.886  1.00 39.71  ? 20   ASP A C   1 
ATOM   100  O  O   . ASP A 1 21  ? -7.180  -0.157  60.405  1.00 35.10  ? 20   ASP A O   1 
ATOM   101  C  CB  . ASP A 1 21  ? -6.446  1.044   57.680  1.00 44.94  ? 20   ASP A CB  1 
ATOM   102  C  CG  . ASP A 1 21  ? -5.819  2.418   57.891  1.00 48.81  ? 20   ASP A CG  1 
ATOM   103  O  OD1 . ASP A 1 21  ? -6.447  3.367   58.418  1.00 53.10  ? 20   ASP A OD1 1 
ATOM   104  O  OD2 . ASP A 1 21  ? -4.651  2.556   57.489  1.00 50.06  ? 20   ASP A OD2 1 
ATOM   105  N  N   . ASP A 1 22  ? -8.025  1.908   60.574  1.00 42.62  ? 21   ASP A N   1 
ATOM   106  C  CA  . ASP A 1 22  ? -7.948  1.942   62.042  1.00 45.32  ? 21   ASP A CA  1 
ATOM   107  C  C   . ASP A 1 22  ? -9.161  1.283   62.711  1.00 44.01  ? 21   ASP A C   1 
ATOM   108  O  O   . ASP A 1 22  ? -8.984  0.548   63.684  1.00 40.42  ? 21   ASP A O   1 
ATOM   109  C  CB  . ASP A 1 22  ? -7.784  3.364   62.551  1.00 44.12  ? 21   ASP A CB  1 
ATOM   110  C  CG  . ASP A 1 22  ? -8.879  4.229   62.097  1.00 45.13  ? 21   ASP A CG  1 
ATOM   111  O  OD1 . ASP A 1 22  ? -9.178  4.171   60.896  1.00 43.80  ? 21   ASP A OD1 1 
ATOM   112  O  OD2 . ASP A 1 22  ? -9.487  4.935   62.925  1.00 53.73  ? 21   ASP A OD2 1 
ATOM   113  N  N   . CYS A 1 23  ? -10.371 1.510   62.196  1.00 44.10  ? 22   CYS A N   1 
ATOM   114  C  CA  . CYS A 1 23  ? -11.573 0.897   62.804  1.00 46.75  ? 22   CYS A CA  1 
ATOM   115  C  C   . CYS A 1 23  ? -12.809 0.838   61.887  1.00 42.75  ? 22   CYS A C   1 
ATOM   116  O  O   . CYS A 1 23  ? -12.865 1.452   60.825  1.00 38.61  ? 22   CYS A O   1 
ATOM   117  C  CB  . CYS A 1 23  ? -11.938 1.575   64.155  1.00 53.48  ? 22   CYS A CB  1 
ATOM   118  S  SG  . CYS A 1 23  ? -12.872 3.123   64.111  1.00 65.49  ? 22   CYS A SG  1 
ATOM   119  N  N   . THR A 1 24  ? -13.809 0.098   62.355  1.00 41.14  ? 23   THR A N   1 
ATOM   120  C  CA  . THR A 1 24  ? -15.073 -0.058  61.665  1.00 38.47  ? 23   THR A CA  1 
ATOM   121  C  C   . THR A 1 24  ? -16.207 0.475   62.524  1.00 39.20  ? 23   THR A C   1 
ATOM   122  O  O   . THR A 1 24  ? -16.376 0.047   63.647  1.00 39.58  ? 23   THR A O   1 
ATOM   123  C  CB  . THR A 1 24  ? -15.345 -1.532  61.373  1.00 36.77  ? 23   THR A CB  1 
ATOM   124  O  OG1 . THR A 1 24  ? -14.306 -2.047  60.543  1.00 35.71  ? 23   THR A OG1 1 
ATOM   125  C  CG2 . THR A 1 24  ? -16.696 -1.711  60.674  1.00 36.86  ? 23   THR A CG2 1 
ATOM   126  N  N   . HIS A 1 25  ? -16.989 1.410   61.989  1.00 42.52  ? 24   HIS A N   1 
ATOM   127  C  CA  . HIS A 1 25  ? -18.082 1.998   62.731  1.00 44.07  ? 24   HIS A CA  1 
ATOM   128  C  C   . HIS A 1 25  ? -19.313 2.274   61.862  1.00 43.97  ? 24   HIS A C   1 
ATOM   129  O  O   . HIS A 1 25  ? -19.204 2.535   60.668  1.00 41.07  ? 24   HIS A O   1 
ATOM   130  C  CB  . HIS A 1 25  ? -17.619 3.247   63.502  1.00 45.14  ? 24   HIS A CB  1 
ATOM   131  C  CG  . HIS A 1 25  ? -17.493 4.482   62.669  1.00 52.32  ? 24   HIS A CG  1 
ATOM   132  N  ND1 . HIS A 1 25  ? -16.453 4.680   61.777  1.00 58.82  ? 24   HIS A ND1 1 
ATOM   133  C  CD2 . HIS A 1 25  ? -18.250 5.612   62.624  1.00 54.34  ? 24   HIS A CD2 1 
ATOM   134  C  CE1 . HIS A 1 25  ? -16.582 5.871   61.204  1.00 54.98  ? 24   HIS A CE1 1 
ATOM   135  N  NE2 . HIS A 1 25  ? -17.665 6.454   61.700  1.00 55.45  ? 24   HIS A NE2 1 
ATOM   136  N  N   . GLU A 1 26  ? -20.485 2.166   62.492  1.00 42.35  ? 25   GLU A N   1 
ATOM   137  C  CA  . GLU A 1 26  ? -21.732 2.348   61.813  1.00 41.41  ? 25   GLU A CA  1 
ATOM   138  C  C   . GLU A 1 26  ? -21.956 3.824   61.582  1.00 39.69  ? 25   GLU A C   1 
ATOM   139  O  O   . GLU A 1 26  ? -22.075 4.606   62.526  1.00 39.32  ? 25   GLU A O   1 
ATOM   140  C  CB  . GLU A 1 26  ? -22.854 1.710   62.589  1.00 47.68  ? 25   GLU A CB  1 
ATOM   141  C  CG  . GLU A 1 26  ? -24.001 1.179   61.738  1.00 50.50  ? 25   GLU A CG  1 
ATOM   142  C  CD  . GLU A 1 26  ? -25.176 0.705   62.582  1.00 53.24  ? 25   GLU A CD  1 
ATOM   143  O  OE1 . GLU A 1 26  ? -25.077 -0.386  63.209  1.00 44.14  ? 25   GLU A OE1 1 
ATOM   144  O  OE2 . GLU A 1 26  ? -26.194 1.443   62.606  1.00 57.77  ? 25   GLU A OE2 1 
ATOM   145  N  N   . ALA A 1 27  ? -21.935 4.205   60.304  1.00 40.36  ? 26   ALA A N   1 
ATOM   146  C  CA  . ALA A 1 27  ? -22.081 5.601   59.893  1.00 39.91  ? 26   ALA A CA  1 
ATOM   147  C  C   . ALA A 1 27  ? -22.586 5.766   58.470  1.00 38.48  ? 26   ALA A C   1 
ATOM   148  O  O   . ALA A 1 27  ? -22.405 4.885   57.589  1.00 41.01  ? 26   ALA A O   1 
ATOM   149  C  CB  . ALA A 1 27  ? -20.768 6.344   60.049  1.00 41.64  ? 26   ALA A CB  1 
ATOM   150  N  N   . ASP A 1 28  ? -23.251 6.897   58.259  1.00 36.13  ? 27   ASP A N   1 
ATOM   151  C  CA  . ASP A 1 28  ? -23.666 7.295   56.932  1.00 37.33  ? 27   ASP A CA  1 
ATOM   152  C  C   . ASP A 1 28  ? -22.600 8.184   56.318  1.00 34.68  ? 27   ASP A C   1 
ATOM   153  O  O   . ASP A 1 28  ? -21.767 8.741   57.005  1.00 31.20  ? 27   ASP A O   1 
ATOM   154  C  CB  . ASP A 1 28  ? -25.003 8.040   56.958  1.00 38.32  ? 27   ASP A CB  1 
ATOM   155  C  CG  . ASP A 1 28  ? -26.170 7.175   57.442  1.00 37.82  ? 27   ASP A CG  1 
ATOM   156  O  OD1 . ASP A 1 28  ? -26.061 5.926   57.521  1.00 37.00  ? 27   ASP A OD1 1 
ATOM   157  O  OD2 . ASP A 1 28  ? -27.220 7.788   57.748  1.00 39.02  ? 27   ASP A OD2 1 
ATOM   158  N  N   . VAL A 1 29  ? -22.597 8.249   54.995  1.00 35.96  ? 28   VAL A N   1 
ATOM   159  C  CA  . VAL A 1 29  ? -21.669 9.118   54.289  1.00 35.45  ? 28   VAL A CA  1 
ATOM   160  C  C   . VAL A 1 29  ? -22.447 9.989   53.336  1.00 35.21  ? 28   VAL A C   1 
ATOM   161  O  O   . VAL A 1 29  ? -23.255 9.510   52.542  1.00 32.61  ? 28   VAL A O   1 
ATOM   162  C  CB  . VAL A 1 29  ? -20.609 8.326   53.499  1.00 34.09  ? 28   VAL A CB  1 
ATOM   163  C  CG1 . VAL A 1 29  ? -19.765 9.278   52.672  1.00 33.77  ? 28   VAL A CG1 1 
ATOM   164  C  CG2 . VAL A 1 29  ? -19.739 7.502   54.447  1.00 33.57  ? 28   VAL A CG2 1 
ATOM   165  N  N   . TYR A 1 30  ? -22.204 11.281  53.433  1.00 37.89  ? 29   TYR A N   1 
ATOM   166  C  CA  . TYR A 1 30  ? -22.815 12.213  52.523  1.00 39.89  ? 29   TYR A CA  1 
ATOM   167  C  C   . TYR A 1 30  ? -21.725 12.841  51.669  1.00 37.66  ? 29   TYR A C   1 
ATOM   168  O  O   . TYR A 1 30  ? -20.760 13.404  52.173  1.00 34.73  ? 29   TYR A O   1 
ATOM   169  C  CB  . TYR A 1 30  ? -23.580 13.279  53.287  1.00 41.69  ? 29   TYR A CB  1 
ATOM   170  C  CG  . TYR A 1 30  ? -24.063 14.392  52.406  1.00 45.74  ? 29   TYR A CG  1 
ATOM   171  C  CD1 . TYR A 1 30  ? -24.977 14.159  51.376  1.00 49.66  ? 29   TYR A CD1 1 
ATOM   172  C  CD2 . TYR A 1 30  ? -23.606 15.686  52.591  1.00 51.78  ? 29   TYR A CD2 1 
ATOM   173  C  CE1 . TYR A 1 30  ? -25.426 15.196  50.546  1.00 53.36  ? 29   TYR A CE1 1 
ATOM   174  C  CE2 . TYR A 1 30  ? -24.042 16.731  51.772  1.00 55.94  ? 29   TYR A CE2 1 
ATOM   175  C  CZ  . TYR A 1 30  ? -24.955 16.481  50.749  1.00 55.80  ? 29   TYR A CZ  1 
ATOM   176  O  OH  . TYR A 1 30  ? -25.377 17.517  49.945  1.00 51.57  ? 29   TYR A OH  1 
ATOM   177  N  N   . ILE A 1 31  ? -21.926 12.757  50.371  1.00 39.49  ? 30   ILE A N   1 
ATOM   178  C  CA  . ILE A 1 31  ? -20.972 13.222  49.398  1.00 44.83  ? 30   ILE A CA  1 
ATOM   179  C  C   . ILE A 1 31  ? -21.602 14.340  48.567  1.00 46.07  ? 30   ILE A C   1 
ATOM   180  O  O   . ILE A 1 31  ? -22.738 14.228  48.115  1.00 43.30  ? 30   ILE A O   1 
ATOM   181  C  CB  . ILE A 1 31  ? -20.563 12.065  48.447  1.00 47.40  ? 30   ILE A CB  1 
ATOM   182  C  CG1 . ILE A 1 31  ? -19.901 10.931  49.220  1.00 49.32  ? 30   ILE A CG1 1 
ATOM   183  C  CG2 . ILE A 1 31  ? -19.602 12.553  47.382  1.00 50.07  ? 30   ILE A CG2 1 
ATOM   184  C  CD1 . ILE A 1 31  ? -20.033 9.590   48.534  1.00 52.55  ? 30   ILE A CD1 1 
ATOM   185  N  N   . GLU A 1 32  ? -20.829 15.396  48.328  1.00 51.35  ? 31   GLU A N   1 
ATOM   186  C  CA  . GLU A 1 32  ? -21.220 16.458  47.414  1.00 53.93  ? 31   GLU A CA  1 
ATOM   187  C  C   . GLU A 1 32  ? -19.997 16.998  46.715  1.00 51.01  ? 31   GLU A C   1 
ATOM   188  O  O   . GLU A 1 32  ? -18.999 17.285  47.361  1.00 51.50  ? 31   GLU A O   1 
ATOM   189  C  CB  . GLU A 1 32  ? -21.940 17.571  48.165  1.00 60.46  ? 31   GLU A CB  1 
ATOM   190  C  CG  . GLU A 1 32  ? -22.851 18.399  47.266  1.00 65.65  ? 31   GLU A CG  1 
ATOM   191  C  CD  . GLU A 1 32  ? -23.598 19.506  47.974  1.00 71.48  ? 31   GLU A CD  1 
ATOM   192  O  OE1 . GLU A 1 32  ? -23.615 19.564  49.226  1.00 68.52  ? 31   GLU A OE1 1 
ATOM   193  O  OE2 . GLU A 1 32  ? -24.202 20.320  47.237  1.00 78.56  ? 31   GLU A OE2 1 
ATOM   194  N  N   . ASN A 1 33  ? -20.070 17.128  45.392  1.00 52.43  ? 32   ASN A N   1 
ATOM   195  C  CA  . ASN A 1 33  ? -18.996 17.759  44.594  1.00 51.40  ? 32   ASN A CA  1 
ATOM   196  C  C   . ASN A 1 33  ? -17.663 17.059  44.699  1.00 48.36  ? 32   ASN A C   1 
ATOM   197  O  O   . ASN A 1 33  ? -16.621 17.699  44.859  1.00 50.66  ? 32   ASN A O   1 
ATOM   198  C  CB  . ASN A 1 33  ? -18.803 19.233  44.974  1.00 53.96  ? 32   ASN A CB  1 
ATOM   199  C  CG  . ASN A 1 33  ? -19.977 20.093  44.569  1.00 60.22  ? 32   ASN A CG  1 
ATOM   200  O  OD1 . ASN A 1 33  ? -20.572 19.928  43.493  1.00 60.86  ? 32   ASN A OD1 1 
ATOM   201  N  ND2 . ASN A 1 33  ? -20.315 21.031  45.438  1.00 67.39  ? 32   ASN A ND2 1 
ATOM   202  N  N   . GLY A 1 34  ? -17.689 15.741  44.605  1.00 44.44  ? 33   GLY A N   1 
ATOM   203  C  CA  . GLY A 1 34  ? -16.442 14.957  44.572  1.00 41.84  ? 33   GLY A CA  1 
ATOM   204  C  C   . GLY A 1 34  ? -15.775 14.778  45.926  1.00 40.02  ? 33   GLY A C   1 
ATOM   205  O  O   . GLY A 1 34  ? -14.834 14.003  46.032  1.00 41.52  ? 33   GLY A O   1 
ATOM   206  N  N   . ILE A 1 35  ? -16.312 15.426  46.957  1.00 34.89  ? 34   ILE A N   1 
ATOM   207  C  CA  . ILE A 1 35  ? -15.752 15.408  48.278  1.00 35.87  ? 34   ILE A CA  1 
ATOM   208  C  C   . ILE A 1 35  ? -16.715 14.790  49.282  1.00 40.08  ? 34   ILE A C   1 
ATOM   209  O  O   . ILE A 1 35  ? -17.925 15.037  49.224  1.00 44.12  ? 34   ILE A O   1 
ATOM   210  C  CB  . ILE A 1 35  ? -15.481 16.851  48.734  1.00 36.82  ? 34   ILE A CB  1 
ATOM   211  C  CG1 . ILE A 1 35  ? -14.342 17.451  47.916  1.00 39.94  ? 34   ILE A CG1 1 
ATOM   212  C  CG2 . ILE A 1 35  ? -15.167 16.941  50.217  1.00 34.93  ? 34   ILE A CG2 1 
ATOM   213  C  CD1 . ILE A 1 35  ? -13.096 16.579  47.838  1.00 43.30  ? 34   ILE A CD1 1 
ATOM   214  N  N   . ILE A 1 36  ? -16.175 14.006  50.222  1.00 39.37  ? 35   ILE A N   1 
ATOM   215  C  CA  . ILE A 1 36  ? -16.930 13.547  51.395  1.00 34.45  ? 35   ILE A CA  1 
ATOM   216  C  C   . ILE A 1 36  ? -17.204 14.709  52.342  1.00 34.46  ? 35   ILE A C   1 
ATOM   217  O  O   . ILE A 1 36  ? -16.279 15.304  52.905  1.00 30.27  ? 35   ILE A O   1 
ATOM   218  C  CB  . ILE A 1 36  ? -16.194 12.419  52.140  1.00 33.95  ? 35   ILE A CB  1 
ATOM   219  C  CG1 . ILE A 1 36  ? -16.090 11.166  51.246  1.00 33.89  ? 35   ILE A CG1 1 
ATOM   220  C  CG2 . ILE A 1 36  ? -16.925 12.063  53.424  1.00 35.35  ? 35   ILE A CG2 1 
ATOM   221  C  CD1 . ILE A 1 36  ? -15.650 9.922   51.983  1.00 33.01  ? 35   ILE A CD1 1 
ATOM   222  N  N   . GLN A 1 37  ? -18.493 15.033  52.502  1.00 38.66  ? 36   GLN A N   1 
ATOM   223  C  CA  . GLN A 1 37  ? -18.939 16.229  53.259  1.00 38.87  ? 36   GLN A CA  1 
ATOM   224  C  C   . GLN A 1 37  ? -19.139 15.878  54.698  1.00 38.16  ? 36   GLN A C   1 
ATOM   225  O  O   . GLN A 1 37  ? -18.680 16.603  55.576  1.00 39.38  ? 36   GLN A O   1 
ATOM   226  C  CB  . GLN A 1 37  ? -20.261 16.799  52.713  1.00 38.91  ? 36   GLN A CB  1 
ATOM   227  C  CG  . GLN A 1 37  ? -20.190 17.443  51.324  1.00 41.88  ? 36   GLN A CG  1 
ATOM   228  C  CD  . GLN A 1 37  ? -19.298 18.669  51.287  1.00 42.42  ? 36   GLN A CD  1 
ATOM   229  O  OE1 . GLN A 1 37  ? -19.400 19.514  52.148  1.00 48.68  ? 36   GLN A OE1 1 
ATOM   230  N  NE2 . GLN A 1 37  ? -18.410 18.757  50.299  1.00 39.85  ? 36   GLN A NE2 1 
ATOM   231  N  N   . GLN A 1 38  ? -19.871 14.798  54.946  1.00 38.67  ? 37   GLN A N   1 
ATOM   232  C  CA  . GLN A 1 38  ? -20.157 14.364  56.331  1.00 41.85  ? 37   GLN A CA  1 
ATOM   233  C  C   . GLN A 1 38  ? -20.082 12.872  56.533  1.00 37.75  ? 37   GLN A C   1 
ATOM   234  O  O   . GLN A 1 38  ? -20.441 12.103  55.634  1.00 36.60  ? 37   GLN A O   1 
ATOM   235  C  CB  . GLN A 1 38  ? -21.547 14.819  56.785  1.00 44.79  ? 37   GLN A CB  1 
ATOM   236  C  CG  . GLN A 1 38  ? -21.678 16.280  57.172  1.00 43.13  ? 37   GLN A CG  1 
ATOM   237  C  CD  . GLN A 1 38  ? -23.113 16.658  57.497  1.00 45.07  ? 37   GLN A CD  1 
ATOM   238  O  OE1 . GLN A 1 38  ? -23.908 15.844  57.971  1.00 44.95  ? 37   GLN A OE1 1 
ATOM   239  N  NE2 . GLN A 1 38  ? -23.454 17.899  57.225  1.00 45.89  ? 37   GLN A NE2 1 
ATOM   240  N  N   . VAL A 1 39  ? -19.585 12.486  57.708  1.00 39.01  ? 38   VAL A N   1 
ATOM   241  C  CA  . VAL A 1 39  ? -19.602 11.088  58.170  1.00 41.71  ? 38   VAL A CA  1 
ATOM   242  C  C   . VAL A 1 39  ? -20.127 10.990  59.597  1.00 42.55  ? 38   VAL A C   1 
ATOM   243  O  O   . VAL A 1 39  ? -19.444 11.398  60.544  1.00 44.31  ? 38   VAL A O   1 
ATOM   244  C  CB  . VAL A 1 39  ? -18.223 10.406  58.098  1.00 39.87  ? 38   VAL A CB  1 
ATOM   245  C  CG1 . VAL A 1 39  ? -18.374 8.945   58.487  1.00 39.91  ? 38   VAL A CG1 1 
ATOM   246  C  CG2 . VAL A 1 39  ? -17.633 10.508  56.690  1.00 39.20  ? 38   VAL A CG2 1 
ATOM   247  N  N   . GLY A 1 40  ? -21.343 10.461  59.728  1.00 44.05  ? 39   GLY A N   1 
ATOM   248  C  CA  . GLY A 1 40  ? -22.066 10.419  61.002  1.00 48.23  ? 39   GLY A CA  1 
ATOM   249  C  C   . GLY A 1 40  ? -23.141 9.346   61.064  1.00 45.94  ? 39   GLY A C   1 
ATOM   250  O  O   . GLY A 1 40  ? -23.592 8.883   60.047  1.00 42.30  ? 39   GLY A O   1 
ATOM   251  N  N   . ARG A 1 41  ? -23.576 8.998   62.271  1.00 55.27  ? 40   ARG A N   1 
ATOM   252  C  CA  . ARG A 1 41  ? -24.545 7.901   62.475  1.00 62.88  ? 40   ARG A CA  1 
ATOM   253  C  C   . ARG A 1 41  ? -25.939 8.216   61.929  1.00 60.65  ? 40   ARG A C   1 
ATOM   254  O  O   . ARG A 1 41  ? -26.581 7.350   61.338  1.00 55.91  ? 40   ARG A O   1 
ATOM   255  C  CB  . ARG A 1 41  ? -24.650 7.522   63.941  1.00 67.14  ? 40   ARG A CB  1 
ATOM   256  C  CG  . ARG A 1 41  ? -23.316 7.319   64.652  1.00 79.49  ? 40   ARG A CG  1 
ATOM   257  C  CD  . ARG A 1 41  ? -23.553 6.916   66.121  1.00 83.67  ? 40   ARG A CD  1 
ATOM   258  N  NE  . ARG A 1 41  ? -24.652 5.928   66.300  1.00 85.52  ? 40   ARG A NE  1 
ATOM   259  C  CZ  . ARG A 1 41  ? -24.504 4.599   66.451  1.00 81.23  ? 40   ARG A CZ  1 
ATOM   260  N  NH1 . ARG A 1 41  ? -23.302 4.034   66.474  1.00 81.66  ? 40   ARG A NH1 1 
ATOM   261  N  NH2 . ARG A 1 41  ? -25.576 3.813   66.587  1.00 76.53  ? 40   ARG A NH2 1 
ATOM   262  N  N   . GLU A 1 42  ? -26.396 9.448   62.115  1.00 62.19  ? 41   GLU A N   1 
ATOM   263  C  CA  . GLU A 1 42  ? -27.647 9.886   61.519  1.00 67.57  ? 41   GLU A CA  1 
ATOM   264  C  C   . GLU A 1 42  ? -27.458 11.278  60.970  1.00 65.60  ? 41   GLU A C   1 
ATOM   265  O  O   . GLU A 1 42  ? -27.153 12.193  61.738  1.00 61.92  ? 41   GLU A O   1 
ATOM   266  C  CB  . GLU A 1 42  ? -28.734 9.920   62.592  1.00 76.34  ? 41   GLU A CB  1 
ATOM   267  C  CG  . GLU A 1 42  ? -30.150 9.813   62.060  1.00 79.28  ? 41   GLU A CG  1 
ATOM   268  C  CD  . GLU A 1 42  ? -30.575 8.374   61.816  1.00 83.67  ? 41   GLU A CD  1 
ATOM   269  O  OE1 . GLU A 1 42  ? -30.046 7.463   62.522  1.00 71.37  ? 41   GLU A OE1 1 
ATOM   270  O  OE2 . GLU A 1 42  ? -31.449 8.166   60.929  1.00 83.19  ? 41   GLU A OE2 1 
ATOM   271  N  N   . LEU A 1 43  ? -27.625 11.456  59.657  1.00 65.47  ? 42   LEU A N   1 
ATOM   272  C  CA  . LEU A 1 43  ? -27.230 12.722  59.019  1.00 62.11  ? 42   LEU A CA  1 
ATOM   273  C  C   . LEU A 1 43  ? -28.393 13.573  58.531  1.00 73.22  ? 42   LEU A C   1 
ATOM   274  O  O   . LEU A 1 43  ? -29.262 13.106  57.797  1.00 76.55  ? 42   LEU A O   1 
ATOM   275  C  CB  . LEU A 1 43  ? -26.271 12.464  57.861  1.00 54.97  ? 42   LEU A CB  1 
ATOM   276  C  CG  . LEU A 1 43  ? -24.867 11.988  58.227  1.00 48.90  ? 42   LEU A CG  1 
ATOM   277  C  CD1 . LEU A 1 43  ? -24.071 11.791  56.955  1.00 47.79  ? 42   LEU A CD1 1 
ATOM   278  C  CD2 . LEU A 1 43  ? -24.131 12.943  59.152  1.00 46.77  ? 42   LEU A CD2 1 
ATOM   279  N  N   . MET A 1 44  ? -28.375 14.839  58.949  1.00 80.89  ? 43   MET A N   1 
ATOM   280  C  CA  . MET A 1 44  ? -29.385 15.841  58.602  1.00 87.51  ? 43   MET A CA  1 
ATOM   281  C  C   . MET A 1 44  ? -28.924 16.615  57.360  1.00 82.34  ? 43   MET A C   1 
ATOM   282  O  O   . MET A 1 44  ? -28.136 17.564  57.442  1.00 70.94  ? 43   MET A O   1 
ATOM   283  C  CB  . MET A 1 44  ? -29.568 16.758  59.829  1.00 97.99  ? 43   MET A CB  1 
ATOM   284  C  CG  . MET A 1 44  ? -30.435 18.006  59.729  1.00 100.47 ? 43   MET A CG  1 
ATOM   285  S  SD  . MET A 1 44  ? -30.325 18.977  61.286  1.00 99.45  ? 43   MET A SD  1 
ATOM   286  C  CE  . MET A 1 44  ? -28.734 19.801  61.154  1.00 90.62  ? 43   MET A CE  1 
ATOM   287  N  N   . ILE A 1 45  ? -29.438 16.193  56.211  1.00 79.36  ? 44   ILE A N   1 
ATOM   288  C  CA  . ILE A 1 45  ? -28.925 16.618  54.894  1.00 84.76  ? 44   ILE A CA  1 
ATOM   289  C  C   . ILE A 1 45  ? -29.961 17.309  53.989  1.00 86.70  ? 44   ILE A C   1 
ATOM   290  O  O   . ILE A 1 45  ? -31.153 17.000  54.038  1.00 81.71  ? 44   ILE A O   1 
ATOM   291  C  CB  . ILE A 1 45  ? -28.374 15.396  54.101  1.00 85.61  ? 44   ILE A CB  1 
ATOM   292  C  CG1 . ILE A 1 45  ? -29.427 14.248  54.002  1.00 87.48  ? 44   ILE A CG1 1 
ATOM   293  C  CG2 . ILE A 1 45  ? -27.107 14.878  54.741  1.00 82.26  ? 44   ILE A CG2 1 
ATOM   294  C  CD1 . ILE A 1 45  ? -30.127 14.148  52.664  1.00 82.11  ? 44   ILE A CD1 1 
ATOM   295  N  N   . PRO A 1 46  ? -29.502 18.232  53.131  1.00 92.91  ? 45   PRO A N   1 
ATOM   296  C  CA  . PRO A 1 46  ? -30.411 18.758  52.104  1.00 95.74  ? 45   PRO A CA  1 
ATOM   297  C  C   . PRO A 1 46  ? -30.725 17.706  51.017  1.00 98.03  ? 45   PRO A C   1 
ATOM   298  O  O   . PRO A 1 46  ? -29.810 17.059  50.504  1.00 104.58 ? 45   PRO A O   1 
ATOM   299  C  CB  . PRO A 1 46  ? -29.654 19.966  51.527  1.00 94.74  ? 45   PRO A CB  1 
ATOM   300  C  CG  . PRO A 1 46  ? -28.226 19.763  51.897  1.00 96.46  ? 45   PRO A CG  1 
ATOM   301  C  CD  . PRO A 1 46  ? -28.206 18.935  53.157  1.00 96.77  ? 45   PRO A CD  1 
ATOM   302  N  N   . GLY A 1 47  ? -32.010 17.544  50.689  1.00 89.51  ? 46   GLY A N   1 
ATOM   303  C  CA  . GLY A 1 47  ? -32.499 16.524  49.739  1.00 88.02  ? 46   GLY A CA  1 
ATOM   304  C  C   . GLY A 1 47  ? -32.141 16.686  48.261  1.00 87.66  ? 46   GLY A C   1 
ATOM   305  O  O   . GLY A 1 47  ? -31.292 17.491  47.899  1.00 94.53  ? 46   GLY A O   1 
ATOM   306  N  N   . GLY A 1 48  ? -32.788 15.892  47.406  1.00 77.33  ? 47   GLY A N   1 
ATOM   307  C  CA  . GLY A 1 48  ? -32.417 15.778  45.992  1.00 68.63  ? 47   GLY A CA  1 
ATOM   308  C  C   . GLY A 1 48  ? -31.282 14.791  45.774  1.00 67.41  ? 47   GLY A C   1 
ATOM   309  O  O   . GLY A 1 48  ? -30.792 14.613  44.641  1.00 63.13  ? 47   GLY A O   1 
ATOM   310  N  N   . ALA A 1 49  ? -30.862 14.130  46.857  1.00 60.33  ? 48   ALA A N   1 
ATOM   311  C  CA  . ALA A 1 49  ? -29.694 13.256  46.809  1.00 52.49  ? 48   ALA A CA  1 
ATOM   312  C  C   . ALA A 1 49  ? -30.001 11.839  46.318  1.00 48.79  ? 48   ALA A C   1 
ATOM   313  O  O   . ALA A 1 49  ? -31.026 11.279  46.653  1.00 50.77  ? 48   ALA A O   1 
ATOM   314  C  CB  . ALA A 1 49  ? -29.028 13.207  48.165  1.00 48.71  ? 48   ALA A CB  1 
ATOM   315  N  N   . LYS A 1 50  ? -29.105 11.270  45.513  1.00 43.89  ? 49   LYS A N   1 
ATOM   316  C  CA  . LYS A 1 50  ? -29.131 9.853   45.248  1.00 44.74  ? 49   LYS A CA  1 
ATOM   317  C  C   . LYS A 1 50  ? -28.851 9.124   46.572  1.00 44.63  ? 49   LYS A C   1 
ATOM   318  O  O   . LYS A 1 50  ? -27.812 9.322   47.227  1.00 47.36  ? 49   LYS A O   1 
ATOM   319  C  CB  . LYS A 1 50  ? -28.103 9.440   44.187  1.00 46.13  ? 49   LYS A CB  1 
ATOM   320  C  CG  . LYS A 1 50  ? -28.107 7.945   43.908  1.00 47.07  ? 49   LYS A CG  1 
ATOM   321  C  CD  . LYS A 1 50  ? -27.617 7.605   42.503  1.00 51.89  ? 49   LYS A CD  1 
ATOM   322  C  CE  . LYS A 1 50  ? -27.590 6.088   42.259  1.00 55.60  ? 49   LYS A CE  1 
ATOM   323  N  NZ  . LYS A 1 50  ? -28.835 5.380   42.709  1.00 53.91  ? 49   LYS A NZ  1 
ATOM   324  N  N   . VAL A 1 51  ? -29.811 8.317   46.982  1.00 40.89  ? 50   VAL A N   1 
ATOM   325  C  CA  . VAL A 1 51  ? -29.667 7.547   48.184  1.00 38.90  ? 50   VAL A CA  1 
ATOM   326  C  C   . VAL A 1 51  ? -29.182 6.156   47.787  1.00 37.38  ? 50   VAL A C   1 
ATOM   327  O  O   . VAL A 1 51  ? -29.680 5.543   46.840  1.00 29.76  ? 50   VAL A O   1 
ATOM   328  C  CB  . VAL A 1 51  ? -30.993 7.521   48.967  1.00 41.32  ? 50   VAL A CB  1 
ATOM   329  C  CG1 . VAL A 1 51  ? -31.011 6.425   50.021  1.00 42.99  ? 50   VAL A CG1 1 
ATOM   330  C  CG2 . VAL A 1 51  ? -31.227 8.875   49.630  1.00 40.20  ? 50   VAL A CG2 1 
ATOM   331  N  N   . ILE A 1 52  ? -28.162 5.682   48.498  1.00 40.02  ? 51   ILE A N   1 
ATOM   332  C  CA  . ILE A 1 52  ? -27.685 4.303   48.333  1.00 38.95  ? 51   ILE A CA  1 
ATOM   333  C  C   . ILE A 1 52  ? -27.979 3.563   49.618  1.00 38.27  ? 51   ILE A C   1 
ATOM   334  O  O   . ILE A 1 52  ? -27.539 3.971   50.686  1.00 38.96  ? 51   ILE A O   1 
ATOM   335  C  CB  . ILE A 1 52  ? -26.181 4.208   47.961  1.00 35.86  ? 51   ILE A CB  1 
ATOM   336  C  CG1 . ILE A 1 52  ? -25.910 4.931   46.647  1.00 37.41  ? 51   ILE A CG1 1 
ATOM   337  C  CG2 . ILE A 1 52  ? -25.767 2.763   47.789  1.00 33.93  ? 51   ILE A CG2 1 
ATOM   338  C  CD1 . ILE A 1 52  ? -24.553 5.583   46.589  1.00 40.74  ? 51   ILE A CD1 1 
ATOM   339  N  N   . ASP A 1 53  ? -28.749 2.485   49.518  1.00 41.75  ? 52   ASP A N   1 
ATOM   340  C  CA  . ASP A 1 53  ? -28.997 1.690   50.694  1.00 45.87  ? 52   ASP A CA  1 
ATOM   341  C  C   . ASP A 1 53  ? -27.781 0.770   50.875  1.00 45.41  ? 52   ASP A C   1 
ATOM   342  O  O   . ASP A 1 53  ? -27.599 -0.179  50.125  1.00 46.42  ? 52   ASP A O   1 
ATOM   343  C  CB  . ASP A 1 53  ? -30.307 0.907   50.609  1.00 44.10  ? 52   ASP A CB  1 
ATOM   344  C  CG  . ASP A 1 53  ? -30.615 0.155   51.903  1.00 44.69  ? 52   ASP A CG  1 
ATOM   345  O  OD1 . ASP A 1 53  ? -29.829 0.198   52.887  1.00 39.66  ? 52   ASP A OD1 1 
ATOM   346  O  OD2 . ASP A 1 53  ? -31.660 -0.501  51.925  1.00 52.36  ? 52   ASP A OD2 1 
ATOM   347  N  N   . ALA A 1 54  ? -26.966 1.084   51.875  1.00 41.40  ? 53   ALA A N   1 
ATOM   348  C  CA  . ALA A 1 54  ? -25.778 0.303   52.200  1.00 43.39  ? 53   ALA A CA  1 
ATOM   349  C  C   . ALA A 1 54  ? -25.981 -0.580  53.447  1.00 39.20  ? 53   ALA A C   1 
ATOM   350  O  O   . ALA A 1 54  ? -25.012 -0.924  54.128  1.00 36.69  ? 53   ALA A O   1 
ATOM   351  C  CB  . ALA A 1 54  ? -24.592 1.248   52.400  1.00 45.09  ? 53   ALA A CB  1 
ATOM   352  N  N   . THR A 1 55  ? -27.229 -0.925  53.761  1.00 34.08  ? 54   THR A N   1 
ATOM   353  C  CA  . THR A 1 55  ? -27.472 -1.745  54.941  1.00 33.99  ? 54   THR A CA  1 
ATOM   354  C  C   . THR A 1 55  ? -26.728 -3.095  54.787  1.00 34.22  ? 54   THR A C   1 
ATOM   355  O  O   . THR A 1 55  ? -26.717 -3.712  53.728  1.00 34.83  ? 54   THR A O   1 
ATOM   356  C  CB  . THR A 1 55  ? -29.010 -1.926  55.277  1.00 35.38  ? 54   THR A CB  1 
ATOM   357  O  OG1 . THR A 1 55  ? -29.615 -0.711  55.777  1.00 31.65  ? 54   THR A OG1 1 
ATOM   358  C  CG2 . THR A 1 55  ? -29.177 -3.005  56.339  1.00 35.76  ? 54   THR A CG2 1 
ATOM   359  N  N   . GLY A 1 56  ? -26.057 -3.529  55.847  1.00 37.04  ? 55   GLY A N   1 
ATOM   360  C  CA  . GLY A 1 56  ? -25.374 -4.844  55.867  1.00 35.25  ? 55   GLY A CA  1 
ATOM   361  C  C   . GLY A 1 56  ? -24.132 -4.895  55.002  1.00 36.67  ? 55   GLY A C   1 
ATOM   362  O  O   . GLY A 1 56  ? -23.547 -5.956  54.810  1.00 41.48  ? 55   GLY A O   1 
ATOM   363  N  N   . LYS A 1 57  ? -23.718 -3.742  54.492  1.00 35.34  ? 56   LYS A N   1 
ATOM   364  C  CA  . LYS A 1 57  ? -22.537 -3.629  53.648  1.00 35.63  ? 56   LYS A CA  1 
ATOM   365  C  C   . LYS A 1 57  ? -21.456 -2.794  54.341  1.00 31.75  ? 56   LYS A C   1 
ATOM   366  O  O   . LYS A 1 57  ? -21.718 -2.100  55.317  1.00 32.51  ? 56   LYS A O   1 
ATOM   367  C  CB  . LYS A 1 57  ? -22.903 -2.965  52.301  1.00 38.14  ? 56   LYS A CB  1 
ATOM   368  C  CG  . LYS A 1 57  ? -24.237 -3.378  51.726  1.00 40.16  ? 56   LYS A CG  1 
ATOM   369  C  CD  . LYS A 1 57  ? -24.321 -4.889  51.546  1.00 42.70  ? 56   LYS A CD  1 
ATOM   370  C  CE  . LYS A 1 57  ? -25.644 -5.307  50.922  1.00 45.67  ? 56   LYS A CE  1 
ATOM   371  N  NZ  . LYS A 1 57  ? -25.660 -6.741  50.521  1.00 46.57  ? 56   LYS A NZ  1 
ATOM   372  N  N   . LEU A 1 58  ? -20.253 -2.842  53.795  1.00 30.07  ? 57   LEU A N   1 
ATOM   373  C  CA  . LEU A 1 58  ? -19.126 -2.041  54.263  1.00 29.27  ? 57   LEU A CA  1 
ATOM   374  C  C   . LEU A 1 58  ? -18.923 -0.881  53.300  1.00 27.57  ? 57   LEU A C   1 
ATOM   375  O  O   . LEU A 1 58  ? -19.058 -1.035  52.089  1.00 29.36  ? 57   LEU A O   1 
ATOM   376  C  CB  . LEU A 1 58  ? -17.840 -2.864  54.339  1.00 28.86  ? 57   LEU A CB  1 
ATOM   377  C  CG  . LEU A 1 58  ? -17.996 -4.259  54.896  1.00 29.98  ? 57   LEU A CG  1 
ATOM   378  C  CD1 . LEU A 1 58  ? -16.693 -5.022  54.883  1.00 29.35  ? 57   LEU A CD1 1 
ATOM   379  C  CD2 . LEU A 1 58  ? -18.538 -4.174  56.306  1.00 31.16  ? 57   LEU A CD2 1 
ATOM   380  N  N   . VAL A 1 59  ? -18.618 0.283   53.850  1.00 26.12  ? 58   VAL A N   1 
ATOM   381  C  CA  . VAL A 1 59  ? -18.345 1.457   53.056  1.00 26.98  ? 58   VAL A CA  1 
ATOM   382  C  C   . VAL A 1 59  ? -16.851 1.745   53.215  1.00 30.47  ? 58   VAL A C   1 
ATOM   383  O  O   . VAL A 1 59  ? -16.391 2.381   54.182  1.00 32.26  ? 58   VAL A O   1 
ATOM   384  C  CB  . VAL A 1 59  ? -19.200 2.647   53.482  1.00 26.84  ? 58   VAL A CB  1 
ATOM   385  C  CG1 . VAL A 1 59  ? -19.119 3.746   52.454  1.00 29.39  ? 58   VAL A CG1 1 
ATOM   386  C  CG2 . VAL A 1 59  ? -20.649 2.231   53.637  1.00 26.98  ? 58   VAL A CG2 1 
ATOM   387  N  N   . ILE A 1 60  ? -16.091 1.187   52.281  1.00 30.21  ? 59   ILE A N   1 
ATOM   388  C  CA  . ILE A 1 60  ? -14.658 1.240   52.309  1.00 29.23  ? 59   ILE A CA  1 
ATOM   389  C  C   . ILE A 1 60  ? -14.137 2.319   51.364  1.00 29.17  ? 59   ILE A C   1 
ATOM   390  O  O   . ILE A 1 60  ? -14.820 2.722   50.427  1.00 29.33  ? 59   ILE A O   1 
ATOM   391  C  CB  . ILE A 1 60  ? -14.046 -0.113  51.891  1.00 30.70  ? 59   ILE A CB  1 
ATOM   392  C  CG1 . ILE A 1 60  ? -14.268 -0.405  50.376  1.00 32.27  ? 59   ILE A CG1 1 
ATOM   393  C  CG2 . ILE A 1 60  ? -14.602 -1.217  52.763  1.00 28.97  ? 59   ILE A CG2 1 
ATOM   394  C  CD1 . ILE A 1 60  ? -13.415 -1.548  49.826  1.00 33.88  ? 59   ILE A CD1 1 
ATOM   395  N  N   . PRO A 1 61  ? -12.908 2.788   51.613  1.00 28.50  ? 60   PRO A N   1 
ATOM   396  C  CA  . PRO A 1 61  ? -12.304 3.615   50.630  1.00 28.20  ? 60   PRO A CA  1 
ATOM   397  C  C   . PRO A 1 61  ? -12.105 2.814   49.399  1.00 28.34  ? 60   PRO A C   1 
ATOM   398  O  O   . PRO A 1 61  ? -11.819 1.630   49.459  1.00 30.47  ? 60   PRO A O   1 
ATOM   399  C  CB  . PRO A 1 61  ? -10.947 3.936   51.235  1.00 29.05  ? 60   PRO A CB  1 
ATOM   400  C  CG  . PRO A 1 61  ? -11.121 3.784   52.693  1.00 28.82  ? 60   PRO A CG  1 
ATOM   401  C  CD  . PRO A 1 61  ? -12.044 2.629   52.799  1.00 28.82  ? 60   PRO A CD  1 
ATOM   402  N  N   . GLY A 1 62  ? -12.232 3.467   48.268  1.00 29.91  ? 61   GLY A N   1 
ATOM   403  C  CA  . GLY A 1 62  ? -11.967 2.817   47.000  1.00 30.10  ? 61   GLY A CA  1 
ATOM   404  C  C   . GLY A 1 62  ? -10.566 2.269   46.998  1.00 29.69  ? 61   GLY A C   1 
ATOM   405  O  O   . GLY A 1 62  ? -9.633  2.885   47.521  1.00 30.84  ? 61   GLY A O   1 
ATOM   406  N  N   . GLY A 1 63  ? -10.405 1.123   46.387  1.00 29.43  ? 62   GLY A N   1 
ATOM   407  C  CA  . GLY A 1 63  ? -9.072  0.588   46.181  1.00 31.20  ? 62   GLY A CA  1 
ATOM   408  C  C   . GLY A 1 63  ? -8.130  1.476   45.384  1.00 31.01  ? 62   GLY A C   1 
ATOM   409  O  O   . GLY A 1 63  ? -8.547  2.189   44.472  1.00 28.18  ? 62   GLY A O   1 
ATOM   410  N  N   . ILE A 1 64  ? -6.851  1.416   45.750  1.00 33.65  ? 63   ILE A N   1 
ATOM   411  C  CA  . ILE A 1 64  ? -5.766  1.978   44.959  1.00 33.82  ? 63   ILE A CA  1 
ATOM   412  C  C   . ILE A 1 64  ? -4.803  0.871   44.524  1.00 35.01  ? 63   ILE A C   1 
ATOM   413  O  O   . ILE A 1 64  ? -4.296  0.102   45.361  1.00 41.16  ? 63   ILE A O   1 
ATOM   414  C  CB  . ILE A 1 64  ? -4.961  2.980   45.760  1.00 33.29  ? 63   ILE A CB  1 
ATOM   415  C  CG1 . ILE A 1 64  ? -5.847  4.123   46.244  1.00 32.08  ? 63   ILE A CG1 1 
ATOM   416  C  CG2 . ILE A 1 64  ? -3.855  3.526   44.874  1.00 37.87  ? 63   ILE A CG2 1 
ATOM   417  C  CD1 . ILE A 1 64  ? -5.216  5.022   47.301  1.00 32.39  ? 63   ILE A CD1 1 
ATOM   418  N  N   . ASP A 1 65  ? -4.573  0.782   43.222  1.00 34.55  ? 64   ASP A N   1 
ATOM   419  C  CA  . ASP A 1 65  ? -3.746  -0.277  42.627  1.00 36.66  ? 64   ASP A CA  1 
ATOM   420  C  C   . ASP A 1 65  ? -2.395  0.312   42.214  1.00 36.65  ? 64   ASP A C   1 
ATOM   421  O  O   . ASP A 1 65  ? -2.268  0.953   41.190  1.00 37.12  ? 64   ASP A O   1 
ATOM   422  C  CB  . ASP A 1 65  ? -4.452  -0.896  41.401  1.00 37.51  ? 64   ASP A CB  1 
ATOM   423  C  CG  . ASP A 1 65  ? -3.951  -2.282  41.064  1.00 38.15  ? 64   ASP A CG  1 
ATOM   424  O  OD1 . ASP A 1 65  ? -2.733  -2.558  41.189  1.00 36.45  ? 64   ASP A OD1 1 
ATOM   425  O  OD2 . ASP A 1 65  ? -4.808  -3.120  40.681  1.00 43.74  ? 64   ASP A OD2 1 
ATOM   426  N  N   . THR A 1 66  ? -1.381  0.062   43.022  1.00 36.79  ? 65   THR A N   1 
ATOM   427  C  CA  . THR A 1 66  ? -0.086  0.691   42.872  1.00 33.39  ? 65   THR A CA  1 
ATOM   428  C  C   . THR A 1 66  ? 0.749   0.161   41.708  1.00 35.00  ? 65   THR A C   1 
ATOM   429  O  O   . THR A 1 66  ? 1.822   0.698   41.432  1.00 33.43  ? 65   THR A O   1 
ATOM   430  C  CB  . THR A 1 66  ? 0.732   0.503   44.142  1.00 31.54  ? 65   THR A CB  1 
ATOM   431  O  OG1 . THR A 1 66  ? 0.592   -0.856  44.588  1.00 30.26  ? 65   THR A OG1 1 
ATOM   432  C  CG2 . THR A 1 66  ? 0.227   1.449   45.200  1.00 30.69  ? 65   THR A CG2 1 
ATOM   433  N  N   . SER A 1 67  ? 0.280   -0.876  41.019  1.00 34.26  ? 66   SER A N   1 
ATOM   434  C  CA  . SER A 1 67  ? 1.019   -1.360  39.872  1.00 33.93  ? 66   SER A CA  1 
ATOM   435  C  C   . SER A 1 67  ? 0.098   -1.835  38.774  1.00 33.49  ? 66   SER A C   1 
ATOM   436  O  O   . SER A 1 67  ? -0.397  -2.949  38.836  1.00 31.28  ? 66   SER A O   1 
ATOM   437  C  CB  . SER A 1 67  ? 2.000   -2.460  40.282  1.00 34.36  ? 66   SER A CB  1 
ATOM   438  O  OG  . SER A 1 67  ? 2.718   -2.897  39.141  1.00 38.77  ? 66   SER A OG  1 
ATOM   439  N  N   . THR A 1 68  ? -0.131  -0.980  37.781  1.00 35.42  ? 67   THR A N   1 
ATOM   440  C  CA  . THR A 1 68  ? -0.850  -1.373  36.569  1.00 38.78  ? 67   THR A CA  1 
ATOM   441  C  C   . THR A 1 68  ? -0.039  -0.975  35.373  1.00 36.40  ? 67   THR A C   1 
ATOM   442  O  O   . THR A 1 68  ? 0.778   -0.084  35.450  1.00 31.86  ? 67   THR A O   1 
ATOM   443  C  CB  . THR A 1 68  ? -2.210  -0.671  36.422  1.00 41.30  ? 67   THR A CB  1 
ATOM   444  O  OG1 . THR A 1 68  ? -2.006  0.739   36.258  1.00 46.44  ? 67   THR A OG1 1 
ATOM   445  C  CG2 . THR A 1 68  ? -3.073  -0.953  37.633  1.00 41.82  ? 67   THR A CG2 1 
ATOM   446  N  N   . HIS A 1 69  ? -0.286  -1.656  34.265  1.00 38.80  ? 68   HIS A N   1 
ATOM   447  C  CA  . HIS A 1 69  ? 0.522   -1.498  33.077  1.00 38.73  ? 68   HIS A CA  1 
ATOM   448  C  C   . HIS A 1 69  ? -0.330  -1.252  31.845  1.00 41.71  ? 68   HIS A C   1 
ATOM   449  O  O   . HIS A 1 69  ? -0.045  -1.789  30.778  1.00 42.83  ? 68   HIS A O   1 
ATOM   450  C  CB  . HIS A 1 69  ? 1.338   -2.762  32.877  1.00 38.35  ? 68   HIS A CB  1 
ATOM   451  C  CG  . HIS A 1 69  ? 2.375   -2.983  33.933  1.00 37.37  ? 68   HIS A CG  1 
ATOM   452  N  ND1 . HIS A 1 69  ? 3.597   -2.357  33.905  1.00 37.87  ? 68   HIS A ND1 1 
ATOM   453  C  CD2 . HIS A 1 69  ? 2.373   -3.759  35.040  1.00 37.30  ? 68   HIS A CD2 1 
ATOM   454  C  CE1 . HIS A 1 69  ? 4.305   -2.732  34.950  1.00 39.02  ? 68   HIS A CE1 1 
ATOM   455  N  NE2 . HIS A 1 69  ? 3.580   -3.578  35.660  1.00 38.99  ? 68   HIS A NE2 1 
ATOM   456  N  N   . PHE A 1 70  ? -1.368  -0.438  31.965  1.00 41.66  ? 69   PHE A N   1 
ATOM   457  C  CA  . PHE A 1 70  ? -2.249  -0.233  30.821  1.00 43.47  ? 69   PHE A CA  1 
ATOM   458  C  C   . PHE A 1 70  ? -1.507  0.392   29.647  1.00 45.00  ? 69   PHE A C   1 
ATOM   459  O  O   . PHE A 1 70  ? -0.660  1.239   29.843  1.00 44.05  ? 69   PHE A O   1 
ATOM   460  C  CB  . PHE A 1 70  ? -3.392  0.691   31.177  1.00 44.81  ? 69   PHE A CB  1 
ATOM   461  C  CG  . PHE A 1 70  ? -4.187  0.252   32.354  1.00 45.58  ? 69   PHE A CG  1 
ATOM   462  C  CD1 . PHE A 1 70  ? -4.395  -1.096  32.619  1.00 46.81  ? 69   PHE A CD1 1 
ATOM   463  C  CD2 . PHE A 1 70  ? -4.769  1.185   33.180  1.00 42.45  ? 69   PHE A CD2 1 
ATOM   464  C  CE1 . PHE A 1 70  ? -5.142  -1.491  33.711  1.00 40.96  ? 69   PHE A CE1 1 
ATOM   465  C  CE2 . PHE A 1 70  ? -5.531  0.787   34.253  1.00 42.16  ? 69   PHE A CE2 1 
ATOM   466  C  CZ  . PHE A 1 70  ? -5.706  -0.548  34.526  1.00 40.14  ? 69   PHE A CZ  1 
ATOM   467  N  N   . HIS A 1 71  ? -1.859  -0.042  28.441  1.00 45.59  ? 70   HIS A N   1 
ATOM   468  C  CA  . HIS A 1 71  ? -1.276  0.432   27.187  1.00 47.79  ? 70   HIS A CA  1 
ATOM   469  C  C   . HIS A 1 71  ? 0.246   0.298   27.054  1.00 46.34  ? 70   HIS A C   1 
ATOM   470  O  O   . HIS A 1 71  ? 0.836   0.919   26.171  1.00 45.75  ? 70   HIS A O   1 
ATOM   471  C  CB  . HIS A 1 71  ? -1.686  1.873   26.919  1.00 53.14  ? 70   HIS A CB  1 
ATOM   472  C  CG  . HIS A 1 71  ? -2.017  2.145   25.476  1.00 57.86  ? 70   HIS A CG  1 
ATOM   473  N  ND1 . HIS A 1 71  ? -1.299  1.613   24.424  1.00 56.49  ? 70   HIS A ND1 1 
ATOM   474  C  CD2 . HIS A 1 71  ? -3.002  2.887   24.917  1.00 58.79  ? 70   HIS A CD2 1 
ATOM   475  C  CE1 . HIS A 1 71  ? -1.819  2.023   23.282  1.00 55.48  ? 70   HIS A CE1 1 
ATOM   476  N  NE2 . HIS A 1 71  ? -2.858  2.792   23.555  1.00 60.31  ? 70   HIS A NE2 1 
ATOM   477  N  N   . GLN A 1 72  ? 0.865   -0.524  27.905  1.00 46.73  ? 71   GLN A N   1 
ATOM   478  C  CA  . GLN A 1 72  ? 2.306   -0.721  27.893  1.00 44.31  ? 71   GLN A CA  1 
ATOM   479  C  C   . GLN A 1 72  ? 2.692   -1.778  26.870  1.00 47.42  ? 71   GLN A C   1 
ATOM   480  O  O   . GLN A 1 72  ? 2.099   -2.860  26.800  1.00 44.55  ? 71   GLN A O   1 
ATOM   481  C  CB  . GLN A 1 72  ? 2.828   -1.127  29.265  1.00 42.88  ? 71   GLN A CB  1 
ATOM   482  C  CG  . GLN A 1 72  ? 4.344   -1.283  29.360  1.00 45.37  ? 71   GLN A CG  1 
ATOM   483  C  CD  . GLN A 1 72  ? 4.807   -1.370  30.818  1.00 47.98  ? 71   GLN A CD  1 
ATOM   484  O  OE1 . GLN A 1 72  ? 4.588   -2.369  31.489  1.00 47.35  ? 71   GLN A OE1 1 
ATOM   485  N  NE2 . GLN A 1 72  ? 5.356   -0.276  31.334  1.00 49.44  ? 71   GLN A NE2 1 
ATOM   486  N  N   . THR A 1 73  ? 3.699   -1.445  26.071  1.00 51.78  ? 72   THR A N   1 
ATOM   487  C  CA  . THR A 1 73  ? 4.315   -2.412  25.188  1.00 51.84  ? 72   THR A CA  1 
ATOM   488  C  C   . THR A 1 73  ? 5.598   -2.931  25.838  1.00 51.06  ? 72   THR A C   1 
ATOM   489  O  O   . THR A 1 73  ? 6.539   -2.180  26.101  1.00 57.33  ? 72   THR A O   1 
ATOM   490  C  CB  . THR A 1 73  ? 4.622   -1.811  23.824  1.00 55.95  ? 72   THR A CB  1 
ATOM   491  O  OG1 . THR A 1 73  ? 3.423   -1.222  23.287  1.00 55.03  ? 72   THR A OG1 1 
ATOM   492  C  CG2 . THR A 1 73  ? 5.158   -2.910  22.898  1.00 55.68  ? 72   THR A CG2 1 
ATOM   493  N  N   . PHE A 1 74  ? 5.602   -4.227  26.114  1.00 46.82  ? 73   PHE A N   1 
ATOM   494  C  CA  . PHE A 1 74  ? 6.611   -4.870  26.945  1.00 43.15  ? 73   PHE A CA  1 
ATOM   495  C  C   . PHE A 1 74  ? 6.979   -6.185  26.288  1.00 45.49  ? 73   PHE A C   1 
ATOM   496  O  O   . PHE A 1 74  ? 6.083   -6.961  25.916  1.00 43.58  ? 73   PHE A O   1 
ATOM   497  C  CB  . PHE A 1 74  ? 6.038   -5.162  28.334  1.00 42.60  ? 73   PHE A CB  1 
ATOM   498  C  CG  . PHE A 1 74  ? 7.063   -5.630  29.330  1.00 39.34  ? 73   PHE A CG  1 
ATOM   499  C  CD1 . PHE A 1 74  ? 7.921   -4.710  29.939  1.00 38.98  ? 73   PHE A CD1 1 
ATOM   500  C  CD2 . PHE A 1 74  ? 7.168   -6.959  29.678  1.00 35.91  ? 73   PHE A CD2 1 
ATOM   501  C  CE1 . PHE A 1 74  ? 8.855   -5.109  30.877  1.00 33.75  ? 73   PHE A CE1 1 
ATOM   502  C  CE2 . PHE A 1 74  ? 8.114   -7.355  30.603  1.00 34.60  ? 73   PHE A CE2 1 
ATOM   503  C  CZ  . PHE A 1 74  ? 8.951   -6.426  31.198  1.00 31.78  ? 73   PHE A CZ  1 
ATOM   504  N  N   . MET A 1 75  ? 8.282   -6.437  26.134  1.00 46.53  ? 74   MET A N   1 
ATOM   505  C  CA  . MET A 1 75  ? 8.731   -7.698  25.603  1.00 46.20  ? 74   MET A CA  1 
ATOM   506  C  C   . MET A 1 75  ? 8.042   -8.012  24.281  1.00 53.27  ? 74   MET A C   1 
ATOM   507  O  O   . MET A 1 75  ? 7.730   -9.182  23.994  1.00 53.66  ? 74   MET A O   1 
ATOM   508  C  CB  . MET A 1 75  ? 8.432   -8.814  26.608  1.00 47.54  ? 74   MET A CB  1 
ATOM   509  C  CG  . MET A 1 75  ? 9.355   -8.799  27.796  1.00 43.65  ? 74   MET A CG  1 
ATOM   510  S  SD  . MET A 1 75  ? 9.149   -10.249 28.823  1.00 44.56  ? 74   MET A SD  1 
ATOM   511  C  CE  . MET A 1 75  ? 10.891  -10.718 28.895  1.00 46.08  ? 74   MET A CE  1 
ATOM   512  N  N   . ASN A 1 76  ? 7.818   -6.959  23.476  1.00 58.60  ? 75   ASN A N   1 
ATOM   513  C  CA  . ASN A 1 76  ? 7.309   -7.083  22.101  1.00 54.80  ? 75   ASN A CA  1 
ATOM   514  C  C   . ASN A 1 76  ? 5.818   -7.415  21.984  1.00 55.16  ? 75   ASN A C   1 
ATOM   515  O  O   . ASN A 1 76  ? 5.334   -7.779  20.914  1.00 57.92  ? 75   ASN A O   1 
ATOM   516  C  CB  . ASN A 1 76  ? 8.165   -8.107  21.323  1.00 55.96  ? 75   ASN A CB  1 
ATOM   517  C  CG  . ASN A 1 76  ? 9.655   -7.728  21.276  1.00 55.81  ? 75   ASN A CG  1 
ATOM   518  O  OD1 . ASN A 1 76  ? 10.035  -6.545  21.164  1.00 49.68  ? 75   ASN A OD1 1 
ATOM   519  N  ND2 . ASN A 1 76  ? 10.503  -8.742  21.337  1.00 55.87  ? 75   ASN A ND2 1 
ATOM   520  N  N   . ALA A 1 77  ? 5.086   -7.287  23.091  1.00 57.65  ? 76   ALA A N   1 
ATOM   521  C  CA  . ALA A 1 77  ? 3.614   -7.368  23.094  1.00 52.51  ? 76   ALA A CA  1 
ATOM   522  C  C   . ALA A 1 77  ? 3.038   -6.141  23.762  1.00 53.43  ? 76   ALA A C   1 
ATOM   523  O  O   . ALA A 1 77  ? 3.662   -5.530  24.643  1.00 56.69  ? 76   ALA A O   1 
ATOM   524  C  CB  . ALA A 1 77  ? 3.144   -8.598  23.825  1.00 53.75  ? 76   ALA A CB  1 
ATOM   525  N  N   . THR A 1 78  ? 1.860   -5.739  23.315  1.00 54.99  ? 77   THR A N   1 
ATOM   526  C  CA  . THR A 1 78  ? 1.195   -4.585  23.900  1.00 53.92  ? 77   THR A CA  1 
ATOM   527  C  C   . THR A 1 78  ? 0.017   -5.030  24.756  1.00 55.05  ? 77   THR A C   1 
ATOM   528  O  O   . THR A 1 78  ? -0.821  -5.823  24.336  1.00 54.44  ? 77   THR A O   1 
ATOM   529  C  CB  . THR A 1 78  ? 0.783   -3.565  22.832  1.00 47.03  ? 77   THR A CB  1 
ATOM   530  O  OG1 . THR A 1 78  ? 1.971   -2.992  22.284  1.00 43.94  ? 77   THR A OG1 1 
ATOM   531  C  CG2 . THR A 1 78  ? -0.071  -2.469  23.436  1.00 47.93  ? 77   THR A CG2 1 
ATOM   532  N  N   . CYS A 1 79  ? -0.022  -4.504  25.970  1.00 55.54  ? 78   CYS A N   1 
ATOM   533  C  CA  . CYS A 1 79  ? -1.007  -4.928  26.929  1.00 56.44  ? 78   CYS A CA  1 
ATOM   534  C  C   . CYS A 1 79  ? -2.417  -4.789  26.336  1.00 55.01  ? 78   CYS A C   1 
ATOM   535  O  O   . CYS A 1 79  ? -2.783  -3.755  25.777  1.00 55.24  ? 78   CYS A O   1 
ATOM   536  C  CB  . CYS A 1 79  ? -0.871  -4.129  28.221  1.00 56.94  ? 78   CYS A CB  1 
ATOM   537  S  SG  . CYS A 1 79  ? -2.068  -4.620  29.465  1.00 52.67  ? 78   CYS A SG  1 
ATOM   538  N  N   . VAL A 1 80  ? -3.190  -5.853  26.453  1.00 50.97  ? 79   VAL A N   1 
ATOM   539  C  CA  . VAL A 1 80  ? -4.559  -5.883  25.953  1.00 51.29  ? 79   VAL A CA  1 
ATOM   540  C  C   . VAL A 1 80  ? -5.439  -4.679  26.394  1.00 48.04  ? 79   VAL A C   1 
ATOM   541  O  O   . VAL A 1 80  ? -6.186  -4.139  25.589  1.00 45.74  ? 79   VAL A O   1 
ATOM   542  C  CB  . VAL A 1 80  ? -5.219  -7.226  26.338  1.00 53.66  ? 79   VAL A CB  1 
ATOM   543  C  CG1 . VAL A 1 80  ? -6.739  -7.133  26.309  1.00 56.11  ? 79   VAL A CG1 1 
ATOM   544  C  CG2 . VAL A 1 80  ? -4.725  -8.320  25.402  1.00 53.77  ? 79   VAL A CG2 1 
ATOM   545  N  N   . ASP A 1 81  ? -5.355  -4.267  27.652  1.00 42.90  ? 80   ASP A N   1 
ATOM   546  C  CA  . ASP A 1 81  ? -6.193  -3.173  28.131  1.00 42.02  ? 80   ASP A CA  1 
ATOM   547  C  C   . ASP A 1 81  ? -5.551  -1.825  27.892  1.00 40.34  ? 80   ASP A C   1 
ATOM   548  O  O   . ASP A 1 81  ? -4.419  -1.592  28.272  1.00 40.62  ? 80   ASP A O   1 
ATOM   549  C  CB  . ASP A 1 81  ? -6.449  -3.298  29.632  1.00 45.70  ? 80   ASP A CB  1 
ATOM   550  C  CG  . ASP A 1 81  ? -7.405  -4.402  29.974  1.00 46.70  ? 80   ASP A CG  1 
ATOM   551  O  OD1 . ASP A 1 81  ? -8.251  -4.752  29.127  1.00 49.28  ? 80   ASP A OD1 1 
ATOM   552  O  OD2 . ASP A 1 81  ? -7.322  -4.910  31.104  1.00 44.54  ? 80   ASP A OD2 1 
ATOM   553  N  N   . ASP A 1 82  ? -6.284  -0.905  27.290  1.00 42.97  ? 81   ASP A N   1 
ATOM   554  C  CA  . ASP A 1 82  ? -5.847  0.477   27.220  1.00 41.68  ? 81   ASP A CA  1 
ATOM   555  C  C   . ASP A 1 82  ? -6.233  1.135   28.524  1.00 43.32  ? 81   ASP A C   1 
ATOM   556  O  O   . ASP A 1 82  ? -6.779  0.485   29.422  1.00 46.86  ? 81   ASP A O   1 
ATOM   557  C  CB  . ASP A 1 82  ? -6.485  1.199   26.024  1.00 41.32  ? 81   ASP A CB  1 
ATOM   558  C  CG  . ASP A 1 82  ? -7.980  1.343   26.141  1.00 45.23  ? 81   ASP A CG  1 
ATOM   559  O  OD1 . ASP A 1 82  ? -8.584  0.806   27.091  1.00 48.76  ? 81   ASP A OD1 1 
ATOM   560  O  OD2 . ASP A 1 82  ? -8.572  2.045   25.295  1.00 54.33  ? 81   ASP A OD2 1 
ATOM   561  N  N   . PHE A 1 83  ? -5.974  2.429   28.629  1.00 43.43  ? 82   PHE A N   1 
ATOM   562  C  CA  . PHE A 1 83  ? -6.282  3.146   29.858  1.00 42.06  ? 82   PHE A CA  1 
ATOM   563  C  C   . PHE A 1 83  ? -7.771  3.223   30.185  1.00 42.50  ? 82   PHE A C   1 
ATOM   564  O  O   . PHE A 1 83  ? -8.121  3.362   31.355  1.00 39.09  ? 82   PHE A O   1 
ATOM   565  C  CB  . PHE A 1 83  ? -5.650  4.525   29.832  1.00 43.36  ? 82   PHE A CB  1 
ATOM   566  C  CG  . PHE A 1 83  ? -4.251  4.534   30.347  1.00 42.48  ? 82   PHE A CG  1 
ATOM   567  C  CD1 . PHE A 1 83  ? -4.020  4.546   31.699  1.00 41.04  ? 82   PHE A CD1 1 
ATOM   568  C  CD2 . PHE A 1 83  ? -3.173  4.514   29.483  1.00 43.03  ? 82   PHE A CD2 1 
ATOM   569  C  CE1 . PHE A 1 83  ? -2.735  4.553   32.200  1.00 43.05  ? 82   PHE A CE1 1 
ATOM   570  C  CE2 . PHE A 1 83  ? -1.877  4.523   29.973  1.00 43.52  ? 82   PHE A CE2 1 
ATOM   571  C  CZ  . PHE A 1 83  ? -1.654  4.542   31.337  1.00 44.21  ? 82   PHE A CZ  1 
ATOM   572  N  N   . TYR A 1 84  ? -8.636  3.163   29.162  1.00 43.73  ? 83   TYR A N   1 
ATOM   573  C  CA  . TYR A 1 84  ? -10.077 3.190   29.380  1.00 43.42  ? 83   TYR A CA  1 
ATOM   574  C  C   . TYR A 1 84  ? -10.559 1.855   29.928  1.00 42.93  ? 83   TYR A C   1 
ATOM   575  O  O   . TYR A 1 84  ? -11.206 1.799   30.962  1.00 43.82  ? 83   TYR A O   1 
ATOM   576  C  CB  . TYR A 1 84  ? -10.851 3.536   28.099  1.00 43.46  ? 83   TYR A CB  1 
ATOM   577  C  CG  . TYR A 1 84  ? -12.351 3.375   28.271  1.00 42.74  ? 83   TYR A CG  1 
ATOM   578  C  CD1 . TYR A 1 84  ? -13.113 4.386   28.795  1.00 42.70  ? 83   TYR A CD1 1 
ATOM   579  C  CD2 . TYR A 1 84  ? -12.986 2.184   27.953  1.00 48.65  ? 83   TYR A CD2 1 
ATOM   580  C  CE1 . TYR A 1 84  ? -14.480 4.239   28.998  1.00 46.60  ? 83   TYR A CE1 1 
ATOM   581  C  CE2 . TYR A 1 84  ? -14.360 2.010   28.154  1.00 50.35  ? 83   TYR A CE2 1 
ATOM   582  C  CZ  . TYR A 1 84  ? -15.106 3.052   28.680  1.00 49.09  ? 83   TYR A CZ  1 
ATOM   583  O  OH  . TYR A 1 84  ? -16.460 2.919   28.890  1.00 43.54  ? 83   TYR A OH  1 
ATOM   584  N  N   . HIS A 1 85  ? -10.249 0.782   29.222  1.00 42.66  ? 84   HIS A N   1 
ATOM   585  C  CA  . HIS A 1 85  ? -10.758 -0.531  29.600  1.00 44.16  ? 84   HIS A CA  1 
ATOM   586  C  C   . HIS A 1 85  ? -10.174 -0.922  30.932  1.00 45.74  ? 84   HIS A C   1 
ATOM   587  O  O   . HIS A 1 85  ? -10.834 -1.574  31.748  1.00 44.65  ? 84   HIS A O   1 
ATOM   588  C  CB  . HIS A 1 85  ? -10.471 -1.585  28.506  1.00 48.40  ? 84   HIS A CB  1 
ATOM   589  C  CG  . HIS A 1 85  ? -11.344 -1.418  27.292  1.00 52.99  ? 84   HIS A CG  1 
ATOM   590  N  ND1 . HIS A 1 85  ? -12.688 -1.725  27.299  1.00 57.72  ? 84   HIS A ND1 1 
ATOM   591  C  CD2 . HIS A 1 85  ? -11.096 -0.887  26.071  1.00 55.15  ? 84   HIS A CD2 1 
ATOM   592  C  CE1 . HIS A 1 85  ? -13.223 -1.437  26.123  1.00 59.02  ? 84   HIS A CE1 1 
ATOM   593  N  NE2 . HIS A 1 85  ? -12.280 -0.911  25.365  1.00 58.51  ? 84   HIS A NE2 1 
ATOM   594  N  N   . GLY A 1 86  ? -8.929  -0.504  31.158  1.00 46.27  ? 85   GLY A N   1 
ATOM   595  C  CA  . GLY A 1 86  ? -8.245  -0.796  32.399  1.00 44.51  ? 85   GLY A CA  1 
ATOM   596  C  C   . GLY A 1 86  ? -8.898  -0.131  33.584  1.00 43.35  ? 85   GLY A C   1 
ATOM   597  O  O   . GLY A 1 86  ? -9.157  -0.781  34.603  1.00 45.65  ? 85   GLY A O   1 
ATOM   598  N  N   . THR A 1 87  ? -9.121  1.177   33.485  1.00 39.97  ? 86   THR A N   1 
ATOM   599  C  CA  . THR A 1 87  ? -9.687  1.902   34.600  1.00 37.41  ? 86   THR A CA  1 
ATOM   600  C  C   . THR A 1 87  ? -11.105 1.410   34.796  1.00 38.21  ? 86   THR A C   1 
ATOM   601  O  O   . THR A 1 87  ? -11.556 1.273   35.929  1.00 42.20  ? 86   THR A O   1 
ATOM   602  C  CB  . THR A 1 87  ? -9.654  3.429   34.411  1.00 35.83  ? 86   THR A CB  1 
ATOM   603  O  OG1 . THR A 1 87  ? -10.195 3.794   33.143  1.00 39.00  ? 86   THR A OG1 1 
ATOM   604  C  CG2 . THR A 1 87  ? -8.265  3.942   34.485  1.00 36.82  ? 86   THR A CG2 1 
ATOM   605  N  N   . LYS A 1 88  ? -11.801 1.123   33.697  1.00 38.29  ? 87   LYS A N   1 
ATOM   606  C  CA  . LYS A 1 88  ? -13.151 0.587   33.779  1.00 40.15  ? 87   LYS A CA  1 
ATOM   607  C  C   . LYS A 1 88  ? -13.125 -0.700  34.569  1.00 40.97  ? 87   LYS A C   1 
ATOM   608  O  O   . LYS A 1 88  ? -13.917 -0.879  35.515  1.00 44.35  ? 87   LYS A O   1 
ATOM   609  C  CB  . LYS A 1 88  ? -13.747 0.320   32.410  1.00 41.96  ? 87   LYS A CB  1 
ATOM   610  C  CG  . LYS A 1 88  ? -14.968 -0.593  32.451  1.00 43.63  ? 87   LYS A CG  1 
ATOM   611  C  CD  . LYS A 1 88  ? -15.713 -0.651  31.120  1.00 43.76  ? 87   LYS A CD  1 
ATOM   612  C  CE  . LYS A 1 88  ? -16.839 -1.654  31.185  1.00 41.73  ? 87   LYS A CE  1 
ATOM   613  N  NZ  . LYS A 1 88  ? -17.348 -2.002  29.849  1.00 39.65  ? 87   LYS A NZ  1 
ATOM   614  N  N   . ALA A 1 89  ? -12.207 -1.581  34.189  1.00 41.32  ? 88   ALA A N   1 
ATOM   615  C  CA  . ALA A 1 89  ? -12.035 -2.883  34.860  1.00 40.98  ? 88   ALA A CA  1 
ATOM   616  C  C   . ALA A 1 89  ? -11.749 -2.715  36.336  1.00 39.34  ? 88   ALA A C   1 
ATOM   617  O  O   . ALA A 1 89  ? -12.231 -3.515  37.149  1.00 42.33  ? 88   ALA A O   1 
ATOM   618  C  CB  . ALA A 1 89  ? -10.924 -3.681  34.215  1.00 39.18  ? 88   ALA A CB  1 
ATOM   619  N  N   . ALA A 1 90  ? -10.965 -1.687  36.667  1.00 34.22  ? 89   ALA A N   1 
ATOM   620  C  CA  . ALA A 1 90  ? -10.646 -1.389  38.034  1.00 33.47  ? 89   ALA A CA  1 
ATOM   621  C  C   . ALA A 1 90  ? -11.933 -1.098  38.814  1.00 38.24  ? 89   ALA A C   1 
ATOM   622  O  O   . ALA A 1 90  ? -12.227 -1.718  39.862  1.00 39.04  ? 89   ALA A O   1 
ATOM   623  C  CB  . ALA A 1 90  ? -9.728  -0.209  38.092  1.00 32.78  ? 89   ALA A CB  1 
ATOM   624  N  N   . LEU A 1 91  ? -12.714 -0.170  38.274  1.00 39.76  ? 90   LEU A N   1 
ATOM   625  C  CA  . LEU A 1 91  ? -13.871 0.365   38.963  1.00 39.30  ? 90   LEU A CA  1 
ATOM   626  C  C   . LEU A 1 91  ? -14.917 -0.716  39.234  1.00 38.57  ? 90   LEU A C   1 
ATOM   627  O  O   . LEU A 1 91  ? -15.459 -0.793  40.338  1.00 36.53  ? 90   LEU A O   1 
ATOM   628  C  CB  . LEU A 1 91  ? -14.464 1.504   38.141  1.00 39.47  ? 90   LEU A CB  1 
ATOM   629  C  CG  . LEU A 1 91  ? -13.568 2.727   38.050  1.00 40.30  ? 90   LEU A CG  1 
ATOM   630  C  CD1 . LEU A 1 91  ? -13.975 3.616   36.880  1.00 40.05  ? 90   LEU A CD1 1 
ATOM   631  C  CD2 . LEU A 1 91  ? -13.572 3.506   39.378  1.00 42.03  ? 90   LEU A CD2 1 
ATOM   632  N  N   . VAL A 1 92  ? -15.170 -1.559  38.237  1.00 38.03  ? 91   VAL A N   1 
ATOM   633  C  CA  . VAL A 1 92  ? -16.101 -2.671  38.395  1.00 38.75  ? 91   VAL A CA  1 
ATOM   634  C  C   . VAL A 1 92  ? -15.552 -3.614  39.472  1.00 36.66  ? 91   VAL A C   1 
ATOM   635  O  O   . VAL A 1 92  ? -16.300 -4.334  40.134  1.00 35.40  ? 91   VAL A O   1 
ATOM   636  C  CB  . VAL A 1 92  ? -16.301 -3.442  37.059  1.00 41.77  ? 91   VAL A CB  1 
ATOM   637  C  CG1 . VAL A 1 92  ? -17.100 -4.730  37.259  1.00 41.34  ? 91   VAL A CG1 1 
ATOM   638  C  CG2 . VAL A 1 92  ? -17.001 -2.567  36.026  1.00 40.66  ? 91   VAL A CG2 1 
ATOM   639  N  N   . GLY A 1 93  ? -14.235 -3.590  39.637  1.00 35.69  ? 92   GLY A N   1 
ATOM   640  C  CA  . GLY A 1 93  ? -13.552 -4.421  40.629  1.00 36.16  ? 92   GLY A CA  1 
ATOM   641  C  C   . GLY A 1 93  ? -13.373 -3.808  42.006  1.00 35.83  ? 92   GLY A C   1 
ATOM   642  O  O   . GLY A 1 93  ? -12.735 -4.415  42.867  1.00 37.69  ? 92   GLY A O   1 
ATOM   643  N  N   . GLY A 1 94  ? -13.889 -2.598  42.200  1.00 34.45  ? 93   GLY A N   1 
ATOM   644  C  CA  . GLY A 1 94  ? -13.791 -1.928  43.481  1.00 33.86  ? 93   GLY A CA  1 
ATOM   645  C  C   . GLY A 1 94  ? -12.541 -1.116  43.663  1.00 34.92  ? 93   GLY A C   1 
ATOM   646  O  O   . GLY A 1 94  ? -12.196 -0.748  44.776  1.00 33.16  ? 93   GLY A O   1 
ATOM   647  N  N   . THR A 1 95  ? -11.865 -0.826  42.549  1.00 38.66  ? 94   THR A N   1 
ATOM   648  C  CA  . THR A 1 95  ? -10.674 0.020   42.532  1.00 37.85  ? 94   THR A CA  1 
ATOM   649  C  C   . THR A 1 95  ? -10.936 1.398   41.872  1.00 36.52  ? 94   THR A C   1 
ATOM   650  O  O   . THR A 1 95  ? -11.367 1.493   40.713  1.00 36.01  ? 94   THR A O   1 
ATOM   651  C  CB  . THR A 1 95  ? -9.505  -0.714  41.854  1.00 40.22  ? 94   THR A CB  1 
ATOM   652  O  OG1 . THR A 1 95  ? -9.089  -1.803  42.684  1.00 43.99  ? 94   THR A OG1 1 
ATOM   653  C  CG2 . THR A 1 95  ? -8.295  0.220   41.646  1.00 44.63  ? 94   THR A CG2 1 
ATOM   654  N  N   . THR A 1 96  ? -10.634 2.460   42.620  1.00 33.42  ? 95   THR A N   1 
ATOM   655  C  CA  . THR A 1 96  ? -10.945 3.834   42.209  1.00 32.35  ? 95   THR A CA  1 
ATOM   656  C  C   . THR A 1 96  ? -9.727  4.687   41.853  1.00 30.71  ? 95   THR A C   1 
ATOM   657  O  O   . THR A 1 96  ? -9.886  5.849   41.463  1.00 30.14  ? 95   THR A O   1 
ATOM   658  C  CB  . THR A 1 96  ? -11.640 4.559   43.364  1.00 31.20  ? 95   THR A CB  1 
ATOM   659  O  OG1 . THR A 1 96  ? -10.757 4.574   44.516  1.00 29.32  ? 95   THR A OG1 1 
ATOM   660  C  CG2 . THR A 1 96  ? -12.954 3.880   43.696  1.00 30.53  ? 95   THR A CG2 1 
ATOM   661  N  N   . MET A 1 97  ? -8.531  4.143   42.093  1.00 30.48  ? 96   MET A N   1 
ATOM   662  C  CA  . MET A 1 97  ? -7.269  4.731   41.643  1.00 29.08  ? 96   MET A CA  1 
ATOM   663  C  C   . MET A 1 97  ? -6.322  3.668   41.141  1.00 29.86  ? 96   MET A C   1 
ATOM   664  O  O   . MET A 1 97  ? -6.188  2.593   41.719  1.00 32.18  ? 96   MET A O   1 
ATOM   665  C  CB  . MET A 1 97  ? -6.547  5.501   42.749  1.00 30.32  ? 96   MET A CB  1 
ATOM   666  C  CG  . MET A 1 97  ? -5.312  6.251   42.257  1.00 30.87  ? 96   MET A CG  1 
ATOM   667  S  SD  . MET A 1 97  ? -4.770  7.553   43.385  1.00 35.13  ? 96   MET A SD  1 
ATOM   668  C  CE  . MET A 1 97  ? -3.747  8.547   42.346  1.00 37.73  ? 96   MET A CE  1 
ATOM   669  N  N   . ILE A 1 98  ? -5.634  3.998   40.064  1.00 31.12  ? 97   ILE A N   1 
ATOM   670  C  CA  . ILE A 1 98  ? -4.573  3.157   39.526  1.00 31.83  ? 97   ILE A CA  1 
ATOM   671  C  C   . ILE A 1 98  ? -3.303  4.008   39.338  1.00 32.26  ? 97   ILE A C   1 
ATOM   672  O  O   . ILE A 1 98  ? -3.354  5.171   38.979  1.00 31.36  ? 97   ILE A O   1 
ATOM   673  C  CB  . ILE A 1 98  ? -4.995  2.544   38.201  1.00 35.22  ? 97   ILE A CB  1 
ATOM   674  C  CG1 . ILE A 1 98  ? -5.196  3.627   37.107  1.00 38.82  ? 97   ILE A CG1 1 
ATOM   675  C  CG2 . ILE A 1 98  ? -6.281  1.759   38.372  1.00 35.15  ? 97   ILE A CG2 1 
ATOM   676  C  CD1 . ILE A 1 98  ? -3.990  3.837   36.210  1.00 38.95  ? 97   ILE A CD1 1 
ATOM   677  N  N   . ILE A 1 99  ? -2.157  3.422   39.624  1.00 34.43  ? 98   ILE A N   1 
ATOM   678  C  CA  . ILE A 1 99  ? -0.892  4.046   39.356  1.00 33.25  ? 98   ILE A CA  1 
ATOM   679  C  C   . ILE A 1 99  ? -0.289  3.346   38.134  1.00 38.15  ? 98   ILE A C   1 
ATOM   680  O  O   . ILE A 1 99  ? -0.096  2.117   38.124  1.00 37.97  ? 98   ILE A O   1 
ATOM   681  C  CB  . ILE A 1 99  ? 0.065   3.934   40.524  1.00 31.76  ? 98   ILE A CB  1 
ATOM   682  C  CG1 . ILE A 1 99  ? -0.646  4.257   41.844  1.00 30.34  ? 98   ILE A CG1 1 
ATOM   683  C  CG2 . ILE A 1 99  ? 1.239   4.880   40.298  1.00 34.58  ? 98   ILE A CG2 1 
ATOM   684  C  CD1 . ILE A 1 99  ? -1.139  5.675   41.973  1.00 30.84  ? 98   ILE A CD1 1 
ATOM   685  N  N   . GLY A 1 100 ? 0.000   4.126   37.089  1.00 40.57  ? 99   GLY A N   1 
ATOM   686  C  CA  . GLY A 1 100 ? 0.586   3.568   35.880  1.00 39.50  ? 99   GLY A CA  1 
ATOM   687  C  C   . GLY A 1 100 ? 2.098   3.422   35.934  1.00 38.66  ? 99   GLY A C   1 
ATOM   688  O  O   . GLY A 1 100 ? 2.793   4.084   36.706  1.00 32.83  ? 99   GLY A O   1 
ATOM   689  N  N   . HIS A 1 101 ? 2.604   2.539   35.081  1.00 41.20  ? 100  HIS A N   1 
ATOM   690  C  CA  . HIS A 1 101 ? 4.051   2.375   34.882  1.00 42.78  ? 100  HIS A CA  1 
ATOM   691  C  C   . HIS A 1 101 ? 4.493   2.955   33.560  1.00 38.73  ? 100  HIS A C   1 
ATOM   692  O  O   . HIS A 1 101 ? 3.863   2.748   32.550  1.00 36.31  ? 100  HIS A O   1 
ATOM   693  C  CB  . HIS A 1 101 ? 4.436   0.919   34.909  1.00 42.79  ? 100  HIS A CB  1 
ATOM   694  C  CG  . HIS A 1 101 ? 4.673   0.402   36.282  1.00 42.93  ? 100  HIS A CG  1 
ATOM   695  N  ND1 . HIS A 1 101 ? 5.924   0.372   36.840  1.00 45.60  ? 100  HIS A ND1 1 
ATOM   696  C  CD2 . HIS A 1 101 ? 3.834   -0.108  37.209  1.00 42.04  ? 100  HIS A CD2 1 
ATOM   697  C  CE1 . HIS A 1 101 ? 5.849   -0.146  38.051  1.00 42.84  ? 100  HIS A CE1 1 
ATOM   698  N  NE2 . HIS A 1 101 ? 4.592   -0.436  38.303  1.00 39.94  ? 100  HIS A NE2 1 
ATOM   699  N  N   . VAL A 1 102 ? 5.571   3.713   33.623  1.00 39.04  ? 101  VAL A N   1 
ATOM   700  C  CA  . VAL A 1 102 ? 6.202   4.280   32.454  1.00 41.10  ? 101  VAL A CA  1 
ATOM   701  C  C   . VAL A 1 102 ? 7.599   3.641   32.372  1.00 40.67  ? 101  VAL A C   1 
ATOM   702  O  O   . VAL A 1 102 ? 8.389   3.755   33.340  1.00 35.00  ? 101  VAL A O   1 
ATOM   703  C  CB  . VAL A 1 102 ? 6.366   5.800   32.603  1.00 41.10  ? 101  VAL A CB  1 
ATOM   704  C  CG1 . VAL A 1 102 ? 7.105   6.369   31.402  1.00 42.81  ? 101  VAL A CG1 1 
ATOM   705  C  CG2 . VAL A 1 102 ? 5.022   6.458   32.815  1.00 40.29  ? 101  VAL A CG2 1 
ATOM   706  N  N   . LEU A 1 103 ? 7.892   2.954   31.257  1.00 35.75  ? 102  LEU A N   1 
ATOM   707  C  CA  . LEU A 1 103 ? 9.157   2.286   31.125  1.00 34.73  ? 102  LEU A CA  1 
ATOM   708  C  C   . LEU A 1 103 ? 9.919   2.815   29.910  1.00 36.30  ? 102  LEU A C   1 
ATOM   709  O  O   . LEU A 1 103 ? 9.871   2.235   28.854  1.00 36.34  ? 102  LEU A O   1 
ATOM   710  C  CB  . LEU A 1 103 ? 8.952   0.778   31.049  1.00 34.25  ? 102  LEU A CB  1 
ATOM   711  C  CG  . LEU A 1 103 ? 10.215  -0.075  31.316  1.00 38.00  ? 102  LEU A CG  1 
ATOM   712  C  CD1 . LEU A 1 103 ? 10.875  0.265   32.648  1.00 37.03  ? 102  LEU A CD1 1 
ATOM   713  C  CD2 . LEU A 1 103 ? 9.905   -1.579  31.261  1.00 41.04  ? 102  LEU A CD2 1 
ATOM   714  N  N   . PRO A 1 104 ? 10.657  3.918   30.070  1.00 39.63  ? 103  PRO A N   1 
ATOM   715  C  CA  . PRO A 1 104 ? 11.442  4.408   28.955  1.00 41.10  ? 103  PRO A CA  1 
ATOM   716  C  C   . PRO A 1 104 ? 12.634  3.517   28.686  1.00 44.18  ? 103  PRO A C   1 
ATOM   717  O  O   . PRO A 1 104 ? 13.262  3.058   29.623  1.00 43.56  ? 103  PRO A O   1 
ATOM   718  C  CB  . PRO A 1 104 ? 11.926  5.760   29.454  1.00 40.14  ? 103  PRO A CB  1 
ATOM   719  C  CG  . PRO A 1 104 ? 12.064  5.595   30.905  1.00 39.09  ? 103  PRO A CG  1 
ATOM   720  C  CD  . PRO A 1 104 ? 10.956  4.655   31.310  1.00 40.44  ? 103  PRO A CD  1 
ATOM   721  N  N   . ASP A 1 105 ? 12.938  3.287   27.412  1.00 45.80  ? 104  ASP A N   1 
ATOM   722  C  CA  . ASP A 1 105 ? 14.079  2.460   27.015  1.00 45.85  ? 104  ASP A CA  1 
ATOM   723  C  C   . ASP A 1 105 ? 15.391  3.069   27.469  1.00 45.67  ? 104  ASP A C   1 
ATOM   724  O  O   . ASP A 1 105 ? 15.447  4.246   27.847  1.00 51.76  ? 104  ASP A O   1 
ATOM   725  C  CB  . ASP A 1 105 ? 14.129  2.332   25.492  1.00 47.73  ? 104  ASP A CB  1 
ATOM   726  C  CG  . ASP A 1 105 ? 13.096  1.415   24.945  1.00 47.85  ? 104  ASP A CG  1 
ATOM   727  O  OD1 . ASP A 1 105 ? 13.081  0.266   25.414  1.00 62.80  ? 104  ASP A OD1 1 
ATOM   728  O  OD2 . ASP A 1 105 ? 12.329  1.812   24.049  1.00 43.35  ? 104  ASP A OD2 1 
ATOM   729  N  N   . LYS A 1 106 ? 16.452  2.271   27.447  1.00 44.00  ? 105  LYS A N   1 
ATOM   730  C  CA  . LYS A 1 106 ? 17.779  2.786   27.813  1.00 46.67  ? 105  LYS A CA  1 
ATOM   731  C  C   . LYS A 1 106 ? 18.175  3.924   26.879  1.00 48.38  ? 105  LYS A C   1 
ATOM   732  O  O   . LYS A 1 106 ? 17.843  3.866   25.687  1.00 47.50  ? 105  LYS A O   1 
ATOM   733  C  CB  . LYS A 1 106 ? 18.848  1.699   27.726  1.00 48.59  ? 105  LYS A CB  1 
ATOM   734  C  CG  . LYS A 1 106 ? 18.741  0.586   28.737  1.00 48.65  ? 105  LYS A CG  1 
ATOM   735  C  CD  . LYS A 1 106 ? 20.065  -0.130  28.873  1.00 51.06  ? 105  LYS A CD  1 
ATOM   736  C  CE  . LYS A 1 106 ? 19.954  -1.366  29.748  1.00 53.01  ? 105  LYS A CE  1 
ATOM   737  N  NZ  . LYS A 1 106 ? 19.914  -1.073  31.193  1.00 49.81  ? 105  LYS A NZ  1 
ATOM   738  N  N   . GLU A 1 107 ? 18.897  4.919   27.419  1.00 45.38  ? 106  GLU A N   1 
ATOM   739  C  CA  . GLU A 1 107 ? 19.396  6.076   26.668  1.00 49.37  ? 106  GLU A CA  1 
ATOM   740  C  C   . GLU A 1 107 ? 18.281  6.982   26.134  1.00 47.18  ? 106  GLU A C   1 
ATOM   741  O  O   . GLU A 1 107 ? 18.522  7.844   25.272  1.00 51.53  ? 106  GLU A O   1 
ATOM   742  C  CB  . GLU A 1 107 ? 20.292  5.630   25.475  1.00 60.12  ? 106  GLU A CB  1 
ATOM   743  C  CG  . GLU A 1 107 ? 21.392  4.600   25.750  1.00 65.36  ? 106  GLU A CG  1 
ATOM   744  C  CD  . GLU A 1 107 ? 22.473  5.099   26.697  1.00 70.38  ? 106  GLU A CD  1 
ATOM   745  O  OE1 . GLU A 1 107 ? 22.970  6.225   26.469  1.00 75.63  ? 106  GLU A OE1 1 
ATOM   746  O  OE2 . GLU A 1 107 ? 22.837  4.354   27.646  1.00 67.68  ? 106  GLU A OE2 1 
ATOM   747  N  N   . THR A 1 108 ? 17.054  6.780   26.591  1.00 42.72  ? 107  THR A N   1 
ATOM   748  C  CA  . THR A 1 108 ? 15.942  7.584   26.100  1.00 41.69  ? 107  THR A CA  1 
ATOM   749  C  C   . THR A 1 108 ? 15.416  8.419   27.250  1.00 43.48  ? 107  THR A C   1 
ATOM   750  O  O   . THR A 1 108 ? 15.747  8.172   28.410  1.00 42.41  ? 107  THR A O   1 
ATOM   751  C  CB  . THR A 1 108 ? 14.824  6.750   25.452  1.00 36.76  ? 107  THR A CB  1 
ATOM   752  O  OG1 . THR A 1 108 ? 13.902  6.298   26.439  1.00 39.42  ? 107  THR A OG1 1 
ATOM   753  C  CG2 . THR A 1 108 ? 15.397  5.594   24.737  1.00 34.29  ? 107  THR A CG2 1 
ATOM   754  N  N   . SER A 1 109 ? 14.624  9.430   26.908  1.00 46.36  ? 108  SER A N   1 
ATOM   755  C  CA  . SER A 1 109 ? 14.139  10.432  27.888  1.00 46.37  ? 108  SER A CA  1 
ATOM   756  C  C   . SER A 1 109 ? 12.922  9.961   28.760  1.00 47.69  ? 108  SER A C   1 
ATOM   757  O  O   . SER A 1 109 ? 11.866  9.492   28.267  1.00 43.07  ? 108  SER A O   1 
ATOM   758  C  CB  . SER A 1 109 ? 13.805  11.739  27.165  1.00 45.34  ? 108  SER A CB  1 
ATOM   759  O  OG  . SER A 1 109 ? 12.892  12.531  27.897  1.00 45.60  ? 108  SER A OG  1 
ATOM   760  N  N   . LEU A 1 110 ? 13.099  10.111  30.065  1.00 46.89  ? 109  LEU A N   1 
ATOM   761  C  CA  . LEU A 1 110 ? 12.048  9.783   31.028  1.00 46.32  ? 109  LEU A CA  1 
ATOM   762  C  C   . LEU A 1 110 ? 10.832  10.713  30.859  1.00 44.28  ? 109  LEU A C   1 
ATOM   763  O  O   . LEU A 1 110 ? 9.663   10.296  30.968  1.00 38.29  ? 109  LEU A O   1 
ATOM   764  C  CB  . LEU A 1 110 ? 12.591  9.894   32.461  1.00 46.61  ? 109  LEU A CB  1 
ATOM   765  C  CG  . LEU A 1 110 ? 13.477  8.752   32.963  1.00 46.41  ? 109  LEU A CG  1 
ATOM   766  C  CD1 . LEU A 1 110 ? 14.770  8.636   32.139  1.00 48.34  ? 109  LEU A CD1 1 
ATOM   767  C  CD2 . LEU A 1 110 ? 13.784  8.976   34.439  1.00 42.78  ? 109  LEU A CD2 1 
ATOM   768  N  N   . VAL A 1 111 ? 11.139  11.987  30.623  1.00 40.55  ? 110  VAL A N   1 
ATOM   769  C  CA  . VAL A 1 111 ? 10.134  13.007  30.509  1.00 37.29  ? 110  VAL A CA  1 
ATOM   770  C  C   . VAL A 1 111 ? 9.334   12.736  29.259  1.00 37.97  ? 110  VAL A C   1 
ATOM   771  O  O   . VAL A 1 111 ? 8.111   12.835  29.261  1.00 38.20  ? 110  VAL A O   1 
ATOM   772  C  CB  . VAL A 1 111 ? 10.769  14.404  30.482  1.00 37.24  ? 110  VAL A CB  1 
ATOM   773  C  CG1 . VAL A 1 111 ? 9.729   15.464  30.190  1.00 35.79  ? 110  VAL A CG1 1 
ATOM   774  C  CG2 . VAL A 1 111 ? 11.466  14.708  31.805  1.00 37.65  ? 110  VAL A CG2 1 
ATOM   775  N  N   . ASP A 1 112 ? 10.012  12.373  28.189  1.00 39.70  ? 111  ASP A N   1 
ATOM   776  C  CA  . ASP A 1 112 ? 9.339   12.121  26.923  1.00 43.17  ? 111  ASP A CA  1 
ATOM   777  C  C   . ASP A 1 112 ? 8.383   10.974  27.084  1.00 42.64  ? 111  ASP A C   1 
ATOM   778  O  O   . ASP A 1 112 ? 7.243   10.990  26.587  1.00 45.73  ? 111  ASP A O   1 
ATOM   779  C  CB  . ASP A 1 112 ? 10.358  11.760  25.829  1.00 43.42  ? 111  ASP A CB  1 
ATOM   780  C  CG  . ASP A 1 112 ? 11.033  12.958  25.258  1.00 46.74  ? 111  ASP A CG  1 
ATOM   781  O  OD1 . ASP A 1 112 ? 10.792  14.102  25.758  1.00 53.88  ? 111  ASP A OD1 1 
ATOM   782  O  OD2 . ASP A 1 112 ? 11.785  12.760  24.284  1.00 49.04  ? 111  ASP A OD2 1 
ATOM   783  N  N   . ALA A 1 113 ? 8.894   9.954   27.735  1.00 42.96  ? 112  ALA A N   1 
ATOM   784  C  CA  . ALA A 1 113 ? 8.111   8.771   28.008  1.00 43.88  ? 112  ALA A CA  1 
ATOM   785  C  C   . ALA A 1 113 ? 6.897   9.155   28.875  1.00 40.45  ? 112  ALA A C   1 
ATOM   786  O  O   . ALA A 1 113 ? 5.758   8.868   28.513  1.00 38.19  ? 112  ALA A O   1 
ATOM   787  C  CB  . ALA A 1 113 ? 8.992   7.739   28.701  1.00 43.83  ? 112  ALA A CB  1 
ATOM   788  N  N   . TYR A 1 114 ? 7.148   9.865   29.983  1.00 37.08  ? 113  TYR A N   1 
ATOM   789  C  CA  . TYR A 1 114 ? 6.072   10.308  30.881  1.00 33.20  ? 113  TYR A CA  1 
ATOM   790  C  C   . TYR A 1 114 ? 4.969   11.029  30.117  1.00 33.63  ? 113  TYR A C   1 
ATOM   791  O  O   . TYR A 1 114 ? 3.793   10.785  30.339  1.00 33.49  ? 113  TYR A O   1 
ATOM   792  C  CB  . TYR A 1 114 ? 6.640   11.167  31.995  1.00 32.75  ? 113  TYR A CB  1 
ATOM   793  C  CG  . TYR A 1 114 ? 5.610   11.938  32.771  1.00 33.10  ? 113  TYR A CG  1 
ATOM   794  C  CD1 . TYR A 1 114 ? 5.214   13.196  32.344  1.00 34.60  ? 113  TYR A CD1 1 
ATOM   795  C  CD2 . TYR A 1 114 ? 5.050   11.439  33.946  1.00 32.09  ? 113  TYR A CD2 1 
ATOM   796  C  CE1 . TYR A 1 114 ? 4.293   13.937  33.053  1.00 35.39  ? 113  TYR A CE1 1 
ATOM   797  C  CE2 . TYR A 1 114 ? 4.097   12.165  34.639  1.00 31.20  ? 113  TYR A CE2 1 
ATOM   798  C  CZ  . TYR A 1 114 ? 3.731   13.412  34.191  1.00 32.43  ? 113  TYR A CZ  1 
ATOM   799  O  OH  . TYR A 1 114 ? 2.806   14.173  34.838  1.00 29.53  ? 113  TYR A OH  1 
ATOM   800  N  N   . GLU A 1 115 ? 5.358   11.893  29.178  1.00 37.56  ? 114  GLU A N   1 
ATOM   801  C  CA  . GLU A 1 115 ? 4.393   12.648  28.350  1.00 33.89  ? 114  GLU A CA  1 
ATOM   802  C  C   . GLU A 1 115 ? 3.638   11.753  27.372  1.00 34.87  ? 114  GLU A C   1 
ATOM   803  O  O   . GLU A 1 115 ? 2.415   11.890  27.251  1.00 34.60  ? 114  GLU A O   1 
ATOM   804  C  CB  . GLU A 1 115 ? 5.085   13.777  27.616  1.00 32.48  ? 114  GLU A CB  1 
ATOM   805  C  CG  . GLU A 1 115 ? 5.642   14.858  28.531  1.00 33.02  ? 114  GLU A CG  1 
ATOM   806  C  CD  . GLU A 1 115 ? 4.558   15.580  29.299  1.00 33.64  ? 114  GLU A CD  1 
ATOM   807  O  OE1 . GLU A 1 115 ? 3.425   15.622  28.774  1.00 35.83  ? 114  GLU A OE1 1 
ATOM   808  O  OE2 . GLU A 1 115 ? 4.822   16.106  30.397  1.00 29.74  ? 114  GLU A OE2 1 
ATOM   809  N  N   . LYS A 1 116 ? 4.338   10.857  26.663  1.00 35.27  ? 115  LYS A N   1 
ATOM   810  C  CA  . LYS A 1 116 ? 3.631   9.912   25.787  1.00 37.06  ? 115  LYS A CA  1 
ATOM   811  C  C   . LYS A 1 116 ? 2.541   9.281   26.618  1.00 37.63  ? 115  LYS A C   1 
ATOM   812  O  O   . LYS A 1 116 ? 1.404   9.114   26.176  1.00 44.95  ? 115  LYS A O   1 
ATOM   813  C  CB  . LYS A 1 116 ? 4.521   8.798   25.240  1.00 36.12  ? 115  LYS A CB  1 
ATOM   814  C  CG  . LYS A 1 116 ? 5.226   9.093   23.934  1.00 39.44  ? 115  LYS A CG  1 
ATOM   815  C  CD  . LYS A 1 116 ? 6.503   8.260   23.739  1.00 41.55  ? 115  LYS A CD  1 
ATOM   816  C  CE  . LYS A 1 116 ? 7.556   9.035   22.969  1.00 44.83  ? 115  LYS A CE  1 
ATOM   817  N  NZ  . LYS A 1 116 ? 8.879   8.390   23.065  1.00 47.87  ? 115  LYS A NZ  1 
ATOM   818  N  N   . CYS A 1 117 ? 2.897   8.930   27.835  1.00 35.68  ? 116  CYS A N   1 
ATOM   819  C  CA  . CYS A 1 117 ? 2.017   8.153   28.642  0.50 36.29  ? 116  CYS A CA  1 
ATOM   820  C  C   . CYS A 1 117 ? 0.826   8.990   29.098  1.00 38.79  ? 116  CYS A C   1 
ATOM   821  O  O   . CYS A 1 117 ? -0.318  8.545   29.000  1.00 38.63  ? 116  CYS A O   1 
ATOM   822  C  CB  . CYS A 1 117 ? 2.776   7.616   29.824  0.50 36.15  ? 116  CYS A CB  1 
ATOM   823  S  SG  . CYS A 1 117 ? 1.740   6.441   30.642  0.91 39.95  ? 116  CYS A SG  1 
ATOM   824  N  N   . ARG A 1 118 ? 1.095   10.202  29.594  1.00 38.24  ? 117  ARG A N   1 
ATOM   825  C  CA  . ARG A 1 118 ? 0.029   11.133  29.949  1.00 36.33  ? 117  ARG A CA  1 
ATOM   826  C  C   . ARG A 1 118 ? -0.928  11.314  28.786  1.00 38.38  ? 117  ARG A C   1 
ATOM   827  O  O   . ARG A 1 118 ? -2.134  11.507  28.983  1.00 43.07  ? 117  ARG A O   1 
ATOM   828  C  CB  . ARG A 1 118 ? 0.571   12.509  30.371  1.00 36.15  ? 117  ARG A CB  1 
ATOM   829  C  CG  . ARG A 1 118 ? 1.152   12.598  31.778  1.00 37.00  ? 117  ARG A CG  1 
ATOM   830  C  CD  . ARG A 1 118 ? 0.074   12.450  32.852  1.00 39.58  ? 117  ARG A CD  1 
ATOM   831  N  NE  . ARG A 1 118 ? -0.901  13.534  32.804  1.00 36.54  ? 117  ARG A NE  1 
ATOM   832  C  CZ  . ARG A 1 118 ? -0.722  14.701  33.410  1.00 35.13  ? 117  ARG A CZ  1 
ATOM   833  N  NH1 . ARG A 1 118 ? 0.388   14.933  34.106  1.00 33.74  ? 117  ARG A NH1 1 
ATOM   834  N  NH2 . ARG A 1 118 ? -1.656  15.637  33.322  1.00 33.42  ? 117  ARG A NH2 1 
ATOM   835  N  N   . GLY A 1 119 ? -0.380  11.297  27.570  1.00 39.57  ? 118  GLY A N   1 
ATOM   836  C  CA  . GLY A 1 119 ? -1.169  11.549  26.355  1.00 36.60  ? 118  GLY A CA  1 
ATOM   837  C  C   . GLY A 1 119 ? -2.151  10.440  26.084  1.00 34.24  ? 118  GLY A C   1 
ATOM   838  O  O   . GLY A 1 119 ? -3.268  10.687  25.611  1.00 33.78  ? 118  GLY A O   1 
ATOM   839  N  N   . LEU A 1 120 ? -1.701  9.220   26.388  1.00 34.31  ? 119  LEU A N   1 
ATOM   840  C  CA  . LEU A 1 120 ? -2.478  7.995   26.222  1.00 34.34  ? 119  LEU A CA  1 
ATOM   841  C  C   . LEU A 1 120 ? -3.541  7.768   27.283  1.00 32.45  ? 119  LEU A C   1 
ATOM   842  O  O   . LEU A 1 120 ? -4.505  7.058   27.038  1.00 27.38  ? 119  LEU A O   1 
ATOM   843  C  CB  . LEU A 1 120 ? -1.540  6.795   26.260  1.00 36.40  ? 119  LEU A CB  1 
ATOM   844  C  CG  . LEU A 1 120 ? -0.724  6.501   25.016  1.00 39.60  ? 119  LEU A CG  1 
ATOM   845  C  CD1 . LEU A 1 120 ? 0.260   5.376   25.340  1.00 40.31  ? 119  LEU A CD1 1 
ATOM   846  C  CD2 . LEU A 1 120 ? -1.639  6.119   23.824  1.00 40.64  ? 119  LEU A CD2 1 
ATOM   847  N  N   . ALA A 1 121 ? -3.340  8.359   28.462  1.00 34.85  ? 120  ALA A N   1 
ATOM   848  C  CA  . ALA A 1 121 ? -4.210  8.128   29.611  1.00 33.56  ? 120  ALA A CA  1 
ATOM   849  C  C   . ALA A 1 121 ? -5.223  9.265   29.848  1.00 34.33  ? 120  ALA A C   1 
ATOM   850  O  O   . ALA A 1 121 ? -6.398  9.003   30.034  1.00 34.01  ? 120  ALA A O   1 
ATOM   851  C  CB  . ALA A 1 121 ? -3.363  7.926   30.844  1.00 33.60  ? 120  ALA A CB  1 
ATOM   852  N  N   . ASP A 1 122 ? -4.769  10.520  29.865  1.00 35.53  ? 121  ASP A N   1 
ATOM   853  C  CA  . ASP A 1 122 ? -5.650  11.668  30.199  1.00 34.20  ? 121  ASP A CA  1 
ATOM   854  C  C   . ASP A 1 122 ? -6.998  11.666  29.464  1.00 35.23  ? 121  ASP A C   1 
ATOM   855  O  O   . ASP A 1 122 ? -8.028  11.712  30.092  1.00 38.68  ? 121  ASP A O   1 
ATOM   856  C  CB  . ASP A 1 122 ? -4.945  13.010  29.970  1.00 32.88  ? 121  ASP A CB  1 
ATOM   857  C  CG  . ASP A 1 122 ? -3.999  13.401  31.114  1.00 32.07  ? 121  ASP A CG  1 
ATOM   858  O  OD1 . ASP A 1 122 ? -3.966  12.710  32.135  1.00 32.88  ? 121  ASP A OD1 1 
ATOM   859  O  OD2 . ASP A 1 122 ? -3.315  14.422  31.004  1.00 28.26  ? 121  ASP A OD2 1 
ATOM   860  N  N   . PRO A 1 123 ? -7.004  11.587  28.129  1.00 37.63  ? 122  PRO A N   1 
ATOM   861  C  CA  . PRO A 1 123 ? -8.298  11.540  27.444  1.00 35.01  ? 122  PRO A CA  1 
ATOM   862  C  C   . PRO A 1 123 ? -9.158  10.312  27.733  1.00 36.66  ? 122  PRO A C   1 
ATOM   863  O  O   . PRO A 1 123 ? -10.367 10.337  27.529  1.00 36.76  ? 122  PRO A O   1 
ATOM   864  C  CB  . PRO A 1 123 ? -7.894  11.535  25.971  1.00 34.67  ? 122  PRO A CB  1 
ATOM   865  C  CG  . PRO A 1 123 ? -6.524  10.989  25.946  1.00 34.34  ? 122  PRO A CG  1 
ATOM   866  C  CD  . PRO A 1 123 ? -5.884  11.559  27.164  1.00 36.74  ? 122  PRO A CD  1 
ATOM   867  N  N   . LYS A 1 124 ? -8.563  9.245   28.233  1.00 40.13  ? 123  LYS A N   1 
ATOM   868  C  CA  . LYS A 1 124 ? -9.243  7.936   28.282  1.00 43.83  ? 123  LYS A CA  1 
ATOM   869  C  C   . LYS A 1 124 ? -9.653  7.432   29.698  1.00 42.64  ? 123  LYS A C   1 
ATOM   870  O  O   . LYS A 1 124 ? -10.578 6.635   29.823  1.00 43.05  ? 123  LYS A O   1 
ATOM   871  C  CB  . LYS A 1 124 ? -8.339  6.908   27.589  1.00 48.08  ? 123  LYS A CB  1 
ATOM   872  C  CG  . LYS A 1 124 ? -8.306  7.029   26.059  1.00 51.88  ? 123  LYS A CG  1 
ATOM   873  C  CD  . LYS A 1 124 ? -9.002  5.862   25.379  1.00 60.03  ? 123  LYS A CD  1 
ATOM   874  C  CE  . LYS A 1 124 ? -9.845  6.253   24.167  1.00 64.13  ? 123  LYS A CE  1 
ATOM   875  N  NZ  . LYS A 1 124 ? -10.768 5.126   23.782  1.00 63.91  ? 123  LYS A NZ  1 
ATOM   876  N  N   . VAL A 1 125 ? -8.969  7.890   30.750  1.00 40.36  ? 124  VAL A N   1 
ATOM   877  C  CA  . VAL A 1 125 ? -9.099  7.292   32.091  1.00 37.37  ? 124  VAL A CA  1 
ATOM   878  C  C   . VAL A 1 125 ? -10.450 7.557   32.702  1.00 38.46  ? 124  VAL A C   1 
ATOM   879  O  O   . VAL A 1 125 ? -10.987 8.663   32.567  1.00 36.34  ? 124  VAL A O   1 
ATOM   880  C  CB  . VAL A 1 125 ? -8.003  7.768   33.093  1.00 35.69  ? 124  VAL A CB  1 
ATOM   881  C  CG1 . VAL A 1 125 ? -6.638  7.184   32.742  1.00 34.30  ? 124  VAL A CG1 1 
ATOM   882  C  CG2 . VAL A 1 125 ? -7.931  9.284   33.152  1.00 35.45  ? 124  VAL A CG2 1 
ATOM   883  N  N   . CYS A 1 126 ? -10.980 6.532   33.386  1.00 37.48  ? 125  CYS A N   1 
ATOM   884  C  CA  . CYS A 1 126 ? -12.278 6.615   34.058  1.00 35.80  ? 125  CYS A CA  1 
ATOM   885  C  C   . CYS A 1 126 ? -12.159 6.968   35.527  1.00 36.63  ? 125  CYS A C   1 
ATOM   886  O  O   . CYS A 1 126 ? -13.092 7.515   36.123  1.00 41.61  ? 125  CYS A O   1 
ATOM   887  C  CB  . CYS A 1 126 ? -13.023 5.301   33.958  1.00 36.00  ? 125  CYS A CB  1 
ATOM   888  S  SG  . CYS A 1 126 ? -13.562 4.891   32.290  0.92 37.06  ? 125  CYS A SG  1 
ATOM   889  N  N   . CYS A 1 127 ? -11.021 6.650   36.122  1.00 35.81  ? 126  CYS A N   1 
ATOM   890  C  CA  . CYS A 1 127 ? -10.798 6.953   37.519  1.00 35.12  ? 126  CYS A CA  1 
ATOM   891  C  C   . CYS A 1 127 ? -9.529  7.776   37.650  1.00 34.61  ? 126  CYS A C   1 
ATOM   892  O  O   . CYS A 1 127 ? -8.793  7.942   36.699  1.00 37.73  ? 126  CYS A O   1 
ATOM   893  C  CB  . CYS A 1 127 ? -10.700 5.661   38.342  1.00 33.57  ? 126  CYS A CB  1 
ATOM   894  S  SG  . CYS A 1 127 ? -9.273  4.615   37.976  1.00 30.25  ? 126  CYS A SG  1 
ATOM   895  N  N   . ASP A 1 128 ? -9.298  8.318   38.835  1.00 35.25  ? 127  ASP A N   1 
ATOM   896  C  CA  . ASP A 1 128 ? -8.102  9.077   39.078  1.00 35.58  ? 127  ASP A CA  1 
ATOM   897  C  C   . ASP A 1 128 ? -6.932  8.143   38.823  1.00 34.61  ? 127  ASP A C   1 
ATOM   898  O  O   . ASP A 1 128 ? -7.084  6.926   38.919  1.00 36.54  ? 127  ASP A O   1 
ATOM   899  C  CB  . ASP A 1 128 ? -8.093  9.681   40.507  1.00 36.94  ? 127  ASP A CB  1 
ATOM   900  C  CG  . ASP A 1 128 ? -8.965  10.918  40.629  1.00 35.18  ? 127  ASP A CG  1 
ATOM   901  O  OD1 . ASP A 1 128 ? -9.584  11.312  39.630  1.00 34.12  ? 127  ASP A OD1 1 
ATOM   902  O  OD2 . ASP A 1 128 ? -9.015  11.520  41.718  1.00 41.37  ? 127  ASP A OD2 1 
ATOM   903  N  N   . TYR A 1 129 ? -5.783  8.719   38.449  1.00 34.31  ? 128  TYR A N   1 
ATOM   904  C  CA  . TYR A 1 129 ? -4.547  7.947   38.210  1.00 31.90  ? 128  TYR A CA  1 
ATOM   905  C  C   . TYR A 1 129 ? -3.288  8.781   38.457  1.00 33.50  ? 128  TYR A C   1 
ATOM   906  O  O   . TYR A 1 129 ? -3.358  10.024  38.626  1.00 35.69  ? 128  TYR A O   1 
ATOM   907  C  CB  . TYR A 1 129 ? -4.514  7.348   36.816  1.00 29.74  ? 128  TYR A CB  1 
ATOM   908  C  CG  . TYR A 1 129 ? -4.029  8.286   35.769  1.00 31.09  ? 128  TYR A CG  1 
ATOM   909  C  CD1 . TYR A 1 129 ? -4.819  9.320   35.320  1.00 32.23  ? 128  TYR A CD1 1 
ATOM   910  C  CD2 . TYR A 1 129 ? -2.772  8.145   35.214  1.00 34.88  ? 128  TYR A CD2 1 
ATOM   911  C  CE1 . TYR A 1 129 ? -4.362  10.205  34.364  1.00 33.08  ? 128  TYR A CE1 1 
ATOM   912  C  CE2 . TYR A 1 129 ? -2.298  9.019   34.242  1.00 35.31  ? 128  TYR A CE2 1 
ATOM   913  C  CZ  . TYR A 1 129 ? -3.101  10.057  33.825  1.00 34.62  ? 128  TYR A CZ  1 
ATOM   914  O  OH  . TYR A 1 129 ? -2.672  10.944  32.855  1.00 32.64  ? 128  TYR A OH  1 
ATOM   915  N  N   . ALA A 1 130 ? -2.161  8.073   38.560  1.00 30.57  ? 129  ALA A N   1 
ATOM   916  C  CA  . ALA A 1 130 ? -0.826  8.666   38.661  1.00 30.18  ? 129  ALA A CA  1 
ATOM   917  C  C   . ALA A 1 130 ? 0.166   7.739   38.007  1.00 30.58  ? 129  ALA A C   1 
ATOM   918  O  O   . ALA A 1 130 ? -0.209  6.661   37.541  1.00 31.07  ? 129  ALA A O   1 
ATOM   919  C  CB  . ALA A 1 130 ? -0.428  8.911   40.122  1.00 30.47  ? 129  ALA A CB  1 
ATOM   920  N  N   . LEU A 1 131 ? 1.445   8.122   37.997  1.00 31.98  ? 130  LEU A N   1 
ATOM   921  C  CA  . LEU A 1 131 ? 2.431   7.299   37.338  1.00 33.25  ? 130  LEU A CA  1 
ATOM   922  C  C   . LEU A 1 131 ? 3.718   7.118   38.093  1.00 32.77  ? 130  LEU A C   1 
ATOM   923  O  O   . LEU A 1 131 ? 4.210   8.022   38.745  1.00 34.28  ? 130  LEU A O   1 
ATOM   924  C  CB  . LEU A 1 131 ? 2.736   7.878   35.963  1.00 35.73  ? 130  LEU A CB  1 
ATOM   925  C  CG  . LEU A 1 131 ? 1.551   8.094   35.001  1.00 38.50  ? 130  LEU A CG  1 
ATOM   926  C  CD1 . LEU A 1 131 ? 1.867   9.230   34.035  1.00 38.01  ? 130  LEU A CD1 1 
ATOM   927  C  CD2 . LEU A 1 131 ? 1.190   6.825   34.243  1.00 38.05  ? 130  LEU A CD2 1 
ATOM   928  N  N   . HIS A 1 132 ? 4.275   5.923   37.953  1.00 36.02  ? 131  HIS A N   1 
ATOM   929  C  CA  . HIS A 1 132 ? 5.689   5.674   38.222  1.00 38.02  ? 131  HIS A CA  1 
ATOM   930  C  C   . HIS A 1 132 ? 6.463   5.890   36.936  1.00 35.29  ? 131  HIS A C   1 
ATOM   931  O  O   . HIS A 1 132 ? 6.030   5.463   35.866  1.00 34.19  ? 131  HIS A O   1 
ATOM   932  C  CB  . HIS A 1 132 ? 5.939   4.225   38.645  1.00 41.09  ? 131  HIS A CB  1 
ATOM   933  C  CG  . HIS A 1 132 ? 5.031   3.736   39.722  1.00 44.47  ? 131  HIS A CG  1 
ATOM   934  N  ND1 . HIS A 1 132 ? 4.965   4.334   40.964  1.00 48.24  ? 131  HIS A ND1 1 
ATOM   935  C  CD2 . HIS A 1 132 ? 4.175   2.688   39.760  1.00 43.73  ? 131  HIS A CD2 1 
ATOM   936  C  CE1 . HIS A 1 132 ? 4.080   3.696   41.709  1.00 47.87  ? 131  HIS A CE1 1 
ATOM   937  N  NE2 . HIS A 1 132 ? 3.585   2.697   41.001  1.00 45.64  ? 131  HIS A NE2 1 
ATOM   938  N  N   . VAL A 1 133 ? 7.623   6.516   37.046  1.00 35.60  ? 132  VAL A N   1 
ATOM   939  C  CA  . VAL A 1 133 ? 8.572   6.538   35.947  1.00 37.35  ? 132  VAL A CA  1 
ATOM   940  C  C   . VAL A 1 133 ? 9.743   5.585   36.216  1.00 37.76  ? 132  VAL A C   1 
ATOM   941  O  O   . VAL A 1 133 ? 10.375  5.617   37.266  1.00 30.97  ? 132  VAL A O   1 
ATOM   942  C  CB  . VAL A 1 133 ? 9.105   7.938   35.648  1.00 36.45  ? 132  VAL A CB  1 
ATOM   943  C  CG1 . VAL A 1 133 ? 9.847   7.924   34.326  1.00 38.70  ? 132  VAL A CG1 1 
ATOM   944  C  CG2 . VAL A 1 133 ? 7.962   8.902   35.536  1.00 39.40  ? 132  VAL A CG2 1 
ATOM   945  N  N   . GLY A 1 134 ? 10.015  4.751   35.217  1.00 41.49  ? 133  GLY A N   1 
ATOM   946  C  CA  . GLY A 1 134 ? 11.086  3.785   35.290  1.00 43.99  ? 133  GLY A CA  1 
ATOM   947  C  C   . GLY A 1 134 ? 12.424  4.368   34.897  1.00 44.98  ? 133  GLY A C   1 
ATOM   948  O  O   . GLY A 1 134 ? 12.535  5.054   33.878  1.00 42.20  ? 133  GLY A O   1 
ATOM   949  N  N   . ILE A 1 135 ? 13.427  4.141   35.749  1.00 45.65  ? 134  ILE A N   1 
ATOM   950  C  CA  . ILE A 1 135 ? 14.784  4.608   35.497  1.00 43.40  ? 134  ILE A CA  1 
ATOM   951  C  C   . ILE A 1 135 ? 15.541  3.411   34.989  1.00 44.27  ? 134  ILE A C   1 
ATOM   952  O  O   . ILE A 1 135 ? 16.067  2.601   35.765  1.00 45.79  ? 134  ILE A O   1 
ATOM   953  C  CB  . ILE A 1 135 ? 15.435  5.206   36.748  1.00 44.48  ? 134  ILE A CB  1 
ATOM   954  C  CG1 . ILE A 1 135 ? 14.675  6.451   37.199  1.00 46.61  ? 134  ILE A CG1 1 
ATOM   955  C  CG2 . ILE A 1 135 ? 16.881  5.584   36.483  1.00 49.72  ? 134  ILE A CG2 1 
ATOM   956  C  CD1 . ILE A 1 135 ? 15.072  6.983   38.572  1.00 46.36  ? 134  ILE A CD1 1 
ATOM   957  N  N   . THR A 1 136 ? 15.566  3.288   33.668  1.00 48.10  ? 135  THR A N   1 
ATOM   958  C  CA  . THR A 1 136 ? 16.187  2.138   33.012  1.00 49.13  ? 135  THR A CA  1 
ATOM   959  C  C   . THR A 1 136 ? 17.666  2.340   32.689  1.00 48.30  ? 135  THR A C   1 
ATOM   960  O  O   . THR A 1 136 ? 18.337  1.429   32.224  1.00 47.24  ? 135  THR A O   1 
ATOM   961  C  CB  . THR A 1 136 ? 15.439  1.767   31.734  1.00 50.13  ? 135  THR A CB  1 
ATOM   962  O  OG1 . THR A 1 136 ? 15.449  2.872   30.822  1.00 53.18  ? 135  THR A OG1 1 
ATOM   963  C  CG2 . THR A 1 136 ? 14.014  1.421   32.076  1.00 54.75  ? 135  THR A CG2 1 
ATOM   964  N  N   . TRP A 1 137 ? 18.175  3.540   32.932  1.00 47.91  ? 136  TRP A N   1 
ATOM   965  C  CA  . TRP A 1 137 ? 19.573  3.815   32.695  1.00 45.82  ? 136  TRP A CA  1 
ATOM   966  C  C   . TRP A 1 137 ? 20.010  4.988   33.525  1.00 48.33  ? 136  TRP A C   1 
ATOM   967  O  O   . TRP A 1 137 ? 19.201  5.638   34.188  1.00 45.71  ? 136  TRP A O   1 
ATOM   968  C  CB  . TRP A 1 137 ? 19.825  4.111   31.226  1.00 43.51  ? 136  TRP A CB  1 
ATOM   969  C  CG  . TRP A 1 137 ? 19.117  5.314   30.725  1.00 43.40  ? 136  TRP A CG  1 
ATOM   970  C  CD1 . TRP A 1 137 ? 17.778  5.462   30.570  1.00 40.00  ? 136  TRP A CD1 1 
ATOM   971  C  CD2 . TRP A 1 137 ? 19.710  6.543   30.289  1.00 47.29  ? 136  TRP A CD2 1 
ATOM   972  N  NE1 . TRP A 1 137 ? 17.491  6.689   30.068  1.00 42.85  ? 136  TRP A NE1 1 
ATOM   973  C  CE2 . TRP A 1 137 ? 18.654  7.384   29.876  1.00 46.26  ? 136  TRP A CE2 1 
ATOM   974  C  CE3 . TRP A 1 137 ? 21.033  7.010   30.176  1.00 50.39  ? 136  TRP A CE3 1 
ATOM   975  C  CZ2 . TRP A 1 137 ? 18.869  8.676   29.353  1.00 46.13  ? 136  TRP A CZ2 1 
ATOM   976  C  CZ3 . TRP A 1 137 ? 21.246  8.305   29.639  1.00 51.16  ? 136  TRP A CZ3 1 
ATOM   977  C  CH2 . TRP A 1 137 ? 20.165  9.117   29.244  1.00 47.66  ? 136  TRP A CH2 1 
ATOM   978  N  N   . TRP A 1 138 ? 21.298  5.285   33.440  1.00 50.75  ? 137  TRP A N   1 
ATOM   979  C  CA  . TRP A 1 138 ? 21.877  6.270   34.312  1.00 48.67  ? 137  TRP A CA  1 
ATOM   980  C  C   . TRP A 1 138 ? 23.012  7.061   33.665  1.00 53.57  ? 137  TRP A C   1 
ATOM   981  O  O   . TRP A 1 138 ? 24.022  6.530   33.227  1.00 53.50  ? 137  TRP A O   1 
ATOM   982  C  CB  . TRP A 1 138 ? 22.348  5.605   35.593  1.00 46.67  ? 137  TRP A CB  1 
ATOM   983  C  CG  . TRP A 1 138 ? 22.828  6.581   36.576  1.00 45.68  ? 137  TRP A CG  1 
ATOM   984  C  CD1 . TRP A 1 138 ? 24.107  6.728   37.018  1.00 45.07  ? 137  TRP A CD1 1 
ATOM   985  C  CD2 . TRP A 1 138 ? 22.055  7.603   37.215  1.00 42.23  ? 137  TRP A CD2 1 
ATOM   986  N  NE1 . TRP A 1 138 ? 24.179  7.777   37.891  1.00 44.36  ? 137  TRP A NE1 1 
ATOM   987  C  CE2 . TRP A 1 138 ? 22.934  8.343   38.020  1.00 42.64  ? 137  TRP A CE2 1 
ATOM   988  C  CE3 . TRP A 1 138 ? 20.708  7.965   37.179  1.00 42.62  ? 137  TRP A CE3 1 
ATOM   989  C  CZ2 . TRP A 1 138 ? 22.511  9.436   38.783  1.00 41.45  ? 137  TRP A CZ2 1 
ATOM   990  C  CZ3 . TRP A 1 138 ? 20.288  9.050   37.947  1.00 43.15  ? 137  TRP A CZ3 1 
ATOM   991  C  CH2 . TRP A 1 138 ? 21.184  9.763   38.735  1.00 42.53  ? 137  TRP A CH2 1 
ATOM   992  N  N   . ALA A 1 139 ? 22.784  8.365   33.617  1.00 59.97  ? 138  ALA A N   1 
ATOM   993  C  CA  . ALA A 1 139 ? 23.790  9.361   33.334  1.00 60.86  ? 138  ALA A CA  1 
ATOM   994  C  C   . ALA A 1 139 ? 23.361  10.577  34.140  1.00 62.83  ? 138  ALA A C   1 
ATOM   995  O  O   . ALA A 1 139 ? 22.338  10.554  34.804  1.00 62.51  ? 138  ALA A O   1 
ATOM   996  C  CB  . ALA A 1 139 ? 23.830  9.676   31.850  1.00 61.87  ? 138  ALA A CB  1 
ATOM   997  N  N   . PRO A 1 140 ? 24.128  11.658  34.088  1.00 69.52  ? 139  PRO A N   1 
ATOM   998  C  CA  . PRO A 1 140 ? 23.622  12.804  34.846  1.00 61.26  ? 139  PRO A CA  1 
ATOM   999  C  C   . PRO A 1 140 ? 22.398  13.481  34.187  1.00 56.21  ? 139  PRO A C   1 
ATOM   1000 O  O   . PRO A 1 140 ? 21.636  14.140  34.882  1.00 54.65  ? 139  PRO A O   1 
ATOM   1001 C  CB  . PRO A 1 140 ? 24.845  13.720  34.936  1.00 66.49  ? 139  PRO A CB  1 
ATOM   1002 C  CG  . PRO A 1 140 ? 26.027  12.818  34.667  1.00 67.38  ? 139  PRO A CG  1 
ATOM   1003 C  CD  . PRO A 1 140 ? 25.521  11.839  33.654  1.00 68.73  ? 139  PRO A CD  1 
ATOM   1004 N  N   . LYS A 1 141 ? 22.199  13.322  32.876  1.00 55.41  ? 140  LYS A N   1 
ATOM   1005 C  CA  . LYS A 1 141 ? 20.944  13.775  32.228  1.00 60.29  ? 140  LYS A CA  1 
ATOM   1006 C  C   . LYS A 1 141 ? 19.691  13.180  32.911  1.00 58.10  ? 140  LYS A C   1 
ATOM   1007 O  O   . LYS A 1 141 ? 18.655  13.848  33.072  1.00 54.94  ? 140  LYS A O   1 
ATOM   1008 C  CB  . LYS A 1 141 ? 20.914  13.398  30.734  1.00 66.61  ? 140  LYS A CB  1 
ATOM   1009 C  CG  . LYS A 1 141 ? 19.660  13.888  29.988  1.00 78.19  ? 140  LYS A CG  1 
ATOM   1010 C  CD  . LYS A 1 141 ? 19.691  13.644  28.468  1.00 91.83  ? 140  LYS A CD  1 
ATOM   1011 C  CE  . LYS A 1 141 ? 18.586  14.442  27.748  1.00 93.76  ? 140  LYS A CE  1 
ATOM   1012 N  NZ  . LYS A 1 141 ? 18.384  14.087  26.315  1.00 85.24  ? 140  LYS A NZ  1 
ATOM   1013 N  N   . VAL A 1 142 ? 19.798  11.904  33.283  1.00 51.24  ? 141  VAL A N   1 
ATOM   1014 C  CA  . VAL A 1 142 ? 18.704  11.182  33.909  1.00 45.23  ? 141  VAL A CA  1 
ATOM   1015 C  C   . VAL A 1 142 ? 18.414  11.795  35.264  1.00 41.15  ? 141  VAL A C   1 
ATOM   1016 O  O   . VAL A 1 142 ? 17.267  12.063  35.585  1.00 42.10  ? 141  VAL A O   1 
ATOM   1017 C  CB  . VAL A 1 142 ? 19.008  9.668   34.030  1.00 45.85  ? 141  VAL A CB  1 
ATOM   1018 C  CG1 . VAL A 1 142 ? 17.978  8.952   34.902  1.00 45.75  ? 141  VAL A CG1 1 
ATOM   1019 C  CG2 . VAL A 1 142 ? 19.044  9.033   32.644  1.00 46.85  ? 141  VAL A CG2 1 
ATOM   1020 N  N   . LYS A 1 143 ? 19.449  12.054  36.038  1.00 38.22  ? 142  LYS A N   1 
ATOM   1021 C  CA  . LYS A 1 143 ? 19.285  12.787  37.284  1.00 38.76  ? 142  LYS A CA  1 
ATOM   1022 C  C   . LYS A 1 143 ? 18.485  14.042  37.028  1.00 41.70  ? 142  LYS A C   1 
ATOM   1023 O  O   . LYS A 1 143 ? 17.631  14.418  37.813  1.00 42.37  ? 142  LYS A O   1 
ATOM   1024 C  CB  . LYS A 1 143 ? 20.646  13.166  37.847  1.00 41.29  ? 142  LYS A CB  1 
ATOM   1025 C  CG  . LYS A 1 143 ? 20.695  13.837  39.205  1.00 42.53  ? 142  LYS A CG  1 
ATOM   1026 C  CD  . LYS A 1 143 ? 22.162  13.953  39.700  1.00 45.66  ? 142  LYS A CD  1 
ATOM   1027 C  CE  . LYS A 1 143 ? 22.280  14.854  40.935  1.00 51.59  ? 142  LYS A CE  1 
ATOM   1028 N  NZ  . LYS A 1 143 ? 23.061  14.275  42.084  1.00 51.95  ? 142  LYS A NZ  1 
ATOM   1029 N  N   . ALA A 1 144 ? 18.781  14.723  35.928  1.00 46.24  ? 143  ALA A N   1 
ATOM   1030 C  CA  . ALA A 1 144 ? 18.155  16.015  35.666  1.00 48.70  ? 143  ALA A CA  1 
ATOM   1031 C  C   . ALA A 1 144 ? 16.668  15.822  35.444  1.00 45.53  ? 143  ALA A C   1 
ATOM   1032 O  O   . ALA A 1 144 ? 15.836  16.483  36.049  1.00 47.57  ? 143  ALA A O   1 
ATOM   1033 C  CB  . ALA A 1 144 ? 18.809  16.690  34.465  1.00 50.72  ? 143  ALA A CB  1 
ATOM   1034 N  N   . GLU A 1 145 ? 16.347  14.909  34.549  1.00 44.81  ? 144  GLU A N   1 
ATOM   1035 C  CA  . GLU A 1 145 ? 14.964  14.597  34.246  1.00 45.37  ? 144  GLU A CA  1 
ATOM   1036 C  C   . GLU A 1 145 ? 14.174  14.117  35.488  1.00 41.10  ? 144  GLU A C   1 
ATOM   1037 O  O   . GLU A 1 145 ? 12.990  14.399  35.611  1.00 36.75  ? 144  GLU A O   1 
ATOM   1038 C  CB  . GLU A 1 145 ? 14.925  13.526  33.157  1.00 50.22  ? 144  GLU A CB  1 
ATOM   1039 C  CG  . GLU A 1 145 ? 15.545  13.926  31.819  1.00 46.92  ? 144  GLU A CG  1 
ATOM   1040 C  CD  . GLU A 1 145 ? 15.147  12.947  30.737  1.00 52.16  ? 144  GLU A CD  1 
ATOM   1041 O  OE1 . GLU A 1 145 ? 15.445  11.712  30.882  1.00 42.55  ? 144  GLU A OE1 1 
ATOM   1042 O  OE2 . GLU A 1 145 ? 14.479  13.418  29.767  1.00 53.92  ? 144  GLU A OE2 1 
ATOM   1043 N  N   . MET A 1 146 ? 14.835  13.368  36.380  1.00 40.61  ? 145  MET A N   1 
ATOM   1044 C  CA  . MET A 1 146 ? 14.247  12.916  37.632  1.00 37.93  ? 145  MET A CA  1 
ATOM   1045 C  C   . MET A 1 146 ? 13.765  14.131  38.409  1.00 42.25  ? 145  MET A C   1 
ATOM   1046 O  O   . MET A 1 146 ? 12.603  14.189  38.845  1.00 45.77  ? 145  MET A O   1 
ATOM   1047 C  CB  . MET A 1 146 ? 15.268  12.173  38.483  1.00 36.21  ? 145  MET A CB  1 
ATOM   1048 C  CG  . MET A 1 146 ? 15.539  10.744  38.067  1.00 38.07  ? 145  MET A CG  1 
ATOM   1049 S  SD  . MET A 1 146 ? 16.807  9.982   39.098  1.00 41.35  ? 145  MET A SD  1 
ATOM   1050 C  CE  . MET A 1 146 ? 15.908  9.825   40.624  1.00 45.03  ? 145  MET A CE  1 
ATOM   1051 N  N   . GLU A 1 147 ? 14.666  15.099  38.564  1.00 47.20  ? 146  GLU A N   1 
ATOM   1052 C  CA  . GLU A 1 147 ? 14.382  16.348  39.278  1.00 50.09  ? 146  GLU A CA  1 
ATOM   1053 C  C   . GLU A 1 147 ? 13.222  17.086  38.625  1.00 44.50  ? 146  GLU A C   1 
ATOM   1054 O  O   . GLU A 1 147 ? 12.338  17.567  39.313  1.00 45.59  ? 146  GLU A O   1 
ATOM   1055 C  CB  . GLU A 1 147 ? 15.616  17.253  39.330  1.00 58.84  ? 146  GLU A CB  1 
ATOM   1056 C  CG  . GLU A 1 147 ? 16.813  16.684  40.104  1.00 71.32  ? 146  GLU A CG  1 
ATOM   1057 C  CD  . GLU A 1 147 ? 18.106  17.498  39.937  1.00 81.43  ? 146  GLU A CD  1 
ATOM   1058 O  OE1 . GLU A 1 147 ? 18.197  18.331  39.001  1.00 92.03  ? 146  GLU A OE1 1 
ATOM   1059 O  OE2 . GLU A 1 147 ? 19.054  17.289  40.732  1.00 82.01  ? 146  GLU A OE2 1 
ATOM   1060 N  N   . THR A 1 148 ? 13.209  17.142  37.296  1.00 43.22  ? 147  THR A N   1 
ATOM   1061 C  CA  . THR A 1 148 ? 12.117  17.784  36.551  1.00 43.53  ? 147  THR A CA  1 
ATOM   1062 C  C   . THR A 1 148 ? 10.751  17.155  36.834  1.00 40.61  ? 147  THR A C   1 
ATOM   1063 O  O   . THR A 1 148 ? 9.761   17.864  37.048  1.00 40.82  ? 147  THR A O   1 
ATOM   1064 C  CB  . THR A 1 148 ? 12.318  17.703  35.026  1.00 45.17  ? 147  THR A CB  1 
ATOM   1065 O  OG1 . THR A 1 148 ? 13.552  18.312  34.645  1.00 47.58  ? 147  THR A OG1 1 
ATOM   1066 C  CG2 . THR A 1 148 ? 11.163  18.378  34.291  1.00 46.90  ? 147  THR A CG2 1 
ATOM   1067 N  N   . LEU A 1 149 ? 10.716  15.826  36.820  1.00 36.47  ? 148  LEU A N   1 
ATOM   1068 C  CA  . LEU A 1 149 ? 9.478   15.085  37.008  1.00 35.65  ? 148  LEU A CA  1 
ATOM   1069 C  C   . LEU A 1 149 ? 8.912   15.276  38.432  1.00 40.28  ? 148  LEU A C   1 
ATOM   1070 O  O   . LEU A 1 149 ? 7.725   15.482  38.614  1.00 39.28  ? 148  LEU A O   1 
ATOM   1071 C  CB  . LEU A 1 149 ? 9.715   13.612  36.735  1.00 33.65  ? 148  LEU A CB  1 
ATOM   1072 C  CG  . LEU A 1 149 ? 9.921   13.254  35.269  1.00 33.73  ? 148  LEU A CG  1 
ATOM   1073 C  CD1 . LEU A 1 149 ? 10.703  11.955  35.143  1.00 34.34  ? 148  LEU A CD1 1 
ATOM   1074 C  CD2 . LEU A 1 149 ? 8.588   13.111  34.548  1.00 35.17  ? 148  LEU A CD2 1 
ATOM   1075 N  N   . VAL A 1 150 ? 9.785   15.224  39.437  1.00 43.15  ? 149  VAL A N   1 
ATOM   1076 C  CA  . VAL A 1 150 ? 9.383   15.475  40.806  1.00 42.06  ? 149  VAL A CA  1 
ATOM   1077 C  C   . VAL A 1 150 ? 8.927   16.908  40.972  1.00 44.41  ? 149  VAL A C   1 
ATOM   1078 O  O   . VAL A 1 150 ? 7.851   17.150  41.493  1.00 47.62  ? 149  VAL A O   1 
ATOM   1079 C  CB  . VAL A 1 150 ? 10.520  15.186  41.809  1.00 43.22  ? 149  VAL A CB  1 
ATOM   1080 C  CG1 . VAL A 1 150 ? 10.109  15.534  43.242  1.00 39.77  ? 149  VAL A CG1 1 
ATOM   1081 C  CG2 . VAL A 1 150 ? 10.944  13.716  41.709  1.00 47.36  ? 149  VAL A CG2 1 
ATOM   1082 N  N   . ARG A 1 151 ? 9.746   17.853  40.542  1.00 45.55  ? 150  ARG A N   1 
ATOM   1083 C  CA  . ARG A 1 151 ? 9.444   19.263  40.768  1.00 50.23  ? 150  ARG A CA  1 
ATOM   1084 C  C   . ARG A 1 151 ? 8.234   19.765  39.964  1.00 47.93  ? 150  ARG A C   1 
ATOM   1085 O  O   . ARG A 1 151 ? 7.498   20.609  40.429  1.00 40.55  ? 150  ARG A O   1 
ATOM   1086 C  CB  . ARG A 1 151 ? 10.637  20.144  40.442  1.00 52.91  ? 150  ARG A CB  1 
ATOM   1087 C  CG  . ARG A 1 151 ? 10.652  21.474  41.179  1.00 61.05  ? 150  ARG A CG  1 
ATOM   1088 C  CD  . ARG A 1 151 ? 11.792  22.360  40.698  1.00 73.60  ? 150  ARG A CD  1 
ATOM   1089 N  NE  . ARG A 1 151 ? 11.947  22.492  39.217  1.00 74.52  ? 150  ARG A NE  1 
ATOM   1090 C  CZ  . ARG A 1 151 ? 12.844  21.833  38.447  1.00 67.93  ? 150  ARG A CZ  1 
ATOM   1091 N  NH1 . ARG A 1 151 ? 13.696  20.905  38.941  1.00 61.37  ? 150  ARG A NH1 1 
ATOM   1092 N  NH2 . ARG A 1 151 ? 12.862  22.081  37.132  1.00 62.76  ? 150  ARG A NH2 1 
ATOM   1093 N  N   . GLU A 1 152 ? 8.046   19.244  38.757  1.00 48.95  ? 151  GLU A N   1 
ATOM   1094 C  CA  . GLU A 1 152 ? 7.132   19.835  37.791  1.00 44.79  ? 151  GLU A CA  1 
ATOM   1095 C  C   . GLU A 1 152 ? 6.056   18.922  37.283  1.00 43.92  ? 151  GLU A C   1 
ATOM   1096 O  O   . GLU A 1 152 ? 5.110   19.405  36.685  1.00 48.07  ? 151  GLU A O   1 
ATOM   1097 C  CB  . GLU A 1 152 ? 7.908   20.299  36.565  1.00 47.98  ? 151  GLU A CB  1 
ATOM   1098 C  CG  . GLU A 1 152 ? 8.714   21.587  36.718  1.00 50.08  ? 151  GLU A CG  1 
ATOM   1099 C  CD  . GLU A 1 152 ? 9.619   21.839  35.532  1.00 49.05  ? 151  GLU A CD  1 
ATOM   1100 O  OE1 . GLU A 1 152 ? 9.080   21.738  34.399  1.00 52.17  ? 151  GLU A OE1 1 
ATOM   1101 O  OE2 . GLU A 1 152 ? 10.837  22.102  35.734  1.00 43.81  ? 151  GLU A OE2 1 
ATOM   1102 N  N   . LYS A 1 153 ? 6.169   17.617  37.479  1.00 44.89  ? 152  LYS A N   1 
ATOM   1103 C  CA  . LYS A 1 153 ? 5.229   16.674  36.825  1.00 45.17  ? 152  LYS A CA  1 
ATOM   1104 C  C   . LYS A 1 153 ? 4.447   15.747  37.777  1.00 38.50  ? 152  LYS A C   1 
ATOM   1105 O  O   . LYS A 1 153 ? 3.791   14.818  37.315  1.00 34.09  ? 152  LYS A O   1 
ATOM   1106 C  CB  . LYS A 1 153 ? 5.972   15.802  35.791  1.00 46.08  ? 152  LYS A CB  1 
ATOM   1107 C  CG  . LYS A 1 153 ? 6.828   16.579  34.826  1.00 42.90  ? 152  LYS A CG  1 
ATOM   1108 C  CD  . LYS A 1 153 ? 5.979   17.335  33.838  1.00 44.79  ? 152  LYS A CD  1 
ATOM   1109 C  CE  . LYS A 1 153 ? 6.858   18.036  32.799  1.00 45.08  ? 152  LYS A CE  1 
ATOM   1110 N  NZ  . LYS A 1 153 ? 6.024   18.464  31.647  1.00 47.96  ? 152  LYS A NZ  1 
ATOM   1111 N  N   . GLY A 1 154 ? 4.499   16.008  39.075  1.00 34.17  ? 153  GLY A N   1 
ATOM   1112 C  CA  . GLY A 1 154 ? 3.739   15.202  40.024  1.00 34.43  ? 153  GLY A CA  1 
ATOM   1113 C  C   . GLY A 1 154 ? 4.156   13.731  40.081  1.00 33.99  ? 153  GLY A C   1 
ATOM   1114 O  O   . GLY A 1 154 ? 3.318   12.826  40.107  1.00 36.34  ? 153  GLY A O   1 
ATOM   1115 N  N   . VAL A 1 155 ? 5.455   13.506  40.082  1.00 31.87  ? 154  VAL A N   1 
ATOM   1116 C  CA  . VAL A 1 155 ? 6.005   12.192  40.192  1.00 30.25  ? 154  VAL A CA  1 
ATOM   1117 C  C   . VAL A 1 155 ? 6.758   12.189  41.493  1.00 29.69  ? 154  VAL A C   1 
ATOM   1118 O  O   . VAL A 1 155 ? 7.501   13.079  41.777  1.00 29.67  ? 154  VAL A O   1 
ATOM   1119 C  CB  . VAL A 1 155 ? 6.929   11.864  38.986  1.00 29.16  ? 154  VAL A CB  1 
ATOM   1120 C  CG1 . VAL A 1 155 ? 7.568   10.490  39.120  1.00 28.23  ? 154  VAL A CG1 1 
ATOM   1121 C  CG2 . VAL A 1 155 ? 6.122   11.920  37.700  1.00 31.27  ? 154  VAL A CG2 1 
ATOM   1122 N  N   . ASN A 1 156 ? 6.536   11.178  42.295  1.00 35.21  ? 155  ASN A N   1 
ATOM   1123 C  CA  . ASN A 1 156 ? 7.347   10.964  43.458  1.00 37.67  ? 155  ASN A CA  1 
ATOM   1124 C  C   . ASN A 1 156 ? 7.796   9.505   43.628  1.00 38.43  ? 155  ASN A C   1 
ATOM   1125 O  O   . ASN A 1 156 ? 8.468   9.192   44.609  1.00 39.35  ? 155  ASN A O   1 
ATOM   1126 C  CB  . ASN A 1 156 ? 6.616   11.475  44.693  1.00 40.70  ? 155  ASN A CB  1 
ATOM   1127 C  CG  . ASN A 1 156 ? 5.423   10.608  45.083  1.00 43.00  ? 155  ASN A CG  1 
ATOM   1128 O  OD1 . ASN A 1 156 ? 5.012   9.717   44.341  1.00 44.87  ? 155  ASN A OD1 1 
ATOM   1129 N  ND2 . ASN A 1 156 ? 4.861   10.883  46.251  1.00 44.70  ? 155  ASN A ND2 1 
ATOM   1130 N  N   . SER A 1 157 ? 7.460   8.620   42.693  1.00 36.86  ? 156  SER A N   1 
ATOM   1131 C  CA  . SER A 1 157 ? 8.114   7.324   42.696  1.00 40.25  ? 156  SER A CA  1 
ATOM   1132 C  C   . SER A 1 157 ? 8.755   6.958   41.344  1.00 40.17  ? 156  SER A C   1 
ATOM   1133 O  O   . SER A 1 157 ? 8.241   7.271   40.266  1.00 38.60  ? 156  SER A O   1 
ATOM   1134 C  CB  . SER A 1 157 ? 7.180   6.203   43.202  1.00 41.43  ? 156  SER A CB  1 
ATOM   1135 O  OG  . SER A 1 157 ? 6.025   6.058   42.427  1.00 45.87  ? 156  SER A OG  1 
ATOM   1136 N  N   . PHE A 1 158 ? 9.891   6.279   41.449  1.00 36.39  ? 157  PHE A N   1 
ATOM   1137 C  CA  . PHE A 1 158 ? 10.614  5.788   40.327  1.00 35.12  ? 157  PHE A CA  1 
ATOM   1138 C  C   . PHE A 1 158 ? 10.785  4.284   40.423  1.00 33.17  ? 157  PHE A C   1 
ATOM   1139 O  O   . PHE A 1 158 ? 10.998  3.757   41.490  1.00 35.45  ? 157  PHE A O   1 
ATOM   1140 C  CB  . PHE A 1 158 ? 11.976  6.463   40.314  1.00 39.43  ? 157  PHE A CB  1 
ATOM   1141 C  CG  . PHE A 1 158 ? 11.910  7.933   39.995  1.00 40.73  ? 157  PHE A CG  1 
ATOM   1142 C  CD1 . PHE A 1 158 ? 11.644  8.351   38.708  1.00 40.14  ? 157  PHE A CD1 1 
ATOM   1143 C  CD2 . PHE A 1 158 ? 12.096  8.883   40.980  1.00 41.95  ? 157  PHE A CD2 1 
ATOM   1144 C  CE1 . PHE A 1 158 ? 11.577  9.687   38.420  1.00 40.87  ? 157  PHE A CE1 1 
ATOM   1145 C  CE2 . PHE A 1 158 ? 12.012  10.232  40.702  1.00 39.96  ? 157  PHE A CE2 1 
ATOM   1146 C  CZ  . PHE A 1 158 ? 11.748  10.631  39.423  1.00 41.08  ? 157  PHE A CZ  1 
ATOM   1147 N  N   . GLN A 1 159 ? 10.683  3.590   39.302  1.00 32.57  ? 158  GLN A N   1 
ATOM   1148 C  CA  . GLN A 1 159 ? 10.766  2.146   39.288  1.00 31.48  ? 158  GLN A CA  1 
ATOM   1149 C  C   . GLN A 1 159 ? 12.079  1.685   38.668  1.00 33.60  ? 158  GLN A C   1 
ATOM   1150 O  O   . GLN A 1 159 ? 12.362  1.966   37.523  1.00 38.74  ? 158  GLN A O   1 
ATOM   1151 C  CB  . GLN A 1 159 ? 9.571   1.559   38.530  1.00 30.33  ? 158  GLN A CB  1 
ATOM   1152 C  CG  . GLN A 1 159 ? 9.625   0.043   38.406  1.00 31.40  ? 158  GLN A CG  1 
ATOM   1153 C  CD  . GLN A 1 159 ? 9.382   -0.652  39.723  1.00 31.71  ? 158  GLN A CD  1 
ATOM   1154 O  OE1 . GLN A 1 159 ? 8.328   -0.501  40.295  1.00 28.33  ? 158  GLN A OE1 1 
ATOM   1155 N  NE2 . GLN A 1 159 ? 10.382  -1.401  40.227  1.00 36.75  ? 158  GLN A NE2 1 
ATOM   1156 N  N   . MET A 1 160 ? 12.882  0.967   39.428  1.00 35.63  ? 159  MET A N   1 
ATOM   1157 C  CA  . MET A 1 160 ? 14.157  0.407   38.941  1.00 36.65  ? 159  MET A CA  1 
ATOM   1158 C  C   . MET A 1 160 ? 14.104  -1.134  38.842  1.00 35.20  ? 159  MET A C   1 
ATOM   1159 O  O   . MET A 1 160 ? 13.309  -1.781  39.509  1.00 34.41  ? 159  MET A O   1 
ATOM   1160 C  CB  . MET A 1 160 ? 15.317  0.848   39.847  1.00 37.67  ? 159  MET A CB  1 
ATOM   1161 C  CG  . MET A 1 160 ? 15.707  2.308   39.688  1.00 40.54  ? 159  MET A CG  1 
ATOM   1162 S  SD  . MET A 1 160 ? 14.516  3.539   40.249  0.55 42.66  ? 159  MET A SD  1 
ATOM   1163 C  CE  . MET A 1 160 ? 14.808  3.412   42.001  1.00 45.71  ? 159  MET A CE  1 
ATOM   1164 N  N   . PHE A 1 161 ? 14.968  -1.705  38.010  1.00 35.16  ? 160  PHE A N   1 
ATOM   1165 C  CA  . PHE A 1 161 ? 15.032  -3.146  37.835  1.00 34.84  ? 160  PHE A CA  1 
ATOM   1166 C  C   . PHE A 1 161 ? 16.432  -3.696  38.009  1.00 34.86  ? 160  PHE A C   1 
ATOM   1167 O  O   . PHE A 1 161 ? 17.394  -3.124  37.486  1.00 36.83  ? 160  PHE A O   1 
ATOM   1168 C  CB  . PHE A 1 161 ? 14.585  -3.470  36.445  1.00 37.59  ? 160  PHE A CB  1 
ATOM   1169 C  CG  . PHE A 1 161 ? 13.153  -3.154  36.192  1.00 37.11  ? 160  PHE A CG  1 
ATOM   1170 C  CD1 . PHE A 1 161 ? 12.771  -1.898  35.801  1.00 36.41  ? 160  PHE A CD1 1 
ATOM   1171 C  CD2 . PHE A 1 161 ? 12.195  -4.139  36.327  1.00 36.84  ? 160  PHE A CD2 1 
ATOM   1172 C  CE1 . PHE A 1 161 ? 11.441  -1.622  35.550  1.00 39.41  ? 160  PHE A CE1 1 
ATOM   1173 C  CE2 . PHE A 1 161 ? 10.871  -3.876  36.064  1.00 37.12  ? 160  PHE A CE2 1 
ATOM   1174 C  CZ  . PHE A 1 161 ? 10.488  -2.617  35.670  1.00 36.90  ? 160  PHE A CZ  1 
ATOM   1175 N  N   . MET A 1 162 ? 16.565  -4.814  38.713  1.00 35.54  ? 161  MET A N   1 
ATOM   1176 C  CA  . MET A 1 162 ? 17.897  -5.446  38.894  1.00 36.35  ? 161  MET A CA  1 
ATOM   1177 C  C   . MET A 1 162 ? 18.069  -6.630  37.971  1.00 39.15  ? 161  MET A C   1 
ATOM   1178 O  O   . MET A 1 162 ? 19.074  -7.305  38.020  1.00 43.96  ? 161  MET A O   1 
ATOM   1179 C  CB  . MET A 1 162 ? 18.087  -5.886  40.323  1.00 34.76  ? 161  MET A CB  1 
ATOM   1180 C  CG  . MET A 1 162 ? 18.055  -4.713  41.271  1.00 34.98  ? 161  MET A CG  1 
ATOM   1181 S  SD  . MET A 1 162 ? 18.077  -5.195  42.981  0.81 39.69  ? 161  MET A SD  1 
ATOM   1182 C  CE  . MET A 1 162 ? 19.771  -5.676  43.177  1.00 43.18  ? 161  MET A CE  1 
ATOM   1183 N  N   . THR A 1 163 ? 17.059  -6.889  37.148  1.00 40.32  ? 162  THR A N   1 
ATOM   1184 C  CA  . THR A 1 163 ? 17.098  -7.935  36.153  1.00 38.52  ? 162  THR A CA  1 
ATOM   1185 C  C   . THR A 1 163 ? 16.654  -7.281  34.850  1.00 38.28  ? 162  THR A C   1 
ATOM   1186 O  O   . THR A 1 163 ? 16.542  -6.066  34.800  1.00 35.74  ? 162  THR A O   1 
ATOM   1187 C  CB  . THR A 1 163 ? 16.149  -9.073  36.522  1.00 42.02  ? 162  THR A CB  1 
ATOM   1188 O  OG1 . THR A 1 163 ? 16.025  -9.964  35.405  1.00 43.64  ? 162  THR A OG1 1 
ATOM   1189 C  CG2 . THR A 1 163 ? 14.742  -8.521  36.898  1.00 40.07  ? 162  THR A CG2 1 
ATOM   1190 N  N   . TYR A 1 164 ? 16.388  -8.067  33.813  1.00 39.96  ? 163  TYR A N   1 
ATOM   1191 C  CA  . TYR A 1 164 ? 16.273  -7.544  32.446  1.00 43.20  ? 163  TYR A CA  1 
ATOM   1192 C  C   . TYR A 1 164 ? 17.606  -6.856  32.036  1.00 47.83  ? 163  TYR A C   1 
ATOM   1193 O  O   . TYR A 1 164 ? 17.692  -5.661  31.629  1.00 43.08  ? 163  TYR A O   1 
ATOM   1194 C  CB  . TYR A 1 164 ? 15.116  -6.593  32.315  1.00 45.87  ? 163  TYR A CB  1 
ATOM   1195 C  CG  . TYR A 1 164 ? 13.789  -7.204  32.595  1.00 45.81  ? 163  TYR A CG  1 
ATOM   1196 C  CD1 . TYR A 1 164 ? 13.215  -8.072  31.690  1.00 47.12  ? 163  TYR A CD1 1 
ATOM   1197 C  CD2 . TYR A 1 164 ? 13.076  -6.865  33.735  1.00 46.69  ? 163  TYR A CD2 1 
ATOM   1198 C  CE1 . TYR A 1 164 ? 11.972  -8.615  31.922  1.00 47.55  ? 163  TYR A CE1 1 
ATOM   1199 C  CE2 . TYR A 1 164 ? 11.823  -7.378  33.972  1.00 44.90  ? 163  TYR A CE2 1 
ATOM   1200 C  CZ  . TYR A 1 164 ? 11.282  -8.260  33.079  1.00 46.22  ? 163  TYR A CZ  1 
ATOM   1201 O  OH  . TYR A 1 164 ? 10.029  -8.768  33.342  1.00 48.35  ? 163  TYR A OH  1 
ATOM   1202 N  N   . LYS A 1 165 ? 18.648  -7.662  32.192  1.00 47.74  ? 164  LYS A N   1 
ATOM   1203 C  CA  . LYS A 1 165 ? 19.960  -7.329  31.758  1.00 48.21  ? 164  LYS A CA  1 
ATOM   1204 C  C   . LYS A 1 165 ? 19.916  -6.877  30.304  1.00 54.46  ? 164  LYS A C   1 
ATOM   1205 O  O   . LYS A 1 165 ? 19.313  -7.535  29.440  1.00 50.52  ? 164  LYS A O   1 
ATOM   1206 C  CB  . LYS A 1 165 ? 20.856  -8.559  31.869  1.00 49.67  ? 164  LYS A CB  1 
ATOM   1207 C  CG  . LYS A 1 165 ? 22.243  -8.320  31.332  1.00 48.57  ? 164  LYS A CG  1 
ATOM   1208 C  CD  . LYS A 1 165 ? 23.113  -9.540  31.346  1.00 51.24  ? 164  LYS A CD  1 
ATOM   1209 C  CE  . LYS A 1 165 ? 24.434  -9.083  30.732  1.00 56.03  ? 164  LYS A CE  1 
ATOM   1210 N  NZ  . LYS A 1 165 ? 25.615  -9.854  31.214  1.00 53.90  ? 164  LYS A NZ  1 
ATOM   1211 N  N   . ASP A 1 166 ? 20.568  -5.748  30.025  1.00 61.41  ? 165  ASP A N   1 
ATOM   1212 C  CA  . ASP A 1 166 ? 20.658  -5.253  28.658  1.00 58.47  ? 165  ASP A CA  1 
ATOM   1213 C  C   . ASP A 1 166 ? 19.334  -4.649  28.219  1.00 53.78  ? 165  ASP A C   1 
ATOM   1214 O  O   . ASP A 1 166 ? 19.208  -4.216  27.101  1.00 52.07  ? 165  ASP A O   1 
ATOM   1215 C  CB  . ASP A 1 166 ? 21.066  -6.383  27.679  1.00 61.65  ? 165  ASP A CB  1 
ATOM   1216 C  CG  . ASP A 1 166 ? 22.538  -6.761  27.791  1.00 64.11  ? 165  ASP A CG  1 
ATOM   1217 O  OD1 . ASP A 1 166 ? 23.346  -5.881  28.163  1.00 66.32  ? 165  ASP A OD1 1 
ATOM   1218 O  OD2 . ASP A 1 166 ? 22.889  -7.929  27.490  1.00 63.36  ? 165  ASP A OD2 1 
ATOM   1219 N  N   . LEU A 1 167 ? 18.356  -4.615  29.104  1.00 55.06  ? 166  LEU A N   1 
ATOM   1220 C  CA  . LEU A 1 167 ? 17.067  -4.026  28.802  1.00 55.86  ? 166  LEU A CA  1 
ATOM   1221 C  C   . LEU A 1 167 ? 16.762  -2.922  29.791  1.00 52.94  ? 166  LEU A C   1 
ATOM   1222 O  O   . LEU A 1 167 ? 16.660  -1.744  29.430  1.00 48.07  ? 166  LEU A O   1 
ATOM   1223 C  CB  . LEU A 1 167 ? 15.963  -5.101  28.878  1.00 58.31  ? 166  LEU A CB  1 
ATOM   1224 C  CG  . LEU A 1 167 ? 15.430  -5.640  27.535  1.00 57.91  ? 166  LEU A CG  1 
ATOM   1225 C  CD1 . LEU A 1 167 ? 14.723  -7.000  27.656  1.00 55.48  ? 166  LEU A CD1 1 
ATOM   1226 C  CD2 . LEU A 1 167 ? 14.480  -4.628  26.901  1.00 55.14  ? 166  LEU A CD2 1 
ATOM   1227 N  N   . TYR A 1 168 ? 16.574  -3.328  31.039  1.00 49.39  ? 167  TYR A N   1 
ATOM   1228 C  CA  . TYR A 1 168 ? 16.093  -2.421  32.062  1.00 45.37  ? 167  TYR A CA  1 
ATOM   1229 C  C   . TYR A 1 168 ? 17.005  -2.400  33.256  1.00 42.73  ? 167  TYR A C   1 
ATOM   1230 O  O   . TYR A 1 168 ? 16.853  -1.562  34.152  1.00 46.55  ? 167  TYR A O   1 
ATOM   1231 C  CB  . TYR A 1 168 ? 14.668  -2.831  32.478  1.00 43.48  ? 167  TYR A CB  1 
ATOM   1232 C  CG  . TYR A 1 168 ? 13.687  -2.854  31.303  1.00 41.92  ? 167  TYR A CG  1 
ATOM   1233 C  CD1 . TYR A 1 168 ? 13.596  -1.788  30.424  1.00 39.32  ? 167  TYR A CD1 1 
ATOM   1234 C  CD2 . TYR A 1 168 ? 12.890  -3.960  31.062  1.00 40.13  ? 167  TYR A CD2 1 
ATOM   1235 C  CE1 . TYR A 1 168 ? 12.737  -1.815  29.356  1.00 40.71  ? 167  TYR A CE1 1 
ATOM   1236 C  CE2 . TYR A 1 168 ? 12.034  -3.997  29.995  1.00 38.87  ? 167  TYR A CE2 1 
ATOM   1237 C  CZ  . TYR A 1 168 ? 11.955  -2.916  29.149  1.00 41.95  ? 167  TYR A CZ  1 
ATOM   1238 O  OH  . TYR A 1 168 ? 11.083  -2.932  28.082  1.00 44.45  ? 167  TYR A OH  1 
ATOM   1239 N  N   . MET A 1 169 ? 17.985  -3.295  33.251  1.00 40.16  ? 168  MET A N   1 
ATOM   1240 C  CA  . MET A 1 169 ? 18.807  -3.544  34.415  1.00 37.77  ? 168  MET A CA  1 
ATOM   1241 C  C   . MET A 1 169 ? 19.753  -2.404  34.745  1.00 35.13  ? 168  MET A C   1 
ATOM   1242 O  O   . MET A 1 169 ? 20.293  -1.747  33.886  1.00 32.48  ? 168  MET A O   1 
ATOM   1243 C  CB  . MET A 1 169 ? 19.617  -4.829  34.228  1.00 37.52  ? 168  MET A CB  1 
ATOM   1244 C  CG  . MET A 1 169 ? 20.356  -5.260  35.481  1.00 38.06  ? 168  MET A CG  1 
ATOM   1245 S  SD  . MET A 1 169 ? 21.323  -6.748  35.264  0.66 36.36  ? 168  MET A SD  1 
ATOM   1246 C  CE  . MET A 1 169 ? 22.569  -6.409  36.511  1.00 37.38  ? 168  MET A CE  1 
ATOM   1247 N  N   . LEU A 1 170 ? 19.950  -2.212  36.033  1.00 36.99  ? 169  LEU A N   1 
ATOM   1248 C  CA  . LEU A 1 170 ? 20.872  -1.239  36.537  1.00 38.94  ? 169  LEU A CA  1 
ATOM   1249 C  C   . LEU A 1 170 ? 21.985  -1.939  37.326  1.00 43.30  ? 169  LEU A C   1 
ATOM   1250 O  O   . LEU A 1 170 ? 21.762  -2.879  38.076  1.00 43.11  ? 169  LEU A O   1 
ATOM   1251 C  CB  . LEU A 1 170 ? 20.156  -0.217  37.414  1.00 39.02  ? 169  LEU A CB  1 
ATOM   1252 C  CG  . LEU A 1 170 ? 19.382  0.915   36.718  1.00 41.94  ? 169  LEU A CG  1 
ATOM   1253 C  CD1 . LEU A 1 170 ? 18.852  1.904   37.750  1.00 41.33  ? 169  LEU A CD1 1 
ATOM   1254 C  CD2 . LEU A 1 170 ? 20.256  1.635   35.696  1.00 42.54  ? 169  LEU A CD2 1 
ATOM   1255 N  N   . ARG A 1 171 ? 23.202  -1.469  37.112  1.00 47.72  ? 170  ARG A N   1 
ATOM   1256 C  CA  . ARG A 1 171 ? 24.369  -1.947  37.826  1.00 48.16  ? 170  ARG A CA  1 
ATOM   1257 C  C   . ARG A 1 171 ? 24.363  -1.383  39.239  1.00 44.01  ? 170  ARG A C   1 
ATOM   1258 O  O   . ARG A 1 171 ? 23.683  -0.407  39.525  1.00 44.49  ? 170  ARG A O   1 
ATOM   1259 C  CB  . ARG A 1 171 ? 25.611  -1.518  37.036  1.00 59.65  ? 170  ARG A CB  1 
ATOM   1260 C  CG  . ARG A 1 171 ? 25.867  -2.417  35.815  1.00 65.59  ? 170  ARG A CG  1 
ATOM   1261 C  CD  . ARG A 1 171 ? 26.442  -1.682  34.598  1.00 74.46  ? 170  ARG A CD  1 
ATOM   1262 N  NE  . ARG A 1 171 ? 27.282  -0.513  34.921  1.00 82.15  ? 170  ARG A NE  1 
ATOM   1263 C  CZ  . ARG A 1 171 ? 27.729  0.394   34.040  1.00 71.32  ? 170  ARG A CZ  1 
ATOM   1264 N  NH1 . ARG A 1 171 ? 27.448  0.282   32.750  1.00 68.01  ? 170  ARG A NH1 1 
ATOM   1265 N  NH2 . ARG A 1 171 ? 28.492  1.410   34.458  1.00 62.25  ? 170  ARG A NH2 1 
ATOM   1266 N  N   . ASP A 1 172 ? 25.129  -1.980  40.131  1.00 47.69  ? 171  ASP A N   1 
ATOM   1267 C  CA  . ASP A 1 172 ? 25.163  -1.518  41.533  1.00 48.87  ? 171  ASP A CA  1 
ATOM   1268 C  C   . ASP A 1 172 ? 25.659  -0.090  41.686  1.00 46.80  ? 171  ASP A C   1 
ATOM   1269 O  O   . ASP A 1 172 ? 25.159  0.648   42.533  1.00 46.47  ? 171  ASP A O   1 
ATOM   1270 C  CB  . ASP A 1 172 ? 26.069  -2.396  42.403  1.00 49.82  ? 171  ASP A CB  1 
ATOM   1271 C  CG  . ASP A 1 172 ? 25.422  -3.677  42.812  1.00 51.33  ? 171  ASP A CG  1 
ATOM   1272 O  OD1 . ASP A 1 172 ? 24.260  -3.903  42.399  1.00 51.06  ? 171  ASP A OD1 1 
ATOM   1273 O  OD2 . ASP A 1 172 ? 26.091  -4.466  43.535  1.00 54.59  ? 171  ASP A OD2 1 
ATOM   1274 N  N   . SER A 1 173 ? 26.664  0.277   40.899  1.00 47.99  ? 172  SER A N   1 
ATOM   1275 C  CA  . SER A 1 173 ? 27.191  1.652   40.917  1.00 50.32  ? 172  SER A CA  1 
ATOM   1276 C  C   . SER A 1 173 ? 26.096  2.622   40.531  1.00 46.19  ? 172  SER A C   1 
ATOM   1277 O  O   . SER A 1 173 ? 26.086  3.759   41.022  1.00 40.86  ? 172  SER A O   1 
ATOM   1278 C  CB  . SER A 1 173 ? 28.344  1.824   39.925  1.00 52.01  ? 172  SER A CB  1 
ATOM   1279 O  OG  . SER A 1 173 ? 27.871  1.565   38.600  1.00 52.57  ? 172  SER A OG  1 
ATOM   1280 N  N   . GLU A 1 174 ? 25.193  2.164   39.652  1.00 40.85  ? 173  GLU A N   1 
ATOM   1281 C  CA  . GLU A 1 174 ? 24.114  2.990   39.147  1.00 42.76  ? 173  GLU A CA  1 
ATOM   1282 C  C   . GLU A 1 174 ? 22.986  3.113   40.145  1.00 45.05  ? 173  GLU A C   1 
ATOM   1283 O  O   . GLU A 1 174 ? 22.540  4.222   40.468  1.00 51.96  ? 173  GLU A O   1 
ATOM   1284 C  CB  . GLU A 1 174 ? 23.608  2.448   37.824  1.00 46.43  ? 173  GLU A CB  1 
ATOM   1285 C  CG  . GLU A 1 174 ? 24.670  2.461   36.719  1.00 50.50  ? 173  GLU A CG  1 
ATOM   1286 C  CD  . GLU A 1 174 ? 24.183  1.921   35.383  1.00 49.36  ? 173  GLU A CD  1 
ATOM   1287 O  OE1 . GLU A 1 174 ? 23.654  0.785   35.337  1.00 41.33  ? 173  GLU A OE1 1 
ATOM   1288 O  OE2 . GLU A 1 174 ? 24.363  2.645   34.380  1.00 54.77  ? 173  GLU A OE2 1 
ATOM   1289 N  N   . LEU A 1 175 ? 22.539  1.986   40.676  1.00 47.34  ? 174  LEU A N   1 
ATOM   1290 C  CA  . LEU A 1 175 ? 21.568  2.006   41.786  1.00 45.92  ? 174  LEU A CA  1 
ATOM   1291 C  C   . LEU A 1 175 ? 22.002  2.967   42.894  1.00 43.11  ? 174  LEU A C   1 
ATOM   1292 O  O   . LEU A 1 175 ? 21.205  3.756   43.375  1.00 47.36  ? 174  LEU A O   1 
ATOM   1293 C  CB  . LEU A 1 175 ? 21.386  0.609   42.375  1.00 43.99  ? 174  LEU A CB  1 
ATOM   1294 C  CG  . LEU A 1 175 ? 20.585  -0.362  41.525  1.00 43.79  ? 174  LEU A CG  1 
ATOM   1295 C  CD1 . LEU A 1 175 ? 20.677  -1.751  42.108  1.00 45.25  ? 174  LEU A CD1 1 
ATOM   1296 C  CD2 . LEU A 1 175 ? 19.149  0.121   41.444  1.00 45.36  ? 174  LEU A CD2 1 
ATOM   1297 N  N   . TYR A 1 176 ? 23.255  2.887   43.307  1.00 39.43  ? 175  TYR A N   1 
ATOM   1298 C  CA  . TYR A 1 176 ? 23.738  3.734   44.392  1.00 40.91  ? 175  TYR A CA  1 
ATOM   1299 C  C   . TYR A 1 176 ? 23.472  5.213   44.075  1.00 44.05  ? 175  TYR A C   1 
ATOM   1300 O  O   . TYR A 1 176 ? 22.989  5.969   44.905  1.00 42.30  ? 175  TYR A O   1 
ATOM   1301 C  CB  . TYR A 1 176 ? 25.238  3.500   44.638  1.00 39.77  ? 175  TYR A CB  1 
ATOM   1302 C  CG  . TYR A 1 176 ? 25.768  4.258   45.823  1.00 39.37  ? 175  TYR A CG  1 
ATOM   1303 C  CD1 . TYR A 1 176 ? 26.048  5.625   45.743  1.00 39.14  ? 175  TYR A CD1 1 
ATOM   1304 C  CD2 . TYR A 1 176 ? 25.970  3.615   47.039  1.00 40.67  ? 175  TYR A CD2 1 
ATOM   1305 C  CE1 . TYR A 1 176 ? 26.529  6.331   46.840  1.00 37.85  ? 175  TYR A CE1 1 
ATOM   1306 C  CE2 . TYR A 1 176 ? 26.446  4.303   48.145  1.00 40.42  ? 175  TYR A CE2 1 
ATOM   1307 C  CZ  . TYR A 1 176 ? 26.725  5.661   48.036  1.00 41.34  ? 175  TYR A CZ  1 
ATOM   1308 O  OH  . TYR A 1 176 ? 27.191  6.336   49.140  1.00 44.68  ? 175  TYR A OH  1 
ATOM   1309 N  N   . GLN A 1 177 ? 23.818  5.616   42.859  1.00 47.89  ? 176  GLN A N   1 
ATOM   1310 C  CA  . GLN A 1 177 ? 23.631  6.988   42.407  1.00 44.07  ? 176  GLN A CA  1 
ATOM   1311 C  C   . GLN A 1 177 ? 22.150  7.289   42.267  1.00 39.85  ? 176  GLN A C   1 
ATOM   1312 O  O   . GLN A 1 177 ? 21.700  8.380   42.618  1.00 36.98  ? 176  GLN A O   1 
ATOM   1313 C  CB  . GLN A 1 177 ? 24.339  7.201   41.062  1.00 48.68  ? 176  GLN A CB  1 
ATOM   1314 C  CG  . GLN A 1 177 ? 25.859  7.074   41.088  1.00 52.56  ? 176  GLN A CG  1 
ATOM   1315 C  CD  . GLN A 1 177 ? 26.499  8.028   42.088  1.00 62.61  ? 176  GLN A CD  1 
ATOM   1316 O  OE1 . GLN A 1 177 ? 26.049  9.167   42.251  1.00 72.12  ? 176  GLN A OE1 1 
ATOM   1317 N  NE2 . GLN A 1 177 ? 27.558  7.573   42.763  1.00 65.47  ? 176  GLN A NE2 1 
ATOM   1318 N  N   . VAL A 1 178 ? 21.387  6.319   41.765  1.00 37.94  ? 177  VAL A N   1 
ATOM   1319 C  CA  . VAL A 1 178 ? 19.956  6.524   41.530  1.00 39.07  ? 177  VAL A CA  1 
ATOM   1320 C  C   . VAL A 1 178 ? 19.232  6.712   42.864  1.00 38.18  ? 177  VAL A C   1 
ATOM   1321 O  O   . VAL A 1 178 ? 18.447  7.628   43.041  1.00 41.17  ? 177  VAL A O   1 
ATOM   1322 C  CB  . VAL A 1 178 ? 19.317  5.350   40.735  1.00 38.08  ? 177  VAL A CB  1 
ATOM   1323 C  CG1 . VAL A 1 178 ? 17.804  5.471   40.675  1.00 38.45  ? 177  VAL A CG1 1 
ATOM   1324 C  CG2 . VAL A 1 178 ? 19.829  5.319   39.327  1.00 40.40  ? 177  VAL A CG2 1 
ATOM   1325 N  N   . LEU A 1 179 ? 19.513  5.838   43.806  1.00 38.26  ? 178  LEU A N   1 
ATOM   1326 C  CA  . LEU A 1 179 ? 18.896  5.931   45.101  1.00 39.33  ? 178  LEU A CA  1 
ATOM   1327 C  C   . LEU A 1 179 ? 19.296  7.241   45.783  1.00 42.45  ? 178  LEU A C   1 
ATOM   1328 O  O   . LEU A 1 179 ? 18.454  7.912   46.399  1.00 47.92  ? 178  LEU A O   1 
ATOM   1329 C  CB  . LEU A 1 179 ? 19.262  4.718   45.965  1.00 37.45  ? 178  LEU A CB  1 
ATOM   1330 C  CG  . LEU A 1 179 ? 18.811  3.369   45.405  1.00 38.41  ? 178  LEU A CG  1 
ATOM   1331 C  CD1 . LEU A 1 179 ? 18.898  2.292   46.470  1.00 41.33  ? 178  LEU A CD1 1 
ATOM   1332 C  CD2 . LEU A 1 179 ? 17.418  3.397   44.806  1.00 37.32  ? 178  LEU A CD2 1 
ATOM   1333 N  N   . HIS A 1 180 ? 20.565  7.616   45.665  1.00 42.53  ? 179  HIS A N   1 
ATOM   1334 C  CA  . HIS A 1 180 ? 21.030  8.855   46.262  1.00 43.71  ? 179  HIS A CA  1 
ATOM   1335 C  C   . HIS A 1 180 ? 20.230  10.006  45.687  1.00 41.42  ? 179  HIS A C   1 
ATOM   1336 O  O   . HIS A 1 180 ? 19.842  10.933  46.368  1.00 39.94  ? 179  HIS A O   1 
ATOM   1337 C  CB  . HIS A 1 180 ? 22.525  9.085   46.000  1.00 46.82  ? 179  HIS A CB  1 
ATOM   1338 C  CG  . HIS A 1 180 ? 23.039  10.323  46.654  1.00 53.14  ? 179  HIS A CG  1 
ATOM   1339 N  ND1 . HIS A 1 180 ? 23.405  10.361  47.982  1.00 56.38  ? 179  HIS A ND1 1 
ATOM   1340 C  CD2 . HIS A 1 180 ? 23.195  11.586  46.187  1.00 61.17  ? 179  HIS A CD2 1 
ATOM   1341 C  CE1 . HIS A 1 180 ? 23.780  11.591  48.305  1.00 62.76  ? 179  HIS A CE1 1 
ATOM   1342 N  NE2 . HIS A 1 180 ? 23.649  12.362  47.237  1.00 66.84  ? 179  HIS A NE2 1 
ATOM   1343 N  N   . ALA A 1 181 ? 19.984  9.908   44.397  1.00 41.24  ? 180  ALA A N   1 
ATOM   1344 C  CA  . ALA A 1 181 ? 19.258  10.917  43.661  1.00 40.38  ? 180  ALA A CA  1 
ATOM   1345 C  C   . ALA A 1 181 ? 17.834  11.039  44.127  1.00 39.27  ? 180  ALA A C   1 
ATOM   1346 O  O   . ALA A 1 181 ? 17.346  12.138  44.305  1.00 44.16  ? 180  ALA A O   1 
ATOM   1347 C  CB  . ALA A 1 181 ? 19.297  10.562  42.173  1.00 44.30  ? 180  ALA A CB  1 
ATOM   1348 N  N   . CYS A 1 182 ? 17.169  9.902   44.305  1.00 40.55  ? 181  CYS A N   1 
ATOM   1349 C  CA  . CYS A 1 182 ? 15.787  9.840   44.797  1.00 38.60  ? 181  CYS A CA  1 
ATOM   1350 C  C   . CYS A 1 182 ? 15.647  10.504  46.163  1.00 39.35  ? 181  CYS A C   1 
ATOM   1351 O  O   . CYS A 1 182 ? 14.726  11.270  46.403  1.00 37.82  ? 181  CYS A O   1 
ATOM   1352 C  CB  . CYS A 1 182 ? 15.323  8.381   44.938  1.00 38.78  ? 181  CYS A CB  1 
ATOM   1353 S  SG  . CYS A 1 182 ? 14.843  7.523   43.425  1.00 40.05  ? 181  CYS A SG  1 
ATOM   1354 N  N   . LYS A 1 183 ? 16.552  10.154  47.067  1.00 39.18  ? 182  LYS A N   1 
ATOM   1355 C  CA  . LYS A 1 183 ? 16.508  10.629  48.445  1.00 38.88  ? 182  LYS A CA  1 
ATOM   1356 C  C   . LYS A 1 183 ? 16.662  12.137  48.505  1.00 38.15  ? 182  LYS A C   1 
ATOM   1357 O  O   . LYS A 1 183 ? 16.008  12.800  49.299  1.00 38.75  ? 182  LYS A O   1 
ATOM   1358 C  CB  . LYS A 1 183 ? 17.602  9.947   49.251  1.00 44.45  ? 182  LYS A CB  1 
ATOM   1359 C  CG  . LYS A 1 183 ? 18.194  10.712  50.432  1.00 50.40  ? 182  LYS A CG  1 
ATOM   1360 C  CD  . LYS A 1 183 ? 19.706  10.547  50.310  1.00 53.66  ? 182  LYS A CD  1 
ATOM   1361 C  CE  . LYS A 1 183 ? 20.612  11.304  51.277  1.00 61.64  ? 182  LYS A CE  1 
ATOM   1362 N  NZ  . LYS A 1 183 ? 20.188  12.685  51.594  1.00 71.18  ? 182  LYS A NZ  1 
ATOM   1363 N  N   . ASP A 1 184 ? 17.513  12.681  47.652  1.00 41.19  ? 183  ASP A N   1 
ATOM   1364 C  CA  . ASP A 1 184 ? 17.739  14.135  47.587  1.00 46.76  ? 183  ASP A CA  1 
ATOM   1365 C  C   . ASP A 1 184 ? 16.512  14.931  47.100  1.00 47.57  ? 183  ASP A C   1 
ATOM   1366 O  O   . ASP A 1 184 ? 16.302  16.039  47.567  1.00 44.00  ? 183  ASP A O   1 
ATOM   1367 C  CB  . ASP A 1 184 ? 18.969  14.451  46.720  1.00 47.01  ? 183  ASP A CB  1 
ATOM   1368 C  CG  . ASP A 1 184 ? 20.282  14.257  47.488  1.00 51.67  ? 183  ASP A CG  1 
ATOM   1369 O  OD1 . ASP A 1 184 ? 20.238  13.946  48.714  1.00 49.32  ? 183  ASP A OD1 1 
ATOM   1370 O  OD2 . ASP A 1 184 ? 21.381  14.387  46.876  1.00 64.00  ? 183  ASP A OD2 1 
ATOM   1371 N  N   . ILE A 1 185 ? 15.721  14.358  46.181  1.00 46.81  ? 184  ILE A N   1 
ATOM   1372 C  CA  . ILE A 1 185 ? 14.497  15.011  45.676  1.00 44.40  ? 184  ILE A CA  1 
ATOM   1373 C  C   . ILE A 1 185 ? 13.218  14.528  46.370  1.00 46.27  ? 184  ILE A C   1 
ATOM   1374 O  O   . ILE A 1 185 ? 12.116  14.994  46.039  1.00 42.66  ? 184  ILE A O   1 
ATOM   1375 C  CB  . ILE A 1 185 ? 14.328  14.855  44.151  1.00 41.57  ? 184  ILE A CB  1 
ATOM   1376 C  CG1 . ILE A 1 185 ? 14.203  13.390  43.750  1.00 43.23  ? 184  ILE A CG1 1 
ATOM   1377 C  CG2 . ILE A 1 185 ? 15.493  15.471  43.432  1.00 41.80  ? 184  ILE A CG2 1 
ATOM   1378 C  CD1 . ILE A 1 185 ? 14.284  13.154  42.243  1.00 43.35  ? 184  ILE A CD1 1 
ATOM   1379 N  N   . GLY A 1 186 ? 13.366  13.607  47.323  1.00 45.63  ? 185  GLY A N   1 
ATOM   1380 C  CA  . GLY A 1 186 ? 12.248  13.174  48.171  1.00 43.86  ? 185  GLY A CA  1 
ATOM   1381 C  C   . GLY A 1 186 ? 11.362  12.109  47.552  1.00 43.67  ? 185  GLY A C   1 
ATOM   1382 O  O   . GLY A 1 186 ? 10.183  12.030  47.862  1.00 42.12  ? 185  GLY A O   1 
ATOM   1383 N  N   . ALA A 1 187 ? 11.918  11.283  46.667  1.00 43.07  ? 186  ALA A N   1 
ATOM   1384 C  CA  . ALA A 1 187 ? 11.118  10.276  45.938  1.00 42.63  ? 186  ALA A CA  1 
ATOM   1385 C  C   . ALA A 1 187 ? 11.135  8.914   46.622  1.00 42.27  ? 186  ALA A C   1 
ATOM   1386 O  O   . ALA A 1 187 ? 11.861  8.697   47.605  1.00 46.51  ? 186  ALA A O   1 
ATOM   1387 C  CB  . ALA A 1 187 ? 11.617  10.123  44.512  1.00 42.11  ? 186  ALA A CB  1 
ATOM   1388 N  N   . ILE A 1 188 ? 10.329  8.003   46.096  1.00 36.44  ? 187  ILE A N   1 
ATOM   1389 C  CA  . ILE A 1 188 ? 10.327  6.633   46.550  1.00 35.40  ? 187  ILE A CA  1 
ATOM   1390 C  C   . ILE A 1 188 ? 10.964  5.704   45.492  1.00 34.86  ? 187  ILE A C   1 
ATOM   1391 O  O   . ILE A 1 188 ? 10.557  5.693   44.331  1.00 33.78  ? 187  ILE A O   1 
ATOM   1392 C  CB  . ILE A 1 188 ? 8.897   6.183   46.887  1.00 33.05  ? 187  ILE A CB  1 
ATOM   1393 C  CG1 . ILE A 1 188 ? 8.405   6.921   48.130  1.00 30.46  ? 187  ILE A CG1 1 
ATOM   1394 C  CG2 . ILE A 1 188 ? 8.857   4.676   47.122  1.00 34.32  ? 187  ILE A CG2 1 
ATOM   1395 C  CD1 . ILE A 1 188 ? 9.149   6.539   49.409  1.00 31.48  ? 187  ILE A CD1 1 
ATOM   1396 N  N   . ALA A 1 189 ? 11.948  4.916   45.911  1.00 30.58  ? 188  ALA A N   1 
ATOM   1397 C  CA  . ALA A 1 189 ? 12.639  4.049   44.996  1.00 28.42  ? 188  ALA A CA  1 
ATOM   1398 C  C   . ALA A 1 189 ? 11.997  2.682   44.960  1.00 28.82  ? 188  ALA A C   1 
ATOM   1399 O  O   . ALA A 1 189 ? 12.181  1.869   45.876  1.00 34.63  ? 188  ALA A O   1 
ATOM   1400 C  CB  . ALA A 1 189 ? 14.094  3.953   45.414  1.00 28.84  ? 188  ALA A CB  1 
ATOM   1401 N  N   . ARG A 1 190 ? 11.212  2.415   43.926  1.00 28.53  ? 189  ARG A N   1 
ATOM   1402 C  CA  . ARG A 1 190 ? 10.632  1.071   43.723  1.00 30.23  ? 189  ARG A CA  1 
ATOM   1403 C  C   . ARG A 1 190 ? 11.602  0.161   42.994  1.00 31.57  ? 189  ARG A C   1 
ATOM   1404 O  O   . ARG A 1 190 ? 11.947  0.389   41.844  1.00 27.44  ? 189  ARG A O   1 
ATOM   1405 C  CB  . ARG A 1 190 ? 9.365   1.121   42.884  1.00 30.53  ? 189  ARG A CB  1 
ATOM   1406 C  CG  . ARG A 1 190 ? 8.172   1.752   43.537  1.00 31.56  ? 189  ARG A CG  1 
ATOM   1407 C  CD  . ARG A 1 190 ? 7.055   1.991   42.529  1.00 31.46  ? 189  ARG A CD  1 
ATOM   1408 N  NE  . ARG A 1 190 ? 6.586   0.746   41.941  1.00 31.88  ? 189  ARG A NE  1 
ATOM   1409 C  CZ  . ARG A 1 190 ? 5.584   0.012   42.406  1.00 32.82  ? 189  ARG A CZ  1 
ATOM   1410 N  NH1 . ARG A 1 190 ? 4.885   0.418   43.474  1.00 34.12  ? 189  ARG A NH1 1 
ATOM   1411 N  NH2 . ARG A 1 190 ? 5.257   -1.126  41.788  1.00 30.25  ? 189  ARG A NH2 1 
ATOM   1412 N  N   . VAL A 1 191 ? 12.034  -0.892  43.650  1.00 36.15  ? 190  VAL A N   1 
ATOM   1413 C  CA  . VAL A 1 191 ? 12.918  -1.825  42.979  1.00 38.65  ? 190  VAL A CA  1 
ATOM   1414 C  C   . VAL A 1 191 ? 12.336  -3.221  42.830  1.00 39.00  ? 190  VAL A C   1 
ATOM   1415 O  O   . VAL A 1 191 ? 11.826  -3.824  43.783  1.00 39.75  ? 190  VAL A O   1 
ATOM   1416 C  CB  . VAL A 1 191 ? 14.281  -1.936  43.670  1.00 36.47  ? 190  VAL A CB  1 
ATOM   1417 C  CG1 . VAL A 1 191 ? 15.179  -2.793  42.819  1.00 38.18  ? 190  VAL A CG1 1 
ATOM   1418 C  CG2 . VAL A 1 191 ? 14.870  -0.567  43.807  1.00 37.70  ? 190  VAL A CG2 1 
ATOM   1419 N  N   . HIS A 1 192 ? 12.492  -3.733  41.627  1.00 36.95  ? 191  HIS A N   1 
ATOM   1420 C  CA  . HIS A 1 192 ? 12.156  -5.092  41.323  1.00 36.99  ? 191  HIS A CA  1 
ATOM   1421 C  C   . HIS A 1 192 ? 13.406  -5.912  41.492  1.00 37.16  ? 191  HIS A C   1 
ATOM   1422 O  O   . HIS A 1 192 ? 14.299  -5.867  40.651  1.00 37.74  ? 191  HIS A O   1 
ATOM   1423 C  CB  . HIS A 1 192 ? 11.664  -5.178  39.895  1.00 35.50  ? 191  HIS A CB  1 
ATOM   1424 C  CG  . HIS A 1 192 ? 11.329  -6.557  39.488  1.00 33.57  ? 191  HIS A CG  1 
ATOM   1425 N  ND1 . HIS A 1 192 ? 12.225  -7.591  39.618  1.00 34.81  ? 191  HIS A ND1 1 
ATOM   1426 C  CD2 . HIS A 1 192 ? 10.188  -7.092  38.998  1.00 34.08  ? 191  HIS A CD2 1 
ATOM   1427 C  CE1 . HIS A 1 192 ? 11.660  -8.707  39.192  1.00 36.69  ? 191  HIS A CE1 1 
ATOM   1428 N  NE2 . HIS A 1 192 ? 10.427  -8.432  38.809  1.00 36.58  ? 191  HIS A NE2 1 
ATOM   1429 N  N   . ALA A 1 193 ? 13.474  -6.692  42.564  1.00 39.30  ? 192  ALA A N   1 
ATOM   1430 C  CA  . ALA A 1 193 ? 14.763  -7.256  42.998  1.00 38.11  ? 192  ALA A CA  1 
ATOM   1431 C  C   . ALA A 1 193 ? 15.001  -8.718  42.647  1.00 36.47  ? 192  ALA A C   1 
ATOM   1432 O  O   . ALA A 1 193 ? 14.755  -9.599  43.441  1.00 35.78  ? 192  ALA A O   1 
ATOM   1433 C  CB  . ALA A 1 193 ? 14.931  -7.063  44.478  1.00 37.32  ? 192  ALA A CB  1 
ATOM   1434 N  N   . GLU A 1 194 ? 15.513  -8.951  41.449  1.00 39.77  ? 193  GLU A N   1 
ATOM   1435 C  CA  . GLU A 1 194 ? 16.146  -10.226 41.087  1.00 42.21  ? 193  GLU A CA  1 
ATOM   1436 C  C   . GLU A 1 194 ? 17.557  -9.942  40.576  1.00 41.83  ? 193  GLU A C   1 
ATOM   1437 O  O   . GLU A 1 194 ? 17.792  -8.912  39.972  1.00 41.51  ? 193  GLU A O   1 
ATOM   1438 C  CB  . GLU A 1 194 ? 15.319  -10.980 40.018  1.00 43.77  ? 193  GLU A CB  1 
ATOM   1439 C  CG  . GLU A 1 194 ? 14.008  -11.547 40.511  1.00 41.52  ? 193  GLU A CG  1 
ATOM   1440 C  CD  . GLU A 1 194 ? 13.292  -12.406 39.492  1.00 39.39  ? 193  GLU A CD  1 
ATOM   1441 O  OE1 . GLU A 1 194 ? 12.521  -11.846 38.687  1.00 34.23  ? 193  GLU A OE1 1 
ATOM   1442 O  OE2 . GLU A 1 194 ? 13.437  -13.649 39.576  1.00 43.35  ? 193  GLU A OE2 1 
ATOM   1443 N  N   . ASN A 1 195 ? 18.480  -10.872 40.818  1.00 44.06  ? 194  ASN A N   1 
ATOM   1444 C  CA  . ASN A 1 195 ? 19.853  -10.762 40.332  1.00 44.42  ? 194  ASN A CA  1 
ATOM   1445 C  C   . ASN A 1 195 ? 19.825  -11.025 38.823  1.00 42.79  ? 194  ASN A C   1 
ATOM   1446 O  O   . ASN A 1 195 ? 19.594  -12.151 38.377  1.00 38.93  ? 194  ASN A O   1 
ATOM   1447 C  CB  . ASN A 1 195 ? 20.766  -11.756 41.078  1.00 46.27  ? 194  ASN A CB  1 
ATOM   1448 C  CG  . ASN A 1 195 ? 22.228  -11.717 40.610  1.00 45.08  ? 194  ASN A CG  1 
ATOM   1449 O  OD1 . ASN A 1 195 ? 22.522  -11.881 39.438  1.00 47.58  ? 194  ASN A OD1 1 
ATOM   1450 N  ND2 . ASN A 1 195 ? 23.130  -11.515 41.531  1.00 44.10  ? 194  ASN A ND2 1 
ATOM   1451 N  N   . GLY A 1 196 ? 20.051  -9.971  38.051  1.00 43.30  ? 195  GLY A N   1 
ATOM   1452 C  CA  . GLY A 1 196 ? 19.912  -10.012 36.598  1.00 46.21  ? 195  GLY A CA  1 
ATOM   1453 C  C   . GLY A 1 196 ? 20.969  -10.810 35.852  1.00 47.25  ? 195  GLY A C   1 
ATOM   1454 O  O   . GLY A 1 196 ? 20.661  -11.389 34.797  1.00 46.21  ? 195  GLY A O   1 
ATOM   1455 N  N   . GLU A 1 197 ? 22.206  -10.821 36.370  1.00 45.47  ? 196  GLU A N   1 
ATOM   1456 C  CA  . GLU A 1 197 ? 23.276  -11.628 35.784  1.00 50.11  ? 196  GLU A CA  1 
ATOM   1457 C  C   . GLU A 1 197 ? 22.945  -13.111 35.895  1.00 47.75  ? 196  GLU A C   1 
ATOM   1458 O  O   . GLU A 1 197 ? 23.011  -13.837 34.900  1.00 48.20  ? 196  GLU A O   1 
ATOM   1459 C  CB  . GLU A 1 197 ? 24.625  -11.355 36.450  1.00 55.91  ? 196  GLU A CB  1 
ATOM   1460 C  CG  . GLU A 1 197 ? 25.158  -9.944  36.208  1.00 62.69  ? 196  GLU A CG  1 
ATOM   1461 C  CD  . GLU A 1 197 ? 25.468  -9.644  34.734  1.00 65.34  ? 196  GLU A CD  1 
ATOM   1462 O  OE1 . GLU A 1 197 ? 25.725  -10.629 34.000  1.00 64.17  ? 196  GLU A OE1 1 
ATOM   1463 O  OE2 . GLU A 1 197 ? 25.462  -8.444  34.315  1.00 55.31  ? 196  GLU A OE2 1 
ATOM   1464 N  N   . LEU A 1 198 ? 22.554  -13.544 37.094  1.00 44.90  ? 197  LEU A N   1 
ATOM   1465 C  CA  . LEU A 1 198 ? 22.152  -14.932 37.324  1.00 41.77  ? 197  LEU A CA  1 
ATOM   1466 C  C   . LEU A 1 198 ? 20.825  -15.296 36.627  1.00 41.78  ? 197  LEU A C   1 
ATOM   1467 O  O   . LEU A 1 198 ? 20.641  -16.441 36.198  1.00 41.40  ? 197  LEU A O   1 
ATOM   1468 C  CB  . LEU A 1 198 ? 22.074  -15.242 38.808  1.00 40.94  ? 197  LEU A CB  1 
ATOM   1469 C  CG  . LEU A 1 198 ? 23.353  -15.119 39.631  1.00 41.96  ? 197  LEU A CG  1 
ATOM   1470 C  CD1 . LEU A 1 198 ? 23.086  -15.518 41.081  1.00 42.45  ? 197  LEU A CD1 1 
ATOM   1471 C  CD2 . LEU A 1 198 ? 24.486  -15.952 39.043  1.00 41.94  ? 197  LEU A CD2 1 
ATOM   1472 N  N   . VAL A 1 199 ? 19.918  -14.339 36.483  1.00 41.06  ? 198  VAL A N   1 
ATOM   1473 C  CA  . VAL A 1 199 ? 18.726  -14.596 35.699  1.00 45.81  ? 198  VAL A CA  1 
ATOM   1474 C  C   . VAL A 1 199 ? 19.077  -14.866 34.237  1.00 49.38  ? 198  VAL A C   1 
ATOM   1475 O  O   . VAL A 1 199 ? 18.587  -15.853 33.644  1.00 49.18  ? 198  VAL A O   1 
ATOM   1476 C  CB  . VAL A 1 199 ? 17.687  -13.468 35.797  1.00 49.00  ? 198  VAL A CB  1 
ATOM   1477 C  CG1 . VAL A 1 199 ? 16.575  -13.641 34.762  1.00 47.43  ? 198  VAL A CG1 1 
ATOM   1478 C  CG2 . VAL A 1 199 ? 17.071  -13.464 37.194  1.00 52.13  ? 198  VAL A CG2 1 
ATOM   1479 N  N   . ALA A 1 200 ? 19.927  -14.011 33.670  1.00 51.44  ? 199  ALA A N   1 
ATOM   1480 C  CA  . ALA A 1 200 ? 20.386  -14.177 32.275  1.00 56.27  ? 199  ALA A CA  1 
ATOM   1481 C  C   . ALA A 1 200 ? 21.031  -15.556 32.043  1.00 56.83  ? 199  ALA A C   1 
ATOM   1482 O  O   . ALA A 1 200 ? 20.686  -16.294 31.084  1.00 52.19  ? 199  ALA A O   1 
ATOM   1483 C  CB  . ALA A 1 200 ? 21.364  -13.071 31.893  1.00 54.94  ? 199  ALA A CB  1 
ATOM   1484 N  N   . GLU A 1 201 ? 21.970  -15.878 32.924  1.00 52.02  ? 200  GLU A N   1 
ATOM   1485 C  CA  . GLU A 1 201 ? 22.709  -17.122 32.829  1.00 53.62  ? 200  GLU A CA  1 
ATOM   1486 C  C   . GLU A 1 201 ? 21.785  -18.296 32.959  1.00 50.76  ? 200  GLU A C   1 
ATOM   1487 O  O   . GLU A 1 201 ? 21.852  -19.213 32.166  1.00 50.37  ? 200  GLU A O   1 
ATOM   1488 C  CB  . GLU A 1 201 ? 23.787  -17.201 33.918  1.00 56.69  ? 200  GLU A CB  1 
ATOM   1489 C  CG  . GLU A 1 201 ? 24.943  -16.214 33.789  1.00 56.84  ? 200  GLU A CG  1 
ATOM   1490 C  CD  . GLU A 1 201 ? 25.687  -16.344 32.461  1.00 60.81  ? 200  GLU A CD  1 
ATOM   1491 O  OE1 . GLU A 1 201 ? 25.542  -17.415 31.775  1.00 55.20  ? 200  GLU A OE1 1 
ATOM   1492 O  OE2 . GLU A 1 201 ? 26.422  -15.367 32.129  1.00 57.24  ? 200  GLU A OE2 1 
ATOM   1493 N  N   . GLY A 1 202 ? 20.910  -18.244 33.961  1.00 55.03  ? 201  GLY A N   1 
ATOM   1494 C  CA  . GLY A 1 202 ? 19.989  -19.340 34.271  1.00 54.52  ? 201  GLY A CA  1 
ATOM   1495 C  C   . GLY A 1 202 ? 18.934  -19.572 33.204  1.00 53.91  ? 201  GLY A C   1 
ATOM   1496 O  O   . GLY A 1 202 ? 18.410  -20.671 33.085  1.00 53.00  ? 201  GLY A O   1 
ATOM   1497 N  N   . ALA A 1 203 ? 18.599  -18.529 32.453  1.00 55.42  ? 202  ALA A N   1 
ATOM   1498 C  CA  . ALA A 1 203 ? 17.673  -18.656 31.333  1.00 58.68  ? 202  ALA A CA  1 
ATOM   1499 C  C   . ALA A 1 203 ? 18.315  -19.458 30.192  1.00 62.41  ? 202  ALA A C   1 
ATOM   1500 O  O   . ALA A 1 203 ? 17.710  -20.407 29.688  1.00 54.64  ? 202  ALA A O   1 
ATOM   1501 C  CB  . ALA A 1 203 ? 17.254  -17.279 30.844  1.00 56.97  ? 202  ALA A CB  1 
ATOM   1502 N  N   . LYS A 1 204 ? 19.533  -19.053 29.802  1.00 70.63  ? 203  LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 204 ? 20.318  -19.712 28.718  1.00 71.77  ? 203  LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 204 ? 20.710  -21.134 29.096  1.00 61.03  ? 203  LYS A C   1 
ATOM   1505 O  O   . LYS A 1 204 ? 20.691  -22.035 28.260  1.00 55.33  ? 203  LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 204 ? 21.615  -18.933 28.365  1.00 76.69  ? 203  LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 204 ? 21.444  -17.500 27.836  1.00 84.04  ? 203  LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 204 ? 20.633  -17.414 26.528  1.00 84.22  ? 203  LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 204 ? 20.332  -15.970 26.119  1.00 72.36  ? 203  LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 204 ? 19.216  -15.372 26.902  1.00 62.94  ? 203  LYS A NZ  1 
ATOM   1511 N  N   . GLU A 1 205 ? 21.086  -21.303 30.361  1.00 55.79  ? 204  GLU A N   1 
ATOM   1512 C  CA  . GLU A 1 205 ? 21.381  -22.602 30.944  1.00 52.68  ? 204  GLU A CA  1 
ATOM   1513 C  C   . GLU A 1 205 ? 20.181  -23.545 30.872  1.00 48.63  ? 204  GLU A C   1 
ATOM   1514 O  O   . GLU A 1 205 ? 20.329  -24.724 30.620  1.00 47.68  ? 204  GLU A O   1 
ATOM   1515 C  CB  . GLU A 1 205 ? 21.822  -22.404 32.383  1.00 57.33  ? 204  GLU A CB  1 
ATOM   1516 C  CG  . GLU A 1 205 ? 21.859  -23.661 33.219  1.00 64.93  ? 204  GLU A CG  1 
ATOM   1517 C  CD  . GLU A 1 205 ? 22.434  -23.405 34.597  1.00 68.47  ? 204  GLU A CD  1 
ATOM   1518 O  OE1 . GLU A 1 205 ? 23.590  -22.937 34.658  1.00 70.08  ? 204  GLU A OE1 1 
ATOM   1519 O  OE2 . GLU A 1 205 ? 21.721  -23.641 35.605  1.00 65.76  ? 204  GLU A OE2 1 
ATOM   1520 N  N   . ALA A 1 206 ? 18.984  -23.007 31.052  1.00 50.19  ? 205  ALA A N   1 
ATOM   1521 C  CA  . ALA A 1 206 ? 17.744  -23.806 30.952  1.00 48.90  ? 205  ALA A CA  1 
ATOM   1522 C  C   . ALA A 1 206 ? 17.336  -24.129 29.513  1.00 46.40  ? 205  ALA A C   1 
ATOM   1523 O  O   . ALA A 1 206 ? 16.923  -25.244 29.220  1.00 46.27  ? 205  ALA A O   1 
ATOM   1524 C  CB  . ALA A 1 206 ? 16.602  -23.105 31.672  1.00 50.40  ? 205  ALA A CB  1 
ATOM   1525 N  N   . LEU A 1 207 ? 17.440  -23.155 28.622  1.00 47.02  ? 206  LEU A N   1 
ATOM   1526 C  CA  . LEU A 1 207 ? 17.209  -23.405 27.193  1.00 51.85  ? 206  LEU A CA  1 
ATOM   1527 C  C   . LEU A 1 207 ? 18.201  -24.429 26.621  1.00 56.54  ? 206  LEU A C   1 
ATOM   1528 O  O   . LEU A 1 207 ? 17.793  -25.332 25.858  1.00 48.98  ? 206  LEU A O   1 
ATOM   1529 C  CB  . LEU A 1 207 ? 17.303  -22.108 26.397  1.00 49.72  ? 206  LEU A CB  1 
ATOM   1530 C  CG  . LEU A 1 207 ? 16.150  -21.112 26.628  1.00 51.22  ? 206  LEU A CG  1 
ATOM   1531 C  CD1 . LEU A 1 207 ? 16.480  -19.774 25.966  1.00 47.35  ? 206  LEU A CD1 1 
ATOM   1532 C  CD2 . LEU A 1 207 ? 14.822  -21.688 26.131  1.00 50.94  ? 206  LEU A CD2 1 
ATOM   1533 N  N   . ASP A 1 208 ? 19.475  -24.295 27.030  1.00 60.78  ? 207  ASP A N   1 
ATOM   1534 C  CA  . ASP A 1 208 ? 20.561  -25.238 26.681  1.00 65.19  ? 207  ASP A CA  1 
ATOM   1535 C  C   . ASP A 1 208 ? 20.369  -26.612 27.263  1.00 63.56  ? 207  ASP A C   1 
ATOM   1536 O  O   . ASP A 1 208 ? 20.810  -27.587 26.660  1.00 67.98  ? 207  ASP A O   1 
ATOM   1537 C  CB  . ASP A 1 208 ? 21.954  -24.728 27.112  1.00 68.71  ? 207  ASP A CB  1 
ATOM   1538 C  CG  . ASP A 1 208 ? 22.552  -23.742 26.115  1.00 78.94  ? 207  ASP A CG  1 
ATOM   1539 O  OD1 . ASP A 1 208 ? 21.923  -23.486 25.064  1.00 86.84  ? 207  ASP A OD1 1 
ATOM   1540 O  OD2 . ASP A 1 208 ? 23.649  -23.211 26.373  1.00 85.86  ? 207  ASP A OD2 1 
ATOM   1541 N  N   . LEU A 1 209 ? 19.721  -26.690 28.419  1.00 63.10  ? 208  LEU A N   1 
ATOM   1542 C  CA  . LEU A 1 209 ? 19.280  -27.976 28.969  1.00 66.56  ? 208  LEU A CA  1 
ATOM   1543 C  C   . LEU A 1 209 ? 18.006  -28.552 28.291  1.00 61.12  ? 208  LEU A C   1 
ATOM   1544 O  O   . LEU A 1 209 ? 17.512  -29.605 28.713  1.00 60.84  ? 208  LEU A O   1 
ATOM   1545 C  CB  . LEU A 1 209 ? 19.085  -27.876 30.491  1.00 67.19  ? 208  LEU A CB  1 
ATOM   1546 C  CG  . LEU A 1 209 ? 20.275  -28.346 31.334  1.00 68.82  ? 208  LEU A CG  1 
ATOM   1547 C  CD1 . LEU A 1 209 ? 21.555  -27.579 31.006  1.00 67.01  ? 208  LEU A CD1 1 
ATOM   1548 C  CD2 . LEU A 1 209 ? 19.937  -28.279 32.822  1.00 70.64  ? 208  LEU A CD2 1 
ATOM   1549 N  N   . GLY A 1 210 ? 17.512  -27.890 27.238  1.00 55.07  ? 209  GLY A N   1 
ATOM   1550 C  CA  . GLY A 1 210 ? 16.328  -28.341 26.511  1.00 58.01  ? 209  GLY A CA  1 
ATOM   1551 C  C   . GLY A 1 210 ? 15.015  -28.077 27.239  1.00 62.56  ? 209  GLY A C   1 
ATOM   1552 O  O   . GLY A 1 210 ? 14.004  -28.714 26.938  1.00 56.16  ? 209  GLY A O   1 
ATOM   1553 N  N   . ILE A 1 211 ? 15.032  -27.146 28.203  1.00 63.73  ? 210  ILE A N   1 
ATOM   1554 C  CA  . ILE A 1 211 ? 13.816  -26.713 28.928  1.00 58.45  ? 210  ILE A CA  1 
ATOM   1555 C  C   . ILE A 1 211 ? 13.260  -25.471 28.234  1.00 57.46  ? 210  ILE A C   1 
ATOM   1556 O  O   . ILE A 1 211 ? 13.913  -24.414 28.238  1.00 52.49  ? 210  ILE A O   1 
ATOM   1557 C  CB  . ILE A 1 211 ? 14.110  -26.388 30.415  1.00 57.01  ? 210  ILE A CB  1 
ATOM   1558 C  CG1 . ILE A 1 211 ? 14.742  -27.623 31.088  1.00 57.78  ? 210  ILE A CG1 1 
ATOM   1559 C  CG2 . ILE A 1 211 ? 12.844  -25.912 31.132  1.00 53.04  ? 210  ILE A CG2 1 
ATOM   1560 C  CD1 . ILE A 1 211 ? 14.902  -27.534 32.592  1.00 56.31  ? 210  ILE A CD1 1 
ATOM   1561 N  N   . THR A 1 212 ? 12.070  -25.608 27.639  1.00 58.58  ? 211  THR A N   1 
ATOM   1562 C  CA  . THR A 1 212 ? 11.461  -24.536 26.824  1.00 59.48  ? 211  THR A CA  1 
ATOM   1563 C  C   . THR A 1 212 ? 10.000  -24.183 27.154  1.00 57.75  ? 211  THR A C   1 
ATOM   1564 O  O   . THR A 1 212 ? 9.516   -23.112 26.727  1.00 56.24  ? 211  THR A O   1 
ATOM   1565 C  CB  . THR A 1 212 ? 11.572  -24.843 25.304  1.00 61.28  ? 211  THR A CB  1 
ATOM   1566 O  OG1 . THR A 1 212 ? 11.025  -26.139 25.009  1.00 57.18  ? 211  THR A OG1 1 
ATOM   1567 C  CG2 . THR A 1 212 ? 13.037  -24.782 24.852  1.00 58.60  ? 211  THR A CG2 1 
ATOM   1568 N  N   . GLY A 1 213 ? 9.298   -25.062 27.886  1.00 52.98  ? 212  GLY A N   1 
ATOM   1569 C  CA  . GLY A 1 213 ? 7.933   -24.755 28.350  1.00 52.93  ? 212  GLY A CA  1 
ATOM   1570 C  C   . GLY A 1 213 ? 7.885   -23.671 29.431  1.00 51.19  ? 212  GLY A C   1 
ATOM   1571 O  O   . GLY A 1 213 ? 8.924   -23.251 29.951  1.00 51.28  ? 212  GLY A O   1 
ATOM   1572 N  N   . PRO A 1 214 ? 6.685   -23.190 29.770  1.00 47.31  ? 213  PRO A N   1 
ATOM   1573 C  CA  . PRO A 1 214 ? 6.498   -22.140 30.765  1.00 45.30  ? 213  PRO A CA  1 
ATOM   1574 C  C   . PRO A 1 214 ? 7.212   -22.388 32.083  1.00 46.40  ? 213  PRO A C   1 
ATOM   1575 O  O   . PRO A 1 214 ? 7.543   -21.415 32.765  1.00 48.21  ? 213  PRO A O   1 
ATOM   1576 C  CB  . PRO A 1 214 ? 4.978   -22.150 30.996  1.00 44.84  ? 213  PRO A CB  1 
ATOM   1577 C  CG  . PRO A 1 214 ? 4.425   -22.590 29.699  1.00 45.06  ? 213  PRO A CG  1 
ATOM   1578 C  CD  . PRO A 1 214 ? 5.402   -23.622 29.205  1.00 47.57  ? 213  PRO A CD  1 
ATOM   1579 N  N   . GLU A 1 215 ? 7.417   -23.662 32.462  1.00 48.84  ? 214  GLU A N   1 
ATOM   1580 C  CA  . GLU A 1 215 ? 8.026   -24.018 33.776  1.00 47.87  ? 214  GLU A CA  1 
ATOM   1581 C  C   . GLU A 1 215 ? 9.452   -23.494 33.921  1.00 48.29  ? 214  GLU A C   1 
ATOM   1582 O  O   . GLU A 1 215 ? 9.930   -23.261 35.025  1.00 44.63  ? 214  GLU A O   1 
ATOM   1583 C  CB  . GLU A 1 215 ? 7.994   -25.525 34.026  1.00 49.87  ? 214  GLU A CB  1 
ATOM   1584 C  CG  . GLU A 1 215 ? 9.078   -26.357 33.324  1.00 55.44  ? 214  GLU A CG  1 
ATOM   1585 C  CD  . GLU A 1 215 ? 8.664   -26.911 31.963  1.00 54.05  ? 214  GLU A CD  1 
ATOM   1586 O  OE1 . GLU A 1 215 ? 7.729   -26.364 31.321  1.00 52.73  ? 214  GLU A OE1 1 
ATOM   1587 O  OE2 . GLU A 1 215 ? 9.304   -27.894 31.531  1.00 54.95  ? 214  GLU A OE2 1 
ATOM   1588 N  N   . GLY A 1 216 ? 10.114  -23.321 32.774  1.00 52.15  ? 215  GLY A N   1 
ATOM   1589 C  CA  . GLY A 1 216 ? 11.420  -22.684 32.690  1.00 49.36  ? 215  GLY A CA  1 
ATOM   1590 C  C   . GLY A 1 216 ? 11.485  -21.309 33.341  1.00 46.26  ? 215  GLY A C   1 
ATOM   1591 O  O   . GLY A 1 216 ? 12.543  -20.913 33.815  1.00 46.22  ? 215  GLY A O   1 
ATOM   1592 N  N   . ILE A 1 217 ? 10.372  -20.572 33.360  1.00 44.73  ? 216  ILE A N   1 
ATOM   1593 C  CA  . ILE A 1 217 ? 10.341  -19.256 34.026  1.00 47.03  ? 216  ILE A CA  1 
ATOM   1594 C  C   . ILE A 1 217 ? 10.688  -19.407 35.496  1.00 46.45  ? 216  ILE A C   1 
ATOM   1595 O  O   . ILE A 1 217 ? 11.244  -18.505 36.090  1.00 49.68  ? 216  ILE A O   1 
ATOM   1596 C  CB  . ILE A 1 217 ? 8.989   -18.513 33.885  1.00 44.05  ? 216  ILE A CB  1 
ATOM   1597 C  CG1 . ILE A 1 217 ? 9.156   -17.022 34.172  1.00 45.28  ? 216  ILE A CG1 1 
ATOM   1598 C  CG2 . ILE A 1 217 ? 7.917   -19.083 34.812  1.00 44.01  ? 216  ILE A CG2 1 
ATOM   1599 C  CD1 . ILE A 1 217 ? 10.131  -16.312 33.259  1.00 48.55  ? 216  ILE A CD1 1 
ATOM   1600 N  N   . GLU A 1 218 ? 10.368  -20.568 36.057  1.00 52.00  ? 217  GLU A N   1 
ATOM   1601 C  CA  . GLU A 1 218 ? 10.692  -20.911 37.449  1.00 55.63  ? 217  GLU A CA  1 
ATOM   1602 C  C   . GLU A 1 218 ? 12.114  -21.502 37.617  1.00 53.82  ? 217  GLU A C   1 
ATOM   1603 O  O   . GLU A 1 218 ? 12.902  -21.040 38.449  1.00 42.18  ? 217  GLU A O   1 
ATOM   1604 C  CB  . GLU A 1 218 ? 9.670   -21.922 37.969  1.00 57.64  ? 217  GLU A CB  1 
ATOM   1605 C  CG  . GLU A 1 218 ? 9.460   -21.868 39.466  1.00 63.41  ? 217  GLU A CG  1 
ATOM   1606 C  CD  . GLU A 1 218 ? 8.272   -22.698 39.886  1.00 71.16  ? 217  GLU A CD  1 
ATOM   1607 O  OE1 . GLU A 1 218 ? 8.252   -23.905 39.540  1.00 79.86  ? 217  GLU A OE1 1 
ATOM   1608 O  OE2 . GLU A 1 218 ? 7.355   -22.144 40.537  1.00 68.11  ? 217  GLU A OE2 1 
ATOM   1609 N  N   . ILE A 1 219 ? 12.437  -22.509 36.800  1.00 52.66  ? 218  ILE A N   1 
ATOM   1610 C  CA  . ILE A 1 219 ? 13.707  -23.218 36.912  1.00 53.22  ? 218  ILE A CA  1 
ATOM   1611 C  C   . ILE A 1 219 ? 14.918  -22.263 36.752  1.00 49.79  ? 218  ILE A C   1 
ATOM   1612 O  O   . ILE A 1 219 ? 15.970  -22.435 37.394  1.00 45.23  ? 218  ILE A O   1 
ATOM   1613 C  CB  . ILE A 1 219 ? 13.804  -24.362 35.858  1.00 56.40  ? 218  ILE A CB  1 
ATOM   1614 C  CG1 . ILE A 1 219 ? 12.676  -25.390 35.959  1.00 52.95  ? 218  ILE A CG1 1 
ATOM   1615 C  CG2 . ILE A 1 219 ? 15.167  -25.061 35.947  1.00 59.43  ? 218  ILE A CG2 1 
ATOM   1616 C  CD1 . ILE A 1 219 ? 12.744  -26.218 37.212  1.00 57.63  ? 218  ILE A CD1 1 
ATOM   1617 N  N   . SER A 1 220 ? 14.748  -21.280 35.870  1.00 46.52  ? 219  SER A N   1 
ATOM   1618 C  CA  . SER A 1 220 ? 15.784  -20.334 35.504  1.00 47.24  ? 219  SER A CA  1 
ATOM   1619 C  C   . SER A 1 220 ? 16.049  -19.297 36.567  1.00 46.75  ? 219  SER A C   1 
ATOM   1620 O  O   . SER A 1 220 ? 17.111  -18.661 36.584  1.00 47.11  ? 219  SER A O   1 
ATOM   1621 C  CB  . SER A 1 220 ? 15.360  -19.579 34.236  1.00 50.35  ? 219  SER A CB  1 
ATOM   1622 O  OG  . SER A 1 220 ? 14.199  -18.792 34.471  1.00 52.36  ? 219  SER A OG  1 
ATOM   1623 N  N   . ARG A 1 221 ? 15.064  -19.071 37.426  1.00 46.67  ? 220  ARG A N   1 
ATOM   1624 C  CA  . ARG A 1 221 ? 15.182  -18.012 38.427  1.00 43.54  ? 220  ARG A CA  1 
ATOM   1625 C  C   . ARG A 1 221 ? 14.627  -18.472 39.750  1.00 38.99  ? 220  ARG A C   1 
ATOM   1626 O  O   . ARG A 1 221 ? 13.606  -17.989 40.199  1.00 34.67  ? 220  ARG A O   1 
ATOM   1627 C  CB  . ARG A 1 221 ? 14.497  -16.733 37.935  1.00 44.39  ? 220  ARG A CB  1 
ATOM   1628 C  CG  . ARG A 1 221 ? 13.143  -16.947 37.291  1.00 41.97  ? 220  ARG A CG  1 
ATOM   1629 C  CD  . ARG A 1 221 ? 13.014  -16.085 36.049  1.00 45.70  ? 220  ARG A CD  1 
ATOM   1630 N  NE  . ARG A 1 221 ? 13.116  -14.659 36.373  1.00 46.17  ? 220  ARG A NE  1 
ATOM   1631 C  CZ  . ARG A 1 221 ? 13.071  -13.654 35.501  1.00 48.99  ? 220  ARG A CZ  1 
ATOM   1632 N  NH1 . ARG A 1 221 ? 12.919  -13.855 34.189  1.00 50.32  ? 220  ARG A NH1 1 
ATOM   1633 N  NH2 . ARG A 1 221 ? 13.169  -12.414 35.955  1.00 50.54  ? 220  ARG A NH2 1 
ATOM   1634 N  N   . PRO A 1 222 ? 15.300  -19.424 40.385  1.00 39.90  ? 221  PRO A N   1 
ATOM   1635 C  CA  . PRO A 1 222 ? 14.765  -19.813 41.680  1.00 45.34  ? 221  PRO A CA  1 
ATOM   1636 C  C   . PRO A 1 222 ? 14.941  -18.733 42.762  1.00 45.20  ? 221  PRO A C   1 
ATOM   1637 O  O   . PRO A 1 222 ? 15.779  -17.828 42.667  1.00 46.29  ? 221  PRO A O   1 
ATOM   1638 C  CB  . PRO A 1 222 ? 15.562  -21.077 42.023  1.00 46.03  ? 221  PRO A CB  1 
ATOM   1639 C  CG  . PRO A 1 222 ? 16.871  -20.833 41.359  1.00 45.87  ? 221  PRO A CG  1 
ATOM   1640 C  CD  . PRO A 1 222 ? 16.514  -20.180 40.053  1.00 42.43  ? 221  PRO A CD  1 
ATOM   1641 N  N   . GLU A 1 223 ? 14.142  -18.869 43.798  1.00 44.43  ? 222  GLU A N   1 
ATOM   1642 C  CA  . GLU A 1 223 ? 13.957  -17.799 44.739  1.00 44.80  ? 222  GLU A CA  1 
ATOM   1643 C  C   . GLU A 1 223 ? 15.247  -17.267 45.387  1.00 42.39  ? 222  GLU A C   1 
ATOM   1644 O  O   . GLU A 1 223 ? 15.253  -16.113 45.879  1.00 36.97  ? 222  GLU A O   1 
ATOM   1645 C  CB  . GLU A 1 223 ? 12.917  -18.194 45.795  1.00 46.97  ? 222  GLU A CB  1 
ATOM   1646 C  CG  . GLU A 1 223 ? 13.381  -19.153 46.882  1.00 48.99  ? 222  GLU A CG  1 
ATOM   1647 C  CD  . GLU A 1 223 ? 12.264  -19.407 47.891  1.00 48.87  ? 222  GLU A CD  1 
ATOM   1648 O  OE1 . GLU A 1 223 ? 11.318  -20.128 47.556  1.00 46.61  ? 222  GLU A OE1 1 
ATOM   1649 O  OE2 . GLU A 1 223 ? 12.299  -18.830 48.990  1.00 47.84  ? 222  GLU A OE2 1 
ATOM   1650 N  N   . GLU A 1 224 ? 16.323  -18.063 45.377  1.00 38.55  ? 223  GLU A N   1 
ATOM   1651 C  CA  . GLU A 1 224 ? 17.588  -17.567 45.936  1.00 39.43  ? 223  GLU A CA  1 
ATOM   1652 C  C   . GLU A 1 224 ? 18.060  -16.281 45.229  1.00 38.68  ? 223  GLU A C   1 
ATOM   1653 O  O   . GLU A 1 224 ? 18.639  -15.378 45.865  1.00 36.23  ? 223  GLU A O   1 
ATOM   1654 C  CB  . GLU A 1 224 ? 18.686  -18.643 45.968  1.00 41.23  ? 223  GLU A CB  1 
ATOM   1655 C  CG  . GLU A 1 224 ? 18.809  -19.510 44.724  1.00 46.04  ? 223  GLU A CG  1 
ATOM   1656 C  CD  . GLU A 1 224 ? 20.215  -20.098 44.497  1.00 45.82  ? 223  GLU A CD  1 
ATOM   1657 O  OE1 . GLU A 1 224 ? 21.176  -19.709 45.226  1.00 46.49  ? 223  GLU A OE1 1 
ATOM   1658 O  OE2 . GLU A 1 224 ? 20.345  -20.964 43.589  1.00 40.02  ? 223  GLU A OE2 1 
ATOM   1659 N  N   . LEU A 1 225 ? 17.761  -16.192 43.930  1.00 39.81  ? 224  LEU A N   1 
ATOM   1660 C  CA  . LEU A 1 225 ? 18.086  -15.026 43.100  1.00 37.44  ? 224  LEU A CA  1 
ATOM   1661 C  C   . LEU A 1 225 ? 17.353  -13.781 43.527  1.00 34.75  ? 224  LEU A C   1 
ATOM   1662 O  O   . LEU A 1 225 ? 17.903  -12.681 43.418  1.00 34.15  ? 224  LEU A O   1 
ATOM   1663 C  CB  . LEU A 1 225 ? 17.760  -15.293 41.623  1.00 38.53  ? 224  LEU A CB  1 
ATOM   1664 C  CG  . LEU A 1 225 ? 18.557  -16.306 40.799  1.00 39.00  ? 224  LEU A CG  1 
ATOM   1665 C  CD1 . LEU A 1 225 ? 18.406  -16.082 39.306  1.00 38.57  ? 224  LEU A CD1 1 
ATOM   1666 C  CD2 . LEU A 1 225 ? 20.020  -16.292 41.153  1.00 40.48  ? 224  LEU A CD2 1 
ATOM   1667 N  N   . GLU A 1 226 ? 16.111  -13.946 43.982  1.00 35.85  ? 225  GLU A N   1 
ATOM   1668 C  CA  . GLU A 1 226 ? 15.298  -12.810 44.504  1.00 34.87  ? 225  GLU A CA  1 
ATOM   1669 C  C   . GLU A 1 226 ? 15.800  -12.389 45.875  1.00 35.40  ? 225  GLU A C   1 
ATOM   1670 O  O   . GLU A 1 226 ? 16.081  -11.217 46.127  1.00 32.01  ? 225  GLU A O   1 
ATOM   1671 C  CB  . GLU A 1 226 ? 13.819  -13.176 44.606  1.00 33.29  ? 225  GLU A CB  1 
ATOM   1672 C  CG  . GLU A 1 226 ? 12.904  -12.023 45.039  1.00 32.98  ? 225  GLU A CG  1 
ATOM   1673 C  CD  . GLU A 1 226 ? 11.453  -12.442 45.256  1.00 33.78  ? 225  GLU A CD  1 
ATOM   1674 O  OE1 . GLU A 1 226 ? 11.075  -13.610 44.967  1.00 32.16  ? 225  GLU A OE1 1 
ATOM   1675 O  OE2 . GLU A 1 226 ? 10.674  -11.601 45.737  1.00 34.93  ? 225  GLU A OE2 1 
ATOM   1676 N  N   . ALA A 1 227 ? 15.917  -13.379 46.749  1.00 37.12  ? 226  ALA A N   1 
ATOM   1677 C  CA  . ALA A 1 227 ? 16.432  -13.178 48.091  1.00 36.50  ? 226  ALA A CA  1 
ATOM   1678 C  C   . ALA A 1 227 ? 17.747  -12.393 48.070  1.00 36.37  ? 226  ALA A C   1 
ATOM   1679 O  O   . ALA A 1 227 ? 17.931  -11.453 48.859  1.00 36.77  ? 226  ALA A O   1 
ATOM   1680 C  CB  . ALA A 1 227 ? 16.611  -14.529 48.770  1.00 37.00  ? 226  ALA A CB  1 
ATOM   1681 N  N   . GLU A 1 228 ? 18.651  -12.804 47.178  1.00 36.60  ? 227  GLU A N   1 
ATOM   1682 C  CA  . GLU A 1 228 ? 19.964  -12.172 46.998  1.00 36.93  ? 227  GLU A CA  1 
ATOM   1683 C  C   . GLU A 1 228 ? 19.813  -10.696 46.619  1.00 33.18  ? 227  GLU A C   1 
ATOM   1684 O  O   . GLU A 1 228 ? 20.237  -9.818  47.352  1.00 35.07  ? 227  GLU A O   1 
ATOM   1685 C  CB  . GLU A 1 228 ? 20.778  -12.925 45.920  1.00 39.35  ? 227  GLU A CB  1 
ATOM   1686 C  CG  . GLU A 1 228 ? 22.230  -12.499 45.732  1.00 39.42  ? 227  GLU A CG  1 
ATOM   1687 C  CD  . GLU A 1 228 ? 22.396  -11.119 45.108  1.00 42.25  ? 227  GLU A CD  1 
ATOM   1688 O  OE1 . GLU A 1 228 ? 22.020  -10.922 43.931  1.00 40.04  ? 227  GLU A OE1 1 
ATOM   1689 O  OE2 . GLU A 1 228 ? 22.883  -10.207 45.817  1.00 46.61  ? 227  GLU A OE2 1 
ATOM   1690 N  N   . ALA A 1 229 ? 19.213  -10.433 45.476  1.00 31.29  ? 228  ALA A N   1 
ATOM   1691 C  CA  . ALA A 1 229 ? 19.075  -9.062  44.978  1.00 33.52  ? 228  ALA A CA  1 
ATOM   1692 C  C   . ALA A 1 229 ? 18.375  -8.175  45.985  1.00 34.62  ? 228  ALA A C   1 
ATOM   1693 O  O   . ALA A 1 229 ? 18.770  -7.035  46.188  1.00 35.95  ? 228  ALA A O   1 
ATOM   1694 C  CB  . ALA A 1 229 ? 18.308  -9.042  43.661  1.00 33.52  ? 228  ALA A CB  1 
ATOM   1695 N  N   . THR A 1 230 ? 17.323  -8.714  46.595  1.00 34.92  ? 229  THR A N   1 
ATOM   1696 C  CA  . THR A 1 230 ? 16.554  -8.024  47.601  1.00 35.07  ? 229  THR A CA  1 
ATOM   1697 C  C   . THR A 1 230 ? 17.447  -7.588  48.737  1.00 33.56  ? 229  THR A C   1 
ATOM   1698 O  O   . THR A 1 230 ? 17.427  -6.436  49.144  1.00 37.13  ? 229  THR A O   1 
ATOM   1699 C  CB  . THR A 1 230 ? 15.450  -8.940  48.164  1.00 36.98  ? 229  THR A CB  1 
ATOM   1700 O  OG1 . THR A 1 230 ? 14.443  -9.144  47.158  1.00 36.01  ? 229  THR A OG1 1 
ATOM   1701 C  CG2 . THR A 1 230 ? 14.813  -8.335  49.407  1.00 36.58  ? 229  THR A CG2 1 
ATOM   1702 N  N   . HIS A 1 231 ? 18.246  -8.503  49.225  1.00 31.20  ? 230  HIS A N   1 
ATOM   1703 C  CA  . HIS A 1 231 ? 19.141  -8.188  50.318  1.00 33.96  ? 230  HIS A CA  1 
ATOM   1704 C  C   . HIS A 1 231 ? 20.140  -7.117  49.895  1.00 37.86  ? 230  HIS A C   1 
ATOM   1705 O  O   . HIS A 1 231 ? 20.477  -6.208  50.662  1.00 40.56  ? 230  HIS A O   1 
ATOM   1706 C  CB  . HIS A 1 231 ? 19.855  -9.465  50.761  1.00 32.13  ? 230  HIS A CB  1 
ATOM   1707 C  CG  . HIS A 1 231 ? 20.843  -9.262  51.840  1.00 29.61  ? 230  HIS A CG  1 
ATOM   1708 N  ND1 . HIS A 1 231 ? 21.723  -10.244 52.226  1.00 29.73  ? 230  HIS A ND1 1 
ATOM   1709 C  CD2 . HIS A 1 231 ? 21.081  -8.207  52.645  1.00 31.26  ? 230  HIS A CD2 1 
ATOM   1710 C  CE1 . HIS A 1 231 ? 22.462  -9.808  53.229  1.00 31.60  ? 230  HIS A CE1 1 
ATOM   1711 N  NE2 . HIS A 1 231 ? 22.099  -8.567  53.496  1.00 33.96  ? 230  HIS A NE2 1 
ATOM   1712 N  N   . ARG A 1 232 ? 20.607  -7.221  48.655  1.00 42.87  ? 231  ARG A N   1 
ATOM   1713 C  CA  . ARG A 1 232 ? 21.620  -6.300  48.113  1.00 42.30  ? 231  ARG A CA  1 
ATOM   1714 C  C   . ARG A 1 232 ? 21.123  -4.863  47.975  1.00 43.51  ? 231  ARG A C   1 
ATOM   1715 O  O   . ARG A 1 232 ? 21.794  -3.944  48.444  1.00 52.92  ? 231  ARG A O   1 
ATOM   1716 C  CB  . ARG A 1 232 ? 22.114  -6.790  46.757  1.00 43.53  ? 231  ARG A CB  1 
ATOM   1717 C  CG  . ARG A 1 232 ? 23.264  -5.975  46.171  1.00 43.86  ? 231  ARG A CG  1 
ATOM   1718 C  CD  . ARG A 1 232 ? 24.052  -6.771  45.134  1.00 41.57  ? 231  ARG A CD  1 
ATOM   1719 N  NE  . ARG A 1 232 ? 23.169  -7.540  44.242  1.00 41.69  ? 231  ARG A NE  1 
ATOM   1720 C  CZ  . ARG A 1 232 ? 22.775  -7.182  43.012  1.00 44.20  ? 231  ARG A CZ  1 
ATOM   1721 N  NH1 . ARG A 1 232 ? 23.190  -6.047  42.450  1.00 42.42  ? 231  ARG A NH1 1 
ATOM   1722 N  NH2 . ARG A 1 232 ? 21.938  -7.976  42.328  1.00 46.67  ? 231  ARG A NH2 1 
ATOM   1723 N  N   . VAL A 1 233 ? 19.964  -4.673  47.346  1.00 37.88  ? 232  VAL A N   1 
ATOM   1724 C  CA  . VAL A 1 233 ? 19.398  -3.342  47.169  1.00 34.91  ? 232  VAL A CA  1 
ATOM   1725 C  C   . VAL A 1 233 ? 19.000  -2.671  48.512  1.00 31.86  ? 232  VAL A C   1 
ATOM   1726 O  O   . VAL A 1 233 ? 19.067  -1.462  48.669  1.00 25.98  ? 232  VAL A O   1 
ATOM   1727 C  CB  . VAL A 1 233 ? 18.207  -3.387  46.188  1.00 35.47  ? 232  VAL A CB  1 
ATOM   1728 C  CG1 . VAL A 1 233 ? 16.981  -3.992  46.843  1.00 36.39  ? 232  VAL A CG1 1 
ATOM   1729 C  CG2 . VAL A 1 233 ? 17.889  -1.992  45.655  1.00 36.46  ? 232  VAL A CG2 1 
ATOM   1730 N  N   . ILE A 1 234 ? 18.612  -3.470  49.481  1.00 32.62  ? 233  ILE A N   1 
ATOM   1731 C  CA  . ILE A 1 234 ? 18.339  -2.945  50.798  1.00 34.73  ? 233  ILE A CA  1 
ATOM   1732 C  C   . ILE A 1 234 ? 19.632  -2.381  51.417  1.00 35.36  ? 233  ILE A C   1 
ATOM   1733 O  O   . ILE A 1 234 ? 19.628  -1.345  52.083  1.00 34.65  ? 233  ILE A O   1 
ATOM   1734 C  CB  . ILE A 1 234 ? 17.745  -4.033  51.712  1.00 34.75  ? 233  ILE A CB  1 
ATOM   1735 C  CG1 . ILE A 1 234 ? 16.281  -4.258  51.364  1.00 34.90  ? 233  ILE A CG1 1 
ATOM   1736 C  CG2 . ILE A 1 234 ? 17.888  -3.672  53.183  1.00 36.33  ? 233  ILE A CG2 1 
ATOM   1737 C  CD1 . ILE A 1 234 ? 15.693  -5.479  52.047  1.00 36.72  ? 233  ILE A CD1 1 
ATOM   1738 N  N   . THR A 1 235 ? 20.738  -3.068  51.209  1.00 35.01  ? 234  THR A N   1 
ATOM   1739 C  CA  . THR A 1 235 ? 22.007  -2.593  51.745  1.00 37.47  ? 234  THR A CA  1 
ATOM   1740 C  C   . THR A 1 235 ? 22.430  -1.302  51.071  1.00 39.68  ? 234  THR A C   1 
ATOM   1741 O  O   . THR A 1 235 ? 22.748  -0.318  51.749  1.00 39.47  ? 234  THR A O   1 
ATOM   1742 C  CB  . THR A 1 235 ? 23.121  -3.610  51.533  1.00 36.88  ? 234  THR A CB  1 
ATOM   1743 O  OG1 . THR A 1 235 ? 22.706  -4.869  52.074  1.00 37.87  ? 234  THR A OG1 1 
ATOM   1744 C  CG2 . THR A 1 235 ? 24.388  -3.138  52.219  1.00 38.74  ? 234  THR A CG2 1 
ATOM   1745 N  N   . ILE A 1 236 ? 22.443  -1.322  49.734  1.00 38.87  ? 235  ILE A N   1 
ATOM   1746 C  CA  . ILE A 1 236 ? 22.711  -0.133  48.936  1.00 36.79  ? 235  ILE A CA  1 
ATOM   1747 C  C   . ILE A 1 236 ? 21.888  1.045   49.451  1.00 38.07  ? 235  ILE A C   1 
ATOM   1748 O  O   . ILE A 1 236 ? 22.437  2.124   49.772  1.00 37.54  ? 235  ILE A O   1 
ATOM   1749 C  CB  . ILE A 1 236 ? 22.356  -0.350  47.468  1.00 38.98  ? 235  ILE A CB  1 
ATOM   1750 C  CG1 . ILE A 1 236 ? 23.278  -1.400  46.827  1.00 41.90  ? 235  ILE A CG1 1 
ATOM   1751 C  CG2 . ILE A 1 236 ? 22.483  0.969   46.723  1.00 40.21  ? 235  ILE A CG2 1 
ATOM   1752 C  CD1 . ILE A 1 236 ? 22.866  -1.817  45.427  1.00 44.87  ? 235  ILE A CD1 1 
ATOM   1753 N  N   . ALA A 1 237 ? 20.571  0.817   49.529  1.00 36.73  ? 236  ALA A N   1 
ATOM   1754 C  CA  . ALA A 1 237 ? 19.599  1.828   49.944  1.00 36.28  ? 236  ALA A CA  1 
ATOM   1755 C  C   . ALA A 1 237 ? 19.889  2.364   51.325  1.00 37.24  ? 236  ALA A C   1 
ATOM   1756 O  O   . ALA A 1 237 ? 19.958  3.583   51.538  1.00 37.48  ? 236  ALA A O   1 
ATOM   1757 C  CB  . ALA A 1 237 ? 18.220  1.242   49.928  1.00 38.24  ? 236  ALA A CB  1 
ATOM   1758 N  N   . ASN A 1 238 ? 20.090  1.445   52.256  1.00 35.14  ? 237  ASN A N   1 
ATOM   1759 C  CA  . ASN A 1 238 ? 20.483  1.816   53.608  1.00 36.40  ? 237  ASN A CA  1 
ATOM   1760 C  C   . ASN A 1 238 ? 21.768  2.597   53.681  1.00 37.36  ? 237  ASN A C   1 
ATOM   1761 O  O   . ASN A 1 238 ? 21.916  3.438   54.556  1.00 45.01  ? 237  ASN A O   1 
ATOM   1762 C  CB  . ASN A 1 238 ? 20.638  0.577   54.460  1.00 39.84  ? 237  ASN A CB  1 
ATOM   1763 C  CG  . ASN A 1 238 ? 20.623  0.885   55.918  1.00 38.27  ? 237  ASN A CG  1 
ATOM   1764 O  OD1 . ASN A 1 238 ? 19.626  1.403   56.464  1.00 40.06  ? 237  ASN A OD1 1 
ATOM   1765 N  ND2 . ASN A 1 238 ? 21.697  0.533   56.572  1.00 37.77  ? 237  ASN A ND2 1 
ATOM   1766 N  N   . ARG A 1 239 ? 22.697  2.339   52.760  1.00 39.38  ? 238  ARG A N   1 
ATOM   1767 C  CA  . ARG A 1 239 ? 23.929  3.138   52.669  1.00 40.29  ? 238  ARG A CA  1 
ATOM   1768 C  C   . ARG A 1 239 ? 23.636  4.514   52.143  1.00 38.15  ? 238  ARG A C   1 
ATOM   1769 O  O   . ARG A 1 239 ? 24.054  5.487   52.726  1.00 36.23  ? 238  ARG A O   1 
ATOM   1770 C  CB  . ARG A 1 239 ? 24.993  2.475   51.786  1.00 43.71  ? 238  ARG A CB  1 
ATOM   1771 C  CG  . ARG A 1 239 ? 25.529  1.131   52.286  1.00 45.14  ? 238  ARG A CG  1 
ATOM   1772 C  CD  . ARG A 1 239 ? 26.022  1.174   53.716  1.00 43.29  ? 238  ARG A CD  1 
ATOM   1773 N  NE  . ARG A 1 239 ? 27.358  1.723   53.815  1.00 44.64  ? 238  ARG A NE  1 
ATOM   1774 C  CZ  . ARG A 1 239 ? 27.832  2.367   54.877  1.00 52.81  ? 238  ARG A CZ  1 
ATOM   1775 N  NH1 . ARG A 1 239 ? 27.047  2.605   55.946  1.00 57.22  ? 238  ARG A NH1 1 
ATOM   1776 N  NH2 . ARG A 1 239 ? 29.102  2.787   54.872  1.00 50.51  ? 238  ARG A NH2 1 
ATOM   1777 N  N   . THR A 1 240 ? 22.873  4.592   51.062  1.00 40.56  ? 239  THR A N   1 
ATOM   1778 C  CA  . THR A 1 240 ? 22.518  5.887   50.457  1.00 41.48  ? 239  THR A CA  1 
ATOM   1779 C  C   . THR A 1 240 ? 21.418  6.657   51.196  1.00 41.58  ? 239  THR A C   1 
ATOM   1780 O  O   . THR A 1 240 ? 21.086  7.758   50.784  1.00 34.26  ? 239  THR A O   1 
ATOM   1781 C  CB  . THR A 1 240 ? 22.041  5.718   49.013  1.00 41.83  ? 239  THR A CB  1 
ATOM   1782 O  OG1 . THR A 1 240 ? 20.978  4.754   48.950  1.00 42.10  ? 239  THR A OG1 1 
ATOM   1783 C  CG2 . THR A 1 240 ? 23.189  5.270   48.154  1.00 44.82  ? 239  THR A CG2 1 
ATOM   1784 N  N   . HIS A 1 241 ? 20.870  6.068   52.271  1.00 43.94  ? 240  HIS A N   1 
ATOM   1785 C  CA  . HIS A 1 241 ? 19.830  6.694   53.112  1.00 44.90  ? 240  HIS A CA  1 
ATOM   1786 C  C   . HIS A 1 241 ? 18.509  6.876   52.361  1.00 46.04  ? 240  HIS A C   1 
ATOM   1787 O  O   . HIS A 1 241 ? 17.702  7.739   52.720  1.00 48.55  ? 240  HIS A O   1 
ATOM   1788 C  CB  . HIS A 1 241 ? 20.284  8.052   53.694  1.00 46.29  ? 240  HIS A CB  1 
ATOM   1789 C  CG  . HIS A 1 241 ? 21.551  7.982   54.486  1.00 53.00  ? 240  HIS A CG  1 
ATOM   1790 N  ND1 . HIS A 1 241 ? 21.599  7.470   55.767  1.00 57.97  ? 240  HIS A ND1 1 
ATOM   1791 C  CD2 . HIS A 1 241 ? 22.821  8.349   54.183  1.00 56.52  ? 240  HIS A CD2 1 
ATOM   1792 C  CE1 . HIS A 1 241 ? 22.843  7.504   56.212  1.00 61.43  ? 240  HIS A CE1 1 
ATOM   1793 N  NE2 . HIS A 1 241 ? 23.604  8.038   55.273  1.00 62.87  ? 240  HIS A NE2 1 
ATOM   1794 N  N   . CYS A 1 242 ? 18.286  6.054   51.330  1.00 44.52  ? 241  CYS A N   1 
ATOM   1795 C  CA  . CYS A 1 242 ? 17.093  6.158   50.486  1.00 41.40  ? 241  CYS A CA  1 
ATOM   1796 C  C   . CYS A 1 242 ? 16.053  5.119   50.877  1.00 44.92  ? 241  CYS A C   1 
ATOM   1797 O  O   . CYS A 1 242 ? 16.395  3.951   51.113  1.00 46.84  ? 241  CYS A O   1 
ATOM   1798 C  CB  . CYS A 1 242 ? 17.464  5.924   49.033  1.00 40.15  ? 241  CYS A CB  1 
ATOM   1799 S  SG  . CYS A 1 242 ? 16.091  5.955   47.846  1.00 32.25  ? 241  CYS A SG  1 
ATOM   1800 N  N   . PRO A 1 243 ? 14.769  5.524   50.922  1.00 46.45  ? 242  PRO A N   1 
ATOM   1801 C  CA  . PRO A 1 243 ? 13.737  4.553   51.189  1.00 44.57  ? 242  PRO A CA  1 
ATOM   1802 C  C   . PRO A 1 243 ? 13.536  3.674   50.008  1.00 41.19  ? 242  PRO A C   1 
ATOM   1803 O  O   . PRO A 1 243 ? 13.381  4.158   48.873  1.00 42.04  ? 242  PRO A O   1 
ATOM   1804 C  CB  . PRO A 1 243 ? 12.501  5.404   51.377  1.00 47.03  ? 242  PRO A CB  1 
ATOM   1805 C  CG  . PRO A 1 243 ? 12.738  6.585   50.522  1.00 47.53  ? 242  PRO A CG  1 
ATOM   1806 C  CD  . PRO A 1 243 ? 14.186  6.868   50.783  1.00 48.74  ? 242  PRO A CD  1 
ATOM   1807 N  N   . ILE A 1 244 ? 13.542  2.384   50.290  1.00 38.59  ? 243  ILE A N   1 
ATOM   1808 C  CA  . ILE A 1 244 ? 13.512  1.383   49.255  1.00 36.08  ? 243  ILE A CA  1 
ATOM   1809 C  C   . ILE A 1 244 ? 12.205  0.604   49.360  1.00 33.35  ? 243  ILE A C   1 
ATOM   1810 O  O   . ILE A 1 244 ? 11.760  0.229   50.444  1.00 33.47  ? 243  ILE A O   1 
ATOM   1811 C  CB  . ILE A 1 244 ? 14.777  0.467   49.309  1.00 35.25  ? 243  ILE A CB  1 
ATOM   1812 C  CG1 . ILE A 1 244 ? 14.901  -0.317  47.997  1.00 35.92  ? 243  ILE A CG1 1 
ATOM   1813 C  CG2 . ILE A 1 244 ? 14.764  -0.489  50.501  1.00 33.20  ? 243  ILE A CG2 1 
ATOM   1814 C  CD1 . ILE A 1 244 ? 15.348  0.549   46.860  1.00 35.90  ? 243  ILE A CD1 1 
ATOM   1815 N  N   . TYR A 1 245 ? 11.623  0.346   48.207  1.00 30.91  ? 244  TYR A N   1 
ATOM   1816 C  CA  . TYR A 1 245 ? 10.298  -0.215  48.114  1.00 31.04  ? 244  TYR A CA  1 
ATOM   1817 C  C   . TYR A 1 245 ? 10.337  -1.365  47.150  1.00 30.38  ? 244  TYR A C   1 
ATOM   1818 O  O   . TYR A 1 245 ? 10.710  -1.208  46.010  1.00 33.62  ? 244  TYR A O   1 
ATOM   1819 C  CB  . TYR A 1 245 ? 9.388   0.878   47.608  1.00 31.42  ? 244  TYR A CB  1 
ATOM   1820 C  CG  . TYR A 1 245 ? 7.951   0.550   47.529  1.00 31.75  ? 244  TYR A CG  1 
ATOM   1821 C  CD1 . TYR A 1 245 ? 7.455   -0.221  46.500  1.00 32.15  ? 244  TYR A CD1 1 
ATOM   1822 C  CD2 . TYR A 1 245 ? 7.061   1.067   48.442  1.00 33.44  ? 244  TYR A CD2 1 
ATOM   1823 C  CE1 . TYR A 1 245 ? 6.103   -0.471  46.391  1.00 32.19  ? 244  TYR A CE1 1 
ATOM   1824 C  CE2 . TYR A 1 245 ? 5.702   0.794   48.351  1.00 33.34  ? 244  TYR A CE2 1 
ATOM   1825 C  CZ  . TYR A 1 245 ? 5.242   0.041   47.317  1.00 32.22  ? 244  TYR A CZ  1 
ATOM   1826 O  OH  . TYR A 1 245 ? 3.921   -0.239  47.217  1.00 33.81  ? 244  TYR A OH  1 
ATOM   1827 N  N   . LEU A 1 246 ? 10.029  -2.549  47.626  1.00 31.27  ? 245  LEU A N   1 
ATOM   1828 C  CA  . LEU A 1 246 ? 10.247  -3.776  46.852  1.00 31.10  ? 245  LEU A CA  1 
ATOM   1829 C  C   . LEU A 1 246 ? 8.965   -4.242  46.218  1.00 32.64  ? 245  LEU A C   1 
ATOM   1830 O  O   . LEU A 1 246 ? 7.912   -4.358  46.870  1.00 36.09  ? 245  LEU A O   1 
ATOM   1831 C  CB  . LEU A 1 246 ? 10.775  -4.884  47.747  1.00 30.09  ? 245  LEU A CB  1 
ATOM   1832 C  CG  . LEU A 1 246 ? 12.192  -4.606  48.163  1.00 30.27  ? 245  LEU A CG  1 
ATOM   1833 C  CD1 . LEU A 1 246 ? 12.470  -5.010  49.573  1.00 32.43  ? 245  LEU A CD1 1 
ATOM   1834 C  CD2 . LEU A 1 246 ? 13.110  -5.370  47.259  1.00 29.56  ? 245  LEU A CD2 1 
ATOM   1835 N  N   . VAL A 1 247 ? 9.053   -4.555  44.943  1.00 32.18  ? 246  VAL A N   1 
ATOM   1836 C  CA  . VAL A 1 247 ? 7.857   -4.837  44.165  1.00 30.38  ? 246  VAL A CA  1 
ATOM   1837 C  C   . VAL A 1 247 ? 7.850   -6.301  43.805  1.00 30.85  ? 246  VAL A C   1 
ATOM   1838 O  O   . VAL A 1 247 ? 8.899   -6.896  43.610  1.00 29.62  ? 246  VAL A O   1 
ATOM   1839 C  CB  . VAL A 1 247 ? 7.725   -3.930  42.933  1.00 27.98  ? 246  VAL A CB  1 
ATOM   1840 C  CG1 . VAL A 1 247 ? 7.911   -2.486  43.352  1.00 29.67  ? 246  VAL A CG1 1 
ATOM   1841 C  CG2 . VAL A 1 247 ? 8.761   -4.266  41.903  1.00 28.52  ? 246  VAL A CG2 1 
ATOM   1842 N  N   . ASN A 1 248 ? 6.634   -6.855  43.750  1.00 33.30  ? 247  ASN A N   1 
ATOM   1843 C  CA  . ASN A 1 248 ? 6.373   -8.193  43.284  1.00 30.95  ? 247  ASN A CA  1 
ATOM   1844 C  C   . ASN A 1 248 ? 7.084   -9.216  44.151  1.00 29.38  ? 247  ASN A C   1 
ATOM   1845 O  O   . ASN A 1 248 ? 7.526   -10.268 43.673  1.00 28.93  ? 247  ASN A O   1 
ATOM   1846 C  CB  . ASN A 1 248 ? 6.792   -8.321  41.811  1.00 33.08  ? 247  ASN A CB  1 
ATOM   1847 C  CG  . ASN A 1 248 ? 5.807   -7.654  40.842  1.00 34.85  ? 247  ASN A CG  1 
ATOM   1848 O  OD1 . ASN A 1 248 ? 5.285   -6.572  41.061  1.00 33.99  ? 247  ASN A OD1 1 
ATOM   1849 N  ND2 . ASN A 1 248 ? 5.568   -8.327  39.746  1.00 38.70  ? 247  ASN A ND2 1 
ATOM   1850 N  N   . VAL A 1 249 ? 7.168   -8.940  45.443  1.00 28.34  ? 248  VAL A N   1 
ATOM   1851 C  CA  . VAL A 1 249 ? 7.799   -9.910  46.341  1.00 28.37  ? 248  VAL A CA  1 
ATOM   1852 C  C   . VAL A 1 249 ? 7.116   -11.285 46.208  1.00 30.32  ? 248  VAL A C   1 
ATOM   1853 O  O   . VAL A 1 249 ? 5.901   -11.458 46.518  1.00 30.52  ? 248  VAL A O   1 
ATOM   1854 C  CB  . VAL A 1 249 ? 7.730   -9.480  47.794  1.00 26.88  ? 248  VAL A CB  1 
ATOM   1855 C  CG1 . VAL A 1 249 ? 8.327   -10.558 48.674  1.00 26.70  ? 248  VAL A CG1 1 
ATOM   1856 C  CG2 . VAL A 1 249 ? 8.458   -8.163  47.966  1.00 26.77  ? 248  VAL A CG2 1 
ATOM   1857 N  N   . SER A 1 250 ? 7.910   -12.258 45.791  1.00 30.12  ? 249  SER A N   1 
ATOM   1858 C  CA  . SER A 1 250 ? 7.394   -13.515 45.297  1.00 33.75  ? 249  SER A CA  1 
ATOM   1859 C  C   . SER A 1 250 ? 7.702   -14.772 46.125  1.00 35.33  ? 249  SER A C   1 
ATOM   1860 O  O   . SER A 1 250 ? 7.153   -15.864 45.818  1.00 31.95  ? 249  SER A O   1 
ATOM   1861 C  CB  . SER A 1 250 ? 8.005   -13.786 43.953  1.00 34.92  ? 249  SER A CB  1 
ATOM   1862 O  OG  . SER A 1 250 ? 9.130   -14.657 44.105  1.00 36.46  ? 249  SER A OG  1 
ATOM   1863 N  N   . SER A 1 251 ? 8.527   -14.621 47.174  1.00 35.82  ? 250  SER A N   1 
ATOM   1864 C  CA  . SER A 1 251 ? 9.128   -15.779 47.808  1.00 35.19  ? 250  SER A CA  1 
ATOM   1865 C  C   . SER A 1 251 ? 9.319   -15.649 49.308  1.00 35.02  ? 250  SER A C   1 
ATOM   1866 O  O   . SER A 1 251 ? 9.452   -14.552 49.855  1.00 30.28  ? 250  SER A O   1 
ATOM   1867 C  CB  . SER A 1 251 ? 10.476  -16.082 47.151  1.00 35.94  ? 250  SER A CB  1 
ATOM   1868 O  OG  . SER A 1 251 ? 11.544  -15.288 47.676  1.00 36.64  ? 250  SER A OG  1 
ATOM   1869 N  N   . ILE A 1 252 ? 9.378   -16.818 49.945  1.00 36.10  ? 251  ILE A N   1 
ATOM   1870 C  CA  . ILE A 1 252 ? 9.583   -16.897 51.365  1.00 38.82  ? 251  ILE A CA  1 
ATOM   1871 C  C   . ILE A 1 252 ? 10.914  -16.259 51.703  1.00 38.87  ? 251  ILE A C   1 
ATOM   1872 O  O   . ILE A 1 252 ? 11.021  -15.484 52.662  1.00 39.37  ? 251  ILE A O   1 
ATOM   1873 C  CB  . ILE A 1 252 ? 9.536   -18.363 51.862  1.00 42.70  ? 251  ILE A CB  1 
ATOM   1874 C  CG1 . ILE A 1 252 ? 8.204   -19.036 51.427  1.00 46.55  ? 251  ILE A CG1 1 
ATOM   1875 C  CG2 . ILE A 1 252 ? 9.715   -18.427 53.375  1.00 40.54  ? 251  ILE A CG2 1 
ATOM   1876 C  CD1 . ILE A 1 252 ? 7.940   -20.377 52.088  1.00 46.56  ? 251  ILE A CD1 1 
ATOM   1877 N  N   . SER A 1 253 ? 11.928  -16.597 50.905  1.00 41.26  ? 252  SER A N   1 
ATOM   1878 C  CA  . SER A 1 253 ? 13.316  -16.177 51.150  1.00 40.77  ? 252  SER A CA  1 
ATOM   1879 C  C   . SER A 1 253 ? 13.411  -14.685 51.166  1.00 38.26  ? 252  SER A C   1 
ATOM   1880 O  O   . SER A 1 253 ? 13.956  -14.080 52.091  1.00 33.34  ? 252  SER A O   1 
ATOM   1881 C  CB  . SER A 1 253 ? 14.222  -16.670 50.033  1.00 42.93  ? 252  SER A CB  1 
ATOM   1882 O  OG  . SER A 1 253 ? 14.249  -18.075 49.946  1.00 47.89  ? 252  SER A OG  1 
ATOM   1883 N  N   . ALA A 1 254 ? 12.853  -14.107 50.108  1.00 37.05  ? 253  ALA A N   1 
ATOM   1884 C  CA  . ALA A 1 254 ? 12.909  -12.683 49.886  1.00 36.79  ? 253  ALA A CA  1 
ATOM   1885 C  C   . ALA A 1 254 ? 12.188  -12.013 51.030  1.00 37.52  ? 253  ALA A C   1 
ATOM   1886 O  O   . ALA A 1 254 ? 12.716  -11.106 51.664  1.00 33.63  ? 253  ALA A O   1 
ATOM   1887 C  CB  . ALA A 1 254 ? 12.257  -12.367 48.564  1.00 35.32  ? 253  ALA A CB  1 
ATOM   1888 N  N   . GLY A 1 255 ? 10.982  -12.518 51.296  1.00 42.03  ? 254  GLY A N   1 
ATOM   1889 C  CA  . GLY A 1 255 ? 10.145  -12.076 52.406  1.00 44.33  ? 254  GLY A CA  1 
ATOM   1890 C  C   . GLY A 1 255 ? 10.856  -12.011 53.750  1.00 40.91  ? 254  GLY A C   1 
ATOM   1891 O  O   . GLY A 1 255 ? 10.647  -11.065 54.519  1.00 40.54  ? 254  GLY A O   1 
ATOM   1892 N  N   . ASP A 1 256 ? 11.678  -13.009 54.031  1.00 36.82  ? 255  ASP A N   1 
ATOM   1893 C  CA  . ASP A 1 256 ? 12.454  -13.021 55.280  1.00 38.18  ? 255  ASP A CA  1 
ATOM   1894 C  C   . ASP A 1 256 ? 13.538  -11.958 55.282  1.00 34.14  ? 255  ASP A C   1 
ATOM   1895 O  O   . ASP A 1 256 ? 13.759  -11.311 56.295  1.00 33.73  ? 255  ASP A O   1 
ATOM   1896 C  CB  . ASP A 1 256 ? 13.116  -14.385 55.513  1.00 41.79  ? 255  ASP A CB  1 
ATOM   1897 C  CG  . ASP A 1 256 ? 12.121  -15.477 55.875  1.00 45.62  ? 255  ASP A CG  1 
ATOM   1898 O  OD1 . ASP A 1 256 ? 10.998  -15.154 56.339  1.00 46.70  ? 255  ASP A OD1 1 
ATOM   1899 O  OD2 . ASP A 1 256 ? 12.486  -16.670 55.713  1.00 50.52  ? 255  ASP A OD2 1 
ATOM   1900 N  N   . VAL A 1 257 ? 14.204  -11.766 54.139  1.00 32.69  ? 256  VAL A N   1 
ATOM   1901 C  CA  . VAL A 1 257 ? 15.196  -10.709 54.020  1.00 30.04  ? 256  VAL A CA  1 
ATOM   1902 C  C   . VAL A 1 257 ? 14.550  -9.378  54.401  1.00 30.98  ? 256  VAL A C   1 
ATOM   1903 O  O   . VAL A 1 257 ? 15.035  -8.637  55.267  1.00 30.48  ? 256  VAL A O   1 
ATOM   1904 C  CB  . VAL A 1 257 ? 15.747  -10.606 52.619  1.00 30.50  ? 256  VAL A CB  1 
ATOM   1905 C  CG1 . VAL A 1 257 ? 16.634  -9.371  52.489  1.00 32.96  ? 256  VAL A CG1 1 
ATOM   1906 C  CG2 . VAL A 1 257 ? 16.550  -11.840 52.277  1.00 29.85  ? 256  VAL A CG2 1 
ATOM   1907 N  N   . ILE A 1 258 ? 13.386  -9.130  53.815  1.00 30.82  ? 257  ILE A N   1 
ATOM   1908 C  CA  . ILE A 1 258 ? 12.648  -7.925  54.106  1.00 30.01  ? 257  ILE A CA  1 
ATOM   1909 C  C   . ILE A 1 258 ? 12.314  -7.837  55.594  1.00 31.33  ? 257  ILE A C   1 
ATOM   1910 O  O   . ILE A 1 258 ? 12.494  -6.787  56.220  1.00 32.98  ? 257  ILE A O   1 
ATOM   1911 C  CB  . ILE A 1 258 ? 11.383  -7.825  53.253  1.00 27.90  ? 257  ILE A CB  1 
ATOM   1912 C  CG1 . ILE A 1 258 ? 11.764  -7.678  51.800  1.00 27.23  ? 257  ILE A CG1 1 
ATOM   1913 C  CG2 . ILE A 1 258 ? 10.554  -6.608  53.673  1.00 27.77  ? 257  ILE A CG2 1 
ATOM   1914 C  CD1 . ILE A 1 258 ? 10.653  -8.079  50.855  1.00 29.28  ? 257  ILE A CD1 1 
ATOM   1915 N  N   . ALA A 1 259 ? 11.824  -8.941  56.144  1.00 33.23  ? 258  ALA A N   1 
ATOM   1916 C  CA  . ALA A 1 259 ? 11.440  -9.003  57.558  1.00 35.58  ? 258  ALA A CA  1 
ATOM   1917 C  C   . ALA A 1 259 ? 12.584  -8.535  58.405  1.00 36.62  ? 258  ALA A C   1 
ATOM   1918 O  O   . ALA A 1 259 ? 12.456  -7.579  59.167  1.00 39.92  ? 258  ALA A O   1 
ATOM   1919 C  CB  . ALA A 1 259 ? 11.065  -10.429 57.954  1.00 36.28  ? 258  ALA A CB  1 
ATOM   1920 N  N   . ALA A 1 260 ? 13.701  -9.233  58.236  1.00 36.67  ? 259  ALA A N   1 
ATOM   1921 C  CA  . ALA A 1 260 ? 14.904  -8.975  58.972  1.00 40.36  ? 259  ALA A CA  1 
ATOM   1922 C  C   . ALA A 1 260 ? 15.334  -7.496  58.879  1.00 43.93  ? 259  ALA A C   1 
ATOM   1923 O  O   . ALA A 1 260 ? 15.568  -6.848  59.907  1.00 43.86  ? 259  ALA A O   1 
ATOM   1924 C  CB  . ALA A 1 260 ? 16.008  -9.877  58.454  1.00 39.21  ? 259  ALA A CB  1 
ATOM   1925 N  N   . ALA A 1 261 ? 15.436  -6.987  57.648  1.00 43.29  ? 260  ALA A N   1 
ATOM   1926 C  CA  . ALA A 1 261 ? 15.884  -5.625  57.395  1.00 42.73  ? 260  ALA A CA  1 
ATOM   1927 C  C   . ALA A 1 261 ? 15.054  -4.625  58.174  1.00 41.53  ? 260  ALA A C   1 
ATOM   1928 O  O   . ALA A 1 261 ? 15.586  -3.680  58.784  1.00 36.16  ? 260  ALA A O   1 
ATOM   1929 C  CB  . ALA A 1 261 ? 15.782  -5.320  55.914  1.00 45.22  ? 260  ALA A CB  1 
ATOM   1930 N  N   . LYS A 1 262 ? 13.742  -4.862  58.150  1.00 44.97  ? 261  LYS A N   1 
ATOM   1931 C  CA  . LYS A 1 262 ? 12.771  -4.028  58.863  1.00 45.91  ? 261  LYS A CA  1 
ATOM   1932 C  C   . LYS A 1 262 ? 13.043  -3.992  60.369  1.00 44.46  ? 261  LYS A C   1 
ATOM   1933 O  O   . LYS A 1 262 ? 13.046  -2.930  60.981  1.00 43.89  ? 261  LYS A O   1 
ATOM   1934 C  CB  . LYS A 1 262 ? 11.340  -4.501  58.597  1.00 46.71  ? 261  LYS A CB  1 
ATOM   1935 C  CG  . LYS A 1 262 ? 10.673  -3.875  57.380  1.00 50.07  ? 261  LYS A CG  1 
ATOM   1936 C  CD  . LYS A 1 262 ? 9.154   -3.714  57.573  1.00 51.21  ? 261  LYS A CD  1 
ATOM   1937 C  CE  . LYS A 1 262 ? 8.486   -3.078  56.343  1.00 58.09  ? 261  LYS A CE  1 
ATOM   1938 N  NZ  . LYS A 1 262 ? 7.778   -3.963  55.359  1.00 53.42  ? 261  LYS A NZ  1 
ATOM   1939 N  N   . MET A 1 263 ? 13.320  -5.142  60.948  1.00 43.99  ? 262  MET A N   1 
ATOM   1940 C  CA  . MET A 1 263 ? 13.549  -5.224  62.370  1.00 47.54  ? 262  MET A CA  1 
ATOM   1941 C  C   . MET A 1 263 ? 14.791  -4.487  62.794  1.00 50.73  ? 262  MET A C   1 
ATOM   1942 O  O   . MET A 1 263 ? 14.865  -3.970  63.903  1.00 51.40  ? 262  MET A O   1 
ATOM   1943 C  CB  . MET A 1 263 ? 13.695  -6.675  62.766  1.00 50.97  ? 262  MET A CB  1 
ATOM   1944 C  CG  . MET A 1 263 ? 12.490  -7.490  62.382  1.00 53.85  ? 262  MET A CG  1 
ATOM   1945 S  SD  . MET A 1 263 ? 12.181  -8.638  63.681  0.91 59.06  ? 262  MET A SD  1 
ATOM   1946 C  CE  . MET A 1 263 ? 13.698  -9.565  63.638  1.00 66.94  ? 262  MET A CE  1 
ATOM   1947 N  N   . GLN A 1 264 ? 15.782  -4.470  61.912  1.00 57.74  ? 263  GLN A N   1 
ATOM   1948 C  CA  . GLN A 1 264 ? 16.991  -3.656  62.099  1.00 58.48  ? 263  GLN A CA  1 
ATOM   1949 C  C   . GLN A 1 264 ? 16.729  -2.144  61.965  1.00 51.69  ? 263  GLN A C   1 
ATOM   1950 O  O   . GLN A 1 264 ? 17.589  -1.331  62.233  1.00 46.54  ? 263  GLN A O   1 
ATOM   1951 C  CB  . GLN A 1 264 ? 18.060  -4.097  61.109  1.00 58.74  ? 263  GLN A CB  1 
ATOM   1952 C  CG  . GLN A 1 264 ? 18.716  -5.376  61.564  1.00 61.84  ? 263  GLN A CG  1 
ATOM   1953 C  CD  . GLN A 1 264 ? 19.333  -6.164  60.429  1.00 67.59  ? 263  GLN A CD  1 
ATOM   1954 O  OE1 . GLN A 1 264 ? 19.364  -5.743  59.265  1.00 70.51  ? 263  GLN A OE1 1 
ATOM   1955 N  NE2 . GLN A 1 264 ? 19.783  -7.358  60.759  1.00 75.72  ? 263  GLN A NE2 1 
ATOM   1956 N  N   . GLY A 1 265 ? 15.535  -1.787  61.526  1.00 47.86  ? 264  GLY A N   1 
ATOM   1957 C  CA  . GLY A 1 265 ? 15.143  -0.405  61.423  1.00 45.22  ? 264  GLY A CA  1 
ATOM   1958 C  C   . GLY A 1 265 ? 15.439  0.188   60.055  1.00 39.62  ? 264  GLY A C   1 
ATOM   1959 O  O   . GLY A 1 265 ? 15.353  1.377   59.875  1.00 39.42  ? 264  GLY A O   1 
ATOM   1960 N  N   . LYS A 1 266 ? 15.787  -0.630  59.087  1.00 36.68  ? 265  LYS A N   1 
ATOM   1961 C  CA  . LYS A 1 266 ? 16.069  -0.108  57.785  1.00 38.11  ? 265  LYS A CA  1 
ATOM   1962 C  C   . LYS A 1 266 ? 14.780  0.298   57.117  1.00 34.96  ? 265  LYS A C   1 
ATOM   1963 O  O   . LYS A 1 266 ? 13.806  -0.414  57.187  1.00 33.11  ? 265  LYS A O   1 
ATOM   1964 C  CB  . LYS A 1 266 ? 16.824  -1.125  56.966  1.00 44.54  ? 265  LYS A CB  1 
ATOM   1965 C  CG  . LYS A 1 266 ? 18.155  -1.445  57.616  1.00 49.85  ? 265  LYS A CG  1 
ATOM   1966 C  CD  . LYS A 1 266 ? 18.880  -2.582  56.936  1.00 52.35  ? 265  LYS A CD  1 
ATOM   1967 C  CE  . LYS A 1 266 ? 19.899  -3.128  57.923  1.00 59.80  ? 265  LYS A CE  1 
ATOM   1968 N  NZ  . LYS A 1 266 ? 21.184  -3.407  57.225  1.00 66.72  ? 265  LYS A NZ  1 
ATOM   1969 N  N   . VAL A 1 267 ? 14.789  1.460   56.478  1.00 35.09  ? 266  VAL A N   1 
ATOM   1970 C  CA  . VAL A 1 267 ? 13.586  2.039   55.929  1.00 35.93  ? 266  VAL A CA  1 
ATOM   1971 C  C   . VAL A 1 267 ? 13.284  1.327   54.654  1.00 33.60  ? 266  VAL A C   1 
ATOM   1972 O  O   . VAL A 1 267 ? 13.608  1.779   53.575  1.00 32.73  ? 266  VAL A O   1 
ATOM   1973 C  CB  . VAL A 1 267 ? 13.709  3.558   55.680  1.00 41.33  ? 266  VAL A CB  1 
ATOM   1974 C  CG1 . VAL A 1 267 ? 12.424  4.112   55.052  1.00 40.28  ? 266  VAL A CG1 1 
ATOM   1975 C  CG2 . VAL A 1 267 ? 14.022  4.267   56.995  1.00 44.04  ? 266  VAL A CG2 1 
ATOM   1976 N  N   . VAL A 1 268 ? 12.648  0.187   54.826  1.00 35.58  ? 267  VAL A N   1 
ATOM   1977 C  CA  . VAL A 1 268 ? 12.215  -0.661  53.742  1.00 35.30  ? 267  VAL A CA  1 
ATOM   1978 C  C   . VAL A 1 268 ? 10.699  -0.751  53.715  1.00 33.54  ? 267  VAL A C   1 
ATOM   1979 O  O   . VAL A 1 268 ? 10.054  -0.997  54.722  1.00 27.88  ? 267  VAL A O   1 
ATOM   1980 C  CB  . VAL A 1 268 ? 12.779  -2.068  53.921  1.00 37.80  ? 267  VAL A CB  1 
ATOM   1981 C  CG1 . VAL A 1 268 ? 12.266  -2.993  52.841  1.00 38.17  ? 267  VAL A CG1 1 
ATOM   1982 C  CG2 . VAL A 1 268 ? 14.305  -2.023  53.916  1.00 37.90  ? 267  VAL A CG2 1 
ATOM   1983 N  N   . LEU A 1 269 ? 10.150  -0.511  52.534  1.00 35.16  ? 268  LEU A N   1 
ATOM   1984 C  CA  . LEU A 1 269 ? 8.756   -0.809  52.223  1.00 34.61  ? 268  LEU A CA  1 
ATOM   1985 C  C   . LEU A 1 269 ? 8.679   -1.905  51.168  1.00 33.60  ? 268  LEU A C   1 
ATOM   1986 O  O   . LEU A 1 269 ? 9.678   -2.276  50.552  1.00 34.51  ? 268  LEU A O   1 
ATOM   1987 C  CB  . LEU A 1 269 ? 8.055   0.440   51.739  1.00 33.02  ? 268  LEU A CB  1 
ATOM   1988 C  CG  . LEU A 1 269 ? 7.951   1.387   52.922  1.00 32.42  ? 268  LEU A CG  1 
ATOM   1989 C  CD1 . LEU A 1 269 ? 7.811   2.823   52.490  1.00 33.29  ? 268  LEU A CD1 1 
ATOM   1990 C  CD2 . LEU A 1 269 ? 6.772   0.978   53.763  1.00 35.30  ? 268  LEU A CD2 1 
ATOM   1991 N  N   . ALA A 1 270 ? 7.492   -2.452  50.992  1.00 32.88  ? 269  ALA A N   1 
ATOM   1992 C  CA  . ALA A 1 270 ? 7.353   -3.657  50.192  1.00 31.92  ? 269  ALA A CA  1 
ATOM   1993 C  C   . ALA A 1 270 ? 5.916   -3.923  49.779  1.00 31.10  ? 269  ALA A C   1 
ATOM   1994 O  O   . ALA A 1 270 ? 4.948   -3.617  50.498  1.00 30.15  ? 269  ALA A O   1 
ATOM   1995 C  CB  . ALA A 1 270 ? 7.906   -4.861  50.939  1.00 33.51  ? 269  ALA A CB  1 
ATOM   1996 N  N   . GLU A 1 271 ? 5.805   -4.510  48.598  1.00 29.22  ? 270  GLU A N   1 
ATOM   1997 C  CA  . GLU A 1 271 ? 4.533   -4.716  47.939  1.00 29.61  ? 270  GLU A CA  1 
ATOM   1998 C  C   . GLU A 1 271 ? 4.575   -6.057  47.254  1.00 29.45  ? 270  GLU A C   1 
ATOM   1999 O  O   . GLU A 1 271 ? 5.601   -6.404  46.669  1.00 34.41  ? 270  GLU A O   1 
ATOM   2000 C  CB  . GLU A 1 271 ? 4.301   -3.560  46.955  1.00 29.98  ? 270  GLU A CB  1 
ATOM   2001 C  CG  . GLU A 1 271 ? 3.607   -3.892  45.658  1.00 31.06  ? 270  GLU A CG  1 
ATOM   2002 C  CD  . GLU A 1 271 ? 3.439   -2.664  44.764  1.00 30.17  ? 270  GLU A CD  1 
ATOM   2003 O  OE1 . GLU A 1 271 ? 3.220   -1.542  45.305  1.00 24.87  ? 270  GLU A OE1 1 
ATOM   2004 O  OE2 . GLU A 1 271 ? 3.522   -2.852  43.509  1.00 29.47  ? 270  GLU A OE2 1 
ATOM   2005 N  N   . THR A 1 272 ? 3.508   -6.837  47.372  1.00 26.64  ? 271  THR A N   1 
ATOM   2006 C  CA  . THR A 1 272 ? 3.377   -8.047  46.579  1.00 26.49  ? 271  THR A CA  1 
ATOM   2007 C  C   . THR A 1 272 ? 2.203   -7.894  45.638  1.00 24.91  ? 271  THR A C   1 
ATOM   2008 O  O   . THR A 1 272 ? 1.525   -6.877  45.662  1.00 23.26  ? 271  THR A O   1 
ATOM   2009 C  CB  . THR A 1 272 ? 3.220   -9.333  47.432  1.00 29.26  ? 271  THR A CB  1 
ATOM   2010 O  OG1 . THR A 1 272 ? 3.467   -10.494 46.612  1.00 26.48  ? 271  THR A OG1 1 
ATOM   2011 C  CG2 . THR A 1 272 ? 1.815   -9.429  48.060  1.00 30.57  ? 271  THR A CG2 1 
ATOM   2012 N  N   . THR A 1 273 ? 1.997   -8.903  44.788  1.00 24.49  ? 272  THR A N   1 
ATOM   2013 C  CA  . THR A 1 273 ? 0.853   -8.946  43.880  1.00 25.35  ? 272  THR A CA  1 
ATOM   2014 C  C   . THR A 1 273 ? -0.215  -9.937  44.389  1.00 27.65  ? 272  THR A C   1 
ATOM   2015 O  O   . THR A 1 273 ? 0.075   -10.807 45.243  1.00 28.58  ? 272  THR A O   1 
ATOM   2016 C  CB  . THR A 1 273 ? 1.254   -9.328  42.437  1.00 24.12  ? 272  THR A CB  1 
ATOM   2017 O  OG1 . THR A 1 273 ? 1.601   -10.724 42.357  1.00 22.78  ? 272  THR A OG1 1 
ATOM   2018 C  CG2 . THR A 1 273 ? 2.415   -8.506  42.011  1.00 25.34  ? 272  THR A CG2 1 
ATOM   2019 N  N   . THR A 1 274 ? -1.433  -9.809  43.853  1.00 26.18  ? 273  THR A N   1 
ATOM   2020 C  CA  . THR A 1 274 ? -2.506  -10.708 44.188  1.00 27.70  ? 273  THR A CA  1 
ATOM   2021 C  C   . THR A 1 274 ? -2.166  -12.191 43.887  1.00 29.61  ? 273  THR A C   1 
ATOM   2022 O  O   . THR A 1 274 ? -2.395  -13.095 44.717  1.00 29.56  ? 273  THR A O   1 
ATOM   2023 C  CB  . THR A 1 274 ? -3.767  -10.352 43.408  1.00 29.24  ? 273  THR A CB  1 
ATOM   2024 O  OG1 . THR A 1 274 ? -3.996  -8.949  43.482  1.00 31.71  ? 273  THR A OG1 1 
ATOM   2025 C  CG2 . THR A 1 274 ? -4.985  -11.105 43.969  1.00 31.63  ? 273  THR A CG2 1 
ATOM   2026 N  N   . ALA A 1 275 ? -1.659  -12.429 42.683  1.00 29.71  ? 274  ALA A N   1 
ATOM   2027 C  CA  . ALA A 1 275 ? -1.275  -13.769 42.259  1.00 29.06  ? 274  ALA A CA  1 
ATOM   2028 C  C   . ALA A 1 275 ? -0.241  -14.371 43.183  1.00 30.02  ? 274  ALA A C   1 
ATOM   2029 O  O   . ALA A 1 275 ? -0.345  -15.527 43.574  1.00 32.22  ? 274  ALA A O   1 
ATOM   2030 C  CB  . ALA A 1 275 ? -0.736  -13.716 40.844  1.00 30.51  ? 274  ALA A CB  1 
ATOM   2031 N  N   . HIS A 1 276 ? 0.769   -13.591 43.544  1.00 31.68  ? 275  HIS A N   1 
ATOM   2032 C  CA  . HIS A 1 276 ? 1.805   -14.093 44.450  1.00 33.95  ? 275  HIS A CA  1 
ATOM   2033 C  C   . HIS A 1 276 ? 1.257   -14.368 45.825  1.00 34.85  ? 275  HIS A C   1 
ATOM   2034 O  O   . HIS A 1 276 ? 1.687   -15.306 46.471  1.00 39.45  ? 275  HIS A O   1 
ATOM   2035 C  CB  . HIS A 1 276 ? 2.965   -13.121 44.585  1.00 35.16  ? 275  HIS A CB  1 
ATOM   2036 C  CG  . HIS A 1 276 ? 3.827   -13.035 43.369  1.00 36.01  ? 275  HIS A CG  1 
ATOM   2037 N  ND1 . HIS A 1 276 ? 3.758   -11.985 42.475  1.00 36.97  ? 275  HIS A ND1 1 
ATOM   2038 C  CD2 . HIS A 1 276 ? 4.803   -13.852 42.920  1.00 36.68  ? 275  HIS A CD2 1 
ATOM   2039 C  CE1 . HIS A 1 276 ? 4.661   -12.159 41.531  1.00 36.98  ? 275  HIS A CE1 1 
ATOM   2040 N  NE2 . HIS A 1 276 ? 5.307   -13.284 41.777  1.00 37.41  ? 275  HIS A NE2 1 
ATOM   2041 N  N   . ALA A 1 277 ? 0.301   -13.565 46.277  1.00 35.28  ? 276  ALA A N   1 
ATOM   2042 C  CA  . ALA A 1 277 ? -0.273  -13.781 47.596  1.00 36.96  ? 276  ALA A CA  1 
ATOM   2043 C  C   . ALA A 1 277 ? -1.247  -14.937 47.640  1.00 38.95  ? 276  ALA A C   1 
ATOM   2044 O  O   . ALA A 1 277 ? -1.571  -15.403 48.731  1.00 44.69  ? 276  ALA A O   1 
ATOM   2045 C  CB  . ALA A 1 277 ? -0.965  -12.525 48.108  1.00 38.54  ? 276  ALA A CB  1 
ATOM   2046 N  N   . THR A 1 278 ? -1.709  -15.431 46.490  1.00 39.27  ? 277  THR A N   1 
ATOM   2047 C  CA  . THR A 1 278 ? -2.769  -16.447 46.505  1.00 40.69  ? 277  THR A CA  1 
ATOM   2048 C  C   . THR A 1 278 ? -2.572  -17.732 45.696  1.00 44.30  ? 277  THR A C   1 
ATOM   2049 O  O   . THR A 1 278 ? -3.344  -18.664 45.869  1.00 41.68  ? 277  THR A O   1 
ATOM   2050 C  CB  . THR A 1 278 ? -4.065  -15.820 46.029  1.00 39.02  ? 277  THR A CB  1 
ATOM   2051 O  OG1 . THR A 1 278 ? -3.841  -15.267 44.733  1.00 42.24  ? 277  THR A OG1 1 
ATOM   2052 C  CG2 . THR A 1 278 ? -4.474  -14.738 46.981  1.00 39.51  ? 277  THR A CG2 1 
ATOM   2053 N  N   . LEU A 1 279 ? -1.575  -17.786 44.816  1.00 50.93  ? 278  LEU A N   1 
ATOM   2054 C  CA  . LEU A 1 279 ? -1.444  -18.890 43.844  1.00 50.90  ? 278  LEU A CA  1 
ATOM   2055 C  C   . LEU A 1 279 ? -0.084  -19.536 43.891  1.00 53.14  ? 278  LEU A C   1 
ATOM   2056 O  O   . LEU A 1 279 ? 0.888   -18.873 44.224  1.00 54.13  ? 278  LEU A O   1 
ATOM   2057 C  CB  . LEU A 1 279 ? -1.648  -18.368 42.424  1.00 48.10  ? 278  LEU A CB  1 
ATOM   2058 C  CG  . LEU A 1 279 ? -3.009  -17.769 42.087  1.00 49.61  ? 278  LEU A CG  1 
ATOM   2059 C  CD1 . LEU A 1 279 ? -2.969  -17.245 40.664  1.00 51.17  ? 278  LEU A CD1 1 
ATOM   2060 C  CD2 . LEU A 1 279 ? -4.120  -18.796 42.254  1.00 50.15  ? 278  LEU A CD2 1 
ATOM   2061 N  N   . THR A 1 280 ? -0.006  -20.818 43.526  1.00 60.29  ? 279  THR A N   1 
ATOM   2062 C  CA  . THR A 1 280 ? 1.301   -21.530 43.487  1.00 62.72  ? 279  THR A CA  1 
ATOM   2063 C  C   . THR A 1 280 ? 1.818   -21.764 42.067  1.00 58.86  ? 279  THR A C   1 
ATOM   2064 O  O   . THR A 1 280 ? 1.067   -21.711 41.100  1.00 54.71  ? 279  THR A O   1 
ATOM   2065 C  CB  . THR A 1 280 ? 1.283   -22.896 44.230  1.00 61.84  ? 279  THR A CB  1 
ATOM   2066 O  OG1 . THR A 1 280 ? 0.565   -23.860 43.450  1.00 53.90  ? 279  THR A OG1 1 
ATOM   2067 C  CG2 . THR A 1 280 ? 0.672   -22.750 45.634  1.00 66.10  ? 279  THR A CG2 1 
ATOM   2068 N  N   . GLY A 1 281 ? 3.114   -22.052 41.992  1.00 58.09  ? 280  GLY A N   1 
ATOM   2069 C  CA  . GLY A 1 281 ? 3.828   -22.222 40.732  1.00 62.68  ? 280  GLY A CA  1 
ATOM   2070 C  C   . GLY A 1 281 ? 3.547   -23.530 40.028  1.00 59.63  ? 280  GLY A C   1 
ATOM   2071 O  O   . GLY A 1 281 ? 3.957   -23.711 38.885  1.00 55.53  ? 280  GLY A O   1 
ATOM   2072 N  N   . LEU A 1 282 ? 2.811   -24.412 40.707  1.00 64.95  ? 281  LEU A N   1 
ATOM   2073 C  CA  . LEU A 1 282 ? 2.287   -25.654 40.137  1.00 66.08  ? 281  LEU A CA  1 
ATOM   2074 C  C   . LEU A 1 282 ? 1.588   -25.447 38.795  1.00 56.14  ? 281  LEU A C   1 
ATOM   2075 O  O   . LEU A 1 282 ? 1.571   -26.339 37.960  1.00 55.57  ? 281  LEU A O   1 
ATOM   2076 C  CB  . LEU A 1 282 ? 1.320   -26.295 41.132  1.00 77.03  ? 281  LEU A CB  1 
ATOM   2077 C  CG  . LEU A 1 282 ? 0.626   -27.598 40.650  1.00 96.73  ? 281  LEU A CG  1 
ATOM   2078 C  CD1 . LEU A 1 282 ? 0.661   -28.772 41.651  1.00 95.89  ? 281  LEU A CD1 1 
ATOM   2079 C  CD2 . LEU A 1 282 ? -0.804  -27.325 40.173  1.00 99.92  ? 281  LEU A CD2 1 
ATOM   2080 N  N   . HIS A 1 283 ? 1.025   -24.259 38.587  1.00 59.64  ? 282  HIS A N   1 
ATOM   2081 C  CA  . HIS A 1 283 ? 0.297   -23.922 37.351  1.00 57.46  ? 282  HIS A CA  1 
ATOM   2082 C  C   . HIS A 1 283 ? 1.218   -23.933 36.139  1.00 55.75  ? 282  HIS A C   1 
ATOM   2083 O  O   . HIS A 1 283 ? 0.744   -24.163 35.031  1.00 56.32  ? 282  HIS A O   1 
ATOM   2084 C  CB  . HIS A 1 283 ? -0.470  -22.573 37.457  1.00 56.99  ? 282  HIS A CB  1 
ATOM   2085 C  CG  . HIS A 1 283 ? -1.590  -22.577 38.474  1.00 64.50  ? 282  HIS A CG  1 
ATOM   2086 N  ND1 . HIS A 1 283 ? -2.894  -22.933 38.164  1.00 71.27  ? 282  HIS A ND1 1 
ATOM   2087 C  CD2 . HIS A 1 283 ? -1.595  -22.248 39.793  1.00 64.48  ? 282  HIS A CD2 1 
ATOM   2088 C  CE1 . HIS A 1 283 ? -3.645  -22.810 39.248  1.00 64.25  ? 282  HIS A CE1 1 
ATOM   2089 N  NE2 . HIS A 1 283 ? -2.884  -22.389 40.245  1.00 62.66  ? 282  HIS A NE2 1 
ATOM   2090 N  N   . TYR A 1 284 ? 2.527   -23.741 36.336  1.00 52.85  ? 283  TYR A N   1 
ATOM   2091 C  CA  . TYR A 1 284 ? 3.464   -23.794 35.205  1.00 56.80  ? 283  TYR A CA  1 
ATOM   2092 C  C   . TYR A 1 284 ? 3.633   -25.220 34.678  1.00 59.05  ? 283  TYR A C   1 
ATOM   2093 O  O   . TYR A 1 284 ? 4.221   -25.434 33.615  1.00 57.51  ? 283  TYR A O   1 
ATOM   2094 C  CB  . TYR A 1 284 ? 4.834   -23.204 35.549  1.00 55.31  ? 283  TYR A CB  1 
ATOM   2095 C  CG  . TYR A 1 284 ? 4.772   -21.777 36.013  1.00 56.85  ? 283  TYR A CG  1 
ATOM   2096 C  CD1 . TYR A 1 284 ? 4.060   -20.819 35.279  1.00 59.28  ? 283  TYR A CD1 1 
ATOM   2097 C  CD2 . TYR A 1 284 ? 5.401   -21.373 37.191  1.00 55.30  ? 283  TYR A CD2 1 
ATOM   2098 C  CE1 . TYR A 1 284 ? 3.977   -19.502 35.709  1.00 60.71  ? 283  TYR A CE1 1 
ATOM   2099 C  CE2 . TYR A 1 284 ? 5.323   -20.056 37.633  1.00 52.87  ? 283  TYR A CE2 1 
ATOM   2100 C  CZ  . TYR A 1 284 ? 4.607   -19.124 36.896  1.00 57.08  ? 283  TYR A CZ  1 
ATOM   2101 O  OH  . TYR A 1 284 ? 4.505   -17.819 37.316  1.00 52.17  ? 283  TYR A OH  1 
ATOM   2102 N  N   . TYR A 1 285 ? 3.087   -26.189 35.404  1.00 61.09  ? 284  TYR A N   1 
ATOM   2103 C  CA  . TYR A 1 285 ? 3.174   -27.589 35.009  1.00 62.91  ? 284  TYR A CA  1 
ATOM   2104 C  C   . TYR A 1 285 ? 1.814   -28.148 34.589  1.00 63.05  ? 284  TYR A C   1 
ATOM   2105 O  O   . TYR A 1 285 ? 1.656   -29.344 34.465  1.00 64.93  ? 284  TYR A O   1 
ATOM   2106 C  CB  . TYR A 1 285 ? 3.788   -28.410 36.153  1.00 60.38  ? 284  TYR A CB  1 
ATOM   2107 C  CG  . TYR A 1 285 ? 5.186   -27.950 36.524  1.00 58.42  ? 284  TYR A CG  1 
ATOM   2108 C  CD1 . TYR A 1 285 ? 5.370   -26.936 37.477  1.00 59.49  ? 284  TYR A CD1 1 
ATOM   2109 C  CD2 . TYR A 1 285 ? 6.310   -28.505 35.925  1.00 54.18  ? 284  TYR A CD2 1 
ATOM   2110 C  CE1 . TYR A 1 285 ? 6.631   -26.500 37.832  1.00 59.46  ? 284  TYR A CE1 1 
ATOM   2111 C  CE2 . TYR A 1 285 ? 7.581   -28.076 36.270  1.00 57.37  ? 284  TYR A CE2 1 
ATOM   2112 C  CZ  . TYR A 1 285 ? 7.732   -27.071 37.222  1.00 61.63  ? 284  TYR A CZ  1 
ATOM   2113 O  OH  . TYR A 1 285 ? 8.970   -26.595 37.572  1.00 63.95  ? 284  TYR A OH  1 
ATOM   2114 N  N   . HIS A 1 286 ? 0.844   -27.275 34.350  1.00 71.44  ? 285  HIS A N   1 
ATOM   2115 C  CA  . HIS A 1 286 ? -0.456  -27.706 33.844  1.00 79.38  ? 285  HIS A CA  1 
ATOM   2116 C  C   . HIS A 1 286 ? -0.269  -28.187 32.404  1.00 86.19  ? 285  HIS A C   1 
ATOM   2117 O  O   . HIS A 1 286 ? 0.645   -27.742 31.687  1.00 77.27  ? 285  HIS A O   1 
ATOM   2118 C  CB  . HIS A 1 286 ? -1.475  -26.562 33.912  1.00 84.10  ? 285  HIS A CB  1 
ATOM   2119 C  CG  . HIS A 1 286 ? -2.882  -26.965 33.581  1.00 88.79  ? 285  HIS A CG  1 
ATOM   2120 N  ND1 . HIS A 1 286 ? -3.296  -27.256 32.300  1.00 86.86  ? 285  HIS A ND1 1 
ATOM   2121 C  CD2 . HIS A 1 286 ? -3.981  -27.088 34.365  1.00 95.94  ? 285  HIS A CD2 1 
ATOM   2122 C  CE1 . HIS A 1 286 ? -4.580  -27.570 32.309  1.00 93.54  ? 285  HIS A CE1 1 
ATOM   2123 N  NE2 . HIS A 1 286 ? -5.022  -27.470 33.550  1.00 94.16  ? 285  HIS A NE2 1 
ATOM   2124 N  N   . GLN A 1 287 ? -1.142  -29.109 32.003  1.00 96.83  ? 286  GLN A N   1 
ATOM   2125 C  CA  . GLN A 1 287 ? -1.022  -29.820 30.728  1.00 99.98  ? 286  GLN A CA  1 
ATOM   2126 C  C   . GLN A 1 287 ? -1.103  -28.880 29.523  1.00 90.36  ? 286  GLN A C   1 
ATOM   2127 O  O   . GLN A 1 287 ? -0.251  -28.912 28.628  1.00 84.99  ? 286  GLN A O   1 
ATOM   2128 C  CB  . GLN A 1 287 ? -2.098  -30.915 30.646  1.00 112.12 ? 286  GLN A CB  1 
ATOM   2129 C  CG  . GLN A 1 287 ? -1.846  -32.078 31.616  1.00 117.92 ? 286  GLN A CG  1 
ATOM   2130 C  CD  . GLN A 1 287 ? -3.075  -32.943 31.897  1.00 115.42 ? 286  GLN A CD  1 
ATOM   2131 O  OE1 . GLN A 1 287 ? -4.213  -32.564 31.596  1.00 108.95 ? 286  GLN A OE1 1 
ATOM   2132 N  NE2 . GLN A 1 287 ? -2.846  -34.106 32.500  1.00 110.73 ? 286  GLN A NE2 1 
ATOM   2133 N  N   . ASP A 1 288 ? -2.143  -28.060 29.496  1.00 76.97  ? 287  ASP A N   1 
ATOM   2134 C  CA  . ASP A 1 288 ? -2.259  -27.027 28.484  1.00 70.21  ? 287  ASP A CA  1 
ATOM   2135 C  C   . ASP A 1 288 ? -1.137  -25.990 28.636  1.00 60.10  ? 287  ASP A C   1 
ATOM   2136 O  O   . ASP A 1 288 ? -0.911  -25.449 29.701  1.00 60.30  ? 287  ASP A O   1 
ATOM   2137 C  CB  . ASP A 1 288 ? -3.639  -26.358 28.554  1.00 69.89  ? 287  ASP A CB  1 
ATOM   2138 C  CG  . ASP A 1 288 ? -3.958  -25.536 27.322  1.00 73.23  ? 287  ASP A CG  1 
ATOM   2139 O  OD1 . ASP A 1 288 ? -3.499  -25.888 26.214  1.00 70.66  ? 287  ASP A OD1 1 
ATOM   2140 O  OD2 . ASP A 1 288 ? -4.689  -24.533 27.469  1.00 79.86  ? 287  ASP A OD2 1 
ATOM   2141 N  N   . TRP A 1 289 ? -0.433  -25.740 27.547  1.00 57.51  ? 288  TRP A N   1 
ATOM   2142 C  CA  . TRP A 1 289 ? 0.613   -24.732 27.502  1.00 51.59  ? 288  TRP A CA  1 
ATOM   2143 C  C   . TRP A 1 289 ? 0.043   -23.345 27.714  1.00 46.10  ? 288  TRP A C   1 
ATOM   2144 O  O   . TRP A 1 289 ? 0.671   -22.509 28.348  1.00 44.01  ? 288  TRP A O   1 
ATOM   2145 C  CB  . TRP A 1 289 ? 1.329   -24.784 26.146  1.00 51.12  ? 288  TRP A CB  1 
ATOM   2146 C  CG  . TRP A 1 289 ? 2.494   -23.851 26.012  1.00 53.45  ? 288  TRP A CG  1 
ATOM   2147 C  CD1 . TRP A 1 289 ? 3.812   -24.165 26.160  1.00 52.57  ? 288  TRP A CD1 1 
ATOM   2148 C  CD2 . TRP A 1 289 ? 2.447   -22.450 25.680  1.00 56.73  ? 288  TRP A CD2 1 
ATOM   2149 N  NE1 . TRP A 1 289 ? 4.597   -23.043 25.960  1.00 57.24  ? 288  TRP A NE1 1 
ATOM   2150 C  CE2 . TRP A 1 289 ? 3.781   -21.982 25.664  1.00 57.79  ? 288  TRP A CE2 1 
ATOM   2151 C  CE3 . TRP A 1 289 ? 1.405   -21.543 25.398  1.00 54.96  ? 288  TRP A CE3 1 
ATOM   2152 C  CZ2 . TRP A 1 289 ? 4.100   -20.649 25.377  1.00 58.28  ? 288  TRP A CZ2 1 
ATOM   2153 C  CZ3 . TRP A 1 289 ? 1.721   -20.227 25.115  1.00 54.30  ? 288  TRP A CZ3 1 
ATOM   2154 C  CH2 . TRP A 1 289 ? 3.061   -19.790 25.114  1.00 56.61  ? 288  TRP A CH2 1 
ATOM   2155 N  N   . SER A 1 290 ? -1.125  -23.102 27.141  1.00 43.80  ? 289  SER A N   1 
ATOM   2156 C  CA  . SER A 1 290 ? -1.774  -21.798 27.193  1.00 44.83  ? 289  SER A CA  1 
ATOM   2157 C  C   . SER A 1 290 ? -2.017  -21.409 28.620  1.00 46.72  ? 289  SER A C   1 
ATOM   2158 O  O   . SER A 1 290 ? -1.811  -20.260 29.007  1.00 43.65  ? 289  SER A O   1 
ATOM   2159 C  CB  . SER A 1 290 ? -3.135  -21.853 26.475  1.00 44.74  ? 289  SER A CB  1 
ATOM   2160 O  OG  . SER A 1 290 ? -2.998  -22.063 25.093  1.00 39.69  ? 289  SER A OG  1 
ATOM   2161 N  N   . HIS A 1 291 ? -2.495  -22.391 29.382  1.00 54.95  ? 290  HIS A N   1 
ATOM   2162 C  CA  . HIS A 1 291 ? -2.804  -22.223 30.799  1.00 57.70  ? 290  HIS A CA  1 
ATOM   2163 C  C   . HIS A 1 291 ? -1.541  -21.919 31.602  1.00 53.66  ? 290  HIS A C   1 
ATOM   2164 O  O   . HIS A 1 291 ? -1.523  -21.010 32.412  1.00 49.91  ? 290  HIS A O   1 
ATOM   2165 C  CB  . HIS A 1 291 ? -3.447  -23.490 31.366  1.00 60.21  ? 290  HIS A CB  1 
ATOM   2166 C  CG  . HIS A 1 291 ? -3.866  -23.361 32.799  1.00 63.92  ? 290  HIS A CG  1 
ATOM   2167 N  ND1 . HIS A 1 291 ? -5.168  -23.103 33.167  1.00 68.87  ? 290  HIS A ND1 1 
ATOM   2168 C  CD2 . HIS A 1 291 ? -3.154  -23.416 33.951  1.00 63.40  ? 290  HIS A CD2 1 
ATOM   2169 C  CE1 . HIS A 1 291 ? -5.253  -23.055 34.486  1.00 69.05  ? 290  HIS A CE1 1 
ATOM   2170 N  NE2 . HIS A 1 291 ? -4.045  -23.249 34.990  1.00 73.45  ? 290  HIS A NE2 1 
ATOM   2171 N  N   . ALA A 1 292 ? -0.497  -22.704 31.384  1.00 48.21  ? 291  ALA A N   1 
ATOM   2172 C  CA  . ALA A 1 292 ? 0.765   -22.505 32.069  1.00 51.68  ? 291  ALA A CA  1 
ATOM   2173 C  C   . ALA A 1 292 ? 1.315   -21.116 31.754  1.00 56.87  ? 291  ALA A C   1 
ATOM   2174 O  O   . ALA A 1 292 ? 1.891   -20.453 32.617  1.00 58.93  ? 291  ALA A O   1 
ATOM   2175 C  CB  . ALA A 1 292 ? 1.766   -23.580 31.665  1.00 50.62  ? 291  ALA A CB  1 
ATOM   2176 N  N   . ALA A 1 293 ? 1.118   -20.683 30.512  1.00 57.55  ? 292  ALA A N   1 
ATOM   2177 C  CA  . ALA A 1 293 ? 1.681   -19.431 30.024  1.00 56.74  ? 292  ALA A CA  1 
ATOM   2178 C  C   . ALA A 1 293 ? 0.948   -18.213 30.576  1.00 57.61  ? 292  ALA A C   1 
ATOM   2179 O  O   . ALA A 1 293 ? 1.526   -17.110 30.661  1.00 59.32  ? 292  ALA A O   1 
ATOM   2180 C  CB  . ALA A 1 293 ? 1.657   -19.413 28.502  1.00 55.38  ? 292  ALA A CB  1 
ATOM   2181 N  N   . ALA A 1 294 ? -0.318  -18.415 30.948  1.00 51.23  ? 293  ALA A N   1 
ATOM   2182 C  CA  . ALA A 1 294 ? -1.147  -17.330 31.462  1.00 50.20  ? 293  ALA A CA  1 
ATOM   2183 C  C   . ALA A 1 294 ? -0.618  -16.805 32.796  1.00 45.31  ? 293  ALA A C   1 
ATOM   2184 O  O   . ALA A 1 294 ? -0.866  -15.660 33.138  1.00 37.71  ? 293  ALA A O   1 
ATOM   2185 C  CB  . ALA A 1 294 ? -2.586  -17.789 31.609  1.00 53.56  ? 293  ALA A CB  1 
ATOM   2186 N  N   . TYR A 1 295 ? 0.123   -17.653 33.516  1.00 43.78  ? 294  TYR A N   1 
ATOM   2187 C  CA  . TYR A 1 295 ? 0.638   -17.344 34.834  1.00 40.56  ? 294  TYR A CA  1 
ATOM   2188 C  C   . TYR A 1 295 ? 2.054   -16.835 34.804  1.00 44.15  ? 294  TYR A C   1 
ATOM   2189 O  O   . TYR A 1 295 ? 2.642   -16.620 35.875  1.00 48.07  ? 294  TYR A O   1 
ATOM   2190 C  CB  . TYR A 1 295 ? 0.602   -18.590 35.697  1.00 38.65  ? 294  TYR A CB  1 
ATOM   2191 C  CG  . TYR A 1 295 ? -0.778  -18.987 36.038  1.00 40.13  ? 294  TYR A CG  1 
ATOM   2192 C  CD1 . TYR A 1 295 ? -1.588  -19.627 35.104  1.00 41.98  ? 294  TYR A CD1 1 
ATOM   2193 C  CD2 . TYR A 1 295 ? -1.306  -18.722 37.285  1.00 45.10  ? 294  TYR A CD2 1 
ATOM   2194 C  CE1 . TYR A 1 295 ? -2.884  -20.021 35.397  1.00 41.29  ? 294  TYR A CE1 1 
ATOM   2195 C  CE2 . TYR A 1 295 ? -2.614  -19.096 37.590  1.00 47.14  ? 294  TYR A CE2 1 
ATOM   2196 C  CZ  . TYR A 1 295 ? -3.386  -19.752 36.635  1.00 44.06  ? 294  TYR A CZ  1 
ATOM   2197 O  OH  . TYR A 1 295 ? -4.639  -20.144 36.929  1.00 46.90  ? 294  TYR A OH  1 
ATOM   2198 N  N   . VAL A 1 296 ? 2.628   -16.687 33.608  1.00 44.80  ? 295  VAL A N   1 
ATOM   2199 C  CA  . VAL A 1 296 ? 4.039   -16.336 33.484  1.00 43.74  ? 295  VAL A CA  1 
ATOM   2200 C  C   . VAL A 1 296 ? 4.205   -14.852 33.750  1.00 41.93  ? 295  VAL A C   1 
ATOM   2201 O  O   . VAL A 1 296 ? 3.726   -14.026 32.996  1.00 41.67  ? 295  VAL A O   1 
ATOM   2202 C  CB  . VAL A 1 296 ? 4.606   -16.725 32.093  1.00 42.03  ? 295  VAL A CB  1 
ATOM   2203 C  CG1 . VAL A 1 296 ? 5.960   -16.081 31.841  1.00 38.91  ? 295  VAL A CG1 1 
ATOM   2204 C  CG2 . VAL A 1 296 ? 4.741   -18.234 31.992  1.00 40.79  ? 295  VAL A CG2 1 
ATOM   2205 N  N   . THR A 1 297 ? 4.842   -14.542 34.866  1.00 41.13  ? 296  THR A N   1 
ATOM   2206 C  CA  . THR A 1 297 ? 5.161   -13.184 35.229  1.00 41.30  ? 296  THR A CA  1 
ATOM   2207 C  C   . THR A 1 297 ? 6.475   -13.356 35.945  1.00 38.23  ? 296  THR A C   1 
ATOM   2208 O  O   . THR A 1 297 ? 6.972   -14.474 36.039  1.00 33.69  ? 296  THR A O   1 
ATOM   2209 C  CB  . THR A 1 297 ? 4.063   -12.548 36.134  1.00 44.50  ? 296  THR A CB  1 
ATOM   2210 O  OG1 . THR A 1 297 ? 4.238   -11.117 36.236  1.00 47.71  ? 296  THR A OG1 1 
ATOM   2211 C  CG2 . THR A 1 297 ? 4.087   -13.144 37.524  1.00 45.32  ? 296  THR A CG2 1 
ATOM   2212 N  N   . VAL A 1 298 ? 7.034   -12.264 36.444  1.00 37.56  ? 297  VAL A N   1 
ATOM   2213 C  CA  . VAL A 1 298 ? 8.202   -12.345 37.278  1.00 38.04  ? 297  VAL A CA  1 
ATOM   2214 C  C   . VAL A 1 298 ? 8.104   -11.406 38.477  1.00 38.72  ? 297  VAL A C   1 
ATOM   2215 O  O   . VAL A 1 298 ? 7.529   -10.335 38.378  1.00 37.30  ? 297  VAL A O   1 
ATOM   2216 C  CB  . VAL A 1 298 ? 9.488   -12.017 36.485  1.00 40.03  ? 297  VAL A CB  1 
ATOM   2217 C  CG1 . VAL A 1 298 ? 9.693   -13.053 35.394  1.00 40.06  ? 297  VAL A CG1 1 
ATOM   2218 C  CG2 . VAL A 1 298 ? 9.460   -10.603 35.910  1.00 39.14  ? 297  VAL A CG2 1 
ATOM   2219 N  N   . PRO A 1 299 ? 8.737   -11.779 39.603  1.00 40.96  ? 298  PRO A N   1 
ATOM   2220 C  CA  . PRO A 1 299 ? 9.395   -13.083 39.758  1.00 39.53  ? 298  PRO A CA  1 
ATOM   2221 C  C   . PRO A 1 299 ? 8.293   -14.108 39.729  1.00 43.66  ? 298  PRO A C   1 
ATOM   2222 O  O   . PRO A 1 299 ? 7.150   -13.784 40.037  1.00 45.28  ? 298  PRO A O   1 
ATOM   2223 C  CB  . PRO A 1 299 ? 10.056  -13.003 41.124  1.00 37.76  ? 298  PRO A CB  1 
ATOM   2224 C  CG  . PRO A 1 299 ? 10.000  -11.558 41.549  1.00 37.54  ? 298  PRO A CG  1 
ATOM   2225 C  CD  . PRO A 1 299 ? 8.872   -10.923 40.798  1.00 37.63  ? 298  PRO A CD  1 
ATOM   2226 N  N   . PRO A 1 300 ? 8.603   -15.330 39.317  1.00 49.05  ? 299  PRO A N   1 
ATOM   2227 C  CA  . PRO A 1 300 ? 7.515   -16.281 39.069  1.00 49.38  ? 299  PRO A CA  1 
ATOM   2228 C  C   . PRO A 1 300 ? 6.826   -16.732 40.353  1.00 49.59  ? 299  PRO A C   1 
ATOM   2229 O  O   . PRO A 1 300 ? 7.411   -16.644 41.437  1.00 44.29  ? 299  PRO A O   1 
ATOM   2230 C  CB  . PRO A 1 300 ? 8.226   -17.466 38.404  1.00 49.11  ? 299  PRO A CB  1 
ATOM   2231 C  CG  . PRO A 1 300 ? 9.635   -17.376 38.865  1.00 49.64  ? 299  PRO A CG  1 
ATOM   2232 C  CD  . PRO A 1 300 ? 9.934   -15.931 39.172  1.00 48.07  ? 299  PRO A CD  1 
ATOM   2233 N  N   . LEU A 1 301 ? 5.575   -17.179 40.216  1.00 49.93  ? 300  LEU A N   1 
ATOM   2234 C  CA  . LEU A 1 301 ? 4.909   -17.929 41.273  1.00 49.31  ? 300  LEU A CA  1 
ATOM   2235 C  C   . LEU A 1 301 ? 5.829   -19.088 41.616  1.00 50.77  ? 300  LEU A C   1 
ATOM   2236 O  O   . LEU A 1 301 ? 6.379   -19.741 40.724  1.00 56.95  ? 300  LEU A O   1 
ATOM   2237 C  CB  . LEU A 1 301 ? 3.561   -18.476 40.803  1.00 48.58  ? 300  LEU A CB  1 
ATOM   2238 C  CG  . LEU A 1 301 ? 2.486   -17.474 40.371  1.00 52.85  ? 300  LEU A CG  1 
ATOM   2239 C  CD1 . LEU A 1 301 ? 1.225   -18.208 39.888  1.00 55.25  ? 300  LEU A CD1 1 
ATOM   2240 C  CD2 . LEU A 1 301 ? 2.156   -16.498 41.490  1.00 49.08  ? 300  LEU A CD2 1 
ATOM   2241 N  N   . ARG A 1 302 ? 5.987   -19.351 42.904  1.00 48.73  ? 301  ARG A N   1 
ATOM   2242 C  CA  . ARG A 1 302 ? 6.946   -20.339 43.371  1.00 46.21  ? 301  ARG A CA  1 
ATOM   2243 C  C   . ARG A 1 302 ? 6.267   -21.692 43.598  1.00 46.46  ? 301  ARG A C   1 
ATOM   2244 O  O   . ARG A 1 302 ? 5.111   -21.759 44.000  1.00 42.02  ? 301  ARG A O   1 
ATOM   2245 C  CB  . ARG A 1 302 ? 7.608   -19.863 44.654  1.00 45.11  ? 301  ARG A CB  1 
ATOM   2246 C  CG  . ARG A 1 302 ? 8.249   -18.505 44.541  1.00 45.99  ? 301  ARG A CG  1 
ATOM   2247 C  CD  . ARG A 1 302 ? 9.325   -18.478 43.476  1.00 50.01  ? 301  ARG A CD  1 
ATOM   2248 N  NE  . ARG A 1 302 ? 10.022  -17.197 43.468  1.00 52.01  ? 301  ARG A NE  1 
ATOM   2249 C  CZ  . ARG A 1 302 ? 11.061  -16.909 42.702  1.00 54.72  ? 301  ARG A CZ  1 
ATOM   2250 N  NH1 . ARG A 1 302 ? 11.519  -17.807 41.850  1.00 57.58  ? 301  ARG A NH1 1 
ATOM   2251 N  NH2 . ARG A 1 302 ? 11.646  -15.714 42.795  1.00 58.60  ? 301  ARG A NH2 1 
ATOM   2252 N  N   . LEU A 1 303 ? 7.008   -22.760 43.340  1.00 48.81  ? 302  LEU A N   1 
ATOM   2253 C  CA  . LEU A 1 303 ? 6.471   -24.103 43.434  1.00 51.86  ? 302  LEU A CA  1 
ATOM   2254 C  C   . LEU A 1 303 ? 6.099   -24.515 44.851  1.00 53.51  ? 302  LEU A C   1 
ATOM   2255 O  O   . LEU A 1 303 ? 5.093   -25.198 45.058  1.00 54.65  ? 302  LEU A O   1 
ATOM   2256 C  CB  . LEU A 1 303 ? 7.459   -25.102 42.849  1.00 51.13  ? 302  LEU A CB  1 
ATOM   2257 C  CG  . LEU A 1 303 ? 6.834   -26.426 42.411  1.00 53.67  ? 302  LEU A CG  1 
ATOM   2258 C  CD1 . LEU A 1 303 ? 5.506   -26.240 41.664  1.00 53.52  ? 302  LEU A CD1 1 
ATOM   2259 C  CD2 . LEU A 1 303 ? 7.851   -27.154 41.540  1.00 57.06  ? 302  LEU A CD2 1 
ATOM   2260 N  N   . ASP A 1 304 ? 6.894   -24.087 45.826  1.00 56.90  ? 303  ASP A N   1 
ATOM   2261 C  CA  . ASP A 1 304 ? 6.632   -24.432 47.214  1.00 53.81  ? 303  ASP A CA  1 
ATOM   2262 C  C   . ASP A 1 304 ? 5.188   -24.070 47.550  1.00 56.05  ? 303  ASP A C   1 
ATOM   2263 O  O   . ASP A 1 304 ? 4.770   -22.939 47.343  1.00 58.54  ? 303  ASP A O   1 
ATOM   2264 C  CB  . ASP A 1 304 ? 7.602   -23.709 48.142  1.00 52.06  ? 303  ASP A CB  1 
ATOM   2265 C  CG  . ASP A 1 304 ? 7.415   -24.095 49.607  1.00 53.47  ? 303  ASP A CG  1 
ATOM   2266 O  OD1 . ASP A 1 304 ? 6.303   -24.492 49.973  1.00 61.89  ? 303  ASP A OD1 1 
ATOM   2267 O  OD2 . ASP A 1 304 ? 8.363   -23.984 50.408  1.00 52.49  ? 303  ASP A OD2 1 
ATOM   2268 N  N   . THR A 1 305 ? 4.455   -25.055 48.068  1.00 60.11  ? 304  THR A N   1 
ATOM   2269 C  CA  . THR A 1 305 ? 3.028   -24.952 48.457  1.00 59.79  ? 304  THR A CA  1 
ATOM   2270 C  C   . THR A 1 305 ? 2.734   -23.879 49.515  1.00 57.20  ? 304  THR A C   1 
ATOM   2271 O  O   . THR A 1 305 ? 1.648   -23.271 49.490  1.00 48.73  ? 304  THR A O   1 
ATOM   2272 C  CB  . THR A 1 305 ? 2.542   -26.298 49.058  1.00 59.30  ? 304  THR A CB  1 
ATOM   2273 O  OG1 . THR A 1 305 ? 2.596   -27.320 48.062  1.00 53.83  ? 304  THR A OG1 1 
ATOM   2274 C  CG2 . THR A 1 305 ? 1.117   -26.197 49.626  1.00 60.52  ? 304  THR A CG2 1 
ATOM   2275 N  N   . ASN A 1 306 ? 3.707   -23.648 50.401  1.00 52.50  ? 305  ASN A N   1 
ATOM   2276 C  CA  . ASN A 1 306 ? 3.543   -22.733 51.520  1.00 57.84  ? 305  ASN A CA  1 
ATOM   2277 C  C   . ASN A 1 306 ? 3.713   -21.253 51.219  1.00 59.79  ? 305  ASN A C   1 
ATOM   2278 O  O   . ASN A 1 306 ? 3.460   -20.422 52.103  1.00 60.52  ? 305  ASN A O   1 
ATOM   2279 C  CB  . ASN A 1 306 ? 4.552   -23.052 52.643  1.00 62.31  ? 305  ASN A CB  1 
ATOM   2280 C  CG  . ASN A 1 306 ? 4.270   -24.352 53.343  1.00 57.90  ? 305  ASN A CG  1 
ATOM   2281 O  OD1 . ASN A 1 306 ? 3.114   -24.716 53.552  1.00 55.19  ? 305  ASN A OD1 1 
ATOM   2282 N  ND2 . ASN A 1 306 ? 5.332   -25.057 53.722  1.00 54.84  ? 305  ASN A ND2 1 
ATOM   2283 N  N   . THR A 1 307 ? 4.172   -20.921 50.011  1.00 58.54  ? 306  THR A N   1 
ATOM   2284 C  CA  . THR A 1 307 ? 4.604   -19.554 49.715  1.00 54.22  ? 306  THR A CA  1 
ATOM   2285 C  C   . THR A 1 307 ? 3.444   -18.561 49.772  1.00 49.06  ? 306  THR A C   1 
ATOM   2286 O  O   . THR A 1 307 ? 3.535   -17.544 50.448  1.00 43.54  ? 306  THR A O   1 
ATOM   2287 C  CB  . THR A 1 307 ? 5.337   -19.467 48.350  1.00 54.10  ? 306  THR A CB  1 
ATOM   2288 O  OG1 . THR A 1 307 ? 6.427   -20.393 48.328  1.00 57.56  ? 306  THR A OG1 1 
ATOM   2289 C  CG2 . THR A 1 307 ? 5.882   -18.070 48.131  1.00 51.75  ? 306  THR A CG2 1 
ATOM   2290 N  N   . SER A 1 308 ? 2.367   -18.849 49.048  1.00 47.84  ? 307  SER A N   1 
ATOM   2291 C  CA  . SER A 1 308 ? 1.232   -17.918 48.986  1.00 46.21  ? 307  SER A CA  1 
ATOM   2292 C  C   . SER A 1 308 ? 0.705   -17.653 50.389  1.00 43.52  ? 307  SER A C   1 
ATOM   2293 O  O   . SER A 1 308 ? 0.562   -16.499 50.799  1.00 40.39  ? 307  SER A O   1 
ATOM   2294 C  CB  . SER A 1 308 ? 0.120   -18.446 48.069  1.00 46.01  ? 307  SER A CB  1 
ATOM   2295 O  OG  . SER A 1 308 ? -0.518  -19.574 48.620  1.00 44.17  ? 307  SER A OG  1 
ATOM   2296 N  N   . THR A 1 309 ? 0.439   -18.734 51.120  1.00 44.28  ? 308  THR A N   1 
ATOM   2297 C  CA  . THR A 1 309 ? 0.019   -18.674 52.527  1.00 45.44  ? 308  THR A CA  1 
ATOM   2298 C  C   . THR A 1 309 ? 0.902   -17.737 53.327  1.00 44.85  ? 308  THR A C   1 
ATOM   2299 O  O   . THR A 1 309 ? 0.385   -16.913 54.107  1.00 44.76  ? 308  THR A O   1 
ATOM   2300 C  CB  . THR A 1 309 ? 0.084   -20.078 53.200  1.00 47.55  ? 308  THR A CB  1 
ATOM   2301 O  OG1 . THR A 1 309 ? -0.779  -20.996 52.516  1.00 40.39  ? 308  THR A OG1 1 
ATOM   2302 C  CG2 . THR A 1 309 ? -0.292  -20.027 54.723  1.00 47.59  ? 308  THR A CG2 1 
ATOM   2303 N  N   . TYR A 1 310 ? 2.218   -17.877 53.141  1.00 43.71  ? 309  TYR A N   1 
ATOM   2304 C  CA  . TYR A 1 310 ? 3.211   -17.095 53.899  1.00 46.80  ? 309  TYR A CA  1 
ATOM   2305 C  C   . TYR A 1 310 ? 3.254   -15.607 53.520  1.00 42.96  ? 309  TYR A C   1 
ATOM   2306 O  O   . TYR A 1 310 ? 3.400   -14.737 54.383  1.00 42.43  ? 309  TYR A O   1 
ATOM   2307 C  CB  . TYR A 1 310 ? 4.590   -17.687 53.683  1.00 47.62  ? 309  TYR A CB  1 
ATOM   2308 C  CG  . TYR A 1 310 ? 5.684   -17.132 54.561  1.00 53.67  ? 309  TYR A CG  1 
ATOM   2309 C  CD1 . TYR A 1 310 ? 5.728   -17.454 55.921  1.00 55.87  ? 309  TYR A CD1 1 
ATOM   2310 C  CD2 . TYR A 1 310 ? 6.708   -16.314 54.038  1.00 53.48  ? 309  TYR A CD2 1 
ATOM   2311 C  CE1 . TYR A 1 310 ? 6.746   -16.987 56.743  1.00 55.51  ? 309  TYR A CE1 1 
ATOM   2312 C  CE2 . TYR A 1 310 ? 7.727   -15.843 54.861  1.00 54.52  ? 309  TYR A CE2 1 
ATOM   2313 C  CZ  . TYR A 1 310 ? 7.740   -16.200 56.211  1.00 54.25  ? 309  TYR A CZ  1 
ATOM   2314 O  OH  . TYR A 1 310 ? 8.712   -15.767 57.068  1.00 54.92  ? 309  TYR A OH  1 
ATOM   2315 N  N   . LEU A 1 311 ? 3.157   -15.338 52.225  1.00 38.34  ? 310  LEU A N   1 
ATOM   2316 C  CA  . LEU A 1 311 ? 3.131   -13.969 51.744  1.00 38.87  ? 310  LEU A CA  1 
ATOM   2317 C  C   . LEU A 1 311 ? 1.885   -13.269 52.273  1.00 40.34  ? 310  LEU A C   1 
ATOM   2318 O  O   . LEU A 1 311 ? 1.966   -12.131 52.723  1.00 42.91  ? 310  LEU A O   1 
ATOM   2319 C  CB  . LEU A 1 311 ? 3.208   -13.897 50.205  1.00 36.33  ? 310  LEU A CB  1 
ATOM   2320 C  CG  . LEU A 1 311 ? 4.533   -14.405 49.631  1.00 33.23  ? 310  LEU A CG  1 
ATOM   2321 C  CD1 . LEU A 1 311 ? 4.615   -14.282 48.125  1.00 31.75  ? 310  LEU A CD1 1 
ATOM   2322 C  CD2 . LEU A 1 311 ? 5.700   -13.701 50.292  1.00 32.05  ? 310  LEU A CD2 1 
ATOM   2323 N  N   . MET A 1 312 ? 0.746   -13.950 52.244  1.00 39.54  ? 311  MET A N   1 
ATOM   2324 C  CA  . MET A 1 312 ? -0.476  -13.424 52.870  1.00 39.63  ? 311  MET A CA  1 
ATOM   2325 C  C   . MET A 1 312 ? -0.319  -13.115 54.378  1.00 38.86  ? 311  MET A C   1 
ATOM   2326 O  O   . MET A 1 312 ? -0.841  -12.113 54.868  1.00 39.14  ? 311  MET A O   1 
ATOM   2327 C  CB  . MET A 1 312 ? -1.628  -14.406 52.670  1.00 39.59  ? 311  MET A CB  1 
ATOM   2328 C  CG  . MET A 1 312 ? -2.987  -13.875 53.082  1.00 39.01  ? 311  MET A CG  1 
ATOM   2329 S  SD  . MET A 1 312 ? -3.520  -12.524 52.053  0.97 37.79  ? 311  MET A SD  1 
ATOM   2330 C  CE  . MET A 1 312 ? -3.884  -13.399 50.517  1.00 37.30  ? 311  MET A CE  1 
ATOM   2331 N  N   . SER A 1 313 ? 0.407   -13.962 55.099  1.00 38.76  ? 312  SER A N   1 
ATOM   2332 C  CA  . SER A 1 313 ? 0.662   -13.741 56.529  1.00 39.66  ? 312  SER A CA  1 
ATOM   2333 C  C   . SER A 1 313 ? 1.469   -12.498 56.746  1.00 38.68  ? 312  SER A C   1 
ATOM   2334 O  O   . SER A 1 313 ? 1.157   -11.691 57.623  1.00 36.73  ? 312  SER A O   1 
ATOM   2335 C  CB  . SER A 1 313 ? 1.435   -14.906 57.144  1.00 43.14  ? 312  SER A CB  1 
ATOM   2336 O  OG  . SER A 1 313 ? 0.596   -16.031 57.267  1.00 53.46  ? 312  SER A OG  1 
ATOM   2337 N  N   . LEU A 1 314 ? 2.524   -12.367 55.935  1.00 40.35  ? 313  LEU A N   1 
ATOM   2338 C  CA  . LEU A 1 314 ? 3.395   -11.185 55.908  1.00 38.51  ? 313  LEU A CA  1 
ATOM   2339 C  C   . LEU A 1 314 ? 2.624   -9.890  55.562  1.00 33.87  ? 313  LEU A C   1 
ATOM   2340 O  O   . LEU A 1 314 ? 2.857   -8.825  56.151  1.00 31.21  ? 313  LEU A O   1 
ATOM   2341 C  CB  . LEU A 1 314 ? 4.530   -11.412 54.912  1.00 39.47  ? 313  LEU A CB  1 
ATOM   2342 C  CG  . LEU A 1 314 ? 5.851   -12.033 55.399  1.00 40.16  ? 313  LEU A CG  1 
ATOM   2343 C  CD1 . LEU A 1 314 ? 5.646   -13.197 56.315  1.00 40.58  ? 313  LEU A CD1 1 
ATOM   2344 C  CD2 . LEU A 1 314 ? 6.729   -12.457 54.229  1.00 43.09  ? 313  LEU A CD2 1 
ATOM   2345 N  N   . LEU A 1 315 ? 1.679   -10.021 54.639  1.00 31.95  ? 314  LEU A N   1 
ATOM   2346 C  CA  . LEU A 1 315 ? 0.784   -8.933  54.227  1.00 32.98  ? 314  LEU A CA  1 
ATOM   2347 C  C   . LEU A 1 315 ? -0.090  -8.450  55.360  1.00 34.31  ? 314  LEU A C   1 
ATOM   2348 O  O   . LEU A 1 315 ? -0.268  -7.229  55.567  1.00 32.94  ? 314  LEU A O   1 
ATOM   2349 C  CB  . LEU A 1 315 ? -0.096  -9.405  53.080  1.00 32.82  ? 314  LEU A CB  1 
ATOM   2350 C  CG  . LEU A 1 315 ? -0.650  -8.379  52.096  1.00 32.94  ? 314  LEU A CG  1 
ATOM   2351 C  CD1 . LEU A 1 315 ? 0.351   -7.292  51.774  1.00 33.15  ? 314  LEU A CD1 1 
ATOM   2352 C  CD2 . LEU A 1 315 ? -1.029  -9.141  50.820  1.00 34.67  ? 314  LEU A CD2 1 
ATOM   2353 N  N   . ALA A 1 316 ? -0.627  -9.425  56.092  1.00 35.47  ? 315  ALA A N   1 
ATOM   2354 C  CA  . ALA A 1 316 ? -1.412  -9.176  57.279  1.00 38.95  ? 315  ALA A CA  1 
ATOM   2355 C  C   . ALA A 1 316 ? -0.560  -8.582  58.369  1.00 41.46  ? 315  ALA A C   1 
ATOM   2356 O  O   . ALA A 1 316 ? -1.046  -7.898  59.260  1.00 40.54  ? 315  ALA A O   1 
ATOM   2357 C  CB  . ALA A 1 316 ? -2.009  -10.485 57.752  1.00 41.23  ? 315  ALA A CB  1 
ATOM   2358 N  N   . ASN A 1 317 ? 0.728   -8.879  58.285  1.00 45.68  ? 316  ASN A N   1 
ATOM   2359 C  CA  . ASN A 1 317 ? 1.686   -8.517  59.298  1.00 45.57  ? 316  ASN A CA  1 
ATOM   2360 C  C   . ASN A 1 317 ? 2.405   -7.187  59.045  1.00 43.22  ? 316  ASN A C   1 
ATOM   2361 O  O   . ASN A 1 317 ? 2.950   -6.599  59.977  1.00 50.80  ? 316  ASN A O   1 
ATOM   2362 C  CB  . ASN A 1 317 ? 2.709   -9.644  59.369  1.00 49.57  ? 316  ASN A CB  1 
ATOM   2363 C  CG  . ASN A 1 317 ? 3.785   -9.385  60.365  1.00 58.80  ? 316  ASN A CG  1 
ATOM   2364 O  OD1 . ASN A 1 317 ? 4.978   -9.514  60.049  1.00 61.51  ? 316  ASN A OD1 1 
ATOM   2365 N  ND2 . ASN A 1 317 ? 3.400   -8.943  61.547  1.00 65.13  ? 316  ASN A ND2 1 
ATOM   2366 N  N   . ASP A 1 318 ? 2.429   -6.733  57.796  1.00 38.39  ? 317  ASP A N   1 
ATOM   2367 C  CA  . ASP A 1 318 ? 3.036   -5.459  57.430  1.00 37.59  ? 317  ASP A CA  1 
ATOM   2368 C  C   . ASP A 1 318 ? 4.507   -5.593  57.139  1.00 37.84  ? 317  ASP A C   1 
ATOM   2369 O  O   . ASP A 1 318 ? 5.215   -4.593  56.996  1.00 41.40  ? 317  ASP A O   1 
ATOM   2370 C  CB  . ASP A 1 318 ? 2.802   -4.374  58.483  1.00 34.54  ? 317  ASP A CB  1 
ATOM   2371 C  CG  . ASP A 1 318 ? 2.888   -3.017  57.932  1.00 35.40  ? 317  ASP A CG  1 
ATOM   2372 O  OD1 . ASP A 1 318 ? 2.617   -2.807  56.740  1.00 34.12  ? 317  ASP A OD1 1 
ATOM   2373 O  OD2 . ASP A 1 318 ? 3.254   -2.142  58.718  1.00 41.04  ? 317  ASP A OD2 1 
ATOM   2374 N  N   . THR A 1 319 ? 4.959   -6.830  57.055  1.00 36.73  ? 318  THR A N   1 
ATOM   2375 C  CA  . THR A 1 319 ? 6.208   -7.134  56.402  1.00 37.00  ? 318  THR A CA  1 
ATOM   2376 C  C   . THR A 1 319 ? 6.026   -6.739  54.948  1.00 35.86  ? 318  THR A C   1 
ATOM   2377 O  O   . THR A 1 319 ? 6.885   -6.147  54.320  1.00 36.49  ? 318  THR A O   1 
ATOM   2378 C  CB  . THR A 1 319 ? 6.483   -8.631  56.488  1.00 37.91  ? 318  THR A CB  1 
ATOM   2379 O  OG1 . THR A 1 319 ? 6.377   -9.064  57.866  1.00 39.47  ? 318  THR A OG1 1 
ATOM   2380 C  CG2 . THR A 1 319 ? 7.850   -8.948  55.984  1.00 36.17  ? 318  THR A CG2 1 
ATOM   2381 N  N   . LEU A 1 320 ? 4.862   -7.059  54.421  1.00 34.74  ? 319  LEU A N   1 
ATOM   2382 C  CA  . LEU A 1 320 ? 4.450   -6.556  53.138  1.00 32.37  ? 319  LEU A CA  1 
ATOM   2383 C  C   . LEU A 1 320 ? 3.364   -5.526  53.387  1.00 29.95  ? 319  LEU A C   1 
ATOM   2384 O  O   . LEU A 1 320 ? 2.457   -5.751  54.109  1.00 28.78  ? 319  LEU A O   1 
ATOM   2385 C  CB  . LEU A 1 320 ? 3.953   -7.701  52.261  1.00 32.37  ? 319  LEU A CB  1 
ATOM   2386 C  CG  . LEU A 1 320 ? 4.973   -8.810  52.046  1.00 35.23  ? 319  LEU A CG  1 
ATOM   2387 C  CD1 . LEU A 1 320 ? 4.412   -9.832  51.103  1.00 38.21  ? 319  LEU A CD1 1 
ATOM   2388 C  CD2 . LEU A 1 320 ? 6.278   -8.279  51.482  1.00 39.99  ? 319  LEU A CD2 1 
ATOM   2389 N  N   . ASN A 1 321 ? 3.464   -4.389  52.751  1.00 33.16  ? 320  ASN A N   1 
ATOM   2390 C  CA  . ASN A 1 321 ? 2.616   -3.266  53.050  1.00 33.44  ? 320  ASN A CA  1 
ATOM   2391 C  C   . ASN A 1 321 ? 1.433   -3.115  52.140  1.00 31.40  ? 320  ASN A C   1 
ATOM   2392 O  O   . ASN A 1 321 ? 0.382   -2.637  52.572  1.00 31.72  ? 320  ASN A O   1 
ATOM   2393 C  CB  . ASN A 1 321 ? 3.469   -2.006  52.966  1.00 34.32  ? 320  ASN A CB  1 
ATOM   2394 C  CG  . ASN A 1 321 ? 4.658   -2.111  53.864  1.00 36.68  ? 320  ASN A CG  1 
ATOM   2395 O  OD1 . ASN A 1 321 ? 5.726   -2.567  53.476  1.00 34.90  ? 320  ASN A OD1 1 
ATOM   2396 N  ND2 . ASN A 1 321 ? 4.421   -1.838  55.122  1.00 41.13  ? 320  ASN A ND2 1 
ATOM   2397 N  N   . ILE A 1 322 ? 1.609   -3.499  50.889  1.00 29.97  ? 321  ILE A N   1 
ATOM   2398 C  CA  . ILE A 1 322 ? 0.651   -3.173  49.847  1.00 28.33  ? 321  ILE A CA  1 
ATOM   2399 C  C   . ILE A 1 322 ? 0.432   -4.381  48.973  1.00 27.87  ? 321  ILE A C   1 
ATOM   2400 O  O   . ILE A 1 322 ? 1.364   -5.144  48.748  1.00 30.87  ? 321  ILE A O   1 
ATOM   2401 C  CB  . ILE A 1 322 ? 1.201   -2.019  49.029  1.00 27.98  ? 321  ILE A CB  1 
ATOM   2402 C  CG1 . ILE A 1 322 ? 1.127   -0.752  49.883  1.00 31.26  ? 321  ILE A CG1 1 
ATOM   2403 C  CG2 . ILE A 1 322 ? 0.444   -1.873  47.728  1.00 28.18  ? 321  ILE A CG2 1 
ATOM   2404 C  CD1 . ILE A 1 322 ? 1.909   0.425   49.355  1.00 35.94  ? 321  ILE A CD1 1 
ATOM   2405 N  N   . VAL A 1 323 ? -0.793  -4.587  48.516  1.00 25.43  ? 322  VAL A N   1 
ATOM   2406 C  CA  . VAL A 1 323 ? -1.059  -5.587  47.481  1.00 26.59  ? 322  VAL A CA  1 
ATOM   2407 C  C   . VAL A 1 323 ? -1.551  -4.909  46.222  1.00 25.94  ? 322  VAL A C   1 
ATOM   2408 O  O   . VAL A 1 323 ? -2.395  -4.042  46.277  1.00 28.88  ? 322  VAL A O   1 
ATOM   2409 C  CB  . VAL A 1 323 ? -2.053  -6.678  47.919  1.00 27.50  ? 322  VAL A CB  1 
ATOM   2410 C  CG1 . VAL A 1 323 ? -3.431  -6.100  48.224  1.00 30.36  ? 322  VAL A CG1 1 
ATOM   2411 C  CG2 . VAL A 1 323 ? -2.187  -7.757  46.854  1.00 27.47  ? 322  VAL A CG2 1 
ATOM   2412 N  N   . ALA A 1 324 ? -0.987  -5.289  45.090  1.00 27.91  ? 323  ALA A N   1 
ATOM   2413 C  CA  . ALA A 1 324 ? -1.348  -4.699  43.795  1.00 30.89  ? 323  ALA A CA  1 
ATOM   2414 C  C   . ALA A 1 324 ? -1.694  -5.795  42.816  1.00 31.60  ? 323  ALA A C   1 
ATOM   2415 O  O   . ALA A 1 324 ? -1.455  -6.977  43.112  1.00 35.93  ? 323  ALA A O   1 
ATOM   2416 C  CB  . ALA A 1 324 ? -0.194  -3.885  43.260  1.00 32.95  ? 323  ALA A CB  1 
ATOM   2417 N  N   . SER A 1 325 ? -2.246  -5.417  41.665  1.00 29.54  ? 324  SER A N   1 
ATOM   2418 C  CA  . SER A 1 325 ? -2.525  -6.373  40.594  1.00 30.94  ? 324  SER A CA  1 
ATOM   2419 C  C   . SER A 1 325 ? -1.291  -6.650  39.710  1.00 34.81  ? 324  SER A C   1 
ATOM   2420 O  O   . SER A 1 325 ? -1.099  -7.783  39.266  1.00 32.52  ? 324  SER A O   1 
ATOM   2421 C  CB  . SER A 1 325 ? -3.660  -5.871  39.709  1.00 31.70  ? 324  SER A CB  1 
ATOM   2422 O  OG  . SER A 1 325 ? -3.344  -4.611  39.102  1.00 31.56  ? 324  SER A OG  1 
ATOM   2423 N  N   . ASP A 1 326 ? -0.473  -5.615  39.457  1.00 36.68  ? 325  ASP A N   1 
ATOM   2424 C  CA  . ASP A 1 326 ? 0.575   -5.663  38.427  1.00 38.99  ? 325  ASP A CA  1 
ATOM   2425 C  C   . ASP A 1 326 ? -0.051  -6.053  37.070  1.00 39.95  ? 325  ASP A C   1 
ATOM   2426 O  O   . ASP A 1 326 ? 0.528   -6.780  36.268  1.00 39.79  ? 325  ASP A O   1 
ATOM   2427 C  CB  . ASP A 1 326 ? 1.662   -6.645  38.834  1.00 41.07  ? 325  ASP A CB  1 
ATOM   2428 C  CG  . ASP A 1 326 ? 2.957   -6.430  38.087  1.00 40.87  ? 325  ASP A CG  1 
ATOM   2429 O  OD1 . ASP A 1 326 ? 3.401   -5.272  37.920  1.00 37.50  ? 325  ASP A OD1 1 
ATOM   2430 O  OD2 . ASP A 1 326 ? 3.532   -7.452  37.691  1.00 44.09  ? 325  ASP A OD2 1 
ATOM   2431 N  N   . HIS A 1 327 ? -1.243  -5.518  36.841  1.00 40.38  ? 326  HIS A N   1 
ATOM   2432 C  CA  . HIS A 1 327 ? -2.069  -5.865  35.724  1.00 39.38  ? 326  HIS A CA  1 
ATOM   2433 C  C   . HIS A 1 327 ? -1.330  -5.624  34.450  1.00 41.89  ? 326  HIS A C   1 
ATOM   2434 O  O   . HIS A 1 327 ? -0.869  -4.489  34.181  1.00 44.42  ? 326  HIS A O   1 
ATOM   2435 C  CB  . HIS A 1 327 ? -3.296  -4.953  35.688  1.00 40.32  ? 326  HIS A CB  1 
ATOM   2436 C  CG  . HIS A 1 327 ? -4.334  -5.368  34.694  1.00 36.66  ? 326  HIS A CG  1 
ATOM   2437 N  ND1 . HIS A 1 327 ? -5.013  -6.550  34.809  1.00 35.35  ? 326  HIS A ND1 1 
ATOM   2438 C  CD2 . HIS A 1 327 ? -4.826  -4.760  33.596  1.00 36.83  ? 326  HIS A CD2 1 
ATOM   2439 C  CE1 . HIS A 1 327 ? -5.884  -6.660  33.830  1.00 37.09  ? 326  HIS A CE1 1 
ATOM   2440 N  NE2 . HIS A 1 327 ? -5.786  -5.586  33.072  1.00 37.79  ? 326  HIS A NE2 1 
ATOM   2441 N  N   . ARG A 1 328 ? -1.200  -6.676  33.665  1.00 39.16  ? 327  ARG A N   1 
ATOM   2442 C  CA  . ARG A 1 328 ? -0.626  -6.538  32.362  1.00 43.23  ? 327  ARG A CA  1 
ATOM   2443 C  C   . ARG A 1 328 ? -1.013  -7.710  31.498  1.00 45.51  ? 327  ARG A C   1 
ATOM   2444 O  O   . ARG A 1 328 ? -0.159  -8.524  31.135  1.00 47.23  ? 327  ARG A O   1 
ATOM   2445 C  CB  . ARG A 1 328 ? 0.914   -6.401  32.434  1.00 44.21  ? 327  ARG A CB  1 
ATOM   2446 C  CG  . ARG A 1 328 ? 1.527   -6.244  31.046  1.00 47.43  ? 327  ARG A CG  1 
ATOM   2447 C  CD  . ARG A 1 328 ? 2.886   -5.593  31.050  1.00 48.33  ? 327  ARG A CD  1 
ATOM   2448 N  NE  . ARG A 1 328 ? 3.859   -6.423  31.747  1.00 47.32  ? 327  ARG A NE  1 
ATOM   2449 C  CZ  . ARG A 1 328 ? 4.981   -5.968  32.302  1.00 46.17  ? 327  ARG A CZ  1 
ATOM   2450 N  NH1 . ARG A 1 328 ? 5.303   -4.677  32.274  1.00 47.81  ? 327  ARG A NH1 1 
ATOM   2451 N  NH2 . ARG A 1 328 ? 5.777   -6.815  32.929  1.00 44.23  ? 327  ARG A NH2 1 
ATOM   2452 N  N   . PRO A 1 329 ? -2.301  -7.803  31.136  1.00 50.37  ? 328  PRO A N   1 
ATOM   2453 C  CA  . PRO A 1 329 ? -2.662  -8.996  30.353  1.00 52.17  ? 328  PRO A CA  1 
ATOM   2454 C  C   . PRO A 1 329 ? -2.085  -9.019  28.949  1.00 54.83  ? 328  PRO A C   1 
ATOM   2455 O  O   . PRO A 1 329 ? -1.833  -7.977  28.348  1.00 47.06  ? 328  PRO A O   1 
ATOM   2456 C  CB  . PRO A 1 329 ? -4.193  -8.927  30.271  1.00 48.87  ? 328  PRO A CB  1 
ATOM   2457 C  CG  . PRO A 1 329 ? -4.514  -7.492  30.514  1.00 48.65  ? 328  PRO A CG  1 
ATOM   2458 C  CD  . PRO A 1 329 ? -3.490  -7.009  31.496  1.00 49.10  ? 328  PRO A CD  1 
ATOM   2459 N  N   . PHE A 1 330 ? -1.891  -10.237 28.463  1.00 60.65  ? 329  PHE A N   1 
ATOM   2460 C  CA  . PHE A 1 330 ? -1.615  -10.500 27.065  1.00 62.04  ? 329  PHE A CA  1 
ATOM   2461 C  C   . PHE A 1 330 ? -2.524  -11.652 26.626  1.00 59.10  ? 329  PHE A C   1 
ATOM   2462 O  O   . PHE A 1 330 ? -2.898  -12.467 27.470  1.00 54.31  ? 329  PHE A O   1 
ATOM   2463 C  CB  . PHE A 1 330 ? -0.148  -10.904 26.914  1.00 64.53  ? 329  PHE A CB  1 
ATOM   2464 C  CG  . PHE A 1 330 ? 0.818   -9.808  27.242  1.00 57.43  ? 329  PHE A CG  1 
ATOM   2465 C  CD1 . PHE A 1 330 ? 0.838   -8.659  26.488  1.00 58.65  ? 329  PHE A CD1 1 
ATOM   2466 C  CD2 . PHE A 1 330 ? 1.707   -9.936  28.289  1.00 53.25  ? 329  PHE A CD2 1 
ATOM   2467 C  CE1 . PHE A 1 330 ? 1.726   -7.633  26.781  1.00 59.01  ? 329  PHE A CE1 1 
ATOM   2468 C  CE2 . PHE A 1 330 ? 2.602   -8.917  28.587  1.00 55.00  ? 329  PHE A CE2 1 
ATOM   2469 C  CZ  . PHE A 1 330 ? 2.618   -7.761  27.827  1.00 55.91  ? 329  PHE A CZ  1 
ATOM   2470 N  N   . THR A 1 331 ? -2.861  -11.715 25.332  1.00 57.06  ? 330  THR A N   1 
ATOM   2471 C  CA  . THR A 1 331 ? -3.601  -12.862 24.768  1.00 59.13  ? 330  THR A CA  1 
ATOM   2472 C  C   . THR A 1 331 ? -2.722  -14.114 24.611  1.00 60.78  ? 330  THR A C   1 
ATOM   2473 O  O   . THR A 1 331 ? -1.471  -14.042 24.585  1.00 60.04  ? 330  THR A O   1 
ATOM   2474 C  CB  . THR A 1 331 ? -4.217  -12.533 23.408  1.00 62.33  ? 330  THR A CB  1 
ATOM   2475 O  OG1 . THR A 1 331 ? -3.186  -12.113 22.491  1.00 70.40  ? 330  THR A OG1 1 
ATOM   2476 C  CG2 . THR A 1 331 ? -5.250  -11.425 23.575  1.00 64.44  ? 330  THR A CG2 1 
ATOM   2477 N  N   . THR A 1 332 ? -3.374  -15.277 24.550  1.00 58.23  ? 331  THR A N   1 
ATOM   2478 C  CA  . THR A 1 332 ? -2.653  -16.553 24.403  1.00 59.69  ? 331  THR A CA  1 
ATOM   2479 C  C   . THR A 1 332 ? -1.920  -16.581 23.075  1.00 59.44  ? 331  THR A C   1 
ATOM   2480 O  O   . THR A 1 332 ? -0.890  -17.235 22.955  1.00 57.54  ? 331  THR A O   1 
ATOM   2481 C  CB  . THR A 1 332 ? -3.599  -17.768 24.455  1.00 61.60  ? 331  THR A CB  1 
ATOM   2482 O  OG1 . THR A 1 332 ? -4.436  -17.677 25.614  1.00 68.94  ? 331  THR A OG1 1 
ATOM   2483 C  CG2 . THR A 1 332 ? -2.823  -19.062 24.525  1.00 61.41  ? 331  THR A CG2 1 
ATOM   2484 N  N   . LYS A 1 333 ? -2.484  -15.887 22.082  1.00 67.35  ? 332  LYS A N   1 
ATOM   2485 C  CA  . LYS A 1 333 ? -1.825  -15.690 20.791  1.00 68.59  ? 332  LYS A CA  1 
ATOM   2486 C  C   . LYS A 1 333 ? -0.530  -14.917 21.019  1.00 66.39  ? 332  LYS A C   1 
ATOM   2487 O  O   . LYS A 1 333 ? 0.521   -15.285 20.517  1.00 58.37  ? 332  LYS A O   1 
ATOM   2488 C  CB  . LYS A 1 333 ? -2.709  -14.900 19.817  1.00 75.03  ? 332  LYS A CB  1 
ATOM   2489 C  CG  . LYS A 1 333 ? -2.061  -14.616 18.441  1.00 85.83  ? 332  LYS A CG  1 
ATOM   2490 C  CD  . LYS A 1 333 ? -2.706  -13.486 17.582  1.00 87.69  ? 332  LYS A CD  1 
ATOM   2491 C  CE  . LYS A 1 333 ? -2.709  -12.102 18.215  1.00 87.06  ? 332  LYS A CE  1 
ATOM   2492 N  NZ  . LYS A 1 333 ? -1.525  -11.236 17.937  1.00 82.30  ? 332  LYS A NZ  1 
ATOM   2493 N  N   . GLN A 1 334 ? -0.632  -13.824 21.770  1.00 65.58  ? 333  GLN A N   1 
ATOM   2494 C  CA  . GLN A 1 334 ? 0.539   -12.998 22.117  1.00 64.31  ? 333  GLN A CA  1 
ATOM   2495 C  C   . GLN A 1 334 ? 1.583   -13.757 22.947  1.00 55.89  ? 333  GLN A C   1 
ATOM   2496 O  O   . GLN A 1 334 ? 2.754   -13.766 22.626  1.00 54.97  ? 333  GLN A O   1 
ATOM   2497 C  CB  . GLN A 1 334 ? 0.107   -11.763 22.900  1.00 65.97  ? 333  GLN A CB  1 
ATOM   2498 C  CG  . GLN A 1 334 ? -0.280  -10.564 22.060  1.00 60.82  ? 333  GLN A CG  1 
ATOM   2499 C  CD  . GLN A 1 334 ? -0.797  -9.442  22.937  1.00 58.11  ? 333  GLN A CD  1 
ATOM   2500 O  OE1 . GLN A 1 334 ? -1.555  -9.668  23.888  1.00 55.46  ? 333  GLN A OE1 1 
ATOM   2501 N  NE2 . GLN A 1 334 ? -0.405  -8.228  22.616  1.00 60.38  ? 333  GLN A NE2 1 
ATOM   2502 N  N   . LYS A 1 335 ? 1.131   -14.402 24.007  1.00 51.31  ? 334  LYS A N   1 
ATOM   2503 C  CA  . LYS A 1 335 ? 2.011   -15.225 24.820  1.00 52.60  ? 334  LYS A CA  1 
ATOM   2504 C  C   . LYS A 1 335 ? 2.759   -16.228 23.937  1.00 52.21  ? 334  LYS A C   1 
ATOM   2505 O  O   . LYS A 1 335 ? 3.943   -16.489 24.136  1.00 49.94  ? 334  LYS A O   1 
ATOM   2506 C  CB  . LYS A 1 335 ? 1.202   -15.984 25.884  1.00 55.54  ? 334  LYS A CB  1 
ATOM   2507 C  CG  . LYS A 1 335 ? 0.629   -15.133 27.018  1.00 56.44  ? 334  LYS A CG  1 
ATOM   2508 C  CD  . LYS A 1 335 ? 1.708   -14.635 27.971  1.00 57.63  ? 334  LYS A CD  1 
ATOM   2509 C  CE  . LYS A 1 335 ? 1.108   -14.165 29.295  1.00 57.35  ? 334  LYS A CE  1 
ATOM   2510 N  NZ  . LYS A 1 335 ? 2.148   -13.774 30.285  1.00 53.60  ? 334  LYS A NZ  1 
ATOM   2511 N  N   . ALA A 1 336 ? 2.043   -16.757 22.943  1.00 54.41  ? 335  ALA A N   1 
ATOM   2512 C  CA  . ALA A 1 336 ? 2.510   -17.849 22.122  1.00 50.07  ? 335  ALA A CA  1 
ATOM   2513 C  C   . ALA A 1 336 ? 3.779   -17.511 21.361  1.00 50.56  ? 335  ALA A C   1 
ATOM   2514 O  O   . ALA A 1 336 ? 4.464   -18.411 20.874  1.00 49.63  ? 335  ALA A O   1 
ATOM   2515 C  CB  . ALA A 1 336 ? 1.417   -18.309 21.180  1.00 49.92  ? 335  ALA A CB  1 
ATOM   2516 N  N   . MET A 1 337 ? 4.132   -16.229 21.307  1.00 58.40  ? 336  MET A N   1 
ATOM   2517 C  CA  . MET A 1 337 ? 5.419   -15.801 20.721  1.00 60.99  ? 336  MET A CA  1 
ATOM   2518 C  C   . MET A 1 337 ? 6.618   -16.408 21.442  1.00 57.63  ? 336  MET A C   1 
ATOM   2519 O  O   . MET A 1 337 ? 7.744   -16.270 20.988  1.00 54.90  ? 336  MET A O   1 
ATOM   2520 C  CB  . MET A 1 337 ? 5.576   -14.267 20.688  1.00 62.19  ? 336  MET A CB  1 
ATOM   2521 C  CG  . MET A 1 337 ? 5.725   -13.594 22.046  1.00 68.26  ? 336  MET A CG  1 
ATOM   2522 S  SD  . MET A 1 337 ? 5.848   -11.788 21.989  1.00 72.89  ? 336  MET A SD  1 
ATOM   2523 C  CE  . MET A 1 337 ? 7.630   -11.770 21.769  1.00 83.17  ? 336  MET A CE  1 
ATOM   2524 N  N   . GLY A 1 338 ? 6.356   -17.072 22.565  1.00 57.66  ? 337  GLY A N   1 
ATOM   2525 C  CA  . GLY A 1 338 ? 7.328   -17.927 23.213  1.00 55.64  ? 337  GLY A CA  1 
ATOM   2526 C  C   . GLY A 1 338 ? 6.880   -19.372 23.364  1.00 53.58  ? 337  GLY A C   1 
ATOM   2527 O  O   . GLY A 1 338 ? 7.246   -20.020 24.347  1.00 51.42  ? 337  GLY A O   1 
ATOM   2528 N  N   . LYS A 1 339 ? 6.163   -19.907 22.371  1.00 53.58  ? 338  LYS A N   1 
ATOM   2529 C  CA  . LYS A 1 339 ? 5.729   -21.306 22.426  1.00 60.07  ? 338  LYS A CA  1 
ATOM   2530 C  C   . LYS A 1 339 ? 6.939   -22.257 22.396  1.00 60.89  ? 338  LYS A C   1 
ATOM   2531 O  O   . LYS A 1 339 ? 6.951   -23.278 23.087  1.00 52.74  ? 338  LYS A O   1 
ATOM   2532 C  CB  . LYS A 1 339 ? 4.729   -21.647 21.297  1.00 64.62  ? 338  LYS A CB  1 
ATOM   2533 C  CG  . LYS A 1 339 ? 3.568   -22.576 21.746  1.00 71.89  ? 338  LYS A CG  1 
ATOM   2534 C  CD  . LYS A 1 339 ? 2.657   -23.106 20.621  1.00 73.00  ? 338  LYS A CD  1 
ATOM   2535 C  CE  . LYS A 1 339 ? 1.857   -24.340 21.056  1.00 71.38  ? 338  LYS A CE  1 
ATOM   2536 N  NZ  . LYS A 1 339 ? 0.514   -24.036 21.637  1.00 74.45  ? 338  LYS A NZ  1 
ATOM   2537 N  N   . GLU A 1 340 ? 7.958   -21.897 21.618  1.00 66.14  ? 339  GLU A N   1 
ATOM   2538 C  CA  . GLU A 1 340 ? 9.184   -22.696 21.494  1.00 69.60  ? 339  GLU A CA  1 
ATOM   2539 C  C   . GLU A 1 340 ? 10.320  -22.233 22.432  1.00 67.81  ? 339  GLU A C   1 
ATOM   2540 O  O   . GLU A 1 340 ? 11.255  -22.988 22.688  1.00 68.15  ? 339  GLU A O   1 
ATOM   2541 C  CB  . GLU A 1 340 ? 9.676   -22.646 20.047  1.00 74.60  ? 339  GLU A CB  1 
ATOM   2542 C  CG  . GLU A 1 340 ? 8.742   -23.304 19.031  1.00 76.94  ? 339  GLU A CG  1 
ATOM   2543 C  CD  . GLU A 1 340 ? 9.012   -22.829 17.586  1.00 77.44  ? 339  GLU A CD  1 
ATOM   2544 O  OE1 . GLU A 1 340 ? 10.165  -22.947 17.071  1.00 66.27  ? 339  GLU A OE1 1 
ATOM   2545 O  OE2 . GLU A 1 340 ? 8.057   -22.300 16.963  1.00 72.32  ? 339  GLU A OE2 1 
ATOM   2546 N  N   . ASP A 1 341 ? 10.231  -21.005 22.941  1.00 61.91  ? 340  ASP A N   1 
ATOM   2547 C  CA  . ASP A 1 341 ? 11.242  -20.451 23.840  1.00 60.57  ? 340  ASP A CA  1 
ATOM   2548 C  C   . ASP A 1 341 ? 10.546  -19.695 24.977  1.00 55.91  ? 340  ASP A C   1 
ATOM   2549 O  O   . ASP A 1 341 ? 9.919   -18.664 24.746  1.00 52.41  ? 340  ASP A O   1 
ATOM   2550 C  CB  . ASP A 1 341 ? 12.163  -19.513 23.036  1.00 63.77  ? 340  ASP A CB  1 
ATOM   2551 C  CG  . ASP A 1 341 ? 13.304  -18.930 23.861  1.00 64.98  ? 340  ASP A CG  1 
ATOM   2552 O  OD1 . ASP A 1 341 ? 13.369  -19.132 25.084  1.00 73.73  ? 340  ASP A OD1 1 
ATOM   2553 O  OD2 . ASP A 1 341 ? 14.149  -18.237 23.259  1.00 63.85  ? 340  ASP A OD2 1 
ATOM   2554 N  N   . PHE A 1 342 ? 10.652  -20.197 26.204  1.00 54.10  ? 341  PHE A N   1 
ATOM   2555 C  CA  . PHE A 1 342 ? 9.966   -19.557 27.348  1.00 51.95  ? 341  PHE A CA  1 
ATOM   2556 C  C   . PHE A 1 342 ? 10.476  -18.133 27.678  1.00 49.13  ? 341  PHE A C   1 
ATOM   2557 O  O   . PHE A 1 342 ? 9.719   -17.320 28.199  1.00 47.16  ? 341  PHE A O   1 
ATOM   2558 C  CB  . PHE A 1 342 ? 9.993   -20.451 28.605  1.00 49.86  ? 341  PHE A CB  1 
ATOM   2559 C  CG  . PHE A 1 342 ? 11.296  -20.421 29.351  1.00 53.62  ? 341  PHE A CG  1 
ATOM   2560 C  CD1 . PHE A 1 342 ? 11.598  -19.377 30.210  1.00 50.47  ? 341  PHE A CD1 1 
ATOM   2561 C  CD2 . PHE A 1 342 ? 12.217  -21.437 29.202  1.00 55.89  ? 341  PHE A CD2 1 
ATOM   2562 C  CE1 . PHE A 1 342 ? 12.787  -19.357 30.900  1.00 49.65  ? 341  PHE A CE1 1 
ATOM   2563 C  CE2 . PHE A 1 342 ? 13.425  -21.398 29.878  1.00 56.07  ? 341  PHE A CE2 1 
ATOM   2564 C  CZ  . PHE A 1 342 ? 13.703  -20.363 30.733  1.00 50.58  ? 341  PHE A CZ  1 
ATOM   2565 N  N   . THR A 1 343 ? 11.726  -17.827 27.343  1.00 47.85  ? 342  THR A N   1 
ATOM   2566 C  CA  . THR A 1 343 ? 12.304  -16.508 27.639  1.00 50.60  ? 342  THR A CA  1 
ATOM   2567 C  C   . THR A 1 343 ? 11.656  -15.387 26.834  1.00 51.65  ? 342  THR A C   1 
ATOM   2568 O  O   . THR A 1 343 ? 11.779  -14.236 27.180  1.00 44.15  ? 342  THR A O   1 
ATOM   2569 C  CB  . THR A 1 343 ? 13.805  -16.487 27.335  1.00 52.54  ? 342  THR A CB  1 
ATOM   2570 O  OG1 . THR A 1 343 ? 14.032  -16.731 25.934  1.00 52.88  ? 342  THR A OG1 1 
ATOM   2571 C  CG2 . THR A 1 343 ? 14.510  -17.568 28.153  1.00 55.01  ? 342  THR A CG2 1 
ATOM   2572 N  N   . LYS A 1 344 ? 10.982  -15.752 25.746  1.00 59.39  ? 343  LYS A N   1 
ATOM   2573 C  CA  . LYS A 1 344 ? 10.292  -14.807 24.874  1.00 62.17  ? 343  LYS A CA  1 
ATOM   2574 C  C   . LYS A 1 344 ? 8.794   -14.683 25.199  1.00 65.80  ? 343  LYS A C   1 
ATOM   2575 O  O   . LYS A 1 344 ? 8.080   -13.894 24.548  1.00 71.07  ? 343  LYS A O   1 
ATOM   2576 C  CB  . LYS A 1 344 ? 10.473  -15.214 23.398  1.00 67.60  ? 343  LYS A CB  1 
ATOM   2577 C  CG  . LYS A 1 344 ? 11.885  -15.012 22.810  1.00 70.70  ? 343  LYS A CG  1 
ATOM   2578 C  CD  . LYS A 1 344 ? 12.012  -15.567 21.375  1.00 75.53  ? 343  LYS A CD  1 
ATOM   2579 C  CE  . LYS A 1 344 ? 13.376  -16.178 21.070  1.00 75.62  ? 343  LYS A CE  1 
ATOM   2580 N  NZ  . LYS A 1 344 ? 13.214  -17.350 20.160  1.00 72.32  ? 343  LYS A NZ  1 
ATOM   2581 N  N   . ILE A 1 345 ? 8.311   -15.463 26.175  1.00 68.01  ? 344  ILE A N   1 
ATOM   2582 C  CA  . ILE A 1 345 ? 6.945   -15.296 26.693  1.00 66.81  ? 344  ILE A CA  1 
ATOM   2583 C  C   . ILE A 1 345 ? 6.907   -13.971 27.444  1.00 66.54  ? 344  ILE A C   1 
ATOM   2584 O  O   . ILE A 1 345 ? 7.675   -13.785 28.388  1.00 74.03  ? 344  ILE A O   1 
ATOM   2585 C  CB  . ILE A 1 345 ? 6.512   -16.384 27.697  1.00 63.93  ? 344  ILE A CB  1 
ATOM   2586 C  CG1 . ILE A 1 345 ? 6.564   -17.791 27.093  1.00 65.23  ? 344  ILE A CG1 1 
ATOM   2587 C  CG2 . ILE A 1 345 ? 5.089   -16.107 28.173  1.00 64.33  ? 344  ILE A CG2 1 
ATOM   2588 C  CD1 . ILE A 1 345 ? 6.238   -18.895 28.094  1.00 61.53  ? 344  ILE A CD1 1 
ATOM   2589 N  N   . PRO A 1 346 ? 6.011   -13.055 27.046  1.00 56.66  ? 345  PRO A N   1 
ATOM   2590 C  CA  . PRO A 1 346 ? 6.001   -11.789 27.752  1.00 55.36  ? 345  PRO A CA  1 
ATOM   2591 C  C   . PRO A 1 346 ? 5.427   -11.911 29.176  1.00 50.87  ? 345  PRO A C   1 
ATOM   2592 O  O   . PRO A 1 346 ? 4.502   -12.670 29.416  1.00 48.22  ? 345  PRO A O   1 
ATOM   2593 C  CB  . PRO A 1 346 ? 5.166   -10.885 26.850  1.00 54.87  ? 345  PRO A CB  1 
ATOM   2594 C  CG  . PRO A 1 346 ? 4.299   -11.807 26.066  1.00 53.69  ? 345  PRO A CG  1 
ATOM   2595 C  CD  . PRO A 1 346 ? 4.952   -13.147 26.030  1.00 54.82  ? 345  PRO A CD  1 
ATOM   2596 N  N   . HIS A 1 347 ? 6.024   -11.164 30.099  1.00 48.99  ? 346  HIS A N   1 
ATOM   2597 C  CA  . HIS A 1 347 ? 5.711   -11.260 31.504  1.00 45.11  ? 346  HIS A CA  1 
ATOM   2598 C  C   . HIS A 1 347 ? 4.547   -10.384 31.777  1.00 47.49  ? 346  HIS A C   1 
ATOM   2599 O  O   . HIS A 1 347 ? 4.636   -9.149  31.657  1.00 50.01  ? 346  HIS A O   1 
ATOM   2600 C  CB  . HIS A 1 347 ? 6.869   -10.791 32.354  1.00 46.20  ? 346  HIS A CB  1 
ATOM   2601 C  CG  . HIS A 1 347 ? 8.121   -11.554 32.110  1.00 46.37  ? 346  HIS A CG  1 
ATOM   2602 N  ND1 . HIS A 1 347 ? 9.367   -11.008 32.299  1.00 46.59  ? 346  HIS A ND1 1 
ATOM   2603 C  CD2 . HIS A 1 347 ? 8.316   -12.819 31.665  1.00 45.19  ? 346  HIS A CD2 1 
ATOM   2604 C  CE1 . HIS A 1 347 ? 10.280  -11.915 32.010  1.00 50.25  ? 346  HIS A CE1 1 
ATOM   2605 N  NE2 . HIS A 1 347 ? 9.666   -13.024 31.622  1.00 50.16  ? 346  HIS A NE2 1 
ATOM   2606 N  N   . GLY A 1 348 ? 3.436   -11.018 32.136  1.00 47.30  ? 347  GLY A N   1 
ATOM   2607 C  CA  . GLY A 1 348 ? 2.195   -10.301 32.357  1.00 40.75  ? 347  GLY A CA  1 
ATOM   2608 C  C   . GLY A 1 348 ? 1.061   -11.214 32.741  1.00 39.47  ? 347  GLY A C   1 
ATOM   2609 O  O   . GLY A 1 348 ? 0.893   -12.296 32.199  1.00 36.91  ? 347  GLY A O   1 
ATOM   2610 N  N   . VAL A 1 349 ? 0.257   -10.745 33.678  1.00 43.23  ? 348  VAL A N   1 
ATOM   2611 C  CA  . VAL A 1 349 ? -0.911  -11.464 34.144  1.00 42.16  ? 348  VAL A CA  1 
ATOM   2612 C  C   . VAL A 1 349 ? -2.068  -10.481 34.250  1.00 39.53  ? 348  VAL A C   1 
ATOM   2613 O  O   . VAL A 1 349 ? -1.892  -9.272  34.329  1.00 38.20  ? 348  VAL A O   1 
ATOM   2614 C  CB  . VAL A 1 349 ? -0.650  -12.093 35.525  1.00 44.62  ? 348  VAL A CB  1 
ATOM   2615 C  CG1 . VAL A 1 349 ? 0.454   -13.136 35.455  1.00 44.33  ? 348  VAL A CG1 1 
ATOM   2616 C  CG2 . VAL A 1 349 ? -0.252  -11.023 36.547  1.00 46.52  ? 348  VAL A CG2 1 
ATOM   2617 N  N   . SER A 1 350 ? -3.263  -11.016 34.244  1.00 42.44  ? 349  SER A N   1 
ATOM   2618 C  CA  . SER A 1 350 ? -4.447  -10.210 34.339  1.00 45.53  ? 349  SER A CA  1 
ATOM   2619 C  C   . SER A 1 350 ? -4.877  -10.192 35.804  1.00 43.87  ? 349  SER A C   1 
ATOM   2620 O  O   . SER A 1 350 ? -4.942  -11.244 36.432  1.00 54.64  ? 349  SER A O   1 
ATOM   2621 C  CB  . SER A 1 350 ? -5.515  -10.859 33.468  1.00 50.23  ? 349  SER A CB  1 
ATOM   2622 O  OG  . SER A 1 350 ? -6.646  -10.023 33.374  1.00 56.65  ? 349  SER A OG  1 
ATOM   2623 N  N   . GLY A 1 351 ? -5.211  -9.037  36.342  1.00 37.71  ? 350  GLY A N   1 
ATOM   2624 C  CA  . GLY A 1 351 ? -5.653  -8.980  37.710  1.00 38.14  ? 350  GLY A CA  1 
ATOM   2625 C  C   . GLY A 1 351 ? -6.326  -7.731  38.245  1.00 38.09  ? 350  GLY A C   1 
ATOM   2626 O  O   . GLY A 1 351 ? -6.753  -7.741  39.393  1.00 40.00  ? 350  GLY A O   1 
ATOM   2627 N  N   . VAL A 1 352 ? -6.503  -6.695  37.435  1.00 38.16  ? 351  VAL A N   1 
ATOM   2628 C  CA  . VAL A 1 352 ? -6.907  -5.391  37.963  1.00 37.94  ? 351  VAL A CA  1 
ATOM   2629 C  C   . VAL A 1 352 ? -8.283  -5.457  38.602  1.00 39.26  ? 351  VAL A C   1 
ATOM   2630 O  O   . VAL A 1 352 ? -8.532  -4.799  39.606  1.00 45.39  ? 351  VAL A O   1 
ATOM   2631 C  CB  . VAL A 1 352 ? -6.879  -4.292  36.881  1.00 35.88  ? 351  VAL A CB  1 
ATOM   2632 C  CG1 . VAL A 1 352 ? -8.031  -4.456  35.904  1.00 36.06  ? 351  VAL A CG1 1 
ATOM   2633 C  CG2 . VAL A 1 352 ? -6.932  -2.928  37.510  1.00 35.18  ? 351  VAL A CG2 1 
ATOM   2634 N  N   . GLN A 1 353 ? -9.165  -6.265  38.020  1.00 40.92  ? 352  GLN A N   1 
ATOM   2635 C  CA  . GLN A 1 353 ? -10.542 -6.403  38.490  1.00 40.94  ? 352  GLN A CA  1 
ATOM   2636 C  C   . GLN A 1 353 ? -10.677 -7.408  39.634  1.00 44.73  ? 352  GLN A C   1 
ATOM   2637 O  O   . GLN A 1 353 ? -11.583 -7.266  40.443  1.00 49.88  ? 352  GLN A O   1 
ATOM   2638 C  CB  . GLN A 1 353 ? -11.395 -6.874  37.341  1.00 40.20  ? 352  GLN A CB  1 
ATOM   2639 C  CG  . GLN A 1 353 ? -12.878 -6.677  37.534  1.00 38.20  ? 352  GLN A CG  1 
ATOM   2640 C  CD  . GLN A 1 353 ? -13.676 -7.383  36.460  1.00 37.89  ? 352  GLN A CD  1 
ATOM   2641 O  OE1 . GLN A 1 353 ? -13.168 -7.706  35.372  1.00 39.59  ? 352  GLN A OE1 1 
ATOM   2642 N  NE2 . GLN A 1 353 ? -14.932 -7.594  36.742  1.00 35.72  ? 352  GLN A NE2 1 
ATOM   2643 N  N   . ASP A 1 354 ? -9.786  -8.394  39.725  1.00 44.75  ? 353  ASP A N   1 
ATOM   2644 C  CA  . ASP A 1 354 ? -9.933  -9.451  40.744  1.00 43.23  ? 353  ASP A CA  1 
ATOM   2645 C  C   . ASP A 1 354 ? -9.357  -9.073  42.074  1.00 36.73  ? 353  ASP A C   1 
ATOM   2646 O  O   . ASP A 1 354 ? -9.619  -9.756  43.059  1.00 39.13  ? 353  ASP A O   1 
ATOM   2647 C  CB  . ASP A 1 354 ? -9.211  -10.749 40.334  1.00 43.76  ? 353  ASP A CB  1 
ATOM   2648 C  CG  . ASP A 1 354 ? -9.352  -11.061 38.892  1.00 41.70  ? 353  ASP A CG  1 
ATOM   2649 O  OD1 . ASP A 1 354 ? -10.474 -11.436 38.496  1.00 42.60  ? 353  ASP A OD1 1 
ATOM   2650 O  OD2 . ASP A 1 354 ? -8.341  -10.997 38.166  1.00 41.00  ? 353  ASP A OD2 1 
ATOM   2651 N  N   . ARG A 1 355 ? -8.503  -8.066  42.097  1.00 31.73  ? 354  ARG A N   1 
ATOM   2652 C  CA  . ARG A 1 355 ? -7.630  -7.864  43.261  1.00 32.87  ? 354  ARG A CA  1 
ATOM   2653 C  C   . ARG A 1 355 ? -8.419  -7.777  44.535  1.00 33.11  ? 354  ARG A C   1 
ATOM   2654 O  O   . ARG A 1 355 ? -8.096  -8.449  45.517  1.00 38.99  ? 354  ARG A O   1 
ATOM   2655 C  CB  . ARG A 1 355 ? -6.790  -6.595  43.126  1.00 32.26  ? 354  ARG A CB  1 
ATOM   2656 C  CG  . ARG A 1 355 ? -5.882  -6.305  44.299  1.00 31.19  ? 354  ARG A CG  1 
ATOM   2657 C  CD  . ARG A 1 355 ? -5.017  -5.086  44.020  1.00 31.09  ? 354  ARG A CD  1 
ATOM   2658 N  NE  . ARG A 1 355 ? -5.821  -3.877  43.838  1.00 30.95  ? 354  ARG A NE  1 
ATOM   2659 C  CZ  . ARG A 1 355 ? -5.894  -2.861  44.711  1.00 31.44  ? 354  ARG A CZ  1 
ATOM   2660 N  NH1 . ARG A 1 355 ? -5.201  -2.869  45.853  1.00 29.74  ? 354  ARG A NH1 1 
ATOM   2661 N  NH2 . ARG A 1 355 ? -6.681  -1.813  44.430  1.00 32.94  ? 354  ARG A NH2 1 
ATOM   2662 N  N   . MET A 1 356 ? -9.452  -6.944  44.525  1.00 34.46  ? 355  MET A N   1 
ATOM   2663 C  CA  . MET A 1 356 ? -10.164 -6.633  45.746  1.00 35.37  ? 355  MET A CA  1 
ATOM   2664 C  C   . MET A 1 356 ? -10.892 -7.850  46.250  1.00 33.88  ? 355  MET A C   1 
ATOM   2665 O  O   . MET A 1 356 ? -10.743 -8.208  47.417  1.00 33.17  ? 355  MET A O   1 
ATOM   2666 C  CB  . MET A 1 356 ? -11.119 -5.487  45.525  1.00 36.72  ? 355  MET A CB  1 
ATOM   2667 C  CG  . MET A 1 356 ? -10.418 -4.174  45.230  1.00 37.69  ? 355  MET A CG  1 
ATOM   2668 S  SD  . MET A 1 356 ? -9.652  -3.454  46.685  0.95 34.04  ? 355  MET A SD  1 
ATOM   2669 C  CE  . MET A 1 356 ? -11.074 -2.724  47.460  1.00 37.23  ? 355  MET A CE  1 
ATOM   2670 N  N   . SER A 1 357 ? -11.612 -8.521  45.354  1.00 32.33  ? 356  SER A N   1 
ATOM   2671 C  CA  . SER A 1 357 ? -12.363 -9.726  45.720  1.00 31.90  ? 356  SER A CA  1 
ATOM   2672 C  C   . SER A 1 357 ? -11.461 -10.911 46.106  1.00 32.56  ? 356  SER A C   1 
ATOM   2673 O  O   . SER A 1 357 ? -11.683 -11.555 47.147  1.00 37.55  ? 356  SER A O   1 
ATOM   2674 C  CB  . SER A 1 357 ? -13.309 -10.149 44.596  1.00 31.66  ? 356  SER A CB  1 
ATOM   2675 O  OG  . SER A 1 357 ? -14.430 -9.266  44.515  1.00 31.37  ? 356  SER A OG  1 
ATOM   2676 N  N   . VAL A 1 358 ? -10.446 -11.198 45.297  1.00 29.23  ? 357  VAL A N   1 
ATOM   2677 C  CA  . VAL A 1 358 ? -9.557  -12.313 45.591  1.00 28.50  ? 357  VAL A CA  1 
ATOM   2678 C  C   . VAL A 1 358 ? -8.868  -12.110 46.943  1.00 29.65  ? 357  VAL A C   1 
ATOM   2679 O  O   . VAL A 1 358 ? -8.791  -13.029 47.754  1.00 27.84  ? 357  VAL A O   1 
ATOM   2680 C  CB  . VAL A 1 358 ? -8.500  -12.492 44.499  1.00 29.03  ? 357  VAL A CB  1 
ATOM   2681 C  CG1 . VAL A 1 358 ? -7.483  -13.572 44.901  1.00 29.96  ? 357  VAL A CG1 1 
ATOM   2682 C  CG2 . VAL A 1 358 ? -9.158  -12.856 43.183  1.00 27.59  ? 357  VAL A CG2 1 
ATOM   2683 N  N   . ILE A 1 359 ? -8.365  -10.898 47.182  1.00 32.55  ? 358  ILE A N   1 
ATOM   2684 C  CA  . ILE A 1 359 ? -7.712  -10.583 48.447  1.00 34.00  ? 358  ILE A CA  1 
ATOM   2685 C  C   . ILE A 1 359 ? -8.681  -10.710 49.630  1.00 34.79  ? 358  ILE A C   1 
ATOM   2686 O  O   . ILE A 1 359 ? -8.293  -11.180 50.728  1.00 31.99  ? 358  ILE A O   1 
ATOM   2687 C  CB  . ILE A 1 359 ? -7.014  -9.199  48.413  1.00 34.63  ? 358  ILE A CB  1 
ATOM   2688 C  CG1 . ILE A 1 359 ? -5.705  -9.273  47.638  1.00 37.73  ? 358  ILE A CG1 1 
ATOM   2689 C  CG2 . ILE A 1 359 ? -6.621  -8.745  49.807  1.00 36.74  ? 358  ILE A CG2 1 
ATOM   2690 C  CD1 . ILE A 1 359 ? -4.690  -10.244 48.257  1.00 42.73  ? 358  ILE A CD1 1 
ATOM   2691 N  N   . TRP A 1 360 ? -9.943  -10.313 49.422  1.00 36.01  ? 359  TRP A N   1 
ATOM   2692 C  CA  . TRP A 1 360 ? -10.938 -10.364 50.518  1.00 33.72  ? 359  TRP A CA  1 
ATOM   2693 C  C   . TRP A 1 360 ? -11.171 -11.818 50.939  1.00 32.83  ? 359  TRP A C   1 
ATOM   2694 O  O   . TRP A 1 360 ? -11.199 -12.181 52.127  1.00 26.97  ? 359  TRP A O   1 
ATOM   2695 C  CB  . TRP A 1 360 ? -12.239 -9.709  50.102  1.00 30.80  ? 359  TRP A CB  1 
ATOM   2696 C  CG  . TRP A 1 360 ? -13.273 -9.722  51.214  1.00 32.55  ? 359  TRP A CG  1 
ATOM   2697 C  CD1 . TRP A 1 360 ? -14.203 -10.689 51.442  1.00 32.79  ? 359  TRP A CD1 1 
ATOM   2698 C  CD2 . TRP A 1 360 ? -13.476 -8.730  52.256  1.00 31.61  ? 359  TRP A CD2 1 
ATOM   2699 N  NE1 . TRP A 1 360 ? -14.972 -10.361 52.529  1.00 30.77  ? 359  TRP A NE1 1 
ATOM   2700 C  CE2 . TRP A 1 360 ? -14.544 -9.169  53.042  1.00 30.53  ? 359  TRP A CE2 1 
ATOM   2701 C  CE3 . TRP A 1 360 ? -12.854 -7.519  52.589  1.00 30.31  ? 359  TRP A CE3 1 
ATOM   2702 C  CZ2 . TRP A 1 360 ? -14.998 -8.452  54.128  1.00 30.23  ? 359  TRP A CZ2 1 
ATOM   2703 C  CZ3 . TRP A 1 360 ? -13.316 -6.817  53.654  1.00 28.24  ? 359  TRP A CZ3 1 
ATOM   2704 C  CH2 . TRP A 1 360 ? -14.371 -7.279  54.413  1.00 29.18  ? 359  TRP A CH2 1 
ATOM   2705 N  N   . GLU A 1 361 ? -11.257 -12.649 49.916  1.00 33.23  ? 360  GLU A N   1 
ATOM   2706 C  CA  . GLU A 1 361 ? -11.482 -14.054 50.102  1.00 36.61  ? 360  GLU A CA  1 
ATOM   2707 C  C   . GLU A 1 361 ? -10.364 -14.762 50.825  1.00 35.53  ? 360  GLU A C   1 
ATOM   2708 O  O   . GLU A 1 361 ? -10.582 -15.360 51.868  1.00 36.91  ? 360  GLU A O   1 
ATOM   2709 C  CB  . GLU A 1 361 ? -11.690 -14.701 48.736  1.00 40.71  ? 360  GLU A CB  1 
ATOM   2710 C  CG  . GLU A 1 361 ? -12.031 -16.175 48.788  1.00 42.59  ? 360  GLU A CG  1 
ATOM   2711 C  CD  . GLU A 1 361 ? -13.272 -16.433 49.600  1.00 44.55  ? 360  GLU A CD  1 
ATOM   2712 O  OE1 . GLU A 1 361 ? -14.112 -15.518 49.652  1.00 41.15  ? 360  GLU A OE1 1 
ATOM   2713 O  OE2 . GLU A 1 361 ? -13.408 -17.551 50.163  1.00 51.03  ? 360  GLU A OE2 1 
ATOM   2714 N  N   . ARG A 1 362 ? -9.159  -14.716 50.267  1.00 35.91  ? 361  ARG A N   1 
ATOM   2715 C  CA  . ARG A 1 362 ? -8.030  -15.411 50.878  1.00 35.06  ? 361  ARG A CA  1 
ATOM   2716 C  C   . ARG A 1 362 ? -7.521  -14.725 52.150  1.00 33.01  ? 361  ARG A C   1 
ATOM   2717 O  O   . ARG A 1 362 ? -7.170  -15.394 53.107  1.00 30.11  ? 361  ARG A O   1 
ATOM   2718 C  CB  . ARG A 1 362 ? -6.933  -15.559 49.874  1.00 38.16  ? 361  ARG A CB  1 
ATOM   2719 C  CG  . ARG A 1 362 ? -7.321  -16.486 48.763  1.00 42.89  ? 361  ARG A CG  1 
ATOM   2720 C  CD  . ARG A 1 362 ? -7.538  -17.899 49.295  1.00 54.84  ? 361  ARG A CD  1 
ATOM   2721 N  NE  . ARG A 1 362 ? -7.853  -18.810 48.185  1.00 67.70  ? 361  ARG A NE  1 
ATOM   2722 C  CZ  . ARG A 1 362 ? -7.130  -19.870 47.847  1.00 72.92  ? 361  ARG A CZ  1 
ATOM   2723 N  NH1 . ARG A 1 362 ? -6.075  -20.230 48.572  1.00 74.21  ? 361  ARG A NH1 1 
ATOM   2724 N  NH2 . ARG A 1 362 ? -7.471  -20.590 46.784  1.00 76.39  ? 361  ARG A NH2 1 
ATOM   2725 N  N   . GLY A 1 363 ? -7.531  -13.396 52.166  1.00 31.56  ? 362  GLY A N   1 
ATOM   2726 C  CA  . GLY A 1 363 ? -7.078  -12.640 53.321  1.00 31.87  ? 362  GLY A CA  1 
ATOM   2727 C  C   . GLY A 1 363 ? -8.072  -12.512 54.469  1.00 34.62  ? 362  GLY A C   1 
ATOM   2728 O  O   . GLY A 1 363 ? -7.718  -12.747 55.630  1.00 34.47  ? 362  GLY A O   1 
ATOM   2729 N  N   . VAL A 1 364 ? -9.307  -12.104 54.163  1.00 36.42  ? 363  VAL A N   1 
ATOM   2730 C  CA  . VAL A 1 364 ? -10.260 -11.753 55.217  1.00 36.24  ? 363  VAL A CA  1 
ATOM   2731 C  C   . VAL A 1 364 ? -11.128 -12.951 55.570  1.00 36.92  ? 363  VAL A C   1 
ATOM   2732 O  O   . VAL A 1 364 ? -11.144 -13.397 56.710  1.00 41.39  ? 363  VAL A O   1 
ATOM   2733 C  CB  . VAL A 1 364 ? -11.136 -10.536 54.851  1.00 37.02  ? 363  VAL A CB  1 
ATOM   2734 C  CG1 . VAL A 1 364 ? -12.208 -10.329 55.907  1.00 36.71  ? 363  VAL A CG1 1 
ATOM   2735 C  CG2 . VAL A 1 364 ? -10.280 -9.273  54.711  1.00 36.73  ? 363  VAL A CG2 1 
ATOM   2736 N  N   . VAL A 1 365 ? -11.832 -13.484 54.588  1.00 37.92  ? 364  VAL A N   1 
ATOM   2737 C  CA  . VAL A 1 365 ? -12.650 -14.679 54.794  1.00 36.14  ? 364  VAL A CA  1 
ATOM   2738 C  C   . VAL A 1 365 ? -11.770 -15.790 55.331  1.00 36.75  ? 364  VAL A C   1 
ATOM   2739 O  O   . VAL A 1 365 ? -12.138 -16.474 56.265  1.00 38.30  ? 364  VAL A O   1 
ATOM   2740 C  CB  . VAL A 1 365 ? -13.320 -15.157 53.469  1.00 34.65  ? 364  VAL A CB  1 
ATOM   2741 C  CG1 . VAL A 1 365 ? -13.804 -16.578 53.610  1.00 35.21  ? 364  VAL A CG1 1 
ATOM   2742 C  CG2 . VAL A 1 365 ? -14.445 -14.230 53.044  1.00 32.13  ? 364  VAL A CG2 1 
ATOM   2743 N  N   . GLY A 1 366 ? -10.599 -15.970 54.720  1.00 38.38  ? 365  GLY A N   1 
ATOM   2744 C  CA  . GLY A 1 366 ? -9.634  -16.998 55.151  1.00 33.99  ? 365  GLY A CA  1 
ATOM   2745 C  C   . GLY A 1 366 ? -9.006  -16.793 56.529  1.00 32.40  ? 365  GLY A C   1 
ATOM   2746 O  O   . GLY A 1 366 ? -8.232  -17.615 56.957  1.00 28.26  ? 365  GLY A O   1 
ATOM   2747 N  N   . GLY A 1 367 ? -9.295  -15.679 57.202  1.00 35.41  ? 366  GLY A N   1 
ATOM   2748 C  CA  . GLY A 1 367 ? -8.903  -15.487 58.608  1.00 41.50  ? 366  GLY A CA  1 
ATOM   2749 C  C   . GLY A 1 367 ? -7.488  -14.964 58.876  1.00 47.82  ? 366  GLY A C   1 
ATOM   2750 O  O   . GLY A 1 367 ? -7.048  -14.864 60.036  1.00 54.71  ? 366  GLY A O   1 
ATOM   2751 N  N   . LYS A 1 368 ? -6.775  -14.586 57.817  1.00 47.90  ? 367  LYS A N   1 
ATOM   2752 C  CA  . LYS A 1 368 ? -5.391  -14.146 57.925  1.00 41.85  ? 367  LYS A CA  1 
ATOM   2753 C  C   . LYS A 1 368 ? -5.317  -12.702 58.383  1.00 39.21  ? 367  LYS A C   1 
ATOM   2754 O  O   . LYS A 1 368 ? -4.339  -12.317 59.021  1.00 35.64  ? 367  LYS A O   1 
ATOM   2755 C  CB  . LYS A 1 368 ? -4.685  -14.301 56.579  1.00 43.58  ? 367  LYS A CB  1 
ATOM   2756 C  CG  . LYS A 1 368 ? -4.667  -15.716 56.027  1.00 48.25  ? 367  LYS A CG  1 
ATOM   2757 C  CD  . LYS A 1 368 ? -3.432  -16.495 56.479  1.00 55.73  ? 367  LYS A CD  1 
ATOM   2758 C  CE  . LYS A 1 368 ? -3.428  -17.922 55.935  1.00 60.40  ? 367  LYS A CE  1 
ATOM   2759 N  NZ  . LYS A 1 368 ? -4.466  -18.802 56.575  1.00 59.40  ? 367  LYS A NZ  1 
ATOM   2760 N  N   . MET A 1 369 ? -6.322  -11.896 58.028  1.00 37.22  ? 368  MET A N   1 
ATOM   2761 C  CA  . MET A 1 369 ? -6.344  -10.481 58.419  1.00 38.27  ? 368  MET A CA  1 
ATOM   2762 C  C   . MET A 1 369 ? -7.775  -10.006 58.551  1.00 37.40  ? 368  MET A C   1 
ATOM   2763 O  O   . MET A 1 369 ? -8.676  -10.570 57.911  1.00 40.27  ? 368  MET A O   1 
ATOM   2764 C  CB  . MET A 1 369 ? -5.639  -9.647  57.362  1.00 40.61  ? 368  MET A CB  1 
ATOM   2765 C  CG  . MET A 1 369 ? -6.378  -9.589  56.032  1.00 42.06  ? 368  MET A CG  1 
ATOM   2766 S  SD  . MET A 1 369 ? -5.559  -8.521  54.827  1.00 44.98  ? 368  MET A SD  1 
ATOM   2767 C  CE  . MET A 1 369 ? -4.391  -9.689  54.139  1.00 45.27  ? 368  MET A CE  1 
ATOM   2768 N  N   . ASP A 1 370 ? -8.001  -8.975  59.367  1.00 36.66  ? 369  ASP A N   1 
ATOM   2769 C  CA  . ASP A 1 370 ? -9.358  -8.403  59.506  1.00 37.54  ? 369  ASP A CA  1 
ATOM   2770 C  C   . ASP A 1 370 ? -9.668  -7.417  58.402  1.00 36.11  ? 369  ASP A C   1 
ATOM   2771 O  O   . ASP A 1 370 ? -8.816  -7.042  57.634  1.00 39.20  ? 369  ASP A O   1 
ATOM   2772 C  CB  . ASP A 1 370 ? -9.649  -7.790  60.906  1.00 38.24  ? 369  ASP A CB  1 
ATOM   2773 C  CG  . ASP A 1 370 ? -8.735  -6.652  61.274  1.00 41.72  ? 369  ASP A CG  1 
ATOM   2774 O  OD1 . ASP A 1 370 ? -7.937  -6.247  60.436  1.00 54.94  ? 369  ASP A OD1 1 
ATOM   2775 O  OD2 . ASP A 1 370 ? -8.805  -6.122  62.395  1.00 41.88  ? 369  ASP A OD2 1 
ATOM   2776 N  N   . GLU A 1 371 ? -10.931 -7.055  58.299  1.00 40.90  ? 370  GLU A N   1 
ATOM   2777 C  CA  . GLU A 1 371 ? -11.444 -6.075  57.323  1.00 38.89  ? 370  GLU A CA  1 
ATOM   2778 C  C   . GLU A 1 371 ? -10.710 -4.757  57.319  1.00 38.07  ? 370  GLU A C   1 
ATOM   2779 O  O   . GLU A 1 371 ? -10.781 -4.047  56.347  1.00 39.86  ? 370  GLU A O   1 
ATOM   2780 C  CB  . GLU A 1 371 ? -12.881 -5.736  57.683  1.00 40.75  ? 370  GLU A CB  1 
ATOM   2781 C  CG  . GLU A 1 371 ? -12.954 -5.028  59.030  1.00 43.41  ? 370  GLU A CG  1 
ATOM   2782 C  CD  . GLU A 1 371 ? -14.347 -4.849  59.532  1.00 44.07  ? 370  GLU A CD  1 
ATOM   2783 O  OE1 . GLU A 1 371 ? -15.293 -5.093  58.800  1.00 49.28  ? 370  GLU A OE1 1 
ATOM   2784 O  OE2 . GLU A 1 371 ? -14.509 -4.451  60.675  1.00 49.35  ? 370  GLU A OE2 1 
ATOM   2785 N  N   . ASN A 1 372 ? -10.069 -4.398  58.428  1.00 38.42  ? 371  ASN A N   1 
ATOM   2786 C  CA  . ASN A 1 372 ? -9.425  -3.096  58.547  1.00 41.47  ? 371  ASN A CA  1 
ATOM   2787 C  C   . ASN A 1 372 ? -7.994  -3.119  57.969  1.00 41.24  ? 371  ASN A C   1 
ATOM   2788 O  O   . ASN A 1 372 ? -7.530  -2.186  57.338  1.00 39.76  ? 371  ASN A O   1 
ATOM   2789 C  CB  . ASN A 1 372 ? -9.376  -2.659  60.010  1.00 42.82  ? 371  ASN A CB  1 
ATOM   2790 C  CG  . ASN A 1 372 ? -10.741 -2.566  60.645  1.00 42.58  ? 371  ASN A CG  1 
ATOM   2791 O  OD1 . ASN A 1 372 ? -11.052 -3.324  61.543  1.00 50.89  ? 371  ASN A OD1 1 
ATOM   2792 N  ND2 . ASN A 1 372 ? -11.562 -1.646  60.188  1.00 44.26  ? 371  ASN A ND2 1 
ATOM   2793 N  N   . ARG A 1 373 ? -7.309  -4.215  58.204  1.00 41.57  ? 372  ARG A N   1 
ATOM   2794 C  CA  . ARG A 1 373 ? -6.059  -4.498  57.523  1.00 41.61  ? 372  ARG A CA  1 
ATOM   2795 C  C   . ARG A 1 373 ? -6.242  -4.644  55.997  1.00 38.71  ? 372  ARG A C   1 
ATOM   2796 O  O   . ARG A 1 373 ? -5.353  -4.265  55.220  1.00 34.01  ? 372  ARG A O   1 
ATOM   2797 C  CB  . ARG A 1 373 ? -5.466  -5.794  58.060  1.00 40.29  ? 372  ARG A CB  1 
ATOM   2798 C  CG  . ARG A 1 373 ? -4.106  -6.103  57.508  1.00 40.26  ? 372  ARG A CG  1 
ATOM   2799 C  CD  . ARG A 1 373 ? -3.113  -4.989  57.815  1.00 41.00  ? 372  ARG A CD  1 
ATOM   2800 N  NE  . ARG A 1 373 ? -1.886  -5.199  57.060  1.00 40.39  ? 372  ARG A NE  1 
ATOM   2801 C  CZ  . ARG A 1 373 ? -0.914  -4.312  56.938  1.00 39.31  ? 372  ARG A CZ  1 
ATOM   2802 N  NH1 . ARG A 1 373 ? -0.966  -3.132  57.535  1.00 37.99  ? 372  ARG A NH1 1 
ATOM   2803 N  NH2 . ARG A 1 373 ? 0.129   -4.624  56.210  1.00 40.57  ? 372  ARG A NH2 1 
ATOM   2804 N  N   . PHE A 1 374 ? -7.393  -5.196  55.600  1.00 34.13  ? 373  PHE A N   1 
ATOM   2805 C  CA  . PHE A 1 374 ? -7.758  -5.300  54.195  1.00 33.66  ? 373  PHE A CA  1 
ATOM   2806 C  C   . PHE A 1 374 ? -7.815  -3.920  53.507  1.00 36.90  ? 373  PHE A C   1 
ATOM   2807 O  O   . PHE A 1 374 ? -7.344  -3.756  52.393  1.00 40.35  ? 373  PHE A O   1 
ATOM   2808 C  CB  . PHE A 1 374 ? -9.091  -6.002  54.033  1.00 30.27  ? 373  PHE A CB  1 
ATOM   2809 C  CG  . PHE A 1 374 ? -9.647  -5.908  52.645  1.00 29.55  ? 373  PHE A CG  1 
ATOM   2810 C  CD1 . PHE A 1 374 ? -10.472 -4.836  52.275  1.00 28.80  ? 373  PHE A CD1 1 
ATOM   2811 C  CD2 . PHE A 1 374 ? -9.338  -6.868  51.694  1.00 28.63  ? 373  PHE A CD2 1 
ATOM   2812 C  CE1 . PHE A 1 374 ? -10.986 -4.736  50.998  1.00 27.91  ? 373  PHE A CE1 1 
ATOM   2813 C  CE2 . PHE A 1 374 ? -9.852  -6.780  50.413  1.00 28.09  ? 373  PHE A CE2 1 
ATOM   2814 C  CZ  . PHE A 1 374 ? -10.667 -5.713  50.064  1.00 29.48  ? 373  PHE A CZ  1 
ATOM   2815 N  N   . VAL A 1 375 ? -8.386  -2.926  54.180  1.00 36.94  ? 374  VAL A N   1 
ATOM   2816 C  CA  . VAL A 1 375 ? -8.348  -1.560  53.686  1.00 33.59  ? 374  VAL A CA  1 
ATOM   2817 C  C   . VAL A 1 375 ? -6.893  -1.103  53.658  1.00 34.50  ? 374  VAL A C   1 
ATOM   2818 O  O   . VAL A 1 375 ? -6.451  -0.484  52.682  1.00 36.97  ? 374  VAL A O   1 
ATOM   2819 C  CB  . VAL A 1 375 ? -9.210  -0.614  54.541  1.00 33.46  ? 374  VAL A CB  1 
ATOM   2820 C  CG1 . VAL A 1 375 ? -9.025  0.845   54.144  1.00 33.13  ? 374  VAL A CG1 1 
ATOM   2821 C  CG2 . VAL A 1 375 ? -10.677 -0.985  54.387  1.00 35.24  ? 374  VAL A CG2 1 
ATOM   2822 N  N   . ALA A 1 376 ? -6.148  -1.406  54.719  1.00 32.80  ? 375  ALA A N   1 
ATOM   2823 C  CA  . ALA A 1 376 ? -4.762  -0.969  54.821  1.00 32.49  ? 375  ALA A CA  1 
ATOM   2824 C  C   . ALA A 1 376 ? -3.996  -1.380  53.575  1.00 33.65  ? 375  ALA A C   1 
ATOM   2825 O  O   . ALA A 1 376 ? -3.357  -0.533  52.913  1.00 40.35  ? 375  ALA A O   1 
ATOM   2826 C  CB  . ALA A 1 376 ? -4.088  -1.532  56.062  1.00 31.03  ? 375  ALA A CB  1 
ATOM   2827 N  N   . VAL A 1 377 ? -4.073  -2.663  53.245  1.00 30.59  ? 376  VAL A N   1 
ATOM   2828 C  CA  . VAL A 1 377 ? -3.228  -3.216  52.214  1.00 30.32  ? 376  VAL A CA  1 
ATOM   2829 C  C   . VAL A 1 377 ? -3.756  -2.975  50.826  1.00 30.08  ? 376  VAL A C   1 
ATOM   2830 O  O   . VAL A 1 377 ? -2.980  -3.007  49.880  1.00 32.10  ? 376  VAL A O   1 
ATOM   2831 C  CB  . VAL A 1 377 ? -3.000  -4.720  52.391  1.00 34.33  ? 376  VAL A CB  1 
ATOM   2832 C  CG1 . VAL A 1 377 ? -2.413  -4.996  53.785  1.00 36.44  ? 376  VAL A CG1 1 
ATOM   2833 C  CG2 . VAL A 1 377 ? -4.283  -5.521  52.133  1.00 33.88  ? 376  VAL A CG2 1 
ATOM   2834 N  N   . THR A 1 378 ? -5.051  -2.690  50.689  1.00 30.64  ? 377  THR A N   1 
ATOM   2835 C  CA  . THR A 1 378 ? -5.641  -2.381  49.366  1.00 29.25  ? 377  THR A CA  1 
ATOM   2836 C  C   . THR A 1 378 ? -5.799  -0.871  49.027  1.00 30.62  ? 377  THR A C   1 
ATOM   2837 O  O   . THR A 1 378 ? -5.833  -0.539  47.850  1.00 28.00  ? 377  THR A O   1 
ATOM   2838 C  CB  . THR A 1 378 ? -6.973  -3.059  49.181  1.00 29.00  ? 377  THR A CB  1 
ATOM   2839 O  OG1 . THR A 1 378 ? -7.834  -2.684  50.252  1.00 32.55  ? 377  THR A OG1 1 
ATOM   2840 C  CG2 . THR A 1 378 ? -6.818  -4.542  49.220  1.00 31.41  ? 377  THR A CG2 1 
ATOM   2841 N  N   . SER A 1 379 ? -5.837  0.038   50.024  1.00 30.11  ? 378  SER A N   1 
ATOM   2842 C  CA  . SER A 1 379 ? -5.831  1.467   49.732  1.00 30.13  ? 378  SER A CA  1 
ATOM   2843 C  C   . SER A 1 379 ? -4.975  2.348   50.638  1.00 33.36  ? 378  SER A C   1 
ATOM   2844 O  O   . SER A 1 379 ? -4.287  3.242   50.149  1.00 37.11  ? 378  SER A O   1 
ATOM   2845 C  CB  . SER A 1 379 ? -7.239  2.024   49.758  1.00 31.56  ? 378  SER A CB  1 
ATOM   2846 O  OG  . SER A 1 379 ? -7.700  2.202   51.084  1.00 32.82  ? 378  SER A OG  1 
ATOM   2847 N  N   . SER A 1 380 ? -5.065  2.188   51.949  1.00 33.91  ? 379  SER A N   1 
ATOM   2848 C  CA  . SER A 1 380 ? -4.512  3.194   52.884  1.00 32.20  ? 379  SER A CA  1 
ATOM   2849 C  C   . SER A 1 380 ? -3.047  3.357   52.842  1.00 29.96  ? 379  SER A C   1 
ATOM   2850 O  O   . SER A 1 380 ? -2.542  4.473   52.829  1.00 30.26  ? 379  SER A O   1 
ATOM   2851 C  CB  . SER A 1 380 ? -4.830  2.831   54.312  1.00 34.45  ? 379  SER A CB  1 
ATOM   2852 O  OG  . SER A 1 380 ? -6.128  3.264   54.619  1.00 38.50  ? 379  SER A OG  1 
ATOM   2853 N  N   . ASN A 1 381 ? -2.340  2.248   52.894  1.00 29.92  ? 380  ASN A N   1 
ATOM   2854 C  CA  . ASN A 1 381 ? -0.889  2.343   52.918  1.00 31.31  ? 380  ASN A CA  1 
ATOM   2855 C  C   . ASN A 1 381 ? -0.428  2.956   51.615  1.00 30.88  ? 380  ASN A C   1 
ATOM   2856 O  O   . ASN A 1 381 ? 0.428   3.785   51.601  1.00 30.69  ? 380  ASN A O   1 
ATOM   2857 C  CB  . ASN A 1 381 ? -0.250  0.968   53.137  1.00 31.47  ? 380  ASN A CB  1 
ATOM   2858 C  CG  . ASN A 1 381 ? -0.360  0.501   54.581  1.00 28.73  ? 380  ASN A CG  1 
ATOM   2859 O  OD1 . ASN A 1 381 ? -0.743  1.280   55.462  1.00 26.56  ? 380  ASN A OD1 1 
ATOM   2860 N  ND2 . ASN A 1 381 ? -0.058  -0.780  54.823  1.00 26.31  ? 380  ASN A ND2 1 
ATOM   2861 N  N   . ALA A 1 382 ? -1.064  2.562   50.522  1.00 32.55  ? 381  ALA A N   1 
ATOM   2862 C  CA  . ALA A 1 382 ? -0.793  3.137   49.211  1.00 30.04  ? 381  ALA A CA  1 
ATOM   2863 C  C   . ALA A 1 382 ? -0.905  4.621   49.259  1.00 31.57  ? 381  ALA A C   1 
ATOM   2864 O  O   . ALA A 1 382 ? -0.013  5.333   48.831  1.00 36.33  ? 381  ALA A O   1 
ATOM   2865 C  CB  . ALA A 1 382 ? -1.788  2.620   48.189  1.00 29.31  ? 381  ALA A CB  1 
ATOM   2866 N  N   . ALA A 1 383 ? -2.038  5.083   49.756  1.00 32.81  ? 382  ALA A N   1 
ATOM   2867 C  CA  . ALA A 1 383 ? -2.309  6.499   49.861  1.00 35.27  ? 382  ALA A CA  1 
ATOM   2868 C  C   . ALA A 1 383 ? -1.269  7.246   50.701  1.00 34.24  ? 382  ALA A C   1 
ATOM   2869 O  O   . ALA A 1 383 ? -0.888  8.370   50.367  1.00 33.12  ? 382  ALA A O   1 
ATOM   2870 C  CB  . ALA A 1 383 ? -3.684  6.711   50.434  1.00 34.85  ? 382  ALA A CB  1 
ATOM   2871 N  N   . LYS A 1 384 ? -0.831  6.623   51.784  1.00 33.29  ? 383  LYS A N   1 
ATOM   2872 C  CA  . LYS A 1 384 ? 0.166   7.238   52.662  1.00 35.67  ? 383  LYS A CA  1 
ATOM   2873 C  C   . LYS A 1 384 ? 1.531   7.444   51.975  1.00 35.08  ? 383  LYS A C   1 
ATOM   2874 O  O   . LYS A 1 384 ? 2.234   8.447   52.161  1.00 32.65  ? 383  LYS A O   1 
ATOM   2875 C  CB  . LYS A 1 384 ? 0.367   6.361   53.909  1.00 36.32  ? 383  LYS A CB  1 
ATOM   2876 C  CG  . LYS A 1 384 ? -0.607  6.637   55.034  1.00 36.70  ? 383  LYS A CG  1 
ATOM   2877 C  CD  . LYS A 1 384 ? -0.715  5.460   55.983  1.00 35.98  ? 383  LYS A CD  1 
ATOM   2878 C  CE  . LYS A 1 384 ? -1.448  5.866   57.229  1.00 36.60  ? 383  LYS A CE  1 
ATOM   2879 N  NZ  . LYS A 1 384 ? -2.394  4.823   57.668  1.00 38.03  ? 383  LYS A NZ  1 
ATOM   2880 N  N   . LEU A 1 385 ? 1.879   6.450   51.182  1.00 37.32  ? 384  LEU A N   1 
ATOM   2881 C  CA  . LEU A 1 385 ? 3.156   6.353   50.515  1.00 38.10  ? 384  LEU A CA  1 
ATOM   2882 C  C   . LEU A 1 385 ? 3.209   7.243   49.254  1.00 37.54  ? 384  LEU A C   1 
ATOM   2883 O  O   . LEU A 1 385 ? 4.227   7.839   48.957  1.00 34.12  ? 384  LEU A O   1 
ATOM   2884 C  CB  . LEU A 1 385 ? 3.278   4.922   50.078  1.00 42.32  ? 384  LEU A CB  1 
ATOM   2885 C  CG  . LEU A 1 385 ? 4.649   4.411   49.756  1.00 51.00  ? 384  LEU A CG  1 
ATOM   2886 C  CD1 . LEU A 1 385 ? 5.102   3.532   50.908  1.00 52.37  ? 384  LEU A CD1 1 
ATOM   2887 C  CD2 . LEU A 1 385 ? 4.563   3.627   48.442  1.00 55.94  ? 384  LEU A CD2 1 
ATOM   2888 N  N   . LEU A 1 386 ? 2.089   7.305   48.523  1.00 36.80  ? 385  LEU A N   1 
ATOM   2889 C  CA  . LEU A 1 386 ? 1.923   8.182   47.369  1.00 33.03  ? 385  LEU A CA  1 
ATOM   2890 C  C   . LEU A 1 386 ? 1.775   9.648   47.783  1.00 34.16  ? 385  LEU A C   1 
ATOM   2891 O  O   . LEU A 1 386 ? 1.829   10.548  46.952  1.00 31.29  ? 385  LEU A O   1 
ATOM   2892 C  CB  . LEU A 1 386 ? 0.685   7.767   46.628  1.00 32.75  ? 385  LEU A CB  1 
ATOM   2893 C  CG  . LEU A 1 386 ? 0.690   6.318   46.122  1.00 34.38  ? 385  LEU A CG  1 
ATOM   2894 C  CD1 . LEU A 1 386 ? -0.731  5.819   45.884  1.00 37.20  ? 385  LEU A CD1 1 
ATOM   2895 C  CD2 . LEU A 1 386 ? 1.457   6.198   44.838  1.00 34.23  ? 385  LEU A CD2 1 
ATOM   2896 N  N   . ASN A 1 387 ? 1.584   9.870   49.088  1.00 36.30  ? 386  ASN A N   1 
ATOM   2897 C  CA  . ASN A 1 387 ? 1.389   11.193  49.692  1.00 33.12  ? 386  ASN A CA  1 
ATOM   2898 C  C   . ASN A 1 387 ? 0.022   11.777  49.354  1.00 31.27  ? 386  ASN A C   1 
ATOM   2899 O  O   . ASN A 1 387 ? -0.133  12.952  49.146  1.00 27.00  ? 386  ASN A O   1 
ATOM   2900 C  CB  . ASN A 1 387 ? 2.494   12.132  49.282  1.00 34.26  ? 386  ASN A CB  1 
ATOM   2901 C  CG  . ASN A 1 387 ? 2.869   13.114  50.362  1.00 34.75  ? 386  ASN A CG  1 
ATOM   2902 O  OD1 . ASN A 1 387 ? 2.319   13.126  51.443  1.00 38.48  ? 386  ASN A OD1 1 
ATOM   2903 N  ND2 . ASN A 1 387 ? 3.851   13.925  50.073  1.00 39.49  ? 386  ASN A ND2 1 
ATOM   2904 N  N   . LEU A 1 388 ? -0.984  10.920  49.352  1.00 34.76  ? 387  LEU A N   1 
ATOM   2905 C  CA  . LEU A 1 388 ? -2.344  11.336  49.089  1.00 38.10  ? 387  LEU A CA  1 
ATOM   2906 C  C   . LEU A 1 388 ? -3.259  11.121  50.293  1.00 38.74  ? 387  LEU A C   1 
ATOM   2907 O  O   . LEU A 1 388 ? -4.472  11.237  50.158  1.00 48.57  ? 387  LEU A O   1 
ATOM   2908 C  CB  . LEU A 1 388 ? -2.896  10.538  47.889  1.00 38.87  ? 387  LEU A CB  1 
ATOM   2909 C  CG  . LEU A 1 388 ? -2.328  10.939  46.534  1.00 36.72  ? 387  LEU A CG  1 
ATOM   2910 C  CD1 . LEU A 1 388 ? -2.654  9.875   45.508  1.00 36.10  ? 387  LEU A CD1 1 
ATOM   2911 C  CD2 . LEU A 1 388 ? -2.855  12.308  46.119  1.00 37.23  ? 387  LEU A CD2 1 
ATOM   2912 N  N   . TYR A 1 389 ? -2.708  10.790  51.451  1.00 36.69  ? 388  TYR A N   1 
ATOM   2913 C  CA  . TYR A 1 389 ? -3.535  10.418  52.591  1.00 36.54  ? 388  TYR A CA  1 
ATOM   2914 C  C   . TYR A 1 389 ? -3.792  11.641  53.432  1.00 35.28  ? 388  TYR A C   1 
ATOM   2915 O  O   . TYR A 1 389 ? -2.883  12.387  53.671  1.00 34.00  ? 388  TYR A O   1 
ATOM   2916 C  CB  . TYR A 1 389 ? -2.824  9.370   53.427  1.00 37.32  ? 388  TYR A CB  1 
ATOM   2917 C  CG  . TYR A 1 389 ? -3.562  8.929   54.652  1.00 39.44  ? 388  TYR A CG  1 
ATOM   2918 C  CD1 . TYR A 1 389 ? -3.402  9.588   55.867  1.00 43.23  ? 388  TYR A CD1 1 
ATOM   2919 C  CD2 . TYR A 1 389 ? -4.395  7.831   54.619  1.00 39.07  ? 388  TYR A CD2 1 
ATOM   2920 C  CE1 . TYR A 1 389 ? -4.079  9.167   57.005  1.00 42.58  ? 388  TYR A CE1 1 
ATOM   2921 C  CE2 . TYR A 1 389 ? -5.046  7.398   55.750  1.00 38.06  ? 388  TYR A CE2 1 
ATOM   2922 C  CZ  . TYR A 1 389 ? -4.887  8.064   56.927  1.00 38.73  ? 388  TYR A CZ  1 
ATOM   2923 O  OH  . TYR A 1 389 ? -5.534  7.624   58.041  1.00 43.76  ? 388  TYR A OH  1 
ATOM   2924 N  N   . PRO A 1 390 ? -5.032  11.834  53.928  1.00 36.11  ? 389  PRO A N   1 
ATOM   2925 C  CA  . PRO A 1 390 ? -6.231  11.026  53.821  1.00 33.59  ? 389  PRO A CA  1 
ATOM   2926 C  C   . PRO A 1 390 ? -7.169  11.508  52.755  1.00 32.79  ? 389  PRO A C   1 
ATOM   2927 O  O   . PRO A 1 390 ? -8.328  11.219  52.810  1.00 35.53  ? 389  PRO A O   1 
ATOM   2928 C  CB  . PRO A 1 390 ? -6.872  11.267  55.165  1.00 35.11  ? 389  PRO A CB  1 
ATOM   2929 C  CG  . PRO A 1 390 ? -6.613  12.717  55.426  1.00 34.01  ? 389  PRO A CG  1 
ATOM   2930 C  CD  . PRO A 1 390 ? -5.262  12.981  54.832  1.00 35.19  ? 389  PRO A CD  1 
ATOM   2931 N  N   . ARG A 1 391 ? -6.673  12.297  51.821  1.00 37.47  ? 390  ARG A N   1 
ATOM   2932 C  CA  . ARG A 1 391 ? -7.445  12.733  50.662  1.00 37.68  ? 390  ARG A CA  1 
ATOM   2933 C  C   . ARG A 1 391 ? -7.997  11.508  49.946  1.00 36.57  ? 390  ARG A C   1 
ATOM   2934 O  O   . ARG A 1 391 ? -9.116  11.533  49.424  1.00 40.22  ? 390  ARG A O   1 
ATOM   2935 C  CB  . ARG A 1 391 ? -6.535  13.521  49.727  1.00 43.55  ? 390  ARG A CB  1 
ATOM   2936 C  CG  . ARG A 1 391 ? -7.242  14.428  48.743  1.00 50.92  ? 390  ARG A CG  1 
ATOM   2937 C  CD  . ARG A 1 391 ? -6.306  14.880  47.609  1.00 57.48  ? 390  ARG A CD  1 
ATOM   2938 N  NE  . ARG A 1 391 ? -6.928  14.610  46.308  1.00 59.61  ? 390  ARG A NE  1 
ATOM   2939 C  CZ  . ARG A 1 391 ? -6.307  14.643  45.128  1.00 62.14  ? 390  ARG A CZ  1 
ATOM   2940 N  NH1 . ARG A 1 391 ? -5.021  14.972  45.047  1.00 61.22  ? 390  ARG A NH1 1 
ATOM   2941 N  NH2 . ARG A 1 391 ? -7.000  14.345  44.018  1.00 61.99  ? 390  ARG A NH2 1 
ATOM   2942 N  N   . LYS A 1 392 ? -7.210  10.435  49.922  1.00 32.10  ? 391  LYS A N   1 
ATOM   2943 C  CA  . LYS A 1 392 ? -7.667  9.129   49.447  1.00 31.32  ? 391  LYS A CA  1 
ATOM   2944 C  C   . LYS A 1 392 ? -7.324  8.070   50.473  1.00 30.98  ? 391  LYS A C   1 
ATOM   2945 O  O   . LYS A 1 392 ? -6.647  8.347   51.457  1.00 29.90  ? 391  LYS A O   1 
ATOM   2946 C  CB  . LYS A 1 392 ? -7.025  8.765   48.094  1.00 31.12  ? 391  LYS A CB  1 
ATOM   2947 C  CG  . LYS A 1 392 ? -7.477  9.680   46.978  1.00 30.13  ? 391  LYS A CG  1 
ATOM   2948 C  CD  . LYS A 1 392 ? -6.866  9.335   45.641  1.00 30.50  ? 391  LYS A CD  1 
ATOM   2949 C  CE  . LYS A 1 392 ? -7.189  10.401  44.570  1.00 31.65  ? 391  LYS A CE  1 
ATOM   2950 N  NZ  . LYS A 1 392 ? -8.629  10.567  44.225  1.00 32.02  ? 391  LYS A NZ  1 
ATOM   2951 N  N   . GLY A 1 393 ? -7.812  6.855   50.250  1.00 31.11  ? 392  GLY A N   1 
ATOM   2952 C  CA  . GLY A 1 393 ? -7.580  5.775   51.196  1.00 30.15  ? 392  GLY A CA  1 
ATOM   2953 C  C   . GLY A 1 393 ? -8.234  5.921   52.546  1.00 31.43  ? 392  GLY A C   1 
ATOM   2954 O  O   . GLY A 1 393 ? -7.964  5.126   53.445  1.00 37.28  ? 392  GLY A O   1 
ATOM   2955 N  N   . ARG A 1 394 ? -9.112  6.912   52.705  1.00 32.95  ? 393  ARG A N   1 
ATOM   2956 C  CA  . ARG A 1 394 ? -9.892  7.072   53.937  1.00 33.43  ? 393  ARG A CA  1 
ATOM   2957 C  C   . ARG A 1 394 ? -11.214 7.756   53.712  1.00 32.78  ? 393  ARG A C   1 
ATOM   2958 O  O   . ARG A 1 394 ? -11.289 8.756   52.994  1.00 31.97  ? 393  ARG A O   1 
ATOM   2959 C  CB  . ARG A 1 394 ? -9.122  7.866   54.999  1.00 34.95  ? 393  ARG A CB  1 
ATOM   2960 C  CG  . ARG A 1 394 ? -9.745  7.809   56.386  1.00 37.97  ? 393  ARG A CG  1 
ATOM   2961 C  CD  . ARG A 1 394 ? -8.903  8.589   57.397  1.00 40.21  ? 393  ARG A CD  1 
ATOM   2962 N  NE  . ARG A 1 394 ? -9.233  8.287   58.798  1.00 41.74  ? 393  ARG A NE  1 
ATOM   2963 C  CZ  . ARG A 1 394 ? -8.805  7.235   59.483  1.00 39.16  ? 393  ARG A CZ  1 
ATOM   2964 N  NH1 . ARG A 1 394 ? -8.008  6.348   58.911  1.00 42.94  ? 393  ARG A NH1 1 
ATOM   2965 N  NH2 . ARG A 1 394 ? -9.170  7.074   60.744  1.00 38.97  ? 393  ARG A NH2 1 
ATOM   2966 N  N   . ILE A 1 395 ? -12.238 7.210   54.381  1.00 33.88  ? 394  ILE A N   1 
ATOM   2967 C  CA  . ILE A 1 395 ? -13.580 7.788   54.494  1.00 32.33  ? 394  ILE A CA  1 
ATOM   2968 C  C   . ILE A 1 395 ? -13.621 8.713   55.717  1.00 31.83  ? 394  ILE A C   1 
ATOM   2969 O  O   . ILE A 1 395 ? -13.903 8.278   56.826  1.00 30.96  ? 394  ILE A O   1 
ATOM   2970 C  CB  . ILE A 1 395 ? -14.657 6.696   54.672  1.00 32.18  ? 394  ILE A CB  1 
ATOM   2971 C  CG1 . ILE A 1 395 ? -14.553 5.638   53.563  1.00 33.75  ? 394  ILE A CG1 1 
ATOM   2972 C  CG2 . ILE A 1 395 ? -16.064 7.296   54.727  1.00 32.08  ? 394  ILE A CG2 1 
ATOM   2973 C  CD1 . ILE A 1 395 ? -14.714 6.136   52.140  1.00 33.65  ? 394  ILE A CD1 1 
ATOM   2974 N  N   . ILE A 1 396 ? -13.262 9.974   55.506  1.00 32.40  ? 395  ILE A N   1 
ATOM   2975 C  CA  . ILE A 1 396 ? -13.573 11.062  56.434  1.00 34.10  ? 395  ILE A CA  1 
ATOM   2976 C  C   . ILE A 1 396 ? -13.960 12.338  55.694  1.00 32.47  ? 395  ILE A C   1 
ATOM   2977 O  O   . ILE A 1 396 ? -13.758 12.449  54.487  1.00 31.98  ? 395  ILE A O   1 
ATOM   2978 C  CB  . ILE A 1 396 ? -12.410 11.443  57.368  1.00 38.22  ? 395  ILE A CB  1 
ATOM   2979 C  CG1 . ILE A 1 396 ? -11.144 11.818  56.588  1.00 38.65  ? 395  ILE A CG1 1 
ATOM   2980 C  CG2 . ILE A 1 396 ? -12.174 10.351  58.413  1.00 41.32  ? 395  ILE A CG2 1 
ATOM   2981 C  CD1 . ILE A 1 396 ? -10.367 12.916  57.290  1.00 40.55  ? 395  ILE A CD1 1 
ATOM   2982 N  N   . PRO A 1 397 ? -14.538 13.297  56.420  1.00 31.97  ? 396  PRO A N   1 
ATOM   2983 C  CA  . PRO A 1 397 ? -14.882 14.540  55.734  1.00 32.47  ? 396  PRO A CA  1 
ATOM   2984 C  C   . PRO A 1 397 ? -13.657 15.258  55.199  1.00 29.24  ? 396  PRO A C   1 
ATOM   2985 O  O   . PRO A 1 397 ? -12.606 15.231  55.828  1.00 27.53  ? 396  PRO A O   1 
ATOM   2986 C  CB  . PRO A 1 397 ? -15.559 15.366  56.834  1.00 33.00  ? 396  PRO A CB  1 
ATOM   2987 C  CG  . PRO A 1 397 ? -16.144 14.345  57.733  1.00 32.68  ? 396  PRO A CG  1 
ATOM   2988 C  CD  . PRO A 1 397 ? -15.163 13.215  57.757  1.00 30.79  ? 396  PRO A CD  1 
ATOM   2989 N  N   . GLY A 1 398 ? -13.816 15.880  54.035  1.00 28.72  ? 397  GLY A N   1 
ATOM   2990 C  CA  . GLY A 1 398 ? -12.690 16.483  53.308  1.00 30.29  ? 397  GLY A CA  1 
ATOM   2991 C  C   . GLY A 1 398 ? -12.071 15.570  52.254  1.00 31.40  ? 397  GLY A C   1 
ATOM   2992 O  O   . GLY A 1 398 ? -11.568 16.039  51.237  1.00 34.16  ? 397  GLY A O   1 
ATOM   2993 N  N   . ALA A 1 399 ? -12.161 14.255  52.463  1.00 32.82  ? 398  ALA A N   1 
ATOM   2994 C  CA  . ALA A 1 399 ? -11.571 13.256  51.567  1.00 32.64  ? 398  ALA A CA  1 
ATOM   2995 C  C   . ALA A 1 399 ? -12.208 13.296  50.193  1.00 30.01  ? 398  ALA A C   1 
ATOM   2996 O  O   . ALA A 1 399 ? -13.325 13.793  50.045  1.00 29.48  ? 398  ALA A O   1 
ATOM   2997 C  CB  . ALA A 1 399 ? -11.717 11.864  52.151  1.00 33.10  ? 398  ALA A CB  1 
ATOM   2998 N  N   . ASP A 1 400 ? -11.480 12.788  49.207  1.00 27.81  ? 399  ASP A N   1 
ATOM   2999 C  CA  . ASP A 1 400 ? -12.041 12.592  47.900  1.00 31.04  ? 399  ASP A CA  1 
ATOM   3000 C  C   . ASP A 1 400 ? -13.043 11.472  47.954  1.00 31.76  ? 399  ASP A C   1 
ATOM   3001 O  O   . ASP A 1 400 ? -12.833 10.489  48.608  1.00 31.19  ? 399  ASP A O   1 
ATOM   3002 C  CB  . ASP A 1 400 ? -10.972 12.208  46.884  1.00 32.82  ? 399  ASP A CB  1 
ATOM   3003 C  CG  . ASP A 1 400 ? -9.961  13.313  46.629  1.00 31.60  ? 399  ASP A CG  1 
ATOM   3004 O  OD1 . ASP A 1 400 ? -10.168 14.454  47.084  1.00 32.89  ? 399  ASP A OD1 1 
ATOM   3005 O  OD2 . ASP A 1 400 ? -8.941  13.026  45.955  1.00 28.44  ? 399  ASP A OD2 1 
ATOM   3006 N  N   . ALA A 1 401 ? -14.151 11.645  47.256  1.00 35.48  ? 400  ALA A N   1 
ATOM   3007 C  CA  . ALA A 1 401 ? -15.208 10.672  47.268  1.00 35.82  ? 400  ALA A CA  1 
ATOM   3008 C  C   . ALA A 1 401 ? -14.873 9.547   46.300  1.00 33.78  ? 400  ALA A C   1 
ATOM   3009 O  O   . ALA A 1 401 ? -15.590 9.309   45.334  1.00 26.89  ? 400  ALA A O   1 
ATOM   3010 C  CB  . ALA A 1 401 ? -16.529 11.333  46.910  1.00 38.22  ? 400  ALA A CB  1 
ATOM   3011 N  N   . ASP A 1 402 ? -13.766 8.875   46.592  1.00 33.73  ? 401  ASP A N   1 
ATOM   3012 C  CA  . ASP A 1 402 ? -13.502 7.605   45.985  1.00 33.95  ? 401  ASP A CA  1 
ATOM   3013 C  C   . ASP A 1 402 ? -13.904 6.576   46.999  1.00 31.34  ? 401  ASP A C   1 
ATOM   3014 O  O   . ASP A 1 402 ? -13.150 6.306   47.936  1.00 30.76  ? 401  ASP A O   1 
ATOM   3015 C  CB  . ASP A 1 402 ? -12.023 7.484   45.673  1.00 40.04  ? 401  ASP A CB  1 
ATOM   3016 C  CG  . ASP A 1 402 ? -11.590 8.377   44.544  1.00 42.15  ? 401  ASP A CG  1 
ATOM   3017 O  OD1 . ASP A 1 402 ? -12.386 9.225   44.098  1.00 44.48  ? 401  ASP A OD1 1 
ATOM   3018 O  OD2 . ASP A 1 402 ? -10.459 8.163   44.076  1.00 46.90  ? 401  ASP A OD2 1 
ATOM   3019 N  N   . VAL A 1 403 ? -15.125 6.052   46.846  1.00 32.16  ? 402  VAL A N   1 
ATOM   3020 C  CA  . VAL A 1 403 ? -15.790 5.247   47.875  1.00 31.43  ? 402  VAL A CA  1 
ATOM   3021 C  C   . VAL A 1 403 ? -16.413 4.029   47.242  1.00 30.43  ? 402  VAL A C   1 
ATOM   3022 O  O   . VAL A 1 403 ? -16.993 4.154   46.180  1.00 31.87  ? 402  VAL A O   1 
ATOM   3023 C  CB  . VAL A 1 403 ? -16.942 6.012   48.533  1.00 33.98  ? 402  VAL A CB  1 
ATOM   3024 C  CG1 . VAL A 1 403 ? -17.678 5.127   49.566  1.00 37.09  ? 402  VAL A CG1 1 
ATOM   3025 C  CG2 . VAL A 1 403 ? -16.429 7.291   49.175  1.00 35.06  ? 402  VAL A CG2 1 
ATOM   3026 N  N   . VAL A 1 404 ? -16.312 2.867   47.894  1.00 27.56  ? 403  VAL A N   1 
ATOM   3027 C  CA  . VAL A 1 404 ? -16.938 1.679   47.401  1.00 27.91  ? 403  VAL A CA  1 
ATOM   3028 C  C   . VAL A 1 404 ? -17.876 1.132   48.463  1.00 30.58  ? 403  VAL A C   1 
ATOM   3029 O  O   . VAL A 1 404 ? -17.516 0.980   49.645  1.00 29.73  ? 403  VAL A O   1 
ATOM   3030 C  CB  . VAL A 1 404 ? -15.898 0.605   47.002  1.00 31.25  ? 403  VAL A CB  1 
ATOM   3031 C  CG1 . VAL A 1 404 ? -16.558 -0.751  46.670  1.00 32.81  ? 403  VAL A CG1 1 
ATOM   3032 C  CG2 . VAL A 1 404 ? -15.076 1.042   45.799  1.00 31.63  ? 403  VAL A CG2 1 
ATOM   3033 N  N   . VAL A 1 405 ? -19.089 0.783   48.028  1.00 32.68  ? 404  VAL A N   1 
ATOM   3034 C  CA  . VAL A 1 405 ? -20.031 0.031   48.876  1.00 30.69  ? 404  VAL A CA  1 
ATOM   3035 C  C   . VAL A 1 405 ? -19.730 -1.420  48.594  1.00 30.13  ? 404  VAL A C   1 
ATOM   3036 O  O   . VAL A 1 405 ? -20.028 -1.933  47.508  1.00 25.96  ? 404  VAL A O   1 
ATOM   3037 C  CB  . VAL A 1 405 ? -21.505 0.359   48.582  1.00 29.99  ? 404  VAL A CB  1 
ATOM   3038 C  CG1 . VAL A 1 405 ? -22.426 -0.607  49.270  1.00 29.77  ? 404  VAL A CG1 1 
ATOM   3039 C  CG2 . VAL A 1 405 ? -21.819 1.773   49.026  1.00 31.22  ? 404  VAL A CG2 1 
ATOM   3040 N  N   . TRP A 1 406 ? -19.113 -2.042  49.603  1.00 32.09  ? 405  TRP A N   1 
ATOM   3041 C  CA  . TRP A 1 406 ? -18.565 -3.396  49.539  1.00 31.47  ? 405  TRP A CA  1 
ATOM   3042 C  C   . TRP A 1 406 ? -19.504 -4.375  50.210  1.00 32.06  ? 405  TRP A C   1 
ATOM   3043 O  O   . TRP A 1 406 ? -19.908 -4.166  51.334  1.00 33.27  ? 405  TRP A O   1 
ATOM   3044 C  CB  . TRP A 1 406 ? -17.187 -3.445  50.249  1.00 31.05  ? 405  TRP A CB  1 
ATOM   3045 C  CG  . TRP A 1 406 ? -16.431 -4.744  50.085  1.00 29.73  ? 405  TRP A CG  1 
ATOM   3046 C  CD1 . TRP A 1 406 ? -16.292 -5.734  51.017  1.00 29.98  ? 405  TRP A CD1 1 
ATOM   3047 C  CD2 . TRP A 1 406 ? -15.762 -5.218  48.905  1.00 27.22  ? 405  TRP A CD2 1 
ATOM   3048 N  NE1 . TRP A 1 406 ? -15.570 -6.793  50.494  1.00 27.30  ? 405  TRP A NE1 1 
ATOM   3049 C  CE2 . TRP A 1 406 ? -15.232 -6.490  49.203  1.00 26.01  ? 405  TRP A CE2 1 
ATOM   3050 C  CE3 . TRP A 1 406 ? -15.531 -4.675  47.640  1.00 26.18  ? 405  TRP A CE3 1 
ATOM   3051 C  CZ2 . TRP A 1 406 ? -14.512 -7.223  48.285  1.00 25.35  ? 405  TRP A CZ2 1 
ATOM   3052 C  CZ3 . TRP A 1 406 ? -14.810 -5.420  46.730  1.00 24.90  ? 405  TRP A CZ3 1 
ATOM   3053 C  CH2 . TRP A 1 406 ? -14.314 -6.675  47.056  1.00 24.72  ? 405  TRP A CH2 1 
ATOM   3054 N  N   . ASP A 1 407 ? -19.856 -5.444  49.499  1.00 36.65  ? 406  ASP A N   1 
ATOM   3055 C  CA  . ASP A 1 407 ? -20.715 -6.510  50.028  1.00 38.34  ? 406  ASP A CA  1 
ATOM   3056 C  C   . ASP A 1 407 ? -19.831 -7.632  50.531  1.00 40.61  ? 406  ASP A C   1 
ATOM   3057 O  O   . ASP A 1 407 ? -19.292 -8.399  49.741  1.00 49.14  ? 406  ASP A O   1 
ATOM   3058 C  CB  . ASP A 1 407 ? -21.686 -7.033  48.959  1.00 37.90  ? 406  ASP A CB  1 
ATOM   3059 C  CG  . ASP A 1 407 ? -22.812 -7.886  49.536  1.00 37.71  ? 406  ASP A CG  1 
ATOM   3060 O  OD1 . ASP A 1 407 ? -22.695 -8.392  50.686  1.00 36.18  ? 406  ASP A OD1 1 
ATOM   3061 O  OD2 . ASP A 1 407 ? -23.816 -8.055  48.810  1.00 35.80  ? 406  ASP A OD2 1 
ATOM   3062 N  N   . PRO A 1 408 ? -19.693 -7.751  51.851  1.00 40.76  ? 407  PRO A N   1 
ATOM   3063 C  CA  . PRO A 1 408 ? -18.836 -8.748  52.449  1.00 43.33  ? 407  PRO A CA  1 
ATOM   3064 C  C   . PRO A 1 408 ? -19.423 -10.133 52.385  1.00 51.65  ? 407  PRO A C   1 
ATOM   3065 O  O   . PRO A 1 408 ? -18.741 -11.107 52.722  1.00 51.64  ? 407  PRO A O   1 
ATOM   3066 C  CB  . PRO A 1 408 ? -18.765 -8.319  53.890  1.00 39.62  ? 407  PRO A CB  1 
ATOM   3067 C  CG  . PRO A 1 408 ? -20.077 -7.726  54.115  1.00 42.50  ? 407  PRO A CG  1 
ATOM   3068 C  CD  . PRO A 1 408 ? -20.429 -7.001  52.863  1.00 40.91  ? 407  PRO A CD  1 
ATOM   3069 N  N   . GLU A 1 409 ? -20.676 -10.228 51.958  1.00 59.58  ? 408  GLU A N   1 
ATOM   3070 C  CA  . GLU A 1 409 ? -21.372 -11.489 51.983  1.00 65.16  ? 408  GLU A CA  1 
ATOM   3071 C  C   . GLU A 1 409 ? -21.329 -12.117 50.620  1.00 61.61  ? 408  GLU A C   1 
ATOM   3072 O  O   . GLU A 1 409 ? -20.915 -13.253 50.476  1.00 58.52  ? 408  GLU A O   1 
ATOM   3073 C  CB  . GLU A 1 409 ? -22.841 -11.285 52.329  1.00 73.60  ? 408  GLU A CB  1 
ATOM   3074 C  CG  . GLU A 1 409 ? -23.130 -11.050 53.802  1.00 76.25  ? 408  GLU A CG  1 
ATOM   3075 C  CD  . GLU A 1 409 ? -24.519 -10.418 54.022  1.00 80.31  ? 408  GLU A CD  1 
ATOM   3076 O  OE1 . GLU A 1 409 ? -24.762 -9.265  53.573  1.00 69.45  ? 408  GLU A OE1 1 
ATOM   3077 O  OE2 . GLU A 1 409 ? -25.380 -11.070 54.665  1.00 78.87  ? 408  GLU A OE2 1 
ATOM   3078 N  N   . ALA A 1 410 ? -21.759 -11.369 49.618  1.00 56.92  ? 409  ALA A N   1 
ATOM   3079 C  CA  . ALA A 1 410 ? -22.183 -11.979 48.382  1.00 60.83  ? 409  ALA A CA  1 
ATOM   3080 C  C   . ALA A 1 410 ? -21.068 -12.780 47.730  1.00 59.14  ? 409  ALA A C   1 
ATOM   3081 O  O   . ALA A 1 410 ? -19.904 -12.403 47.818  1.00 65.35  ? 409  ALA A O   1 
ATOM   3082 C  CB  . ALA A 1 410 ? -22.726 -10.922 47.430  1.00 66.07  ? 409  ALA A CB  1 
ATOM   3083 N  N   . THR A 1 411 ? -21.435 -13.889 47.094  1.00 58.08  ? 410  THR A N   1 
ATOM   3084 C  CA  . THR A 1 411 ? -20.473 -14.729 46.406  1.00 58.67  ? 410  THR A CA  1 
ATOM   3085 C  C   . THR A 1 411 ? -20.765 -14.749 44.897  1.00 57.38  ? 410  THR A C   1 
ATOM   3086 O  O   . THR A 1 411 ? -21.904 -14.857 44.442  1.00 51.37  ? 410  THR A O   1 
ATOM   3087 C  CB  . THR A 1 411 ? -20.428 -16.167 46.950  1.00 59.13  ? 410  THR A CB  1 
ATOM   3088 O  OG1 . THR A 1 411 ? -21.589 -16.890 46.518  1.00 57.96  ? 410  THR A OG1 1 
ATOM   3089 C  CG2 . THR A 1 411 ? -20.358 -16.160 48.461  1.00 58.89  ? 410  THR A CG2 1 
ATOM   3090 N  N   . LYS A 1 412 ? -19.676 -14.646 44.157  1.00 55.34  ? 411  LYS A N   1 
ATOM   3091 C  CA  . LYS A 1 412 ? -19.623 -14.573 42.724  1.00 55.34  ? 411  LYS A CA  1 
ATOM   3092 C  C   . LYS A 1 412 ? -18.584 -15.629 42.468  1.00 52.08  ? 411  LYS A C   1 
ATOM   3093 O  O   . LYS A 1 412 ? -17.661 -15.779 43.267  1.00 53.49  ? 411  LYS A O   1 
ATOM   3094 C  CB  . LYS A 1 412 ? -19.121 -13.183 42.258  1.00 57.24  ? 411  LYS A CB  1 
ATOM   3095 C  CG  . LYS A 1 412 ? -18.635 -13.120 40.795  1.00 57.17  ? 411  LYS A CG  1 
ATOM   3096 C  CD  . LYS A 1 412 ? -17.512 -12.093 40.628  1.00 56.37  ? 411  LYS A CD  1 
ATOM   3097 C  CE  . LYS A 1 412 ? -17.400 -11.509 39.210  1.00 57.34  ? 411  LYS A CE  1 
ATOM   3098 N  NZ  . LYS A 1 412 ? -18.291 -10.327 38.921  1.00 56.12  ? 411  LYS A NZ  1 
ATOM   3099 N  N   . THR A 1 413 ? -18.715 -16.366 41.377  1.00 49.46  ? 412  THR A N   1 
ATOM   3100 C  CA  . THR A 1 413 ? -17.658 -17.298 40.988  1.00 52.37  ? 412  THR A CA  1 
ATOM   3101 C  C   . THR A 1 413 ? -16.862 -16.694 39.835  1.00 51.38  ? 412  THR A C   1 
ATOM   3102 O  O   . THR A 1 413 ? -17.426 -16.418 38.781  1.00 45.30  ? 412  THR A O   1 
ATOM   3103 C  CB  . THR A 1 413 ? -18.218 -18.684 40.600  1.00 51.21  ? 412  THR A CB  1 
ATOM   3104 O  OG1 . THR A 1 413 ? -18.690 -19.348 41.784  1.00 49.71  ? 412  THR A OG1 1 
ATOM   3105 C  CG2 . THR A 1 413 ? -17.141 -19.552 39.940  1.00 51.18  ? 412  THR A CG2 1 
ATOM   3106 N  N   . ILE A 1 414 ? -15.555 -16.498 40.038  1.00 52.07  ? 413  ILE A N   1 
ATOM   3107 C  CA  . ILE A 1 414 ? -14.733 -15.863 39.006  1.00 52.08  ? 413  ILE A CA  1 
ATOM   3108 C  C   . ILE A 1 414 ? -14.605 -16.728 37.765  1.00 51.48  ? 413  ILE A C   1 
ATOM   3109 O  O   . ILE A 1 414 ? -14.262 -17.919 37.840  1.00 53.06  ? 413  ILE A O   1 
ATOM   3110 C  CB  . ILE A 1 414 ? -13.305 -15.504 39.453  1.00 51.97  ? 413  ILE A CB  1 
ATOM   3111 C  CG1 . ILE A 1 414 ? -13.356 -14.576 40.666  1.00 49.97  ? 413  ILE A CG1 1 
ATOM   3112 C  CG2 . ILE A 1 414 ? -12.563 -14.835 38.297  1.00 53.48  ? 413  ILE A CG2 1 
ATOM   3113 C  CD1 . ILE A 1 414 ? -12.017 -13.978 41.027  1.00 49.35  ? 413  ILE A CD1 1 
ATOM   3114 N  N   . SER A 1 415 ? -14.918 -16.108 36.640  1.00 46.58  ? 414  SER A N   1 
ATOM   3115 C  CA  . SER A 1 415 ? -14.711 -16.712 35.365  1.00 50.52  ? 414  SER A CA  1 
ATOM   3116 C  C   . SER A 1 415 ? -14.142 -15.687 34.401  1.00 51.58  ? 414  SER A C   1 
ATOM   3117 O  O   . SER A 1 415 ? -14.451 -14.498 34.511  1.00 52.41  ? 414  SER A O   1 
ATOM   3118 C  CB  . SER A 1 415 ? -16.037 -17.241 34.835  1.00 51.03  ? 414  SER A CB  1 
ATOM   3119 O  OG  . SER A 1 415 ? -15.904 -17.582 33.464  1.00 54.18  ? 414  SER A OG  1 
ATOM   3120 N  N   . ALA A 1 416 ? -13.366 -16.165 33.424  1.00 48.03  ? 415  ALA A N   1 
ATOM   3121 C  CA  . ALA A 1 416 ? -12.884 -15.328 32.317  1.00 47.62  ? 415  ALA A CA  1 
ATOM   3122 C  C   . ALA A 1 416 ? -14.037 -14.860 31.444  1.00 45.67  ? 415  ALA A C   1 
ATOM   3123 O  O   . ALA A 1 416 ? -14.085 -13.710 31.010  1.00 42.79  ? 415  ALA A O   1 
ATOM   3124 C  CB  . ALA A 1 416 ? -11.899 -16.101 31.467  1.00 46.35  ? 415  ALA A CB  1 
ATOM   3125 N  N   . SER A 1 417 ? -14.984 -15.764 31.231  1.00 47.42  ? 416  SER A N   1 
ATOM   3126 C  CA  . SER A 1 417 ? -16.133 -15.509 30.379  1.00 49.06  ? 416  SER A CA  1 
ATOM   3127 C  C   . SER A 1 417 ? -17.054 -14.374 30.867  1.00 49.14  ? 416  SER A C   1 
ATOM   3128 O  O   . SER A 1 417 ? -17.930 -13.953 30.128  1.00 54.25  ? 416  SER A O   1 
ATOM   3129 C  CB  . SER A 1 417 ? -16.940 -16.804 30.201  1.00 47.23  ? 416  SER A CB  1 
ATOM   3130 O  OG  . SER A 1 417 ? -17.533 -17.179 31.426  1.00 45.33  ? 416  SER A OG  1 
ATOM   3131 N  N   . THR A 1 418 ? -16.855 -13.863 32.077  1.00 53.18  ? 417  THR A N   1 
ATOM   3132 C  CA  . THR A 1 418 ? -17.647 -12.710 32.559  1.00 53.82  ? 417  THR A CA  1 
ATOM   3133 C  C   . THR A 1 418 ? -16.821 -11.488 33.001  1.00 48.64  ? 417  THR A C   1 
ATOM   3134 O  O   . THR A 1 418 ? -17.370 -10.527 33.513  1.00 41.70  ? 417  THR A O   1 
ATOM   3135 C  CB  . THR A 1 418 ? -18.547 -13.137 33.732  1.00 52.37  ? 417  THR A CB  1 
ATOM   3136 O  OG1 . THR A 1 418 ? -17.734 -13.399 34.897  1.00 50.74  ? 417  THR A OG1 1 
ATOM   3137 C  CG2 . THR A 1 418 ? -19.348 -14.377 33.351  1.00 48.47  ? 417  THR A CG2 1 
ATOM   3138 N  N   . GLN A 1 419 ? -15.508 -11.530 32.817  1.00 49.55  ? 418  GLN A N   1 
ATOM   3139 C  CA  . GLN A 1 419 ? -14.652 -10.431 33.280  1.00 52.81  ? 418  GLN A CA  1 
ATOM   3140 C  C   . GLN A 1 419 ? -14.621 -9.317  32.255  1.00 46.73  ? 418  GLN A C   1 
ATOM   3141 O  O   . GLN A 1 419 ? -14.865 -9.562  31.089  1.00 45.66  ? 418  GLN A O   1 
ATOM   3142 C  CB  . GLN A 1 419 ? -13.233 -10.925 33.540  1.00 56.41  ? 418  GLN A CB  1 
ATOM   3143 C  CG  . GLN A 1 419 ? -12.431 -11.184 32.271  1.00 60.84  ? 418  GLN A CG  1 
ATOM   3144 C  CD  . GLN A 1 419 ? -11.093 -11.814 32.552  1.00 66.23  ? 418  GLN A CD  1 
ATOM   3145 O  OE1 . GLN A 1 419 ? -10.772 -12.137 33.690  1.00 69.79  ? 418  GLN A OE1 1 
ATOM   3146 N  NE2 . GLN A 1 419 ? -10.287 -11.962 31.510  1.00 64.86  ? 418  GLN A NE2 1 
ATOM   3147 N  N   . VAL A 1 420 ? -14.332 -8.106  32.707  1.00 44.96  ? 419  VAL A N   1 
ATOM   3148 C  CA  . VAL A 1 420 ? -14.260 -6.946  31.828  1.00 48.65  ? 419  VAL A CA  1 
ATOM   3149 C  C   . VAL A 1 420 ? -12.813 -6.500  31.620  1.00 50.57  ? 419  VAL A C   1 
ATOM   3150 O  O   . VAL A 1 420 ? -12.522 -5.577  30.861  1.00 48.19  ? 419  VAL A O   1 
ATOM   3151 C  CB  . VAL A 1 420 ? -15.148 -5.781  32.355  1.00 51.94  ? 419  VAL A CB  1 
ATOM   3152 C  CG1 . VAL A 1 420 ? -16.590 -6.247  32.551  1.00 49.75  ? 419  VAL A CG1 1 
ATOM   3153 C  CG2 . VAL A 1 420 ? -14.607 -5.191  33.661  1.00 54.67  ? 419  VAL A CG2 1 
ATOM   3154 N  N   . GLN A 1 421 ? -11.909 -7.151  32.324  1.00 55.15  ? 420  GLN A N   1 
ATOM   3155 C  CA  . GLN A 1 421 ? -10.502 -6.904  32.135  1.00 51.95  ? 420  GLN A CA  1 
ATOM   3156 C  C   . GLN A 1 421 ? -10.061 -7.750  30.962  1.00 55.08  ? 420  GLN A C   1 
ATOM   3157 O  O   . GLN A 1 421 ? -10.724 -8.721  30.587  1.00 48.70  ? 420  GLN A O   1 
ATOM   3158 C  CB  . GLN A 1 421 ? -9.714  -7.257  33.398  1.00 50.19  ? 420  GLN A CB  1 
ATOM   3159 C  CG  . GLN A 1 421 ? -9.949  -8.676  33.896  1.00 48.54  ? 420  GLN A CG  1 
ATOM   3160 C  CD  . GLN A 1 421 ? -9.094  -9.023  35.075  1.00 48.91  ? 420  GLN A CD  1 
ATOM   3161 O  OE1 . GLN A 1 421 ? -8.407  -8.164  35.640  1.00 46.41  ? 420  GLN A OE1 1 
ATOM   3162 N  NE2 . GLN A 1 421 ? -9.087  -10.302 35.436  1.00 47.91  ? 420  GLN A NE2 1 
ATOM   3163 N  N   . GLY A 1 422 ? -8.905  -7.392  30.420  1.00 58.74  ? 421  GLY A N   1 
ATOM   3164 C  CA  . GLY A 1 422 ? -8.325  -8.083  29.279  1.00 55.26  ? 421  GLY A CA  1 
ATOM   3165 C  C   . GLY A 1 422 ? -7.726  -9.418  29.643  1.00 58.19  ? 421  GLY A C   1 
ATOM   3166 O  O   . GLY A 1 422 ? -7.448  -9.676  30.812  1.00 52.47  ? 421  GLY A O   1 
ATOM   3167 N  N   . GLY A 1 423 ? -7.519  -10.261 28.635  1.00 65.96  ? 422  GLY A N   1 
ATOM   3168 C  CA  . GLY A 1 423 ? -6.896  -11.586 28.812  1.00 67.81  ? 422  GLY A CA  1 
ATOM   3169 C  C   . GLY A 1 423 ? -7.824  -12.737 28.462  1.00 66.40  ? 422  GLY A C   1 
ATOM   3170 O  O   . GLY A 1 423 ? -8.972  -12.746 28.851  1.00 70.59  ? 422  GLY A O   1 
ATOM   3171 N  N   . ASP A 1 424 ? -7.336  -13.700 27.698  1.00 68.18  ? 423  ASP A N   1 
ATOM   3172 C  CA  . ASP A 1 424 ? -8.072  -14.938 27.452  1.00 66.81  ? 423  ASP A CA  1 
ATOM   3173 C  C   . ASP A 1 424 ? -8.422  -15.618 28.760  1.00 62.74  ? 423  ASP A C   1 
ATOM   3174 O  O   . ASP A 1 424 ? -9.420  -16.321 28.845  1.00 57.65  ? 423  ASP A O   1 
ATOM   3175 C  CB  . ASP A 1 424 ? -7.195  -15.933 26.685  1.00 69.21  ? 423  ASP A CB  1 
ATOM   3176 C  CG  . ASP A 1 424 ? -6.926  -15.513 25.297  1.00 69.93  ? 423  ASP A CG  1 
ATOM   3177 O  OD1 . ASP A 1 424 ? -7.456  -14.471 24.896  1.00 80.28  ? 423  ASP A OD1 1 
ATOM   3178 O  OD2 . ASP A 1 424 ? -6.189  -16.232 24.602  1.00 75.04  ? 423  ASP A OD2 1 
ATOM   3179 N  N   . PHE A 1 425 ? -7.554  -15.435 29.755  1.00 57.82  ? 424  PHE A N   1 
ATOM   3180 C  CA  . PHE A 1 425 ? -7.592  -16.216 30.972  1.00 59.33  ? 424  PHE A CA  1 
ATOM   3181 C  C   . PHE A 1 425 ? -7.796  -15.368 32.214  1.00 53.44  ? 424  PHE A C   1 
ATOM   3182 O  O   . PHE A 1 425 ? -7.456  -14.185 32.245  1.00 55.84  ? 424  PHE A O   1 
ATOM   3183 C  CB  . PHE A 1 425 ? -6.265  -16.962 31.142  1.00 64.33  ? 424  PHE A CB  1 
ATOM   3184 C  CG  . PHE A 1 425 ? -6.179  -18.239 30.373  1.00 71.00  ? 424  PHE A CG  1 
ATOM   3185 C  CD1 . PHE A 1 425 ? -5.715  -18.252 29.064  1.00 74.66  ? 424  PHE A CD1 1 
ATOM   3186 C  CD2 . PHE A 1 425 ? -6.550  -19.441 30.961  1.00 75.92  ? 424  PHE A CD2 1 
ATOM   3187 C  CE1 . PHE A 1 425 ? -5.630  -19.443 28.349  1.00 76.20  ? 424  PHE A CE1 1 
ATOM   3188 C  CE2 . PHE A 1 425 ? -6.461  -20.632 30.256  1.00 79.37  ? 424  PHE A CE2 1 
ATOM   3189 C  CZ  . PHE A 1 425 ? -6.003  -20.633 28.947  1.00 76.48  ? 424  PHE A CZ  1 
ATOM   3190 N  N   . ASN A 1 426 ? -8.352  -16.012 33.230  1.00 49.19  ? 425  ASN A N   1 
ATOM   3191 C  CA  . ASN A 1 426 ? -8.345  -15.526 34.579  1.00 48.91  ? 425  ASN A CA  1 
ATOM   3192 C  C   . ASN A 1 426 ? -7.540  -16.510 35.415  1.00 47.26  ? 425  ASN A C   1 
ATOM   3193 O  O   . ASN A 1 426 ? -7.813  -17.717 35.397  1.00 43.31  ? 425  ASN A O   1 
ATOM   3194 C  CB  . ASN A 1 426 ? -9.776  -15.487 35.084  1.00 52.15  ? 425  ASN A CB  1 
ATOM   3195 C  CG  . ASN A 1 426 ? -10.010 -14.399 36.086  1.00 57.32  ? 425  ASN A CG  1 
ATOM   3196 O  OD1 . ASN A 1 426 ? -9.874  -14.590 37.307  1.00 51.12  ? 425  ASN A OD1 1 
ATOM   3197 N  ND2 . ASN A 1 426 ? -10.390 -13.235 35.571  1.00 59.49  ? 425  ASN A ND2 1 
ATOM   3198 N  N   . LEU A 1 427 ? -6.574  -16.000 36.174  1.00 46.64  ? 426  LEU A N   1 
ATOM   3199 C  CA  . LEU A 1 427 ? -5.765  -16.881 37.018  1.00 44.25  ? 426  LEU A CA  1 
ATOM   3200 C  C   . LEU A 1 427 ? -6.629  -17.522 38.088  1.00 48.15  ? 426  LEU A C   1 
ATOM   3201 O  O   . LEU A 1 427 ? -6.242  -18.527 38.694  1.00 51.29  ? 426  LEU A O   1 
ATOM   3202 C  CB  . LEU A 1 427 ? -4.656  -16.100 37.689  1.00 42.83  ? 426  LEU A CB  1 
ATOM   3203 C  CG  . LEU A 1 427 ? -3.790  -15.247 36.774  1.00 41.05  ? 426  LEU A CG  1 
ATOM   3204 C  CD1 . LEU A 1 427 ? -2.658  -14.665 37.589  1.00 40.21  ? 426  LEU A CD1 1 
ATOM   3205 C  CD2 . LEU A 1 427 ? -3.283  -16.064 35.609  1.00 39.81  ? 426  LEU A CD2 1 
ATOM   3206 N  N   . TYR A 1 428 ? -7.793  -16.920 38.339  1.00 46.97  ? 427  TYR A N   1 
ATOM   3207 C  CA  . TYR A 1 428 ? -8.639  -17.334 39.429  1.00 46.23  ? 427  TYR A CA  1 
ATOM   3208 C  C   . TYR A 1 428 ? -9.886  -18.066 38.951  1.00 49.72  ? 427  TYR A C   1 
ATOM   3209 O  O   . TYR A 1 428 ? -10.859 -18.155 39.686  1.00 45.99  ? 427  TYR A O   1 
ATOM   3210 C  CB  . TYR A 1 428 ? -9.018  -16.104 40.267  1.00 45.19  ? 427  TYR A CB  1 
ATOM   3211 C  CG  . TYR A 1 428 ? -7.828  -15.278 40.594  1.00 40.95  ? 427  TYR A CG  1 
ATOM   3212 C  CD1 . TYR A 1 428 ? -6.911  -15.715 41.530  1.00 42.61  ? 427  TYR A CD1 1 
ATOM   3213 C  CD2 . TYR A 1 428 ? -7.574  -14.105 39.915  1.00 38.86  ? 427  TYR A CD2 1 
ATOM   3214 C  CE1 . TYR A 1 428 ? -5.787  -14.973 41.828  1.00 43.42  ? 427  TYR A CE1 1 
ATOM   3215 C  CE2 . TYR A 1 428 ? -6.459  -13.352 40.200  1.00 41.03  ? 427  TYR A CE2 1 
ATOM   3216 C  CZ  . TYR A 1 428 ? -5.584  -13.787 41.173  1.00 42.03  ? 427  TYR A CZ  1 
ATOM   3217 O  OH  . TYR A 1 428 ? -4.465  -13.059 41.472  1.00 49.37  ? 427  TYR A OH  1 
ATOM   3218 N  N   . GLU A 1 429 ? -9.853  -18.610 37.738  1.00 52.64  ? 428  GLU A N   1 
ATOM   3219 C  CA  . GLU A 1 429 ? -11.026 -19.291 37.200  1.00 54.66  ? 428  GLU A CA  1 
ATOM   3220 C  C   . GLU A 1 429 ? -11.642 -20.232 38.219  1.00 60.46  ? 428  GLU A C   1 
ATOM   3221 O  O   . GLU A 1 429 ? -10.921 -20.974 38.900  1.00 64.90  ? 428  GLU A O   1 
ATOM   3222 C  CB  . GLU A 1 429 ? -10.683 -20.096 35.946  1.00 54.05  ? 428  GLU A CB  1 
ATOM   3223 C  CG  . GLU A 1 429 ? -11.907 -20.547 35.142  1.00 52.90  ? 428  GLU A CG  1 
ATOM   3224 C  CD  . GLU A 1 429 ? -12.456 -19.458 34.222  1.00 54.42  ? 428  GLU A CD  1 
ATOM   3225 O  OE1 . GLU A 1 429 ? -11.638 -18.646 33.712  1.00 59.91  ? 428  GLU A OE1 1 
ATOM   3226 O  OE2 . GLU A 1 429 ? -13.687 -19.418 33.994  1.00 43.48  ? 428  GLU A OE2 1 
ATOM   3227 N  N   . ASN A 1 430 ? -12.972 -20.198 38.314  1.00 57.82  ? 429  ASN A N   1 
ATOM   3228 C  CA  . ASN A 1 430 ? -13.729 -21.113 39.170  1.00 56.68  ? 429  ASN A CA  1 
ATOM   3229 C  C   . ASN A 1 430 ? -13.612 -20.805 40.643  1.00 56.24  ? 429  ASN A C   1 
ATOM   3230 O  O   . ASN A 1 430 ? -14.275 -21.435 41.443  1.00 53.47  ? 429  ASN A O   1 
ATOM   3231 C  CB  . ASN A 1 430 ? -13.322 -22.589 38.982  1.00 55.68  ? 429  ASN A CB  1 
ATOM   3232 C  CG  . ASN A 1 430 ? -14.207 -23.326 37.995  1.00 57.00  ? 429  ASN A CG  1 
ATOM   3233 O  OD1 . ASN A 1 430 ? -15.429 -23.153 37.981  1.00 54.27  ? 429  ASN A OD1 1 
ATOM   3234 N  ND2 . ASN A 1 430 ? -13.598 -24.191 37.193  1.00 55.50  ? 429  ASN A ND2 1 
ATOM   3235 N  N   . MET A 1 431 ? -12.774 -19.842 41.009  1.00 58.28  ? 430  MET A N   1 
ATOM   3236 C  CA  . MET A 1 431 ? -12.618 -19.485 42.403  1.00 57.47  ? 430  MET A CA  1 
ATOM   3237 C  C   . MET A 1 431 ? -13.917 -18.884 42.926  1.00 61.23  ? 430  MET A C   1 
ATOM   3238 O  O   . MET A 1 431 ? -14.438 -17.889 42.399  1.00 60.39  ? 430  MET A O   1 
ATOM   3239 C  CB  . MET A 1 431 ? -11.469 -18.504 42.605  1.00 56.28  ? 430  MET A CB  1 
ATOM   3240 C  CG  . MET A 1 431 ? -11.035 -18.370 44.044  1.00 54.41  ? 430  MET A CG  1 
ATOM   3241 S  SD  . MET A 1 431 ? -10.376 -16.743 44.438  1.00 54.12  ? 430  MET A SD  1 
ATOM   3242 C  CE  . MET A 1 431 ? -9.109  -17.206 45.633  1.00 57.46  ? 430  MET A CE  1 
ATOM   3243 N  N   . ARG A 1 432 ? -14.427 -19.529 43.971  1.00 64.53  ? 431  ARG A N   1 
ATOM   3244 C  CA  . ARG A 1 432 ? -15.600 -19.094 44.717  1.00 60.39  ? 431  ARG A CA  1 
ATOM   3245 C  C   . ARG A 1 432 ? -15.143 -17.958 45.630  1.00 48.65  ? 431  ARG A C   1 
ATOM   3246 O  O   . ARG A 1 432 ? -14.378 -18.156 46.569  1.00 47.04  ? 431  ARG A O   1 
ATOM   3247 C  CB  . ARG A 1 432 ? -16.093 -20.314 45.503  1.00 75.19  ? 431  ARG A CB  1 
ATOM   3248 C  CG  . ARG A 1 432 ? -17.216 -20.203 46.532  1.00 87.72  ? 431  ARG A CG  1 
ATOM   3249 C  CD  . ARG A 1 432 ? -17.385 -21.587 47.192  1.00 91.94  ? 431  ARG A CD  1 
ATOM   3250 N  NE  . ARG A 1 432 ? -18.680 -21.830 47.834  1.00 91.60  ? 431  ARG A NE  1 
ATOM   3251 C  CZ  . ARG A 1 432 ? -19.840 -22.025 47.194  1.00 87.31  ? 431  ARG A CZ  1 
ATOM   3252 N  NH1 . ARG A 1 432 ? -19.924 -21.970 45.863  1.00 85.36  ? 431  ARG A NH1 1 
ATOM   3253 N  NH2 . ARG A 1 432 ? -20.940 -22.253 47.897  1.00 79.19  ? 431  ARG A NH2 1 
ATOM   3254 N  N   . CYS A 1 433 ? -15.573 -16.752 45.329  1.00 43.98  ? 432  CYS A N   1 
ATOM   3255 C  CA  . CYS A 1 433 ? -15.140 -15.608 46.087  1.00 46.52  ? 432  CYS A CA  1 
ATOM   3256 C  C   . CYS A 1 433 ? -16.292 -14.961 46.852  1.00 52.39  ? 432  CYS A C   1 
ATOM   3257 O  O   . CYS A 1 433 ? -17.315 -14.592 46.282  1.00 53.05  ? 432  CYS A O   1 
ATOM   3258 C  CB  . CYS A 1 433 ? -14.543 -14.554 45.160  1.00 49.86  ? 432  CYS A CB  1 
ATOM   3259 S  SG  . CYS A 1 433 ? -12.815 -14.825 44.668  0.75 46.66  ? 432  CYS A SG  1 
ATOM   3260 N  N   . HIS A 1 434 ? -16.113 -14.796 48.152  1.00 54.48  ? 433  HIS A N   1 
ATOM   3261 C  CA  . HIS A 1 434 ? -16.918 -13.817 48.887  1.00 56.95  ? 433  HIS A CA  1 
ATOM   3262 C  C   . HIS A 1 434 ? -16.332 -12.442 48.551  1.00 57.88  ? 433  HIS A C   1 
ATOM   3263 O  O   . HIS A 1 434 ? -15.162 -12.338 48.163  1.00 67.55  ? 433  HIS A O   1 
ATOM   3264 C  CB  . HIS A 1 434 ? -16.833 -14.024 50.395  1.00 53.99  ? 433  HIS A CB  1 
ATOM   3265 C  CG  . HIS A 1 434 ? -17.397 -15.326 50.863  1.00 50.44  ? 433  HIS A CG  1 
ATOM   3266 N  ND1 . HIS A 1 434 ? -16.637 -16.457 51.026  1.00 49.33  ? 433  HIS A ND1 1 
ATOM   3267 C  CD2 . HIS A 1 434 ? -18.653 -15.675 51.208  1.00 53.11  ? 433  HIS A CD2 1 
ATOM   3268 C  CE1 . HIS A 1 434 ? -17.382 -17.442 51.483  1.00 47.89  ? 433  HIS A CE1 1 
ATOM   3269 N  NE2 . HIS A 1 434 ? -18.614 -16.993 51.601  1.00 53.76  ? 433  HIS A NE2 1 
ATOM   3270 N  N   . GLY A 1 435 ? -17.084 -11.377 48.748  1.00 50.83  ? 434  GLY A N   1 
ATOM   3271 C  CA  . GLY A 1 435 ? -16.502 -10.045 48.551  1.00 45.88  ? 434  GLY A CA  1 
ATOM   3272 C  C   . GLY A 1 435 ? -16.813 -9.530  47.171  1.00 45.38  ? 434  GLY A C   1 
ATOM   3273 O  O   . GLY A 1 435 ? -16.280 -10.032 46.172  1.00 48.85  ? 434  GLY A O   1 
ATOM   3274 N  N   . VAL A 1 436 ? -17.653 -8.506  47.099  1.00 43.71  ? 435  VAL A N   1 
ATOM   3275 C  CA  . VAL A 1 436 ? -18.063 -7.963  45.814  1.00 43.10  ? 435  VAL A CA  1 
ATOM   3276 C  C   . VAL A 1 436 ? -18.467 -6.522  45.977  1.00 38.65  ? 435  VAL A C   1 
ATOM   3277 O  O   . VAL A 1 436 ? -19.242 -6.209  46.858  1.00 42.19  ? 435  VAL A O   1 
ATOM   3278 C  CB  . VAL A 1 436 ? -19.237 -8.790  45.210  1.00 44.88  ? 435  VAL A CB  1 
ATOM   3279 C  CG1 . VAL A 1 436 ? -20.173 -7.935  44.374  1.00 42.90  ? 435  VAL A CG1 1 
ATOM   3280 C  CG2 . VAL A 1 436 ? -18.681 -9.937  44.365  1.00 49.38  ? 435  VAL A CG2 1 
ATOM   3281 N  N   . PRO A 1 437 ? -17.956 -5.638  45.115  1.00 34.93  ? 436  PRO A N   1 
ATOM   3282 C  CA  . PRO A 1 437 ? -18.490 -4.292  45.163  1.00 35.06  ? 436  PRO A CA  1 
ATOM   3283 C  C   . PRO A 1 437 ? -19.872 -4.210  44.542  1.00 37.92  ? 436  PRO A C   1 
ATOM   3284 O  O   . PRO A 1 437 ? -20.087 -4.711  43.430  1.00 39.92  ? 436  PRO A O   1 
ATOM   3285 C  CB  . PRO A 1 437 ? -17.495 -3.488  44.330  1.00 33.52  ? 436  PRO A CB  1 
ATOM   3286 C  CG  . PRO A 1 437 ? -16.950 -4.467  43.371  1.00 32.96  ? 436  PRO A CG  1 
ATOM   3287 C  CD  . PRO A 1 437 ? -16.907 -5.778  44.096  1.00 33.22  ? 436  PRO A CD  1 
ATOM   3288 N  N   . LEU A 1 438 ? -20.806 -3.612  45.271  1.00 40.97  ? 437  LEU A N   1 
ATOM   3289 C  CA  . LEU A 1 438 ? -22.129 -3.348  44.740  1.00 41.96  ? 437  LEU A CA  1 
ATOM   3290 C  C   . LEU A 1 438 ? -22.159 -2.021  44.021  1.00 39.67  ? 437  LEU A C   1 
ATOM   3291 O  O   . LEU A 1 438 ? -22.684 -1.928  42.912  1.00 41.65  ? 437  LEU A O   1 
ATOM   3292 C  CB  . LEU A 1 438 ? -23.137 -3.338  45.860  1.00 45.00  ? 437  LEU A CB  1 
ATOM   3293 C  CG  . LEU A 1 438 ? -23.087 -4.596  46.708  1.00 50.89  ? 437  LEU A CG  1 
ATOM   3294 C  CD1 . LEU A 1 438 ? -24.299 -4.629  47.640  1.00 52.85  ? 437  LEU A CD1 1 
ATOM   3295 C  CD2 . LEU A 1 438 ? -23.048 -5.845  45.844  1.00 52.12  ? 437  LEU A CD2 1 
ATOM   3296 N  N   . VAL A 1 439 ? -21.578 -1.013  44.650  1.00 35.76  ? 438  VAL A N   1 
ATOM   3297 C  CA  . VAL A 1 439 ? -21.499 0.324   44.076  1.00 36.90  ? 438  VAL A CA  1 
ATOM   3298 C  C   . VAL A 1 439 ? -20.075 0.872   44.141  1.00 36.87  ? 438  VAL A C   1 
ATOM   3299 O  O   . VAL A 1 439 ? -19.384 0.707   45.165  1.00 38.86  ? 438  VAL A O   1 
ATOM   3300 C  CB  . VAL A 1 439 ? -22.385 1.315   44.845  1.00 39.79  ? 438  VAL A CB  1 
ATOM   3301 C  CG1 . VAL A 1 439 ? -22.320 2.706   44.219  1.00 41.05  ? 438  VAL A CG1 1 
ATOM   3302 C  CG2 . VAL A 1 439 ? -23.811 0.796   44.907  1.00 42.57  ? 438  VAL A CG2 1 
ATOM   3303 N  N   . THR A 1 440 ? -19.636 1.499   43.048  1.00 35.34  ? 439  THR A N   1 
ATOM   3304 C  CA  . THR A 1 440 ? -18.327 2.148   43.000  1.00 36.68  ? 439  THR A CA  1 
ATOM   3305 C  C   . THR A 1 440 ? -18.471 3.604   42.655  1.00 34.51  ? 439  THR A C   1 
ATOM   3306 O  O   . THR A 1 440 ? -18.847 3.933   41.544  1.00 33.02  ? 439  THR A O   1 
ATOM   3307 C  CB  . THR A 1 440 ? -17.367 1.534   41.965  1.00 38.20  ? 439  THR A CB  1 
ATOM   3308 O  OG1 . THR A 1 440 ? -17.151 0.139   42.254  1.00 40.30  ? 439  THR A OG1 1 
ATOM   3309 C  CG2 . THR A 1 440 ? -16.019 2.277   41.979  1.00 36.61  ? 439  THR A CG2 1 
ATOM   3310 N  N   . ILE A 1 441 ? -18.185 4.457   43.638  1.00 33.09  ? 440  ILE A N   1 
ATOM   3311 C  CA  . ILE A 1 441 ? -18.209 5.882   43.462  1.00 32.77  ? 440  ILE A CA  1 
ATOM   3312 C  C   . ILE A 1 441 ? -16.784 6.367   43.274  1.00 33.83  ? 440  ILE A C   1 
ATOM   3313 O  O   . ILE A 1 441 ? -15.911 6.132   44.110  1.00 38.64  ? 440  ILE A O   1 
ATOM   3314 C  CB  . ILE A 1 441 ? -18.864 6.605   44.667  1.00 34.01  ? 440  ILE A CB  1 
ATOM   3315 C  CG1 . ILE A 1 441 ? -20.352 6.220   44.794  1.00 35.69  ? 440  ILE A CG1 1 
ATOM   3316 C  CG2 . ILE A 1 441 ? -18.709 8.125   44.553  1.00 31.97  ? 440  ILE A CG2 1 
ATOM   3317 C  CD1 . ILE A 1 441 ? -20.858 6.120   46.231  1.00 34.42  ? 440  ILE A CD1 1 
ATOM   3318 N  N   . SER A 1 442 ? -16.581 7.084   42.172  1.00 33.93  ? 441  SER A N   1 
ATOM   3319 C  CA  . SER A 1 442 ? -15.317 7.734   41.817  1.00 33.75  ? 441  SER A CA  1 
ATOM   3320 C  C   . SER A 1 442 ? -15.561 9.234   41.630  1.00 33.45  ? 441  SER A C   1 
ATOM   3321 O  O   . SER A 1 442 ? -16.509 9.631   40.952  1.00 40.52  ? 441  SER A O   1 
ATOM   3322 C  CB  . SER A 1 442 ? -14.754 7.137   40.520  1.00 33.32  ? 441  SER A CB  1 
ATOM   3323 O  OG  . SER A 1 442 ? -13.545 7.775   40.116  1.00 35.69  ? 441  SER A OG  1 
ATOM   3324 N  N   . ARG A 1 443 ? -14.721 10.061  42.231  1.00 29.45  ? 442  ARG A N   1 
ATOM   3325 C  CA  . ARG A 1 443 ? -14.892 11.505  42.142  1.00 30.97  ? 442  ARG A CA  1 
ATOM   3326 C  C   . ARG A 1 443 ? -16.331 11.991  42.494  1.00 31.50  ? 442  ARG A C   1 
ATOM   3327 O  O   . ARG A 1 443 ? -16.879 12.889  41.846  1.00 30.09  ? 442  ARG A O   1 
ATOM   3328 C  CB  . ARG A 1 443 ? -14.489 11.985  40.752  1.00 28.79  ? 442  ARG A CB  1 
ATOM   3329 C  CG  . ARG A 1 443 ? -13.080 11.641  40.369  1.00 29.07  ? 442  ARG A CG  1 
ATOM   3330 C  CD  . ARG A 1 443 ? -12.717 12.188  39.009  1.00 28.43  ? 442  ARG A CD  1 
ATOM   3331 N  NE  . ARG A 1 443 ? -12.750 13.641  38.981  1.00 28.59  ? 442  ARG A NE  1 
ATOM   3332 C  CZ  . ARG A 1 443 ? -11.787 14.427  39.434  1.00 30.72  ? 442  ARG A CZ  1 
ATOM   3333 N  NH1 . ARG A 1 443 ? -10.683 13.936  40.021  1.00 32.93  ? 442  ARG A NH1 1 
ATOM   3334 N  NH2 . ARG A 1 443 ? -11.942 15.726  39.326  1.00 31.84  ? 442  ARG A NH2 1 
ATOM   3335 N  N   . GLY A 1 444 ? -16.914 11.382  43.519  1.00 32.38  ? 443  GLY A N   1 
ATOM   3336 C  CA  . GLY A 1 444 ? -18.265 11.688  43.942  1.00 34.57  ? 443  GLY A CA  1 
ATOM   3337 C  C   . GLY A 1 444 ? -19.328 11.475  42.888  1.00 37.63  ? 443  GLY A C   1 
ATOM   3338 O  O   . GLY A 1 444 ? -20.322 12.190  42.873  1.00 34.89  ? 443  GLY A O   1 
ATOM   3339 N  N   . ARG A 1 445 ? -19.097 10.521  41.987  1.00 43.39  ? 444  ARG A N   1 
ATOM   3340 C  CA  . ARG A 1 445 ? -20.098 10.091  41.003  1.00 48.30  ? 444  ARG A CA  1 
ATOM   3341 C  C   . ARG A 1 445 ? -20.203 8.574   41.014  1.00 45.37  ? 444  ARG A C   1 
ATOM   3342 O  O   . ARG A 1 445 ? -19.219 7.874   41.264  1.00 47.32  ? 444  ARG A O   1 
ATOM   3343 C  CB  . ARG A 1 445 ? -19.701 10.524  39.588  1.00 60.65  ? 444  ARG A CB  1 
ATOM   3344 C  CG  . ARG A 1 445 ? -19.735 12.022  39.331  1.00 71.73  ? 444  ARG A CG  1 
ATOM   3345 C  CD  . ARG A 1 445 ? -19.297 12.337  37.900  1.00 80.49  ? 444  ARG A CD  1 
ATOM   3346 N  NE  . ARG A 1 445 ? -19.259 13.775  37.594  1.00 86.04  ? 444  ARG A NE  1 
ATOM   3347 C  CZ  . ARG A 1 445 ? -20.324 14.521  37.293  1.00 87.63  ? 444  ARG A CZ  1 
ATOM   3348 N  NH1 . ARG A 1 445 ? -21.556 13.991  37.272  1.00 87.33  ? 444  ARG A NH1 1 
ATOM   3349 N  NH2 . ARG A 1 445 ? -20.154 15.811  37.015  1.00 78.24  ? 444  ARG A NH2 1 
ATOM   3350 N  N   . VAL A 1 446 ? -21.389 8.051   40.743  1.00 40.14  ? 445  VAL A N   1 
ATOM   3351 C  CA  . VAL A 1 446 ? -21.538 6.619   40.752  1.00 38.90  ? 445  VAL A CA  1 
ATOM   3352 C  C   . VAL A 1 446 ? -21.156 6.097   39.382  1.00 36.85  ? 445  VAL A C   1 
ATOM   3353 O  O   . VAL A 1 446 ? -21.819 6.388   38.399  1.00 36.32  ? 445  VAL A O   1 
ATOM   3354 C  CB  . VAL A 1 446 ? -22.971 6.211   41.126  1.00 40.24  ? 445  VAL A CB  1 
ATOM   3355 C  CG1 . VAL A 1 446 ? -23.154 4.705   40.991  1.00 40.61  ? 445  VAL A CG1 1 
ATOM   3356 C  CG2 . VAL A 1 446 ? -23.301 6.646   42.544  1.00 41.37  ? 445  VAL A CG2 1 
ATOM   3357 N  N   . VAL A 1 447 ? -20.097 5.309   39.300  1.00 35.69  ? 446  VAL A N   1 
ATOM   3358 C  CA  . VAL A 1 447 ? -19.672 4.816   37.998  1.00 36.03  ? 446  VAL A CA  1 
ATOM   3359 C  C   . VAL A 1 447 ? -20.049 3.375   37.757  1.00 39.32  ? 446  VAL A C   1 
ATOM   3360 O  O   . VAL A 1 447 ? -20.019 2.905   36.604  1.00 43.95  ? 446  VAL A O   1 
ATOM   3361 C  CB  . VAL A 1 447 ? -18.165 5.005   37.755  1.00 36.17  ? 446  VAL A CB  1 
ATOM   3362 C  CG1 . VAL A 1 447 ? -17.830 6.480   37.744  1.00 37.93  ? 446  VAL A CG1 1 
ATOM   3363 C  CG2 . VAL A 1 447 ? -17.315 4.301   38.790  1.00 36.08  ? 446  VAL A CG2 1 
ATOM   3364 N  N   . TYR A 1 448 ? -20.403 2.665   38.827  1.00 39.30  ? 447  TYR A N   1 
ATOM   3365 C  CA  . TYR A 1 448 ? -20.805 1.265   38.692  1.00 37.72  ? 447  TYR A CA  1 
ATOM   3366 C  C   . TYR A 1 448 ? -21.809 0.896   39.760  1.00 40.35  ? 447  TYR A C   1 
ATOM   3367 O  O   . TYR A 1 448 ? -21.513 0.967   40.942  1.00 40.02  ? 447  TYR A O   1 
ATOM   3368 C  CB  . TYR A 1 448 ? -19.609 0.395   38.813  1.00 34.68  ? 447  TYR A CB  1 
ATOM   3369 C  CG  . TYR A 1 448 ? -19.883 -1.073  38.853  1.00 33.85  ? 447  TYR A CG  1 
ATOM   3370 C  CD1 . TYR A 1 448 ? -20.136 -1.771  37.713  1.00 31.71  ? 447  TYR A CD1 1 
ATOM   3371 C  CD2 . TYR A 1 448 ? -19.784 -1.795  40.056  1.00 36.29  ? 447  TYR A CD2 1 
ATOM   3372 C  CE1 . TYR A 1 448 ? -20.341 -3.145  37.751  1.00 33.04  ? 447  TYR A CE1 1 
ATOM   3373 C  CE2 . TYR A 1 448 ? -19.969 -3.184  40.093  1.00 35.08  ? 447  TYR A CE2 1 
ATOM   3374 C  CZ  . TYR A 1 448 ? -20.253 -3.838  38.923  1.00 31.24  ? 447  TYR A CZ  1 
ATOM   3375 O  OH  . TYR A 1 448 ? -20.481 -5.160  38.903  1.00 27.56  ? 447  TYR A OH  1 
ATOM   3376 N  N   . GLU A 1 449 ? -22.998 0.491   39.308  1.00 45.28  ? 448  GLU A N   1 
ATOM   3377 C  CA  . GLU A 1 449 ? -24.098 0.115   40.177  1.00 48.22  ? 448  GLU A CA  1 
ATOM   3378 C  C   . GLU A 1 449 ? -24.933 -0.977  39.501  1.00 45.55  ? 448  GLU A C   1 
ATOM   3379 O  O   . GLU A 1 449 ? -24.994 -1.037  38.295  1.00 40.47  ? 448  GLU A O   1 
ATOM   3380 C  CB  . GLU A 1 449 ? -24.942 1.356   40.494  1.00 50.22  ? 448  GLU A CB  1 
ATOM   3381 C  CG  . GLU A 1 449 ? -26.079 1.140   41.500  1.00 54.07  ? 448  GLU A CG  1 
ATOM   3382 C  CD  . GLU A 1 449 ? -26.805 2.434   41.851  1.00 56.89  ? 448  GLU A CD  1 
ATOM   3383 O  OE1 . GLU A 1 449 ? -26.632 3.438   41.116  1.00 54.01  ? 448  GLU A OE1 1 
ATOM   3384 O  OE2 . GLU A 1 449 ? -27.528 2.449   42.882  1.00 58.92  ? 448  GLU A OE2 1 
ATOM   3385 N  N   . ASN A 1 450 ? -25.562 -1.839  40.296  1.00 55.78  ? 449  ASN A N   1 
ATOM   3386 C  CA  . ASN A 1 450 ? -26.447 -2.904  39.775  1.00 62.64  ? 449  ASN A CA  1 
ATOM   3387 C  C   . ASN A 1 450 ? -25.742 -3.827  38.773  1.00 60.08  ? 449  ASN A C   1 
ATOM   3388 O  O   . ASN A 1 450 ? -26.386 -4.435  37.932  1.00 55.26  ? 449  ASN A O   1 
ATOM   3389 C  CB  . ASN A 1 450 ? -27.730 -2.296  39.129  1.00 66.43  ? 449  ASN A CB  1 
ATOM   3390 C  CG  . ASN A 1 450 ? -28.686 -1.678  40.160  1.00 76.74  ? 449  ASN A CG  1 
ATOM   3391 O  OD1 . ASN A 1 450 ? -29.033 -0.488  40.089  1.00 74.38  ? 449  ASN A OD1 1 
ATOM   3392 N  ND2 . ASN A 1 450 ? -29.120 -2.496  41.126  1.00 80.34  ? 449  ASN A ND2 1 
ATOM   3393 N  N   . GLY A 1 451 ? -24.418 -3.918  38.848  1.00 59.48  ? 450  GLY A N   1 
ATOM   3394 C  CA  . GLY A 1 451 ? -23.652 -4.622  37.802  1.00 57.53  ? 450  GLY A CA  1 
ATOM   3395 C  C   . GLY A 1 451 ? -23.522 -3.865  36.471  1.00 52.96  ? 450  GLY A C   1 
ATOM   3396 O  O   . GLY A 1 451 ? -23.126 -4.430  35.459  1.00 44.29  ? 450  GLY A O   1 
ATOM   3397 N  N   . VAL A 1 452 ? -23.831 -2.573  36.483  1.00 48.89  ? 451  VAL A N   1 
ATOM   3398 C  CA  . VAL A 1 452 ? -23.848 -1.783  35.279  1.00 47.90  ? 451  VAL A CA  1 
ATOM   3399 C  C   . VAL A 1 452 ? -22.843 -0.641  35.357  1.00 48.13  ? 451  VAL A C   1 
ATOM   3400 O  O   . VAL A 1 452 ? -22.878 0.195   36.251  1.00 44.48  ? 451  VAL A O   1 
ATOM   3401 C  CB  . VAL A 1 452 ? -25.262 -1.225  35.004  1.00 49.87  ? 451  VAL A CB  1 
ATOM   3402 C  CG1 . VAL A 1 452 ? -25.274 -0.370  33.741  1.00 47.72  ? 451  VAL A CG1 1 
ATOM   3403 C  CG2 . VAL A 1 452 ? -26.247 -2.381  34.886  1.00 49.47  ? 451  VAL A CG2 1 
ATOM   3404 N  N   . PHE A 1 453 ? -21.943 -0.609  34.385  1.00 51.43  ? 452  PHE A N   1 
ATOM   3405 C  CA  . PHE A 1 453 ? -20.920 0.409   34.345  1.00 48.28  ? 452  PHE A CA  1 
ATOM   3406 C  C   . PHE A 1 453 ? -21.424 1.575   33.568  1.00 47.08  ? 452  PHE A C   1 
ATOM   3407 O  O   . PHE A 1 453 ? -22.004 1.389   32.537  1.00 52.97  ? 452  PHE A O   1 
ATOM   3408 C  CB  . PHE A 1 453 ? -19.679 -0.130  33.662  1.00 46.95  ? 452  PHE A CB  1 
ATOM   3409 C  CG  . PHE A 1 453 ? -18.543 0.831   33.689  1.00 47.45  ? 452  PHE A CG  1 
ATOM   3410 C  CD1 . PHE A 1 453 ? -17.824 1.027   34.861  1.00 46.44  ? 452  PHE A CD1 1 
ATOM   3411 C  CD2 . PHE A 1 453 ? -18.209 1.565   32.561  1.00 46.55  ? 452  PHE A CD2 1 
ATOM   3412 C  CE1 . PHE A 1 453 ? -16.787 1.924   34.903  1.00 46.13  ? 452  PHE A CE1 1 
ATOM   3413 C  CE2 . PHE A 1 453 ? -17.167 2.464   32.597  1.00 44.30  ? 452  PHE A CE2 1 
ATOM   3414 C  CZ  . PHE A 1 453 ? -16.458 2.646   33.768  1.00 45.73  ? 452  PHE A CZ  1 
ATOM   3415 N  N   . MET A 1 454 ? -21.193 2.783   34.047  1.00 49.15  ? 453  MET A N   1 
ATOM   3416 C  CA  . MET A 1 454 ? -21.582 3.981   33.294  1.00 51.19  ? 453  MET A CA  1 
ATOM   3417 C  C   . MET A 1 454 ? -20.569 5.088   33.576  1.00 54.40  ? 453  MET A C   1 
ATOM   3418 O  O   . MET A 1 454 ? -20.538 5.615   34.678  1.00 53.56  ? 453  MET A O   1 
ATOM   3419 C  CB  . MET A 1 454 ? -23.021 4.436   33.669  1.00 54.94  ? 453  MET A CB  1 
ATOM   3420 C  CG  . MET A 1 454 ? -23.248 4.707   35.175  1.00 63.35  ? 453  MET A CG  1 
ATOM   3421 S  SD  . MET A 1 454 ? -24.954 4.629   35.846  0.60 53.09  ? 453  MET A SD  1 
ATOM   3422 C  CE  . MET A 1 454 ? -25.178 2.916   36.256  1.00 50.20  ? 453  MET A CE  1 
ATOM   3423 N  N   . CYS A 1 455 ? -19.720 5.424   32.595  1.00 58.54  ? 454  CYS A N   1 
ATOM   3424 C  CA  . CYS A 1 455 ? -18.718 6.497   32.756  1.00 54.41  ? 454  CYS A CA  1 
ATOM   3425 C  C   . CYS A 1 455 ? -18.064 6.927   31.444  1.00 56.40  ? 454  CYS A C   1 
ATOM   3426 O  O   . CYS A 1 455 ? -17.663 6.096   30.620  1.00 57.75  ? 454  CYS A O   1 
ATOM   3427 C  CB  . CYS A 1 455 ? -17.593 6.051   33.706  1.00 58.97  ? 454  CYS A CB  1 
ATOM   3428 S  SG  . CYS A 1 455 ? -16.527 7.389   34.333  0.70 57.66  ? 454  CYS A SG  1 
ATOM   3429 N  N   . ALA A 1 456 ? -17.902 8.239   31.289  1.00 60.75  ? 455  ALA A N   1 
ATOM   3430 C  CA  . ALA A 1 456 ? -17.220 8.833   30.123  1.00 58.30  ? 455  ALA A CA  1 
ATOM   3431 C  C   . ALA A 1 456 ? -15.685 8.707   30.182  1.00 59.00  ? 455  ALA A C   1 
ATOM   3432 O  O   . ALA A 1 456 ? -15.065 8.952   31.227  1.00 56.66  ? 455  ALA A O   1 
ATOM   3433 C  CB  . ALA A 1 456 ? -17.612 10.306  29.981  1.00 53.60  ? 455  ALA A CB  1 
ATOM   3434 N  N   . GLU A 1 457 ? -15.084 8.334   29.049  1.00 56.29  ? 456  GLU A N   1 
ATOM   3435 C  CA  . GLU A 1 457 ? -13.640 8.424   28.889  1.00 51.38  ? 456  GLU A CA  1 
ATOM   3436 C  C   . GLU A 1 457 ? -13.225 9.801   29.382  1.00 47.55  ? 456  GLU A C   1 
ATOM   3437 O  O   . GLU A 1 457 ? -13.886 10.791  29.079  1.00 43.14  ? 456  GLU A O   1 
ATOM   3438 C  CB  . GLU A 1 457 ? -13.210 8.317   27.414  1.00 55.51  ? 456  GLU A CB  1 
ATOM   3439 C  CG  . GLU A 1 457 ? -13.949 7.336   26.502  1.00 57.80  ? 456  GLU A CG  1 
ATOM   3440 C  CD  . GLU A 1 457 ? -13.343 7.300   25.088  1.00 60.21  ? 456  GLU A CD  1 
ATOM   3441 O  OE1 . GLU A 1 457 ? -12.758 8.309   24.636  1.00 56.14  ? 456  GLU A OE1 1 
ATOM   3442 O  OE2 . GLU A 1 457 ? -13.437 6.255   24.414  1.00 62.95  ? 456  GLU A OE2 1 
ATOM   3443 N  N   . GLY A 1 458 ? -12.122 9.874   30.116  1.00 47.19  ? 457  GLY A N   1 
ATOM   3444 C  CA  . GLY A 1 458 ? -11.482 11.170  30.452  1.00 44.47  ? 457  GLY A CA  1 
ATOM   3445 C  C   . GLY A 1 458 ? -12.034 11.890  31.648  1.00 40.31  ? 457  GLY A C   1 
ATOM   3446 O  O   . GLY A 1 458 ? -11.542 12.934  32.045  1.00 39.09  ? 457  GLY A O   1 
ATOM   3447 N  N   . THR A 1 459 ? -13.070 11.309  32.225  1.00 45.58  ? 458  THR A N   1 
ATOM   3448 C  CA  . THR A 1 459 ? -13.660 11.762  33.478  1.00 47.61  ? 458  THR A CA  1 
ATOM   3449 C  C   . THR A 1 459 ? -12.651 11.756  34.650  1.00 43.68  ? 458  THR A C   1 
ATOM   3450 O  O   . THR A 1 459 ? -12.745 12.589  35.558  1.00 40.20  ? 458  THR A O   1 
ATOM   3451 C  CB  . THR A 1 459 ? -14.819 10.829  33.849  1.00 49.41  ? 458  THR A CB  1 
ATOM   3452 O  OG1 . THR A 1 459 ? -15.734 10.774  32.765  1.00 43.67  ? 458  THR A OG1 1 
ATOM   3453 C  CG2 . THR A 1 459 ? -15.528 11.310  35.120  1.00 58.22  ? 458  THR A CG2 1 
ATOM   3454 N  N   . GLY A 1 460 ? -11.728 10.791  34.614  1.00 38.44  ? 459  GLY A N   1 
ATOM   3455 C  CA  . GLY A 1 460 ? -10.674 10.665  35.598  1.00 38.50  ? 459  GLY A CA  1 
ATOM   3456 C  C   . GLY A 1 460 ? -9.586  11.710  35.458  1.00 38.40  ? 459  GLY A C   1 
ATOM   3457 O  O   . GLY A 1 460 ? -9.377  12.273  34.387  1.00 39.02  ? 459  GLY A O   1 
ATOM   3458 N  N   . LYS A 1 461 ? -8.863  11.953  36.545  1.00 38.94  ? 460  LYS A N   1 
ATOM   3459 C  CA  . LYS A 1 461 ? -7.820  12.975  36.551  1.00 38.99  ? 460  LYS A CA  1 
ATOM   3460 C  C   . LYS A 1 461 ? -6.490  12.487  37.104  1.00 38.53  ? 460  LYS A C   1 
ATOM   3461 O  O   . LYS A 1 461 ? -6.409  11.825  38.144  1.00 41.62  ? 460  LYS A O   1 
ATOM   3462 C  CB  . LYS A 1 461 ? -8.258  14.208  37.332  1.00 39.19  ? 460  LYS A CB  1 
ATOM   3463 C  CG  . LYS A 1 461 ? -9.457  14.917  36.742  1.00 43.85  ? 460  LYS A CG  1 
ATOM   3464 C  CD  . LYS A 1 461 ? -9.111  15.686  35.487  1.00 49.84  ? 460  LYS A CD  1 
ATOM   3465 C  CE  . LYS A 1 461 ? -10.328 15.915  34.615  1.00 60.32  ? 460  LYS A CE  1 
ATOM   3466 N  NZ  . LYS A 1 461 ? -9.905  16.205  33.216  1.00 65.95  ? 460  LYS A NZ  1 
ATOM   3467 N  N   . PHE A 1 462 ? -5.432  12.790  36.363  1.00 37.27  ? 461  PHE A N   1 
ATOM   3468 C  CA  . PHE A 1 462 ? -4.094  12.674  36.886  1.00 33.98  ? 461  PHE A CA  1 
ATOM   3469 C  C   . PHE A 1 462 ? -4.066  13.418  38.219  1.00 33.31  ? 461  PHE A C   1 
ATOM   3470 O  O   . PHE A 1 462 ? -4.613  14.502  38.331  1.00 30.66  ? 461  PHE A O   1 
ATOM   3471 C  CB  . PHE A 1 462 ? -3.087  13.272  35.913  1.00 32.91  ? 461  PHE A CB  1 
ATOM   3472 C  CG  . PHE A 1 462 ? -1.670  13.211  36.406  1.00 33.09  ? 461  PHE A CG  1 
ATOM   3473 C  CD1 . PHE A 1 462 ? -1.144  14.223  37.229  1.00 33.65  ? 461  PHE A CD1 1 
ATOM   3474 C  CD2 . PHE A 1 462 ? -0.868  12.136  36.078  1.00 32.24  ? 461  PHE A CD2 1 
ATOM   3475 C  CE1 . PHE A 1 462 ? 0.156   14.156  37.699  1.00 31.11  ? 461  PHE A CE1 1 
ATOM   3476 C  CE2 . PHE A 1 462 ? 0.425   12.067  36.547  1.00 31.02  ? 461  PHE A CE2 1 
ATOM   3477 C  CZ  . PHE A 1 462 ? 0.931   13.060  37.365  1.00 30.95  ? 461  PHE A CZ  1 
ATOM   3478 N  N   . CYS A 1 463 ? -3.434  12.813  39.217  1.00 34.29  ? 462  CYS A N   1 
ATOM   3479 C  CA  . CYS A 1 463 ? -3.289  13.410  40.544  1.00 32.93  ? 462  CYS A CA  1 
ATOM   3480 C  C   . CYS A 1 463 ? -1.833  13.647  40.857  1.00 31.70  ? 462  CYS A C   1 
ATOM   3481 O  O   . CYS A 1 463 ? -1.107  12.739  41.249  1.00 29.61  ? 462  CYS A O   1 
ATOM   3482 C  CB  . CYS A 1 463 ? -3.887  12.478  41.605  1.00 33.56  ? 462  CYS A CB  1 
ATOM   3483 S  SG  . CYS A 1 463 ? -5.662  12.232  41.317  0.84 35.10  ? 462  CYS A SG  1 
ATOM   3484 N  N   . PRO A 1 464 ? -1.378  14.877  40.674  1.00 32.74  ? 463  PRO A N   1 
ATOM   3485 C  CA  . PRO A 1 464 ? 0.003   15.160  41.030  1.00 33.78  ? 463  PRO A CA  1 
ATOM   3486 C  C   . PRO A 1 464 ? 0.352   14.588  42.391  1.00 33.03  ? 463  PRO A C   1 
ATOM   3487 O  O   . PRO A 1 464 ? -0.390  14.827  43.321  1.00 33.95  ? 463  PRO A O   1 
ATOM   3488 C  CB  . PRO A 1 464 ? 0.030   16.688  41.046  1.00 30.81  ? 463  PRO A CB  1 
ATOM   3489 C  CG  . PRO A 1 464 ? -0.910  17.040  39.969  1.00 31.55  ? 463  PRO A CG  1 
ATOM   3490 C  CD  . PRO A 1 464 ? -2.041  16.053  40.102  1.00 32.37  ? 463  PRO A CD  1 
ATOM   3491 N  N   . LEU A 1 465 ? 1.463   13.851  42.479  1.00 34.38  ? 464  LEU A N   1 
ATOM   3492 C  CA  . LEU A 1 465 ? 1.969   13.281  43.738  1.00 38.62  ? 464  LEU A CA  1 
ATOM   3493 C  C   . LEU A 1 465 ? 3.091   14.098  44.385  1.00 42.45  ? 464  LEU A C   1 
ATOM   3494 O  O   . LEU A 1 465 ? 4.127   14.273  43.778  1.00 43.96  ? 464  LEU A O   1 
ATOM   3495 C  CB  . LEU A 1 465 ? 2.499   11.876  43.505  1.00 38.26  ? 464  LEU A CB  1 
ATOM   3496 C  CG  . LEU A 1 465 ? 1.480   10.866  42.980  1.00 41.80  ? 464  LEU A CG  1 
ATOM   3497 C  CD1 . LEU A 1 465 ? 2.065   9.462   42.988  1.00 41.64  ? 464  LEU A CD1 1 
ATOM   3498 C  CD2 . LEU A 1 465 ? 0.199   10.911  43.797  1.00 42.87  ? 464  LEU A CD2 1 
ATOM   3499 N  N   . ARG A 1 466 ? 2.902   14.553  45.632  1.00 47.09  ? 465  ARG A N   1 
ATOM   3500 C  CA  . ARG A 1 466 ? 3.879   15.442  46.270  1.00 46.02  ? 465  ARG A CA  1 
ATOM   3501 C  C   . ARG A 1 466 ? 5.092   14.667  46.780  1.00 40.71  ? 465  ARG A C   1 
ATOM   3502 O  O   . ARG A 1 466 ? 4.961   13.597  47.361  1.00 41.18  ? 465  ARG A O   1 
ATOM   3503 C  CB  . ARG A 1 466 ? 3.248   16.302  47.403  1.00 51.53  ? 465  ARG A CB  1 
ATOM   3504 C  CG  . ARG A 1 466 ? 4.034   17.606  47.699  1.00 59.46  ? 465  ARG A CG  1 
ATOM   3505 C  CD  . ARG A 1 466 ? 3.884   18.181  49.110  1.00 65.92  ? 465  ARG A CD  1 
ATOM   3506 N  NE  . ARG A 1 466 ? 4.507   17.315  50.138  1.00 79.45  ? 465  ARG A NE  1 
ATOM   3507 C  CZ  . ARG A 1 466 ? 4.170   17.262  51.438  1.00 72.29  ? 465  ARG A CZ  1 
ATOM   3508 N  NH1 . ARG A 1 466 ? 3.200   18.046  51.918  1.00 68.41  ? 465  ARG A NH1 1 
ATOM   3509 N  NH2 . ARG A 1 466 ? 4.802   16.401  52.256  1.00 55.96  ? 465  ARG A NH2 1 
ATOM   3510 N  N   . SER A 1 467 ? 6.271   15.238  46.592  1.00 37.86  ? 466  SER A N   1 
ATOM   3511 C  CA  . SER A 1 467 ? 7.512   14.639  47.074  1.00 36.41  ? 466  SER A CA  1 
ATOM   3512 C  C   . SER A 1 467 ? 7.576   14.559  48.614  1.00 35.40  ? 466  SER A C   1 
ATOM   3513 O  O   . SER A 1 467 ? 6.774   15.158  49.289  1.00 36.01  ? 466  SER A O   1 
ATOM   3514 C  CB  . SER A 1 467 ? 8.702   15.466  46.586  1.00 36.00  ? 466  SER A CB  1 
ATOM   3515 O  OG  . SER A 1 467 ? 8.837   16.686  47.310  1.00 31.01  ? 466  SER A OG  1 
ATOM   3516 N  N   . PHE A 1 468 ? 8.579   13.864  49.133  1.00 33.84  ? 467  PHE A N   1 
ATOM   3517 C  CA  . PHE A 1 468 ? 8.810   13.712  50.560  1.00 33.39  ? 467  PHE A CA  1 
ATOM   3518 C  C   . PHE A 1 468 ? 7.580   13.201  51.323  1.00 35.62  ? 467  PHE A C   1 
ATOM   3519 O  O   . PHE A 1 468 ? 7.147   13.783  52.304  1.00 36.57  ? 467  PHE A O   1 
ATOM   3520 C  CB  . PHE A 1 468 ? 9.304   15.017  51.155  1.00 32.50  ? 467  PHE A CB  1 
ATOM   3521 C  CG  . PHE A 1 468 ? 10.691  15.358  50.783  1.00 33.92  ? 467  PHE A CG  1 
ATOM   3522 C  CD1 . PHE A 1 468 ? 11.748  14.714  51.391  1.00 36.32  ? 467  PHE A CD1 1 
ATOM   3523 C  CD2 . PHE A 1 468 ? 10.966  16.347  49.842  1.00 36.12  ? 467  PHE A CD2 1 
ATOM   3524 C  CE1 . PHE A 1 468 ? 13.072  15.027  51.063  1.00 39.45  ? 467  PHE A CE1 1 
ATOM   3525 C  CE2 . PHE A 1 468 ? 12.286  16.677  49.509  1.00 37.43  ? 467  PHE A CE2 1 
ATOM   3526 C  CZ  . PHE A 1 468 ? 13.344  16.006  50.110  1.00 38.33  ? 467  PHE A CZ  1 
ATOM   3527 N  N   . PRO A 1 469 ? 7.022   12.082  50.885  1.00 37.34  ? 468  PRO A N   1 
ATOM   3528 C  CA  . PRO A 1 469 ? 5.908   11.494  51.604  1.00 36.51  ? 468  PRO A CA  1 
ATOM   3529 C  C   . PRO A 1 469 ? 6.186   11.297  53.080  1.00 37.71  ? 468  PRO A C   1 
ATOM   3530 O  O   . PRO A 1 469 ? 7.083   10.554  53.436  1.00 35.65  ? 468  PRO A O   1 
ATOM   3531 C  CB  . PRO A 1 469 ? 5.764   10.118  50.964  1.00 37.81  ? 468  PRO A CB  1 
ATOM   3532 C  CG  . PRO A 1 469 ? 6.842   9.957   49.966  1.00 36.12  ? 468  PRO A CG  1 
ATOM   3533 C  CD  . PRO A 1 469 ? 7.462   11.278  49.732  1.00 37.51  ? 468  PRO A CD  1 
ATOM   3534 N  N   . ASP A 1 470 ? 5.400   11.941  53.933  1.00 44.23  ? 469  ASP A N   1 
ATOM   3535 C  CA  . ASP A 1 470 ? 5.659   11.944  55.411  1.00 44.48  ? 469  ASP A CA  1 
ATOM   3536 C  C   . ASP A 1 470 ? 5.897   10.602  56.048  1.00 45.14  ? 469  ASP A C   1 
ATOM   3537 O  O   . ASP A 1 470 ? 6.666   10.478  57.003  1.00 50.90  ? 469  ASP A O   1 
ATOM   3538 C  CB  . ASP A 1 470 ? 4.510   12.597  56.167  1.00 42.75  ? 469  ASP A CB  1 
ATOM   3539 C  CG  . ASP A 1 470 ? 4.760   14.049  56.423  1.00 50.15  ? 469  ASP A CG  1 
ATOM   3540 O  OD1 . ASP A 1 470 ? 5.724   14.618  55.836  1.00 50.43  ? 469  ASP A OD1 1 
ATOM   3541 O  OD2 . ASP A 1 470 ? 4.008   14.618  57.244  1.00 59.42  ? 469  ASP A OD2 1 
ATOM   3542 N  N   . THR A 1 471 ? 5.190   9.604   55.556  1.00 48.51  ? 470  THR A N   1 
ATOM   3543 C  CA  . THR A 1 471 ? 5.158   8.319   56.216  1.00 49.38  ? 470  THR A CA  1 
ATOM   3544 C  C   . THR A 1 471 ? 6.526   7.613   56.181  1.00 47.81  ? 470  THR A C   1 
ATOM   3545 O  O   . THR A 1 471 ? 6.803   6.791   57.012  1.00 53.89  ? 470  THR A O   1 
ATOM   3546 C  CB  . THR A 1 471 ? 4.015   7.462   55.626  1.00 52.09  ? 470  THR A CB  1 
ATOM   3547 O  OG1 . THR A 1 471 ? 3.706   6.407   56.530  1.00 56.31  ? 470  THR A OG1 1 
ATOM   3548 C  CG2 . THR A 1 471 ? 4.386   6.869   54.269  1.00 53.54  ? 470  THR A CG2 1 
ATOM   3549 N  N   . VAL A 1 472 ? 7.360   7.943   55.202  1.00 48.81  ? 471  VAL A N   1 
ATOM   3550 C  CA  . VAL A 1 472 ? 8.755   7.455   55.073  1.00 41.05  ? 471  VAL A CA  1 
ATOM   3551 C  C   . VAL A 1 472 ? 9.805   8.518   55.505  1.00 37.51  ? 471  VAL A C   1 
ATOM   3552 O  O   . VAL A 1 472 ? 10.712  8.245   56.288  1.00 36.63  ? 471  VAL A O   1 
ATOM   3553 C  CB  . VAL A 1 472 ? 9.078   7.147   53.597  1.00 41.16  ? 471  VAL A CB  1 
ATOM   3554 C  CG1 . VAL A 1 472 ? 10.541  6.852   53.428  1.00 43.48  ? 471  VAL A CG1 1 
ATOM   3555 C  CG2 . VAL A 1 472 ? 8.248   5.995   53.091  1.00 42.35  ? 471  VAL A CG2 1 
ATOM   3556 N  N   . TYR A 1 473 ? 9.677   9.727   54.985  1.00 32.34  ? 472  TYR A N   1 
ATOM   3557 C  CA  . TYR A 1 473 ? 10.736  10.697  55.077  1.00 34.90  ? 472  TYR A CA  1 
ATOM   3558 C  C   . TYR A 1 473 ? 10.932  11.447  56.356  1.00 35.38  ? 472  TYR A C   1 
ATOM   3559 O  O   . TYR A 1 473 ? 11.978  12.078  56.549  1.00 35.11  ? 472  TYR A O   1 
ATOM   3560 C  CB  . TYR A 1 473 ? 10.572  11.741  53.985  1.00 36.05  ? 472  TYR A CB  1 
ATOM   3561 C  CG  . TYR A 1 473 ? 11.227  11.254  52.772  1.00 35.76  ? 472  TYR A CG  1 
ATOM   3562 C  CD1 . TYR A 1 473 ? 12.604  11.347  52.638  1.00 34.23  ? 472  TYR A CD1 1 
ATOM   3563 C  CD2 . TYR A 1 473 ? 10.506  10.602  51.806  1.00 35.91  ? 472  TYR A CD2 1 
ATOM   3564 C  CE1 . TYR A 1 473 ? 13.233  10.858  51.525  1.00 34.03  ? 472  TYR A CE1 1 
ATOM   3565 C  CE2 . TYR A 1 473 ? 11.127  10.115  50.682  1.00 37.09  ? 472  TYR A CE2 1 
ATOM   3566 C  CZ  . TYR A 1 473 ? 12.489  10.247  50.548  1.00 34.97  ? 472  TYR A CZ  1 
ATOM   3567 O  OH  . TYR A 1 473 ? 13.101  9.758   49.420  1.00 35.65  ? 472  TYR A OH  1 
ATOM   3568 N  N   . LYS A 1 474 ? 9.931   11.418  57.215  1.00 36.95  ? 473  LYS A N   1 
ATOM   3569 C  CA  . LYS A 1 474 ? 9.973   12.200  58.414  1.00 36.02  ? 473  LYS A CA  1 
ATOM   3570 C  C   . LYS A 1 474 ? 10.999  11.579  59.366  1.00 38.26  ? 473  LYS A C   1 
ATOM   3571 O  O   . LYS A 1 474 ? 11.780  12.295  59.985  1.00 43.75  ? 473  LYS A O   1 
ATOM   3572 C  CB  . LYS A 1 474 ? 8.594   12.269  59.017  1.00 38.16  ? 473  LYS A CB  1 
ATOM   3573 C  CG  . LYS A 1 474 ? 8.316   13.597  59.707  1.00 41.40  ? 473  LYS A CG  1 
ATOM   3574 C  CD  . LYS A 1 474 ? 7.051   13.497  60.529  1.00 40.74  ? 473  LYS A CD  1 
ATOM   3575 C  CE  . LYS A 1 474 ? 5.825   13.508  59.650  1.00 39.72  ? 473  LYS A CE  1 
ATOM   3576 N  NZ  . LYS A 1 474 ? 4.606   13.325  60.481  1.00 42.76  ? 473  LYS A NZ  1 
ATOM   3577 N  N   . LYS A 1 475 ? 11.031  10.259  59.471  1.00 41.28  ? 474  LYS A N   1 
ATOM   3578 C  CA  . LYS A 1 475 ? 12.042  9.619   60.315  1.00 47.53  ? 474  LYS A CA  1 
ATOM   3579 C  C   . LYS A 1 475 ? 13.400  9.788   59.690  1.00 49.64  ? 474  LYS A C   1 
ATOM   3580 O  O   . LYS A 1 475 ? 14.336  10.205  60.370  1.00 51.92  ? 474  LYS A O   1 
ATOM   3581 C  CB  . LYS A 1 475 ? 11.725  8.135   60.663  1.00 52.08  ? 474  LYS A CB  1 
ATOM   3582 C  CG  . LYS A 1 475 ? 11.337  7.226   59.496  1.00 59.57  ? 474  LYS A CG  1 
ATOM   3583 C  CD  . LYS A 1 475 ? 10.831  5.856   59.943  1.00 62.68  ? 474  LYS A CD  1 
ATOM   3584 C  CE  . LYS A 1 475 ? 9.653   5.414   59.069  1.00 65.91  ? 474  LYS A CE  1 
ATOM   3585 N  NZ  . LYS A 1 475 ? 8.391   5.970   59.645  1.00 66.53  ? 474  LYS A NZ  1 
ATOM   3586 N  N   . LEU A 1 476 ? 13.491  9.503   58.391  1.00 53.73  ? 475  LEU A N   1 
ATOM   3587 C  CA  . LEU A 1 476 ? 14.778  9.535   57.655  1.00 52.13  ? 475  LEU A CA  1 
ATOM   3588 C  C   . LEU A 1 476 ? 15.530  10.857  57.759  1.00 51.70  ? 475  LEU A C   1 
ATOM   3589 O  O   . LEU A 1 476 ? 16.754  10.884  57.844  1.00 52.30  ? 475  LEU A O   1 
ATOM   3590 C  CB  . LEU A 1 476 ? 14.536  9.311   56.187  1.00 49.60  ? 475  LEU A CB  1 
ATOM   3591 C  CG  . LEU A 1 476 ? 14.665  7.885   55.710  1.00 54.89  ? 475  LEU A CG  1 
ATOM   3592 C  CD1 . LEU A 1 476 ? 14.155  7.850   54.281  1.00 58.74  ? 475  LEU A CD1 1 
ATOM   3593 C  CD2 . LEU A 1 476 ? 16.094  7.364   55.814  1.00 53.87  ? 475  LEU A CD2 1 
ATOM   3594 N  N   . VAL A 1 477 ? 14.761  11.941  57.703  1.00 53.90  ? 476  VAL A N   1 
ATOM   3595 C  CA  . VAL A 1 477 ? 15.262  13.293  57.857  1.00 57.62  ? 476  VAL A CA  1 
ATOM   3596 C  C   . VAL A 1 477 ? 15.859  13.517  59.253  1.00 62.02  ? 476  VAL A C   1 
ATOM   3597 O  O   . VAL A 1 477 ? 16.964  14.035  59.375  1.00 66.52  ? 476  VAL A O   1 
ATOM   3598 C  CB  . VAL A 1 477 ? 14.125  14.308  57.552  1.00 60.67  ? 476  VAL A CB  1 
ATOM   3599 C  CG1 . VAL A 1 477 ? 14.311  15.676  58.240  1.00 64.21  ? 476  VAL A CG1 1 
ATOM   3600 C  CG2 . VAL A 1 477 ? 13.946  14.444  56.041  1.00 57.53  ? 476  VAL A CG2 1 
ATOM   3601 N  N   . GLN A 1 478 ? 15.136  13.104  60.291  1.00 65.61  ? 477  GLN A N   1 
ATOM   3602 C  CA  . GLN A 1 478 ? 15.636  13.160  61.673  1.00 62.36  ? 477  GLN A CA  1 
ATOM   3603 C  C   . GLN A 1 478 ? 16.849  12.228  61.896  1.00 67.18  ? 477  GLN A C   1 
ATOM   3604 O  O   . GLN A 1 478 ? 17.774  12.533  62.648  1.00 75.85  ? 477  GLN A O   1 
ATOM   3605 C  CB  . GLN A 1 478 ? 14.519  12.767  62.644  1.00 56.35  ? 477  GLN A CB  1 
ATOM   3606 C  CG  . GLN A 1 478 ? 14.918  12.844  64.107  1.00 52.46  ? 477  GLN A CG  1 
ATOM   3607 C  CD  . GLN A 1 478 ? 15.394  14.228  64.517  1.00 50.26  ? 477  GLN A CD  1 
ATOM   3608 O  OE1 . GLN A 1 478 ? 14.938  15.221  63.980  1.00 52.44  ? 477  GLN A OE1 1 
ATOM   3609 N  NE2 . GLN A 1 478 ? 16.327  14.295  65.452  1.00 48.77  ? 477  GLN A NE2 1 
ATOM   3610 N  N   . ARG A 1 479 ? 16.816  11.074  61.256  1.00 71.26  ? 478  ARG A N   1 
ATOM   3611 C  CA  . ARG A 1 479 ? 17.956  10.156  61.306  1.00 76.29  ? 478  ARG A CA  1 
ATOM   3612 C  C   . ARG A 1 479 ? 19.270  10.796  60.920  1.00 80.55  ? 478  ARG A C   1 
ATOM   3613 O  O   . ARG A 1 479 ? 20.259  10.686  61.638  1.00 77.83  ? 478  ARG A O   1 
ATOM   3614 C  CB  . ARG A 1 479 ? 17.781  8.988   60.329  1.00 77.13  ? 478  ARG A CB  1 
ATOM   3615 C  CG  . ARG A 1 479 ? 16.807  7.943   60.779  1.00 80.87  ? 478  ARG A CG  1 
ATOM   3616 C  CD  . ARG A 1 479 ? 16.959  6.738   59.897  1.00 80.10  ? 478  ARG A CD  1 
ATOM   3617 N  NE  . ARG A 1 479 ? 16.038  5.707   60.325  1.00 87.10  ? 478  ARG A NE  1 
ATOM   3618 C  CZ  . ARG A 1 479 ? 16.261  4.403   60.224  1.00 95.83  ? 478  ARG A CZ  1 
ATOM   3619 N  NH1 . ARG A 1 479 ? 17.409  3.913   59.721  1.00 89.99  ? 478  ARG A NH1 1 
ATOM   3620 N  NH2 . ARG A 1 479 ? 15.320  3.583   60.670  1.00 98.26  ? 478  ARG A NH2 1 
ATOM   3621 N  N   . GLU A 1 480 ? 19.269  11.410  59.742  1.00 90.54  ? 479  GLU A N   1 
ATOM   3622 C  CA  . GLU A 1 480 ? 20.506  11.884  59.101  1.00 93.76  ? 479  GLU A CA  1 
ATOM   3623 C  C   . GLU A 1 480 ? 20.762  13.354  59.375  1.00 93.24  ? 479  GLU A C   1 
ATOM   3624 O  O   . GLU A 1 480 ? 21.767  13.897  58.944  1.00 103.17 ? 479  GLU A O   1 
ATOM   3625 C  CB  . GLU A 1 480 ? 20.525  11.560  57.601  1.00 92.50  ? 479  GLU A CB  1 
ATOM   3626 C  CG  . GLU A 1 480 ? 19.676  12.437  56.699  1.00 91.82  ? 479  GLU A CG  1 
ATOM   3627 C  CD  . GLU A 1 480 ? 19.722  11.940  55.261  1.00 92.12  ? 479  GLU A CD  1 
ATOM   3628 O  OE1 . GLU A 1 480 ? 20.553  11.068  54.932  1.00 91.86  ? 479  GLU A OE1 1 
ATOM   3629 O  OE2 . GLU A 1 480 ? 18.922  12.415  54.448  1.00 90.34  ? 479  GLU A OE2 1 
ATOM   3630 N  N   . LYS A 1 481 ? 19.862  13.978  60.116  1.00 92.09  ? 480  LYS A N   1 
ATOM   3631 C  CA  . LYS A 1 481 ? 20.154  15.230  60.766  1.00 101.25 ? 480  LYS A CA  1 
ATOM   3632 C  C   . LYS A 1 481 ? 21.130  15.009  61.925  1.00 108.09 ? 480  LYS A C   1 
ATOM   3633 O  O   . LYS A 1 481 ? 21.619  15.985  62.464  1.00 128.47 ? 480  LYS A O   1 
ATOM   3634 C  CB  . LYS A 1 481 ? 18.860  15.875  61.305  1.00 102.89 ? 480  LYS A CB  1 
ATOM   3635 C  CG  . LYS A 1 481 ? 19.106  17.218  61.967  1.00 106.29 ? 480  LYS A CG  1 
ATOM   3636 C  CD  . LYS A 1 481 ? 18.134  17.595  63.079  1.00 109.06 ? 480  LYS A CD  1 
ATOM   3637 C  CE  . LYS A 1 481 ? 18.699  18.789  63.865  1.00 112.81 ? 480  LYS A CE  1 
ATOM   3638 N  NZ  . LYS A 1 481 ? 17.765  19.400  64.857  1.00 111.35 ? 480  LYS A NZ  1 
ATOM   3639 N  N   . THR A 1 482 ? 21.413  13.766  62.321  1.00 105.18 ? 481  THR A N   1 
ATOM   3640 C  CA  . THR A 1 482 ? 22.128  13.519  63.585  1.00 106.88 ? 481  THR A CA  1 
ATOM   3641 C  C   . THR A 1 482 ? 23.218  12.429  63.615  1.00 114.99 ? 481  THR A C   1 
ATOM   3642 O  O   . THR A 1 482 ? 23.787  12.173  64.689  1.00 108.40 ? 481  THR A O   1 
ATOM   3643 C  CB  . THR A 1 482 ? 21.117  13.237  64.740  1.00 105.50 ? 481  THR A CB  1 
ATOM   3644 O  OG1 . THR A 1 482 ? 20.131  12.276  64.326  1.00 97.95  ? 481  THR A OG1 1 
ATOM   3645 C  CG2 . THR A 1 482 ? 20.403  14.523  65.249  1.00 103.58 ? 481  THR A CG2 1 
ATOM   3646 N  N   . LEU A 1 483 ? 23.519  11.809  62.469  1.00 125.85 ? 482  LEU A N   1 
ATOM   3647 C  CA  . LEU A 1 483 ? 24.602  10.792  62.350  1.00 128.38 ? 482  LEU A CA  1 
ATOM   3648 C  C   . LEU A 1 483 ? 24.457  9.975   61.062  1.00 115.56 ? 482  LEU A C   1 
ATOM   3649 O  O   . LEU A 1 483 ? 23.365  9.859   60.501  1.00 94.44  ? 482  LEU A O   1 
ATOM   3650 C  CB  . LEU A 1 483 ? 24.671  9.850   63.585  1.00 139.37 ? 482  LEU A CB  1 
ATOM   3651 C  CG  . LEU A 1 483 ? 25.464  8.521   63.523  1.00 138.28 ? 482  LEU A CG  1 
ATOM   3652 C  CD1 . LEU A 1 483 ? 26.424  8.367   64.704  1.00 129.22 ? 482  LEU A CD1 1 
ATOM   3653 C  CD2 . LEU A 1 483 ? 24.527  7.315   63.415  1.00 132.21 ? 482  LEU A CD2 1 
ATOM   3654 N  N   . VAL B 1 9   ? -22.502 5.656   2.356   1.00 95.03  ? 8    VAL B N   1 
ATOM   3655 C  CA  . VAL B 1 9   ? -22.546 5.730   0.859   1.00 94.70  ? 8    VAL B CA  1 
ATOM   3656 C  C   . VAL B 1 9   ? -21.379 4.964   0.264   1.00 81.21  ? 8    VAL B C   1 
ATOM   3657 O  O   . VAL B 1 9   ? -20.272 5.035   0.764   1.00 86.41  ? 8    VAL B O   1 
ATOM   3658 C  CB  . VAL B 1 9   ? -22.493 7.193   0.347   1.00 101.40 ? 8    VAL B CB  1 
ATOM   3659 C  CG1 . VAL B 1 9   ? -22.506 7.230   -1.183  1.00 103.43 ? 8    VAL B CG1 1 
ATOM   3660 C  CG2 . VAL B 1 9   ? -23.643 8.015   0.928   1.00 103.57 ? 8    VAL B CG2 1 
ATOM   3661 N  N   . ARG B 1 10  ? -21.640 4.255   -0.822  1.00 72.29  ? 9    ARG B N   1 
ATOM   3662 C  CA  . ARG B 1 10  ? -20.622 3.475   -1.502  1.00 66.36  ? 9    ARG B CA  1 
ATOM   3663 C  C   . ARG B 1 10  ? -20.167 4.204   -2.745  1.00 62.99  ? 9    ARG B C   1 
ATOM   3664 O  O   . ARG B 1 10  ? -20.983 4.542   -3.591  1.00 59.03  ? 9    ARG B O   1 
ATOM   3665 C  CB  . ARG B 1 10  ? -21.179 2.114   -1.891  1.00 73.92  ? 9    ARG B CB  1 
ATOM   3666 C  CG  . ARG B 1 10  ? -21.257 1.140   -0.719  1.00 84.66  ? 9    ARG B CG  1 
ATOM   3667 C  CD  . ARG B 1 10  ? -21.453 -0.324  -1.092  1.00 91.65  ? 9    ARG B CD  1 
ATOM   3668 N  NE  . ARG B 1 10  ? -22.688 -0.518  -1.845  1.00 99.08  ? 9    ARG B NE  1 
ATOM   3669 C  CZ  . ARG B 1 10  ? -23.903 -0.637  -1.309  1.00 101.27 ? 9    ARG B CZ  1 
ATOM   3670 N  NH1 . ARG B 1 10  ? -24.081 -0.609  0.007   1.00 100.26 ? 9    ARG B NH1 1 
ATOM   3671 N  NH2 . ARG B 1 10  ? -24.953 -0.786  -2.104  1.00 106.14 ? 9    ARG B NH2 1 
ATOM   3672 N  N   . ILE B 1 11  ? -18.854 4.420   -2.875  1.00 66.12  ? 10   ILE B N   1 
ATOM   3673 C  CA  . ILE B 1 11  ? -18.307 5.122   -4.049  1.00 59.27  ? 10   ILE B CA  1 
ATOM   3674 C  C   . ILE B 1 11  ? -17.245 4.302   -4.753  1.00 55.21  ? 10   ILE B C   1 
ATOM   3675 O  O   . ILE B 1 11  ? -16.362 3.726   -4.120  1.00 49.55  ? 10   ILE B O   1 
ATOM   3676 C  CB  . ILE B 1 11  ? -17.706 6.502   -3.724  1.00 55.73  ? 10   ILE B CB  1 
ATOM   3677 C  CG1 . ILE B 1 11  ? -18.582 7.252   -2.723  1.00 53.43  ? 10   ILE B CG1 1 
ATOM   3678 C  CG2 . ILE B 1 11  ? -17.600 7.326   -5.004  1.00 53.70  ? 10   ILE B CG2 1 
ATOM   3679 C  CD1 . ILE B 1 11  ? -18.002 8.561   -2.234  1.00 52.20  ? 10   ILE B CD1 1 
ATOM   3680 N  N   . LEU B 1 12  ? -17.362 4.237   -6.074  1.00 53.02  ? 11   LEU B N   1 
ATOM   3681 C  CA  . LEU B 1 12  ? -16.342 3.623   -6.895  1.00 52.32  ? 11   LEU B CA  1 
ATOM   3682 C  C   . LEU B 1 12  ? -15.793 4.623   -7.916  1.00 57.27  ? 11   LEU B C   1 
ATOM   3683 O  O   . LEU B 1 12  ? -16.543 5.185   -8.751  1.00 54.58  ? 11   LEU B O   1 
ATOM   3684 C  CB  . LEU B 1 12  ? -16.865 2.384   -7.607  1.00 52.24  ? 11   LEU B CB  1 
ATOM   3685 C  CG  . LEU B 1 12  ? -15.848 1.749   -8.559  1.00 54.85  ? 11   LEU B CG  1 
ATOM   3686 C  CD1 . LEU B 1 12  ? -14.939 0.803   -7.774  1.00 53.84  ? 11   LEU B CD1 1 
ATOM   3687 C  CD2 . LEU B 1 12  ? -16.553 1.044   -9.726  1.00 54.56  ? 11   LEU B CD2 1 
ATOM   3688 N  N   . ILE B 1 13  ? -14.469 4.813   -7.848  1.00 56.75  ? 12   ILE B N   1 
ATOM   3689 C  CA  . ILE B 1 13  ? -13.746 5.672   -8.763  1.00 58.54  ? 12   ILE B CA  1 
ATOM   3690 C  C   . ILE B 1 13  ? -13.084 4.780   -9.782  1.00 59.17  ? 12   ILE B C   1 
ATOM   3691 O  O   . ILE B 1 13  ? -12.037 4.161   -9.534  1.00 63.21  ? 12   ILE B O   1 
ATOM   3692 C  CB  . ILE B 1 13  ? -12.725 6.561   -8.036  1.00 69.45  ? 12   ILE B CB  1 
ATOM   3693 C  CG1 . ILE B 1 13  ? -13.410 7.388   -6.948  1.00 73.27  ? 12   ILE B CG1 1 
ATOM   3694 C  CG2 . ILE B 1 13  ? -12.054 7.540   -9.003  1.00 73.84  ? 12   ILE B CG2 1 
ATOM   3695 C  CD1 . ILE B 1 13  ? -12.451 8.062   -5.985  1.00 74.92  ? 12   ILE B CD1 1 
ATOM   3696 N  N   . LYS B 1 14  ? -13.727 4.706   -10.939 1.00 64.63  ? 13   LYS B N   1 
ATOM   3697 C  CA  . LYS B 1 14  ? -13.356 3.767   -11.988 1.00 72.24  ? 13   LYS B CA  1 
ATOM   3698 C  C   . LYS B 1 14  ? -12.391 4.411   -12.997 1.00 70.12  ? 13   LYS B C   1 
ATOM   3699 O  O   . LYS B 1 14  ? -12.577 5.566   -13.400 1.00 73.01  ? 13   LYS B O   1 
ATOM   3700 C  CB  . LYS B 1 14  ? -14.635 3.280   -12.697 1.00 83.51  ? 13   LYS B CB  1 
ATOM   3701 C  CG  . LYS B 1 14  ? -14.438 2.194   -13.759 1.00 88.01  ? 13   LYS B CG  1 
ATOM   3702 C  CD  . LYS B 1 14  ? -15.716 1.420   -14.069 1.00 85.52  ? 13   LYS B CD  1 
ATOM   3703 C  CE  . LYS B 1 14  ? -15.409 0.183   -14.923 1.00 83.45  ? 13   LYS B CE  1 
ATOM   3704 N  NZ  . LYS B 1 14  ? -14.376 -0.743  -14.345 1.00 74.22  ? 13   LYS B NZ  1 
ATOM   3705 N  N   . GLY B 1 15  ? -11.369 3.655   -13.395 1.00 67.61  ? 14   GLY B N   1 
ATOM   3706 C  CA  . GLY B 1 15  ? -10.533 4.006   -14.548 1.00 69.16  ? 14   GLY B CA  1 
ATOM   3707 C  C   . GLY B 1 15  ? -9.531  5.131   -14.361 1.00 73.62  ? 14   GLY B C   1 
ATOM   3708 O  O   . GLY B 1 15  ? -9.052  5.720   -15.345 1.00 58.57  ? 14   GLY B O   1 
ATOM   3709 N  N   . GLY B 1 16  ? -9.218  5.447   -13.101 1.00 75.62  ? 15   GLY B N   1 
ATOM   3710 C  CA  . GLY B 1 16  ? -8.223  6.471   -12.808 1.00 73.26  ? 15   GLY B CA  1 
ATOM   3711 C  C   . GLY B 1 16  ? -6.806  5.941   -12.746 1.00 68.09  ? 15   GLY B C   1 
ATOM   3712 O  O   . GLY B 1 16  ? -6.586  4.732   -12.761 1.00 64.39  ? 15   GLY B O   1 
ATOM   3713 N  N   . LYS B 1 17  ? -5.852  6.873   -12.719 1.00 61.98  ? 16   LYS B N   1 
ATOM   3714 C  CA  . LYS B 1 17  ? -4.482  6.584   -12.336 1.00 60.13  ? 16   LYS B CA  1 
ATOM   3715 C  C   . LYS B 1 17  ? -4.307  7.092   -10.909 1.00 60.53  ? 16   LYS B C   1 
ATOM   3716 O  O   . LYS B 1 17  ? -4.361  8.297   -10.656 1.00 62.60  ? 16   LYS B O   1 
ATOM   3717 C  CB  . LYS B 1 17  ? -3.489  7.289   -13.256 1.00 58.70  ? 16   LYS B CB  1 
ATOM   3718 C  CG  . LYS B 1 17  ? -3.140  6.521   -14.523 1.00 61.33  ? 16   LYS B CG  1 
ATOM   3719 C  CD  . LYS B 1 17  ? -2.348  7.425   -15.450 1.00 60.17  ? 16   LYS B CD  1 
ATOM   3720 C  CE  . LYS B 1 17  ? -1.922  6.717   -16.693 1.00 61.11  ? 16   LYS B CE  1 
ATOM   3721 N  NZ  . LYS B 1 17  ? -1.664  7.728   -17.740 1.00 63.86  ? 16   LYS B NZ  1 
ATOM   3722 N  N   . VAL B 1 18  ? -4.127  6.180   -9.961  1.00 57.08  ? 17   VAL B N   1 
ATOM   3723 C  CA  . VAL B 1 18  ? -3.891  6.589   -8.585  1.00 53.57  ? 17   VAL B CA  1 
ATOM   3724 C  C   . VAL B 1 18  ? -2.483  7.174   -8.461  1.00 50.43  ? 17   VAL B C   1 
ATOM   3725 O  O   . VAL B 1 18  ? -1.510  6.515   -8.780  1.00 50.07  ? 17   VAL B O   1 
ATOM   3726 C  CB  . VAL B 1 18  ? -4.086  5.429   -7.597  1.00 50.06  ? 17   VAL B CB  1 
ATOM   3727 C  CG1 . VAL B 1 18  ? -3.495  5.763   -6.232  1.00 53.42  ? 17   VAL B CG1 1 
ATOM   3728 C  CG2 . VAL B 1 18  ? -5.549  5.125   -7.435  1.00 48.81  ? 17   VAL B CG2 1 
ATOM   3729 N  N   . VAL B 1 19  ? -2.401  8.413   -7.999  1.00 46.27  ? 18   VAL B N   1 
ATOM   3730 C  CA  . VAL B 1 19  ? -1.131  9.051   -7.719  1.00 46.90  ? 18   VAL B CA  1 
ATOM   3731 C  C   . VAL B 1 19  ? -0.934  9.189   -6.210  1.00 44.44  ? 18   VAL B C   1 
ATOM   3732 O  O   . VAL B 1 19  ? -1.788  9.673   -5.501  1.00 42.47  ? 18   VAL B O   1 
ATOM   3733 C  CB  . VAL B 1 19  ? -1.049  10.431  -8.361  1.00 45.63  ? 18   VAL B CB  1 
ATOM   3734 C  CG1 . VAL B 1 19  ? 0.354   10.953  -8.276  1.00 45.74  ? 18   VAL B CG1 1 
ATOM   3735 C  CG2 . VAL B 1 19  ? -1.498  10.359  -9.811  1.00 46.36  ? 18   VAL B CG2 1 
ATOM   3736 N  N   . ASN B 1 20  ? 0.190   8.700   -5.734  1.00 42.04  ? 19   ASN B N   1 
ATOM   3737 C  CA  . ASN B 1 20  ? 0.590   8.859   -4.351  1.00 43.22  ? 19   ASN B CA  1 
ATOM   3738 C  C   . ASN B 1 20  ? 1.947   9.508   -4.439  1.00 43.47  ? 19   ASN B C   1 
ATOM   3739 O  O   . ASN B 1 20  ? 2.417   9.705   -5.546  1.00 44.80  ? 19   ASN B O   1 
ATOM   3740 C  CB  . ASN B 1 20  ? 0.657   7.503   -3.663  1.00 42.12  ? 19   ASN B CB  1 
ATOM   3741 C  CG  . ASN B 1 20  ? -0.676  7.057   -3.115  1.00 39.08  ? 19   ASN B CG  1 
ATOM   3742 O  OD1 . ASN B 1 20  ? -1.492  7.861   -2.786  1.00 40.24  ? 19   ASN B OD1 1 
ATOM   3743 N  ND2 . ASN B 1 20  ? -0.861  5.763   -2.962  1.00 36.95  ? 19   ASN B ND2 1 
ATOM   3744 N  N   . ASP B 1 21  ? 2.608   9.785   -3.322  1.00 42.59  ? 20   ASP B N   1 
ATOM   3745 C  CA  . ASP B 1 21  ? 3.945   10.387  -3.429  1.00 45.59  ? 20   ASP B CA  1 
ATOM   3746 C  C   . ASP B 1 21  ? 5.068   9.469   -3.914  1.00 43.35  ? 20   ASP B C   1 
ATOM   3747 O  O   . ASP B 1 21  ? 6.039   9.935   -4.470  1.00 41.58  ? 20   ASP B O   1 
ATOM   3748 C  CB  . ASP B 1 21  ? 4.360   11.142  -2.150  1.00 47.69  ? 20   ASP B CB  1 
ATOM   3749 C  CG  . ASP B 1 21  ? 4.534   10.251  -0.916  1.00 50.17  ? 20   ASP B CG  1 
ATOM   3750 O  OD1 . ASP B 1 21  ? 4.316   9.026   -0.948  1.00 52.78  ? 20   ASP B OD1 1 
ATOM   3751 O  OD2 . ASP B 1 21  ? 4.870   10.846  0.130   1.00 57.24  ? 20   ASP B OD2 1 
ATOM   3752 N  N   . ASP B 1 22  ? 4.912   8.173   -3.721  1.00 48.57  ? 21   ASP B N   1 
ATOM   3753 C  CA  . ASP B 1 22  ? 5.891   7.195   -4.199  1.00 55.95  ? 21   ASP B CA  1 
ATOM   3754 C  C   . ASP B 1 22  ? 5.714   6.808   -5.682  1.00 57.71  ? 21   ASP B C   1 
ATOM   3755 O  O   . ASP B 1 22  ? 6.692   6.690   -6.417  1.00 59.76  ? 21   ASP B O   1 
ATOM   3756 C  CB  . ASP B 1 22  ? 5.905   5.933   -3.309  1.00 54.59  ? 21   ASP B CB  1 
ATOM   3757 C  CG  . ASP B 1 22  ? 4.579   5.250   -3.247  1.00 57.37  ? 21   ASP B CG  1 
ATOM   3758 O  OD1 . ASP B 1 22  ? 3.580   5.958   -3.059  1.00 62.91  ? 21   ASP B OD1 1 
ATOM   3759 O  OD2 . ASP B 1 22  ? 4.522   4.016   -3.364  1.00 61.69  ? 21   ASP B OD2 1 
ATOM   3760 N  N   . CYS B 1 23  ? 4.480   6.585   -6.111  1.00 56.61  ? 22   CYS B N   1 
ATOM   3761 C  CA  . CYS B 1 23  ? 4.229   6.134   -7.484  1.00 54.47  ? 22   CYS B CA  1 
ATOM   3762 C  C   . CYS B 1 23  ? 2.819   6.404   -7.999  1.00 52.62  ? 22   CYS B C   1 
ATOM   3763 O  O   . CYS B 1 23  ? 1.885   6.715   -7.245  1.00 46.62  ? 22   CYS B O   1 
ATOM   3764 C  CB  . CYS B 1 23  ? 4.541   4.628   -7.641  1.00 60.81  ? 22   CYS B CB  1 
ATOM   3765 S  SG  . CYS B 1 23  ? 3.244   3.450   -7.084  0.89 60.85  ? 22   CYS B SG  1 
ATOM   3766 N  N   . THR B 1 24  ? 2.705   6.286   -9.320  1.00 51.78  ? 23   THR B N   1 
ATOM   3767 C  CA  . THR B 1 24  ? 1.461   6.465   -10.042 1.00 50.45  ? 23   THR B CA  1 
ATOM   3768 C  C   . THR B 1 24  ? 1.094   5.160   -10.747 1.00 58.26  ? 23   THR B C   1 
ATOM   3769 O  O   . THR B 1 24  ? 1.870   4.650   -11.531 1.00 61.54  ? 23   THR B O   1 
ATOM   3770 C  CB  . THR B 1 24  ? 1.593   7.568   -11.091 1.00 45.29  ? 23   THR B CB  1 
ATOM   3771 O  OG1 . THR B 1 24  ? 1.907   8.803   -10.438 1.00 45.18  ? 23   THR B OG1 1 
ATOM   3772 C  CG2 . THR B 1 24  ? 0.307   7.715   -11.866 1.00 44.72  ? 23   THR B CG2 1 
ATOM   3773 N  N   . HIS B 1 25  ? -0.080  4.613   -10.456 1.00 63.22  ? 24   HIS B N   1 
ATOM   3774 C  CA  . HIS B 1 25  ? -0.496  3.364   -11.061 1.00 62.68  ? 24   HIS B CA  1 
ATOM   3775 C  C   . HIS B 1 25  ? -1.997  3.330   -11.378 1.00 67.73  ? 24   HIS B C   1 
ATOM   3776 O  O   . HIS B 1 25  ? -2.804  3.973   -10.701 1.00 62.69  ? 24   HIS B O   1 
ATOM   3777 C  CB  . HIS B 1 25  ? -0.062  2.168   -10.196 1.00 65.25  ? 24   HIS B CB  1 
ATOM   3778 C  CG  . HIS B 1 25  ? -0.915  1.927   -8.993  1.00 72.73  ? 24   HIS B CG  1 
ATOM   3779 N  ND1 . HIS B 1 25  ? -0.868  2.734   -7.875  1.00 79.46  ? 24   HIS B ND1 1 
ATOM   3780 C  CD2 . HIS B 1 25  ? -1.813  0.945   -8.714  1.00 75.47  ? 24   HIS B CD2 1 
ATOM   3781 C  CE1 . HIS B 1 25  ? -1.703  2.263   -6.959  1.00 82.05  ? 24   HIS B CE1 1 
ATOM   3782 N  NE2 . HIS B 1 25  ? -2.289  1.179   -7.443  1.00 78.08  ? 24   HIS B NE2 1 
ATOM   3783 N  N   . GLU B 1 26  ? -2.335  2.577   -12.434 1.00 70.43  ? 25   GLU B N   1 
ATOM   3784 C  CA  . GLU B 1 26  ? -3.701  2.415   -12.913 1.00 62.90  ? 25   GLU B CA  1 
ATOM   3785 C  C   . GLU B 1 26  ? -4.444  1.540   -11.910 1.00 55.12  ? 25   GLU B C   1 
ATOM   3786 O  O   . GLU B 1 26  ? -4.165  0.357   -11.788 1.00 46.50  ? 25   GLU B O   1 
ATOM   3787 C  CB  . GLU B 1 26  ? -3.729  1.762   -14.332 1.00 66.57  ? 25   GLU B CB  1 
ATOM   3788 C  CG  . GLU B 1 26  ? -3.930  2.752   -15.489 1.00 70.31  ? 25   GLU B CG  1 
ATOM   3789 C  CD  . GLU B 1 26  ? -3.527  2.212   -16.881 1.00 67.80  ? 25   GLU B CD  1 
ATOM   3790 O  OE1 . GLU B 1 26  ? -2.457  1.582   -16.989 1.00 65.32  ? 25   GLU B OE1 1 
ATOM   3791 O  OE2 . GLU B 1 26  ? -4.250  2.440   -17.883 1.00 55.83  ? 25   GLU B OE2 1 
ATOM   3792 N  N   . ALA B 1 27  ? -5.385  2.146   -11.195 1.00 51.94  ? 26   ALA B N   1 
ATOM   3793 C  CA  . ALA B 1 27  ? -6.202  1.430   -10.228 1.00 54.47  ? 26   ALA B CA  1 
ATOM   3794 C  C   . ALA B 1 27  ? -7.551  2.100   -9.979  1.00 55.98  ? 26   ALA B C   1 
ATOM   3795 O  O   . ALA B 1 27  ? -7.726  3.318   -10.146 1.00 61.84  ? 26   ALA B O   1 
ATOM   3796 C  CB  . ALA B 1 27  ? -5.458  1.278   -8.911  1.00 58.93  ? 26   ALA B CB  1 
ATOM   3797 N  N   . ASP B 1 28  ? -8.504  1.271   -9.561  1.00 59.08  ? 27   ASP B N   1 
ATOM   3798 C  CA  . ASP B 1 28  ? -9.794  1.756   -9.112  1.00 58.51  ? 27   ASP B CA  1 
ATOM   3799 C  C   . ASP B 1 28  ? -9.740  1.946   -7.607  1.00 55.56  ? 27   ASP B C   1 
ATOM   3800 O  O   . ASP B 1 28  ? -8.904  1.366   -6.910  1.00 57.23  ? 27   ASP B O   1 
ATOM   3801 C  CB  . ASP B 1 28  ? -10.905 0.777   -9.491  1.00 58.10  ? 27   ASP B CB  1 
ATOM   3802 C  CG  . ASP B 1 28  ? -11.069 0.615   -11.009 1.00 64.01  ? 27   ASP B CG  1 
ATOM   3803 O  OD1 . ASP B 1 28  ? -10.527 1.428   -11.806 1.00 59.07  ? 27   ASP B OD1 1 
ATOM   3804 O  OD2 . ASP B 1 28  ? -11.770 -0.344  -11.394 1.00 67.39  ? 27   ASP B OD2 1 
ATOM   3805 N  N   . VAL B 1 29  ? -10.634 2.768   -7.105  1.00 52.04  ? 28   VAL B N   1 
ATOM   3806 C  CA  . VAL B 1 29  ? -10.759 2.940   -5.672  1.00 56.11  ? 28   VAL B CA  1 
ATOM   3807 C  C   . VAL B 1 29  ? -12.212 2.722   -5.260  1.00 55.74  ? 28   VAL B C   1 
ATOM   3808 O  O   . VAL B 1 29  ? -13.133 3.309   -5.841  1.00 61.11  ? 28   VAL B O   1 
ATOM   3809 C  CB  . VAL B 1 29  ? -10.316 4.343   -5.233  1.00 59.77  ? 28   VAL B CB  1 
ATOM   3810 C  CG1 . VAL B 1 29  ? -10.593 4.543   -3.747  1.00 59.70  ? 28   VAL B CG1 1 
ATOM   3811 C  CG2 . VAL B 1 29  ? -8.843  4.550   -5.544  1.00 62.34  ? 28   VAL B CG2 1 
ATOM   3812 N  N   . TYR B 1 30  ? -12.408 1.880   -4.260  1.00 49.39  ? 29   TYR B N   1 
ATOM   3813 C  CA  . TYR B 1 30  ? -13.724 1.650   -3.747  1.00 51.81  ? 29   TYR B CA  1 
ATOM   3814 C  C   . TYR B 1 30  ? -13.785 2.129   -2.337  1.00 53.02  ? 29   TYR B C   1 
ATOM   3815 O  O   . TYR B 1 30  ? -12.967 1.738   -1.494  1.00 54.99  ? 29   TYR B O   1 
ATOM   3816 C  CB  . TYR B 1 30  ? -14.065 0.172   -3.790  1.00 57.45  ? 29   TYR B CB  1 
ATOM   3817 C  CG  . TYR B 1 30  ? -15.337 -0.180  -3.058  1.00 57.88  ? 29   TYR B CG  1 
ATOM   3818 C  CD1 . TYR B 1 30  ? -16.560 0.326   -3.464  1.00 59.86  ? 29   TYR B CD1 1 
ATOM   3819 C  CD2 . TYR B 1 30  ? -15.313 -1.030  -1.974  1.00 59.62  ? 29   TYR B CD2 1 
ATOM   3820 C  CE1 . TYR B 1 30  ? -17.722 -0.006  -2.789  1.00 59.02  ? 29   TYR B CE1 1 
ATOM   3821 C  CE2 . TYR B 1 30  ? -16.471 -1.377  -1.297  1.00 59.87  ? 29   TYR B CE2 1 
ATOM   3822 C  CZ  . TYR B 1 30  ? -17.672 -0.853  -1.699  1.00 58.97  ? 29   TYR B CZ  1 
ATOM   3823 O  OH  . TYR B 1 30  ? -18.820 -1.198  -1.001  1.00 66.98  ? 29   TYR B OH  1 
ATOM   3824 N  N   . ILE B 1 31  ? -14.773 2.975   -2.080  1.00 53.40  ? 30   ILE B N   1 
ATOM   3825 C  CA  . ILE B 1 31  ? -14.935 3.637   -0.784  1.00 55.89  ? 30   ILE B CA  1 
ATOM   3826 C  C   . ILE B 1 31  ? -16.283 3.266   -0.157  1.00 58.40  ? 30   ILE B C   1 
ATOM   3827 O  O   . ILE B 1 31  ? -17.303 3.237   -0.832  1.00 61.08  ? 30   ILE B O   1 
ATOM   3828 C  CB  . ILE B 1 31  ? -14.897 5.168   -0.949  1.00 52.41  ? 30   ILE B CB  1 
ATOM   3829 C  CG1 . ILE B 1 31  ? -13.560 5.641   -1.560  1.00 47.00  ? 30   ILE B CG1 1 
ATOM   3830 C  CG2 . ILE B 1 31  ? -15.135 5.852   0.381   1.00 49.77  ? 30   ILE B CG2 1 
ATOM   3831 C  CD1 . ILE B 1 31  ? -13.666 6.962   -2.321  1.00 44.16  ? 30   ILE B CD1 1 
ATOM   3832 N  N   . GLU B 1 32  ? -16.270 2.976   1.135   1.00 61.65  ? 31   GLU B N   1 
ATOM   3833 C  CA  . GLU B 1 32  ? -17.483 2.683   1.888   1.00 59.21  ? 31   GLU B CA  1 
ATOM   3834 C  C   . GLU B 1 32  ? -17.306 3.156   3.316   1.00 57.51  ? 31   GLU B C   1 
ATOM   3835 O  O   . GLU B 1 32  ? -16.277 2.876   3.936   1.00 56.12  ? 31   GLU B O   1 
ATOM   3836 C  CB  . GLU B 1 32  ? -17.752 1.181   1.886   1.00 66.39  ? 31   GLU B CB  1 
ATOM   3837 C  CG  . GLU B 1 32  ? -19.157 0.776   2.304   1.00 72.68  ? 31   GLU B CG  1 
ATOM   3838 C  CD  . GLU B 1 32  ? -19.254 -0.743  2.509   1.00 75.07  ? 31   GLU B CD  1 
ATOM   3839 O  OE1 . GLU B 1 32  ? -18.869 -1.485  1.587   1.00 78.63  ? 31   GLU B OE1 1 
ATOM   3840 O  OE2 . GLU B 1 32  ? -19.661 -1.207  3.597   1.00 71.63  ? 31   GLU B OE2 1 
ATOM   3841 N  N   . ASN B 1 33  ? -18.300 3.871   3.830   1.00 58.46  ? 32   ASN B N   1 
ATOM   3842 C  CA  . ASN B 1 33  ? -18.301 4.337   5.217   1.00 61.37  ? 32   ASN B CA  1 
ATOM   3843 C  C   . ASN B 1 33  ? -17.116 5.237   5.590   1.00 60.48  ? 32   ASN B C   1 
ATOM   3844 O  O   . ASN B 1 33  ? -16.507 5.055   6.639   1.00 58.82  ? 32   ASN B O   1 
ATOM   3845 C  CB  . ASN B 1 33  ? -18.347 3.138   6.173   1.00 68.06  ? 32   ASN B CB  1 
ATOM   3846 C  CG  . ASN B 1 33  ? -19.561 2.243   5.943   1.00 76.09  ? 32   ASN B CG  1 
ATOM   3847 O  OD1 . ASN B 1 33  ? -19.404 1.035   5.737   1.00 75.42  ? 32   ASN B OD1 1 
ATOM   3848 N  ND2 . ASN B 1 33  ? -20.771 2.821   5.937   1.00 77.35  ? 32   ASN B ND2 1 
ATOM   3849 N  N   . GLY B 1 34  ? -16.776 6.193   4.722   1.00 60.45  ? 33   GLY B N   1 
ATOM   3850 C  CA  . GLY B 1 34  ? -15.700 7.162   4.997   1.00 54.01  ? 33   GLY B CA  1 
ATOM   3851 C  C   . GLY B 1 34  ? -14.288 6.627   4.809   1.00 57.32  ? 33   GLY B C   1 
ATOM   3852 O  O   . GLY B 1 34  ? -13.324 7.373   4.916   1.00 56.13  ? 33   GLY B O   1 
ATOM   3853 N  N   . ILE B 1 35  ? -14.165 5.326   4.544   1.00 59.49  ? 34   ILE B N   1 
ATOM   3854 C  CA  . ILE B 1 35  ? -12.891 4.632   4.480   1.00 55.67  ? 34   ILE B CA  1 
ATOM   3855 C  C   . ILE B 1 35  ? -12.665 4.071   3.088   1.00 57.03  ? 34   ILE B C   1 
ATOM   3856 O  O   . ILE B 1 35  ? -13.587 3.518   2.491   1.00 53.89  ? 34   ILE B O   1 
ATOM   3857 C  CB  . ILE B 1 35  ? -12.878 3.458   5.481   1.00 57.90  ? 34   ILE B CB  1 
ATOM   3858 C  CG1 . ILE B 1 35  ? -12.871 3.990   6.913   1.00 60.96  ? 34   ILE B CG1 1 
ATOM   3859 C  CG2 . ILE B 1 35  ? -11.695 2.523   5.253   1.00 57.07  ? 34   ILE B CG2 1 
ATOM   3860 C  CD1 . ILE B 1 35  ? -11.819 5.039   7.202   1.00 61.43  ? 34   ILE B CD1 1 
ATOM   3861 N  N   . ILE B 1 36  ? -11.429 4.199   2.589   1.00 58.22  ? 35   ILE B N   1 
ATOM   3862 C  CA  . ILE B 1 36  ? -10.988 3.471   1.385   1.00 52.96  ? 35   ILE B CA  1 
ATOM   3863 C  C   . ILE B 1 36  ? -10.920 1.949   1.684   1.00 49.56  ? 35   ILE B C   1 
ATOM   3864 O  O   . ILE B 1 36  ? -10.106 1.497   2.486   1.00 42.94  ? 35   ILE B O   1 
ATOM   3865 C  CB  . ILE B 1 36  ? -9.627  3.990   0.859   1.00 53.21  ? 35   ILE B CB  1 
ATOM   3866 C  CG1 . ILE B 1 36  ? -9.735  5.447   0.421   1.00 52.06  ? 35   ILE B CG1 1 
ATOM   3867 C  CG2 . ILE B 1 36  ? -9.128  3.136   -0.303  1.00 54.92  ? 35   ILE B CG2 1 
ATOM   3868 C  CD1 . ILE B 1 36  ? -8.532  5.936   -0.365  1.00 53.07  ? 35   ILE B CD1 1 
ATOM   3869 N  N   . GLN B 1 37  ? -11.774 1.184   1.011   1.00 52.92  ? 36   GLN B N   1 
ATOM   3870 C  CA  . GLN B 1 37  ? -11.935 -0.265  1.250   1.00 53.92  ? 36   GLN B CA  1 
ATOM   3871 C  C   . GLN B 1 37  ? -10.990 -1.072  0.381   1.00 54.26  ? 36   GLN B C   1 
ATOM   3872 O  O   . GLN B 1 37  ? -10.317 -1.974  0.865   1.00 51.83  ? 36   GLN B O   1 
ATOM   3873 C  CB  . GLN B 1 37  ? -13.370 -0.724  0.926   1.00 55.59  ? 36   GLN B CB  1 
ATOM   3874 C  CG  . GLN B 1 37  ? -14.457 -0.218  1.860   1.00 57.19  ? 36   GLN B CG  1 
ATOM   3875 C  CD  . GLN B 1 37  ? -14.273 -0.735  3.268   1.00 58.45  ? 36   GLN B CD  1 
ATOM   3876 O  OE1 . GLN B 1 37  ? -14.016 -1.916  3.462   1.00 54.71  ? 36   GLN B OE1 1 
ATOM   3877 N  NE2 . GLN B 1 37  ? -14.366 0.156   4.258   1.00 58.67  ? 36   GLN B NE2 1 
ATOM   3878 N  N   . GLN B 1 38  ? -10.957 -0.746  -0.912  1.00 56.58  ? 37   GLN B N   1 
ATOM   3879 C  CA  . GLN B 1 38  ? -10.079 -1.431  -1.847  1.00 59.59  ? 37   GLN B CA  1 
ATOM   3880 C  C   . GLN B 1 38  ? -9.399  -0.502  -2.828  1.00 56.56  ? 37   GLN B C   1 
ATOM   3881 O  O   . GLN B 1 38  ? -10.004 0.474   -3.295  1.00 55.17  ? 37   GLN B O   1 
ATOM   3882 C  CB  . GLN B 1 38  ? -10.862 -2.473  -2.643  1.00 66.48  ? 37   GLN B CB  1 
ATOM   3883 C  CG  . GLN B 1 38  ? -11.184 -3.752  -1.888  1.00 68.55  ? 37   GLN B CG  1 
ATOM   3884 C  CD  . GLN B 1 38  ? -12.139 -4.645  -2.671  1.00 66.02  ? 37   GLN B CD  1 
ATOM   3885 O  OE1 . GLN B 1 38  ? -12.094 -4.717  -3.903  1.00 65.45  ? 37   GLN B OE1 1 
ATOM   3886 N  NE2 . GLN B 1 38  ? -13.004 -5.328  -1.953  1.00 64.87  ? 37   GLN B NE2 1 
ATOM   3887 N  N   . VAL B 1 39  ? -8.152  -0.854  -3.157  1.00 56.67  ? 38   VAL B N   1 
ATOM   3888 C  CA  . VAL B 1 39  ? -7.421  -0.246  -4.281  1.00 59.56  ? 38   VAL B CA  1 
ATOM   3889 C  C   . VAL B 1 39  ? -6.795  -1.331  -5.172  1.00 59.07  ? 38   VAL B C   1 
ATOM   3890 O  O   . VAL B 1 39  ? -5.810  -1.978  -4.795  1.00 53.54  ? 38   VAL B O   1 
ATOM   3891 C  CB  . VAL B 1 39  ? -6.323  0.733   -3.826  1.00 53.80  ? 38   VAL B CB  1 
ATOM   3892 C  CG1 . VAL B 1 39  ? -5.696  1.389   -5.039  1.00 56.38  ? 38   VAL B CG1 1 
ATOM   3893 C  CG2 . VAL B 1 39  ? -6.904  1.788   -2.907  1.00 53.11  ? 38   VAL B CG2 1 
ATOM   3894 N  N   . GLY B 1 40  ? -7.368  -1.492  -6.361  1.00 62.17  ? 39   GLY B N   1 
ATOM   3895 C  CA  . GLY B 1 40  ? -7.005  -2.576  -7.267  1.00 71.04  ? 39   GLY B CA  1 
ATOM   3896 C  C   . GLY B 1 40  ? -7.399  -2.322  -8.707  1.00 80.15  ? 39   GLY B C   1 
ATOM   3897 O  O   . GLY B 1 40  ? -8.234  -1.454  -8.985  1.00 74.58  ? 39   GLY B O   1 
ATOM   3898 N  N   . ARG B 1 41  ? -6.796  -3.091  -9.620  1.00 90.33  ? 40   ARG B N   1 
ATOM   3899 C  CA  . ARG B 1 41  ? -6.914  -2.823  -11.057 1.00 91.27  ? 40   ARG B CA  1 
ATOM   3900 C  C   . ARG B 1 41  ? -8.336  -3.085  -11.570 1.00 87.37  ? 40   ARG B C   1 
ATOM   3901 O  O   . ARG B 1 41  ? -8.860  -2.310  -12.378 1.00 101.28 ? 40   ARG B O   1 
ATOM   3902 C  CB  . ARG B 1 41  ? -5.889  -3.637  -11.867 1.00 96.03  ? 40   ARG B CB  1 
ATOM   3903 C  CG  . ARG B 1 41  ? -5.603  -3.048  -13.250 1.00 105.60 ? 40   ARG B CG  1 
ATOM   3904 C  CD  . ARG B 1 41  ? -4.895  -4.003  -14.210 1.00 114.76 ? 40   ARG B CD  1 
ATOM   3905 N  NE  . ARG B 1 41  ? -3.734  -4.677  -13.619 1.00 121.33 ? 40   ARG B NE  1 
ATOM   3906 C  CZ  . ARG B 1 41  ? -3.730  -5.901  -13.072 1.00 111.30 ? 40   ARG B CZ  1 
ATOM   3907 N  NH1 . ARG B 1 41  ? -4.842  -6.633  -13.001 1.00 110.12 ? 40   ARG B NH1 1 
ATOM   3908 N  NH2 . ARG B 1 41  ? -2.597  -6.403  -12.591 1.00 94.25  ? 40   ARG B NH2 1 
ATOM   3909 N  N   . GLU B 1 42  ? -8.960  -4.159  -11.102 1.00 78.16  ? 41   GLU B N   1 
ATOM   3910 C  CA  . GLU B 1 42  ? -10.369 -4.432  -11.444 1.00 86.74  ? 41   GLU B CA  1 
ATOM   3911 C  C   . GLU B 1 42  ? -11.148 -4.961  -10.252 1.00 82.97  ? 41   GLU B C   1 
ATOM   3912 O  O   . GLU B 1 42  ? -10.914 -6.087  -9.806  1.00 75.75  ? 41   GLU B O   1 
ATOM   3913 C  CB  . GLU B 1 42  ? -10.489 -5.427  -12.601 1.00 97.79  ? 41   GLU B CB  1 
ATOM   3914 C  CG  . GLU B 1 42  ? -9.800  -4.993  -13.887 1.00 101.02 ? 41   GLU B CG  1 
ATOM   3915 C  CD  . GLU B 1 42  ? -10.556 -3.916  -14.639 1.00 102.07 ? 41   GLU B CD  1 
ATOM   3916 O  OE1 . GLU B 1 42  ? -11.227 -3.073  -14.004 1.00 96.33  ? 41   GLU B OE1 1 
ATOM   3917 O  OE2 . GLU B 1 42  ? -10.466 -3.918  -15.882 1.00 112.39 ? 41   GLU B OE2 1 
ATOM   3918 N  N   . LEU B 1 43  ? -12.099 -4.175  -9.768  1.00 76.09  ? 42   LEU B N   1 
ATOM   3919 C  CA  . LEU B 1 43  ? -12.664 -4.470  -8.472  1.00 83.25  ? 42   LEU B CA  1 
ATOM   3920 C  C   . LEU B 1 43  ? -14.064 -5.042  -8.536  1.00 86.85  ? 42   LEU B C   1 
ATOM   3921 O  O   . LEU B 1 43  ? -14.942 -4.478  -9.183  1.00 84.10  ? 42   LEU B O   1 
ATOM   3922 C  CB  . LEU B 1 43  ? -12.653 -3.223  -7.610  1.00 84.42  ? 42   LEU B CB  1 
ATOM   3923 C  CG  . LEU B 1 43  ? -11.287 -2.741  -7.141  1.00 81.87  ? 42   LEU B CG  1 
ATOM   3924 C  CD1 . LEU B 1 43  ? -11.496 -1.599  -6.161  1.00 78.02  ? 42   LEU B CD1 1 
ATOM   3925 C  CD2 . LEU B 1 43  ? -10.480 -3.836  -6.486  1.00 84.45  ? 42   LEU B CD2 1 
ATOM   3926 N  N   . MET B 1 44  ? -14.257 -6.167  -7.854  1.00 94.69  ? 43   MET B N   1 
ATOM   3927 C  CA  . MET B 1 44  ? -15.572 -6.800  -7.748  1.00 108.93 ? 43   MET B CA  1 
ATOM   3928 C  C   . MET B 1 44  ? -16.328 -6.116  -6.591  1.00 116.49 ? 43   MET B C   1 
ATOM   3929 O  O   . MET B 1 44  ? -16.006 -6.289  -5.408  1.00 101.66 ? 43   MET B O   1 
ATOM   3930 C  CB  . MET B 1 44  ? -15.431 -8.337  -7.603  1.00 112.64 ? 43   MET B CB  1 
ATOM   3931 C  CG  . MET B 1 44  ? -15.099 -8.880  -6.223  1.00 118.32 ? 43   MET B CG  1 
ATOM   3932 S  SD  . MET B 1 44  ? -14.650 -10.636 -6.258  1.00 122.44 ? 43   MET B SD  1 
ATOM   3933 C  CE  . MET B 1 44  ? -12.969 -10.619 -6.901  1.00 114.89 ? 43   MET B CE  1 
ATOM   3934 N  N   . ILE B 1 45  ? -17.316 -5.302  -6.965  1.00 128.49 ? 44   ILE B N   1 
ATOM   3935 C  CA  . ILE B 1 45  ? -18.074 -4.445  -6.025  1.00 130.62 ? 44   ILE B CA  1 
ATOM   3936 C  C   . ILE B 1 45  ? -19.566 -4.833  -5.992  1.00 130.89 ? 44   ILE B C   1 
ATOM   3937 O  O   . ILE B 1 45  ? -20.146 -5.092  -7.049  1.00 138.32 ? 44   ILE B O   1 
ATOM   3938 C  CB  . ILE B 1 45  ? -17.957 -2.934  -6.399  1.00 119.79 ? 44   ILE B CB  1 
ATOM   3939 C  CG1 . ILE B 1 45  ? -18.435 -2.638  -7.836  1.00 121.69 ? 44   ILE B CG1 1 
ATOM   3940 C  CG2 . ILE B 1 45  ? -16.533 -2.451  -6.215  1.00 105.57 ? 44   ILE B CG2 1 
ATOM   3941 C  CD1 . ILE B 1 45  ? -19.026 -1.256  -8.040  1.00 123.40 ? 44   ILE B CD1 1 
ATOM   3942 N  N   . PRO B 1 46  ? -20.195 -4.889  -4.793  1.00 122.27 ? 45   PRO B N   1 
ATOM   3943 C  CA  . PRO B 1 46  ? -21.671 -4.934  -4.833  1.00 119.03 ? 45   PRO B CA  1 
ATOM   3944 C  C   . PRO B 1 46  ? -22.233 -3.592  -5.330  1.00 114.38 ? 45   PRO B C   1 
ATOM   3945 O  O   . PRO B 1 46  ? -21.816 -2.543  -4.840  1.00 114.26 ? 45   PRO B O   1 
ATOM   3946 C  CB  . PRO B 1 46  ? -22.071 -5.229  -3.374  1.00 116.36 ? 45   PRO B CB  1 
ATOM   3947 C  CG  . PRO B 1 46  ? -20.869 -4.906  -2.546  1.00 109.89 ? 45   PRO B CG  1 
ATOM   3948 C  CD  . PRO B 1 46  ? -19.664 -5.083  -3.428  1.00 112.33 ? 45   PRO B CD  1 
ATOM   3949 N  N   . GLY B 1 47  ? -23.157 -3.632  -6.296  1.00 106.24 ? 46   GLY B N   1 
ATOM   3950 C  CA  . GLY B 1 47  ? -23.688 -2.419  -6.957  1.00 100.29 ? 46   GLY B CA  1 
ATOM   3951 C  C   . GLY B 1 47  ? -24.538 -1.472  -6.099  1.00 99.13  ? 46   GLY B C   1 
ATOM   3952 O  O   . GLY B 1 47  ? -24.705 -1.677  -4.894  1.00 102.69 ? 46   GLY B O   1 
ATOM   3953 N  N   . GLY B 1 48  ? -25.096 -0.433  -6.722  1.00 90.94  ? 47   GLY B N   1 
ATOM   3954 C  CA  . GLY B 1 48  ? -25.753 0.658   -5.981  1.00 79.55  ? 47   GLY B CA  1 
ATOM   3955 C  C   . GLY B 1 48  ? -24.720 1.618   -5.411  1.00 71.37  ? 47   GLY B C   1 
ATOM   3956 O  O   . GLY B 1 48  ? -25.010 2.449   -4.562  1.00 61.81  ? 47   GLY B O   1 
ATOM   3957 N  N   . ALA B 1 49  ? -23.489 1.480   -5.868  1.00 70.42  ? 48   ALA B N   1 
ATOM   3958 C  CA  . ALA B 1 49  ? -22.457 2.437   -5.551  1.00 73.69  ? 48   ALA B CA  1 
ATOM   3959 C  C   . ALA B 1 49  ? -22.577 3.602   -6.519  1.00 73.31  ? 48   ALA B C   1 
ATOM   3960 O  O   . ALA B 1 49  ? -22.913 3.408   -7.692  1.00 70.00  ? 48   ALA B O   1 
ATOM   3961 C  CB  . ALA B 1 49  ? -21.079 1.799   -5.667  1.00 71.88  ? 48   ALA B CB  1 
ATOM   3962 N  N   . LYS B 1 50  ? -22.295 4.811   -6.036  1.00 70.09  ? 49   LYS B N   1 
ATOM   3963 C  CA  . LYS B 1 50  ? -22.036 5.908   -6.944  1.00 64.33  ? 49   LYS B CA  1 
ATOM   3964 C  C   . LYS B 1 50  ? -20.755 5.584   -7.733  1.00 65.22  ? 49   LYS B C   1 
ATOM   3965 O  O   . LYS B 1 50  ? -19.680 5.381   -7.162  1.00 60.25  ? 49   LYS B O   1 
ATOM   3966 C  CB  . LYS B 1 50  ? -21.924 7.239   -6.212  1.00 65.36  ? 49   LYS B CB  1 
ATOM   3967 C  CG  . LYS B 1 50  ? -21.645 8.410   -7.158  1.00 71.91  ? 49   LYS B CG  1 
ATOM   3968 C  CD  . LYS B 1 50  ? -22.145 9.744   -6.607  1.00 78.69  ? 49   LYS B CD  1 
ATOM   3969 C  CE  . LYS B 1 50  ? -21.796 10.920  -7.526  1.00 84.96  ? 49   LYS B CE  1 
ATOM   3970 N  NZ  . LYS B 1 50  ? -22.093 10.682  -8.974  1.00 84.80  ? 49   LYS B NZ  1 
ATOM   3971 N  N   . VAL B 1 51  ? -20.887 5.504   -9.056  1.00 68.17  ? 50   VAL B N   1 
ATOM   3972 C  CA  . VAL B 1 51  ? -19.741 5.286   -9.932  1.00 71.29  ? 50   VAL B CA  1 
ATOM   3973 C  C   . VAL B 1 51  ? -19.214 6.641   -10.405 1.00 74.67  ? 50   VAL B C   1 
ATOM   3974 O  O   . VAL B 1 51  ? -19.991 7.508   -10.817 1.00 77.94  ? 50   VAL B O   1 
ATOM   3975 C  CB  . VAL B 1 51  ? -20.096 4.356   -11.120 1.00 71.11  ? 50   VAL B CB  1 
ATOM   3976 C  CG1 . VAL B 1 51  ? -19.036 4.403   -12.214 1.00 72.24  ? 50   VAL B CG1 1 
ATOM   3977 C  CG2 . VAL B 1 51  ? -20.235 2.930   -10.607 1.00 73.18  ? 50   VAL B CG2 1 
ATOM   3978 N  N   . ILE B 1 52  ? -17.899 6.846   -10.288 1.00 72.65  ? 51   ILE B N   1 
ATOM   3979 C  CA  . ILE B 1 52  ? -17.248 8.050   -10.841 1.00 65.89  ? 51   ILE B CA  1 
ATOM   3980 C  C   . ILE B 1 52  ? -16.329 7.603   -11.966 1.00 66.57  ? 51   ILE B C   1 
ATOM   3981 O  O   . ILE B 1 52  ? -15.447 6.767   -11.765 1.00 63.74  ? 51   ILE B O   1 
ATOM   3982 C  CB  . ILE B 1 52  ? -16.458 8.866   -9.790  1.00 58.44  ? 51   ILE B CB  1 
ATOM   3983 C  CG1 . ILE B 1 52  ? -17.375 9.329   -8.665  1.00 57.10  ? 51   ILE B CG1 1 
ATOM   3984 C  CG2 . ILE B 1 52  ? -15.831 10.099  -10.427 1.00 56.87  ? 51   ILE B CG2 1 
ATOM   3985 C  CD1 . ILE B 1 52  ? -16.701 9.409   -7.319  1.00 58.61  ? 51   ILE B CD1 1 
ATOM   3986 N  N   . ASP B 1 53  ? -16.555 8.141   -13.162 1.00 67.08  ? 52   ASP B N   1 
ATOM   3987 C  CA  . ASP B 1 53  ? -15.671 7.844   -14.269 1.00 65.47  ? 52   ASP B CA  1 
ATOM   3988 C  C   . ASP B 1 53  ? -14.459 8.730   -14.116 1.00 67.79  ? 52   ASP B C   1 
ATOM   3989 O  O   . ASP B 1 53  ? -14.518 9.933   -14.356 1.00 70.44  ? 52   ASP B O   1 
ATOM   3990 C  CB  . ASP B 1 53  ? -16.327 8.071   -15.626 1.00 63.07  ? 52   ASP B CB  1 
ATOM   3991 C  CG  . ASP B 1 53  ? -15.410 7.695   -16.781 1.00 66.86  ? 52   ASP B CG  1 
ATOM   3992 O  OD1 . ASP B 1 53  ? -14.290 7.162   -16.536 1.00 66.79  ? 52   ASP B OD1 1 
ATOM   3993 O  OD2 . ASP B 1 53  ? -15.817 7.923   -17.939 1.00 66.78  ? 52   ASP B OD2 1 
ATOM   3994 N  N   . ALA B 1 54  ? -13.359 8.116   -13.701 1.00 71.20  ? 53   ALA B N   1 
ATOM   3995 C  CA  . ALA B 1 54  ? -12.094 8.818   -13.530 1.00 68.31  ? 53   ALA B CA  1 
ATOM   3996 C  C   . ALA B 1 54  ? -11.120 8.511   -14.669 1.00 61.03  ? 53   ALA B C   1 
ATOM   3997 O  O   . ALA B 1 54  ? -9.911  8.624   -14.511 1.00 53.21  ? 53   ALA B O   1 
ATOM   3998 C  CB  . ALA B 1 54  ? -11.472 8.452   -12.195 1.00 67.08  ? 53   ALA B CB  1 
ATOM   3999 N  N   . THR B 1 55  ? -11.635 8.134   -15.826 1.00 60.03  ? 54   THR B N   1 
ATOM   4000 C  CA  . THR B 1 55  ? -10.738 7.843   -16.923 1.00 65.38  ? 54   THR B CA  1 
ATOM   4001 C  C   . THR B 1 55  ? -9.950  9.101   -17.288 1.00 60.03  ? 54   THR B C   1 
ATOM   4002 O  O   . THR B 1 55  ? -10.493 10.198  -17.322 1.00 51.90  ? 54   THR B O   1 
ATOM   4003 C  CB  . THR B 1 55  ? -11.461 7.234   -18.141 1.00 67.30  ? 54   THR B CB  1 
ATOM   4004 O  OG1 . THR B 1 55  ? -12.742 7.841   -18.314 1.00 69.65  ? 54   THR B OG1 1 
ATOM   4005 C  CG2 . THR B 1 55  ? -11.645 5.727   -17.951 1.00 66.68  ? 54   THR B CG2 1 
ATOM   4006 N  N   . GLY B 1 56  ? -8.652  8.923   -17.519 1.00 59.13  ? 55   GLY B N   1 
ATOM   4007 C  CA  . GLY B 1 56  ? -7.802  10.020  -17.963 1.00 60.95  ? 55   GLY B CA  1 
ATOM   4008 C  C   . GLY B 1 56  ? -7.531  11.052  -16.896 1.00 61.03  ? 55   GLY B C   1 
ATOM   4009 O  O   . GLY B 1 56  ? -6.986  12.119  -17.188 1.00 54.40  ? 55   GLY B O   1 
ATOM   4010 N  N   . LYS B 1 57  ? -7.936  10.736  -15.669 1.00 57.89  ? 56   LYS B N   1 
ATOM   4011 C  CA  . LYS B 1 57  ? -7.763  11.625  -14.540 1.00 59.21  ? 56   LYS B CA  1 
ATOM   4012 C  C   . LYS B 1 57  ? -6.838  10.980  -13.510 1.00 58.90  ? 56   LYS B C   1 
ATOM   4013 O  O   . LYS B 1 57  ? -6.572  9.777   -13.558 1.00 57.49  ? 56   LYS B O   1 
ATOM   4014 C  CB  . LYS B 1 57  ? -9.117  11.928  -13.866 1.00 61.25  ? 56   LYS B CB  1 
ATOM   4015 C  CG  . LYS B 1 57  ? -10.298 12.131  -14.802 1.00 59.25  ? 56   LYS B CG  1 
ATOM   4016 C  CD  . LYS B 1 57  ? -10.051 13.256  -15.781 1.00 62.41  ? 56   LYS B CD  1 
ATOM   4017 C  CE  . LYS B 1 57  ? -11.256 13.485  -16.661 1.00 60.78  ? 56   LYS B CE  1 
ATOM   4018 N  NZ  . LYS B 1 57  ? -11.120 14.724  -17.468 1.00 65.12  ? 56   LYS B NZ  1 
ATOM   4019 N  N   . LEU B 1 58  ? -6.358  11.798  -12.574 1.00 55.02  ? 57   LEU B N   1 
ATOM   4020 C  CA  . LEU B 1 58  ? -5.525  11.327  -11.483 1.00 50.18  ? 57   LEU B CA  1 
ATOM   4021 C  C   . LEU B 1 58  ? -6.378  11.245  -10.248 1.00 47.97  ? 57   LEU B C   1 
ATOM   4022 O  O   . LEU B 1 58  ? -7.227  12.101  -10.009 1.00 51.70  ? 57   LEU B O   1 
ATOM   4023 C  CB  . LEU B 1 58  ? -4.360  12.277  -11.232 1.00 51.87  ? 57   LEU B CB  1 
ATOM   4024 C  CG  . LEU B 1 58  ? -3.669  12.798  -12.490 1.00 52.74  ? 57   LEU B CG  1 
ATOM   4025 C  CD1 . LEU B 1 58  ? -2.553  13.747  -12.121 1.00 54.35  ? 57   LEU B CD1 1 
ATOM   4026 C  CD2 . LEU B 1 58  ? -3.110  11.629  -13.268 1.00 54.40  ? 57   LEU B CD2 1 
ATOM   4027 N  N   . VAL B 1 59  ? -6.164  10.203  -9.465  1.00 43.08  ? 58   VAL B N   1 
ATOM   4028 C  CA  . VAL B 1 59  ? -6.870  10.039  -8.226  1.00 41.77  ? 58   VAL B CA  1 
ATOM   4029 C  C   . VAL B 1 59  ? -5.825  10.253  -7.134  1.00 40.06  ? 58   VAL B C   1 
ATOM   4030 O  O   . VAL B 1 59  ? -5.120  9.325   -6.704  1.00 41.77  ? 58   VAL B O   1 
ATOM   4031 C  CB  . VAL B 1 59  ? -7.564  8.654   -8.118  1.00 43.58  ? 58   VAL B CB  1 
ATOM   4032 C  CG1 . VAL B 1 59  ? -8.545  8.619   -6.954  1.00 43.20  ? 58   VAL B CG1 1 
ATOM   4033 C  CG2 . VAL B 1 59  ? -8.300  8.326   -9.401  1.00 44.04  ? 58   VAL B CG2 1 
ATOM   4034 N  N   . ILE B 1 60  ? -5.768  11.497  -6.674  1.00 37.64  ? 59   ILE B N   1 
ATOM   4035 C  CA  . ILE B 1 60  ? -4.828  11.934  -5.657  1.00 34.98  ? 59   ILE B CA  1 
ATOM   4036 C  C   . ILE B 1 60  ? -5.450  11.976  -4.275  1.00 34.53  ? 59   ILE B C   1 
ATOM   4037 O  O   . ILE B 1 60  ? -6.671  12.082  -4.134  1.00 33.62  ? 59   ILE B O   1 
ATOM   4038 C  CB  . ILE B 1 60  ? -4.269  13.328  -5.991  1.00 35.51  ? 59   ILE B CB  1 
ATOM   4039 C  CG1 . ILE B 1 60  ? -5.333  14.439  -5.817  1.00 33.73  ? 59   ILE B CG1 1 
ATOM   4040 C  CG2 . ILE B 1 60  ? -3.706  13.317  -7.417  1.00 37.96  ? 59   ILE B CG2 1 
ATOM   4041 C  CD1 . ILE B 1 60  ? -4.771  15.853  -5.831  1.00 34.29  ? 59   ILE B CD1 1 
ATOM   4042 N  N   . PRO B 1 61  ? -4.610  11.891  -3.237  1.00 35.73  ? 60   PRO B N   1 
ATOM   4043 C  CA  . PRO B 1 61  ? -5.125  12.197  -1.927  1.00 36.55  ? 60   PRO B CA  1 
ATOM   4044 C  C   . PRO B 1 61  ? -5.559  13.627  -1.869  1.00 36.21  ? 60   PRO B C   1 
ATOM   4045 O  O   . PRO B 1 61  ? -4.959  14.488  -2.515  1.00 40.03  ? 60   PRO B O   1 
ATOM   4046 C  CB  . PRO B 1 61  ? -3.913  12.046  -1.019  1.00 35.96  ? 60   PRO B CB  1 
ATOM   4047 C  CG  . PRO B 1 61  ? -3.021  11.134  -1.743  1.00 36.24  ? 60   PRO B CG  1 
ATOM   4048 C  CD  . PRO B 1 61  ? -3.197  11.512  -3.175  1.00 35.51  ? 60   PRO B CD  1 
ATOM   4049 N  N   . GLY B 1 62  ? -6.602  13.872  -1.098  1.00 35.80  ? 61   GLY B N   1 
ATOM   4050 C  CA  . GLY B 1 62  ? -7.070  15.210  -0.903  1.00 34.95  ? 61   GLY B CA  1 
ATOM   4051 C  C   . GLY B 1 62  ? -5.975  16.045  -0.314  1.00 35.53  ? 61   GLY B C   1 
ATOM   4052 O  O   . GLY B 1 62  ? -5.212  15.587  0.533   1.00 37.81  ? 61   GLY B O   1 
ATOM   4053 N  N   . GLY B 1 63  ? -5.859  17.269  -0.803  1.00 36.87  ? 62   GLY B N   1 
ATOM   4054 C  CA  . GLY B 1 63  ? -4.939  18.217  -0.218  1.00 37.07  ? 62   GLY B CA  1 
ATOM   4055 C  C   . GLY B 1 63  ? -5.136  18.481  1.277   1.00 35.58  ? 62   GLY B C   1 
ATOM   4056 O  O   . GLY B 1 63  ? -6.256  18.446  1.797   1.00 31.75  ? 62   GLY B O   1 
ATOM   4057 N  N   . ILE B 1 64  ? -4.017  18.743  1.950   1.00 34.75  ? 63   ILE B N   1 
ATOM   4058 C  CA  . ILE B 1 64  ? -4.006  19.252  3.311   1.00 34.67  ? 63   ILE B CA  1 
ATOM   4059 C  C   . ILE B 1 64  ? -3.309  20.608  3.318   1.00 34.90  ? 63   ILE B C   1 
ATOM   4060 O  O   . ILE B 1 64  ? -2.157  20.724  2.908   1.00 33.40  ? 63   ILE B O   1 
ATOM   4061 C  CB  . ILE B 1 64  ? -3.274  18.312  4.285   1.00 34.63  ? 63   ILE B CB  1 
ATOM   4062 C  CG1 . ILE B 1 64  ? -3.923  16.918  4.280   1.00 36.78  ? 63   ILE B CG1 1 
ATOM   4063 C  CG2 . ILE B 1 64  ? -3.299  18.895  5.676   1.00 35.23  ? 63   ILE B CG2 1 
ATOM   4064 C  CD1 . ILE B 1 64  ? -3.091  15.822  4.921   1.00 39.11  ? 63   ILE B CD1 1 
ATOM   4065 N  N   . ASP B 1 65  ? -4.009  21.613  3.847   1.00 37.29  ? 64   ASP B N   1 
ATOM   4066 C  CA  . ASP B 1 65  ? -3.503  22.976  3.940   1.00 36.63  ? 64   ASP B CA  1 
ATOM   4067 C  C   . ASP B 1 65  ? -3.069  23.269  5.371   1.00 36.60  ? 64   ASP B C   1 
ATOM   4068 O  O   . ASP B 1 65  ? -3.879  23.552  6.253   1.00 38.12  ? 64   ASP B O   1 
ATOM   4069 C  CB  . ASP B 1 65  ? -4.600  23.955  3.512   1.00 38.51  ? 64   ASP B CB  1 
ATOM   4070 C  CG  . ASP B 1 65  ? -4.050  25.304  3.041   1.00 38.72  ? 64   ASP B CG  1 
ATOM   4071 O  OD1 . ASP B 1 65  ? -3.073  25.815  3.628   1.00 34.70  ? 64   ASP B OD1 1 
ATOM   4072 O  OD2 . ASP B 1 65  ? -4.603  25.831  2.046   1.00 42.18  ? 64   ASP B OD2 1 
ATOM   4073 N  N   . THR B 1 66  ? -1.775  23.238  5.597   1.00 35.53  ? 65   THR B N   1 
ATOM   4074 C  CA  . THR B 1 66  ? -1.233  23.378  6.947   1.00 35.11  ? 65   THR B CA  1 
ATOM   4075 C  C   . THR B 1 66  ? -1.304  24.793  7.564   1.00 32.80  ? 65   THR B C   1 
ATOM   4076 O  O   . THR B 1 66  ? -0.933  24.978  8.723   1.00 30.54  ? 65   THR B O   1 
ATOM   4077 C  CB  . THR B 1 66  ? 0.232   22.934  6.941   1.00 35.95  ? 65   THR B CB  1 
ATOM   4078 O  OG1 . THR B 1 66  ? 0.894   23.515  5.796   1.00 34.97  ? 65   THR B OG1 1 
ATOM   4079 C  CG2 . THR B 1 66  ? 0.283   21.437  6.858   1.00 34.55  ? 65   THR B CG2 1 
ATOM   4080 N  N   . SER B 1 67  ? -1.749  25.789  6.808   1.00 31.68  ? 66   SER B N   1 
ATOM   4081 C  CA  . SER B 1 67  ? -1.867  27.128  7.375   1.00 33.72  ? 66   SER B CA  1 
ATOM   4082 C  C   . SER B 1 67  ? -3.034  27.876  6.802   1.00 34.38  ? 66   SER B C   1 
ATOM   4083 O  O   . SER B 1 67  ? -2.959  28.405  5.696   1.00 32.55  ? 66   SER B O   1 
ATOM   4084 C  CB  . SER B 1 67  ? -0.588  27.942  7.166   1.00 37.08  ? 66   SER B CB  1 
ATOM   4085 O  OG  . SER B 1 67  ? -0.742  29.230  7.730   1.00 36.13  ? 66   SER B OG  1 
ATOM   4086 N  N   . THR B 1 68  ? -4.127  27.896  7.558   1.00 37.45  ? 67   THR B N   1 
ATOM   4087 C  CA  . THR B 1 68  ? -5.298  28.708  7.230   1.00 36.65  ? 67   THR B CA  1 
ATOM   4088 C  C   . THR B 1 68  ? -5.681  29.517  8.440   1.00 36.13  ? 67   THR B C   1 
ATOM   4089 O  O   . THR B 1 68  ? -5.390  29.132  9.570   1.00 33.68  ? 67   THR B O   1 
ATOM   4090 C  CB  . THR B 1 68  ? -6.507  27.855  6.851   1.00 37.09  ? 67   THR B CB  1 
ATOM   4091 O  OG1 . THR B 1 68  ? -6.935  27.083  7.984   1.00 40.52  ? 67   THR B OG1 1 
ATOM   4092 C  CG2 . THR B 1 68  ? -6.175  26.955  5.701   1.00 38.28  ? 67   THR B CG2 1 
ATOM   4093 N  N   . HIS B 1 69  ? -6.356  30.629  8.192   1.00 36.75  ? 68   HIS B N   1 
ATOM   4094 C  CA  . HIS B 1 69  ? -6.687  31.586  9.233   1.00 37.52  ? 68   HIS B CA  1 
ATOM   4095 C  C   . HIS B 1 69  ? -8.164  31.932  9.262   1.00 38.49  ? 68   HIS B C   1 
ATOM   4096 O  O   . HIS B 1 69  ? -8.507  33.071  9.492   1.00 36.48  ? 68   HIS B O   1 
ATOM   4097 C  CB  . HIS B 1 69  ? -5.882  32.839  9.019   1.00 35.13  ? 68   HIS B CB  1 
ATOM   4098 C  CG  . HIS B 1 69  ? -4.416  32.630  9.176   1.00 34.81  ? 68   HIS B CG  1 
ATOM   4099 N  ND1 . HIS B 1 69  ? -3.820  32.628  10.407  1.00 34.04  ? 68   HIS B ND1 1 
ATOM   4100 C  CD2 . HIS B 1 69  ? -3.419  32.431  8.274   1.00 34.77  ? 68   HIS B CD2 1 
ATOM   4101 C  CE1 . HIS B 1 69  ? -2.520  32.440  10.266  1.00 34.63  ? 68   HIS B CE1 1 
ATOM   4102 N  NE2 . HIS B 1 69  ? -2.252  32.297  8.984   1.00 32.40  ? 68   HIS B NE2 1 
ATOM   4103 N  N   . PHE B 1 70  ? -9.034  30.942  9.088   1.00 41.92  ? 69   PHE B N   1 
ATOM   4104 C  CA  . PHE B 1 70  ? -10.463 31.228  9.046   1.00 43.26  ? 69   PHE B CA  1 
ATOM   4105 C  C   . PHE B 1 70  ? -10.941 31.810  10.354  1.00 44.22  ? 69   PHE B C   1 
ATOM   4106 O  O   . PHE B 1 70  ? -10.485 31.398  11.408  1.00 46.93  ? 69   PHE B O   1 
ATOM   4107 C  CB  . PHE B 1 70  ? -11.255 29.971  8.789   1.00 45.25  ? 69   PHE B CB  1 
ATOM   4108 C  CG  . PHE B 1 70  ? -10.841 29.226  7.564   1.00 45.11  ? 69   PHE B CG  1 
ATOM   4109 C  CD1 . PHE B 1 70  ? -10.368 29.887  6.446   1.00 45.35  ? 69   PHE B CD1 1 
ATOM   4110 C  CD2 . PHE B 1 70  ? -10.972 27.854  7.515   1.00 47.95  ? 69   PHE B CD2 1 
ATOM   4111 C  CE1 . PHE B 1 70  ? -10.007 29.181  5.306   1.00 46.80  ? 69   PHE B CE1 1 
ATOM   4112 C  CE2 . PHE B 1 70  ? -10.618 27.144  6.374   1.00 51.17  ? 69   PHE B CE2 1 
ATOM   4113 C  CZ  . PHE B 1 70  ? -10.129 27.805  5.272   1.00 48.11  ? 69   PHE B CZ  1 
ATOM   4114 N  N   . HIS B 1 71  ? -11.842 32.781  10.266  1.00 48.32  ? 70   HIS B N   1 
ATOM   4115 C  CA  . HIS B 1 71  ? -12.438 33.477  11.420  1.00 53.58  ? 70   HIS B CA  1 
ATOM   4116 C  C   . HIS B 1 71  ? -11.461 34.158  12.391  1.00 54.96  ? 70   HIS B C   1 
ATOM   4117 O  O   . HIS B 1 71  ? -11.832 34.464  13.531  1.00 51.05  ? 70   HIS B O   1 
ATOM   4118 C  CB  . HIS B 1 71  ? -13.342 32.521  12.216  1.00 60.32  ? 70   HIS B CB  1 
ATOM   4119 C  CG  . HIS B 1 71  ? -14.601 33.160  12.731  1.00 62.73  ? 70   HIS B CG  1 
ATOM   4120 N  ND1 . HIS B 1 71  ? -14.619 34.416  13.302  1.00 61.67  ? 70   HIS B ND1 1 
ATOM   4121 C  CD2 . HIS B 1 71  ? -15.878 32.708  12.773  1.00 60.58  ? 70   HIS B CD2 1 
ATOM   4122 C  CE1 . HIS B 1 71  ? -15.856 34.721  13.649  1.00 61.01  ? 70   HIS B CE1 1 
ATOM   4123 N  NE2 . HIS B 1 71  ? -16.637 33.699  13.346  1.00 59.40  ? 70   HIS B NE2 1 
ATOM   4124 N  N   . GLN B 1 72  ? -10.231 34.405  11.940  1.00 55.70  ? 71   GLN B N   1 
ATOM   4125 C  CA  . GLN B 1 72  ? -9.209  35.036  12.775  1.00 51.91  ? 71   GLN B CA  1 
ATOM   4126 C  C   . GLN B 1 72  ? -9.303  36.561  12.671  1.00 50.15  ? 71   GLN B C   1 
ATOM   4127 O  O   . GLN B 1 72  ? -9.427  37.138  11.586  1.00 51.35  ? 71   GLN B O   1 
ATOM   4128 C  CB  . GLN B 1 72  ? -7.794  34.575  12.370  1.00 55.72  ? 71   GLN B CB  1 
ATOM   4129 C  CG  . GLN B 1 72  ? -6.684  35.185  13.234  1.00 56.55  ? 71   GLN B CG  1 
ATOM   4130 C  CD  . GLN B 1 72  ? -5.288  34.630  13.026  1.00 53.01  ? 71   GLN B CD  1 
ATOM   4131 O  OE1 . GLN B 1 72  ? -4.809  34.553  11.908  1.00 52.80  ? 71   GLN B OE1 1 
ATOM   4132 N  NE2 . GLN B 1 72  ? -4.604  34.303  14.122  1.00 51.52  ? 71   GLN B NE2 1 
ATOM   4133 N  N   . THR B 1 73  ? -9.260  37.205  13.823  1.00 50.80  ? 72   THR B N   1 
ATOM   4134 C  CA  . THR B 1 73  ? -9.134  38.651  13.889  1.00 50.16  ? 72   THR B CA  1 
ATOM   4135 C  C   . THR B 1 73  ? -7.670  39.008  14.149  1.00 45.56  ? 72   THR B C   1 
ATOM   4136 O  O   . THR B 1 73  ? -7.099  38.665  15.193  1.00 37.34  ? 72   THR B O   1 
ATOM   4137 C  CB  . THR B 1 73  ? -10.026 39.265  14.985  1.00 48.93  ? 72   THR B CB  1 
ATOM   4138 O  OG1 . THR B 1 73  ? -11.378 38.842  14.774  1.00 44.00  ? 72   THR B OG1 1 
ATOM   4139 C  CG2 . THR B 1 73  ? -9.936  40.791  14.919  1.00 49.67  ? 72   THR B CG2 1 
ATOM   4140 N  N   . PHE B 1 74  ? -7.101  39.715  13.183  1.00 43.15  ? 73   PHE B N   1 
ATOM   4141 C  CA  . PHE B 1 74  ? -5.676  39.967  13.116  1.00 43.10  ? 73   PHE B CA  1 
ATOM   4142 C  C   . PHE B 1 74  ? -5.471  41.406  12.699  1.00 44.35  ? 73   PHE B C   1 
ATOM   4143 O  O   . PHE B 1 74  ? -6.060  41.856  11.718  1.00 42.78  ? 73   PHE B O   1 
ATOM   4144 C  CB  . PHE B 1 74  ? -5.028  39.036  12.079  1.00 42.63  ? 73   PHE B CB  1 
ATOM   4145 C  CG  . PHE B 1 74  ? -3.524  39.035  12.107  1.00 40.31  ? 73   PHE B CG  1 
ATOM   4146 C  CD1 . PHE B 1 74  ? -2.842  38.304  13.074  1.00 39.06  ? 73   PHE B CD1 1 
ATOM   4147 C  CD2 . PHE B 1 74  ? -2.796  39.735  11.153  1.00 40.20  ? 73   PHE B CD2 1 
ATOM   4148 C  CE1 . PHE B 1 74  ? -1.461  38.288  13.128  1.00 40.26  ? 73   PHE B CE1 1 
ATOM   4149 C  CE2 . PHE B 1 74  ? -1.418  39.722  11.196  1.00 42.85  ? 73   PHE B CE2 1 
ATOM   4150 C  CZ  . PHE B 1 74  ? -0.752  39.006  12.197  1.00 42.42  ? 73   PHE B CZ  1 
ATOM   4151 N  N   . MET B 1 75  ? -4.640  42.135  13.439  1.00 48.78  ? 74   MET B N   1 
ATOM   4152 C  CA  . MET B 1 75  ? -4.302  43.498  13.066  1.00 56.58  ? 74   MET B CA  1 
ATOM   4153 C  C   . MET B 1 75  ? -5.552  44.371  12.879  1.00 54.74  ? 74   MET B C   1 
ATOM   4154 O  O   . MET B 1 75  ? -5.590  45.220  11.982  1.00 55.89  ? 74   MET B O   1 
ATOM   4155 C  CB  . MET B 1 75  ? -3.439  43.482  11.772  1.00 66.85  ? 74   MET B CB  1 
ATOM   4156 C  CG  . MET B 1 75  ? -1.990  42.994  11.955  1.00 71.30  ? 74   MET B CG  1 
ATOM   4157 S  SD  . MET B 1 75  ? -0.944  43.151  10.479  0.85 63.01  ? 74   MET B SD  1 
ATOM   4158 C  CE  . MET B 1 75  ? -0.708  44.907  10.405  1.00 58.38  ? 74   MET B CE  1 
ATOM   4159 N  N   . ASN B 1 76  ? -6.572  44.121  13.705  1.00 54.51  ? 75   ASN B N   1 
ATOM   4160 C  CA  . ASN B 1 76  ? -7.858  44.882  13.710  1.00 57.64  ? 75   ASN B CA  1 
ATOM   4161 C  C   . ASN B 1 76  ? -8.820  44.608  12.564  1.00 57.35  ? 75   ASN B C   1 
ATOM   4162 O  O   . ASN B 1 76  ? -9.778  45.347  12.368  1.00 54.97  ? 75   ASN B O   1 
ATOM   4163 C  CB  . ASN B 1 76  ? -7.653  46.396  13.781  1.00 57.65  ? 75   ASN B CB  1 
ATOM   4164 C  CG  . ASN B 1 76  ? -7.224  46.850  15.146  1.00 58.31  ? 75   ASN B CG  1 
ATOM   4165 O  OD1 . ASN B 1 76  ? -7.631  46.276  16.165  1.00 63.58  ? 75   ASN B OD1 1 
ATOM   4166 N  ND2 . ASN B 1 76  ? -6.377  47.867  15.184  1.00 61.19  ? 75   ASN B ND2 1 
ATOM   4167 N  N   . ALA B 1 77  ? -8.559  43.553  11.808  1.00 58.38  ? 76   ALA B N   1 
ATOM   4168 C  CA  . ALA B 1 77  ? -9.494  43.105  10.805  1.00 57.82  ? 76   ALA B CA  1 
ATOM   4169 C  C   . ALA B 1 77  ? -9.818  41.646  11.076  1.00 58.47  ? 76   ALA B C   1 
ATOM   4170 O  O   . ALA B 1 77  ? -8.984  40.893  11.574  1.00 59.39  ? 76   ALA B O   1 
ATOM   4171 C  CB  . ALA B 1 77  ? -8.913  43.295  9.411   1.00 61.66  ? 76   ALA B CB  1 
ATOM   4172 N  N   . THR B 1 78  ? -11.036 41.249  10.723  1.00 57.29  ? 77   THR B N   1 
ATOM   4173 C  CA  . THR B 1 78  ? -11.425 39.865  10.847  1.00 55.23  ? 77   THR B CA  1 
ATOM   4174 C  C   . THR B 1 78  ? -11.507 39.205  9.471   1.00 52.95  ? 77   THR B C   1 
ATOM   4175 O  O   . THR B 1 78  ? -12.092 39.744  8.514   1.00 47.21  ? 77   THR B O   1 
ATOM   4176 C  CB  . THR B 1 78  ? -12.728 39.728  11.620  1.00 57.82  ? 77   THR B CB  1 
ATOM   4177 O  OG1 . THR B 1 78  ? -12.484 40.100  12.975  1.00 49.34  ? 77   THR B OG1 1 
ATOM   4178 C  CG2 . THR B 1 78  ? -13.236 38.279  11.590  1.00 62.75  ? 77   THR B CG2 1 
ATOM   4179 N  N   . CYS B 1 79  ? -10.885 38.035  9.382   1.00 48.65  ? 78   CYS B N   1 
ATOM   4180 C  CA  . CYS B 1 79  ? -10.745 37.362  8.111   1.00 49.11  ? 78   CYS B CA  1 
ATOM   4181 C  C   . CYS B 1 79  ? -12.115 37.167  7.445   1.00 48.59  ? 78   CYS B C   1 
ATOM   4182 O  O   . CYS B 1 79  ? -13.062 36.707  8.080   1.00 49.53  ? 78   CYS B O   1 
ATOM   4183 C  CB  . CYS B 1 79  ? -10.023 36.027  8.292   1.00 46.47  ? 78   CYS B CB  1 
ATOM   4184 S  SG  . CYS B 1 79  ? -9.819  35.129  6.739   0.94 42.73  ? 78   CYS B SG  1 
ATOM   4185 N  N   . VAL B 1 80  ? -12.198 37.550  6.176   1.00 46.18  ? 79   VAL B N   1 
ATOM   4186 C  CA  . VAL B 1 80  ? -13.417 37.439  5.411   1.00 46.82  ? 79   VAL B CA  1 
ATOM   4187 C  C   . VAL B 1 80  ? -14.084 36.059  5.496   1.00 46.33  ? 79   VAL B C   1 
ATOM   4188 O  O   . VAL B 1 80  ? -15.300 35.973  5.637   1.00 49.04  ? 79   VAL B O   1 
ATOM   4189 C  CB  . VAL B 1 80  ? -13.164 37.844  3.940   1.00 49.25  ? 79   VAL B CB  1 
ATOM   4190 C  CG1 . VAL B 1 80  ? -14.241 37.291  3.008   1.00 51.46  ? 79   VAL B CG1 1 
ATOM   4191 C  CG2 . VAL B 1 80  ? -13.114 39.355  3.844   1.00 50.50  ? 79   VAL B CG2 1 
ATOM   4192 N  N   . ASP B 1 81  ? -13.316 34.983  5.405   1.00 45.25  ? 80   ASP B N   1 
ATOM   4193 C  CA  . ASP B 1 81  ? -13.913 33.637  5.414   1.00 46.57  ? 80   ASP B CA  1 
ATOM   4194 C  C   . ASP B 1 81  ? -14.063 33.071  6.828   1.00 48.31  ? 80   ASP B C   1 
ATOM   4195 O  O   . ASP B 1 81  ? -13.127 33.048  7.611   1.00 48.00  ? 80   ASP B O   1 
ATOM   4196 C  CB  . ASP B 1 81  ? -13.055 32.660  4.634   1.00 46.29  ? 80   ASP B CB  1 
ATOM   4197 C  CG  . ASP B 1 81  ? -13.127 32.856  3.150   1.00 44.64  ? 80   ASP B CG  1 
ATOM   4198 O  OD1 . ASP B 1 81  ? -14.132 33.338  2.650   1.00 43.02  ? 80   ASP B OD1 1 
ATOM   4199 O  OD2 . ASP B 1 81  ? -12.157 32.477  2.464   1.00 48.38  ? 80   ASP B OD2 1 
ATOM   4200 N  N   . ASP B 1 82  ? -15.250 32.607  7.153   1.00 46.59  ? 81   ASP B N   1 
ATOM   4201 C  CA  . ASP B 1 82  ? -15.439 31.879  8.385   1.00 45.84  ? 81   ASP B CA  1 
ATOM   4202 C  C   . ASP B 1 82  ? -15.038 30.450  8.100   1.00 43.05  ? 81   ASP B C   1 
ATOM   4203 O  O   . ASP B 1 82  ? -14.599 30.117  6.993   1.00 40.07  ? 81   ASP B O   1 
ATOM   4204 C  CB  . ASP B 1 82  ? -16.902 31.921  8.819   1.00 49.91  ? 81   ASP B CB  1 
ATOM   4205 C  CG  . ASP B 1 82  ? -17.824 31.207  7.834   1.00 53.07  ? 81   ASP B CG  1 
ATOM   4206 O  OD1 . ASP B 1 82  ? -17.435 30.935  6.678   1.00 60.91  ? 81   ASP B OD1 1 
ATOM   4207 O  OD2 . ASP B 1 82  ? -18.965 30.941  8.199   1.00 56.74  ? 81   ASP B OD2 1 
ATOM   4208 N  N   . PHE B 1 83  ? -15.235 29.592  9.092   1.00 42.81  ? 82   PHE B N   1 
ATOM   4209 C  CA  . PHE B 1 83  ? -14.858 28.202  8.952   1.00 41.28  ? 82   PHE B CA  1 
ATOM   4210 C  C   . PHE B 1 83  ? -15.646 27.401  7.918   1.00 40.48  ? 82   PHE B C   1 
ATOM   4211 O  O   . PHE B 1 83  ? -15.130 26.443  7.348   1.00 40.36  ? 82   PHE B O   1 
ATOM   4212 C  CB  . PHE B 1 83  ? -14.890 27.522  10.306  1.00 41.91  ? 82   PHE B CB  1 
ATOM   4213 C  CG  . PHE B 1 83  ? -13.610 27.648  11.060  1.00 41.13  ? 82   PHE B CG  1 
ATOM   4214 C  CD1 . PHE B 1 83  ? -12.519 26.822  10.738  1.00 41.61  ? 82   PHE B CD1 1 
ATOM   4215 C  CD2 . PHE B 1 83  ? -13.477 28.582  12.057  1.00 43.12  ? 82   PHE B CD2 1 
ATOM   4216 C  CE1 . PHE B 1 83  ? -11.330 26.903  11.425  1.00 41.50  ? 82   PHE B CE1 1 
ATOM   4217 C  CE2 . PHE B 1 83  ? -12.282 28.684  12.761  1.00 47.56  ? 82   PHE B CE2 1 
ATOM   4218 C  CZ  . PHE B 1 83  ? -11.209 27.833  12.453  1.00 47.14  ? 82   PHE B CZ  1 
ATOM   4219 N  N   . TYR B 1 84  ? -16.871 27.815  7.646   1.00 45.34  ? 83   TYR B N   1 
ATOM   4220 C  CA  . TYR B 1 84  ? -17.669 27.173  6.601   1.00 45.23  ? 83   TYR B CA  1 
ATOM   4221 C  C   . TYR B 1 84  ? -17.190 27.575  5.214   1.00 42.58  ? 83   TYR B C   1 
ATOM   4222 O  O   . TYR B 1 84  ? -16.914 26.716  4.379   1.00 41.17  ? 83   TYR B O   1 
ATOM   4223 C  CB  . TYR B 1 84  ? -19.138 27.539  6.720   1.00 45.45  ? 83   TYR B CB  1 
ATOM   4224 C  CG  . TYR B 1 84  ? -19.930 27.035  5.531   1.00 45.73  ? 83   TYR B CG  1 
ATOM   4225 C  CD1 . TYR B 1 84  ? -20.416 25.740  5.513   1.00 45.78  ? 83   TYR B CD1 1 
ATOM   4226 C  CD2 . TYR B 1 84  ? -20.204 27.861  4.435   1.00 44.20  ? 83   TYR B CD2 1 
ATOM   4227 C  CE1 . TYR B 1 84  ? -21.159 25.276  4.450   1.00 47.36  ? 83   TYR B CE1 1 
ATOM   4228 C  CE2 . TYR B 1 84  ? -20.933 27.398  3.356   1.00 44.79  ? 83   TYR B CE2 1 
ATOM   4229 C  CZ  . TYR B 1 84  ? -21.410 26.105  3.367   1.00 46.28  ? 83   TYR B CZ  1 
ATOM   4230 O  OH  . TYR B 1 84  ? -22.146 25.606  2.310   1.00 52.23  ? 83   TYR B OH  1 
ATOM   4231 N  N   . HIS B 1 85  ? -17.129 28.882  4.962   1.00 43.52  ? 84   HIS B N   1 
ATOM   4232 C  CA  . HIS B 1 85  ? -16.784 29.358  3.624   1.00 50.64  ? 84   HIS B CA  1 
ATOM   4233 C  C   . HIS B 1 85  ? -15.365 28.944  3.280   1.00 48.24  ? 84   HIS B C   1 
ATOM   4234 O  O   . HIS B 1 85  ? -15.075 28.594  2.127   1.00 44.10  ? 84   HIS B O   1 
ATOM   4235 C  CB  . HIS B 1 85  ? -16.980 30.864  3.483   1.00 53.22  ? 84   HIS B CB  1 
ATOM   4236 C  CG  . HIS B 1 85  ? -18.411 31.256  3.407   1.00 60.12  ? 84   HIS B CG  1 
ATOM   4237 N  ND1 . HIS B 1 85  ? -19.180 31.017  2.286   1.00 66.52  ? 84   HIS B ND1 1 
ATOM   4238 C  CD2 . HIS B 1 85  ? -19.237 31.815  4.320   1.00 67.16  ? 84   HIS B CD2 1 
ATOM   4239 C  CE1 . HIS B 1 85  ? -20.415 31.434  2.501   1.00 72.88  ? 84   HIS B CE1 1 
ATOM   4240 N  NE2 . HIS B 1 85  ? -20.475 31.925  3.728   1.00 81.20  ? 84   HIS B NE2 1 
ATOM   4241 N  N   . GLY B 1 86  ? -14.514 28.936  4.302   1.00 44.89  ? 85   GLY B N   1 
ATOM   4242 C  CA  . GLY B 1 86  ? -13.139 28.523  4.147   1.00 45.09  ? 85   GLY B CA  1 
ATOM   4243 C  C   . GLY B 1 86  ? -12.973 27.059  3.768   1.00 46.30  ? 85   GLY B C   1 
ATOM   4244 O  O   . GLY B 1 86  ? -12.298 26.738  2.799   1.00 49.87  ? 85   GLY B O   1 
ATOM   4245 N  N   . THR B 1 87  ? -13.610 26.169  4.519   1.00 42.56  ? 86   THR B N   1 
ATOM   4246 C  CA  . THR B 1 87  ? -13.508 24.767  4.228   1.00 41.43  ? 86   THR B CA  1 
ATOM   4247 C  C   . THR B 1 87  ? -14.172 24.495  2.889   1.00 45.63  ? 86   THR B C   1 
ATOM   4248 O  O   . THR B 1 87  ? -13.675 23.679  2.105   1.00 54.47  ? 86   THR B O   1 
ATOM   4249 C  CB  . THR B 1 87  ? -14.107 23.860  5.336   1.00 36.59  ? 86   THR B CB  1 
ATOM   4250 O  OG1 . THR B 1 87  ? -15.438 24.265  5.633   1.00 35.38  ? 86   THR B OG1 1 
ATOM   4251 C  CG2 . THR B 1 87  ? -13.285 23.930  6.580   1.00 35.20  ? 86   THR B CG2 1 
ATOM   4252 N  N   . LYS B 1 88  ? -15.292 25.163  2.621   1.00 46.38  ? 87   LYS B N   1 
ATOM   4253 C  CA  . LYS B 1 88  ? -15.968 25.011  1.333   1.00 46.78  ? 87   LYS B CA  1 
ATOM   4254 C  C   . LYS B 1 88  ? -14.992 25.358  0.210   1.00 44.91  ? 87   LYS B C   1 
ATOM   4255 O  O   . LYS B 1 88  ? -14.851 24.606  -0.757  1.00 39.31  ? 87   LYS B O   1 
ATOM   4256 C  CB  . LYS B 1 88  ? -17.208 25.917  1.233   1.00 45.67  ? 87   LYS B CB  1 
ATOM   4257 C  CG  . LYS B 1 88  ? -17.705 26.076  -0.200  1.00 45.52  ? 87   LYS B CG  1 
ATOM   4258 C  CD  . LYS B 1 88  ? -19.049 26.746  -0.285  1.00 46.25  ? 87   LYS B CD  1 
ATOM   4259 C  CE  . LYS B 1 88  ? -19.434 26.997  -1.743  1.00 46.79  ? 87   LYS B CE  1 
ATOM   4260 N  NZ  . LYS B 1 88  ? -20.568 27.954  -1.868  1.00 45.19  ? 87   LYS B NZ  1 
ATOM   4261 N  N   . ALA B 1 89  ? -14.341 26.513  0.365   1.00 44.49  ? 88   ALA B N   1 
ATOM   4262 C  CA  . ALA B 1 89  ? -13.386 27.030  -0.619  1.00 43.47  ? 88   ALA B CA  1 
ATOM   4263 C  C   . ALA B 1 89  ? -12.248 26.065  -0.830  1.00 42.69  ? 88   ALA B C   1 
ATOM   4264 O  O   . ALA B 1 89  ? -11.775 25.896  -1.947  1.00 44.14  ? 88   ALA B O   1 
ATOM   4265 C  CB  . ALA B 1 89  ? -12.844 28.381  -0.180  1.00 42.29  ? 88   ALA B CB  1 
ATOM   4266 N  N   . ALA B 1 90  ? -11.836 25.419  0.251   1.00 40.23  ? 89   ALA B N   1 
ATOM   4267 C  CA  . ALA B 1 90  ? -10.804 24.409  0.197   1.00 41.28  ? 89   ALA B CA  1 
ATOM   4268 C  C   . ALA B 1 90  ? -11.225 23.254  -0.721  1.00 42.46  ? 89   ALA B C   1 
ATOM   4269 O  O   . ALA B 1 90  ? -10.513 22.887  -1.651  1.00 44.40  ? 89   ALA B O   1 
ATOM   4270 C  CB  . ALA B 1 90  ? -10.535 23.885  1.605   1.00 42.35  ? 89   ALA B CB  1 
ATOM   4271 N  N   . LEU B 1 91  ? -12.407 22.708  -0.445  1.00 41.72  ? 90   LEU B N   1 
ATOM   4272 C  CA  . LEU B 1 91  ? -12.893 21.490  -1.080  1.00 39.11  ? 90   LEU B CA  1 
ATOM   4273 C  C   . LEU B 1 91  ? -13.084 21.705  -2.562  1.00 38.36  ? 90   LEU B C   1 
ATOM   4274 O  O   . LEU B 1 91  ? -12.681 20.860  -3.352  1.00 42.67  ? 90   LEU B O   1 
ATOM   4275 C  CB  . LEU B 1 91  ? -14.202 21.049  -0.426  1.00 39.51  ? 90   LEU B CB  1 
ATOM   4276 C  CG  . LEU B 1 91  ? -14.045 20.600  1.032   1.00 39.68  ? 90   LEU B CG  1 
ATOM   4277 C  CD1 . LEU B 1 91  ? -15.392 20.652  1.748   1.00 44.24  ? 90   LEU B CD1 1 
ATOM   4278 C  CD2 . LEU B 1 91  ? -13.427 19.223  1.100   1.00 36.66  ? 90   LEU B CD2 1 
ATOM   4279 N  N   . VAL B 1 92  ? -13.643 22.847  -2.945  1.00 35.13  ? 91   VAL B N   1 
ATOM   4280 C  CA  . VAL B 1 92  ? -13.796 23.189  -4.350  1.00 38.22  ? 91   VAL B CA  1 
ATOM   4281 C  C   . VAL B 1 92  ? -12.416 23.296  -4.973  1.00 39.13  ? 91   VAL B C   1 
ATOM   4282 O  O   . VAL B 1 92  ? -12.245 23.067  -6.189  1.00 38.05  ? 91   VAL B O   1 
ATOM   4283 C  CB  . VAL B 1 92  ? -14.564 24.525  -4.560  1.00 40.43  ? 91   VAL B CB  1 
ATOM   4284 C  CG1 . VAL B 1 92  ? -14.555 24.971  -6.019  1.00 39.83  ? 91   VAL B CG1 1 
ATOM   4285 C  CG2 . VAL B 1 92  ? -16.001 24.383  -4.101  1.00 41.99  ? 91   VAL B CG2 1 
ATOM   4286 N  N   . GLY B 1 93  ? -11.430 23.638  -4.137  1.00 41.06  ? 92   GLY B N   1 
ATOM   4287 C  CA  . GLY B 1 93  ? -10.034 23.781  -4.566  1.00 40.94  ? 92   GLY B CA  1 
ATOM   4288 C  C   . GLY B 1 93  ? -9.185  22.526  -4.480  1.00 41.68  ? 92   GLY B C   1 
ATOM   4289 O  O   . GLY B 1 93  ? -7.997  22.562  -4.788  1.00 48.68  ? 92   GLY B O   1 
ATOM   4290 N  N   . GLY B 1 94  ? -9.790  21.411  -4.098  1.00 40.76  ? 93   GLY B N   1 
ATOM   4291 C  CA  . GLY B 1 94  ? -9.096  20.132  -4.057  1.00 41.12  ? 93   GLY B CA  1 
ATOM   4292 C  C   . GLY B 1 94  ? -8.407  19.870  -2.736  1.00 38.80  ? 93   GLY B C   1 
ATOM   4293 O  O   . GLY B 1 94  ? -7.552  19.004  -2.652  1.00 39.00  ? 93   GLY B O   1 
ATOM   4294 N  N   . THR B 1 95  ? -8.788  20.629  -1.712  1.00 39.47  ? 94   THR B N   1 
ATOM   4295 C  CA  . THR B 1 95  ? -8.259  20.464  -0.341  1.00 35.70  ? 94   THR B CA  1 
ATOM   4296 C  C   . THR B 1 95  ? -9.331  19.895  0.620   1.00 34.23  ? 94   THR B C   1 
ATOM   4297 O  O   . THR B 1 95  ? -10.411 20.446  0.771   1.00 34.30  ? 94   THR B O   1 
ATOM   4298 C  CB  . THR B 1 95  ? -7.672  21.793  0.178   1.00 32.37  ? 94   THR B CB  1 
ATOM   4299 O  OG1 . THR B 1 95  ? -6.497  22.091  -0.571  1.00 30.44  ? 94   THR B OG1 1 
ATOM   4300 C  CG2 . THR B 1 95  ? -7.313  21.716  1.640   1.00 30.83  ? 94   THR B CG2 1 
ATOM   4301 N  N   . THR B 1 96  ? -8.995  18.783  1.252   1.00 34.89  ? 95   THR B N   1 
ATOM   4302 C  CA  . THR B 1 96  ? -9.903  18.003  2.084   1.00 35.47  ? 95   THR B CA  1 
ATOM   4303 C  C   . THR B 1 96  ? -9.557  18.042  3.568   1.00 36.32  ? 95   THR B C   1 
ATOM   4304 O  O   . THR B 1 96  ? -10.312 17.477  4.392   1.00 40.90  ? 95   THR B O   1 
ATOM   4305 C  CB  . THR B 1 96  ? -9.829  16.514  1.696   1.00 38.73  ? 95   THR B CB  1 
ATOM   4306 O  OG1 . THR B 1 96  ? -8.486  16.026  1.900   1.00 37.31  ? 95   THR B OG1 1 
ATOM   4307 C  CG2 . THR B 1 96  ? -10.264 16.319  0.234   1.00 39.83  ? 95   THR B CG2 1 
ATOM   4308 N  N   . MET B 1 97  ? -8.417  18.660  3.907   1.00 35.05  ? 96   MET B N   1 
ATOM   4309 C  CA  . MET B 1 97  ? -8.081  19.019  5.299   1.00 34.09  ? 96   MET B CA  1 
ATOM   4310 C  C   . MET B 1 97  ? -7.443  20.387  5.409   1.00 34.34  ? 96   MET B C   1 
ATOM   4311 O  O   . MET B 1 97  ? -6.665  20.800  4.554   1.00 36.47  ? 96   MET B O   1 
ATOM   4312 C  CB  . MET B 1 97  ? -7.136  18.028  5.930   1.00 32.85  ? 96   MET B CB  1 
ATOM   4313 C  CG  . MET B 1 97  ? -6.893  18.292  7.413   1.00 33.09  ? 96   MET B CG  1 
ATOM   4314 S  SD  . MET B 1 97  ? -6.195  16.857  8.250   1.00 32.33  ? 96   MET B SD  1 
ATOM   4315 C  CE  . MET B 1 97  ? -6.524  17.244  9.949   1.00 33.00  ? 96   MET B CE  1 
ATOM   4316 N  N   . ILE B 1 98  ? -7.791  21.090  6.479   1.00 35.25  ? 97   ILE B N   1 
ATOM   4317 C  CA  . ILE B 1 98  ? -7.203  22.386  6.799   1.00 35.98  ? 97   ILE B CA  1 
ATOM   4318 C  C   . ILE B 1 98  ? -6.776  22.411  8.246   1.00 36.43  ? 97   ILE B C   1 
ATOM   4319 O  O   . ILE B 1 98  ? -7.429  21.851  9.120   1.00 38.37  ? 97   ILE B O   1 
ATOM   4320 C  CB  . ILE B 1 98  ? -8.203  23.535  6.560   1.00 38.33  ? 97   ILE B CB  1 
ATOM   4321 C  CG1 . ILE B 1 98  ? -9.416  23.476  7.515   1.00 37.59  ? 97   ILE B CG1 1 
ATOM   4322 C  CG2 . ILE B 1 98  ? -8.694  23.514  5.109   1.00 38.44  ? 97   ILE B CG2 1 
ATOM   4323 C  CD1 . ILE B 1 98  ? -9.275  24.338  8.738   1.00 36.55  ? 97   ILE B CD1 1 
ATOM   4324 N  N   . ILE B 1 99  ? -5.649  23.035  8.508   1.00 38.75  ? 98   ILE B N   1 
ATOM   4325 C  CA  . ILE B 1 99  ? -5.195  23.220  9.880   1.00 39.14  ? 98   ILE B CA  1 
ATOM   4326 C  C   . ILE B 1 99  ? -5.386  24.703  10.244  1.00 38.22  ? 98   ILE B C   1 
ATOM   4327 O  O   . ILE B 1 99  ? -4.891  25.587  9.557   1.00 38.67  ? 98   ILE B O   1 
ATOM   4328 C  CB  . ILE B 1 99  ? -3.725  22.816  10.059  1.00 40.10  ? 98   ILE B CB  1 
ATOM   4329 C  CG1 . ILE B 1 99  ? -3.418  21.481  9.352   1.00 39.91  ? 98   ILE B CG1 1 
ATOM   4330 C  CG2 . ILE B 1 99  ? -3.393  22.738  11.539  1.00 43.96  ? 98   ILE B CG2 1 
ATOM   4331 C  CD1 . ILE B 1 99  ? -4.137  20.280  9.910   1.00 41.87  ? 98   ILE B CD1 1 
ATOM   4332 N  N   . GLY B 1 100 ? -6.140  24.965  11.298  1.00 34.43  ? 99   GLY B N   1 
ATOM   4333 C  CA  . GLY B 1 100 ? -6.390  26.323  11.704  1.00 33.05  ? 99   GLY B CA  1 
ATOM   4334 C  C   . GLY B 1 100 ? -5.324  26.904  12.611  1.00 34.63  ? 99   GLY B C   1 
ATOM   4335 O  O   . GLY B 1 100 ? -4.580  26.192  13.269  1.00 36.81  ? 99   GLY B O   1 
ATOM   4336 N  N   . HIS B 1 101 ? -5.273  28.224  12.651  1.00 36.41  ? 100  HIS B N   1 
ATOM   4337 C  CA  . HIS B 1 101 ? -4.410  28.937  13.566  1.00 36.66  ? 100  HIS B CA  1 
ATOM   4338 C  C   . HIS B 1 101 ? -5.219  29.553  14.675  1.00 37.66  ? 100  HIS B C   1 
ATOM   4339 O  O   . HIS B 1 101 ? -6.255  30.124  14.453  1.00 32.31  ? 100  HIS B O   1 
ATOM   4340 C  CB  . HIS B 1 101 ? -3.674  30.041  12.849  1.00 37.90  ? 100  HIS B CB  1 
ATOM   4341 C  CG  . HIS B 1 101 ? -2.419  29.588  12.192  1.00 37.98  ? 100  HIS B CG  1 
ATOM   4342 N  ND1 . HIS B 1 101 ? -1.196  29.693  12.803  1.00 37.21  ? 100  HIS B ND1 1 
ATOM   4343 C  CD2 . HIS B 1 101 ? -2.189  29.047  10.975  1.00 39.94  ? 100  HIS B CD2 1 
ATOM   4344 C  CE1 . HIS B 1 101 ? -0.263  29.234  11.991  1.00 37.74  ? 100  HIS B CE1 1 
ATOM   4345 N  NE2 . HIS B 1 101 ? -0.843  28.817  10.883  1.00 39.82  ? 100  HIS B NE2 1 
ATOM   4346 N  N   . VAL B 1 102 ? -4.711  29.415  15.882  1.00 41.10  ? 101  VAL B N   1 
ATOM   4347 C  CA  . VAL B 1 102 ? -5.269  30.026  17.065  1.00 42.68  ? 101  VAL B CA  1 
ATOM   4348 C  C   . VAL B 1 102 ? -4.186  30.983  17.571  1.00 45.57  ? 101  VAL B C   1 
ATOM   4349 O  O   . VAL B 1 102 ? -3.069  30.556  17.883  1.00 48.74  ? 101  VAL B O   1 
ATOM   4350 C  CB  . VAL B 1 102 ? -5.563  28.958  18.155  1.00 42.95  ? 101  VAL B CB  1 
ATOM   4351 C  CG1 . VAL B 1 102 ? -6.075  29.603  19.438  1.00 42.50  ? 101  VAL B CG1 1 
ATOM   4352 C  CG2 . VAL B 1 102 ? -6.522  27.901  17.643  1.00 40.90  ? 101  VAL B CG2 1 
ATOM   4353 N  N   . LEU B 1 103 ? -4.499  32.272  17.666  1.00 47.83  ? 102  LEU B N   1 
ATOM   4354 C  CA  . LEU B 1 103 ? -3.514  33.247  18.128  1.00 44.03  ? 102  LEU B CA  1 
ATOM   4355 C  C   . LEU B 1 103 ? -4.020  33.943  19.366  1.00 41.40  ? 102  LEU B C   1 
ATOM   4356 O  O   . LEU B 1 103 ? -4.568  35.031  19.285  1.00 49.75  ? 102  LEU B O   1 
ATOM   4357 C  CB  . LEU B 1 103 ? -3.199  34.261  17.022  1.00 44.70  ? 102  LEU B CB  1 
ATOM   4358 C  CG  . LEU B 1 103 ? -1.907  35.087  17.207  1.00 47.50  ? 102  LEU B CG  1 
ATOM   4359 C  CD1 . LEU B 1 103 ? -0.691  34.194  17.427  1.00 46.17  ? 102  LEU B CD1 1 
ATOM   4360 C  CD2 . LEU B 1 103 ? -1.658  36.041  16.020  1.00 50.02  ? 102  LEU B CD2 1 
ATOM   4361 N  N   . PRO B 1 104 ? -3.848  33.327  20.518  1.00 37.98  ? 103  PRO B N   1 
ATOM   4362 C  CA  . PRO B 1 104 ? -4.244  34.026  21.714  1.00 36.95  ? 103  PRO B CA  1 
ATOM   4363 C  C   . PRO B 1 104 ? -3.318  35.204  21.983  1.00 33.26  ? 103  PRO B C   1 
ATOM   4364 O  O   . PRO B 1 104 ? -2.116  35.102  21.860  1.00 29.10  ? 103  PRO B O   1 
ATOM   4365 C  CB  . PRO B 1 104 ? -4.052  32.967  22.814  1.00 42.53  ? 103  PRO B CB  1 
ATOM   4366 C  CG  . PRO B 1 104 ? -2.890  32.160  22.339  1.00 43.89  ? 103  PRO B CG  1 
ATOM   4367 C  CD  . PRO B 1 104 ? -3.028  32.144  20.816  1.00 42.14  ? 103  PRO B CD  1 
ATOM   4368 N  N   . ASP B 1 105 ? -3.886  36.305  22.419  1.00 35.86  ? 104  ASP B N   1 
ATOM   4369 C  CA  . ASP B 1 105 ? -3.104  37.495  22.783  1.00 40.19  ? 104  ASP B CA  1 
ATOM   4370 C  C   . ASP B 1 105 ? -2.154  37.268  23.948  1.00 39.40  ? 104  ASP B C   1 
ATOM   4371 O  O   . ASP B 1 105 ? -2.287  36.289  24.674  1.00 41.03  ? 104  ASP B O   1 
ATOM   4372 C  CB  . ASP B 1 105 ? -4.047  38.659  23.083  1.00 43.18  ? 104  ASP B CB  1 
ATOM   4373 C  CG  . ASP B 1 105 ? -4.660  39.242  21.808  1.00 44.48  ? 104  ASP B CG  1 
ATOM   4374 O  OD1 . ASP B 1 105 ? -3.898  39.497  20.851  1.00 46.96  ? 104  ASP B OD1 1 
ATOM   4375 O  OD2 . ASP B 1 105 ? -5.890  39.418  21.762  1.00 42.14  ? 104  ASP B OD2 1 
ATOM   4376 N  N   . LYS B 1 106 ? -1.208  38.185  24.121  1.00 42.89  ? 105  LYS B N   1 
ATOM   4377 C  CA  . LYS B 1 106 ? -0.289  38.136  25.255  1.00 45.57  ? 105  LYS B CA  1 
ATOM   4378 C  C   . LYS B 1 106 ? -1.099  38.205  26.546  1.00 49.41  ? 105  LYS B C   1 
ATOM   4379 O  O   . LYS B 1 106 ? -2.119  38.903  26.612  1.00 47.97  ? 105  LYS B O   1 
ATOM   4380 C  CB  . LYS B 1 106 ? 0.703   39.305  25.258  1.00 44.52  ? 105  LYS B CB  1 
ATOM   4381 C  CG  . LYS B 1 106 ? 1.709   39.334  24.132  1.00 46.39  ? 105  LYS B CG  1 
ATOM   4382 C  CD  . LYS B 1 106 ? 2.922   40.192  24.490  1.00 48.30  ? 105  LYS B CD  1 
ATOM   4383 C  CE  . LYS B 1 106 ? 3.877   40.392  23.317  1.00 44.86  ? 105  LYS B CE  1 
ATOM   4384 N  NZ  . LYS B 1 106 ? 4.708   39.213  22.998  1.00 45.78  ? 105  LYS B NZ  1 
ATOM   4385 N  N   . GLU B 1 107 ? -0.642  37.466  27.559  1.00 53.17  ? 106  GLU B N   1 
ATOM   4386 C  CA  . GLU B 1 107 ? -1.287  37.419  28.896  1.00 54.53  ? 106  GLU B CA  1 
ATOM   4387 C  C   . GLU B 1 107 ? -2.696  36.790  28.900  1.00 50.46  ? 106  GLU B C   1 
ATOM   4388 O  O   . GLU B 1 107 ? -3.430  36.918  29.885  1.00 47.13  ? 106  GLU B O   1 
ATOM   4389 C  CB  . GLU B 1 107 ? -1.377  38.821  29.539  1.00 58.02  ? 106  GLU B CB  1 
ATOM   4390 C  CG  . GLU B 1 107 ? -0.093  39.650  29.510  1.00 63.72  ? 106  GLU B CG  1 
ATOM   4391 C  CD  . GLU B 1 107 ? 1.086   38.931  30.165  1.00 66.93  ? 106  GLU B CD  1 
ATOM   4392 O  OE1 . GLU B 1 107 ? 0.861   38.149  31.131  1.00 64.04  ? 106  GLU B OE1 1 
ATOM   4393 O  OE2 . GLU B 1 107 ? 2.235   39.123  29.690  1.00 69.19  ? 106  GLU B OE2 1 
ATOM   4394 N  N   . THR B 1 108 ? -3.062  36.101  27.819  1.00 46.65  ? 107  THR B N   1 
ATOM   4395 C  CA  . THR B 1 108 ? -4.365  35.441  27.742  1.00 45.22  ? 107  THR B CA  1 
ATOM   4396 C  C   . THR B 1 108 ? -4.194  33.902  27.630  1.00 43.52  ? 107  THR B C   1 
ATOM   4397 O  O   . THR B 1 108 ? -3.108  33.417  27.338  1.00 43.32  ? 107  THR B O   1 
ATOM   4398 C  CB  . THR B 1 108 ? -5.251  36.019  26.605  1.00 40.16  ? 107  THR B CB  1 
ATOM   4399 O  OG1 . THR B 1 108 ? -5.003  35.322  25.393  1.00 34.79  ? 107  THR B OG1 1 
ATOM   4400 C  CG2 . THR B 1 108 ? -4.972  37.470  26.399  1.00 39.18  ? 107  THR B CG2 1 
ATOM   4401 N  N   . SER B 1 109 ? -5.280  33.169  27.875  1.00 40.72  ? 108  SER B N   1 
ATOM   4402 C  CA  . SER B 1 109 ? -5.248  31.706  27.960  1.00 41.18  ? 108  SER B CA  1 
ATOM   4403 C  C   . SER B 1 109 ? -5.277  30.963  26.594  1.00 42.52  ? 108  SER B C   1 
ATOM   4404 O  O   . SER B 1 109 ? -6.159  31.192  25.733  1.00 44.40  ? 108  SER B O   1 
ATOM   4405 C  CB  . SER B 1 109 ? -6.410  31.222  28.855  1.00 39.46  ? 108  SER B CB  1 
ATOM   4406 O  OG  . SER B 1 109 ? -6.751  29.880  28.597  1.00 38.91  ? 108  SER B OG  1 
ATOM   4407 N  N   . LEU B 1 110 ? -4.320  30.052  26.415  1.00 38.35  ? 109  LEU B N   1 
ATOM   4408 C  CA  . LEU B 1 110 ? -4.237  29.263  25.183  1.00 39.43  ? 109  LEU B CA  1 
ATOM   4409 C  C   . LEU B 1 110 ? -5.421  28.305  25.043  1.00 36.81  ? 109  LEU B C   1 
ATOM   4410 O  O   . LEU B 1 110 ? -5.992  28.111  23.951  1.00 33.88  ? 109  LEU B O   1 
ATOM   4411 C  CB  . LEU B 1 110 ? -2.922  28.460  25.143  1.00 39.56  ? 109  LEU B CB  1 
ATOM   4412 C  CG  . LEU B 1 110 ? -1.631  29.213  24.806  1.00 40.15  ? 109  LEU B CG  1 
ATOM   4413 C  CD1 . LEU B 1 110 ? -1.295  30.292  25.834  1.00 38.01  ? 109  LEU B CD1 1 
ATOM   4414 C  CD2 . LEU B 1 110 ? -0.487  28.212  24.639  1.00 42.67  ? 109  LEU B CD2 1 
ATOM   4415 N  N   . VAL B 1 111 ? -5.780  27.708  26.170  1.00 36.26  ? 110  VAL B N   1 
ATOM   4416 C  CA  . VAL B 1 111 ? -6.874  26.739  26.210  1.00 36.67  ? 110  VAL B CA  1 
ATOM   4417 C  C   . VAL B 1 111 ? -8.187  27.441  25.918  1.00 35.38  ? 110  VAL B C   1 
ATOM   4418 O  O   . VAL B 1 111 ? -9.000  26.948  25.171  1.00 32.21  ? 110  VAL B O   1 
ATOM   4419 C  CB  . VAL B 1 111 ? -6.928  26.018  27.586  1.00 36.02  ? 110  VAL B CB  1 
ATOM   4420 C  CG1 . VAL B 1 111 ? -8.145  25.119  27.681  1.00 34.49  ? 110  VAL B CG1 1 
ATOM   4421 C  CG2 . VAL B 1 111 ? -5.660  25.198  27.800  1.00 37.12  ? 110  VAL B CG2 1 
ATOM   4422 N  N   . ASP B 1 112 ? -8.370  28.613  26.506  1.00 39.01  ? 111  ASP B N   1 
ATOM   4423 C  CA  . ASP B 1 112 ? -9.599  29.367  26.303  1.00 44.02  ? 111  ASP B CA  1 
ATOM   4424 C  C   . ASP B 1 112 ? -9.729  29.720  24.868  1.00 41.20  ? 111  ASP B C   1 
ATOM   4425 O  O   . ASP B 1 112 ? -10.808 29.614  24.285  1.00 38.52  ? 111  ASP B O   1 
ATOM   4426 C  CB  . ASP B 1 112 ? -9.605  30.664  27.123  1.00 49.39  ? 111  ASP B CB  1 
ATOM   4427 C  CG  . ASP B 1 112 ? -9.965  30.434  28.584  1.00 49.78  ? 111  ASP B CG  1 
ATOM   4428 O  OD1 . ASP B 1 112 ? -10.131 29.262  29.006  1.00 43.91  ? 111  ASP B OD1 1 
ATOM   4429 O  OD2 . ASP B 1 112 ? -10.051 31.441  29.305  1.00 54.40  ? 111  ASP B OD2 1 
ATOM   4430 N  N   . ALA B 1 113 ? -8.611  30.177  24.311  1.00 43.91  ? 112  ALA B N   1 
ATOM   4431 C  CA  . ALA B 1 113 ? -8.538  30.512  22.902  1.00 45.06  ? 112  ALA B CA  1 
ATOM   4432 C  C   . ALA B 1 113 ? -8.872  29.252  22.073  1.00 42.40  ? 112  ALA B C   1 
ATOM   4433 O  O   . ALA B 1 113 ? -9.759  29.290  21.224  1.00 42.51  ? 112  ALA B O   1 
ATOM   4434 C  CB  . ALA B 1 113 ? -7.150  31.070  22.550  1.00 46.91  ? 112  ALA B CB  1 
ATOM   4435 N  N   . TYR B 1 114 ? -8.183  28.150  22.348  1.00 37.59  ? 113  TYR B N   1 
ATOM   4436 C  CA  . TYR B 1 114 ? -8.419  26.913  21.626  1.00 40.22  ? 113  TYR B CA  1 
ATOM   4437 C  C   . TYR B 1 114 ? -9.903  26.533  21.624  1.00 43.54  ? 113  TYR B C   1 
ATOM   4438 O  O   . TYR B 1 114 ? -10.434 26.142  20.587  1.00 46.89  ? 113  TYR B O   1 
ATOM   4439 C  CB  . TYR B 1 114 ? -7.552  25.796  22.202  1.00 39.53  ? 113  TYR B CB  1 
ATOM   4440 C  CG  . TYR B 1 114 ? -7.977  24.409  21.815  1.00 38.18  ? 113  TYR B CG  1 
ATOM   4441 C  CD1 . TYR B 1 114 ? -7.505  23.822  20.675  1.00 39.51  ? 113  TYR B CD1 1 
ATOM   4442 C  CD2 . TYR B 1 114 ? -8.861  23.677  22.613  1.00 39.19  ? 113  TYR B CD2 1 
ATOM   4443 C  CE1 . TYR B 1 114 ? -7.903  22.547  20.313  1.00 39.45  ? 113  TYR B CE1 1 
ATOM   4444 C  CE2 . TYR B 1 114 ? -9.248  22.407  22.265  1.00 38.99  ? 113  TYR B CE2 1 
ATOM   4445 C  CZ  . TYR B 1 114 ? -8.764  21.856  21.109  1.00 39.69  ? 113  TYR B CZ  1 
ATOM   4446 O  OH  . TYR B 1 114 ? -9.132  20.596  20.732  1.00 44.56  ? 113  TYR B OH  1 
ATOM   4447 N  N   . GLU B 1 115 ? -10.568 26.677  22.772  1.00 49.75  ? 114  GLU B N   1 
ATOM   4448 C  CA  . GLU B 1 115 ? -12.015 26.370  22.922  1.00 49.20  ? 114  GLU B CA  1 
ATOM   4449 C  C   . GLU B 1 115 ? -12.896 27.337  22.161  1.00 46.08  ? 114  GLU B C   1 
ATOM   4450 O  O   . GLU B 1 115 ? -13.807 26.900  21.469  1.00 42.40  ? 114  GLU B O   1 
ATOM   4451 C  CB  . GLU B 1 115 ? -12.435 26.361  24.398  1.00 55.34  ? 114  GLU B CB  1 
ATOM   4452 C  CG  . GLU B 1 115 ? -11.835 25.217  25.228  1.00 63.51  ? 114  GLU B CG  1 
ATOM   4453 C  CD  . GLU B 1 115 ? -12.358 23.842  24.816  1.00 69.37  ? 114  GLU B CD  1 
ATOM   4454 O  OE1 . GLU B 1 115 ? -13.429 23.792  24.159  1.00 69.19  ? 114  GLU B OE1 1 
ATOM   4455 O  OE2 . GLU B 1 115 ? -11.693 22.813  25.119  1.00 68.72  ? 114  GLU B OE2 1 
ATOM   4456 N  N   . LYS B 1 116 ? -12.626 28.649  22.258  1.00 45.54  ? 115  LYS B N   1 
ATOM   4457 C  CA  . LYS B 1 116 ? -13.373 29.627  21.447  1.00 44.11  ? 115  LYS B CA  1 
ATOM   4458 C  C   . LYS B 1 116 ? -13.294 29.158  20.014  1.00 44.49  ? 115  LYS B C   1 
ATOM   4459 O  O   . LYS B 1 116 ? -14.280 29.153  19.295  1.00 52.11  ? 115  LYS B O   1 
ATOM   4460 C  CB  . LYS B 1 116 ? -12.807 31.042  21.517  1.00 47.26  ? 115  LYS B CB  1 
ATOM   4461 C  CG  . LYS B 1 116 ? -13.328 31.922  22.651  1.00 55.60  ? 115  LYS B CG  1 
ATOM   4462 C  CD  . LYS B 1 116 ? -12.291 33.022  23.016  1.00 66.72  ? 115  LYS B CD  1 
ATOM   4463 C  CE  . LYS B 1 116 ? -12.076 33.273  24.529  1.00 66.98  ? 115  LYS B CE  1 
ATOM   4464 N  NZ  . LYS B 1 116 ? -10.635 33.409  24.964  1.00 62.42  ? 115  LYS B NZ  1 
ATOM   4465 N  N   . CYS B 1 117 ? -12.108 28.730  19.608  1.00 40.98  ? 116  CYS B N   1 
ATOM   4466 C  CA  . CYS B 1 117 ? -11.867 28.423  18.239  0.50 37.33  ? 116  CYS B CA  1 
ATOM   4467 C  C   . CYS B 1 117 ? -12.580 27.162  17.840  1.00 37.01  ? 116  CYS B C   1 
ATOM   4468 O  O   . CYS B 1 117 ? -13.272 27.135  16.807  1.00 36.57  ? 116  CYS B O   1 
ATOM   4469 C  CB  . CYS B 1 117 ? -10.398 28.289  17.982  0.50 37.24  ? 116  CYS B CB  1 
ATOM   4470 S  SG  . CYS B 1 117 ? -10.173 28.234  16.224  1.00 41.90  ? 116  CYS B SG  1 
ATOM   4471 N  N   . ARG B 1 118 ? -12.454 26.113  18.659  1.00 36.70  ? 117  ARG B N   1 
ATOM   4472 C  CA  . ARG B 1 118 ? -13.239 24.887  18.446  1.00 37.72  ? 117  ARG B CA  1 
ATOM   4473 C  C   . ARG B 1 118 ? -14.739 25.182  18.335  1.00 41.65  ? 117  ARG B C   1 
ATOM   4474 O  O   . ARG B 1 118 ? -15.442 24.527  17.550  1.00 43.24  ? 117  ARG B O   1 
ATOM   4475 C  CB  . ARG B 1 118 ? -13.050 23.877  19.567  1.00 37.39  ? 117  ARG B CB  1 
ATOM   4476 C  CG  . ARG B 1 118 ? -11.737 23.095  19.537  1.00 39.59  ? 117  ARG B CG  1 
ATOM   4477 C  CD  . ARG B 1 118 ? -11.678 22.109  18.368  1.00 38.56  ? 117  ARG B CD  1 
ATOM   4478 N  NE  . ARG B 1 118 ? -12.727 21.083  18.471  1.00 34.47  ? 117  ARG B NE  1 
ATOM   4479 C  CZ  . ARG B 1 118 ? -12.615 19.988  19.194  1.00 29.81  ? 117  ARG B CZ  1 
ATOM   4480 N  NH1 . ARG B 1 118 ? -11.509 19.748  19.870  1.00 29.38  ? 117  ARG B NH1 1 
ATOM   4481 N  NH2 . ARG B 1 118 ? -13.605 19.138  19.231  1.00 29.78  ? 117  ARG B NH2 1 
ATOM   4482 N  N   . GLY B 1 119 ? -15.215 26.169  19.116  1.00 41.31  ? 118  GLY B N   1 
ATOM   4483 C  CA  . GLY B 1 119 ? -16.631 26.529  19.147  1.00 39.70  ? 118  GLY B CA  1 
ATOM   4484 C  C   . GLY B 1 119 ? -17.086 27.139  17.836  1.00 42.11  ? 118  GLY B C   1 
ATOM   4485 O  O   . GLY B 1 119 ? -18.213 26.888  17.376  1.00 41.29  ? 118  GLY B O   1 
ATOM   4486 N  N   . LEU B 1 120 ? -16.187 27.925  17.244  1.00 39.79  ? 119  LEU B N   1 
ATOM   4487 C  CA  . LEU B 1 120 ? -16.401 28.592  15.969  1.00 39.62  ? 119  LEU B CA  1 
ATOM   4488 C  C   . LEU B 1 120 ? -16.295 27.687  14.758  1.00 37.26  ? 119  LEU B C   1 
ATOM   4489 O  O   . LEU B 1 120 ? -16.825 28.017  13.701  1.00 37.63  ? 119  LEU B O   1 
ATOM   4490 C  CB  . LEU B 1 120 ? -15.356 29.714  15.785  1.00 43.64  ? 119  LEU B CB  1 
ATOM   4491 C  CG  . LEU B 1 120 ? -15.543 31.017  16.575  1.00 44.22  ? 119  LEU B CG  1 
ATOM   4492 C  CD1 . LEU B 1 120 ? -14.311 31.884  16.369  1.00 44.94  ? 119  LEU B CD1 1 
ATOM   4493 C  CD2 . LEU B 1 120 ? -16.812 31.745  16.142  1.00 41.94  ? 119  LEU B CD2 1 
ATOM   4494 N  N   . ALA B 1 121 ? -15.551 26.594  14.882  1.00 38.50  ? 120  ALA B N   1 
ATOM   4495 C  CA  . ALA B 1 121 ? -15.266 25.705  13.737  1.00 40.58  ? 120  ALA B CA  1 
ATOM   4496 C  C   . ALA B 1 121 ? -16.138 24.443  13.709  1.00 40.90  ? 120  ALA B C   1 
ATOM   4497 O  O   . ALA B 1 121 ? -16.689 24.119  12.660  1.00 42.80  ? 120  ALA B O   1 
ATOM   4498 C  CB  . ALA B 1 121 ? -13.803 25.307  13.744  1.00 41.74  ? 120  ALA B CB  1 
ATOM   4499 N  N   . ASP B 1 122 ? -16.248 23.736  14.843  1.00 36.40  ? 121  ASP B N   1 
ATOM   4500 C  CA  . ASP B 1 122 ? -16.976 22.465  14.886  1.00 36.15  ? 121  ASP B CA  1 
ATOM   4501 C  C   . ASP B 1 122 ? -18.358 22.498  14.222  1.00 37.36  ? 121  ASP B C   1 
ATOM   4502 O  O   . ASP B 1 122 ? -18.626 21.712  13.327  1.00 41.23  ? 121  ASP B O   1 
ATOM   4503 C  CB  . ASP B 1 122 ? -17.115 21.923  16.310  1.00 35.99  ? 121  ASP B CB  1 
ATOM   4504 C  CG  . ASP B 1 122 ? -15.871 21.224  16.803  1.00 36.02  ? 121  ASP B CG  1 
ATOM   4505 O  OD1 . ASP B 1 122 ? -14.917 21.028  16.043  1.00 36.06  ? 121  ASP B OD1 1 
ATOM   4506 O  OD2 . ASP B 1 122 ? -15.831 20.876  17.991  1.00 40.45  ? 121  ASP B OD2 1 
ATOM   4507 N  N   . PRO B 1 123 ? -19.249 23.399  14.645  1.00 36.10  ? 122  PRO B N   1 
ATOM   4508 C  CA  . PRO B 1 123 ? -20.533 23.450  13.946  1.00 36.27  ? 122  PRO B CA  1 
ATOM   4509 C  C   . PRO B 1 123 ? -20.487 23.790  12.432  1.00 37.81  ? 122  PRO B C   1 
ATOM   4510 O  O   . PRO B 1 123 ? -21.422 23.525  11.715  1.00 39.44  ? 122  PRO B O   1 
ATOM   4511 C  CB  . PRO B 1 123 ? -21.270 24.552  14.699  1.00 33.14  ? 122  PRO B CB  1 
ATOM   4512 C  CG  . PRO B 1 123 ? -20.196 25.374  15.274  1.00 31.82  ? 122  PRO B CG  1 
ATOM   4513 C  CD  . PRO B 1 123 ? -19.153 24.430  15.683  1.00 33.02  ? 122  PRO B CD  1 
ATOM   4514 N  N   . LYS B 1 124 ? -19.412 24.395  11.968  1.00 42.92  ? 123  LYS B N   1 
ATOM   4515 C  CA  . LYS B 1 124 ? -19.389 25.038  10.652  1.00 45.79  ? 123  LYS B CA  1 
ATOM   4516 C  C   . LYS B 1 124 ? -18.522 24.329  9.578   1.00 43.82  ? 123  LYS B C   1 
ATOM   4517 O  O   . LYS B 1 124 ? -18.808 24.449  8.391   1.00 43.50  ? 123  LYS B O   1 
ATOM   4518 C  CB  . LYS B 1 124 ? -18.912 26.497  10.832  1.00 47.63  ? 123  LYS B CB  1 
ATOM   4519 C  CG  . LYS B 1 124 ? -19.949 27.442  11.428  1.00 49.09  ? 123  LYS B CG  1 
ATOM   4520 C  CD  . LYS B 1 124 ? -20.488 28.431  10.396  1.00 52.48  ? 123  LYS B CD  1 
ATOM   4521 C  CE  . LYS B 1 124 ? -21.998 28.656  10.479  1.00 53.89  ? 123  LYS B CE  1 
ATOM   4522 N  NZ  . LYS B 1 124 ? -22.497 29.337  9.254   1.00 52.20  ? 123  LYS B NZ  1 
ATOM   4523 N  N   . VAL B 1 125 ? -17.497 23.577  9.992   1.00 41.73  ? 124  VAL B N   1 
ATOM   4524 C  CA  . VAL B 1 125 ? -16.511 23.009  9.055   1.00 39.71  ? 124  VAL B CA  1 
ATOM   4525 C  C   . VAL B 1 125 ? -17.085 21.956  8.116   1.00 42.49  ? 124  VAL B C   1 
ATOM   4526 O  O   . VAL B 1 125 ? -17.917 21.127  8.522   1.00 44.48  ? 124  VAL B O   1 
ATOM   4527 C  CB  . VAL B 1 125 ? -15.296 22.398  9.759   1.00 38.77  ? 124  VAL B CB  1 
ATOM   4528 C  CG1 . VAL B 1 125 ? -14.453 23.490  10.401  1.00 40.26  ? 124  VAL B CG1 1 
ATOM   4529 C  CG2 . VAL B 1 125 ? -15.702 21.366  10.792  1.00 38.25  ? 124  VAL B CG2 1 
ATOM   4530 N  N   . CYS B 1 126 ? -16.658 22.007  6.856   1.00 43.41  ? 125  CYS B N   1 
ATOM   4531 C  CA  . CYS B 1 126 ? -17.119 21.063  5.824   1.00 46.93  ? 125  CYS B CA  1 
ATOM   4532 C  C   . CYS B 1 126 ? -16.182 19.879  5.651   1.00 47.46  ? 125  CYS B C   1 
ATOM   4533 O  O   . CYS B 1 126 ? -16.581 18.826  5.176   1.00 53.30  ? 125  CYS B O   1 
ATOM   4534 C  CB  . CYS B 1 126 ? -17.249 21.761  4.472   1.00 47.92  ? 125  CYS B CB  1 
ATOM   4535 S  SG  . CYS B 1 126 ? -18.571 22.963  4.403   1.00 48.35  ? 125  CYS B SG  1 
ATOM   4536 N  N   . CYS B 1 127 ? -14.914 20.075  5.986   1.00 48.14  ? 126  CYS B N   1 
ATOM   4537 C  CA  . CYS B 1 127 ? -13.918 19.018  5.855   1.00 43.41  ? 126  CYS B CA  1 
ATOM   4538 C  C   . CYS B 1 127 ? -13.273 18.807  7.188   1.00 44.74  ? 126  CYS B C   1 
ATOM   4539 O  O   . CYS B 1 127 ? -13.462 19.599  8.126   1.00 52.88  ? 126  CYS B O   1 
ATOM   4540 C  CB  . CYS B 1 127 ? -12.880 19.382  4.797   1.00 42.17  ? 126  CYS B CB  1 
ATOM   4541 S  SG  . CYS B 1 127 ? -11.862 20.821  5.160   0.87 41.91  ? 126  CYS B SG  1 
ATOM   4542 N  N   . ASP B 1 128 ? -12.516 17.736  7.303   1.00 44.59  ? 127  ASP B N   1 
ATOM   4543 C  CA  . ASP B 1 128 ? -11.790 17.505  8.540   1.00 43.11  ? 127  ASP B CA  1 
ATOM   4544 C  C   . ASP B 1 128 ? -10.833 18.688  8.778   1.00 41.02  ? 127  ASP B C   1 
ATOM   4545 O  O   . ASP B 1 128 ? -10.485 19.421  7.833   1.00 37.90  ? 127  ASP B O   1 
ATOM   4546 C  CB  . ASP B 1 128 ? -11.032 16.178  8.483   1.00 44.41  ? 127  ASP B CB  1 
ATOM   4547 C  CG  . ASP B 1 128 ? -11.940 14.980  8.664   1.00 44.93  ? 127  ASP B CG  1 
ATOM   4548 O  OD1 . ASP B 1 128 ? -13.155 15.179  8.845   1.00 44.96  ? 127  ASP B OD1 1 
ATOM   4549 O  OD2 . ASP B 1 128 ? -11.446 13.839  8.616   1.00 42.17  ? 127  ASP B OD2 1 
ATOM   4550 N  N   . TYR B 1 129 ? -10.488 18.910  10.048  1.00 37.04  ? 128  TYR B N   1 
ATOM   4551 C  CA  . TYR B 1 129 ? -9.605  20.006  10.434  1.00 35.87  ? 128  TYR B CA  1 
ATOM   4552 C  C   . TYR B 1 129 ? -8.878  19.707  11.740  1.00 35.62  ? 128  TYR B C   1 
ATOM   4553 O  O   . TYR B 1 129 ? -9.231  18.800  12.469  1.00 35.37  ? 128  TYR B O   1 
ATOM   4554 C  CB  . TYR B 1 129 ? -10.359 21.372  10.541  1.00 35.76  ? 128  TYR B CB  1 
ATOM   4555 C  CG  . TYR B 1 129 ? -11.061 21.614  11.879  1.00 33.83  ? 128  TYR B CG  1 
ATOM   4556 C  CD1 . TYR B 1 129 ? -12.235 20.969  12.180  1.00 33.88  ? 128  TYR B CD1 1 
ATOM   4557 C  CD2 . TYR B 1 129 ? -10.534 22.472  12.815  1.00 33.48  ? 128  TYR B CD2 1 
ATOM   4558 C  CE1 . TYR B 1 129 ? -12.864 21.149  13.380  1.00 34.53  ? 128  TYR B CE1 1 
ATOM   4559 C  CE2 . TYR B 1 129 ? -11.165 22.677  14.025  1.00 35.67  ? 128  TYR B CE2 1 
ATOM   4560 C  CZ  . TYR B 1 129 ? -12.341 22.007  14.305  1.00 36.35  ? 128  TYR B CZ  1 
ATOM   4561 O  OH  . TYR B 1 129 ? -13.005 22.189  15.505  1.00 34.47  ? 128  TYR B OH  1 
ATOM   4562 N  N   . ALA B 1 130 ? -7.853  20.515  11.994  1.00 37.97  ? 129  ALA B N   1 
ATOM   4563 C  CA  . ALA B 1 130 ? -7.096  20.521  13.234  1.00 37.07  ? 129  ALA B CA  1 
ATOM   4564 C  C   . ALA B 1 130 ? -6.564  21.950  13.484  1.00 38.09  ? 129  ALA B C   1 
ATOM   4565 O  O   . ALA B 1 130 ? -6.788  22.865  12.674  1.00 34.17  ? 129  ALA B O   1 
ATOM   4566 C  CB  . ALA B 1 130 ? -5.940  19.550  13.142  1.00 37.63  ? 129  ALA B CB  1 
ATOM   4567 N  N   . LEU B 1 131 ? -5.873  22.147  14.606  1.00 37.76  ? 130  LEU B N   1 
ATOM   4568 C  CA  . LEU B 1 131 ? -5.419  23.485  14.931  1.00 37.24  ? 130  LEU B CA  1 
ATOM   4569 C  C   . LEU B 1 131 ? -3.998  23.570  15.444  1.00 38.54  ? 130  LEU B C   1 
ATOM   4570 O  O   . LEU B 1 131 ? -3.513  22.701  16.180  1.00 34.15  ? 130  LEU B O   1 
ATOM   4571 C  CB  . LEU B 1 131 ? -6.342  24.089  15.977  1.00 38.03  ? 130  LEU B CB  1 
ATOM   4572 C  CG  . LEU B 1 131 ? -7.847  24.154  15.660  1.00 36.94  ? 130  LEU B CG  1 
ATOM   4573 C  CD1 . LEU B 1 131 ? -8.656  24.128  16.951  1.00 38.05  ? 130  LEU B CD1 1 
ATOM   4574 C  CD2 . LEU B 1 131 ? -8.192  25.387  14.846  1.00 35.45  ? 130  LEU B CD2 1 
ATOM   4575 N  N   . HIS B 1 132 ? -3.346  24.654  15.040  1.00 40.21  ? 131  HIS B N   1 
ATOM   4576 C  CA  . HIS B 1 132 ? -2.158  25.151  15.721  1.00 39.29  ? 131  HIS B CA  1 
ATOM   4577 C  C   . HIS B 1 132 ? -2.591  26.127  16.818  1.00 38.36  ? 131  HIS B C   1 
ATOM   4578 O  O   . HIS B 1 132 ? -3.481  26.932  16.614  1.00 35.69  ? 131  HIS B O   1 
ATOM   4579 C  CB  . HIS B 1 132 ? -1.238  25.900  14.764  1.00 37.30  ? 131  HIS B CB  1 
ATOM   4580 C  CG  . HIS B 1 132 ? -0.956  25.170  13.482  1.00 38.61  ? 131  HIS B CG  1 
ATOM   4581 N  ND1 . HIS B 1 132 ? -0.335  23.939  13.429  1.00 36.68  ? 131  HIS B ND1 1 
ATOM   4582 C  CD2 . HIS B 1 132 ? -1.186  25.527  12.196  1.00 37.83  ? 131  HIS B CD2 1 
ATOM   4583 C  CE1 . HIS B 1 132 ? -0.218  23.555  12.172  1.00 35.28  ? 131  HIS B CE1 1 
ATOM   4584 N  NE2 . HIS B 1 132 ? -0.728  24.501  11.404  1.00 37.54  ? 131  HIS B NE2 1 
ATOM   4585 N  N   . VAL B 1 133 ? -1.967  26.027  17.984  1.00 39.28  ? 132  VAL B N   1 
ATOM   4586 C  CA  . VAL B 1 133 ? -2.110  27.050  19.006  1.00 39.82  ? 132  VAL B CA  1 
ATOM   4587 C  C   . VAL B 1 133 ? -0.857  27.917  19.054  1.00 37.34  ? 132  VAL B C   1 
ATOM   4588 O  O   . VAL B 1 133 ? 0.266   27.420  19.103  1.00 40.70  ? 132  VAL B O   1 
ATOM   4589 C  CB  . VAL B 1 133 ? -2.414  26.475  20.401  1.00 41.41  ? 132  VAL B CB  1 
ATOM   4590 C  CG1 . VAL B 1 133 ? -2.806  27.602  21.342  1.00 42.18  ? 132  VAL B CG1 1 
ATOM   4591 C  CG2 . VAL B 1 133 ? -3.561  25.489  20.320  1.00 42.31  ? 132  VAL B CG2 1 
ATOM   4592 N  N   . GLY B 1 134 ? -1.064  29.216  19.022  1.00 34.19  ? 133  GLY B N   1 
ATOM   4593 C  CA  . GLY B 1 134 ? 0.025   30.160  19.039  1.00 35.48  ? 133  GLY B CA  1 
ATOM   4594 C  C   . GLY B 1 134 ? 0.455   30.465  20.455  1.00 37.20  ? 133  GLY B C   1 
ATOM   4595 O  O   . GLY B 1 134 ? -0.381  30.772  21.325  1.00 41.51  ? 133  GLY B O   1 
ATOM   4596 N  N   . ILE B 1 135 ? 1.761   30.384  20.690  1.00 36.24  ? 134  ILE B N   1 
ATOM   4597 C  CA  . ILE B 1 135 ? 2.333   30.737  21.972  1.00 36.59  ? 134  ILE B CA  1 
ATOM   4598 C  C   . ILE B 1 135 ? 2.899   32.151  21.857  1.00 39.05  ? 134  ILE B C   1 
ATOM   4599 O  O   . ILE B 1 135 ? 4.051   32.353  21.399  1.00 37.49  ? 134  ILE B O   1 
ATOM   4600 C  CB  . ILE B 1 135 ? 3.405   29.749  22.403  1.00 36.56  ? 134  ILE B CB  1 
ATOM   4601 C  CG1 . ILE B 1 135 ? 2.778   28.368  22.577  1.00 36.78  ? 134  ILE B CG1 1 
ATOM   4602 C  CG2 . ILE B 1 135 ? 4.077   30.182  23.715  1.00 35.80  ? 134  ILE B CG2 1 
ATOM   4603 C  CD1 . ILE B 1 135 ? 3.810   27.250  22.708  1.00 39.38  ? 134  ILE B CD1 1 
ATOM   4604 N  N   . THR B 1 136 ? 2.071   33.129  22.264  1.00 40.71  ? 135  THR B N   1 
ATOM   4605 C  CA  . THR B 1 136 ? 2.419   34.559  22.135  1.00 41.50  ? 135  THR B CA  1 
ATOM   4606 C  C   . THR B 1 136 ? 3.084   35.163  23.378  1.00 42.23  ? 135  THR B C   1 
ATOM   4607 O  O   . THR B 1 136 ? 3.531   36.309  23.353  1.00 42.35  ? 135  THR B O   1 
ATOM   4608 C  CB  . THR B 1 136 ? 1.188   35.397  21.781  1.00 40.74  ? 135  THR B CB  1 
ATOM   4609 O  OG1 . THR B 1 136 ? 0.205   35.270  22.816  1.00 40.47  ? 135  THR B OG1 1 
ATOM   4610 C  CG2 . THR B 1 136 ? 0.617   34.901  20.470  1.00 44.42  ? 135  THR B CG2 1 
ATOM   4611 N  N   . TRP B 1 137 ? 3.161   34.393  24.452  1.00 41.32  ? 136  TRP B N   1 
ATOM   4612 C  CA  . TRP B 1 137 ? 3.820   34.856  25.659  1.00 41.62  ? 136  TRP B CA  1 
ATOM   4613 C  C   . TRP B 1 137 ? 4.257   33.661  26.468  1.00 42.21  ? 136  TRP B C   1 
ATOM   4614 O  O   . TRP B 1 137 ? 3.992   32.511  26.099  1.00 40.22  ? 136  TRP B O   1 
ATOM   4615 C  CB  . TRP B 1 137 ? 2.901   35.733  26.489  1.00 43.08  ? 136  TRP B CB  1 
ATOM   4616 C  CG  . TRP B 1 137 ? 1.657   35.026  27.000  1.00 44.50  ? 136  TRP B CG  1 
ATOM   4617 C  CD1 . TRP B 1 137 ? 0.645   34.553  26.249  1.00 44.75  ? 136  TRP B CD1 1 
ATOM   4618 C  CD2 . TRP B 1 137 ? 1.280   34.794  28.368  1.00 44.97  ? 136  TRP B CD2 1 
ATOM   4619 N  NE1 . TRP B 1 137 ? -0.331  34.017  27.046  1.00 44.81  ? 136  TRP B NE1 1 
ATOM   4620 C  CE2 . TRP B 1 137 ? 0.032   34.157  28.352  1.00 42.61  ? 136  TRP B CE2 1 
ATOM   4621 C  CE3 . TRP B 1 137 ? 1.883   35.069  29.609  1.00 45.53  ? 136  TRP B CE3 1 
ATOM   4622 C  CZ2 . TRP B 1 137 ? -0.633  33.772  29.521  1.00 44.50  ? 136  TRP B CZ2 1 
ATOM   4623 C  CZ3 . TRP B 1 137 ? 1.212   34.686  30.787  1.00 40.85  ? 136  TRP B CZ3 1 
ATOM   4624 C  CH2 . TRP B 1 137 ? -0.025  34.047  30.728  1.00 41.97  ? 136  TRP B CH2 1 
ATOM   4625 N  N   . TRP B 1 138 ? 4.972   33.933  27.552  1.00 43.50  ? 137  TRP B N   1 
ATOM   4626 C  CA  . TRP B 1 138 ? 5.639   32.858  28.271  1.00 43.27  ? 137  TRP B CA  1 
ATOM   4627 C  C   . TRP B 1 138 ? 5.714   33.065  29.792  1.00 41.83  ? 137  TRP B C   1 
ATOM   4628 O  O   . TRP B 1 138 ? 6.346   33.992  30.276  1.00 40.06  ? 137  TRP B O   1 
ATOM   4629 C  CB  . TRP B 1 138 ? 7.029   32.615  27.661  1.00 45.43  ? 137  TRP B CB  1 
ATOM   4630 C  CG  . TRP B 1 138 ? 7.707   31.454  28.298  1.00 42.59  ? 137  TRP B CG  1 
ATOM   4631 C  CD1 . TRP B 1 138 ? 8.836   31.486  29.043  1.00 42.04  ? 137  TRP B CD1 1 
ATOM   4632 C  CD2 . TRP B 1 138 ? 7.296   30.097  28.238  1.00 36.95  ? 137  TRP B CD2 1 
ATOM   4633 N  NE1 . TRP B 1 138 ? 9.161   30.233  29.451  1.00 41.94  ? 137  TRP B NE1 1 
ATOM   4634 C  CE2 . TRP B 1 138 ? 8.222   29.356  28.983  1.00 37.15  ? 137  TRP B CE2 1 
ATOM   4635 C  CE3 . TRP B 1 138 ? 6.237   29.439  27.627  1.00 37.31  ? 137  TRP B CE3 1 
ATOM   4636 C  CZ2 . TRP B 1 138 ? 8.116   27.990  29.160  1.00 34.43  ? 137  TRP B CZ2 1 
ATOM   4637 C  CZ3 . TRP B 1 138 ? 6.135   28.097  27.797  1.00 37.64  ? 137  TRP B CZ3 1 
ATOM   4638 C  CH2 . TRP B 1 138 ? 7.076   27.378  28.559  1.00 35.98  ? 137  TRP B CH2 1 
ATOM   4639 N  N   . ALA B 1 139 ? 5.020   32.190  30.511  1.00 42.34  ? 138  ALA B N   1 
ATOM   4640 C  CA  . ALA B 1 139 ? 4.963   32.157  31.972  1.00 44.60  ? 138  ALA B CA  1 
ATOM   4641 C  C   . ALA B 1 139 ? 4.700   30.711  32.415  1.00 44.18  ? 138  ALA B C   1 
ATOM   4642 O  O   . ALA B 1 139 ? 4.594   29.836  31.570  1.00 41.86  ? 138  ALA B O   1 
ATOM   4643 C  CB  . ALA B 1 139 ? 3.853   33.065  32.468  1.00 44.73  ? 138  ALA B CB  1 
ATOM   4644 N  N   . PRO B 1 140 ? 4.599   30.456  33.740  1.00 48.91  ? 139  PRO B N   1 
ATOM   4645 C  CA  . PRO B 1 140 ? 4.407   29.030  34.062  1.00 51.17  ? 139  PRO B CA  1 
ATOM   4646 C  C   . PRO B 1 140 ? 3.002   28.524  33.745  1.00 49.15  ? 139  PRO B C   1 
ATOM   4647 O  O   . PRO B 1 140 ? 2.825   27.312  33.477  1.00 50.04  ? 139  PRO B O   1 
ATOM   4648 C  CB  . PRO B 1 140 ? 4.737   28.946  35.564  1.00 48.57  ? 139  PRO B CB  1 
ATOM   4649 C  CG  . PRO B 1 140 ? 5.577   30.162  35.839  1.00 47.34  ? 139  PRO B CG  1 
ATOM   4650 C  CD  . PRO B 1 140 ? 5.037   31.228  34.924  1.00 47.03  ? 139  PRO B CD  1 
ATOM   4651 N  N   . LYS B 1 141 ? 2.034   29.435  33.732  1.00 44.78  ? 140  LYS B N   1 
ATOM   4652 C  CA  . LYS B 1 141 ? 0.689   29.095  33.260  1.00 47.02  ? 140  LYS B CA  1 
ATOM   4653 C  C   . LYS B 1 141 ? 0.713   28.541  31.826  1.00 47.62  ? 140  LYS B C   1 
ATOM   4654 O  O   . LYS B 1 141 ? -0.006  27.600  31.513  1.00 45.83  ? 140  LYS B O   1 
ATOM   4655 C  CB  . LYS B 1 141 ? -0.217  30.335  33.321  1.00 53.54  ? 140  LYS B CB  1 
ATOM   4656 C  CG  . LYS B 1 141 ? -1.666  30.075  32.906  1.00 61.55  ? 140  LYS B CG  1 
ATOM   4657 C  CD  . LYS B 1 141 ? -2.618  31.246  33.162  1.00 67.01  ? 140  LYS B CD  1 
ATOM   4658 C  CE  . LYS B 1 141 ? -4.084  30.820  33.004  1.00 69.76  ? 140  LYS B CE  1 
ATOM   4659 N  NZ  . LYS B 1 141 ? -5.066  31.955  32.975  1.00 72.89  ? 140  LYS B NZ  1 
ATOM   4660 N  N   . VAL B 1 142 ? 1.558   29.128  30.966  1.00 50.15  ? 141  VAL B N   1 
ATOM   4661 C  CA  . VAL B 1 142 ? 1.607   28.791  29.531  1.00 48.33  ? 141  VAL B CA  1 
ATOM   4662 C  C   . VAL B 1 142 ? 2.168   27.393  29.307  1.00 45.37  ? 141  VAL B C   1 
ATOM   4663 O  O   . VAL B 1 142 ? 1.566   26.601  28.581  1.00 41.33  ? 141  VAL B O   1 
ATOM   4664 C  CB  . VAL B 1 142 ? 2.397   29.844  28.689  1.00 49.38  ? 141  VAL B CB  1 
ATOM   4665 C  CG1 . VAL B 1 142 ? 2.557   29.398  27.228  1.00 48.17  ? 141  VAL B CG1 1 
ATOM   4666 C  CG2 . VAL B 1 142 ? 1.698   31.205  28.735  1.00 48.92  ? 141  VAL B CG2 1 
ATOM   4667 N  N   . LYS B 1 143 ? 3.313   27.088  29.916  1.00 43.07  ? 142  LYS B N   1 
ATOM   4668 C  CA  . LYS B 1 143 ? 3.861   25.736  29.858  1.00 45.77  ? 142  LYS B CA  1 
ATOM   4669 C  C   . LYS B 1 143 ? 2.774   24.762  30.252  1.00 44.24  ? 142  LYS B C   1 
ATOM   4670 O  O   . LYS B 1 143 ? 2.622   23.717  29.631  1.00 45.70  ? 142  LYS B O   1 
ATOM   4671 C  CB  . LYS B 1 143 ? 5.053   25.595  30.805  1.00 52.13  ? 142  LYS B CB  1 
ATOM   4672 C  CG  . LYS B 1 143 ? 5.789   24.256  30.767  1.00 55.15  ? 142  LYS B CG  1 
ATOM   4673 C  CD  . LYS B 1 143 ? 7.067   24.299  31.608  1.00 58.59  ? 142  LYS B CD  1 
ATOM   4674 C  CE  . LYS B 1 143 ? 7.674   22.904  31.815  1.00 67.05  ? 142  LYS B CE  1 
ATOM   4675 N  NZ  . LYS B 1 143 ? 9.153   22.785  31.558  1.00 69.12  ? 142  LYS B NZ  1 
ATOM   4676 N  N   . ALA B 1 144 ? 1.992   25.125  31.261  1.00 42.86  ? 143  ALA B N   1 
ATOM   4677 C  CA  . ALA B 1 144 ? 0.949   24.233  31.761  1.00 43.53  ? 143  ALA B CA  1 
ATOM   4678 C  C   . ALA B 1 144 ? -0.108  23.979  30.710  1.00 40.30  ? 143  ALA B C   1 
ATOM   4679 O  O   . ALA B 1 144 ? -0.424  22.842  30.364  1.00 37.97  ? 143  ALA B O   1 
ATOM   4680 C  CB  . ALA B 1 144 ? 0.312   24.795  33.020  1.00 43.61  ? 143  ALA B CB  1 
ATOM   4681 N  N   . GLU B 1 145 ? -0.642  25.053  30.184  1.00 41.67  ? 144  GLU B N   1 
ATOM   4682 C  CA  . GLU B 1 145 ? -1.658  24.948  29.149  1.00 45.64  ? 144  GLU B CA  1 
ATOM   4683 C  C   . GLU B 1 145 ? -1.164  24.194  27.874  1.00 42.45  ? 144  GLU B C   1 
ATOM   4684 O  O   . GLU B 1 145 ? -1.941  23.499  27.231  1.00 40.71  ? 144  GLU B O   1 
ATOM   4685 C  CB  . GLU B 1 145 ? -2.108  26.345  28.767  1.00 47.42  ? 144  GLU B CB  1 
ATOM   4686 C  CG  . GLU B 1 145 ? -2.803  27.158  29.825  1.00 44.79  ? 144  GLU B CG  1 
ATOM   4687 C  CD  . GLU B 1 145 ? -3.480  28.363  29.178  1.00 47.29  ? 144  GLU B CD  1 
ATOM   4688 O  OE1 . GLU B 1 145 ? -2.756  29.286  28.727  1.00 43.29  ? 144  GLU B OE1 1 
ATOM   4689 O  OE2 . GLU B 1 145 ? -4.727  28.369  29.099  1.00 47.18  ? 144  GLU B OE2 1 
ATOM   4690 N  N   . MET B 1 146 ? 0.118   24.351  27.529  1.00 39.85  ? 145  MET B N   1 
ATOM   4691 C  CA  . MET B 1 146 ? 0.733   23.631  26.403  1.00 38.34  ? 145  MET B CA  1 
ATOM   4692 C  C   . MET B 1 146 ? 0.572   22.145  26.625  1.00 39.98  ? 145  MET B C   1 
ATOM   4693 O  O   . MET B 1 146 ? 0.094   21.414  25.740  1.00 36.66  ? 145  MET B O   1 
ATOM   4694 C  CB  . MET B 1 146 ? 2.233   23.931  26.294  1.00 38.69  ? 145  MET B CB  1 
ATOM   4695 C  CG  . MET B 1 146 ? 2.593   25.280  25.683  1.00 40.07  ? 145  MET B CG  1 
ATOM   4696 S  SD  . MET B 1 146 ? 4.387   25.574  25.702  1.00 39.40  ? 145  MET B SD  1 
ATOM   4697 C  CE  . MET B 1 146 ? 4.845   24.344  24.436  1.00 41.37  ? 145  MET B CE  1 
ATOM   4698 N  N   . GLU B 1 147 ? 0.979   21.714  27.831  1.00 39.02  ? 146  GLU B N   1 
ATOM   4699 C  CA  . GLU B 1 147 ? 0.922   20.321  28.228  1.00 33.83  ? 146  GLU B CA  1 
ATOM   4700 C  C   . GLU B 1 147 ? -0.517  19.823  28.169  1.00 35.18  ? 146  GLU B C   1 
ATOM   4701 O  O   . GLU B 1 147 ? -0.776  18.734  27.653  1.00 36.29  ? 146  GLU B O   1 
ATOM   4702 C  CB  . GLU B 1 147 ? 1.476   20.154  29.617  1.00 33.02  ? 146  GLU B CB  1 
ATOM   4703 C  CG  . GLU B 1 147 ? 2.957   20.455  29.787  1.00 33.98  ? 146  GLU B CG  1 
ATOM   4704 C  CD  . GLU B 1 147 ? 3.381   20.538  31.261  1.00 36.68  ? 146  GLU B CD  1 
ATOM   4705 O  OE1 . GLU B 1 147 ? 2.510   20.707  32.162  1.00 39.04  ? 146  GLU B OE1 1 
ATOM   4706 O  OE2 . GLU B 1 147 ? 4.586   20.392  31.545  1.00 34.16  ? 146  GLU B OE2 1 
ATOM   4707 N  N   . THR B 1 148 ? -1.455  20.615  28.682  1.00 34.24  ? 147  THR B N   1 
ATOM   4708 C  CA  . THR B 1 148 ? -2.862  20.239  28.646  1.00 35.13  ? 147  THR B CA  1 
ATOM   4709 C  C   . THR B 1 148 ? -3.323  20.002  27.210  1.00 33.70  ? 147  THR B C   1 
ATOM   4710 O  O   . THR B 1 148 ? -4.058  19.039  26.945  1.00 33.74  ? 147  THR B O   1 
ATOM   4711 C  CB  . THR B 1 148 ? -3.774  21.354  29.197  1.00 38.28  ? 147  THR B CB  1 
ATOM   4712 O  OG1 . THR B 1 148 ? -3.437  21.654  30.544  1.00 40.15  ? 147  THR B OG1 1 
ATOM   4713 C  CG2 . THR B 1 148 ? -5.244  20.941  29.122  1.00 38.93  ? 147  THR B CG2 1 
ATOM   4714 N  N   . LEU B 1 149 ? -2.966  20.925  26.314  1.00 30.35  ? 148  LEU B N   1 
ATOM   4715 C  CA  . LEU B 1 149 ? -3.449  20.879  24.948  1.00 31.76  ? 148  LEU B CA  1 
ATOM   4716 C  C   . LEU B 1 149 ? -2.913  19.646  24.220  1.00 32.96  ? 148  LEU B C   1 
ATOM   4717 O  O   . LEU B 1 149 ? -3.652  18.948  23.505  1.00 34.54  ? 148  LEU B O   1 
ATOM   4718 C  CB  . LEU B 1 149 ? -3.075  22.147  24.200  1.00 31.60  ? 148  LEU B CB  1 
ATOM   4719 C  CG  . LEU B 1 149 ? -3.837  23.422  24.594  1.00 30.67  ? 148  LEU B CG  1 
ATOM   4720 C  CD1 . LEU B 1 149 ? -3.001  24.654  24.298  1.00 29.74  ? 148  LEU B CD1 1 
ATOM   4721 C  CD2 . LEU B 1 149 ? -5.166  23.498  23.862  1.00 31.10  ? 148  LEU B CD2 1 
ATOM   4722 N  N   . VAL B 1 150 ? -1.642  19.361  24.413  1.00 33.58  ? 149  VAL B N   1 
ATOM   4723 C  CA  . VAL B 1 150 ? -1.059  18.157  23.837  1.00 35.04  ? 149  VAL B CA  1 
ATOM   4724 C  C   . VAL B 1 150 ? -1.651  16.898  24.441  1.00 34.12  ? 149  VAL B C   1 
ATOM   4725 O  O   . VAL B 1 150 ? -2.079  16.013  23.731  1.00 36.79  ? 149  VAL B O   1 
ATOM   4726 C  CB  . VAL B 1 150 ? 0.458   18.115  24.029  1.00 35.64  ? 149  VAL B CB  1 
ATOM   4727 C  CG1 . VAL B 1 150 ? 1.021   16.808  23.491  1.00 38.34  ? 149  VAL B CG1 1 
ATOM   4728 C  CG2 . VAL B 1 150 ? 1.110   19.307  23.349  1.00 35.34  ? 149  VAL B CG2 1 
ATOM   4729 N  N   . ARG B 1 151 ? -1.707  16.834  25.758  1.00 38.45  ? 150  ARG B N   1 
ATOM   4730 C  CA  . ARG B 1 151 ? -2.145  15.616  26.445  1.00 39.33  ? 150  ARG B CA  1 
ATOM   4731 C  C   . ARG B 1 151 ? -3.545  15.236  26.056  1.00 43.07  ? 150  ARG B C   1 
ATOM   4732 O  O   . ARG B 1 151 ? -3.793  14.086  25.643  1.00 53.16  ? 150  ARG B O   1 
ATOM   4733 C  CB  . ARG B 1 151 ? -2.024  15.772  27.948  1.00 38.04  ? 150  ARG B CB  1 
ATOM   4734 C  CG  . ARG B 1 151 ? -0.587  15.613  28.451  1.00 36.82  ? 150  ARG B CG  1 
ATOM   4735 C  CD  . ARG B 1 151 ? -0.387  16.413  29.731  1.00 37.34  ? 150  ARG B CD  1 
ATOM   4736 N  NE  . ARG B 1 151 ? 0.954   16.361  30.261  1.00 38.85  ? 150  ARG B NE  1 
ATOM   4737 C  CZ  . ARG B 1 151 ? 1.321   17.053  31.330  1.00 37.52  ? 150  ARG B CZ  1 
ATOM   4738 N  NH1 . ARG B 1 151 ? 0.420   17.820  31.925  1.00 35.54  ? 150  ARG B NH1 1 
ATOM   4739 N  NH2 . ARG B 1 151 ? 2.582   16.999  31.785  1.00 37.53  ? 150  ARG B NH2 1 
ATOM   4740 N  N   . GLU B 1 152 ? -4.451  16.202  26.062  1.00 45.29  ? 151  GLU B N   1 
ATOM   4741 C  CA  . GLU B 1 152 ? -5.856  15.833  25.864  1.00 44.90  ? 151  GLU B CA  1 
ATOM   4742 C  C   . GLU B 1 152 ? -6.678  16.697  24.964  1.00 42.93  ? 151  GLU B C   1 
ATOM   4743 O  O   . GLU B 1 152 ? -7.869  16.513  24.953  1.00 48.38  ? 151  GLU B O   1 
ATOM   4744 C  CB  . GLU B 1 152 ? -6.558  15.676  27.219  1.00 48.92  ? 151  GLU B CB  1 
ATOM   4745 C  CG  . GLU B 1 152 ? -7.008  16.973  27.891  1.00 50.30  ? 151  GLU B CG  1 
ATOM   4746 C  CD  . GLU B 1 152 ? -6.845  16.894  29.402  1.00 54.04  ? 151  GLU B CD  1 
ATOM   4747 O  OE1 . GLU B 1 152 ? -5.657  16.851  29.894  1.00 53.19  ? 151  GLU B OE1 1 
ATOM   4748 O  OE2 . GLU B 1 152 ? -7.898  16.872  30.074  1.00 50.73  ? 151  GLU B OE2 1 
ATOM   4749 N  N   . LYS B 1 153 ? -6.092  17.609  24.199  1.00 42.12  ? 152  LYS B N   1 
ATOM   4750 C  CA  . LYS B 1 153 ? -6.906  18.380  23.232  1.00 43.52  ? 152  LYS B CA  1 
ATOM   4751 C  C   . LYS B 1 153 ? -6.558  18.119  21.784  1.00 38.03  ? 152  LYS B C   1 
ATOM   4752 O  O   . LYS B 1 153 ? -7.102  18.743  20.916  1.00 30.30  ? 152  LYS B O   1 
ATOM   4753 C  CB  . LYS B 1 153 ? -6.850  19.885  23.518  1.00 48.59  ? 152  LYS B CB  1 
ATOM   4754 C  CG  . LYS B 1 153 ? -7.185  20.266  24.955  1.00 51.51  ? 152  LYS B CG  1 
ATOM   4755 C  CD  . LYS B 1 153 ? -8.653  20.048  25.269  1.00 55.66  ? 152  LYS B CD  1 
ATOM   4756 C  CE  . LYS B 1 153 ? -8.999  20.522  26.684  1.00 59.78  ? 152  LYS B CE  1 
ATOM   4757 N  NZ  . LYS B 1 153 ? -10.474 20.667  26.846  1.00 57.24  ? 152  LYS B NZ  1 
ATOM   4758 N  N   . GLY B 1 154 ? -5.653  17.183  21.537  1.00 42.26  ? 153  GLY B N   1 
ATOM   4759 C  CA  . GLY B 1 154 ? -5.296  16.837  20.171  1.00 42.44  ? 153  GLY B CA  1 
ATOM   4760 C  C   . GLY B 1 154 ? -4.534  17.939  19.461  1.00 40.69  ? 153  GLY B C   1 
ATOM   4761 O  O   . GLY B 1 154 ? -4.768  18.219  18.279  1.00 41.12  ? 153  GLY B O   1 
ATOM   4762 N  N   . VAL B 1 155 ? -3.614  18.563  20.184  1.00 38.36  ? 154  VAL B N   1 
ATOM   4763 C  CA  . VAL B 1 155 ? -2.767  19.582  19.612  1.00 38.23  ? 154  VAL B CA  1 
ATOM   4764 C  C   . VAL B 1 155 ? -1.371  19.024  19.659  1.00 38.29  ? 154  VAL B C   1 
ATOM   4765 O  O   . VAL B 1 155 ? -0.972  18.437  20.651  1.00 36.18  ? 154  VAL B O   1 
ATOM   4766 C  CB  . VAL B 1 155 ? -2.864  20.890  20.403  1.00 39.01  ? 154  VAL B CB  1 
ATOM   4767 C  CG1 . VAL B 1 155 ? -1.896  21.937  19.867  1.00 42.61  ? 154  VAL B CG1 1 
ATOM   4768 C  CG2 . VAL B 1 155 ? -4.286  21.422  20.353  1.00 37.61  ? 154  VAL B CG2 1 
ATOM   4769 N  N   . ASN B 1 156 ? -0.659  19.114  18.544  1.00 37.27  ? 155  ASN B N   1 
ATOM   4770 C  CA  . ASN B 1 156 ? 0.720   18.732  18.530  1.00 35.23  ? 155  ASN B CA  1 
ATOM   4771 C  C   . ASN B 1 156 ? 1.615   19.730  17.816  1.00 37.38  ? 155  ASN B C   1 
ATOM   4772 O  O   . ASN B 1 156 ? 2.825   19.517  17.717  1.00 43.41  ? 155  ASN B O   1 
ATOM   4773 C  CB  . ASN B 1 156 ? 0.874   17.317  17.976  1.00 33.99  ? 155  ASN B CB  1 
ATOM   4774 C  CG  . ASN B 1 156 ? 0.624   17.227  16.496  1.00 33.90  ? 155  ASN B CG  1 
ATOM   4775 O  OD1 . ASN B 1 156 ? 0.175   18.172  15.876  1.00 33.28  ? 155  ASN B OD1 1 
ATOM   4776 N  ND2 . ASN B 1 156 ? 0.926   16.056  15.912  1.00 35.93  ? 155  ASN B ND2 1 
ATOM   4777 N  N   . SER B 1 157 ? 1.061   20.836  17.353  1.00 36.28  ? 156  SER B N   1 
ATOM   4778 C  CA  . SER B 1 157 ? 1.924   21.927  16.910  1.00 35.08  ? 156  SER B CA  1 
ATOM   4779 C  C   . SER B 1 157 ? 1.557   23.277  17.549  1.00 35.68  ? 156  SER B C   1 
ATOM   4780 O  O   . SER B 1 157 ? 0.386   23.607  17.794  1.00 33.19  ? 156  SER B O   1 
ATOM   4781 C  CB  . SER B 1 157 ? 1.978   22.026  15.375  1.00 33.93  ? 156  SER B CB  1 
ATOM   4782 O  OG  . SER B 1 157 ? 0.716   22.234  14.795  1.00 31.28  ? 156  SER B OG  1 
ATOM   4783 N  N   . PHE B 1 158 ? 2.598   24.046  17.816  1.00 35.45  ? 157  PHE B N   1 
ATOM   4784 C  CA  . PHE B 1 158 ? 2.461   25.370  18.348  1.00 34.38  ? 157  PHE B CA  1 
ATOM   4785 C  C   . PHE B 1 158 ? 3.140   26.355  17.398  1.00 35.10  ? 157  PHE B C   1 
ATOM   4786 O  O   . PHE B 1 158 ? 4.189   26.062  16.827  1.00 34.98  ? 157  PHE B O   1 
ATOM   4787 C  CB  . PHE B 1 158 ? 3.130   25.412  19.707  1.00 33.40  ? 157  PHE B CB  1 
ATOM   4788 C  CG  . PHE B 1 158 ? 2.422   24.624  20.730  1.00 30.32  ? 157  PHE B CG  1 
ATOM   4789 C  CD1 . PHE B 1 158 ? 1.275   25.107  21.295  1.00 29.72  ? 157  PHE B CD1 1 
ATOM   4790 C  CD2 . PHE B 1 158 ? 2.885   23.374  21.102  1.00 29.86  ? 157  PHE B CD2 1 
ATOM   4791 C  CE1 . PHE B 1 158 ? 0.588   24.354  22.236  1.00 32.19  ? 157  PHE B CE1 1 
ATOM   4792 C  CE2 . PHE B 1 158 ? 2.212   22.619  22.045  1.00 29.58  ? 157  PHE B CE2 1 
ATOM   4793 C  CZ  . PHE B 1 158 ? 1.064   23.107  22.609  1.00 30.20  ? 157  PHE B CZ  1 
ATOM   4794 N  N   . GLN B 1 159 ? 2.541   27.525  17.242  1.00 33.38  ? 158  GLN B N   1 
ATOM   4795 C  CA  . GLN B 1 159 ? 3.075   28.530  16.358  1.00 33.74  ? 158  GLN B CA  1 
ATOM   4796 C  C   . GLN B 1 159 ? 3.672   29.694  17.155  1.00 33.27  ? 158  GLN B C   1 
ATOM   4797 O  O   . GLN B 1 159 ? 2.985   30.368  17.885  1.00 35.88  ? 158  GLN B O   1 
ATOM   4798 C  CB  . GLN B 1 159 ? 1.978   29.032  15.421  1.00 34.54  ? 158  GLN B CB  1 
ATOM   4799 C  CG  . GLN B 1 159 ? 2.432   30.152  14.496  1.00 34.78  ? 158  GLN B CG  1 
ATOM   4800 C  CD  . GLN B 1 159 ? 3.391   29.642  13.452  1.00 35.43  ? 158  GLN B CD  1 
ATOM   4801 O  OE1 . GLN B 1 159 ? 3.022   28.795  12.628  1.00 37.74  ? 158  GLN B OE1 1 
ATOM   4802 N  NE2 . GLN B 1 159 ? 4.620   30.149  13.459  1.00 34.44  ? 158  GLN B NE2 1 
ATOM   4803 N  N   . MET B 1 160 ? 4.958   29.939  16.964  1.00 35.82  ? 159  MET B N   1 
ATOM   4804 C  CA  . MET B 1 160 ? 5.649   31.071  17.582  1.00 37.30  ? 159  MET B CA  1 
ATOM   4805 C  C   . MET B 1 160 ? 6.073   32.141  16.551  1.00 39.20  ? 159  MET B C   1 
ATOM   4806 O  O   . MET B 1 160 ? 6.182   31.866  15.349  1.00 44.90  ? 159  MET B O   1 
ATOM   4807 C  CB  . MET B 1 160 ? 6.880   30.556  18.323  1.00 38.92  ? 159  MET B CB  1 
ATOM   4808 C  CG  . MET B 1 160 ? 6.544   29.831  19.624  1.00 40.11  ? 159  MET B CG  1 
ATOM   4809 S  SD  . MET B 1 160 ? 5.706   28.234  19.444  0.89 41.46  ? 159  MET B SD  1 
ATOM   4810 C  CE  . MET B 1 160 ? 6.980   27.342  18.542  1.00 41.81  ? 159  MET B CE  1 
ATOM   4811 N  N   . PHE B 1 161 ? 6.304   33.364  17.015  1.00 39.57  ? 160  PHE B N   1 
ATOM   4812 C  CA  . PHE B 1 161 ? 6.667   34.485  16.129  1.00 38.40  ? 160  PHE B CA  1 
ATOM   4813 C  C   . PHE B 1 161 ? 7.886   35.246  16.627  1.00 38.19  ? 160  PHE B C   1 
ATOM   4814 O  O   . PHE B 1 161 ? 7.983   35.532  17.836  1.00 34.57  ? 160  PHE B O   1 
ATOM   4815 C  CB  . PHE B 1 161 ? 5.534   35.473  16.075  1.00 39.65  ? 160  PHE B CB  1 
ATOM   4816 C  CG  . PHE B 1 161 ? 4.319   34.948  15.418  1.00 41.67  ? 160  PHE B CG  1 
ATOM   4817 C  CD1 . PHE B 1 161 ? 3.377   34.250  16.150  1.00 44.93  ? 160  PHE B CD1 1 
ATOM   4818 C  CD2 . PHE B 1 161 ? 4.098   35.173  14.063  1.00 44.31  ? 160  PHE B CD2 1 
ATOM   4819 C  CE1 . PHE B 1 161 ? 2.232   33.758  15.538  1.00 46.81  ? 160  PHE B CE1 1 
ATOM   4820 C  CE2 . PHE B 1 161 ? 2.950   34.709  13.442  1.00 44.81  ? 160  PHE B CE2 1 
ATOM   4821 C  CZ  . PHE B 1 161 ? 2.016   33.995  14.182  1.00 46.79  ? 160  PHE B CZ  1 
ATOM   4822 N  N   . MET B 1 162 ? 8.814   35.564  15.707  1.00 38.64  ? 161  MET B N   1 
ATOM   4823 C  CA  . MET B 1 162 ? 10.033  36.293  16.076  1.00 37.95  ? 161  MET B CA  1 
ATOM   4824 C  C   . MET B 1 162 ? 9.910   37.746  15.698  1.00 40.22  ? 161  MET B C   1 
ATOM   4825 O  O   . MET B 1 162 ? 10.817  38.527  15.946  1.00 39.66  ? 161  MET B O   1 
ATOM   4826 C  CB  . MET B 1 162 ? 11.258  35.701  15.419  1.00 36.18  ? 161  MET B CB  1 
ATOM   4827 C  CG  . MET B 1 162 ? 11.515  34.276  15.850  1.00 37.57  ? 161  MET B CG  1 
ATOM   4828 S  SD  . MET B 1 162 ? 12.894  33.477  14.981  1.00 37.43  ? 161  MET B SD  1 
ATOM   4829 C  CE  . MET B 1 162 ? 14.225  33.768  16.153  1.00 35.01  ? 161  MET B CE  1 
ATOM   4830 N  N   . THR B 1 163 ? 8.778   38.110  15.131  1.00 42.08  ? 162  THR B N   1 
ATOM   4831 C  CA  . THR B 1 163 ? 8.486   39.476  14.815  1.00 45.63  ? 162  THR B CA  1 
ATOM   4832 C  C   . THR B 1 163 ? 7.143   39.790  15.454  1.00 51.48  ? 162  THR B C   1 
ATOM   4833 O  O   . THR B 1 163 ? 6.655   39.003  16.271  1.00 52.21  ? 162  THR B O   1 
ATOM   4834 C  CB  . THR B 1 163 ? 8.436   39.681  13.303  1.00 48.31  ? 162  THR B CB  1 
ATOM   4835 O  OG1 . THR B 1 163 ? 7.881   40.972  13.020  1.00 50.53  ? 162  THR B OG1 1 
ATOM   4836 C  CG2 . THR B 1 163 ? 7.573   38.608  12.632  1.00 49.55  ? 162  THR B CG2 1 
ATOM   4837 N  N   . TYR B 1 164 ? 6.525   40.912  15.071  1.00 52.97  ? 163  TYR B N   1 
ATOM   4838 C  CA  . TYR B 1 164 ? 5.367   41.438  15.804  1.00 48.76  ? 163  TYR B CA  1 
ATOM   4839 C  C   . TYR B 1 164 ? 5.790   41.707  17.263  1.00 49.68  ? 163  TYR B C   1 
ATOM   4840 O  O   . TYR B 1 164 ? 5.235   41.166  18.239  1.00 44.73  ? 163  TYR B O   1 
ATOM   4841 C  CB  . TYR B 1 164 ? 4.182   40.482  15.732  1.00 46.51  ? 163  TYR B CB  1 
ATOM   4842 C  CG  . TYR B 1 164 ? 3.649   40.242  14.352  1.00 41.60  ? 163  TYR B CG  1 
ATOM   4843 C  CD1 . TYR B 1 164 ? 2.960   41.214  13.697  1.00 38.26  ? 163  TYR B CD1 1 
ATOM   4844 C  CD2 . TYR B 1 164 ? 3.818   39.007  13.729  1.00 42.72  ? 163  TYR B CD2 1 
ATOM   4845 C  CE1 . TYR B 1 164 ? 2.440   40.977  12.449  1.00 42.24  ? 163  TYR B CE1 1 
ATOM   4846 C  CE2 . TYR B 1 164 ? 3.292   38.747  12.493  1.00 42.22  ? 163  TYR B CE2 1 
ATOM   4847 C  CZ  . TYR B 1 164 ? 2.613   39.734  11.837  1.00 43.22  ? 163  TYR B CZ  1 
ATOM   4848 O  OH  . TYR B 1 164 ? 2.124   39.457  10.564  1.00 40.42  ? 163  TYR B OH  1 
ATOM   4849 N  N   . LYS B 1 165 ? 6.825   42.529  17.376  1.00 51.64  ? 164  LYS B N   1 
ATOM   4850 C  CA  . LYS B 1 165 ? 7.308   43.031  18.649  1.00 52.08  ? 164  LYS B CA  1 
ATOM   4851 C  C   . LYS B 1 165 ? 6.175   43.659  19.432  1.00 56.40  ? 164  LYS B C   1 
ATOM   4852 O  O   . LYS B 1 165 ? 5.384   44.457  18.891  1.00 52.00  ? 164  LYS B O   1 
ATOM   4853 C  CB  . LYS B 1 165 ? 8.372   44.096  18.382  1.00 52.18  ? 164  LYS B CB  1 
ATOM   4854 C  CG  . LYS B 1 165 ? 8.893   44.770  19.634  1.00 53.33  ? 164  LYS B CG  1 
ATOM   4855 C  CD  . LYS B 1 165 ? 9.888   45.887  19.336  1.00 56.23  ? 164  LYS B CD  1 
ATOM   4856 C  CE  . LYS B 1 165 ? 10.551  46.451  20.610  1.00 62.18  ? 164  LYS B CE  1 
ATOM   4857 N  NZ  . LYS B 1 165 ? 11.321  47.733  20.487  1.00 57.84  ? 164  LYS B NZ  1 
ATOM   4858 N  N   . ASP B 1 166 ? 6.077   43.299  20.702  1.00 59.19  ? 165  ASP B N   1 
ATOM   4859 C  CA  . ASP B 1 166 ? 5.077   43.925  21.564  1.00 63.90  ? 165  ASP B CA  1 
ATOM   4860 C  C   . ASP B 1 166 ? 3.686   43.408  21.264  1.00 61.35  ? 165  ASP B C   1 
ATOM   4861 O  O   . ASP B 1 166 ? 2.727   43.869  21.868  1.00 58.55  ? 165  ASP B O   1 
ATOM   4862 C  CB  . ASP B 1 166 ? 5.077   45.468  21.436  1.00 66.05  ? 165  ASP B CB  1 
ATOM   4863 C  CG  . ASP B 1 166 ? 6.224   46.121  22.192  1.00 66.47  ? 165  ASP B CG  1 
ATOM   4864 O  OD1 . ASP B 1 166 ? 6.727   45.497  23.151  1.00 69.52  ? 165  ASP B OD1 1 
ATOM   4865 O  OD2 . ASP B 1 166 ? 6.629   47.251  21.834  1.00 59.36  ? 165  ASP B OD2 1 
ATOM   4866 N  N   . LEU B 1 167 ? 3.571   42.436  20.351  1.00 58.91  ? 166  LEU B N   1 
ATOM   4867 C  CA  . LEU B 1 167 ? 2.276   41.819  20.040  1.00 49.17  ? 166  LEU B CA  1 
ATOM   4868 C  C   . LEU B 1 167 ? 2.302   40.302  20.123  1.00 47.80  ? 166  LEU B C   1 
ATOM   4869 O  O   . LEU B 1 167 ? 1.588   39.703  20.924  1.00 42.91  ? 166  LEU B O   1 
ATOM   4870 C  CB  . LEU B 1 167 ? 1.860   42.186  18.655  1.00 47.56  ? 166  LEU B CB  1 
ATOM   4871 C  CG  . LEU B 1 167 ? 0.390   42.193  18.354  1.00 47.68  ? 166  LEU B CG  1 
ATOM   4872 C  CD1 . LEU B 1 167 ? -0.361  42.795  19.531  1.00 44.25  ? 166  LEU B CD1 1 
ATOM   4873 C  CD2 . LEU B 1 167 ? 0.151   42.981  17.063  1.00 46.93  ? 166  LEU B CD2 1 
ATOM   4874 N  N   . TYR B 1 168 ? 3.155   39.684  19.312  1.00 46.04  ? 167  TYR B N   1 
ATOM   4875 C  CA  . TYR B 1 168 ? 3.252   38.231  19.283  1.00 45.64  ? 167  TYR B CA  1 
ATOM   4876 C  C   . TYR B 1 168 ? 4.666   37.723  19.538  1.00 41.47  ? 167  TYR B C   1 
ATOM   4877 O  O   . TYR B 1 168 ? 4.887   36.515  19.713  1.00 39.23  ? 167  TYR B O   1 
ATOM   4878 C  CB  . TYR B 1 168 ? 2.752   37.744  17.920  1.00 44.26  ? 167  TYR B CB  1 
ATOM   4879 C  CG  . TYR B 1 168 ? 1.353   38.224  17.652  1.00 46.50  ? 167  TYR B CG  1 
ATOM   4880 C  CD1 . TYR B 1 168 ? 0.356   38.074  18.614  1.00 47.22  ? 167  TYR B CD1 1 
ATOM   4881 C  CD2 . TYR B 1 168 ? 1.004   38.812  16.444  1.00 48.36  ? 167  TYR B CD2 1 
ATOM   4882 C  CE1 . TYR B 1 168 ? -0.936  38.489  18.370  1.00 47.50  ? 167  TYR B CE1 1 
ATOM   4883 C  CE2 . TYR B 1 168 ? -0.290  39.224  16.197  1.00 46.65  ? 167  TYR B CE2 1 
ATOM   4884 C  CZ  . TYR B 1 168 ? -1.247  39.066  17.171  1.00 44.78  ? 167  TYR B CZ  1 
ATOM   4885 O  OH  . TYR B 1 168 ? -2.529  39.472  16.968  1.00 44.45  ? 167  TYR B OH  1 
ATOM   4886 N  N   . MET B 1 169 ? 5.612   38.649  19.541  1.00 41.32  ? 168  MET B N   1 
ATOM   4887 C  CA  . MET B 1 169 ? 7.016   38.311  19.477  1.00 42.11  ? 168  MET B CA  1 
ATOM   4888 C  C   . MET B 1 169 ? 7.465   37.632  20.750  1.00 42.35  ? 168  MET B C   1 
ATOM   4889 O  O   . MET B 1 169 ? 6.961   37.888  21.817  1.00 46.05  ? 168  MET B O   1 
ATOM   4890 C  CB  . MET B 1 169 ? 7.856   39.556  19.246  1.00 41.42  ? 168  MET B CB  1 
ATOM   4891 C  CG  . MET B 1 169 ? 9.322   39.259  19.025  1.00 43.20  ? 168  MET B CG  1 
ATOM   4892 S  SD  . MET B 1 169 ? 10.322  40.719  18.699  0.97 42.92  ? 168  MET B SD  1 
ATOM   4893 C  CE  . MET B 1 169 ? 11.862  40.112  19.347  1.00 50.11  ? 168  MET B CE  1 
ATOM   4894 N  N   . LEU B 1 170 ? 8.422   36.744  20.616  1.00 45.07  ? 169  LEU B N   1 
ATOM   4895 C  CA  . LEU B 1 170 ? 9.007   36.084  21.745  1.00 44.75  ? 169  LEU B CA  1 
ATOM   4896 C  C   . LEU B 1 170 ? 10.487  36.426  21.783  1.00 44.43  ? 169  LEU B C   1 
ATOM   4897 O  O   . LEU B 1 170 ? 11.175  36.451  20.760  1.00 44.67  ? 169  LEU B O   1 
ATOM   4898 C  CB  . LEU B 1 170 ? 8.791   34.565  21.652  1.00 45.28  ? 169  LEU B CB  1 
ATOM   4899 C  CG  . LEU B 1 170 ? 7.448   34.014  22.129  1.00 46.05  ? 169  LEU B CG  1 
ATOM   4900 C  CD1 . LEU B 1 170 ? 7.450   32.488  22.097  1.00 45.22  ? 169  LEU B CD1 1 
ATOM   4901 C  CD2 . LEU B 1 170 ? 7.125   34.509  23.534  1.00 44.62  ? 169  LEU B CD2 1 
ATOM   4902 N  N   . ARG B 1 171 ? 10.968  36.659  22.986  1.00 47.32  ? 170  ARG B N   1 
ATOM   4903 C  CA  . ARG B 1 171 ? 12.354  36.891  23.207  1.00 52.31  ? 170  ARG B CA  1 
ATOM   4904 C  C   . ARG B 1 171 ? 13.155  35.551  23.051  1.00 52.67  ? 170  ARG B C   1 
ATOM   4905 O  O   . ARG B 1 171 ? 12.596  34.453  23.127  1.00 53.72  ? 170  ARG B O   1 
ATOM   4906 C  CB  . ARG B 1 171 ? 12.522  37.470  24.606  1.00 58.87  ? 170  ARG B CB  1 
ATOM   4907 C  CG  . ARG B 1 171 ? 12.139  38.937  24.828  1.00 63.60  ? 170  ARG B CG  1 
ATOM   4908 C  CD  . ARG B 1 171 ? 11.729  39.198  26.300  1.00 79.34  ? 170  ARG B CD  1 
ATOM   4909 N  NE  . ARG B 1 171 ? 12.404  38.302  27.283  1.00 86.16  ? 170  ARG B NE  1 
ATOM   4910 C  CZ  . ARG B 1 171 ? 12.022  38.104  28.554  1.00 80.34  ? 170  ARG B CZ  1 
ATOM   4911 N  NH1 . ARG B 1 171 ? 10.966  38.748  29.063  1.00 78.21  ? 170  ARG B NH1 1 
ATOM   4912 N  NH2 . ARG B 1 171 ? 12.706  37.258  29.322  1.00 70.96  ? 170  ARG B NH2 1 
ATOM   4913 N  N   . ASP B 1 172 ? 14.461  35.643  22.813  1.00 49.68  ? 171  ASP B N   1 
ATOM   4914 C  CA  . ASP B 1 172 ? 15.288  34.440  22.624  1.00 50.06  ? 171  ASP B CA  1 
ATOM   4915 C  C   . ASP B 1 172 ? 15.290  33.547  23.843  1.00 51.65  ? 171  ASP B C   1 
ATOM   4916 O  O   . ASP B 1 172 ? 15.311  32.310  23.710  1.00 50.49  ? 171  ASP B O   1 
ATOM   4917 C  CB  . ASP B 1 172 ? 16.757  34.788  22.321  1.00 50.96  ? 171  ASP B CB  1 
ATOM   4918 C  CG  . ASP B 1 172 ? 16.996  35.158  20.891  1.00 47.29  ? 171  ASP B CG  1 
ATOM   4919 O  OD1 . ASP B 1 172 ? 16.039  35.152  20.095  1.00 51.12  ? 171  ASP B OD1 1 
ATOM   4920 O  OD2 . ASP B 1 172 ? 18.156  35.412  20.547  1.00 43.40  ? 171  ASP B OD2 1 
ATOM   4921 N  N   . SER B 1 173 ? 15.322  34.164  25.029  1.00 51.24  ? 172  SER B N   1 
ATOM   4922 C  CA  . SER B 1 173 ? 15.258  33.399  26.295  1.00 52.11  ? 172  SER B CA  1 
ATOM   4923 C  C   . SER B 1 173 ? 13.961  32.604  26.361  1.00 44.08  ? 172  SER B C   1 
ATOM   4924 O  O   . SER B 1 173 ? 13.930  31.541  26.955  1.00 42.74  ? 172  SER B O   1 
ATOM   4925 C  CB  . SER B 1 173 ? 15.339  34.329  27.516  1.00 55.69  ? 172  SER B CB  1 
ATOM   4926 O  OG  . SER B 1 173 ? 14.229  35.235  27.537  1.00 66.02  ? 172  SER B OG  1 
ATOM   4927 N  N   . GLU B 1 174 ? 12.901  33.158  25.758  1.00 39.84  ? 173  GLU B N   1 
ATOM   4928 C  CA  . GLU B 1 174 ? 11.579  32.576  25.780  1.00 38.54  ? 173  GLU B CA  1 
ATOM   4929 C  C   . GLU B 1 174 ? 11.468  31.454  24.769  1.00 38.63  ? 173  GLU B C   1 
ATOM   4930 O  O   . GLU B 1 174 ? 11.033  30.356  25.107  1.00 38.42  ? 173  GLU B O   1 
ATOM   4931 C  CB  . GLU B 1 174 ? 10.520  33.646  25.550  1.00 40.99  ? 173  GLU B CB  1 
ATOM   4932 C  CG  . GLU B 1 174 ? 10.486  34.687  26.659  1.00 42.72  ? 173  GLU B CG  1 
ATOM   4933 C  CD  . GLU B 1 174 ? 9.409   35.736  26.483  1.00 45.72  ? 173  GLU B CD  1 
ATOM   4934 O  OE1 . GLU B 1 174 ? 9.339   36.338  25.379  1.00 45.89  ? 173  GLU B OE1 1 
ATOM   4935 O  OE2 . GLU B 1 174 ? 8.661   35.959  27.482  1.00 45.38  ? 173  GLU B OE2 1 
ATOM   4936 N  N   . LEU B 1 175 ? 11.878  31.714  23.534  1.00 39.45  ? 174  LEU B N   1 
ATOM   4937 C  CA  . LEU B 1 175 ? 11.953  30.642  22.520  1.00 39.75  ? 174  LEU B CA  1 
ATOM   4938 C  C   . LEU B 1 175 ? 12.702  29.416  23.043  1.00 41.58  ? 174  LEU B C   1 
ATOM   4939 O  O   . LEU B 1 175 ? 12.240  28.304  22.896  1.00 42.26  ? 174  LEU B O   1 
ATOM   4940 C  CB  . LEU B 1 175 ? 12.668  31.124  21.262  1.00 39.39  ? 174  LEU B CB  1 
ATOM   4941 C  CG  . LEU B 1 175 ? 11.884  32.064  20.378  1.00 37.46  ? 174  LEU B CG  1 
ATOM   4942 C  CD1 . LEU B 1 175 ? 12.800  32.632  19.302  1.00 38.26  ? 174  LEU B CD1 1 
ATOM   4943 C  CD2 . LEU B 1 175 ? 10.710  31.311  19.803  1.00 36.70  ? 174  LEU B CD2 1 
ATOM   4944 N  N   . TYR B 1 176 ? 13.854  29.632  23.681  1.00 43.32  ? 175  TYR B N   1 
ATOM   4945 C  CA  . TYR B 1 176 ? 14.633  28.531  24.221  1.00 42.01  ? 175  TYR B CA  1 
ATOM   4946 C  C   . TYR B 1 176 ? 13.781  27.664  25.162  1.00 45.30  ? 175  TYR B C   1 
ATOM   4947 O  O   . TYR B 1 176 ? 13.752  26.436  25.046  1.00 43.99  ? 175  TYR B O   1 
ATOM   4948 C  CB  . TYR B 1 176 ? 15.854  29.045  24.945  1.00 41.88  ? 175  TYR B CB  1 
ATOM   4949 C  CG  . TYR B 1 176 ? 16.736  27.924  25.387  1.00 46.07  ? 175  TYR B CG  1 
ATOM   4950 C  CD1 . TYR B 1 176 ? 17.693  27.380  24.528  1.00 47.61  ? 175  TYR B CD1 1 
ATOM   4951 C  CD2 . TYR B 1 176 ? 16.588  27.360  26.655  1.00 48.77  ? 175  TYR B CD2 1 
ATOM   4952 C  CE1 . TYR B 1 176 ? 18.502  26.311  24.931  1.00 48.31  ? 175  TYR B CE1 1 
ATOM   4953 C  CE2 . TYR B 1 176 ? 17.379  26.290  27.069  1.00 52.74  ? 175  TYR B CE2 1 
ATOM   4954 C  CZ  . TYR B 1 176 ? 18.332  25.764  26.200  1.00 52.17  ? 175  TYR B CZ  1 
ATOM   4955 O  OH  . TYR B 1 176 ? 19.110  24.720  26.653  1.00 50.41  ? 175  TYR B OH  1 
ATOM   4956 N  N   . GLN B 1 177 ? 13.062  28.318  26.069  1.00 51.45  ? 176  GLN B N   1 
ATOM   4957 C  CA  . GLN B 1 177 ? 12.184  27.634  27.021  1.00 55.26  ? 176  GLN B CA  1 
ATOM   4958 C  C   . GLN B 1 177 ? 10.998  26.996  26.300  1.00 50.96  ? 176  GLN B C   1 
ATOM   4959 O  O   . GLN B 1 177 ? 10.580  25.895  26.645  1.00 54.73  ? 176  GLN B O   1 
ATOM   4960 C  CB  . GLN B 1 177 ? 11.663  28.618  28.088  1.00 61.18  ? 176  GLN B CB  1 
ATOM   4961 C  CG  . GLN B 1 177 ? 12.712  29.213  29.029  1.00 65.02  ? 176  GLN B CG  1 
ATOM   4962 C  CD  . GLN B 1 177 ? 13.475  28.135  29.796  1.00 75.20  ? 176  GLN B CD  1 
ATOM   4963 O  OE1 . GLN B 1 177 ? 12.927  27.076  30.144  1.00 72.55  ? 176  GLN B OE1 1 
ATOM   4964 N  NE2 . GLN B 1 177 ? 14.763  28.381  30.023  1.00 76.92  ? 176  GLN B NE2 1 
ATOM   4965 N  N   . VAL B 1 178 ? 10.446  27.706  25.319  1.00 43.85  ? 177  VAL B N   1 
ATOM   4966 C  CA  . VAL B 1 178 ? 9.244   27.249  24.622  1.00 41.86  ? 177  VAL B CA  1 
ATOM   4967 C  C   . VAL B 1 178 ? 9.611   26.003  23.807  1.00 47.55  ? 177  VAL B C   1 
ATOM   4968 O  O   . VAL B 1 178 ? 8.898   24.999  23.821  1.00 47.55  ? 177  VAL B O   1 
ATOM   4969 C  CB  . VAL B 1 178 ? 8.648   28.343  23.699  1.00 38.16  ? 177  VAL B CB  1 
ATOM   4970 C  CG1 . VAL B 1 178 ? 7.571   27.788  22.782  1.00 37.29  ? 177  VAL B CG1 1 
ATOM   4971 C  CG2 . VAL B 1 178 ? 8.051   29.473  24.502  1.00 38.24  ? 177  VAL B CG2 1 
ATOM   4972 N  N   . LEU B 1 179 ? 10.730  26.063  23.093  1.00 48.14  ? 178  LEU B N   1 
ATOM   4973 C  CA  . LEU B 1 179 ? 11.156  24.939  22.287  1.00 47.44  ? 178  LEU B CA  1 
ATOM   4974 C  C   . LEU B 1 179 ? 11.466  23.753  23.187  1.00 45.76  ? 178  LEU B C   1 
ATOM   4975 O  O   . LEU B 1 179 ? 11.117  22.611  22.871  1.00 43.23  ? 178  LEU B O   1 
ATOM   4976 C  CB  . LEU B 1 179 ? 12.351  25.315  21.405  1.00 47.21  ? 178  LEU B CB  1 
ATOM   4977 C  CG  . LEU B 1 179 ? 12.117  26.454  20.383  1.00 45.22  ? 178  LEU B CG  1 
ATOM   4978 C  CD1 . LEU B 1 179 ? 13.231  26.481  19.341  1.00 42.46  ? 178  LEU B CD1 1 
ATOM   4979 C  CD2 . LEU B 1 179 ? 10.766  26.347  19.702  1.00 43.86  ? 178  LEU B CD2 1 
ATOM   4980 N  N   . HIS B 1 180 ? 12.095  24.029  24.324  1.00 49.79  ? 179  HIS B N   1 
ATOM   4981 C  CA  . HIS B 1 180 ? 12.409  22.969  25.279  1.00 53.16  ? 179  HIS B CA  1 
ATOM   4982 C  C   . HIS B 1 180 ? 11.104  22.321  25.722  1.00 48.28  ? 179  HIS B C   1 
ATOM   4983 O  O   . HIS B 1 180 ? 10.992  21.093  25.828  1.00 46.49  ? 179  HIS B O   1 
ATOM   4984 C  CB  . HIS B 1 180 ? 13.177  23.508  26.486  1.00 54.46  ? 179  HIS B CB  1 
ATOM   4985 C  CG  . HIS B 1 180 ? 13.594  22.445  27.457  1.00 64.49  ? 179  HIS B CG  1 
ATOM   4986 N  ND1 . HIS B 1 180 ? 14.765  21.725  27.331  1.00 70.41  ? 179  HIS B ND1 1 
ATOM   4987 C  CD2 . HIS B 1 180 ? 12.982  21.971  28.567  1.00 73.10  ? 179  HIS B CD2 1 
ATOM   4988 C  CE1 . HIS B 1 180 ? 14.855  20.851  28.320  1.00 72.94  ? 179  HIS B CE1 1 
ATOM   4989 N  NE2 . HIS B 1 180 ? 13.789  20.984  29.089  1.00 80.69  ? 179  HIS B NE2 1 
ATOM   4990 N  N   . ALA B 1 181 ? 10.117  23.171  25.941  1.00 42.51  ? 180  ALA B N   1 
ATOM   4991 C  CA  . ALA B 1 181 ? 8.819   22.744  26.356  1.00 39.37  ? 180  ALA B CA  1 
ATOM   4992 C  C   . ALA B 1 181 ? 8.153   21.880  25.308  1.00 39.29  ? 180  ALA B C   1 
ATOM   4993 O  O   . ALA B 1 181 ? 7.598   20.837  25.647  1.00 42.54  ? 180  ALA B O   1 
ATOM   4994 C  CB  . ALA B 1 181 ? 7.960   23.951  26.651  1.00 42.17  ? 180  ALA B CB  1 
ATOM   4995 N  N   . CYS B 1 182 ? 8.196   22.312  24.052  1.00 37.35  ? 181  CYS B N   1 
ATOM   4996 C  CA  . CYS B 1 182 ? 7.646   21.528  22.926  1.00 37.99  ? 181  CYS B CA  1 
ATOM   4997 C  C   . CYS B 1 182 ? 8.256   20.140  22.805  1.00 36.51  ? 181  CYS B C   1 
ATOM   4998 O  O   . CYS B 1 182 ? 7.557   19.160  22.618  1.00 39.05  ? 181  CYS B O   1 
ATOM   4999 C  CB  . CYS B 1 182 ? 7.892   22.234  21.587  1.00 40.01  ? 181  CYS B CB  1 
ATOM   5000 S  SG  . CYS B 1 182 ? 6.824   23.637  21.191  0.99 38.44  ? 181  CYS B SG  1 
ATOM   5001 N  N   . LYS B 1 183 ? 9.566   20.071  22.891  1.00 38.19  ? 182  LYS B N   1 
ATOM   5002 C  CA  . LYS B 1 183 ? 10.286  18.820  22.734  1.00 44.83  ? 182  LYS B CA  1 
ATOM   5003 C  C   . LYS B 1 183 ? 9.914   17.830  23.823  1.00 41.64  ? 182  LYS B C   1 
ATOM   5004 O  O   . LYS B 1 183 ? 9.834   16.630  23.567  1.00 37.67  ? 182  LYS B O   1 
ATOM   5005 C  CB  . LYS B 1 183 ? 11.810  19.092  22.725  1.00 54.33  ? 182  LYS B CB  1 
ATOM   5006 C  CG  . LYS B 1 183 ? 12.751  17.957  23.176  1.00 62.06  ? 182  LYS B CG  1 
ATOM   5007 C  CD  . LYS B 1 183 ? 13.858  18.462  24.124  1.00 68.62  ? 182  LYS B CD  1 
ATOM   5008 C  CE  . LYS B 1 183 ? 14.033  17.645  25.430  1.00 68.29  ? 182  LYS B CE  1 
ATOM   5009 N  NZ  . LYS B 1 183 ? 13.922  16.144  25.493  1.00 63.93  ? 182  LYS B NZ  1 
ATOM   5010 N  N   . ASP B 1 184 ? 9.727   18.339  25.035  1.00 42.53  ? 183  ASP B N   1 
ATOM   5011 C  CA  . ASP B 1 184 ? 9.394   17.493  26.173  1.00 43.94  ? 183  ASP B CA  1 
ATOM   5012 C  C   . ASP B 1 184 ? 8.037   16.846  25.999  1.00 40.96  ? 183  ASP B C   1 
ATOM   5013 O  O   . ASP B 1 184 ? 7.860   15.697  26.389  1.00 39.89  ? 183  ASP B O   1 
ATOM   5014 C  CB  . ASP B 1 184 ? 9.420   18.288  27.499  1.00 48.30  ? 183  ASP B CB  1 
ATOM   5015 C  CG  . ASP B 1 184 ? 10.814  18.406  28.108  1.00 51.81  ? 183  ASP B CG  1 
ATOM   5016 O  OD1 . ASP B 1 184 ? 11.736  17.727  27.606  1.00 58.00  ? 183  ASP B OD1 1 
ATOM   5017 O  OD2 . ASP B 1 184 ? 11.005  19.156  29.106  1.00 57.72  ? 183  ASP B OD2 1 
ATOM   5018 N  N   . ILE B 1 185 ? 7.081   17.584  25.441  1.00 39.41  ? 184  ILE B N   1 
ATOM   5019 C  CA  . ILE B 1 185 ? 5.715   17.066  25.259  1.00 42.15  ? 184  ILE B CA  1 
ATOM   5020 C  C   . ILE B 1 185 ? 5.450   16.462  23.871  1.00 42.37  ? 184  ILE B C   1 
ATOM   5021 O  O   . ILE B 1 185 ? 4.350   15.990  23.575  1.00 41.76  ? 184  ILE B O   1 
ATOM   5022 C  CB  . ILE B 1 185 ? 4.641   18.132  25.560  1.00 42.35  ? 184  ILE B CB  1 
ATOM   5023 C  CG1 . ILE B 1 185 ? 4.730   19.310  24.615  1.00 42.02  ? 184  ILE B CG1 1 
ATOM   5024 C  CG2 . ILE B 1 185 ? 4.758   18.612  26.992  1.00 44.36  ? 184  ILE B CG2 1 
ATOM   5025 C  CD1 . ILE B 1 185 ? 3.850   20.469  25.020  1.00 43.55  ? 184  ILE B CD1 1 
ATOM   5026 N  N   . GLY B 1 186 ? 6.462   16.491  23.021  1.00 45.13  ? 185  GLY B N   1 
ATOM   5027 C  CA  . GLY B 1 186 ? 6.398   15.846  21.713  1.00 45.72  ? 185  GLY B CA  1 
ATOM   5028 C  C   . GLY B 1 186 ? 5.727   16.669  20.617  1.00 44.92  ? 185  GLY B C   1 
ATOM   5029 O  O   . GLY B 1 186 ? 5.173   16.108  19.670  1.00 49.05  ? 185  GLY B O   1 
ATOM   5030 N  N   . ALA B 1 187 ? 5.811   17.988  20.710  1.00 41.19  ? 186  ALA B N   1 
ATOM   5031 C  CA  . ALA B 1 187 ? 5.142   18.851  19.750  1.00 41.29  ? 186  ALA B CA  1 
ATOM   5032 C  C   . ALA B 1 187 ? 6.073   19.302  18.625  1.00 39.18  ? 186  ALA B C   1 
ATOM   5033 O  O   . ALA B 1 187 ? 7.272   19.015  18.621  1.00 34.99  ? 186  ALA B O   1 
ATOM   5034 C  CB  . ALA B 1 187 ? 4.577   20.072  20.463  1.00 44.21  ? 186  ALA B CB  1 
ATOM   5035 N  N   . ILE B 1 188 ? 5.485   19.994  17.653  1.00 37.05  ? 187  ILE B N   1 
ATOM   5036 C  CA  . ILE B 1 188 ? 6.225   20.583  16.559  1.00 35.58  ? 187  ILE B CA  1 
ATOM   5037 C  C   . ILE B 1 188 ? 6.228   22.102  16.727  1.00 35.75  ? 187  ILE B C   1 
ATOM   5038 O  O   . ILE B 1 188 ? 5.188   22.742  16.862  1.00 38.09  ? 187  ILE B O   1 
ATOM   5039 C  CB  . ILE B 1 188 ? 5.636   20.175  15.204  1.00 34.55  ? 187  ILE B CB  1 
ATOM   5040 C  CG1 . ILE B 1 188 ? 5.885   18.699  14.946  1.00 35.24  ? 187  ILE B CG1 1 
ATOM   5041 C  CG2 . ILE B 1 188 ? 6.252   20.987  14.075  1.00 35.26  ? 187  ILE B CG2 1 
ATOM   5042 C  CD1 . ILE B 1 188 ? 7.356   18.344  14.739  1.00 37.98  ? 187  ILE B CD1 1 
ATOM   5043 N  N   . ALA B 1 189 ? 7.412   22.682  16.696  1.00 34.73  ? 188  ALA B N   1 
ATOM   5044 C  CA  . ALA B 1 189 ? 7.544   24.095  16.883  1.00 33.21  ? 188  ALA B CA  1 
ATOM   5045 C  C   . ALA B 1 189 ? 7.543   24.806  15.521  1.00 33.42  ? 188  ALA B C   1 
ATOM   5046 O  O   . ALA B 1 189 ? 8.534   24.806  14.802  1.00 34.54  ? 188  ALA B O   1 
ATOM   5047 C  CB  . ALA B 1 189 ? 8.821   24.391  17.655  1.00 33.44  ? 188  ALA B CB  1 
ATOM   5048 N  N   . ARG B 1 190 ? 6.419   25.415  15.179  1.00 33.43  ? 189  ARG B N   1 
ATOM   5049 C  CA  . ARG B 1 190 ? 6.337   26.249  13.994  1.00 32.99  ? 189  ARG B CA  1 
ATOM   5050 C  C   . ARG B 1 190 ? 6.788   27.669  14.295  1.00 35.08  ? 189  ARG B C   1 
ATOM   5051 O  O   . ARG B 1 190 ? 6.162   28.392  15.089  1.00 32.52  ? 189  ARG B O   1 
ATOM   5052 C  CB  . ARG B 1 190 ? 4.909   26.345  13.500  1.00 33.43  ? 189  ARG B CB  1 
ATOM   5053 C  CG  . ARG B 1 190 ? 4.365   25.082  12.911  1.00 33.87  ? 189  ARG B CG  1 
ATOM   5054 C  CD  . ARG B 1 190 ? 2.873   25.212  12.681  1.00 35.41  ? 189  ARG B CD  1 
ATOM   5055 N  NE  . ARG B 1 190 ? 2.586   26.273  11.734  1.00 35.45  ? 189  ARG B NE  1 
ATOM   5056 C  CZ  . ARG B 1 190 ? 2.451   26.103  10.422  1.00 36.20  ? 189  ARG B CZ  1 
ATOM   5057 N  NH1 . ARG B 1 190 ? 2.580   24.898  9.869   1.00 36.36  ? 189  ARG B NH1 1 
ATOM   5058 N  NH2 . ARG B 1 190 ? 2.177   27.155  9.653   1.00 37.24  ? 189  ARG B NH2 1 
ATOM   5059 N  N   . VAL B 1 191 ? 7.848   28.106  13.630  1.00 38.91  ? 190  VAL B N   1 
ATOM   5060 C  CA  . VAL B 1 191 ? 8.287   29.479  13.831  1.00 38.59  ? 190  VAL B CA  1 
ATOM   5061 C  C   . VAL B 1 191 ? 8.310   30.302  12.592  1.00 35.42  ? 190  VAL B C   1 
ATOM   5062 O  O   . VAL B 1 191 ? 8.782   29.890  11.530  1.00 33.42  ? 190  VAL B O   1 
ATOM   5063 C  CB  . VAL B 1 191 ? 9.666   29.569  14.434  1.00 43.39  ? 190  VAL B CB  1 
ATOM   5064 C  CG1 . VAL B 1 191 ? 9.980   31.022  14.753  1.00 44.54  ? 190  VAL B CG1 1 
ATOM   5065 C  CG2 . VAL B 1 191 ? 9.703   28.734  15.709  1.00 48.10  ? 190  VAL B CG2 1 
ATOM   5066 N  N   . HIS B 1 192 ? 7.773   31.494  12.770  1.00 35.23  ? 191  HIS B N   1 
ATOM   5067 C  CA  . HIS B 1 192 ? 7.758   32.492  11.750  1.00 34.62  ? 191  HIS B CA  1 
ATOM   5068 C  C   . HIS B 1 192 ? 8.975   33.379  11.976  1.00 35.06  ? 191  HIS B C   1 
ATOM   5069 O  O   . HIS B 1 192 ? 8.982   34.210  12.870  1.00 33.92  ? 191  HIS B O   1 
ATOM   5070 C  CB  . HIS B 1 192 ? 6.484   33.315  11.847  1.00 33.56  ? 191  HIS B CB  1 
ATOM   5071 C  CG  . HIS B 1 192 ? 6.428   34.412  10.847  1.00 33.57  ? 191  HIS B CG  1 
ATOM   5072 N  ND1 . HIS B 1 192 ? 7.433   35.339  10.714  1.00 33.02  ? 191  HIS B ND1 1 
ATOM   5073 C  CD2 . HIS B 1 192 ? 5.516   34.702  9.897   1.00 33.35  ? 191  HIS B CD2 1 
ATOM   5074 C  CE1 . HIS B 1 192 ? 7.139   36.158  9.726   1.00 33.66  ? 191  HIS B CE1 1 
ATOM   5075 N  NE2 . HIS B 1 192 ? 5.982   35.795  9.216   1.00 33.41  ? 191  HIS B NE2 1 
ATOM   5076 N  N   . ALA B 1 193 ? 9.975   33.213  11.122  1.00 36.13  ? 192  ALA B N   1 
ATOM   5077 C  CA  . ALA B 1 193 ? 11.296  33.738  11.412  1.00 36.61  ? 192  ALA B CA  1 
ATOM   5078 C  C   . ALA B 1 193 ? 11.673  35.002  10.678  1.00 35.47  ? 192  ALA B C   1 
ATOM   5079 O  O   . ALA B 1 193 ? 12.322  34.950  9.630   1.00 30.41  ? 192  ALA B O   1 
ATOM   5080 C  CB  . ALA B 1 193 ? 12.328  32.691  11.118  1.00 38.46  ? 192  ALA B CB  1 
ATOM   5081 N  N   . GLU B 1 194 ? 11.282  36.129  11.271  1.00 36.17  ? 193  GLU B N   1 
ATOM   5082 C  CA  . GLU B 1 194 ? 11.856  37.434  10.960  1.00 35.31  ? 193  GLU B CA  1 
ATOM   5083 C  C   . GLU B 1 194 ? 12.332  38.088  12.252  1.00 33.46  ? 193  GLU B C   1 
ATOM   5084 O  O   . GLU B 1 194 ? 11.797  37.846  13.301  1.00 33.49  ? 193  GLU B O   1 
ATOM   5085 C  CB  . GLU B 1 194 ? 10.833  38.336  10.271  1.00 36.22  ? 193  GLU B CB  1 
ATOM   5086 C  CG  . GLU B 1 194 ? 10.501  37.915  8.861   1.00 37.31  ? 193  GLU B CG  1 
ATOM   5087 C  CD  . GLU B 1 194 ? 9.627   38.898  8.140   1.00 39.50  ? 193  GLU B CD  1 
ATOM   5088 O  OE1 . GLU B 1 194 ? 8.397   38.818  8.293   1.00 39.65  ? 193  GLU B OE1 1 
ATOM   5089 O  OE2 . GLU B 1 194 ? 10.180  39.749  7.394   1.00 51.40  ? 193  GLU B OE2 1 
ATOM   5090 N  N   . ASN B 1 195 ? 13.389  38.882  12.161  1.00 38.27  ? 194  ASN B N   1 
ATOM   5091 C  CA  . ASN B 1 195 ? 13.975  39.568  13.314  1.00 38.07  ? 194  ASN B CA  1 
ATOM   5092 C  C   . ASN B 1 195 ? 13.063  40.722  13.633  1.00 41.95  ? 194  ASN B C   1 
ATOM   5093 O  O   . ASN B 1 195 ? 12.965  41.676  12.880  1.00 48.46  ? 194  ASN B O   1 
ATOM   5094 C  CB  . ASN B 1 195 ? 15.412  40.020  12.994  1.00 36.77  ? 194  ASN B CB  1 
ATOM   5095 C  CG  . ASN B 1 195 ? 16.066  40.784  14.125  1.00 35.89  ? 194  ASN B CG  1 
ATOM   5096 O  OD1 . ASN B 1 195 ? 15.544  41.783  14.593  1.00 37.07  ? 194  ASN B OD1 1 
ATOM   5097 N  ND2 . ASN B 1 195 ? 17.240  40.342  14.542  1.00 36.34  ? 194  ASN B ND2 1 
ATOM   5098 N  N   . GLY B 1 196 ? 12.383  40.622  14.763  1.00 49.06  ? 195  GLY B N   1 
ATOM   5099 C  CA  . GLY B 1 196 ? 11.330  41.574  15.141  1.00 50.71  ? 195  GLY B CA  1 
ATOM   5100 C  C   . GLY B 1 196 ? 11.787  42.962  15.556  1.00 50.71  ? 195  GLY B C   1 
ATOM   5101 O  O   . GLY B 1 196 ? 11.071  43.935  15.317  1.00 52.42  ? 195  GLY B O   1 
ATOM   5102 N  N   . GLU B 1 197 ? 12.959  43.047  16.184  1.00 49.28  ? 196  GLU B N   1 
ATOM   5103 C  CA  . GLU B 1 197 ? 13.558  44.335  16.520  1.00 49.74  ? 196  GLU B CA  1 
ATOM   5104 C  C   . GLU B 1 197 ? 13.876  45.111  15.253  1.00 48.37  ? 196  GLU B C   1 
ATOM   5105 O  O   . GLU B 1 197 ? 13.534  46.299  15.149  1.00 41.80  ? 196  GLU B O   1 
ATOM   5106 C  CB  . GLU B 1 197 ? 14.826  44.169  17.343  1.00 52.56  ? 196  GLU B CB  1 
ATOM   5107 C  CG  . GLU B 1 197 ? 14.566  43.563  18.720  1.00 62.01  ? 196  GLU B CG  1 
ATOM   5108 C  CD  . GLU B 1 197 ? 13.727  44.450  19.623  1.00 61.79  ? 196  GLU B CD  1 
ATOM   5109 O  OE1 . GLU B 1 197 ? 13.741  45.672  19.396  1.00 66.53  ? 196  GLU B OE1 1 
ATOM   5110 O  OE2 . GLU B 1 197 ? 13.074  43.929  20.563  1.00 62.13  ? 196  GLU B OE2 1 
ATOM   5111 N  N   . LEU B 1 198 ? 14.516  44.442  14.289  1.00 45.62  ? 197  LEU B N   1 
ATOM   5112 C  CA  . LEU B 1 198 ? 14.872  45.088  13.018  1.00 46.17  ? 197  LEU B CA  1 
ATOM   5113 C  C   . LEU B 1 198 ? 13.644  45.350  12.159  1.00 44.04  ? 197  LEU B C   1 
ATOM   5114 O  O   . LEU B 1 198 ? 13.604  46.331  11.415  1.00 44.29  ? 197  LEU B O   1 
ATOM   5115 C  CB  . LEU B 1 198 ? 15.922  44.273  12.237  1.00 49.55  ? 197  LEU B CB  1 
ATOM   5116 C  CG  . LEU B 1 198 ? 17.328  44.078  12.856  1.00 48.76  ? 197  LEU B CG  1 
ATOM   5117 C  CD1 . LEU B 1 198 ? 18.222  43.286  11.913  1.00 47.53  ? 197  LEU B CD1 1 
ATOM   5118 C  CD2 . LEU B 1 198 ? 17.957  45.404  13.219  1.00 47.74  ? 197  LEU B CD2 1 
ATOM   5119 N  N   . VAL B 1 199 ? 12.633  44.500  12.262  1.00 40.44  ? 198  VAL B N   1 
ATOM   5120 C  CA  . VAL B 1 199 ? 11.392  44.787  11.557  1.00 41.56  ? 198  VAL B CA  1 
ATOM   5121 C  C   . VAL B 1 199 ? 10.743  46.073  12.109  1.00 39.81  ? 198  VAL B C   1 
ATOM   5122 O  O   . VAL B 1 199 ? 10.340  46.934  11.330  1.00 36.17  ? 198  VAL B O   1 
ATOM   5123 C  CB  . VAL B 1 199 ? 10.408  43.589  11.592  1.00 41.90  ? 198  VAL B CB  1 
ATOM   5124 C  CG1 . VAL B 1 199 ? 9.033   43.999  11.083  1.00 42.86  ? 198  VAL B CG1 1 
ATOM   5125 C  CG2 . VAL B 1 199 ? 10.925  42.459  10.732  1.00 42.62  ? 198  VAL B CG2 1 
ATOM   5126 N  N   . ALA B 1 200 ? 10.662  46.189  13.443  1.00 40.05  ? 199  ALA B N   1 
ATOM   5127 C  CA  . ALA B 1 200 ? 10.107  47.393  14.123  1.00 41.90  ? 199  ALA B CA  1 
ATOM   5128 C  C   . ALA B 1 200 ? 10.816  48.680  13.716  1.00 44.64  ? 199  ALA B C   1 
ATOM   5129 O  O   . ALA B 1 200 ? 10.184  49.655  13.280  1.00 42.35  ? 199  ALA B O   1 
ATOM   5130 C  CB  . ALA B 1 200 ? 10.181  47.246  15.633  1.00 40.83  ? 199  ALA B CB  1 
ATOM   5131 N  N   . GLU B 1 201 ? 12.147  48.638  13.819  1.00 49.87  ? 200  GLU B N   1 
ATOM   5132 C  CA  . GLU B 1 201 ? 13.010  49.769  13.454  1.00 48.56  ? 200  GLU B CA  1 
ATOM   5133 C  C   . GLU B 1 201 ? 12.826  50.122  12.005  1.00 43.38  ? 200  GLU B C   1 
ATOM   5134 O  O   . GLU B 1 201 ? 12.644  51.271  11.691  1.00 43.17  ? 200  GLU B O   1 
ATOM   5135 C  CB  . GLU B 1 201 ? 14.491  49.450  13.688  1.00 51.05  ? 200  GLU B CB  1 
ATOM   5136 C  CG  . GLU B 1 201 ? 14.910  49.273  15.138  1.00 55.71  ? 200  GLU B CG  1 
ATOM   5137 C  CD  . GLU B 1 201 ? 14.675  50.509  15.993  1.00 60.48  ? 200  GLU B CD  1 
ATOM   5138 O  OE1 . GLU B 1 201 ? 14.429  51.616  15.416  1.00 61.36  ? 200  GLU B OE1 1 
ATOM   5139 O  OE2 . GLU B 1 201 ? 14.725  50.343  17.245  1.00 56.62  ? 200  GLU B OE2 1 
ATOM   5140 N  N   . GLY B 1 202 ? 12.870  49.118  11.139  1.00 42.66  ? 201  GLY B N   1 
ATOM   5141 C  CA  . GLY B 1 202 ? 12.828  49.316  9.690   1.00 46.67  ? 201  GLY B CA  1 
ATOM   5142 C  C   . GLY B 1 202 ? 11.501  49.811  9.183   1.00 49.07  ? 201  GLY B C   1 
ATOM   5143 O  O   . GLY B 1 202 ? 11.424  50.450  8.144   1.00 44.74  ? 201  GLY B O   1 
ATOM   5144 N  N   . ALA B 1 203 ? 10.447  49.519  9.937   1.00 60.56  ? 202  ALA B N   1 
ATOM   5145 C  CA  . ALA B 1 203 ? 9.112   50.038  9.633   1.00 62.22  ? 202  ALA B CA  1 
ATOM   5146 C  C   . ALA B 1 203 ? 9.050   51.537  9.899   1.00 64.07  ? 202  ALA B C   1 
ATOM   5147 O  O   . ALA B 1 203 ? 8.610   52.296  9.041   1.00 60.21  ? 202  ALA B O   1 
ATOM   5148 C  CB  . ALA B 1 203 ? 8.063   49.303  10.459  1.00 61.97  ? 202  ALA B CB  1 
ATOM   5149 N  N   . LYS B 1 204 ? 9.491   51.939  11.101  1.00 70.60  ? 203  LYS B N   1 
ATOM   5150 C  CA  . LYS B 1 204 ? 9.521   53.350  11.538  1.00 69.28  ? 203  LYS B CA  1 
ATOM   5151 C  C   . LYS B 1 204 ? 10.477  54.189  10.693  1.00 61.04  ? 203  LYS B C   1 
ATOM   5152 O  O   . LYS B 1 204 ? 10.198  55.335  10.342  1.00 60.34  ? 203  LYS B O   1 
ATOM   5153 C  CB  . LYS B 1 204 ? 9.910   53.444  13.030  1.00 70.76  ? 203  LYS B CB  1 
ATOM   5154 C  CG  . LYS B 1 204 ? 10.045  54.893  13.514  1.00 86.66  ? 203  LYS B CG  1 
ATOM   5155 C  CD  . LYS B 1 204 ? 10.143  55.110  15.032  1.00 91.92  ? 203  LYS B CD  1 
ATOM   5156 C  CE  . LYS B 1 204 ? 10.393  56.581  15.390  1.00 89.56  ? 203  LYS B CE  1 
ATOM   5157 N  NZ  . LYS B 1 204 ? 11.817  56.988  15.220  1.00 89.19  ? 203  LYS B NZ  1 
ATOM   5158 N  N   . GLU B 1 205 ? 11.611  53.597  10.395  1.00 59.71  ? 204  GLU B N   1 
ATOM   5159 C  CA  . GLU B 1 205 ? 12.599  54.192  9.530   1.00 63.36  ? 204  GLU B CA  1 
ATOM   5160 C  C   . GLU B 1 205 ? 12.039  54.463  8.133   1.00 59.66  ? 204  GLU B C   1 
ATOM   5161 O  O   . GLU B 1 205 ? 12.372  55.469  7.512   1.00 62.58  ? 204  GLU B O   1 
ATOM   5162 C  CB  . GLU B 1 205 ? 13.789  53.251  9.467   1.00 65.61  ? 204  GLU B CB  1 
ATOM   5163 C  CG  . GLU B 1 205 ? 14.790  53.545  8.386   1.00 72.36  ? 204  GLU B CG  1 
ATOM   5164 C  CD  . GLU B 1 205 ? 16.013  52.673  8.547   1.00 76.10  ? 204  GLU B CD  1 
ATOM   5165 O  OE1 . GLU B 1 205 ? 16.627  52.714  9.639   1.00 77.25  ? 204  GLU B OE1 1 
ATOM   5166 O  OE2 . GLU B 1 205 ? 16.342  51.937  7.592   1.00 84.81  ? 204  GLU B OE2 1 
ATOM   5167 N  N   . ALA B 1 206 ? 11.195  53.569  7.646   1.00 52.94  ? 205  ALA B N   1 
ATOM   5168 C  CA  . ALA B 1 206 ? 10.587  53.744  6.330   1.00 54.72  ? 205  ALA B CA  1 
ATOM   5169 C  C   . ALA B 1 206 ? 9.456   54.792  6.322   1.00 52.61  ? 205  ALA B C   1 
ATOM   5170 O  O   . ALA B 1 206 ? 9.336   55.584  5.394   1.00 48.84  ? 205  ALA B O   1 
ATOM   5171 C  CB  . ALA B 1 206 ? 10.081  52.403  5.812   1.00 55.32  ? 205  ALA B CB  1 
ATOM   5172 N  N   . LEU B 1 207 ? 8.614   54.768  7.344   1.00 54.71  ? 206  LEU B N   1 
ATOM   5173 C  CA  . LEU B 1 207 ? 7.578   55.784  7.500   1.00 57.26  ? 206  LEU B CA  1 
ATOM   5174 C  C   . LEU B 1 207 ? 8.197   57.173  7.629   1.00 61.14  ? 206  LEU B C   1 
ATOM   5175 O  O   . LEU B 1 207 ? 7.692   58.132  7.032   1.00 59.43  ? 206  LEU B O   1 
ATOM   5176 C  CB  . LEU B 1 207 ? 6.717   55.486  8.732   1.00 54.75  ? 206  LEU B CB  1 
ATOM   5177 C  CG  . LEU B 1 207 ? 5.782   54.295  8.599   1.00 57.30  ? 206  LEU B CG  1 
ATOM   5178 C  CD1 . LEU B 1 207 ? 5.137   53.952  9.950   1.00 54.74  ? 206  LEU B CD1 1 
ATOM   5179 C  CD2 . LEU B 1 207 ? 4.732   54.557  7.514   1.00 56.68  ? 206  LEU B CD2 1 
ATOM   5180 N  N   . ASP B 1 208 ? 9.275   57.263  8.423   1.00 64.28  ? 207  ASP B N   1 
ATOM   5181 C  CA  . ASP B 1 208 ? 10.037  58.512  8.635   1.00 62.08  ? 207  ASP B CA  1 
ATOM   5182 C  C   . ASP B 1 208 ? 10.743  58.989  7.378   1.00 62.17  ? 207  ASP B C   1 
ATOM   5183 O  O   . ASP B 1 208 ? 10.967  60.177  7.224   1.00 62.19  ? 207  ASP B O   1 
ATOM   5184 C  CB  . ASP B 1 208 ? 11.066  58.364  9.766   1.00 61.36  ? 207  ASP B CB  1 
ATOM   5185 C  CG  . ASP B 1 208 ? 10.444  58.528  11.155  1.00 61.73  ? 207  ASP B CG  1 
ATOM   5186 O  OD1 . ASP B 1 208 ? 9.226   58.803  11.231  1.00 59.58  ? 207  ASP B OD1 1 
ATOM   5187 O  OD2 . ASP B 1 208 ? 11.171  58.379  12.173  1.00 57.03  ? 207  ASP B OD2 1 
ATOM   5188 N  N   . LEU B 1 209 ? 11.100  58.063  6.495   1.00 62.88  ? 208  LEU B N   1 
ATOM   5189 C  CA  . LEU B 1 209 ? 11.611  58.417  5.159   1.00 66.46  ? 208  LEU B CA  1 
ATOM   5190 C  C   . LEU B 1 209 ? 10.491  58.809  4.162   1.00 66.30  ? 208  LEU B C   1 
ATOM   5191 O  O   . LEU B 1 209 ? 10.763  59.027  2.981   1.00 58.12  ? 208  LEU B O   1 
ATOM   5192 C  CB  . LEU B 1 209 ? 12.473  57.270  4.582   1.00 74.08  ? 208  LEU B CB  1 
ATOM   5193 C  CG  . LEU B 1 209 ? 13.992  57.419  4.753   1.00 75.02  ? 208  LEU B CG  1 
ATOM   5194 C  CD1 . LEU B 1 209 ? 14.390  57.546  6.234   1.00 80.64  ? 208  LEU B CD1 1 
ATOM   5195 C  CD2 . LEU B 1 209 ? 14.723  56.264  4.073   1.00 69.08  ? 208  LEU B CD2 1 
ATOM   5196 N  N   . GLY B 1 210 ? 9.245   58.887  4.640   1.00 67.59  ? 209  GLY B N   1 
ATOM   5197 C  CA  . GLY B 1 210 ? 8.096   59.244  3.806   1.00 60.77  ? 209  GLY B CA  1 
ATOM   5198 C  C   . GLY B 1 210 ? 7.619   58.120  2.906   1.00 61.58  ? 209  GLY B C   1 
ATOM   5199 O  O   . GLY B 1 210 ? 6.952   58.373  1.912   1.00 60.02  ? 209  GLY B O   1 
ATOM   5200 N  N   . ILE B 1 211 ? 7.965   56.875  3.243   1.00 67.45  ? 210  ILE B N   1 
ATOM   5201 C  CA  . ILE B 1 211 ? 7.486   55.688  2.509   1.00 68.59  ? 210  ILE B CA  1 
ATOM   5202 C  C   . ILE B 1 211 ? 6.265   55.122  3.219   1.00 60.69  ? 210  ILE B C   1 
ATOM   5203 O  O   . ILE B 1 211 ? 6.371   54.657  4.360   1.00 60.72  ? 210  ILE B O   1 
ATOM   5204 C  CB  . ILE B 1 211 ? 8.575   54.590  2.408   1.00 74.26  ? 210  ILE B CB  1 
ATOM   5205 C  CG1 . ILE B 1 211 ? 9.841   55.165  1.740   1.00 81.73  ? 210  ILE B CG1 1 
ATOM   5206 C  CG2 . ILE B 1 211 ? 8.042   53.365  1.663   1.00 72.35  ? 210  ILE B CG2 1 
ATOM   5207 C  CD1 . ILE B 1 211 ? 10.918  54.151  1.393   1.00 83.42  ? 210  ILE B CD1 1 
ATOM   5208 N  N   . THR B 1 212 ? 5.111   55.187  2.550   1.00 58.85  ? 211  THR B N   1 
ATOM   5209 C  CA  . THR B 1 212 ? 3.817   54.817  3.171   1.00 56.19  ? 211  THR B CA  1 
ATOM   5210 C  C   . THR B 1 212 ? 2.925   53.872  2.345   1.00 56.42  ? 211  THR B C   1 
ATOM   5211 O  O   . THR B 1 212 ? 1.969   53.285  2.889   1.00 54.71  ? 211  THR B O   1 
ATOM   5212 C  CB  . THR B 1 212 ? 2.989   56.069  3.543   1.00 54.77  ? 211  THR B CB  1 
ATOM   5213 O  OG1 . THR B 1 212 ? 2.850   56.940  2.410   1.00 47.47  ? 211  THR B OG1 1 
ATOM   5214 C  CG2 . THR B 1 212 ? 3.642   56.834  4.690   1.00 59.31  ? 211  THR B CG2 1 
ATOM   5215 N  N   . GLY B 1 213 ? 3.216   53.733  1.049   1.00 53.29  ? 212  GLY B N   1 
ATOM   5216 C  CA  . GLY B 1 213 ? 2.509   52.766  0.212   1.00 53.25  ? 212  GLY B CA  1 
ATOM   5217 C  C   . GLY B 1 213 ? 2.838   51.324  0.550   1.00 53.88  ? 212  GLY B C   1 
ATOM   5218 O  O   . GLY B 1 213 ? 3.751   51.044  1.323   1.00 60.65  ? 212  GLY B O   1 
ATOM   5219 N  N   . PRO B 1 214 ? 2.121   50.380  -0.052  1.00 57.33  ? 213  PRO B N   1 
ATOM   5220 C  CA  . PRO B 1 214 ? 2.343   48.944  0.164   1.00 61.98  ? 213  PRO B CA  1 
ATOM   5221 C  C   . PRO B 1 214 ? 3.789   48.454  0.012   1.00 64.80  ? 213  PRO B C   1 
ATOM   5222 O  O   . PRO B 1 214 ? 4.156   47.466  0.658   1.00 64.88  ? 213  PRO B O   1 
ATOM   5223 C  CB  . PRO B 1 214 ? 1.497   48.296  -0.925  1.00 58.51  ? 213  PRO B CB  1 
ATOM   5224 C  CG  . PRO B 1 214 ? 0.408   49.262  -1.140  1.00 61.12  ? 213  PRO B CG  1 
ATOM   5225 C  CD  . PRO B 1 214 ? 1.056   50.612  -1.025  1.00 58.28  ? 213  PRO B CD  1 
ATOM   5226 N  N   . GLU B 1 215 ? 4.587   49.135  -0.822  1.00 59.23  ? 214  GLU B N   1 
ATOM   5227 C  CA  . GLU B 1 215 ? 5.966   48.722  -1.087  1.00 54.81  ? 214  GLU B CA  1 
ATOM   5228 C  C   . GLU B 1 215 ? 6.826   48.759  0.160   1.00 48.43  ? 214  GLU B C   1 
ATOM   5229 O  O   . GLU B 1 215 ? 7.822   48.032  0.255   1.00 49.97  ? 214  GLU B O   1 
ATOM   5230 C  CB  . GLU B 1 215 ? 6.604   49.564  -2.204  1.00 59.08  ? 214  GLU B CB  1 
ATOM   5231 C  CG  . GLU B 1 215 ? 7.141   50.944  -1.802  1.00 63.40  ? 214  GLU B CG  1 
ATOM   5232 C  CD  . GLU B 1 215 ? 6.142   52.088  -1.984  1.00 64.38  ? 214  GLU B CD  1 
ATOM   5233 O  OE1 . GLU B 1 215 ? 4.912   51.834  -2.009  1.00 63.27  ? 214  GLU B OE1 1 
ATOM   5234 O  OE2 . GLU B 1 215 ? 6.596   53.247  -2.111  1.00 59.50  ? 214  GLU B OE2 1 
ATOM   5235 N  N   . GLY B 1 216 ? 6.447   49.624  1.090   1.00 44.78  ? 215  GLY B N   1 
ATOM   5236 C  CA  . GLY B 1 216 ? 7.072   49.700  2.396   1.00 47.55  ? 215  GLY B CA  1 
ATOM   5237 C  C   . GLY B 1 216 ? 7.120   48.379  3.152   1.00 46.89  ? 215  GLY B C   1 
ATOM   5238 O  O   . GLY B 1 216 ? 8.040   48.160  3.941   1.00 43.59  ? 215  GLY B O   1 
ATOM   5239 N  N   . ILE B 1 217 ? 6.154   47.490  2.908   1.00 46.60  ? 216  ILE B N   1 
ATOM   5240 C  CA  . ILE B 1 217 ? 6.169   46.165  3.538   1.00 50.85  ? 216  ILE B CA  1 
ATOM   5241 C  C   . ILE B 1 217 ? 7.456   45.405  3.162   1.00 57.88  ? 216  ILE B C   1 
ATOM   5242 O  O   . ILE B 1 217 ? 7.932   44.573  3.931   1.00 55.50  ? 216  ILE B O   1 
ATOM   5243 C  CB  . ILE B 1 217 ? 4.917   45.286  3.188   1.00 49.35  ? 216  ILE B CB  1 
ATOM   5244 C  CG1 . ILE B 1 217 ? 4.744   44.145  4.209   1.00 45.98  ? 216  ILE B CG1 1 
ATOM   5245 C  CG2 . ILE B 1 217 ? 5.009   44.691  1.780   1.00 45.92  ? 216  ILE B CG2 1 
ATOM   5246 C  CD1 . ILE B 1 217 ? 4.576   44.604  5.641   1.00 44.31  ? 216  ILE B CD1 1 
ATOM   5247 N  N   . GLU B 1 218 ? 7.988   45.697  1.972   1.00 55.36  ? 217  GLU B N   1 
ATOM   5248 C  CA  . GLU B 1 218 ? 9.230   45.112  1.495   1.00 52.83  ? 217  GLU B CA  1 
ATOM   5249 C  C   . GLU B 1 218 ? 10.478  45.872  1.984   1.00 48.59  ? 217  GLU B C   1 
ATOM   5250 O  O   . GLU B 1 218 ? 11.422  45.291  2.520   1.00 43.34  ? 217  GLU B O   1 
ATOM   5251 C  CB  . GLU B 1 218 ? 9.207   45.095  -0.028  1.00 57.67  ? 217  GLU B CB  1 
ATOM   5252 C  CG  . GLU B 1 218 ? 10.055  43.995  -0.645  1.00 64.62  ? 217  GLU B CG  1 
ATOM   5253 C  CD  . GLU B 1 218 ? 9.803   43.874  -2.124  1.00 67.51  ? 217  GLU B CD  1 
ATOM   5254 O  OE1 . GLU B 1 218 ? 9.949   44.907  -2.813  1.00 74.98  ? 217  GLU B OE1 1 
ATOM   5255 O  OE2 . GLU B 1 218 ? 9.454   42.765  -2.586  1.00 66.08  ? 217  GLU B OE2 1 
ATOM   5256 N  N   . ILE B 1 219 ? 10.477  47.179  1.786   1.00 49.25  ? 218  ILE B N   1 
ATOM   5257 C  CA  . ILE B 1 219 ? 11.644  48.011  2.095   1.00 53.22  ? 218  ILE B CA  1 
ATOM   5258 C  C   . ILE B 1 219 ? 12.019  47.948  3.591   1.00 53.35  ? 218  ILE B C   1 
ATOM   5259 O  O   . ILE B 1 219 ? 13.199  47.995  3.957   1.00 56.15  ? 218  ILE B O   1 
ATOM   5260 C  CB  . ILE B 1 219 ? 11.387  49.468  1.662   1.00 55.42  ? 218  ILE B CB  1 
ATOM   5261 C  CG1 . ILE B 1 219 ? 11.133  49.497  0.134   1.00 55.91  ? 218  ILE B CG1 1 
ATOM   5262 C  CG2 . ILE B 1 219 ? 12.558  50.361  2.052   1.00 55.70  ? 218  ILE B CG2 1 
ATOM   5263 C  CD1 . ILE B 1 219 ? 11.092  50.872  -0.494  1.00 57.51  ? 218  ILE B CD1 1 
ATOM   5264 N  N   . SER B 1 220 ? 11.001  47.801  4.433   1.00 50.09  ? 219  SER B N   1 
ATOM   5265 C  CA  . SER B 1 220 ? 11.164  47.743  5.875   1.00 50.07  ? 219  SER B CA  1 
ATOM   5266 C  C   . SER B 1 220 ? 11.741  46.430  6.378   1.00 45.28  ? 219  SER B C   1 
ATOM   5267 O  O   . SER B 1 220 ? 12.241  46.346  7.488   1.00 47.36  ? 219  SER B O   1 
ATOM   5268 C  CB  . SER B 1 220 ? 9.795   47.934  6.537   1.00 52.66  ? 219  SER B CB  1 
ATOM   5269 O  OG  . SER B 1 220 ? 8.922   46.860  6.223   1.00 58.22  ? 219  SER B OG  1 
ATOM   5270 N  N   . ARG B 1 221 ? 11.600  45.383  5.591   1.00 44.20  ? 220  ARG B N   1 
ATOM   5271 C  CA  . ARG B 1 221 ? 11.995  44.061  6.033   1.00 42.33  ? 220  ARG B CA  1 
ATOM   5272 C  C   . ARG B 1 221 ? 12.657  43.298  4.897   1.00 41.60  ? 220  ARG B C   1 
ATOM   5273 O  O   . ARG B 1 221 ? 12.112  42.320  4.396   1.00 43.30  ? 220  ARG B O   1 
ATOM   5274 C  CB  . ARG B 1 221 ? 10.791  43.290  6.605   1.00 41.47  ? 220  ARG B CB  1 
ATOM   5275 C  CG  . ARG B 1 221 ? 9.524   43.395  5.784   1.00 40.81  ? 220  ARG B CG  1 
ATOM   5276 C  CD  . ARG B 1 221 ? 8.337   43.624  6.682   1.00 42.68  ? 220  ARG B CD  1 
ATOM   5277 N  NE  . ARG B 1 221 ? 8.091   42.492  7.574   1.00 43.16  ? 220  ARG B NE  1 
ATOM   5278 C  CZ  . ARG B 1 221 ? 7.272   42.560  8.617   1.00 40.77  ? 220  ARG B CZ  1 
ATOM   5279 N  NH1 . ARG B 1 221 ? 6.646   43.703  8.939   1.00 36.92  ? 220  ARG B NH1 1 
ATOM   5280 N  NH2 . ARG B 1 221 ? 7.100   41.495  9.355   1.00 41.06  ? 220  ARG B NH2 1 
ATOM   5281 N  N   . PRO B 1 222 ? 13.855  43.731  4.490   1.00 42.46  ? 221  PRO B N   1 
ATOM   5282 C  CA  . PRO B 1 222 ? 14.480  42.950  3.436   1.00 39.51  ? 221  PRO B CA  1 
ATOM   5283 C  C   . PRO B 1 222 ? 14.962  41.588  3.906   1.00 38.61  ? 221  PRO B C   1 
ATOM   5284 O  O   . PRO B 1 222 ? 15.192  41.342  5.108   1.00 37.18  ? 221  PRO B O   1 
ATOM   5285 C  CB  . PRO B 1 222 ? 15.650  43.833  3.017   1.00 41.32  ? 221  PRO B CB  1 
ATOM   5286 C  CG  . PRO B 1 222 ? 16.019  44.559  4.265   1.00 40.87  ? 221  PRO B CG  1 
ATOM   5287 C  CD  . PRO B 1 222 ? 14.692  44.884  4.888   1.00 42.70  ? 221  PRO B CD  1 
ATOM   5288 N  N   . GLU B 1 223 ? 15.143  40.706  2.935   1.00 39.16  ? 222  GLU B N   1 
ATOM   5289 C  CA  . GLU B 1 223 ? 15.313  39.292  3.217   1.00 37.95  ? 222  GLU B CA  1 
ATOM   5290 C  C   . GLU B 1 223 ? 16.420  38.955  4.219   1.00 39.11  ? 222  GLU B C   1 
ATOM   5291 O  O   . GLU B 1 223 ? 16.390  37.883  4.816   1.00 45.33  ? 222  GLU B O   1 
ATOM   5292 C  CB  . GLU B 1 223 ? 15.460  38.498  1.915   1.00 38.24  ? 222  GLU B CB  1 
ATOM   5293 C  CG  . GLU B 1 223 ? 16.826  38.564  1.214   1.00 38.75  ? 222  GLU B CG  1 
ATOM   5294 C  CD  . GLU B 1 223 ? 16.843  37.692  -0.038  1.00 37.66  ? 222  GLU B CD  1 
ATOM   5295 O  OE1 . GLU B 1 223 ? 16.202  38.083  -1.039  1.00 37.84  ? 222  GLU B OE1 1 
ATOM   5296 O  OE2 . GLU B 1 223 ? 17.413  36.583  -0.008  1.00 35.20  ? 222  GLU B OE2 1 
ATOM   5297 N  N   . GLU B 1 224 ? 17.411  39.831  4.397   1.00 44.39  ? 223  GLU B N   1 
ATOM   5298 C  CA  . GLU B 1 224 ? 18.507  39.555  5.374   1.00 44.61  ? 223  GLU B CA  1 
ATOM   5299 C  C   . GLU B 1 224 ? 17.937  39.343  6.796   1.00 42.80  ? 223  GLU B C   1 
ATOM   5300 O  O   . GLU B 1 224 ? 18.437  38.525  7.554   1.00 36.69  ? 223  GLU B O   1 
ATOM   5301 C  CB  . GLU B 1 224 ? 19.641  40.612  5.336   1.00 45.30  ? 223  GLU B CB  1 
ATOM   5302 C  CG  . GLU B 1 224 ? 19.204  42.069  5.199   1.00 48.41  ? 223  GLU B CG  1 
ATOM   5303 C  CD  . GLU B 1 224 ? 20.246  43.088  5.715   1.00 51.54  ? 223  GLU B CD  1 
ATOM   5304 O  OE1 . GLU B 1 224 ? 21.243  42.697  6.400   1.00 47.29  ? 223  GLU B OE1 1 
ATOM   5305 O  OE2 . GLU B 1 224 ? 20.035  44.308  5.447   1.00 54.59  ? 223  GLU B OE2 1 
ATOM   5306 N  N   . LEU B 1 225 ? 16.838  40.051  7.094   1.00 44.41  ? 224  LEU B N   1 
ATOM   5307 C  CA  . LEU B 1 225 ? 16.111  39.941  8.379   1.00 39.50  ? 224  LEU B CA  1 
ATOM   5308 C  C   . LEU B 1 225 ? 15.469  38.579  8.572   1.00 36.70  ? 224  LEU B C   1 
ATOM   5309 O  O   . LEU B 1 225 ? 15.396  38.104  9.684   1.00 29.26  ? 224  LEU B O   1 
ATOM   5310 C  CB  . LEU B 1 225 ? 15.047  41.020  8.495   1.00 40.33  ? 224  LEU B CB  1 
ATOM   5311 C  CG  . LEU B 1 225 ? 15.593  42.429  8.831   1.00 40.45  ? 224  LEU B CG  1 
ATOM   5312 C  CD1 . LEU B 1 225 ? 16.506  42.954  7.747   1.00 42.80  ? 224  LEU B CD1 1 
ATOM   5313 C  CD2 . LEU B 1 225 ? 14.486  43.455  9.047   1.00 39.90  ? 224  LEU B CD2 1 
ATOM   5314 N  N   . GLU B 1 226 ? 15.013  37.964  7.472   1.00 38.97  ? 225  GLU B N   1 
ATOM   5315 C  CA  . GLU B 1 226 ? 14.472  36.585  7.496   1.00 36.78  ? 225  GLU B CA  1 
ATOM   5316 C  C   . GLU B 1 226 ? 15.601  35.576  7.665   1.00 33.37  ? 225  GLU B C   1 
ATOM   5317 O  O   . GLU B 1 226 ? 15.560  34.709  8.529   1.00 31.17  ? 225  GLU B O   1 
ATOM   5318 C  CB  . GLU B 1 226 ? 13.671  36.256  6.217   1.00 35.40  ? 225  GLU B CB  1 
ATOM   5319 C  CG  . GLU B 1 226 ? 12.992  34.864  6.219   1.00 34.57  ? 225  GLU B CG  1 
ATOM   5320 C  CD  . GLU B 1 226 ? 12.301  34.515  4.890   1.00 30.37  ? 225  GLU B CD  1 
ATOM   5321 O  OE1 . GLU B 1 226 ? 12.207  35.361  4.006   1.00 29.63  ? 225  GLU B OE1 1 
ATOM   5322 O  OE2 . GLU B 1 226 ? 11.817  33.409  4.739   1.00 25.69  ? 225  GLU B OE2 1 
ATOM   5323 N  N   . ALA B 1 227 ? 16.592  35.712  6.802   1.00 33.69  ? 226  ALA B N   1 
ATOM   5324 C  CA  . ALA B 1 227 ? 17.771  34.854  6.795   1.00 32.97  ? 226  ALA B CA  1 
ATOM   5325 C  C   . ALA B 1 227 ? 18.404  34.781  8.178   1.00 31.93  ? 226  ALA B C   1 
ATOM   5326 O  O   . ALA B 1 227 ? 18.704  33.679  8.672   1.00 28.58  ? 226  ALA B O   1 
ATOM   5327 C  CB  . ALA B 1 227 ? 18.767  35.361  5.775   1.00 31.32  ? 226  ALA B CB  1 
ATOM   5328 N  N   . GLU B 1 228 ? 18.529  35.951  8.803   1.00 32.74  ? 227  GLU B N   1 
ATOM   5329 C  CA  . GLU B 1 228 ? 19.044  36.083  10.161  1.00 35.69  ? 227  GLU B CA  1 
ATOM   5330 C  C   . GLU B 1 228 ? 18.210  35.286  11.176  1.00 38.29  ? 227  GLU B C   1 
ATOM   5331 O  O   . GLU B 1 228 ? 18.701  34.351  11.796  1.00 42.75  ? 227  GLU B O   1 
ATOM   5332 C  CB  . GLU B 1 228 ? 19.063  37.561  10.558  1.00 38.05  ? 227  GLU B CB  1 
ATOM   5333 C  CG  . GLU B 1 228 ? 19.752  37.873  11.881  1.00 44.02  ? 227  GLU B CG  1 
ATOM   5334 C  CD  . GLU B 1 228 ? 18.982  37.411  13.115  1.00 44.29  ? 227  GLU B CD  1 
ATOM   5335 O  OE1 . GLU B 1 228 ? 17.886  37.950  13.386  1.00 44.20  ? 227  GLU B OE1 1 
ATOM   5336 O  OE2 . GLU B 1 228 ? 19.506  36.531  13.828  1.00 46.44  ? 227  GLU B OE2 1 
ATOM   5337 N  N   . ALA B 1 229 ? 16.944  35.659  11.343  1.00 39.42  ? 228  ALA B N   1 
ATOM   5338 C  CA  . ALA B 1 229 ? 16.079  35.029  12.335  1.00 37.88  ? 228  ALA B CA  1 
ATOM   5339 C  C   . ALA B 1 229 ? 16.012  33.533  12.127  1.00 35.04  ? 228  ALA B C   1 
ATOM   5340 O  O   . ALA B 1 229 ? 16.043  32.780  13.076  1.00 39.45  ? 228  ALA B O   1 
ATOM   5341 C  CB  . ALA B 1 229 ? 14.680  35.642  12.281  1.00 39.17  ? 228  ALA B CB  1 
ATOM   5342 N  N   . THR B 1 230 ? 15.888  33.120  10.870  1.00 32.17  ? 229  THR B N   1 
ATOM   5343 C  CA  . THR B 1 230 ? 15.796  31.717  10.488  1.00 26.50  ? 229  THR B CA  1 
ATOM   5344 C  C   . THR B 1 230 ? 16.996  31.007  11.010  1.00 27.72  ? 229  THR B C   1 
ATOM   5345 O  O   . THR B 1 230 ? 16.895  29.965  11.612  1.00 26.76  ? 229  THR B O   1 
ATOM   5346 C  CB  . THR B 1 230 ? 15.741  31.589  8.958   1.00 25.04  ? 229  THR B CB  1 
ATOM   5347 O  OG1 . THR B 1 230 ? 14.478  32.074  8.485   1.00 25.20  ? 229  THR B OG1 1 
ATOM   5348 C  CG2 . THR B 1 230 ? 15.937  30.161  8.509   1.00 24.97  ? 229  THR B CG2 1 
ATOM   5349 N  N   . HIS B 1 231 ? 18.165  31.564  10.746  1.00 33.16  ? 230  HIS B N   1 
ATOM   5350 C  CA  . HIS B 1 231 ? 19.419  30.922  11.165  1.00 36.59  ? 230  HIS B CA  1 
ATOM   5351 C  C   . HIS B 1 231 ? 19.475  30.836  12.702  1.00 37.54  ? 230  HIS B C   1 
ATOM   5352 O  O   . HIS B 1 231 ? 19.917  29.836  13.272  1.00 38.17  ? 230  HIS B O   1 
ATOM   5353 C  CB  . HIS B 1 231 ? 20.628  31.687  10.604  1.00 35.66  ? 230  HIS B CB  1 
ATOM   5354 C  CG  . HIS B 1 231 ? 21.955  31.134  11.027  1.00 36.22  ? 230  HIS B CG  1 
ATOM   5355 N  ND1 . HIS B 1 231 ? 23.128  31.836  10.887  1.00 37.66  ? 230  HIS B ND1 1 
ATOM   5356 C  CD2 . HIS B 1 231 ? 22.296  29.977  11.634  1.00 37.68  ? 230  HIS B CD2 1 
ATOM   5357 C  CE1 . HIS B 1 231 ? 24.133  31.144  11.382  1.00 35.51  ? 230  HIS B CE1 1 
ATOM   5358 N  NE2 . HIS B 1 231 ? 23.656  30.009  11.842  1.00 38.54  ? 230  HIS B NE2 1 
ATOM   5359 N  N   . ARG B 1 232 ? 18.984  31.884  13.355  1.00 38.55  ? 231  ARG B N   1 
ATOM   5360 C  CA  . ARG B 1 232 ? 18.974  31.972  14.824  1.00 37.46  ? 231  ARG B CA  1 
ATOM   5361 C  C   . ARG B 1 232 ? 18.096  30.920  15.501  1.00 34.13  ? 231  ARG B C   1 
ATOM   5362 O  O   . ARG B 1 232 ? 18.556  30.249  16.416  1.00 32.55  ? 231  ARG B O   1 
ATOM   5363 C  CB  . ARG B 1 232 ? 18.533  33.381  15.278  1.00 37.48  ? 231  ARG B CB  1 
ATOM   5364 C  CG  . ARG B 1 232 ? 18.599  33.621  16.789  1.00 37.63  ? 231  ARG B CG  1 
ATOM   5365 C  CD  . ARG B 1 232 ? 18.715  35.091  17.120  1.00 36.35  ? 231  ARG B CD  1 
ATOM   5366 N  NE  . ARG B 1 232 ? 17.874  35.973  16.320  1.00 37.07  ? 231  ARG B NE  1 
ATOM   5367 C  CZ  . ARG B 1 232 ? 16.675  36.403  16.663  1.00 40.21  ? 231  ARG B CZ  1 
ATOM   5368 N  NH1 . ARG B 1 232 ? 16.122  35.988  17.796  1.00 45.20  ? 231  ARG B NH1 1 
ATOM   5369 N  NH2 . ARG B 1 232 ? 15.998  37.225  15.850  1.00 39.14  ? 231  ARG B NH2 1 
ATOM   5370 N  N   . VAL B 1 233 ? 16.845  30.811  15.059  1.00 32.10  ? 232  VAL B N   1 
ATOM   5371 C  CA  . VAL B 1 233 ? 15.906  29.897  15.647  1.00 32.90  ? 232  VAL B CA  1 
ATOM   5372 C  C   . VAL B 1 233 ? 16.319  28.441  15.389  1.00 35.62  ? 232  VAL B C   1 
ATOM   5373 O  O   . VAL B 1 233 ? 16.053  27.553  16.210  1.00 37.57  ? 232  VAL B O   1 
ATOM   5374 C  CB  . VAL B 1 233 ? 14.473  30.177  15.154  1.00 35.75  ? 232  VAL B CB  1 
ATOM   5375 C  CG1 . VAL B 1 233 ? 14.255  29.730  13.709  1.00 33.76  ? 232  VAL B CG1 1 
ATOM   5376 C  CG2 . VAL B 1 233 ? 13.451  29.507  16.082  1.00 40.89  ? 232  VAL B CG2 1 
ATOM   5377 N  N   . ILE B 1 234 ? 16.973  28.181  14.257  1.00 34.96  ? 233  ILE B N   1 
ATOM   5378 C  CA  . ILE B 1 234 ? 17.490  26.853  13.976  1.00 33.24  ? 233  ILE B CA  1 
ATOM   5379 C  C   . ILE B 1 234 ? 18.547  26.488  15.000  1.00 32.09  ? 233  ILE B C   1 
ATOM   5380 O  O   . ILE B 1 234 ? 18.626  25.355  15.475  1.00 31.13  ? 233  ILE B O   1 
ATOM   5381 C  CB  . ILE B 1 234 ? 18.068  26.777  12.560  1.00 35.54  ? 233  ILE B CB  1 
ATOM   5382 C  CG1 . ILE B 1 234 ? 16.923  26.656  11.553  1.00 36.89  ? 233  ILE B CG1 1 
ATOM   5383 C  CG2 . ILE B 1 234 ? 19.023  25.589  12.407  1.00 37.30  ? 233  ILE B CG2 1 
ATOM   5384 C  CD1 . ILE B 1 234 ? 17.393  26.805  10.109  1.00 39.44  ? 233  ILE B CD1 1 
ATOM   5385 N  N   . THR B 1 235 ? 19.380  27.455  15.341  1.00 33.74  ? 234  THR B N   1 
ATOM   5386 C  CA  . THR B 1 235 ? 20.436  27.209  16.323  1.00 35.81  ? 234  THR B CA  1 
ATOM   5387 C  C   . THR B 1 235 ? 19.853  26.954  17.702  1.00 37.65  ? 234  THR B C   1 
ATOM   5388 O  O   . THR B 1 235 ? 20.173  25.940  18.328  1.00 39.67  ? 234  THR B O   1 
ATOM   5389 C  CB  . THR B 1 235 ? 21.397  28.380  16.428  1.00 34.69  ? 234  THR B CB  1 
ATOM   5390 O  OG1 . THR B 1 235 ? 21.870  28.698  15.124  1.00 32.61  ? 234  THR B OG1 1 
ATOM   5391 C  CG2 . THR B 1 235 ? 22.557  28.002  17.324  1.00 34.59  ? 234  THR B CG2 1 
ATOM   5392 N  N   . ILE B 1 236 ? 19.002  27.881  18.159  1.00 37.72  ? 235  ILE B N   1 
ATOM   5393 C  CA  . ILE B 1 236 ? 18.239  27.701  19.398  1.00 38.05  ? 235  ILE B CA  1 
ATOM   5394 C  C   . ILE B 1 236 ? 17.644  26.285  19.469  1.00 37.80  ? 235  ILE B C   1 
ATOM   5395 O  O   . ILE B 1 236 ? 17.875  25.545  20.422  1.00 33.36  ? 235  ILE B O   1 
ATOM   5396 C  CB  . ILE B 1 236 ? 17.072  28.703  19.509  1.00 36.20  ? 235  ILE B CB  1 
ATOM   5397 C  CG1 . ILE B 1 236 ? 17.582  30.144  19.619  1.00 37.49  ? 235  ILE B CG1 1 
ATOM   5398 C  CG2 . ILE B 1 236 ? 16.246  28.371  20.731  1.00 37.28  ? 235  ILE B CG2 1 
ATOM   5399 C  CD1 . ILE B 1 236 ? 16.501  31.212  19.551  1.00 36.93  ? 235  ILE B CD1 1 
ATOM   5400 N  N   . ALA B 1 237 ? 16.871  25.954  18.429  1.00 38.05  ? 236  ALA B N   1 
ATOM   5401 C  CA  . ALA B 1 237 ? 16.168  24.685  18.324  1.00 37.59  ? 236  ALA B CA  1 
ATOM   5402 C  C   . ALA B 1 237 ? 17.112  23.519  18.411  1.00 39.56  ? 236  ALA B C   1 
ATOM   5403 O  O   . ALA B 1 237 ? 16.904  22.589  19.185  1.00 46.38  ? 236  ALA B O   1 
ATOM   5404 C  CB  . ALA B 1 237 ? 15.428  24.623  17.027  1.00 38.39  ? 236  ALA B CB  1 
ATOM   5405 N  N   . ASN B 1 238 ? 18.153  23.565  17.600  1.00 42.55  ? 237  ASN B N   1 
ATOM   5406 C  CA  . ASN B 1 238 ? 19.194  22.533  17.628  1.00 42.50  ? 237  ASN B CA  1 
ATOM   5407 C  C   . ASN B 1 238 ? 19.854  22.385  19.008  1.00 41.43  ? 237  ASN B C   1 
ATOM   5408 O  O   . ASN B 1 238 ? 20.274  21.290  19.377  1.00 31.92  ? 237  ASN B O   1 
ATOM   5409 C  CB  . ASN B 1 238 ? 20.281  22.838  16.593  1.00 39.11  ? 237  ASN B CB  1 
ATOM   5410 C  CG  . ASN B 1 238 ? 21.157  21.641  16.311  1.00 36.09  ? 237  ASN B CG  1 
ATOM   5411 O  OD1 . ASN B 1 238 ? 20.691  20.587  15.851  1.00 37.30  ? 237  ASN B OD1 1 
ATOM   5412 N  ND2 . ASN B 1 238 ? 22.423  21.794  16.581  1.00 34.24  ? 237  ASN B ND2 1 
ATOM   5413 N  N   . ARG B 1 239 ? 19.971  23.497  19.737  1.00 43.56  ? 238  ARG B N   1 
ATOM   5414 C  CA  . ARG B 1 239 ? 20.490  23.442  21.099  1.00 47.87  ? 238  ARG B CA  1 
ATOM   5415 C  C   . ARG B 1 239 ? 19.470  22.771  22.015  1.00 44.42  ? 238  ARG B C   1 
ATOM   5416 O  O   . ARG B 1 239 ? 19.824  21.893  22.781  1.00 45.32  ? 238  ARG B O   1 
ATOM   5417 C  CB  . ARG B 1 239 ? 20.830  24.833  21.640  1.00 53.74  ? 238  ARG B CB  1 
ATOM   5418 C  CG  . ARG B 1 239 ? 21.956  25.574  20.916  1.00 56.88  ? 238  ARG B CG  1 
ATOM   5419 C  CD  . ARG B 1 239 ? 23.233  24.759  20.797  1.00 56.47  ? 238  ARG B CD  1 
ATOM   5420 N  NE  . ARG B 1 239 ? 23.994  24.760  22.050  1.00 56.48  ? 238  ARG B NE  1 
ATOM   5421 C  CZ  . ARG B 1 239 ? 24.755  23.754  22.474  1.00 56.44  ? 238  ARG B CZ  1 
ATOM   5422 N  NH1 . ARG B 1 239 ? 24.872  22.637  21.746  1.00 55.44  ? 238  ARG B NH1 1 
ATOM   5423 N  NH2 . ARG B 1 239 ? 25.406  23.867  23.631  1.00 57.02  ? 238  ARG B NH2 1 
ATOM   5424 N  N   . THR B 1 240 ? 18.205  23.167  21.907  1.00 40.36  ? 239  THR B N   1 
ATOM   5425 C  CA  . THR B 1 240 ? 17.160  22.595  22.741  1.00 41.46  ? 239  THR B CA  1 
ATOM   5426 C  C   . THR B 1 240 ? 16.695  21.224  22.307  1.00 40.04  ? 239  THR B C   1 
ATOM   5427 O  O   . THR B 1 240 ? 15.857  20.642  22.982  1.00 43.16  ? 239  THR B O   1 
ATOM   5428 C  CB  . THR B 1 240 ? 15.929  23.512  22.821  1.00 43.56  ? 239  THR B CB  1 
ATOM   5429 O  OG1 . THR B 1 240 ? 15.495  23.840  21.504  1.00 37.93  ? 239  THR B OG1 1 
ATOM   5430 C  CG2 . THR B 1 240 ? 16.268  24.789  23.572  1.00 46.18  ? 239  THR B CG2 1 
ATOM   5431 N  N   . HIS B 1 241 ? 17.232  20.722  21.202  1.00 38.59  ? 240  HIS B N   1 
ATOM   5432 C  CA  . HIS B 1 241 ? 16.895  19.411  20.622  1.00 40.10  ? 240  HIS B CA  1 
ATOM   5433 C  C   . HIS B 1 241 ? 15.444  19.334  20.104  1.00 37.15  ? 240  HIS B C   1 
ATOM   5434 O  O   . HIS B 1 241 ? 14.877  18.255  20.006  1.00 37.70  ? 240  HIS B O   1 
ATOM   5435 C  CB  . HIS B 1 241 ? 17.195  18.249  21.586  1.00 45.83  ? 240  HIS B CB  1 
ATOM   5436 C  CG  . HIS B 1 241 ? 18.649  18.071  21.931  1.00 49.94  ? 240  HIS B CG  1 
ATOM   5437 N  ND1 . HIS B 1 241 ? 19.681  18.435  21.093  1.00 54.57  ? 240  HIS B ND1 1 
ATOM   5438 C  CD2 . HIS B 1 241 ? 19.236  17.505  23.013  1.00 55.81  ? 240  HIS B CD2 1 
ATOM   5439 C  CE1 . HIS B 1 241 ? 20.842  18.154  21.661  1.00 57.97  ? 240  HIS B CE1 1 
ATOM   5440 N  NE2 . HIS B 1 241 ? 20.598  17.580  22.825  1.00 57.11  ? 240  HIS B NE2 1 
ATOM   5441 N  N   . CYS B 1 242 ? 14.861  20.486  19.784  1.00 34.41  ? 241  CYS B N   1 
ATOM   5442 C  CA  . CYS B 1 242 ? 13.469  20.586  19.380  1.00 33.07  ? 241  CYS B CA  1 
ATOM   5443 C  C   . CYS B 1 242 ? 13.341  20.672  17.872  1.00 33.77  ? 241  CYS B C   1 
ATOM   5444 O  O   . CYS B 1 242 ? 14.028  21.464  17.227  1.00 36.58  ? 241  CYS B O   1 
ATOM   5445 C  CB  . CYS B 1 242 ? 12.838  21.839  19.987  1.00 32.99  ? 241  CYS B CB  1 
ATOM   5446 S  SG  . CYS B 1 242 ? 11.130  22.154  19.499  0.85 38.36  ? 241  CYS B SG  1 
ATOM   5447 N  N   . PRO B 1 243 ? 12.469  19.861  17.285  1.00 34.61  ? 242  PRO B N   1 
ATOM   5448 C  CA  . PRO B 1 243 ? 12.282  20.012  15.877  1.00 36.32  ? 242  PRO B CA  1 
ATOM   5449 C  C   . PRO B 1 243 ? 11.664  21.335  15.571  1.00 38.06  ? 242  PRO B C   1 
ATOM   5450 O  O   . PRO B 1 243 ? 10.632  21.708  16.169  1.00 43.46  ? 242  PRO B O   1 
ATOM   5451 C  CB  . PRO B 1 243 ? 11.298  18.911  15.549  1.00 38.57  ? 242  PRO B CB  1 
ATOM   5452 C  CG  . PRO B 1 243 ? 10.503  18.751  16.787  1.00 38.23  ? 242  PRO B CG  1 
ATOM   5453 C  CD  . PRO B 1 243 ? 11.551  18.855  17.836  1.00 38.57  ? 242  PRO B CD  1 
ATOM   5454 N  N   . ILE B 1 244 ? 12.249  22.009  14.593  1.00 38.91  ? 243  ILE B N   1 
ATOM   5455 C  CA  . ILE B 1 244 ? 11.840  23.358  14.231  1.00 38.05  ? 243  ILE B CA  1 
ATOM   5456 C  C   . ILE B 1 244 ? 11.301  23.348  12.812  1.00 34.32  ? 243  ILE B C   1 
ATOM   5457 O  O   . ILE B 1 244 ? 11.845  22.735  11.895  1.00 32.31  ? 243  ILE B O   1 
ATOM   5458 C  CB  . ILE B 1 244 ? 12.997  24.385  14.400  1.00 39.31  ? 243  ILE B CB  1 
ATOM   5459 C  CG1 . ILE B 1 244 ? 12.458  25.811  14.410  1.00 39.86  ? 243  ILE B CG1 1 
ATOM   5460 C  CG2 . ILE B 1 244 ? 14.088  24.206  13.344  1.00 38.61  ? 243  ILE B CG2 1 
ATOM   5461 C  CD1 . ILE B 1 244 ? 11.697  26.145  15.669  1.00 42.80  ? 243  ILE B CD1 1 
ATOM   5462 N  N   . TYR B 1 245 ? 10.219  24.069  12.655  1.00 33.68  ? 244  TYR B N   1 
ATOM   5463 C  CA  . TYR B 1 245 ? 9.475   24.070  11.429  1.00 34.29  ? 244  TYR B CA  1 
ATOM   5464 C  C   . TYR B 1 245 ? 9.285   25.517  11.017  1.00 33.29  ? 244  TYR B C   1 
ATOM   5465 O  O   . TYR B 1 245 ? 8.700   26.294  11.752  1.00 34.72  ? 244  TYR B O   1 
ATOM   5466 C  CB  . TYR B 1 245 ? 8.158   23.389  11.728  1.00 35.14  ? 244  TYR B CB  1 
ATOM   5467 C  CG  . TYR B 1 245 ? 7.245   23.165  10.574  1.00 32.73  ? 244  TYR B CG  1 
ATOM   5468 C  CD1 . TYR B 1 245 ? 6.485   24.181  10.087  1.00 32.96  ? 244  TYR B CD1 1 
ATOM   5469 C  CD2 . TYR B 1 245 ? 7.085   21.900  10.029  1.00 32.16  ? 244  TYR B CD2 1 
ATOM   5470 C  CE1 . TYR B 1 245 ? 5.603   23.959  9.045   1.00 34.59  ? 244  TYR B CE1 1 
ATOM   5471 C  CE2 . TYR B 1 245 ? 6.213   21.676  8.985   1.00 31.64  ? 244  TYR B CE2 1 
ATOM   5472 C  CZ  . TYR B 1 245 ? 5.481   22.704  8.505   1.00 31.48  ? 244  TYR B CZ  1 
ATOM   5473 O  OH  . TYR B 1 245 ? 4.639   22.490  7.490   1.00 31.06  ? 244  TYR B OH  1 
ATOM   5474 N  N   . LEU B 1 246 ? 9.763   25.871  9.840   1.00 33.82  ? 245  LEU B N   1 
ATOM   5475 C  CA  . LEU B 1 246 ? 9.780   27.259  9.423   1.00 35.18  ? 245  LEU B CA  1 
ATOM   5476 C  C   . LEU B 1 246 ? 8.633   27.566  8.486   1.00 38.04  ? 245  LEU B C   1 
ATOM   5477 O  O   . LEU B 1 246 ? 8.401   26.845  7.495   1.00 42.24  ? 245  LEU B O   1 
ATOM   5478 C  CB  . LEU B 1 246 ? 11.058  27.557  8.708   1.00 33.61  ? 245  LEU B CB  1 
ATOM   5479 C  CG  . LEU B 1 246 ? 12.155  27.451  9.725   1.00 33.56  ? 245  LEU B CG  1 
ATOM   5480 C  CD1 . LEU B 1 246 ? 13.488  27.041  9.136   1.00 36.27  ? 245  LEU B CD1 1 
ATOM   5481 C  CD2 . LEU B 1 246 ? 12.281  28.835  10.236  1.00 33.41  ? 245  LEU B CD2 1 
ATOM   5482 N  N   . VAL B 1 247 ? 7.936   28.660  8.788   1.00 35.87  ? 246  VAL B N   1 
ATOM   5483 C  CA  . VAL B 1 247 ? 6.721   28.960  8.084   1.00 34.11  ? 246  VAL B CA  1 
ATOM   5484 C  C   . VAL B 1 247 ? 6.937   30.183  7.235   1.00 35.09  ? 246  VAL B C   1 
ATOM   5485 O  O   . VAL B 1 247 ? 7.720   31.084  7.579   1.00 29.54  ? 246  VAL B O   1 
ATOM   5486 C  CB  . VAL B 1 247 ? 5.531   29.132  9.034   1.00 33.03  ? 246  VAL B CB  1 
ATOM   5487 C  CG1 . VAL B 1 247 ? 5.470   27.958  9.981   1.00 33.28  ? 246  VAL B CG1 1 
ATOM   5488 C  CG2 . VAL B 1 247 ? 5.629   30.399  9.842   1.00 32.45  ? 246  VAL B CG2 1 
ATOM   5489 N  N   . ASN B 1 248 ? 6.260   30.155  6.085   1.00 39.68  ? 247  ASN B N   1 
ATOM   5490 C  CA  . ASN B 1 248 ? 6.202   31.271  5.151   1.00 39.17  ? 247  ASN B CA  1 
ATOM   5491 C  C   . ASN B 1 248 ? 7.569   31.619  4.568   1.00 34.27  ? 247  ASN B C   1 
ATOM   5492 O  O   . ASN B 1 248 ? 7.884   32.786  4.341   1.00 31.22  ? 247  ASN B O   1 
ATOM   5493 C  CB  . ASN B 1 248 ? 5.547   32.494  5.848   1.00 43.48  ? 247  ASN B CB  1 
ATOM   5494 C  CG  . ASN B 1 248 ? 4.033   32.379  5.984   1.00 41.14  ? 247  ASN B CG  1 
ATOM   5495 O  OD1 . ASN B 1 248 ? 3.475   31.330  6.302   1.00 42.54  ? 247  ASN B OD1 1 
ATOM   5496 N  ND2 . ASN B 1 248 ? 3.374   33.466  5.739   1.00 39.83  ? 247  ASN B ND2 1 
ATOM   5497 N  N   . VAL B 1 249 ? 8.400   30.600  4.347   1.00 33.99  ? 248  VAL B N   1 
ATOM   5498 C  CA  . VAL B 1 249 ? 9.747   30.850  3.822   1.00 34.80  ? 248  VAL B CA  1 
ATOM   5499 C  C   . VAL B 1 249 ? 9.680   31.615  2.483   1.00 36.65  ? 248  VAL B C   1 
ATOM   5500 O  O   . VAL B 1 249 ? 9.116   31.119  1.500   1.00 34.18  ? 248  VAL B O   1 
ATOM   5501 C  CB  . VAL B 1 249 ? 10.538  29.590  3.610   1.00 33.16  ? 248  VAL B CB  1 
ATOM   5502 C  CG1 . VAL B 1 249 ? 11.877  29.934  2.990   1.00 31.61  ? 248  VAL B CG1 1 
ATOM   5503 C  CG2 . VAL B 1 249 ? 10.716  28.865  4.932   1.00 35.85  ? 248  VAL B CG2 1 
ATOM   5504 N  N   . SER B 1 250 ? 10.267  32.813  2.480   1.00 33.53  ? 249  SER B N   1 
ATOM   5505 C  CA  . SER B 1 250 ? 9.972   33.802  1.480   1.00 35.62  ? 249  SER B CA  1 
ATOM   5506 C  C   . SER B 1 250 ? 11.103  34.148  0.542   1.00 38.26  ? 249  SER B C   1 
ATOM   5507 O  O   . SER B 1 250 ? 10.896  34.962  -0.385  1.00 38.56  ? 249  SER B O   1 
ATOM   5508 C  CB  . SER B 1 250 ? 9.552   35.108  2.180   1.00 37.52  ? 249  SER B CB  1 
ATOM   5509 O  OG  . SER B 1 250 ? 10.643  36.013  2.310   1.00 35.99  ? 249  SER B OG  1 
ATOM   5510 N  N   . SER B 1 251 ? 12.301  33.636  0.832   1.00 37.59  ? 250  SER B N   1 
ATOM   5511 C  CA  . SER B 1 251 ? 13.508  34.231  0.277   1.00 39.37  ? 250  SER B CA  1 
ATOM   5512 C  C   . SER B 1 251 ? 14.611  33.234  -0.006  1.00 44.36  ? 250  SER B C   1 
ATOM   5513 O  O   . SER B 1 251 ? 14.724  32.192  0.645   1.00 46.03  ? 250  SER B O   1 
ATOM   5514 C  CB  . SER B 1 251 ? 14.061  35.334  1.215   1.00 39.43  ? 250  SER B CB  1 
ATOM   5515 O  OG  . SER B 1 251 ? 14.872  34.833  2.275   1.00 38.04  ? 250  SER B OG  1 
ATOM   5516 N  N   . ILE B 1 252 ? 15.466  33.605  -0.959  1.00 46.44  ? 251  ILE B N   1 
ATOM   5517 C  CA  . ILE B 1 252 ? 16.595  32.777  -1.352  1.00 43.07  ? 251  ILE B CA  1 
ATOM   5518 C  C   . ILE B 1 252 ? 17.526  32.599  -0.161  1.00 38.38  ? 251  ILE B C   1 
ATOM   5519 O  O   . ILE B 1 252 ? 17.961  31.489  0.124   1.00 39.44  ? 251  ILE B O   1 
ATOM   5520 C  CB  . ILE B 1 252 ? 17.363  33.411  -2.526  1.00 47.78  ? 251  ILE B CB  1 
ATOM   5521 C  CG1 . ILE B 1 252 ? 16.423  33.708  -3.710  1.00 48.45  ? 251  ILE B CG1 1 
ATOM   5522 C  CG2 . ILE B 1 252 ? 18.494  32.490  -2.966  1.00 52.71  ? 251  ILE B CG2 1 
ATOM   5523 C  CD1 . ILE B 1 252 ? 17.128  34.100  -4.996  1.00 45.37  ? 251  ILE B CD1 1 
ATOM   5524 N  N   . SER B 1 253 ? 17.799  33.700  0.536   1.00 36.06  ? 252  SER B N   1 
ATOM   5525 C  CA  . SER B 1 253 ? 18.725  33.724  1.663   1.00 35.72  ? 252  SER B CA  1 
ATOM   5526 C  C   . SER B 1 253 ? 18.288  32.721  2.715   1.00 37.35  ? 252  SER B C   1 
ATOM   5527 O  O   . SER B 1 253 ? 19.054  31.915  3.187   1.00 37.03  ? 252  SER B O   1 
ATOM   5528 C  CB  . SER B 1 253 ? 18.729  35.099  2.333   1.00 35.48  ? 252  SER B CB  1 
ATOM   5529 O  OG  . SER B 1 253 ? 19.133  36.106  1.466   1.00 38.28  ? 252  SER B OG  1 
ATOM   5530 N  N   . ALA B 1 254 ? 17.027  32.844  3.103   1.00 42.36  ? 253  ALA B N   1 
ATOM   5531 C  CA  . ALA B 1 254 ? 16.439  32.088  4.176   1.00 38.50  ? 253  ALA B CA  1 
ATOM   5532 C  C   . ALA B 1 254 ? 16.469  30.636  3.759   1.00 41.20  ? 253  ALA B C   1 
ATOM   5533 O  O   . ALA B 1 254 ? 16.955  29.790  4.508   1.00 48.25  ? 253  ALA B O   1 
ATOM   5534 C  CB  . ALA B 1 254 ? 15.022  32.559  4.391   1.00 39.23  ? 253  ALA B CB  1 
ATOM   5535 N  N   . GLY B 1 255 ? 16.008  30.378  2.533   1.00 38.86  ? 254  GLY B N   1 
ATOM   5536 C  CA  . GLY B 1 255 ? 16.052  29.061  1.899   1.00 35.48  ? 254  GLY B CA  1 
ATOM   5537 C  C   . GLY B 1 255 ? 17.402  28.379  1.938   1.00 35.57  ? 254  GLY B C   1 
ATOM   5538 O  O   . GLY B 1 255 ? 17.477  27.170  2.182   1.00 35.73  ? 254  GLY B O   1 
ATOM   5539 N  N   . ASP B 1 256 ? 18.472  29.145  1.731   1.00 35.48  ? 255  ASP B N   1 
ATOM   5540 C  CA  . ASP B 1 256 ? 19.833  28.602  1.840   1.00 36.43  ? 255  ASP B CA  1 
ATOM   5541 C  C   . ASP B 1 256 ? 20.171  28.245  3.273   1.00 35.23  ? 255  ASP B C   1 
ATOM   5542 O  O   . ASP B 1 256 ? 20.824  27.218  3.519   1.00 36.65  ? 255  ASP B O   1 
ATOM   5543 C  CB  . ASP B 1 256 ? 20.907  29.589  1.327   1.00 38.62  ? 255  ASP B CB  1 
ATOM   5544 C  CG  . ASP B 1 256 ? 20.925  29.717  -0.201  1.00 37.66  ? 255  ASP B CG  1 
ATOM   5545 O  OD1 . ASP B 1 256 ? 20.357  28.856  -0.915  1.00 37.97  ? 255  ASP B OD1 1 
ATOM   5546 O  OD2 . ASP B 1 256 ? 21.494  30.709  -0.668  1.00 36.61  ? 255  ASP B OD2 1 
ATOM   5547 N  N   . VAL B 1 257 ? 19.769  29.096  4.219   1.00 31.51  ? 256  VAL B N   1 
ATOM   5548 C  CA  . VAL B 1 257 ? 20.036  28.819  5.610   1.00 29.43  ? 256  VAL B CA  1 
ATOM   5549 C  C   . VAL B 1 257 ? 19.459  27.448  5.892   1.00 29.69  ? 256  VAL B C   1 
ATOM   5550 O  O   . VAL B 1 257 ? 20.113  26.560  6.466   1.00 30.35  ? 256  VAL B O   1 
ATOM   5551 C  CB  . VAL B 1 257 ? 19.442  29.877  6.524   1.00 29.51  ? 256  VAL B CB  1 
ATOM   5552 C  CG1 . VAL B 1 257 ? 19.545  29.480  7.982   1.00 30.66  ? 256  VAL B CG1 1 
ATOM   5553 C  CG2 . VAL B 1 257 ? 20.170  31.180  6.328   1.00 30.43  ? 256  VAL B CG2 1 
ATOM   5554 N  N   . ILE B 1 258 ? 18.232  27.267  5.456   1.00 29.46  ? 257  ILE B N   1 
ATOM   5555 C  CA  . ILE B 1 258 ? 17.545  26.020  5.706   1.00 31.69  ? 257  ILE B CA  1 
ATOM   5556 C  C   . ILE B 1 258 ? 18.275  24.873  5.052   1.00 33.60  ? 257  ILE B C   1 
ATOM   5557 O  O   . ILE B 1 258 ? 18.498  23.829  5.678   1.00 38.89  ? 257  ILE B O   1 
ATOM   5558 C  CB  . ILE B 1 258 ? 16.086  26.093  5.244   1.00 31.28  ? 257  ILE B CB  1 
ATOM   5559 C  CG1 . ILE B 1 258 ? 15.310  27.113  6.119   1.00 28.69  ? 257  ILE B CG1 1 
ATOM   5560 C  CG2 . ILE B 1 258 ? 15.436  24.727  5.364   1.00 31.92  ? 257  ILE B CG2 1 
ATOM   5561 C  CD1 . ILE B 1 258 ? 14.059  27.629  5.451   1.00 26.67  ? 257  ILE B CD1 1 
ATOM   5562 N  N   . ALA B 1 259 ? 18.663  25.074  3.804   1.00 35.33  ? 258  ALA B N   1 
ATOM   5563 C  CA  . ALA B 1 259 ? 19.417  24.053  3.045   1.00 34.20  ? 258  ALA B CA  1 
ATOM   5564 C  C   . ALA B 1 259 ? 20.591  23.580  3.824   1.00 32.89  ? 258  ALA B C   1 
ATOM   5565 O  O   . ALA B 1 259 ? 20.709  22.388  4.136   1.00 33.64  ? 258  ALA B O   1 
ATOM   5566 C  CB  . ALA B 1 259 ? 19.908  24.613  1.734   1.00 34.63  ? 258  ALA B CB  1 
ATOM   5567 N  N   . ALA B 1 260 ? 21.434  24.543  4.178   1.00 32.00  ? 259  ALA B N   1 
ATOM   5568 C  CA  . ALA B 1 260 ? 22.658  24.290  4.939   1.00 32.15  ? 259  ALA B CA  1 
ATOM   5569 C  C   . ALA B 1 260 ? 22.408  23.518  6.246   1.00 31.98  ? 259  ALA B C   1 
ATOM   5570 O  O   . ALA B 1 260 ? 23.018  22.490  6.475   1.00 33.15  ? 259  ALA B O   1 
ATOM   5571 C  CB  . ALA B 1 260 ? 23.318  25.614  5.249   1.00 32.48  ? 259  ALA B CB  1 
ATOM   5572 N  N   . ALA B 1 261 ? 21.475  24.011  7.060   1.00 32.37  ? 260  ALA B N   1 
ATOM   5573 C  CA  . ALA B 1 261 ? 21.147  23.416  8.342   1.00 33.68  ? 260  ALA B CA  1 
ATOM   5574 C  C   . ALA B 1 261 ? 20.791  21.949  8.176   1.00 38.36  ? 260  ALA B C   1 
ATOM   5575 O  O   . ALA B 1 261 ? 21.215  21.072  8.967   1.00 37.37  ? 260  ALA B O   1 
ATOM   5576 C  CB  . ALA B 1 261 ? 19.984  24.150  8.976   1.00 33.16  ? 260  ALA B CB  1 
ATOM   5577 N  N   . LYS B 1 262 ? 20.004  21.693  7.144   1.00 41.72  ? 261  LYS B N   1 
ATOM   5578 C  CA  . LYS B 1 262 ? 19.566  20.340  6.834   1.00 47.16  ? 261  LYS B CA  1 
ATOM   5579 C  C   . LYS B 1 262 ? 20.748  19.409  6.541   1.00 48.20  ? 261  LYS B C   1 
ATOM   5580 O  O   . LYS B 1 262 ? 20.800  18.277  7.008   1.00 51.54  ? 261  LYS B O   1 
ATOM   5581 C  CB  . LYS B 1 262 ? 18.581  20.350  5.647   1.00 47.22  ? 261  LYS B CB  1 
ATOM   5582 C  CG  . LYS B 1 262 ? 17.118  20.511  6.046   1.00 46.47  ? 261  LYS B CG  1 
ATOM   5583 C  CD  . LYS B 1 262 ? 16.177  19.749  5.104   1.00 49.30  ? 261  LYS B CD  1 
ATOM   5584 C  CE  . LYS B 1 262 ? 14.709  19.893  5.512   1.00 48.40  ? 261  LYS B CE  1 
ATOM   5585 N  NZ  . LYS B 1 262 ? 13.880  20.892  4.758   1.00 45.76  ? 261  LYS B NZ  1 
ATOM   5586 N  N   . MET B 1 263 ? 21.703  19.896  5.771   1.00 46.87  ? 262  MET B N   1 
ATOM   5587 C  CA  . MET B 1 263 ? 22.849  19.084  5.394   1.00 44.22  ? 262  MET B CA  1 
ATOM   5588 C  C   . MET B 1 263 ? 23.711  18.744  6.568   1.00 43.44  ? 262  MET B C   1 
ATOM   5589 O  O   . MET B 1 263 ? 24.328  17.689  6.601   1.00 40.04  ? 262  MET B O   1 
ATOM   5590 C  CB  . MET B 1 263 ? 23.684  19.861  4.407   1.00 47.11  ? 262  MET B CB  1 
ATOM   5591 C  CG  . MET B 1 263 ? 22.905  20.250  3.170   1.00 44.98  ? 262  MET B CG  1 
ATOM   5592 S  SD  . MET B 1 263 ? 24.062  20.152  1.842   0.79 44.12  ? 262  MET B SD  1 
ATOM   5593 C  CE  . MET B 1 263 ? 24.651  21.863  1.753   1.00 48.87  ? 262  MET B CE  1 
ATOM   5594 N  N   . GLN B 1 264 ? 23.746  19.664  7.530   1.00 46.00  ? 263  GLN B N   1 
ATOM   5595 C  CA  . GLN B 1 264 ? 24.394  19.439  8.809   1.00 45.60  ? 263  GLN B CA  1 
ATOM   5596 C  C   . GLN B 1 264 ? 23.634  18.446  9.695   1.00 45.09  ? 263  GLN B C   1 
ATOM   5597 O  O   . GLN B 1 264 ? 24.136  17.999  10.733  1.00 44.47  ? 263  GLN B O   1 
ATOM   5598 C  CB  . GLN B 1 264 ? 24.560  20.753  9.522   1.00 48.83  ? 263  GLN B CB  1 
ATOM   5599 C  CG  . GLN B 1 264 ? 25.672  21.595  8.946   1.00 52.43  ? 263  GLN B CG  1 
ATOM   5600 C  CD  . GLN B 1 264 ? 25.452  23.088  9.132   1.00 59.43  ? 263  GLN B CD  1 
ATOM   5601 O  OE1 . GLN B 1 264 ? 24.601  23.531  9.896   1.00 60.79  ? 263  GLN B OE1 1 
ATOM   5602 N  NE2 . GLN B 1 264 ? 26.252  23.877  8.431   1.00 69.94  ? 263  GLN B NE2 1 
ATOM   5603 N  N   . GLY B 1 265 ? 22.440  18.066  9.268   1.00 44.81  ? 264  GLY B N   1 
ATOM   5604 C  CA  . GLY B 1 265 ? 21.686  17.016  9.933   1.00 45.16  ? 264  GLY B CA  1 
ATOM   5605 C  C   . GLY B 1 265 ? 20.753  17.572  10.970  1.00 45.65  ? 264  GLY B C   1 
ATOM   5606 O  O   . GLY B 1 265 ? 20.178  16.826  11.739  1.00 51.93  ? 264  GLY B O   1 
ATOM   5607 N  N   . LYS B 1 266 ? 20.574  18.890  10.996  1.00 44.86  ? 265  LYS B N   1 
ATOM   5608 C  CA  . LYS B 1 266 ? 19.722  19.501  12.010  1.00 39.80  ? 265  LYS B CA  1 
ATOM   5609 C  C   . LYS B 1 266 ? 18.287  19.234  11.647  1.00 39.45  ? 265  LYS B C   1 
ATOM   5610 O  O   . LYS B 1 266 ? 17.924  19.317  10.478  1.00 38.14  ? 265  LYS B O   1 
ATOM   5611 C  CB  . LYS B 1 266 ? 19.998  20.978  12.116  1.00 37.64  ? 265  LYS B CB  1 
ATOM   5612 C  CG  . LYS B 1 266 ? 21.420  21.196  12.555  1.00 38.70  ? 265  LYS B CG  1 
ATOM   5613 C  CD  . LYS B 1 266 ? 21.816  22.636  12.519  1.00 40.33  ? 265  LYS B CD  1 
ATOM   5614 C  CE  . LYS B 1 266 ? 23.329  22.695  12.514  1.00 40.58  ? 265  LYS B CE  1 
ATOM   5615 N  NZ  . LYS B 1 266 ? 23.797  23.784  13.419  1.00 45.40  ? 265  LYS B NZ  1 
ATOM   5616 N  N   . VAL B 1 267 ? 17.486  18.884  12.651  1.00 38.80  ? 266  VAL B N   1 
ATOM   5617 C  CA  . VAL B 1 267 ? 16.111  18.460  12.428  1.00 37.40  ? 266  VAL B CA  1 
ATOM   5618 C  C   . VAL B 1 267 ? 15.299  19.692  12.184  1.00 35.86  ? 266  VAL B C   1 
ATOM   5619 O  O   . VAL B 1 267 ? 14.683  20.236  13.086  1.00 34.82  ? 266  VAL B O   1 
ATOM   5620 C  CB  . VAL B 1 267 ? 15.542  17.657  13.596  1.00 37.52  ? 266  VAL B CB  1 
ATOM   5621 C  CG1 . VAL B 1 267 ? 14.082  17.310  13.340  1.00 37.03  ? 266  VAL B CG1 1 
ATOM   5622 C  CG2 . VAL B 1 267 ? 16.371  16.396  13.789  1.00 39.05  ? 266  VAL B CG2 1 
ATOM   5623 N  N   . VAL B 1 268 ? 15.378  20.136  10.933  1.00 36.46  ? 267  VAL B N   1 
ATOM   5624 C  CA  . VAL B 1 268 ? 14.662  21.272  10.440  1.00 36.29  ? 267  VAL B CA  1 
ATOM   5625 C  C   . VAL B 1 268 ? 13.656  20.835  9.392   1.00 35.49  ? 267  VAL B C   1 
ATOM   5626 O  O   . VAL B 1 268 ? 13.979  20.117  8.467   1.00 38.90  ? 267  VAL B O   1 
ATOM   5627 C  CB  . VAL B 1 268 ? 15.624  22.268  9.813   1.00 36.27  ? 267  VAL B CB  1 
ATOM   5628 C  CG1 . VAL B 1 268 ? 14.854  23.432  9.214   1.00 38.81  ? 267  VAL B CG1 1 
ATOM   5629 C  CG2 . VAL B 1 268 ? 16.596  22.777  10.861  1.00 37.99  ? 267  VAL B CG2 1 
ATOM   5630 N  N   . LEU B 1 269 ? 12.421  21.260  9.583   1.00 35.87  ? 268  LEU B N   1 
ATOM   5631 C  CA  . LEU B 1 269 ? 11.386  21.190  8.559   1.00 35.05  ? 268  LEU B CA  1 
ATOM   5632 C  C   . LEU B 1 269 ? 11.004  22.581  8.119   1.00 33.60  ? 268  LEU B C   1 
ATOM   5633 O  O   . LEU B 1 269 ? 11.349  23.591  8.764   1.00 36.39  ? 268  LEU B O   1 
ATOM   5634 C  CB  . LEU B 1 269 ? 10.180  20.459  9.100   1.00 34.92  ? 268  LEU B CB  1 
ATOM   5635 C  CG  . LEU B 1 269 ? 10.585  19.009  9.280   1.00 36.72  ? 268  LEU B CG  1 
ATOM   5636 C  CD1 . LEU B 1 269 ? 9.741   18.293  10.325  1.00 39.82  ? 268  LEU B CD1 1 
ATOM   5637 C  CD2 . LEU B 1 269 ? 10.484  18.322  7.937   1.00 37.59  ? 268  LEU B CD2 1 
ATOM   5638 N  N   . ALA B 1 270 ? 10.283  22.649  7.022   1.00 31.60  ? 269  ALA B N   1 
ATOM   5639 C  CA  . ALA B 1 270 ? 10.032  23.943  6.423   1.00 34.29  ? 269  ALA B CA  1 
ATOM   5640 C  C   . ALA B 1 270 ? 8.876   23.924  5.440   1.00 34.82  ? 269  ALA B C   1 
ATOM   5641 O  O   . ALA B 1 270 ? 8.607   22.940  4.756   1.00 31.78  ? 269  ALA B O   1 
ATOM   5642 C  CB  . ALA B 1 270 ? 11.287  24.462  5.736   1.00 33.78  ? 269  ALA B CB  1 
ATOM   5643 N  N   . GLU B 1 271 ? 8.209   25.066  5.385   1.00 37.67  ? 270  GLU B N   1 
ATOM   5644 C  CA  . GLU B 1 271 ? 6.988   25.209  4.648   1.00 38.30  ? 270  GLU B CA  1 
ATOM   5645 C  C   . GLU B 1 271 ? 7.006   26.589  4.025   1.00 37.25  ? 270  GLU B C   1 
ATOM   5646 O  O   . GLU B 1 271 ? 7.378   27.555  4.689   1.00 39.74  ? 270  GLU B O   1 
ATOM   5647 C  CB  . GLU B 1 271 ? 5.801   25.007  5.608   1.00 40.75  ? 270  GLU B CB  1 
ATOM   5648 C  CG  . GLU B 1 271 ? 4.595   25.889  5.366   1.00 43.77  ? 270  GLU B CG  1 
ATOM   5649 C  CD  . GLU B 1 271 ? 3.517   25.726  6.424   1.00 44.28  ? 270  GLU B CD  1 
ATOM   5650 O  OE1 . GLU B 1 271 ? 3.193   24.575  6.807   1.00 38.87  ? 270  GLU B OE1 1 
ATOM   5651 O  OE2 . GLU B 1 271 ? 2.998   26.782  6.872   1.00 45.02  ? 270  GLU B OE2 1 
ATOM   5652 N  N   . THR B 1 272 ? 6.646   26.678  2.744   1.00 35.57  ? 271  THR B N   1 
ATOM   5653 C  CA  . THR B 1 272 ? 6.389   27.963  2.105   1.00 35.16  ? 271  THR B CA  1 
ATOM   5654 C  C   . THR B 1 272 ? 4.910   28.072  1.764   1.00 35.51  ? 271  THR B C   1 
ATOM   5655 O  O   . THR B 1 272 ? 4.139   27.156  2.018   1.00 37.88  ? 271  THR B O   1 
ATOM   5656 C  CB  . THR B 1 272 ? 7.243   28.194  0.845   1.00 36.12  ? 271  THR B CB  1 
ATOM   5657 O  OG1 . THR B 1 272 ? 7.248   29.586  0.500   1.00 37.52  ? 271  THR B OG1 1 
ATOM   5658 C  CG2 . THR B 1 272 ? 6.735   27.392  -0.342  1.00 36.00  ? 271  THR B CG2 1 
ATOM   5659 N  N   . THR B 1 273 ? 4.522   29.227  1.238   1.00 35.52  ? 272  THR B N   1 
ATOM   5660 C  CA  . THR B 1 273 ? 3.166   29.482  0.773   1.00 35.56  ? 272  THR B CA  1 
ATOM   5661 C  C   . THR B 1 273 ? 3.117   29.472  -0.745  1.00 38.56  ? 272  THR B C   1 
ATOM   5662 O  O   . THR B 1 273 ? 4.155   29.577  -1.432  1.00 39.54  ? 272  THR B O   1 
ATOM   5663 C  CB  . THR B 1 273 ? 2.605   30.843  1.296   1.00 35.63  ? 272  THR B CB  1 
ATOM   5664 O  OG1 . THR B 1 273 ? 3.205   31.957  0.628   1.00 31.14  ? 272  THR B OG1 1 
ATOM   5665 C  CG2 . THR B 1 273 ? 2.846   30.984  2.807   1.00 36.34  ? 272  THR B CG2 1 
ATOM   5666 N  N   . THR B 1 274 ? 1.906   29.350  -1.272  1.00 38.86  ? 273  THR B N   1 
ATOM   5667 C  CA  . THR B 1 274 ? 1.695   29.345  -2.718  1.00 40.37  ? 273  THR B CA  1 
ATOM   5668 C  C   . THR B 1 274 ? 2.161   30.648  -3.367  1.00 43.10  ? 273  THR B C   1 
ATOM   5669 O  O   . THR B 1 274 ? 2.873   30.632  -4.392  1.00 48.42  ? 273  THR B O   1 
ATOM   5670 C  CB  . THR B 1 274 ? 0.222   29.184  -3.044  1.00 40.08  ? 273  THR B CB  1 
ATOM   5671 O  OG1 . THR B 1 274 ? -0.326  28.105  -2.264  1.00 35.13  ? 273  THR B OG1 1 
ATOM   5672 C  CG2 . THR B 1 274 ? 0.038   28.936  -4.527  1.00 40.89  ? 273  THR B CG2 1 
ATOM   5673 N  N   . ALA B 1 275 ? 1.771   31.765  -2.761  1.00 43.36  ? 274  ALA B N   1 
ATOM   5674 C  CA  . ALA B 1 275 ? 2.177   33.072  -3.241  1.00 47.76  ? 274  ALA B CA  1 
ATOM   5675 C  C   . ALA B 1 275 ? 3.712   33.223  -3.292  1.00 49.19  ? 274  ALA B C   1 
ATOM   5676 O  O   . ALA B 1 275 ? 4.270   33.725  -4.278  1.00 56.19  ? 274  ALA B O   1 
ATOM   5677 C  CB  . ALA B 1 275 ? 1.575   34.158  -2.377  1.00 48.66  ? 274  ALA B CB  1 
ATOM   5678 N  N   . HIS B 1 276 ? 4.386   32.784  -2.242  1.00 44.60  ? 275  HIS B N   1 
ATOM   5679 C  CA  . HIS B 1 276 ? 5.832   32.880  -2.206  1.00 44.35  ? 275  HIS B CA  1 
ATOM   5680 C  C   . HIS B 1 276 ? 6.471   31.995  -3.239  1.00 42.61  ? 275  HIS B C   1 
ATOM   5681 O  O   . HIS B 1 276 ? 7.493   32.360  -3.808  1.00 43.69  ? 275  HIS B O   1 
ATOM   5682 C  CB  . HIS B 1 276 ? 6.387   32.519  -0.829  1.00 44.36  ? 275  HIS B CB  1 
ATOM   5683 C  CG  . HIS B 1 276 ? 6.133   33.564  0.215   1.00 47.37  ? 275  HIS B CG  1 
ATOM   5684 N  ND1 . HIS B 1 276 ? 5.177   33.420  1.195   1.00 50.08  ? 275  HIS B ND1 1 
ATOM   5685 C  CD2 . HIS B 1 276 ? 6.706   34.772  0.424   1.00 46.72  ? 275  HIS B CD2 1 
ATOM   5686 C  CE1 . HIS B 1 276 ? 5.187   34.484  1.977   1.00 48.71  ? 275  HIS B CE1 1 
ATOM   5687 N  NE2 . HIS B 1 276 ? 6.110   35.316  1.535   1.00 45.49  ? 275  HIS B NE2 1 
ATOM   5688 N  N   . ALA B 1 277 ? 5.889   30.829  -3.478  1.00 41.82  ? 276  ALA B N   1 
ATOM   5689 C  CA  . ALA B 1 277 ? 6.462   29.919  -4.463  1.00 43.77  ? 276  ALA B CA  1 
ATOM   5690 C  C   . ALA B 1 277 ? 6.222   30.367  -5.894  1.00 45.84  ? 276  ALA B C   1 
ATOM   5691 O  O   . ALA B 1 277 ? 6.867   29.843  -6.804  1.00 52.59  ? 276  ALA B O   1 
ATOM   5692 C  CB  . ALA B 1 277 ? 5.945   28.506  -4.271  1.00 44.99  ? 276  ALA B CB  1 
ATOM   5693 N  N   . THR B 1 278 ? 5.306   31.304  -6.122  1.00 45.02  ? 277  THR B N   1 
ATOM   5694 C  CA  . THR B 1 278 ? 4.916   31.611  -7.503  1.00 46.21  ? 277  THR B CA  1 
ATOM   5695 C  C   . THR B 1 278 ? 4.886   33.050  -7.950  1.00 44.15  ? 277  THR B C   1 
ATOM   5696 O  O   . THR B 1 278 ? 4.789   33.277  -9.142  1.00 40.24  ? 277  THR B O   1 
ATOM   5697 C  CB  . THR B 1 278 ? 3.523   31.067  -7.772  1.00 44.34  ? 277  THR B CB  1 
ATOM   5698 O  OG1 . THR B 1 278 ? 2.634   31.626  -6.802  1.00 44.45  ? 277  THR B OG1 1 
ATOM   5699 C  CG2 . THR B 1 278 ? 3.538   29.551  -7.651  1.00 43.79  ? 277  THR B CG2 1 
ATOM   5700 N  N   . LEU B 1 279 ? 4.983   34.010  -7.030  1.00 48.01  ? 278  LEU B N   1 
ATOM   5701 C  CA  . LEU B 1 279 ? 4.778   35.439  -7.359  1.00 50.37  ? 278  LEU B CA  1 
ATOM   5702 C  C   . LEU B 1 279 ? 5.921   36.297  -6.905  1.00 49.72  ? 278  LEU B C   1 
ATOM   5703 O  O   . LEU B 1 279 ? 6.582   35.960  -5.934  1.00 55.39  ? 278  LEU B O   1 
ATOM   5704 C  CB  . LEU B 1 279 ? 3.528   35.965  -6.670  1.00 51.95  ? 278  LEU B CB  1 
ATOM   5705 C  CG  . LEU B 1 279 ? 2.208   35.325  -7.052  1.00 55.79  ? 278  LEU B CG  1 
ATOM   5706 C  CD1 . LEU B 1 279 ? 1.110   35.908  -6.175  1.00 57.09  ? 278  LEU B CD1 1 
ATOM   5707 C  CD2 . LEU B 1 279 ? 1.910   35.528  -8.532  1.00 55.38  ? 278  LEU B CD2 1 
ATOM   5708 N  N   . THR B 1 280 ? 6.136   37.422  -7.579  1.00 51.87  ? 279  THR B N   1 
ATOM   5709 C  CA  . THR B 1 280 ? 7.198   38.363  -7.174  1.00 54.79  ? 279  THR B CA  1 
ATOM   5710 C  C   . THR B 1 280 ? 6.659   39.621  -6.509  1.00 51.37  ? 279  THR B C   1 
ATOM   5711 O  O   . THR B 1 280 ? 5.499   39.958  -6.641  1.00 46.77  ? 279  THR B O   1 
ATOM   5712 C  CB  . THR B 1 280 ? 8.133   38.786  -8.337  1.00 57.83  ? 279  THR B CB  1 
ATOM   5713 O  OG1 . THR B 1 280 ? 7.472   39.724  -9.191  1.00 55.51  ? 279  THR B OG1 1 
ATOM   5714 C  CG2 . THR B 1 280 ? 8.603   37.563  -9.137  1.00 61.35  ? 279  THR B CG2 1 
ATOM   5715 N  N   . GLY B 1 281 ? 7.557   40.312  -5.805  1.00 57.54  ? 280  GLY B N   1 
ATOM   5716 C  CA  . GLY B 1 281 ? 7.238   41.492  -5.003  1.00 53.57  ? 280  GLY B CA  1 
ATOM   5717 C  C   . GLY B 1 281 ? 6.959   42.724  -5.832  1.00 55.92  ? 280  GLY B C   1 
ATOM   5718 O  O   . GLY B 1 281 ? 6.538   43.742  -5.294  1.00 53.51  ? 280  GLY B O   1 
ATOM   5719 N  N   . LEU B 1 282 ? 7.193   42.619  -7.146  1.00 59.02  ? 281  LEU B N   1 
ATOM   5720 C  CA  . LEU B 1 282 ? 6.862   43.653  -8.122  1.00 62.32  ? 281  LEU B CA  1 
ATOM   5721 C  C   . LEU B 1 282 ? 5.451   44.183  -7.964  1.00 57.04  ? 281  LEU B C   1 
ATOM   5722 O  O   . LEU B 1 282 ? 5.170   45.334  -8.305  1.00 52.16  ? 281  LEU B O   1 
ATOM   5723 C  CB  . LEU B 1 282 ? 7.032   43.095  -9.543  1.00 72.43  ? 281  LEU B CB  1 
ATOM   5724 C  CG  . LEU B 1 282 ? 6.321   43.817  -10.719 1.00 84.39  ? 281  LEU B CG  1 
ATOM   5725 C  CD1 . LEU B 1 282 ? 7.038   45.126  -11.027 1.00 87.40  ? 281  LEU B CD1 1 
ATOM   5726 C  CD2 . LEU B 1 282 ? 6.185   42.927  -11.961 1.00 86.48  ? 281  LEU B CD2 1 
ATOM   5727 N  N   . HIS B 1 283 ? 4.561   43.322  -7.475  1.00 57.63  ? 282  HIS B N   1 
ATOM   5728 C  CA  . HIS B 1 283 ? 3.147   43.658  -7.343  1.00 55.85  ? 282  HIS B CA  1 
ATOM   5729 C  C   . HIS B 1 283 ? 2.965   44.797  -6.336  1.00 52.81  ? 282  HIS B C   1 
ATOM   5730 O  O   . HIS B 1 283 ? 1.996   45.523  -6.424  1.00 53.83  ? 282  HIS B O   1 
ATOM   5731 C  CB  . HIS B 1 283 ? 2.283   42.427  -6.991  1.00 55.11  ? 282  HIS B CB  1 
ATOM   5732 C  CG  . HIS B 1 283 ? 2.215   41.385  -8.068  1.00 56.61  ? 282  HIS B CG  1 
ATOM   5733 N  ND1 . HIS B 1 283 ? 1.237   41.367  -9.042  1.00 67.91  ? 282  HIS B ND1 1 
ATOM   5734 C  CD2 . HIS B 1 283 ? 2.993   40.302  -8.301  1.00 61.92  ? 282  HIS B CD2 1 
ATOM   5735 C  CE1 . HIS B 1 283 ? 1.433   40.329  -9.841  1.00 64.88  ? 282  HIS B CE1 1 
ATOM   5736 N  NE2 . HIS B 1 283 ? 2.489   39.665  -9.411  1.00 64.92  ? 282  HIS B NE2 1 
ATOM   5737 N  N   . TYR B 1 284 ? 3.907   44.998  -5.424  1.00 52.23  ? 283  TYR B N   1 
ATOM   5738 C  CA  . TYR B 1 284 ? 3.781   46.102  -4.462  1.00 54.83  ? 283  TYR B CA  1 
ATOM   5739 C  C   . TYR B 1 284 ? 3.996   47.447  -5.127  1.00 56.25  ? 283  TYR B C   1 
ATOM   5740 O  O   . TYR B 1 284 ? 3.774   48.501  -4.515  1.00 54.13  ? 283  TYR B O   1 
ATOM   5741 C  CB  . TYR B 1 284 ? 4.744   45.938  -3.273  1.00 56.22  ? 283  TYR B CB  1 
ATOM   5742 C  CG  . TYR B 1 284 ? 4.556   44.649  -2.514  1.00 57.84  ? 283  TYR B CG  1 
ATOM   5743 C  CD1 . TYR B 1 284 ? 3.294   44.251  -2.100  1.00 57.83  ? 283  TYR B CD1 1 
ATOM   5744 C  CD2 . TYR B 1 284 ? 5.642   43.807  -2.227  1.00 59.33  ? 283  TYR B CD2 1 
ATOM   5745 C  CE1 . TYR B 1 284 ? 3.115   43.053  -1.422  1.00 59.88  ? 283  TYR B CE1 1 
ATOM   5746 C  CE2 . TYR B 1 284 ? 5.467   42.610  -1.536  1.00 57.23  ? 283  TYR B CE2 1 
ATOM   5747 C  CZ  . TYR B 1 284 ? 4.203   42.241  -1.139  1.00 55.08  ? 283  TYR B CZ  1 
ATOM   5748 O  OH  . TYR B 1 284 ? 4.021   41.064  -0.473  1.00 55.71  ? 283  TYR B OH  1 
ATOM   5749 N  N   . TYR B 1 285 ? 4.443   47.414  -6.376  1.00 59.69  ? 284  TYR B N   1 
ATOM   5750 C  CA  . TYR B 1 285 ? 4.719   48.636  -7.110  1.00 65.37  ? 284  TYR B CA  1 
ATOM   5751 C  C   . TYR B 1 285 ? 3.716   48.831  -8.247  1.00 70.41  ? 284  TYR B C   1 
ATOM   5752 O  O   . TYR B 1 285 ? 3.928   49.669  -9.128  1.00 63.60  ? 284  TYR B O   1 
ATOM   5753 C  CB  . TYR B 1 285 ? 6.171   48.614  -7.635  1.00 63.45  ? 284  TYR B CB  1 
ATOM   5754 C  CG  . TYR B 1 285 ? 7.205   48.524  -6.543  1.00 57.04  ? 284  TYR B CG  1 
ATOM   5755 C  CD1 . TYR B 1 285 ? 7.622   47.301  -6.064  1.00 58.33  ? 284  TYR B CD1 1 
ATOM   5756 C  CD2 . TYR B 1 285 ? 7.741   49.676  -5.963  1.00 58.87  ? 284  TYR B CD2 1 
ATOM   5757 C  CE1 . TYR B 1 285 ? 8.545   47.215  -5.030  1.00 62.34  ? 284  TYR B CE1 1 
ATOM   5758 C  CE2 . TYR B 1 285 ? 8.680   49.606  -4.941  1.00 61.94  ? 284  TYR B CE2 1 
ATOM   5759 C  CZ  . TYR B 1 285 ? 9.082   48.365  -4.475  1.00 64.69  ? 284  TYR B CZ  1 
ATOM   5760 O  OH  . TYR B 1 285 ? 9.984   48.253  -3.439  1.00 60.73  ? 284  TYR B OH  1 
ATOM   5761 N  N   . HIS B 1 286 ? 2.623   48.064  -8.228  1.00 79.92  ? 285  HIS B N   1 
ATOM   5762 C  CA  . HIS B 1 286 ? 1.553   48.220  -9.230  1.00 90.33  ? 285  HIS B CA  1 
ATOM   5763 C  C   . HIS B 1 286 ? 0.857   49.560  -8.985  1.00 100.44 ? 285  HIS B C   1 
ATOM   5764 O  O   . HIS B 1 286 ? 0.855   50.072  -7.844  1.00 91.98  ? 285  HIS B O   1 
ATOM   5765 C  CB  . HIS B 1 286 ? 0.547   47.065  -9.166  1.00 86.73  ? 285  HIS B CB  1 
ATOM   5766 C  CG  . HIS B 1 286 ? -0.499  47.070  -10.258 1.00 86.71  ? 285  HIS B CG  1 
ATOM   5767 N  ND1 . HIS B 1 286 ? -1.544  47.974  -10.298 1.00 80.68  ? 285  HIS B ND1 1 
ATOM   5768 C  CD2 . HIS B 1 286 ? -0.688  46.239  -11.315 1.00 78.28  ? 285  HIS B CD2 1 
ATOM   5769 C  CE1 . HIS B 1 286 ? -2.326  47.702  -11.329 1.00 71.60  ? 285  HIS B CE1 1 
ATOM   5770 N  NE2 . HIS B 1 286 ? -1.830  46.652  -11.961 1.00 69.68  ? 285  HIS B NE2 1 
ATOM   5771 N  N   . GLN B 1 287 ? 0.292   50.115  -10.064 1.00 103.33 ? 286  GLN B N   1 
ATOM   5772 C  CA  . GLN B 1 287 ? -0.250  51.476  -10.068 1.00 102.45 ? 286  GLN B CA  1 
ATOM   5773 C  C   . GLN B 1 287 ? -1.406  51.649  -9.071  1.00 90.98  ? 286  GLN B C   1 
ATOM   5774 O  O   . GLN B 1 287 ? -1.413  52.572  -8.245  1.00 82.01  ? 286  GLN B O   1 
ATOM   5775 C  CB  . GLN B 1 287 ? -0.675  51.848  -11.488 1.00 105.39 ? 286  GLN B CB  1 
ATOM   5776 C  CG  . GLN B 1 287 ? 0.516   52.024  -12.435 1.00 108.70 ? 286  GLN B CG  1 
ATOM   5777 C  CD  . GLN B 1 287 ? 0.164   51.901  -13.918 1.00 107.52 ? 286  GLN B CD  1 
ATOM   5778 O  OE1 . GLN B 1 287 ? -0.928  51.463  -14.287 1.00 101.81 ? 286  GLN B OE1 1 
ATOM   5779 N  NE2 . GLN B 1 287 ? 1.102   52.288  -14.779 1.00 101.43 ? 286  GLN B NE2 1 
ATOM   5780 N  N   . ASP B 1 288 ? -2.381  50.758  -9.148  1.00 77.00  ? 287  ASP B N   1 
ATOM   5781 C  CA  . ASP B 1 288 ? -3.456  50.724  -8.165  1.00 71.01  ? 287  ASP B CA  1 
ATOM   5782 C  C   . ASP B 1 288 ? -2.928  50.333  -6.780  1.00 66.36  ? 287  ASP B C   1 
ATOM   5783 O  O   . ASP B 1 288 ? -2.238  49.339  -6.628  1.00 62.66  ? 287  ASP B O   1 
ATOM   5784 C  CB  . ASP B 1 288 ? -4.558  49.763  -8.636  1.00 70.62  ? 287  ASP B CB  1 
ATOM   5785 C  CG  . ASP B 1 288 ? -5.855  49.935  -7.875  1.00 75.77  ? 287  ASP B CG  1 
ATOM   5786 O  OD1 . ASP B 1 288 ? -6.157  51.070  -7.424  1.00 70.02  ? 287  ASP B OD1 1 
ATOM   5787 O  OD2 . ASP B 1 288 ? -6.580  48.917  -7.737  1.00 84.16  ? 287  ASP B OD2 1 
ATOM   5788 N  N   . TRP B 1 289 ? -3.245  51.143  -5.778  1.00 65.79  ? 288  TRP B N   1 
ATOM   5789 C  CA  . TRP B 1 289 ? -2.900  50.856  -4.384  1.00 61.73  ? 288  TRP B CA  1 
ATOM   5790 C  C   . TRP B 1 289 ? -3.593  49.594  -3.885  1.00 62.51  ? 288  TRP B C   1 
ATOM   5791 O  O   . TRP B 1 289 ? -3.021  48.829  -3.128  1.00 58.16  ? 288  TRP B O   1 
ATOM   5792 C  CB  . TRP B 1 289 ? -3.338  52.020  -3.491  1.00 60.64  ? 288  TRP B CB  1 
ATOM   5793 C  CG  . TRP B 1 289 ? -2.958  51.872  -2.036  1.00 62.84  ? 288  TRP B CG  1 
ATOM   5794 C  CD1 . TRP B 1 289 ? -1.886  52.432  -1.422  1.00 64.39  ? 288  TRP B CD1 1 
ATOM   5795 C  CD2 . TRP B 1 289 ? -3.666  51.133  -1.012  1.00 64.21  ? 288  TRP B CD2 1 
ATOM   5796 N  NE1 . TRP B 1 289 ? -1.868  52.085  -0.081  1.00 67.87  ? 288  TRP B NE1 1 
ATOM   5797 C  CE2 . TRP B 1 289 ? -2.947  51.290  0.191   1.00 58.31  ? 288  TRP B CE2 1 
ATOM   5798 C  CE3 . TRP B 1 289 ? -4.836  50.356  -1.003  1.00 67.34  ? 288  TRP B CE3 1 
ATOM   5799 C  CZ2 . TRP B 1 289 ? -3.349  50.713  1.385   1.00 58.19  ? 288  TRP B CZ2 1 
ATOM   5800 C  CZ3 . TRP B 1 289 ? -5.242  49.780  0.195   1.00 67.83  ? 288  TRP B CZ3 1 
ATOM   5801 C  CH2 . TRP B 1 289 ? -4.489  49.959  1.375   1.00 64.50  ? 288  TRP B CH2 1 
ATOM   5802 N  N   . SER B 1 290 ? -4.850  49.422  -4.284  1.00 63.96  ? 289  SER B N   1 
ATOM   5803 C  CA  . SER B 1 290 ? -5.666  48.289  -3.874  1.00 65.91  ? 289  SER B CA  1 
ATOM   5804 C  C   . SER B 1 290 ? -4.979  46.998  -4.268  1.00 63.33  ? 289  SER B C   1 
ATOM   5805 O  O   . SER B 1 290 ? -4.947  46.032  -3.487  1.00 65.08  ? 289  SER B O   1 
ATOM   5806 C  CB  . SER B 1 290 ? -7.048  48.324  -4.568  1.00 65.78  ? 289  SER B CB  1 
ATOM   5807 O  OG  . SER B 1 290 ? -7.827  49.425  -4.153  1.00 57.04  ? 289  SER B OG  1 
ATOM   5808 N  N   . HIS B 1 291 ? -4.477  46.991  -5.503  1.00 56.45  ? 290  HIS B N   1 
ATOM   5809 C  CA  . HIS B 1 291 ? -3.790  45.836  -6.078  1.00 61.77  ? 290  HIS B CA  1 
ATOM   5810 C  C   . HIS B 1 291 ? -2.505  45.525  -5.328  1.00 58.15  ? 290  HIS B C   1 
ATOM   5811 O  O   . HIS B 1 291 ? -2.253  44.381  -4.956  1.00 55.76  ? 290  HIS B O   1 
ATOM   5812 C  CB  . HIS B 1 291 ? -3.452  46.087  -7.534  1.00 65.05  ? 290  HIS B CB  1 
ATOM   5813 C  CG  . HIS B 1 291 ? -2.841  44.913  -8.216  1.00 69.51  ? 290  HIS B CG  1 
ATOM   5814 N  ND1 . HIS B 1 291 ? -3.559  44.080  -9.049  1.00 74.66  ? 290  HIS B ND1 1 
ATOM   5815 C  CD2 . HIS B 1 291 ? -1.586  44.411  -8.168  1.00 75.52  ? 290  HIS B CD2 1 
ATOM   5816 C  CE1 . HIS B 1 291 ? -2.762  43.127  -9.504  1.00 80.13  ? 290  HIS B CE1 1 
ATOM   5817 N  NE2 . HIS B 1 291 ? -1.559  43.304  -8.986  1.00 80.57  ? 290  HIS B NE2 1 
ATOM   5818 N  N   . ALA B 1 292 ? -1.716  46.557  -5.078  1.00 51.84  ? 291  ALA B N   1 
ATOM   5819 C  CA  . ALA B 1 292 ? -0.502  46.409  -4.311  1.00 48.90  ? 291  ALA B CA  1 
ATOM   5820 C  C   . ALA B 1 292 ? -0.796  45.877  -2.923  1.00 46.63  ? 291  ALA B C   1 
ATOM   5821 O  O   . ALA B 1 292 ? -0.046  45.050  -2.389  1.00 54.12  ? 291  ALA B O   1 
ATOM   5822 C  CB  . ALA B 1 292 ? 0.242   47.734  -4.237  1.00 48.82  ? 291  ALA B CB  1 
ATOM   5823 N  N   . ALA B 1 293 ? -1.888  46.338  -2.346  1.00 47.07  ? 292  ALA B N   1 
ATOM   5824 C  CA  . ALA B 1 293 ? -2.231  46.006  -0.967  1.00 51.81  ? 292  ALA B CA  1 
ATOM   5825 C  C   . ALA B 1 293 ? -2.737  44.570  -0.820  1.00 53.22  ? 292  ALA B C   1 
ATOM   5826 O  O   . ALA B 1 293 ? -2.651  43.980  0.284   1.00 52.25  ? 292  ALA B O   1 
ATOM   5827 C  CB  . ALA B 1 293 ? -3.268  46.981  -0.450  1.00 53.72  ? 292  ALA B CB  1 
ATOM   5828 N  N   . ALA B 1 294 ? -3.256  44.015  -1.924  1.00 48.49  ? 293  ALA B N   1 
ATOM   5829 C  CA  . ALA B 1 294 ? -3.818  42.667  -1.914  1.00 45.30  ? 293  ALA B CA  1 
ATOM   5830 C  C   . ALA B 1 294 ? -2.743  41.638  -1.670  1.00 43.23  ? 293  ALA B C   1 
ATOM   5831 O  O   . ALA B 1 294 ? -3.036  40.559  -1.178  1.00 46.86  ? 293  ALA B O   1 
ATOM   5832 C  CB  . ALA B 1 294 ? -4.534  42.381  -3.228  1.00 47.40  ? 293  ALA B CB  1 
ATOM   5833 N  N   . TYR B 1 295 ? -1.500  41.986  -1.996  1.00 41.21  ? 294  TYR B N   1 
ATOM   5834 C  CA  . TYR B 1 295 ? -0.359  41.084  -1.886  1.00 39.38  ? 294  TYR B CA  1 
ATOM   5835 C  C   . TYR B 1 295 ? 0.422   41.269  -0.602  1.00 39.46  ? 294  TYR B C   1 
ATOM   5836 O  O   . TYR B 1 295 ? 1.427   40.593  -0.409  1.00 42.52  ? 294  TYR B O   1 
ATOM   5837 C  CB  . TYR B 1 295 ? 0.609   41.324  -3.042  1.00 38.38  ? 294  TYR B CB  1 
ATOM   5838 C  CG  . TYR B 1 295 ? 0.050   40.898  -4.359  1.00 37.77  ? 294  TYR B CG  1 
ATOM   5839 C  CD1 . TYR B 1 295 ? -0.927  41.659  -4.986  1.00 39.21  ? 294  TYR B CD1 1 
ATOM   5840 C  CD2 . TYR B 1 295 ? 0.457   39.734  -4.964  1.00 34.23  ? 294  TYR B CD2 1 
ATOM   5841 C  CE1 . TYR B 1 295 ? -1.471  41.283  -6.193  1.00 38.54  ? 294  TYR B CE1 1 
ATOM   5842 C  CE2 . TYR B 1 295 ? -0.091  39.344  -6.159  1.00 35.69  ? 294  TYR B CE2 1 
ATOM   5843 C  CZ  . TYR B 1 295 ? -1.051  40.133  -6.774  1.00 37.38  ? 294  TYR B CZ  1 
ATOM   5844 O  OH  . TYR B 1 295 ? -1.627  39.746  -7.968  1.00 38.46  ? 294  TYR B OH  1 
ATOM   5845 N  N   . VAL B 1 296 ? -0.024  42.161  0.271   1.00 38.04  ? 295  VAL B N   1 
ATOM   5846 C  CA  . VAL B 1 296 ? 0.687   42.449  1.486   1.00 37.43  ? 295  VAL B CA  1 
ATOM   5847 C  C   . VAL B 1 296 ? 0.477   41.309  2.492   1.00 41.35  ? 295  VAL B C   1 
ATOM   5848 O  O   . VAL B 1 296 ? -0.612  41.111  3.015   1.00 38.47  ? 295  VAL B O   1 
ATOM   5849 C  CB  . VAL B 1 296 ? 0.250   43.804  2.087   1.00 39.82  ? 295  VAL B CB  1 
ATOM   5850 C  CG1 . VAL B 1 296 ? 0.777   44.010  3.502   1.00 41.39  ? 295  VAL B CG1 1 
ATOM   5851 C  CG2 . VAL B 1 296 ? 0.751   44.933  1.222   1.00 41.24  ? 295  VAL B CG2 1 
ATOM   5852 N  N   . THR B 1 297 ? 1.547   40.558  2.743   1.00 45.85  ? 296  THR B N   1 
ATOM   5853 C  CA  . THR B 1 297 ? 1.586   39.519  3.761   1.00 43.09  ? 296  THR B CA  1 
ATOM   5854 C  C   . THR B 1 297 ? 3.000   39.606  4.283   1.00 41.72  ? 296  THR B C   1 
ATOM   5855 O  O   . THR B 1 297 ? 3.757   40.471  3.840   1.00 40.56  ? 296  THR B O   1 
ATOM   5856 C  CB  . THR B 1 297 ? 1.269   38.134  3.163   1.00 44.23  ? 296  THR B CB  1 
ATOM   5857 O  OG1 . THR B 1 297 ? 0.998   37.184  4.205   1.00 44.52  ? 296  THR B OG1 1 
ATOM   5858 C  CG2 . THR B 1 297 ? 2.389   37.631  2.321   1.00 43.89  ? 296  THR B CG2 1 
ATOM   5859 N  N   . VAL B 1 298 ? 3.357   38.745  5.225   1.00 39.45  ? 297  VAL B N   1 
ATOM   5860 C  CA  . VAL B 1 298 ? 4.732   38.653  5.676   1.00 38.05  ? 297  VAL B CA  1 
ATOM   5861 C  C   . VAL B 1 298 ? 5.193   37.207  5.866   1.00 38.87  ? 297  VAL B C   1 
ATOM   5862 O  O   . VAL B 1 298 ? 4.388   36.344  6.193   1.00 38.33  ? 297  VAL B O   1 
ATOM   5863 C  CB  . VAL B 1 298 ? 4.955   39.384  7.000   1.00 39.09  ? 297  VAL B CB  1 
ATOM   5864 C  CG1 . VAL B 1 298 ? 4.710   40.873  6.809   1.00 41.75  ? 297  VAL B CG1 1 
ATOM   5865 C  CG2 . VAL B 1 298 ? 4.086   38.802  8.110   1.00 38.19  ? 297  VAL B CG2 1 
ATOM   5866 N  N   . PRO B 1 299 ? 6.488   36.930  5.633   1.00 37.79  ? 298  PRO B N   1 
ATOM   5867 C  CA  . PRO B 1 299 ? 7.423   37.889  5.064   1.00 37.82  ? 298  PRO B CA  1 
ATOM   5868 C  C   . PRO B 1 299 ? 6.977   38.212  3.644   1.00 36.02  ? 298  PRO B C   1 
ATOM   5869 O  O   . PRO B 1 299 ? 6.329   37.411  3.015   1.00 34.12  ? 298  PRO B O   1 
ATOM   5870 C  CB  . PRO B 1 299 ? 8.768   37.161  5.083   1.00 38.31  ? 298  PRO B CB  1 
ATOM   5871 C  CG  . PRO B 1 299 ? 8.560   35.900  5.866   1.00 37.80  ? 298  PRO B CG  1 
ATOM   5872 C  CD  . PRO B 1 299 ? 7.099   35.610  5.831   1.00 37.44  ? 298  PRO B CD  1 
ATOM   5873 N  N   . PRO B 1 300 ? 7.299   39.405  3.166   1.00 36.76  ? 299  PRO B N   1 
ATOM   5874 C  CA  . PRO B 1 300 ? 6.709   39.835  1.920   1.00 35.13  ? 299  PRO B CA  1 
ATOM   5875 C  C   . PRO B 1 300 ? 7.228   39.045  0.727   1.00 33.57  ? 299  PRO B C   1 
ATOM   5876 O  O   . PRO B 1 300 ? 8.311   38.496  0.789   1.00 34.03  ? 299  PRO B O   1 
ATOM   5877 C  CB  . PRO B 1 300 ? 7.133   41.321  1.835   1.00 36.58  ? 299  PRO B CB  1 
ATOM   5878 C  CG  . PRO B 1 300 ? 8.362   41.445  2.658   1.00 35.74  ? 299  PRO B CG  1 
ATOM   5879 C  CD  . PRO B 1 300 ? 8.299   40.365  3.702   1.00 37.09  ? 299  PRO B CD  1 
ATOM   5880 N  N   . LEU B 1 301 ? 6.453   39.015  -0.349  1.00 35.51  ? 300  LEU B N   1 
ATOM   5881 C  CA  . LEU B 1 301 ? 6.954   38.614  -1.660  1.00 35.77  ? 300  LEU B CA  1 
ATOM   5882 C  C   . LEU B 1 301 ? 8.161   39.487  -1.976  1.00 40.07  ? 300  LEU B C   1 
ATOM   5883 O  O   . LEU B 1 301 ? 8.165   40.697  -1.686  1.00 42.07  ? 300  LEU B O   1 
ATOM   5884 C  CB  . LEU B 1 301 ? 5.918   38.850  -2.738  1.00 33.74  ? 300  LEU B CB  1 
ATOM   5885 C  CG  . LEU B 1 301 ? 4.596   38.105  -2.615  1.00 34.04  ? 300  LEU B CG  1 
ATOM   5886 C  CD1 . LEU B 1 301 ? 3.687   38.483  -3.779  1.00 34.22  ? 300  LEU B CD1 1 
ATOM   5887 C  CD2 . LEU B 1 301 ? 4.818   36.605  -2.578  1.00 36.28  ? 300  LEU B CD2 1 
ATOM   5888 N  N   . ARG B 1 302 ? 9.204   38.862  -2.513  1.00 40.96  ? 301  ARG B N   1 
ATOM   5889 C  CA  . ARG B 1 302 ? 10.499  39.520  -2.659  1.00 42.34  ? 301  ARG B CA  1 
ATOM   5890 C  C   . ARG B 1 302 ? 10.629  40.054  -4.053  1.00 45.17  ? 301  ARG B C   1 
ATOM   5891 O  O   . ARG B 1 302 ? 10.159  39.450  -4.996  1.00 48.35  ? 301  ARG B O   1 
ATOM   5892 C  CB  . ARG B 1 302 ? 11.664  38.566  -2.349  1.00 39.86  ? 301  ARG B CB  1 
ATOM   5893 C  CG  . ARG B 1 302 ? 11.607  37.939  -0.970  1.00 37.97  ? 301  ARG B CG  1 
ATOM   5894 C  CD  . ARG B 1 302 ? 11.616  39.002  0.128   1.00 37.56  ? 301  ARG B CD  1 
ATOM   5895 N  NE  . ARG B 1 302 ? 11.688  38.385  1.445   1.00 35.98  ? 301  ARG B NE  1 
ATOM   5896 C  CZ  . ARG B 1 302 ? 11.735  39.050  2.578   1.00 33.52  ? 301  ARG B CZ  1 
ATOM   5897 N  NH1 . ARG B 1 302 ? 11.747  40.378  2.577   1.00 32.80  ? 301  ARG B NH1 1 
ATOM   5898 N  NH2 . ARG B 1 302 ? 11.778  38.378  3.717   1.00 37.26  ? 301  ARG B NH2 1 
ATOM   5899 N  N   . LEU B 1 303 ? 11.274  41.203  -4.172  1.00 49.50  ? 302  LEU B N   1 
ATOM   5900 C  CA  . LEU B 1 303 ? 11.433  41.875  -5.444  1.00 51.08  ? 302  LEU B CA  1 
ATOM   5901 C  C   . LEU B 1 303 ? 12.274  41.074  -6.443  1.00 49.19  ? 302  LEU B C   1 
ATOM   5902 O  O   . LEU B 1 303 ? 11.973  41.065  -7.635  1.00 45.71  ? 302  LEU B O   1 
ATOM   5903 C  CB  . LEU B 1 303 ? 12.090  43.237  -5.208  1.00 52.83  ? 302  LEU B CB  1 
ATOM   5904 C  CG  . LEU B 1 303 ? 12.101  44.241  -6.363  1.00 56.38  ? 302  LEU B CG  1 
ATOM   5905 C  CD1 . LEU B 1 303 ? 10.753  44.358  -7.079  1.00 58.07  ? 302  LEU B CD1 1 
ATOM   5906 C  CD2 . LEU B 1 303 ? 12.522  45.597  -5.816  1.00 55.48  ? 302  LEU B CD2 1 
ATOM   5907 N  N   . ASP B 1 304 ? 13.322  40.415  -5.955  1.00 50.57  ? 303  ASP B N   1 
ATOM   5908 C  CA  . ASP B 1 304 ? 14.196  39.641  -6.817  1.00 52.46  ? 303  ASP B CA  1 
ATOM   5909 C  C   . ASP B 1 304 ? 13.348  38.700  -7.649  1.00 53.41  ? 303  ASP B C   1 
ATOM   5910 O  O   . ASP B 1 304 ? 12.577  37.926  -7.121  1.00 61.51  ? 303  ASP B O   1 
ATOM   5911 C  CB  . ASP B 1 304 ? 15.244  38.875  -6.008  1.00 53.88  ? 303  ASP B CB  1 
ATOM   5912 C  CG  . ASP B 1 304 ? 16.215  38.092  -6.895  1.00 56.79  ? 303  ASP B CG  1 
ATOM   5913 O  OD1 . ASP B 1 304 ? 15.851  37.773  -8.041  1.00 54.60  ? 303  ASP B OD1 1 
ATOM   5914 O  OD2 . ASP B 1 304 ? 17.349  37.782  -6.460  1.00 51.58  ? 303  ASP B OD2 1 
ATOM   5915 N  N   . THR B 1 305 ? 13.496  38.817  -8.960  1.00 58.35  ? 304  THR B N   1 
ATOM   5916 C  CA  . THR B 1 305 ? 12.760  38.047  -9.966  1.00 57.70  ? 304  THR B CA  1 
ATOM   5917 C  C   . THR B 1 305 ? 12.930  36.541  -9.828  1.00 54.84  ? 304  THR B C   1 
ATOM   5918 O  O   . THR B 1 305 ? 12.014  35.791  -10.172 1.00 44.21  ? 304  THR B O   1 
ATOM   5919 C  CB  . THR B 1 305 ? 13.279  38.433  -11.378 1.00 63.40  ? 304  THR B CB  1 
ATOM   5920 O  OG1 . THR B 1 305 ? 12.964  39.805  -11.653 1.00 63.04  ? 304  THR B OG1 1 
ATOM   5921 C  CG2 . THR B 1 305 ? 12.699  37.534  -12.479 1.00 67.28  ? 304  THR B CG2 1 
ATOM   5922 N  N   . ASN B 1 306 ? 14.107  36.111  -9.359  1.00 56.13  ? 305  ASN B N   1 
ATOM   5923 C  CA  . ASN B 1 306 ? 14.455  34.673  -9.309  1.00 62.18  ? 305  ASN B CA  1 
ATOM   5924 C  C   . ASN B 1 306 ? 13.963  33.909  -8.096  1.00 60.95  ? 305  ASN B C   1 
ATOM   5925 O  O   . ASN B 1 306 ? 14.144  32.682  -8.044  1.00 62.94  ? 305  ASN B O   1 
ATOM   5926 C  CB  . ASN B 1 306 ? 15.973  34.474  -9.377  1.00 65.13  ? 305  ASN B CB  1 
ATOM   5927 C  CG  . ASN B 1 306 ? 16.517  34.685  -10.771 1.00 69.42  ? 305  ASN B CG  1 
ATOM   5928 O  OD1 . ASN B 1 306 ? 15.942  34.232  -11.761 1.00 64.14  ? 305  ASN B OD1 1 
ATOM   5929 N  ND2 . ASN B 1 306 ? 17.637  35.383  -10.853 1.00 76.60  ? 305  ASN B ND2 1 
ATOM   5930 N  N   . THR B 1 307 ? 13.351  34.614  -7.135  1.00 56.10  ? 306  THR B N   1 
ATOM   5931 C  CA  . THR B 1 307 ? 13.015  34.031  -5.843  1.00 51.81  ? 306  THR B CA  1 
ATOM   5932 C  C   . THR B 1 307 ? 11.940  32.971  -5.927  1.00 50.40  ? 306  THR B C   1 
ATOM   5933 O  O   . THR B 1 307 ? 12.123  31.871  -5.396  1.00 50.54  ? 306  THR B O   1 
ATOM   5934 C  CB  . THR B 1 307 ? 12.578  35.090  -4.847  1.00 53.41  ? 306  THR B CB  1 
ATOM   5935 O  OG1 . THR B 1 307 ? 13.612  36.083  -4.727  1.00 55.60  ? 306  THR B OG1 1 
ATOM   5936 C  CG2 . THR B 1 307 ? 12.330  34.470  -3.479  1.00 55.60  ? 306  THR B CG2 1 
ATOM   5937 N  N   . SER B 1 308 ? 10.849  33.258  -6.625  1.00 50.06  ? 307  SER B N   1 
ATOM   5938 C  CA  . SER B 1 308 ? 9.741   32.292  -6.735  1.00 52.16  ? 307  SER B CA  1 
ATOM   5939 C  C   . SER B 1 308 ? 10.202  30.990  -7.397  1.00 50.81  ? 307  SER B C   1 
ATOM   5940 O  O   . SER B 1 308 ? 10.017  29.903  -6.848  1.00 47.68  ? 307  SER B O   1 
ATOM   5941 C  CB  . SER B 1 308 ? 8.550   32.903  -7.486  1.00 52.61  ? 307  SER B CB  1 
ATOM   5942 O  OG  . SER B 1 308 ? 8.854   33.109  -8.848  1.00 51.26  ? 307  SER B OG  1 
ATOM   5943 N  N   . THR B 1 309 ? 10.846  31.129  -8.551  1.00 53.03  ? 308  THR B N   1 
ATOM   5944 C  CA  . THR B 1 309 ? 11.479  30.008  -9.260  1.00 53.17  ? 308  THR B CA  1 
ATOM   5945 C  C   . THR B 1 309 ? 12.318  29.129  -8.312  1.00 50.21  ? 308  THR B C   1 
ATOM   5946 O  O   . THR B 1 309 ? 12.249  27.909  -8.375  1.00 51.62  ? 308  THR B O   1 
ATOM   5947 C  CB  . THR B 1 309 ? 12.413  30.537  -10.385 1.00 57.05  ? 308  THR B CB  1 
ATOM   5948 O  OG1 . THR B 1 309 ? 11.650  31.281  -11.334 1.00 51.84  ? 308  THR B OG1 1 
ATOM   5949 C  CG2 . THR B 1 309 ? 13.166  29.392  -11.108 1.00 59.71  ? 308  THR B CG2 1 
ATOM   5950 N  N   . TYR B 1 310 ? 13.128  29.773  -7.461  1.00 44.73  ? 309  TYR B N   1 
ATOM   5951 C  CA  . TYR B 1 310 ? 14.076  29.084  -6.564  1.00 43.93  ? 309  TYR B CA  1 
ATOM   5952 C  C   . TYR B 1 310 ? 13.379  28.376  -5.419  1.00 45.97  ? 309  TYR B C   1 
ATOM   5953 O  O   . TYR B 1 310 ? 13.775  27.271  -5.023  1.00 39.75  ? 309  TYR B O   1 
ATOM   5954 C  CB  . TYR B 1 310 ? 15.049  30.095  -5.979  1.00 46.88  ? 309  TYR B CB  1 
ATOM   5955 C  CG  . TYR B 1 310 ? 16.197  29.499  -5.182  1.00 52.21  ? 309  TYR B CG  1 
ATOM   5956 C  CD1 . TYR B 1 310 ? 17.235  28.830  -5.832  1.00 57.55  ? 309  TYR B CD1 1 
ATOM   5957 C  CD2 . TYR B 1 310 ? 16.284  29.659  -3.786  1.00 54.78  ? 309  TYR B CD2 1 
ATOM   5958 C  CE1 . TYR B 1 310 ? 18.316  28.314  -5.128  1.00 57.91  ? 309  TYR B CE1 1 
ATOM   5959 C  CE2 . TYR B 1 310 ? 17.352  29.135  -3.063  1.00 55.12  ? 309  TYR B CE2 1 
ATOM   5960 C  CZ  . TYR B 1 310 ? 18.370  28.467  -3.748  1.00 59.42  ? 309  TYR B CZ  1 
ATOM   5961 O  OH  . TYR B 1 310 ? 19.458  27.941  -3.088  1.00 60.03  ? 309  TYR B OH  1 
ATOM   5962 N  N   . LEU B 1 311 ? 12.347  29.034  -4.862  1.00 44.88  ? 310  LEU B N   1 
ATOM   5963 C  CA  . LEU B 1 311 ? 11.559  28.439  -3.783  1.00 39.59  ? 310  LEU B CA  1 
ATOM   5964 C  C   . LEU B 1 311 ? 10.835  27.220  -4.300  1.00 38.42  ? 310  LEU B C   1 
ATOM   5965 O  O   . LEU B 1 311 ? 10.830  26.185  -3.636  1.00 39.83  ? 310  LEU B O   1 
ATOM   5966 C  CB  . LEU B 1 311 ? 10.594  29.440  -3.167  1.00 37.29  ? 310  LEU B CB  1 
ATOM   5967 C  CG  . LEU B 1 311 ? 11.280  30.595  -2.425  1.00 36.91  ? 310  LEU B CG  1 
ATOM   5968 C  CD1 . LEU B 1 311 ? 10.270  31.536  -1.767  1.00 39.38  ? 310  LEU B CD1 1 
ATOM   5969 C  CD2 . LEU B 1 311 ? 12.265  30.085  -1.410  1.00 34.55  ? 310  LEU B CD2 1 
ATOM   5970 N  N   . MET B 1 312 ? 10.282  27.311  -5.506  1.00 36.47  ? 311  MET B N   1 
ATOM   5971 C  CA  . MET B 1 312 ? 9.715   26.125  -6.169  1.00 37.52  ? 311  MET B CA  1 
ATOM   5972 C  C   . MET B 1 312 ? 10.722  24.963  -6.341  1.00 38.26  ? 311  MET B C   1 
ATOM   5973 O  O   . MET B 1 312 ? 10.366  23.793  -6.200  1.00 36.69  ? 311  MET B O   1 
ATOM   5974 C  CB  . MET B 1 312 ? 9.124   26.520  -7.518  1.00 38.74  ? 311  MET B CB  1 
ATOM   5975 C  CG  . MET B 1 312 ? 8.302   25.431  -8.197  1.00 40.61  ? 311  MET B CG  1 
ATOM   5976 S  SD  . MET B 1 312 ? 6.790   25.019  -7.312  1.00 43.26  ? 311  MET B SD  1 
ATOM   5977 C  CE  . MET B 1 312 ? 5.838   26.508  -7.616  1.00 42.05  ? 311  MET B CE  1 
ATOM   5978 N  N   . SER B 1 313 ? 11.974  25.290  -6.665  1.00 42.01  ? 312  SER B N   1 
ATOM   5979 C  CA  . SER B 1 313 ? 13.033  24.273  -6.850  1.00 42.24  ? 312  SER B CA  1 
ATOM   5980 C  C   . SER B 1 313 ? 13.305  23.567  -5.563  1.00 36.65  ? 312  SER B C   1 
ATOM   5981 O  O   . SER B 1 313 ? 13.417  22.355  -5.538  1.00 33.88  ? 312  SER B O   1 
ATOM   5982 C  CB  . SER B 1 313 ? 14.342  24.890  -7.359  1.00 44.58  ? 312  SER B CB  1 
ATOM   5983 O  OG  . SER B 1 313 ? 14.212  25.296  -8.711  1.00 50.83  ? 312  SER B OG  1 
ATOM   5984 N  N   . LEU B 1 314 ? 13.427  24.360  -4.507  1.00 36.40  ? 313  LEU B N   1 
ATOM   5985 C  CA  . LEU B 1 314 ? 13.638  23.857  -3.139  1.00 40.12  ? 313  LEU B CA  1 
ATOM   5986 C  C   . LEU B 1 314 ? 12.481  22.945  -2.680  1.00 39.88  ? 313  LEU B C   1 
ATOM   5987 O  O   . LEU B 1 314 ? 12.682  21.937  -2.003  1.00 34.54  ? 313  LEU B O   1 
ATOM   5988 C  CB  . LEU B 1 314 ? 13.782  25.047  -2.184  1.00 43.91  ? 313  LEU B CB  1 
ATOM   5989 C  CG  . LEU B 1 314 ? 15.187  25.576  -1.894  1.00 47.56  ? 313  LEU B CG  1 
ATOM   5990 C  CD1 . LEU B 1 314 ? 16.043  25.687  -3.147  1.00 49.30  ? 313  LEU B CD1 1 
ATOM   5991 C  CD2 . LEU B 1 314 ? 15.122  26.936  -1.214  1.00 49.26  ? 313  LEU B CD2 1 
ATOM   5992 N  N   . LEU B 1 315 ? 11.267  23.342  -3.071  1.00 41.52  ? 314  LEU B N   1 
ATOM   5993 C  CA  . LEU B 1 315 ? 10.029  22.606  -2.797  1.00 39.76  ? 314  LEU B CA  1 
ATOM   5994 C  C   . LEU B 1 315 ? 10.031  21.235  -3.446  1.00 39.88  ? 314  LEU B C   1 
ATOM   5995 O  O   . LEU B 1 315 ? 9.666   20.235  -2.824  1.00 37.68  ? 314  LEU B O   1 
ATOM   5996 C  CB  . LEU B 1 315 ? 8.836   23.411  -3.316  1.00 40.14  ? 314  LEU B CB  1 
ATOM   5997 C  CG  . LEU B 1 315 ? 7.478   23.212  -2.659  1.00 44.56  ? 314  LEU B CG  1 
ATOM   5998 C  CD1 . LEU B 1 315 ? 7.583   23.022  -1.150  1.00 44.30  ? 314  LEU B CD1 1 
ATOM   5999 C  CD2 . LEU B 1 315 ? 6.621   24.428  -2.977  1.00 45.53  ? 314  LEU B CD2 1 
ATOM   6000 N  N   . ALA B 1 316 ? 10.476  21.218  -4.703  1.00 40.28  ? 315  ALA B N   1 
ATOM   6001 C  CA  . ALA B 1 316 ? 10.672  20.010  -5.466  1.00 38.35  ? 315  ALA B CA  1 
ATOM   6002 C  C   . ALA B 1 316 ? 11.799  19.215  -4.877  1.00 40.76  ? 315  ALA B C   1 
ATOM   6003 O  O   . ALA B 1 316 ? 11.833  17.985  -4.990  1.00 40.40  ? 315  ALA B O   1 
ATOM   6004 C  CB  . ALA B 1 316 ? 11.003  20.378  -6.893  1.00 39.07  ? 315  ALA B CB  1 
ATOM   6005 N  N   . ASN B 1 317 ? 12.725  19.927  -4.244  1.00 44.52  ? 316  ASN B N   1 
ATOM   6006 C  CA  . ASN B 1 317 ? 13.927  19.333  -3.698  1.00 53.36  ? 316  ASN B CA  1 
ATOM   6007 C  C   . ASN B 1 317 ? 13.767  18.782  -2.251  1.00 54.96  ? 316  ASN B C   1 
ATOM   6008 O  O   . ASN B 1 317 ? 14.484  17.877  -1.864  1.00 52.73  ? 316  ASN B O   1 
ATOM   6009 C  CB  . ASN B 1 317 ? 15.041  20.373  -3.767  1.00 58.64  ? 316  ASN B CB  1 
ATOM   6010 C  CG  . ASN B 1 317 ? 16.438  19.762  -3.660  1.00 66.38  ? 316  ASN B CG  1 
ATOM   6011 O  OD1 . ASN B 1 317 ? 16.592  18.544  -3.662  1.00 74.90  ? 316  ASN B OD1 1 
ATOM   6012 N  ND2 . ASN B 1 317 ? 17.463  20.611  -3.600  1.00 72.25  ? 316  ASN B ND2 1 
ATOM   6013 N  N   . ASP B 1 318 ? 12.831  19.328  -1.475  1.00 54.84  ? 317  ASP B N   1 
ATOM   6014 C  CA  . ASP B 1 318 ? 12.561  18.915  -0.082  1.00 46.70  ? 317  ASP B CA  1 
ATOM   6015 C  C   . ASP B 1 318 ? 13.414  19.672  0.888   1.00 44.42  ? 317  ASP B C   1 
ATOM   6016 O  O   . ASP B 1 318 ? 13.508  19.325  2.065   1.00 45.00  ? 317  ASP B O   1 
ATOM   6017 C  CB  . ASP B 1 318 ? 12.654  17.399  0.168   1.00 45.02  ? 317  ASP B CB  1 
ATOM   6018 C  CG  . ASP B 1 318 ? 11.671  16.943  1.280   1.00 42.57  ? 317  ASP B CG  1 
ATOM   6019 O  OD1 . ASP B 1 318 ? 11.356  17.778  2.094   1.00 49.64  ? 317  ASP B OD1 1 
ATOM   6020 O  OD2 . ASP B 1 318 ? 11.119  15.836  1.342   1.00 37.76  ? 317  ASP B OD2 1 
ATOM   6021 N  N   . THR B 1 319 ? 14.028  20.730  0.383   1.00 43.65  ? 318  THR B N   1 
ATOM   6022 C  CA  . THR B 1 319 ? 14.504  21.793  1.231   1.00 43.57  ? 318  THR B CA  1 
ATOM   6023 C  C   . THR B 1 319 ? 13.283  22.418  1.880   1.00 41.01  ? 318  THR B C   1 
ATOM   6024 O  O   . THR B 1 319 ? 13.260  22.745  3.053   1.00 42.97  ? 318  THR B O   1 
ATOM   6025 C  CB  . THR B 1 319 ? 15.182  22.836  0.371   1.00 44.61  ? 318  THR B CB  1 
ATOM   6026 O  OG1 . THR B 1 319 ? 16.039  22.161  -0.535  1.00 46.75  ? 318  THR B OG1 1 
ATOM   6027 C  CG2 . THR B 1 319 ? 15.946  23.835  1.225   1.00 48.31  ? 318  THR B CG2 1 
ATOM   6028 N  N   . LEU B 1 320 ? 12.256  22.595  1.081   1.00 38.57  ? 319  LEU B N   1 
ATOM   6029 C  CA  . LEU B 1 320 ? 10.975  22.992  1.578   1.00 34.72  ? 319  LEU B CA  1 
ATOM   6030 C  C   . LEU B 1 320 ? 10.076  21.769  1.449   1.00 34.59  ? 319  LEU B C   1 
ATOM   6031 O  O   . LEU B 1 320 ? 10.021  21.137  0.429   1.00 33.88  ? 319  LEU B O   1 
ATOM   6032 C  CB  . LEU B 1 320 ? 10.432  24.162  0.776   1.00 34.19  ? 319  LEU B CB  1 
ATOM   6033 C  CG  . LEU B 1 320 ? 11.312  25.402  0.789   1.00 36.02  ? 319  LEU B CG  1 
ATOM   6034 C  CD1 . LEU B 1 320 ? 10.656  26.523  0.031   1.00 35.37  ? 319  LEU B CD1 1 
ATOM   6035 C  CD2 . LEU B 1 320 ? 11.634  25.867  2.209   1.00 38.95  ? 319  LEU B CD2 1 
ATOM   6036 N  N   . ASN B 1 321 ? 9.388   21.428  2.518   1.00 34.38  ? 320  ASN B N   1 
ATOM   6037 C  CA  . ASN B 1 321 ? 8.693   20.178  2.604   1.00 33.86  ? 320  ASN B CA  1 
ATOM   6038 C  C   . ASN B 1 321 ? 7.238   20.311  2.197   1.00 37.30  ? 320  ASN B C   1 
ATOM   6039 O  O   . ASN B 1 321 ? 6.643   19.348  1.700   1.00 42.13  ? 320  ASN B O   1 
ATOM   6040 C  CB  . ASN B 1 321 ? 8.737   19.676  4.039   1.00 33.85  ? 320  ASN B CB  1 
ATOM   6041 C  CG  . ASN B 1 321 ? 10.135  19.517  4.569   1.00 32.78  ? 320  ASN B CG  1 
ATOM   6042 O  OD1 . ASN B 1 321 ? 10.785  20.479  4.925   1.00 30.75  ? 320  ASN B OD1 1 
ATOM   6043 N  ND2 . ASN B 1 321 ? 10.575  18.293  4.691   1.00 35.93  ? 320  ASN B ND2 1 
ATOM   6044 N  N   . ILE B 1 322 ? 6.639   21.475  2.477   1.00 35.84  ? 321  ILE B N   1 
ATOM   6045 C  CA  . ILE B 1 322 ? 5.202   21.618  2.456   1.00 34.90  ? 321  ILE B CA  1 
ATOM   6046 C  C   . ILE B 1 322 ? 4.829   22.942  1.856   1.00 36.93  ? 321  ILE B C   1 
ATOM   6047 O  O   . ILE B 1 322 ? 5.463   23.934  2.151   1.00 41.79  ? 321  ILE B O   1 
ATOM   6048 C  CB  . ILE B 1 322 ? 4.643   21.545  3.900   1.00 36.04  ? 321  ILE B CB  1 
ATOM   6049 C  CG1 . ILE B 1 322 ? 4.738   20.102  4.416   1.00 33.67  ? 321  ILE B CG1 1 
ATOM   6050 C  CG2 . ILE B 1 322 ? 3.201   22.047  3.952   1.00 40.12  ? 321  ILE B CG2 1 
ATOM   6051 C  CD1 . ILE B 1 322 ? 4.533   19.936  5.889   1.00 32.59  ? 321  ILE B CD1 1 
ATOM   6052 N  N   . VAL B 1 323 ? 3.792   22.961  1.022   1.00 38.03  ? 322  VAL B N   1 
ATOM   6053 C  CA  . VAL B 1 323 ? 3.245   24.211  0.541   1.00 38.57  ? 322  VAL B CA  1 
ATOM   6054 C  C   . VAL B 1 323 ? 1.850   24.415  1.122   1.00 38.33  ? 322  VAL B C   1 
ATOM   6055 O  O   . VAL B 1 323 ? 1.048   23.499  1.109   1.00 38.90  ? 322  VAL B O   1 
ATOM   6056 C  CB  . VAL B 1 323 ? 3.219   24.302  -1.006  1.00 39.15  ? 322  VAL B CB  1 
ATOM   6057 C  CG1 . VAL B 1 323 ? 2.325   23.252  -1.637  1.00 36.95  ? 322  VAL B CG1 1 
ATOM   6058 C  CG2 . VAL B 1 323 ? 2.766   25.691  -1.436  1.00 40.77  ? 322  VAL B CG2 1 
ATOM   6059 N  N   . ALA B 1 324 ? 1.583   25.626  1.624   1.00 38.25  ? 323  ALA B N   1 
ATOM   6060 C  CA  . ALA B 1 324 ? 0.294   25.989  2.222   1.00 36.60  ? 323  ALA B CA  1 
ATOM   6061 C  C   . ALA B 1 324 ? -0.220  27.256  1.601   1.00 38.23  ? 323  ALA B C   1 
ATOM   6062 O  O   . ALA B 1 324 ? 0.507   27.923  0.869   1.00 39.11  ? 323  ALA B O   1 
ATOM   6063 C  CB  . ALA B 1 324 ? 0.443   26.187  3.723   1.00 35.62  ? 323  ALA B CB  1 
ATOM   6064 N  N   . SER B 1 325 ? -1.486  27.582  1.875   1.00 39.71  ? 324  SER B N   1 
ATOM   6065 C  CA  . SER B 1 325 ? -2.114  28.843  1.415   1.00 36.82  ? 324  SER B CA  1 
ATOM   6066 C  C   . SER B 1 325 ? -1.823  30.013  2.363   1.00 37.19  ? 324  SER B C   1 
ATOM   6067 O  O   . SER B 1 325 ? -1.595  31.122  1.898   1.00 41.14  ? 324  SER B O   1 
ATOM   6068 C  CB  . SER B 1 325 ? -3.629  28.686  1.284   1.00 35.96  ? 324  SER B CB  1 
ATOM   6069 O  OG  . SER B 1 325 ? -4.228  28.352  2.543   1.00 37.71  ? 324  SER B OG  1 
ATOM   6070 N  N   . ASP B 1 326 ? -1.812  29.764  3.681   1.00 38.27  ? 325  ASP B N   1 
ATOM   6071 C  CA  . ASP B 1 326 ? -1.754  30.824  4.709   1.00 37.67  ? 325  ASP B CA  1 
ATOM   6072 C  C   . ASP B 1 326 ? -2.940  31.758  4.552   1.00 37.62  ? 325  ASP B C   1 
ATOM   6073 O  O   . ASP B 1 326 ? -2.842  33.002  4.649   1.00 39.73  ? 325  ASP B O   1 
ATOM   6074 C  CB  . ASP B 1 326 ? -0.425  31.588  4.610   1.00 39.07  ? 325  ASP B CB  1 
ATOM   6075 C  CG  . ASP B 1 326 ? -0.116  32.387  5.862   1.00 38.83  ? 325  ASP B CG  1 
ATOM   6076 O  OD1 . ASP B 1 326 ? -0.314  31.865  6.979   1.00 38.49  ? 325  ASP B OD1 1 
ATOM   6077 O  OD2 . ASP B 1 326 ? 0.345   33.537  5.706   1.00 38.35  ? 325  ASP B OD2 1 
ATOM   6078 N  N   . HIS B 1 327 ? -4.055  31.140  4.205   1.00 36.64  ? 326  HIS B N   1 
ATOM   6079 C  CA  . HIS B 1 327 ? -5.240  31.856  3.777   1.00 35.45  ? 326  HIS B CA  1 
ATOM   6080 C  C   . HIS B 1 327 ? -5.655  32.799  4.875   1.00 33.67  ? 326  HIS B C   1 
ATOM   6081 O  O   . HIS B 1 327 ? -5.902  32.393  6.000   1.00 31.26  ? 326  HIS B O   1 
ATOM   6082 C  CB  . HIS B 1 327 ? -6.351  30.856  3.548   1.00 36.64  ? 326  HIS B CB  1 
ATOM   6083 C  CG  . HIS B 1 327 ? -7.561  31.431  2.913   1.00 36.81  ? 326  HIS B CG  1 
ATOM   6084 N  ND1 . HIS B 1 327 ? -7.554  31.902  1.628   1.00 35.67  ? 326  HIS B ND1 1 
ATOM   6085 C  CD2 . HIS B 1 327 ? -8.831  31.562  3.357   1.00 37.80  ? 326  HIS B CD2 1 
ATOM   6086 C  CE1 . HIS B 1 327 ? -8.766  32.292  1.294   1.00 36.10  ? 326  HIS B CE1 1 
ATOM   6087 N  NE2 . HIS B 1 327 ? -9.561  32.102  2.330   1.00 37.53  ? 326  HIS B NE2 1 
ATOM   6088 N  N   . ARG B 1 328 ? -5.758  34.062  4.515   1.00 34.14  ? 327  ARG B N   1 
ATOM   6089 C  CA  . ARG B 1 328 ? -6.322  35.039  5.414   1.00 33.31  ? 327  ARG B CA  1 
ATOM   6090 C  C   . ARG B 1 328 ? -6.787  36.277  4.649   1.00 31.95  ? 327  ARG B C   1 
ATOM   6091 O  O   . ARG B 1 328 ? -6.206  37.330  4.793   1.00 30.06  ? 327  ARG B O   1 
ATOM   6092 C  CB  . ARG B 1 328 ? -5.307  35.418  6.499   1.00 35.08  ? 327  ARG B CB  1 
ATOM   6093 C  CG  . ARG B 1 328 ? -5.864  36.440  7.464   1.00 37.56  ? 327  ARG B CG  1 
ATOM   6094 C  CD  . ARG B 1 328 ? -5.168  36.453  8.791   1.00 39.89  ? 327  ARG B CD  1 
ATOM   6095 N  NE  . ARG B 1 328 ? -3.782  36.860  8.606   1.00 45.94  ? 327  ARG B NE  1 
ATOM   6096 C  CZ  . ARG B 1 328 ? -2.801  36.632  9.477   1.00 46.63  ? 327  ARG B CZ  1 
ATOM   6097 N  NH1 . ARG B 1 328 ? -3.018  36.037  10.647  1.00 45.56  ? 327  ARG B NH1 1 
ATOM   6098 N  NH2 . ARG B 1 328 ? -1.586  37.029  9.190   1.00 50.44  ? 327  ARG B NH2 1 
ATOM   6099 N  N   . PRO B 1 329 ? -7.849  36.156  3.829   1.00 35.55  ? 328  PRO B N   1 
ATOM   6100 C  CA  . PRO B 1 329 ? -8.227  37.326  3.046   1.00 37.23  ? 328  PRO B CA  1 
ATOM   6101 C  C   . PRO B 1 329 ? -8.785  38.431  3.876   1.00 40.79  ? 328  PRO B C   1 
ATOM   6102 O  O   . PRO B 1 329 ? -9.331  38.196  4.972   1.00 41.34  ? 328  PRO B O   1 
ATOM   6103 C  CB  . PRO B 1 329 ? -9.313  36.817  2.121   1.00 35.77  ? 328  PRO B CB  1 
ATOM   6104 C  CG  . PRO B 1 329 ? -9.842  35.618  2.791   1.00 37.20  ? 328  PRO B CG  1 
ATOM   6105 C  CD  . PRO B 1 329 ? -8.655  34.988  3.445   1.00 36.15  ? 328  PRO B CD  1 
ATOM   6106 N  N   . PHE B 1 330 ? -8.589  39.642  3.360   1.00 41.45  ? 329  PHE B N   1 
ATOM   6107 C  CA  . PHE B 1 330 ? -9.236  40.826  3.877   1.00 42.08  ? 329  PHE B CA  1 
ATOM   6108 C  C   . PHE B 1 330 ? -9.743  41.555  2.660   1.00 47.39  ? 329  PHE B C   1 
ATOM   6109 O  O   . PHE B 1 330 ? -9.182  41.398  1.565   1.00 46.75  ? 329  PHE B O   1 
ATOM   6110 C  CB  . PHE B 1 330 ? -8.248  41.708  4.625   1.00 40.37  ? 329  PHE B CB  1 
ATOM   6111 C  CG  . PHE B 1 330 ? -7.740  41.108  5.882   1.00 40.82  ? 329  PHE B CG  1 
ATOM   6112 C  CD1 . PHE B 1 330 ? -8.610  40.815  6.925   1.00 44.77  ? 329  PHE B CD1 1 
ATOM   6113 C  CD2 . PHE B 1 330 ? -6.409  40.841  6.041   1.00 43.93  ? 329  PHE B CD2 1 
ATOM   6114 C  CE1 . PHE B 1 330 ? -8.160  40.255  8.112   1.00 45.15  ? 329  PHE B CE1 1 
ATOM   6115 C  CE2 . PHE B 1 330 ? -5.945  40.272  7.221   1.00 49.73  ? 329  PHE B CE2 1 
ATOM   6116 C  CZ  . PHE B 1 330 ? -6.822  39.987  8.264   1.00 47.37  ? 329  PHE B CZ  1 
ATOM   6117 N  N   . THR B 1 331 ? -10.815 42.341  2.833   1.00 53.79  ? 330  THR B N   1 
ATOM   6118 C  CA  . THR B 1 331 ? -11.330 43.220  1.749   1.00 51.39  ? 330  THR B CA  1 
ATOM   6119 C  C   . THR B 1 331 ? -10.428 44.453  1.514   1.00 51.65  ? 330  THR B C   1 
ATOM   6120 O  O   . THR B 1 331 ? -9.668  44.875  2.418   1.00 49.73  ? 330  THR B O   1 
ATOM   6121 C  CB  . THR B 1 331 ? -12.781 43.672  2.031   1.00 47.69  ? 330  THR B CB  1 
ATOM   6122 O  OG1 . THR B 1 331 ? -12.869 44.356  3.298   1.00 43.84  ? 330  THR B OG1 1 
ATOM   6123 C  CG2 . THR B 1 331 ? -13.702 42.462  2.037   1.00 46.72  ? 330  THR B CG2 1 
ATOM   6124 N  N   . THR B 1 332 ? -10.522 45.033  0.314   1.00 46.25  ? 331  THR B N   1 
ATOM   6125 C  CA  . THR B 1 332 ? -9.750  46.240  -0.017  1.00 43.04  ? 331  THR B CA  1 
ATOM   6126 C  C   . THR B 1 332 ? -10.157 47.379  0.897   1.00 43.64  ? 331  THR B C   1 
ATOM   6127 O  O   . THR B 1 332 ? -9.354  48.279  1.196   1.00 41.83  ? 331  THR B O   1 
ATOM   6128 C  CB  . THR B 1 332 ? -9.984  46.700  -1.445  1.00 44.58  ? 331  THR B CB  1 
ATOM   6129 O  OG1 . THR B 1 332 ? -9.794  45.608  -2.342  1.00 43.92  ? 331  THR B OG1 1 
ATOM   6130 C  CG2 . THR B 1 332 ? -9.028  47.810  -1.823  1.00 48.82  ? 331  THR B CG2 1 
ATOM   6131 N  N   . LYS B 1 333 ? -11.420 47.344  1.320   1.00 41.80  ? 332  LYS B N   1 
ATOM   6132 C  CA  . LYS B 1 333 ? -11.930 48.275  2.300   1.00 43.85  ? 332  LYS B CA  1 
ATOM   6133 C  C   . LYS B 1 333 ? -11.221 48.083  3.626   1.00 41.03  ? 332  LYS B C   1 
ATOM   6134 O  O   . LYS B 1 333 ? -10.767 49.052  4.239   1.00 42.05  ? 332  LYS B O   1 
ATOM   6135 C  CB  . LYS B 1 333 ? -13.418 48.061  2.437   1.00 48.19  ? 332  LYS B CB  1 
ATOM   6136 C  CG  . LYS B 1 333 ? -14.196 49.277  2.896   1.00 49.52  ? 332  LYS B CG  1 
ATOM   6137 C  CD  . LYS B 1 333 ? -15.659 49.084  2.491   1.00 53.37  ? 332  LYS B CD  1 
ATOM   6138 C  CE  . LYS B 1 333 ? -16.298 50.340  1.863   1.00 56.18  ? 332  LYS B CE  1 
ATOM   6139 N  NZ  . LYS B 1 333 ? -15.828 51.578  2.561   1.00 62.54  ? 332  LYS B NZ  1 
ATOM   6140 N  N   . GLN B 1 334 ? -11.110 46.830  4.048   1.00 40.14  ? 333  GLN B N   1 
ATOM   6141 C  CA  . GLN B 1 334 ? -10.388 46.482  5.263   1.00 40.89  ? 333  GLN B CA  1 
ATOM   6142 C  C   . GLN B 1 334 ? -8.907  46.848  5.151   1.00 43.80  ? 333  GLN B C   1 
ATOM   6143 O  O   . GLN B 1 334 ? -8.337  47.490  6.040   1.00 37.32  ? 333  GLN B O   1 
ATOM   6144 C  CB  . GLN B 1 334 ? -10.521 44.990  5.552   1.00 42.18  ? 333  GLN B CB  1 
ATOM   6145 C  CG  . GLN B 1 334 ? -11.727 44.601  6.376   1.00 44.19  ? 333  GLN B CG  1 
ATOM   6146 C  CD  . GLN B 1 334 ? -11.878 43.098  6.487   1.00 46.03  ? 333  GLN B CD  1 
ATOM   6147 O  OE1 . GLN B 1 334 ? -11.608 42.358  5.540   1.00 42.36  ? 333  GLN B OE1 1 
ATOM   6148 N  NE2 . GLN B 1 334 ? -12.272 42.632  7.661   1.00 51.65  ? 333  GLN B NE2 1 
ATOM   6149 N  N   . LYS B 1 335 ? -8.274  46.421  4.058   1.00 46.34  ? 334  LYS B N   1 
ATOM   6150 C  CA  . LYS B 1 335 ? -6.864  46.737  3.833   1.00 48.23  ? 334  LYS B CA  1 
ATOM   6151 C  C   . LYS B 1 335 ? -6.636  48.253  3.957   1.00 48.34  ? 334  LYS B C   1 
ATOM   6152 O  O   . LYS B 1 335 ? -5.641  48.709  4.513   1.00 49.86  ? 334  LYS B O   1 
ATOM   6153 C  CB  . LYS B 1 335 ? -6.428  46.266  2.443   1.00 48.15  ? 334  LYS B CB  1 
ATOM   6154 C  CG  . LYS B 1 335 ? -6.320  44.752  2.267   1.00 48.35  ? 334  LYS B CG  1 
ATOM   6155 C  CD  . LYS B 1 335 ? -5.116  44.151  2.998   1.00 45.89  ? 334  LYS B CD  1 
ATOM   6156 C  CE  . LYS B 1 335 ? -4.771  42.773  2.451   1.00 42.03  ? 334  LYS B CE  1 
ATOM   6157 N  NZ  . LYS B 1 335 ? -3.549  42.227  3.062   1.00 39.60  ? 334  LYS B NZ  1 
ATOM   6158 N  N   . ALA B 1 336 ? -7.598  49.016  3.464   1.00 47.60  ? 335  ALA B N   1 
ATOM   6159 C  CA  . ALA B 1 336 ? -7.474  50.464  3.327   1.00 47.58  ? 335  ALA B CA  1 
ATOM   6160 C  C   . ALA B 1 336 ? -7.213  51.215  4.641   1.00 48.23  ? 335  ALA B C   1 
ATOM   6161 O  O   . ALA B 1 336 ? -6.803  52.359  4.615   1.00 45.61  ? 335  ALA B O   1 
ATOM   6162 C  CB  . ALA B 1 336 ? -8.703  51.016  2.614   1.00 44.04  ? 335  ALA B CB  1 
ATOM   6163 N  N   . MET B 1 337 ? -7.424  50.564  5.784   1.00 50.94  ? 336  MET B N   1 
ATOM   6164 C  CA  . MET B 1 337 ? -7.108  51.182  7.085   1.00 51.22  ? 336  MET B CA  1 
ATOM   6165 C  C   . MET B 1 337 ? -5.632  51.511  7.199   1.00 50.83  ? 336  MET B C   1 
ATOM   6166 O  O   . MET B 1 337 ? -5.205  52.077  8.182   1.00 50.19  ? 336  MET B O   1 
ATOM   6167 C  CB  . MET B 1 337 ? -7.539  50.285  8.268   1.00 54.61  ? 336  MET B CB  1 
ATOM   6168 C  CG  . MET B 1 337 ? -6.783  48.961  8.442   1.00 62.78  ? 336  MET B CG  1 
ATOM   6169 S  SD  . MET B 1 337 ? -7.420  47.972  9.858   0.93 64.96  ? 336  MET B SD  1 
ATOM   6170 C  CE  . MET B 1 337 ? -8.831  47.191  9.080   1.00 74.60  ? 336  MET B CE  1 
ATOM   6171 N  N   . GLY B 1 338 ? -4.852  51.085  6.217   1.00 54.93  ? 337  GLY B N   1 
ATOM   6172 C  CA  . GLY B 1 338 ? -3.471  51.515  6.084   1.00 58.42  ? 337  GLY B CA  1 
ATOM   6173 C  C   . GLY B 1 338 ? -3.161  52.230  4.780   1.00 61.96  ? 337  GLY B C   1 
ATOM   6174 O  O   . GLY B 1 338 ? -2.030  52.115  4.259   1.00 62.45  ? 337  GLY B O   1 
ATOM   6175 N  N   . LYS B 1 339 ? -4.146  52.958  4.239   1.00 62.69  ? 338  LYS B N   1 
ATOM   6176 C  CA  . LYS B 1 339 ? -3.961  53.664  2.958   1.00 64.70  ? 338  LYS B CA  1 
ATOM   6177 C  C   . LYS B 1 339 ? -2.868  54.727  3.103   1.00 63.51  ? 338  LYS B C   1 
ATOM   6178 O  O   . LYS B 1 339 ? -2.082  54.948  2.199   1.00 60.54  ? 338  LYS B O   1 
ATOM   6179 C  CB  . LYS B 1 339 ? -5.280  54.283  2.464   1.00 73.91  ? 338  LYS B CB  1 
ATOM   6180 C  CG  . LYS B 1 339 ? -5.521  54.196  0.949   1.00 82.88  ? 338  LYS B CG  1 
ATOM   6181 C  CD  . LYS B 1 339 ? -6.814  54.996  0.562   1.00 84.06  ? 338  LYS B CD  1 
ATOM   6182 C  CE  . LYS B 1 339 ? -7.336  54.932  -0.896  1.00 75.78  ? 338  LYS B CE  1 
ATOM   6183 N  NZ  . LYS B 1 339 ? -8.309  53.818  -1.168  1.00 70.67  ? 338  LYS B NZ  1 
ATOM   6184 N  N   . GLU B 1 340 ? -2.804  55.347  4.272   1.00 71.38  ? 339  GLU B N   1 
ATOM   6185 C  CA  . GLU B 1 340 ? -1.790  56.350  4.566   1.00 75.18  ? 339  GLU B CA  1 
ATOM   6186 C  C   . GLU B 1 340 ? -0.582  55.804  5.357   1.00 73.71  ? 339  GLU B C   1 
ATOM   6187 O  O   . GLU B 1 340 ? 0.450   56.457  5.423   1.00 75.38  ? 339  GLU B O   1 
ATOM   6188 C  CB  . GLU B 1 340 ? -2.437  57.494  5.355   1.00 79.26  ? 339  GLU B CB  1 
ATOM   6189 C  CG  . GLU B 1 340 ? -3.462  58.303  4.574   1.00 76.77  ? 339  GLU B CG  1 
ATOM   6190 C  CD  . GLU B 1 340 ? -4.191  59.269  5.487   1.00 78.01  ? 339  GLU B CD  1 
ATOM   6191 O  OE1 . GLU B 1 340 ? -3.634  60.330  5.850   1.00 80.52  ? 339  GLU B OE1 1 
ATOM   6192 O  OE2 . GLU B 1 340 ? -5.317  58.945  5.886   1.00 77.39  ? 339  GLU B OE2 1 
ATOM   6193 N  N   . ASP B 1 341 ? -0.727  54.644  5.989   1.00 70.40  ? 340  ASP B N   1 
ATOM   6194 C  CA  . ASP B 1 341 ? 0.355   54.026  6.759   1.00 64.26  ? 340  ASP B CA  1 
ATOM   6195 C  C   . ASP B 1 341 ? 0.398   52.515  6.429   1.00 64.29  ? 340  ASP B C   1 
ATOM   6196 O  O   . ASP B 1 341 ? -0.496  51.780  6.808   1.00 68.06  ? 340  ASP B O   1 
ATOM   6197 C  CB  . ASP B 1 341 ? 0.130   54.282  8.269   1.00 60.18  ? 340  ASP B CB  1 
ATOM   6198 C  CG  . ASP B 1 341 ? 1.260   53.718  9.171   1.00 55.94  ? 340  ASP B CG  1 
ATOM   6199 O  OD1 . ASP B 1 341 ? 2.187   53.024  8.691   1.00 51.02  ? 340  ASP B OD1 1 
ATOM   6200 O  OD2 . ASP B 1 341 ? 1.220   53.971  10.378  1.00 47.67  ? 340  ASP B OD2 1 
ATOM   6201 N  N   . PHE B 1 342 ? 1.452   52.063  5.747   1.00 60.72  ? 341  PHE B N   1 
ATOM   6202 C  CA  . PHE B 1 342 ? 1.561   50.651  5.343   1.00 55.31  ? 341  PHE B CA  1 
ATOM   6203 C  C   . PHE B 1 342 ? 1.640   49.674  6.514   1.00 50.30  ? 341  PHE B C   1 
ATOM   6204 O  O   . PHE B 1 342 ? 1.231   48.521  6.382   1.00 41.79  ? 341  PHE B O   1 
ATOM   6205 C  CB  . PHE B 1 342 ? 2.721   50.416  4.342   1.00 55.27  ? 341  PHE B CB  1 
ATOM   6206 C  CG  . PHE B 1 342 ? 4.085   50.352  4.969   1.00 53.64  ? 341  PHE B CG  1 
ATOM   6207 C  CD1 . PHE B 1 342 ? 4.532   49.188  5.566   1.00 56.41  ? 341  PHE B CD1 1 
ATOM   6208 C  CD2 . PHE B 1 342 ? 4.930   51.439  4.941   1.00 54.35  ? 341  PHE B CD2 1 
ATOM   6209 C  CE1 . PHE B 1 342 ? 5.779   49.125  6.144   1.00 54.39  ? 341  PHE B CE1 1 
ATOM   6210 C  CE2 . PHE B 1 342 ? 6.187   51.382  5.520   1.00 53.32  ? 341  PHE B CE2 1 
ATOM   6211 C  CZ  . PHE B 1 342 ? 6.610   50.228  6.116   1.00 52.29  ? 341  PHE B CZ  1 
ATOM   6212 N  N   . THR B 1 343 ? 2.153   50.129  7.659   1.00 52.36  ? 342  THR B N   1 
ATOM   6213 C  CA  . THR B 1 343 ? 2.325   49.256  8.838   1.00 49.28  ? 342  THR B CA  1 
ATOM   6214 C  C   . THR B 1 343 ? 1.001   48.813  9.412   1.00 50.14  ? 342  THR B C   1 
ATOM   6215 O  O   . THR B 1 343 ? 0.943   47.825  10.120  1.00 40.84  ? 342  THR B O   1 
ATOM   6216 C  CB  . THR B 1 343 ? 3.123   49.954  9.950   1.00 47.41  ? 342  THR B CB  1 
ATOM   6217 O  OG1 . THR B 1 343 ? 2.419   51.113  10.427  1.00 42.77  ? 342  THR B OG1 1 
ATOM   6218 C  CG2 . THR B 1 343 ? 4.499   50.354  9.410   1.00 48.89  ? 342  THR B CG2 1 
ATOM   6219 N  N   . LYS B 1 344 ? -0.051  49.570  9.092   1.00 58.98  ? 343  LYS B N   1 
ATOM   6220 C  CA  . LYS B 1 344 ? -1.414  49.287  9.552   1.00 63.69  ? 343  LYS B CA  1 
ATOM   6221 C  C   . LYS B 1 344 ? -2.258  48.498  8.534   1.00 60.67  ? 343  LYS B C   1 
ATOM   6222 O  O   . LYS B 1 344 ? -3.414  48.165  8.806   1.00 60.77  ? 343  LYS B O   1 
ATOM   6223 C  CB  . LYS B 1 344 ? -2.133  50.600  9.892   1.00 69.83  ? 343  LYS B CB  1 
ATOM   6224 C  CG  . LYS B 1 344 ? -1.683  51.319  11.159  1.00 71.52  ? 343  LYS B CG  1 
ATOM   6225 C  CD  . LYS B 1 344 ? -2.617  52.516  11.305  1.00 81.17  ? 343  LYS B CD  1 
ATOM   6226 C  CE  . LYS B 1 344 ? -2.509  53.320  12.606  1.00 85.67  ? 343  LYS B CE  1 
ATOM   6227 N  NZ  . LYS B 1 344 ? -2.321  52.485  13.829  1.00 83.62  ? 343  LYS B NZ  1 
ATOM   6228 N  N   . ILE B 1 345 ? -1.688  48.194  7.369   1.00 60.57  ? 344  ILE B N   1 
ATOM   6229 C  CA  . ILE B 1 345 ? -2.309  47.248  6.423   1.00 54.15  ? 344  ILE B CA  1 
ATOM   6230 C  C   . ILE B 1 345 ? -2.243  45.842  7.041   1.00 54.16  ? 344  ILE B C   1 
ATOM   6231 O  O   . ILE B 1 345 ? -1.152  45.346  7.345   1.00 54.37  ? 344  ILE B O   1 
ATOM   6232 C  CB  . ILE B 1 345 ? -1.560  47.152  5.075   1.00 51.28  ? 344  ILE B CB  1 
ATOM   6233 C  CG1 . ILE B 1 345 ? -1.458  48.502  4.364   1.00 48.48  ? 344  ILE B CG1 1 
ATOM   6234 C  CG2 . ILE B 1 345 ? -2.271  46.165  4.169   1.00 53.46  ? 344  ILE B CG2 1 
ATOM   6235 C  CD1 . ILE B 1 345 ? -0.650  48.458  3.074   1.00 45.18  ? 344  ILE B CD1 1 
ATOM   6236 N  N   . PRO B 1 346 ? -3.397  45.194  7.227   1.00 51.88  ? 345  PRO B N   1 
ATOM   6237 C  CA  . PRO B 1 346 ? -3.331  43.869  7.829   1.00 49.79  ? 345  PRO B CA  1 
ATOM   6238 C  C   . PRO B 1 346 ? -2.714  42.808  6.876   1.00 43.77  ? 345  PRO B C   1 
ATOM   6239 O  O   . PRO B 1 346 ? -2.927  42.832  5.670   1.00 39.36  ? 345  PRO B O   1 
ATOM   6240 C  CB  . PRO B 1 346 ? -4.784  43.571  8.193   1.00 50.48  ? 345  PRO B CB  1 
ATOM   6241 C  CG  . PRO B 1 346 ? -5.601  44.416  7.265   1.00 54.96  ? 345  PRO B CG  1 
ATOM   6242 C  CD  . PRO B 1 346 ? -4.756  45.562  6.794   1.00 53.05  ? 345  PRO B CD  1 
ATOM   6243 N  N   . HIS B 1 347 ? -1.943  41.900  7.453   1.00 40.15  ? 346  HIS B N   1 
ATOM   6244 C  CA  . HIS B 1 347 ? -1.188  40.917  6.691   1.00 37.37  ? 346  HIS B CA  1 
ATOM   6245 C  C   . HIS B 1 347 ? -2.073  39.754  6.410   1.00 34.76  ? 346  HIS B C   1 
ATOM   6246 O  O   . HIS B 1 347 ? -2.463  39.027  7.325   1.00 31.11  ? 346  HIS B O   1 
ATOM   6247 C  CB  . HIS B 1 347 ? 0.039   40.417  7.466   1.00 35.43  ? 346  HIS B CB  1 
ATOM   6248 C  CG  . HIS B 1 347 ? 0.959   41.504  7.872   1.00 35.37  ? 346  HIS B CG  1 
ATOM   6249 N  ND1 . HIS B 1 347 ? 1.716   41.444  9.017   1.00 35.63  ? 346  HIS B ND1 1 
ATOM   6250 C  CD2 . HIS B 1 347 ? 1.193   42.719  7.323   1.00 36.13  ? 346  HIS B CD2 1 
ATOM   6251 C  CE1 . HIS B 1 347 ? 2.399   42.566  9.146   1.00 34.20  ? 346  HIS B CE1 1 
ATOM   6252 N  NE2 . HIS B 1 347 ? 2.097   43.357  8.132   1.00 35.30  ? 346  HIS B NE2 1 
ATOM   6253 N  N   . GLY B 1 348 ? -2.355  39.570  5.136   1.00 34.59  ? 347  GLY B N   1 
ATOM   6254 C  CA  . GLY B 1 348 ? -3.261  38.530  4.720   1.00 37.84  ? 347  GLY B CA  1 
ATOM   6255 C  C   . GLY B 1 348 ? -3.476  38.484  3.221   1.00 39.16  ? 347  GLY B C   1 
ATOM   6256 O  O   . GLY B 1 348 ? -3.614  39.512  2.562   1.00 41.96  ? 347  GLY B O   1 
ATOM   6257 N  N   . VAL B 1 349 ? -3.509  37.277  2.692   1.00 41.41  ? 348  VAL B N   1 
ATOM   6258 C  CA  . VAL B 1 349 ? -3.738  37.065  1.278   1.00 44.92  ? 348  VAL B CA  1 
ATOM   6259 C  C   . VAL B 1 349 ? -4.777  35.955  1.143   1.00 48.48  ? 348  VAL B C   1 
ATOM   6260 O  O   . VAL B 1 349 ? -4.984  35.140  2.060   1.00 54.06  ? 348  VAL B O   1 
ATOM   6261 C  CB  . VAL B 1 349 ? -2.442  36.653  0.548   1.00 45.22  ? 348  VAL B CB  1 
ATOM   6262 C  CG1 . VAL B 1 349 ? -1.417  37.774  0.617   1.00 45.75  ? 348  VAL B CG1 1 
ATOM   6263 C  CG2 . VAL B 1 349 ? -1.843  35.395  1.161   1.00 51.62  ? 348  VAL B CG2 1 
ATOM   6264 N  N   . SER B 1 350 ? -5.403  35.913  -0.019  1.00 46.72  ? 349  SER B N   1 
ATOM   6265 C  CA  . SER B 1 350 ? -6.377  34.917  -0.316  1.00 45.99  ? 349  SER B CA  1 
ATOM   6266 C  C   . SER B 1 350 ? -5.716  33.804  -1.121  1.00 44.26  ? 349  SER B C   1 
ATOM   6267 O  O   . SER B 1 350 ? -4.992  34.077  -2.075  1.00 46.21  ? 349  SER B O   1 
ATOM   6268 C  CB  . SER B 1 350 ? -7.454  35.571  -1.140  1.00 48.70  ? 349  SER B CB  1 
ATOM   6269 O  OG  . SER B 1 350 ? -8.523  34.673  -1.331  1.00 59.77  ? 349  SER B OG  1 
ATOM   6270 N  N   . GLY B 1 351 ? -5.931  32.552  -0.739  1.00 40.64  ? 350  GLY B N   1 
ATOM   6271 C  CA  . GLY B 1 351 ? -5.312  31.453  -1.449  1.00 41.23  ? 350  GLY B CA  1 
ATOM   6272 C  C   . GLY B 1 351 ? -5.812  30.038  -1.258  1.00 43.43  ? 350  GLY B C   1 
ATOM   6273 O  O   . GLY B 1 351 ? -5.315  29.138  -1.930  1.00 50.12  ? 350  GLY B O   1 
ATOM   6274 N  N   . VAL B 1 352 ? -6.773  29.807  -0.369  1.00 43.20  ? 351  VAL B N   1 
ATOM   6275 C  CA  . VAL B 1 352 ? -7.087  28.453  0.055   1.00 42.49  ? 351  VAL B CA  1 
ATOM   6276 C  C   . VAL B 1 352 ? -7.573  27.597  -1.119  1.00 39.47  ? 351  VAL B C   1 
ATOM   6277 O  O   . VAL B 1 352 ? -7.278  26.412  -1.192  1.00 36.96  ? 351  VAL B O   1 
ATOM   6278 C  CB  . VAL B 1 352 ? -8.144  28.429  1.180   1.00 43.22  ? 351  VAL B CB  1 
ATOM   6279 C  CG1 . VAL B 1 352 ? -9.520  28.785  0.647   1.00 45.68  ? 351  VAL B CG1 1 
ATOM   6280 C  CG2 . VAL B 1 352 ? -8.187  27.053  1.834   1.00 41.89  ? 351  VAL B CG2 1 
ATOM   6281 N  N   . GLN B 1 353 ? -8.305  28.217  -2.027  1.00 39.24  ? 352  GLN B N   1 
ATOM   6282 C  CA  . GLN B 1 353 ? -8.856  27.534  -3.186  1.00 41.06  ? 352  GLN B CA  1 
ATOM   6283 C  C   . GLN B 1 353 ? -7.868  27.396  -4.335  1.00 39.98  ? 352  GLN B C   1 
ATOM   6284 O  O   . GLN B 1 353 ? -7.975  26.460  -5.128  1.00 39.06  ? 352  GLN B O   1 
ATOM   6285 C  CB  . GLN B 1 353 ? -10.054 28.321  -3.675  1.00 41.15  ? 352  GLN B CB  1 
ATOM   6286 C  CG  . GLN B 1 353 ? -10.967 27.551  -4.584  1.00 38.86  ? 352  GLN B CG  1 
ATOM   6287 C  CD  . GLN B 1 353 ? -12.002 28.447  -5.219  1.00 38.80  ? 352  GLN B CD  1 
ATOM   6288 O  OE1 . GLN B 1 353 ? -12.289 29.555  -4.741  1.00 40.09  ? 352  GLN B OE1 1 
ATOM   6289 N  NE2 . GLN B 1 353 ? -12.580 27.972  -6.301  1.00 36.28  ? 352  GLN B NE2 1 
ATOM   6290 N  N   . ASP B 1 354 ? -6.910  28.316  -4.436  1.00 42.16  ? 353  ASP B N   1 
ATOM   6291 C  CA  . ASP B 1 354 ? -5.983  28.311  -5.584  1.00 45.75  ? 353  ASP B CA  1 
ATOM   6292 C  C   . ASP B 1 354 ? -4.790  27.352  -5.415  1.00 44.93  ? 353  ASP B C   1 
ATOM   6293 O  O   . ASP B 1 354 ? -4.110  27.058  -6.388  1.00 47.20  ? 353  ASP B O   1 
ATOM   6294 C  CB  . ASP B 1 354 ? -5.369  29.702  -5.834  1.00 47.32  ? 353  ASP B CB  1 
ATOM   6295 C  CG  . ASP B 1 354 ? -6.350  30.854  -5.654  1.00 46.91  ? 353  ASP B CG  1 
ATOM   6296 O  OD1 . ASP B 1 354 ? -7.210  31.002  -6.517  1.00 48.62  ? 353  ASP B OD1 1 
ATOM   6297 O  OD2 . ASP B 1 354 ? -6.226  31.624  -4.684  1.00 43.03  ? 353  ASP B OD2 1 
ATOM   6298 N  N   . ARG B 1 355 ? -4.520  26.911  -4.186  1.00 38.36  ? 354  ARG B N   1 
ATOM   6299 C  CA  . ARG B 1 355 ? -3.245  26.294  -3.860  1.00 37.12  ? 354  ARG B CA  1 
ATOM   6300 C  C   . ARG B 1 355 ? -2.928  25.143  -4.759  1.00 41.72  ? 354  ARG B C   1 
ATOM   6301 O  O   . ARG B 1 355 ? -1.854  25.068  -5.352  1.00 44.04  ? 354  ARG B O   1 
ATOM   6302 C  CB  . ARG B 1 355 ? -3.203  25.809  -2.427  1.00 34.77  ? 354  ARG B CB  1 
ATOM   6303 C  CG  . ARG B 1 355 ? -1.891  25.152  -2.033  1.00 35.81  ? 354  ARG B CG  1 
ATOM   6304 C  CD  . ARG B 1 355 ? -1.858  24.826  -0.546  1.00 34.10  ? 354  ARG B CD  1 
ATOM   6305 N  NE  . ARG B 1 355 ? -2.921  23.880  -0.230  1.00 32.72  ? 354  ARG B NE  1 
ATOM   6306 C  CZ  . ARG B 1 355 ? -2.722  22.609  0.088   1.00 31.11  ? 354  ARG B CZ  1 
ATOM   6307 N  NH1 . ARG B 1 355 ? -1.494  22.112  0.173   1.00 30.24  ? 354  ARG B NH1 1 
ATOM   6308 N  NH2 . ARG B 1 355 ? -3.766  21.823  0.357   1.00 31.32  ? 354  ARG B NH2 1 
ATOM   6309 N  N   . MET B 1 356 ? -3.877  24.237  -4.874  1.00 45.60  ? 355  MET B N   1 
ATOM   6310 C  CA  . MET B 1 356 ? -3.622  22.990  -5.577  1.00 43.23  ? 355  MET B CA  1 
ATOM   6311 C  C   . MET B 1 356 ? -3.391  23.269  -7.047  1.00 41.26  ? 355  MET B C   1 
ATOM   6312 O  O   . MET B 1 356 ? -2.447  22.777  -7.612  1.00 43.49  ? 355  MET B O   1 
ATOM   6313 C  CB  . MET B 1 356 ? -4.778  22.036  -5.363  1.00 42.45  ? 355  MET B CB  1 
ATOM   6314 C  CG  . MET B 1 356 ? -4.930  21.602  -3.912  1.00 42.74  ? 355  MET B CG  1 
ATOM   6315 S  SD  . MET B 1 356 ? -3.693  20.397  -3.421  0.92 42.57  ? 355  MET B SD  1 
ATOM   6316 C  CE  . MET B 1 356 ? -4.390  18.926  -4.173  1.00 46.25  ? 355  MET B CE  1 
ATOM   6317 N  N   . SER B 1 357 ? -4.255  24.072  -7.650  1.00 42.12  ? 356  SER B N   1 
ATOM   6318 C  CA  . SER B 1 357 ? -4.154  24.370  -9.075  1.00 42.78  ? 356  SER B CA  1 
ATOM   6319 C  C   . SER B 1 357 ? -2.930  25.199  -9.393  1.00 43.08  ? 356  SER B C   1 
ATOM   6320 O  O   . SER B 1 357 ? -2.203  24.889  -10.338 1.00 45.23  ? 356  SER B O   1 
ATOM   6321 C  CB  . SER B 1 357 ? -5.412  25.101  -9.590  1.00 44.09  ? 356  SER B CB  1 
ATOM   6322 O  OG  . SER B 1 357 ? -6.494  24.197  -9.731  1.00 43.51  ? 356  SER B OG  1 
ATOM   6323 N  N   . VAL B 1 358 ? -2.714  26.268  -8.632  1.00 42.27  ? 357  VAL B N   1 
ATOM   6324 C  CA  . VAL B 1 358 ? -1.562  27.143  -8.880  1.00 41.74  ? 357  VAL B CA  1 
ATOM   6325 C  C   . VAL B 1 358 ? -0.250  26.355  -8.768  1.00 41.95  ? 357  VAL B C   1 
ATOM   6326 O  O   . VAL B 1 358 ? 0.610   26.451  -9.632  1.00 39.50  ? 357  VAL B O   1 
ATOM   6327 C  CB  . VAL B 1 358 ? -1.522  28.349  -7.923  1.00 38.62  ? 357  VAL B CB  1 
ATOM   6328 C  CG1 . VAL B 1 358 ? -0.244  29.147  -8.127  1.00 36.55  ? 357  VAL B CG1 1 
ATOM   6329 C  CG2 . VAL B 1 358 ? -2.725  29.238  -8.168  1.00 38.80  ? 357  VAL B CG2 1 
ATOM   6330 N  N   . ILE B 1 359 ? -0.133  25.552  -7.716  1.00 42.28  ? 358  ILE B N   1 
ATOM   6331 C  CA  . ILE B 1 359 ? 1.043   24.707  -7.531  1.00 39.94  ? 358  ILE B CA  1 
ATOM   6332 C  C   . ILE B 1 359 ? 1.199   23.687  -8.680  1.00 38.71  ? 358  ILE B C   1 
ATOM   6333 O  O   . ILE B 1 359 ? 2.318   23.418  -9.117  1.00 35.89  ? 358  ILE B O   1 
ATOM   6334 C  CB  . ILE B 1 359 ? 1.062   24.010  -6.128  1.00 39.32  ? 358  ILE B CB  1 
ATOM   6335 C  CG1 . ILE B 1 359 ? 1.441   25.004  -5.040  1.00 40.67  ? 358  ILE B CG1 1 
ATOM   6336 C  CG2 . ILE B 1 359 ? 2.101   22.914  -6.056  1.00 39.22  ? 358  ILE B CG2 1 
ATOM   6337 C  CD1 . ILE B 1 359 ? 2.824   25.605  -5.228  1.00 41.53  ? 358  ILE B CD1 1 
ATOM   6338 N  N   . TRP B 1 360 ? 0.092   23.120  -9.157  1.00 37.93  ? 359  TRP B N   1 
ATOM   6339 C  CA  . TRP B 1 360 ? 0.156   22.118  -10.212 1.00 40.67  ? 359  TRP B CA  1 
ATOM   6340 C  C   . TRP B 1 360 ? 0.729   22.767  -11.486 1.00 43.56  ? 359  TRP B C   1 
ATOM   6341 O  O   . TRP B 1 360 ? 1.615   22.204  -12.171 1.00 45.10  ? 359  TRP B O   1 
ATOM   6342 C  CB  . TRP B 1 360 ? -1.229  21.506  -10.498 1.00 41.76  ? 359  TRP B CB  1 
ATOM   6343 C  CG  . TRP B 1 360 ? -1.225  20.438  -11.620 1.00 39.32  ? 359  TRP B CG  1 
ATOM   6344 C  CD1 . TRP B 1 360 ? -1.400  20.648  -12.948 1.00 35.77  ? 359  TRP B CD1 1 
ATOM   6345 C  CD2 . TRP B 1 360 ? -0.986  19.031  -11.462 1.00 37.68  ? 359  TRP B CD2 1 
ATOM   6346 N  NE1 . TRP B 1 360 ? -1.290  19.467  -13.627 1.00 35.27  ? 359  TRP B NE1 1 
ATOM   6347 C  CE2 . TRP B 1 360 ? -1.055  18.457  -12.740 1.00 34.66  ? 359  TRP B CE2 1 
ATOM   6348 C  CE3 . TRP B 1 360 ? -0.736  18.199  -10.354 1.00 37.57  ? 359  TRP B CE3 1 
ATOM   6349 C  CZ2 . TRP B 1 360 ? -0.884  17.094  -12.959 1.00 35.61  ? 359  TRP B CZ2 1 
ATOM   6350 C  CZ3 . TRP B 1 360 ? -0.571  16.847  -10.576 1.00 38.85  ? 359  TRP B CZ3 1 
ATOM   6351 C  CH2 . TRP B 1 360 ? -0.638  16.308  -11.870 1.00 37.85  ? 359  TRP B CH2 1 
ATOM   6352 N  N   . GLU B 1 361 ? 0.235   23.963  -11.761 1.00 40.81  ? 360  GLU B N   1 
ATOM   6353 C  CA  . GLU B 1 361 ? 0.643   24.691  -12.903 1.00 42.96  ? 360  GLU B CA  1 
ATOM   6354 C  C   . GLU B 1 361 ? 2.118   25.054  -12.856 1.00 45.36  ? 360  GLU B C   1 
ATOM   6355 O  O   . GLU B 1 361 ? 2.860   24.733  -13.779 1.00 52.29  ? 360  GLU B O   1 
ATOM   6356 C  CB  . GLU B 1 361 ? -0.186  25.960  -12.995 1.00 46.79  ? 360  GLU B CB  1 
ATOM   6357 C  CG  . GLU B 1 361 ? 0.075   26.776  -14.247 1.00 50.84  ? 360  GLU B CG  1 
ATOM   6358 C  CD  . GLU B 1 361 ? -0.214  25.985  -15.524 1.00 54.04  ? 360  GLU B CD  1 
ATOM   6359 O  OE1 . GLU B 1 361 ? -1.063  25.051  -15.455 1.00 49.89  ? 360  GLU B OE1 1 
ATOM   6360 O  OE2 . GLU B 1 361 ? 0.444   26.274  -16.569 1.00 54.72  ? 360  GLU B OE2 1 
ATOM   6361 N  N   . ARG B 1 362 ? 2.543   25.771  -11.827 1.00 44.94  ? 361  ARG B N   1 
ATOM   6362 C  CA  . ARG B 1 362 ? 3.915   26.225  -11.764 1.00 43.16  ? 361  ARG B CA  1 
ATOM   6363 C  C   . ARG B 1 362 ? 4.881   25.119  -11.416 1.00 42.42  ? 361  ARG B C   1 
ATOM   6364 O  O   . ARG B 1 362 ? 5.984   25.064  -11.965 1.00 44.37  ? 361  ARG B O   1 
ATOM   6365 C  CB  . ARG B 1 362 ? 4.042   27.374  -10.794 1.00 45.29  ? 361  ARG B CB  1 
ATOM   6366 C  CG  . ARG B 1 362 ? 3.338   28.625  -11.284 1.00 47.24  ? 361  ARG B CG  1 
ATOM   6367 C  CD  . ARG B 1 362 ? 4.028   29.187  -12.516 1.00 52.30  ? 361  ARG B CD  1 
ATOM   6368 N  NE  . ARG B 1 362 ? 3.490   30.503  -12.840 1.00 59.87  ? 361  ARG B NE  1 
ATOM   6369 C  CZ  . ARG B 1 362 ? 2.600   30.763  -13.813 1.00 61.31  ? 361  ARG B CZ  1 
ATOM   6370 N  NH1 . ARG B 1 362 ? 2.142   29.813  -14.639 1.00 58.17  ? 361  ARG B NH1 1 
ATOM   6371 N  NH2 . ARG B 1 362 ? 2.182   32.012  -13.977 1.00 60.13  ? 361  ARG B NH2 1 
ATOM   6372 N  N   . GLY B 1 363 ? 4.460   24.212  -10.553 1.00 42.06  ? 362  GLY B N   1 
ATOM   6373 C  CA  . GLY B 1 363 ? 5.309   23.087  -10.147 1.00 44.97  ? 362  GLY B CA  1 
ATOM   6374 C  C   . GLY B 1 363 ? 5.374   21.915  -11.105 1.00 42.33  ? 362  GLY B C   1 
ATOM   6375 O  O   . GLY B 1 363 ? 6.456   21.451  -11.437 1.00 41.94  ? 362  GLY B O   1 
ATOM   6376 N  N   . VAL B 1 364 ? 4.224   21.422  -11.540 1.00 44.82  ? 363  VAL B N   1 
ATOM   6377 C  CA  . VAL B 1 364 ? 4.193   20.177  -12.297 1.00 49.60  ? 363  VAL B CA  1 
ATOM   6378 C  C   . VAL B 1 364 ? 4.239   20.453  -13.798 1.00 49.45  ? 363  VAL B C   1 
ATOM   6379 O  O   . VAL B 1 364 ? 5.137   19.970  -14.490 1.00 43.75  ? 363  VAL B O   1 
ATOM   6380 C  CB  . VAL B 1 364 ? 2.976   19.301  -11.941 1.00 53.01  ? 363  VAL B CB  1 
ATOM   6381 C  CG1 . VAL B 1 364 ? 2.902   18.091  -12.869 1.00 56.44  ? 363  VAL B CG1 1 
ATOM   6382 C  CG2 . VAL B 1 364 ? 3.045   18.837  -10.491 1.00 51.55  ? 363  VAL B CG2 1 
ATOM   6383 N  N   . VAL B 1 365 ? 3.263   21.217  -14.288 1.00 48.38  ? 364  VAL B N   1 
ATOM   6384 C  CA  . VAL B 1 365 ? 3.224   21.606  -15.690 1.00 44.94  ? 364  VAL B CA  1 
ATOM   6385 C  C   . VAL B 1 365 ? 4.517   22.334  -16.039 1.00 45.53  ? 364  VAL B C   1 
ATOM   6386 O  O   . VAL B 1 365 ? 5.109   22.082  -17.076 1.00 51.84  ? 364  VAL B O   1 
ATOM   6387 C  CB  . VAL B 1 365 ? 2.024   22.516  -15.995 1.00 46.44  ? 364  VAL B CB  1 
ATOM   6388 C  CG1 . VAL B 1 365 ? 2.174   23.214  -17.350 1.00 48.11  ? 364  VAL B CG1 1 
ATOM   6389 C  CG2 . VAL B 1 365 ? 0.710   21.745  -15.917 1.00 46.53  ? 364  VAL B CG2 1 
ATOM   6390 N  N   . GLY B 1 366 ? 4.961   23.221  -15.163 1.00 48.95  ? 365  GLY B N   1 
ATOM   6391 C  CA  . GLY B 1 366 ? 6.213   23.964  -15.353 1.00 51.23  ? 365  GLY B CA  1 
ATOM   6392 C  C   . GLY B 1 366 ? 7.497   23.139  -15.284 1.00 54.68  ? 365  GLY B C   1 
ATOM   6393 O  O   . GLY B 1 366 ? 8.566   23.678  -15.489 1.00 53.27  ? 365  GLY B O   1 
ATOM   6394 N  N   . GLY B 1 367 ? 7.402   21.845  -14.963 1.00 57.54  ? 366  GLY B N   1 
ATOM   6395 C  CA  . GLY B 1 367 ? 8.547   20.914  -15.048 1.00 56.19  ? 366  GLY B CA  1 
ATOM   6396 C  C   . GLY B 1 367 ? 9.502   20.847  -13.852 1.00 54.21  ? 366  GLY B C   1 
ATOM   6397 O  O   . GLY B 1 367 ? 10.542  20.174  -13.890 1.00 50.38  ? 366  GLY B O   1 
ATOM   6398 N  N   . LYS B 1 368 ? 9.148   21.542  -12.784 1.00 53.91  ? 367  LYS B N   1 
ATOM   6399 C  CA  . LYS B 1 368 ? 9.994   21.625  -11.612 1.00 53.83  ? 367  LYS B CA  1 
ATOM   6400 C  C   . LYS B 1 368 ? 9.907   20.364  -10.751 1.00 46.79  ? 367  LYS B C   1 
ATOM   6401 O  O   . LYS B 1 368 ? 10.859  20.008  -10.074 1.00 49.67  ? 367  LYS B O   1 
ATOM   6402 C  CB  . LYS B 1 368 ? 9.622   22.864  -10.787 1.00 57.54  ? 367  LYS B CB  1 
ATOM   6403 C  CG  . LYS B 1 368 ? 9.724   24.186  -11.543 1.00 59.00  ? 367  LYS B CG  1 
ATOM   6404 C  CD  . LYS B 1 368 ? 11.097  24.817  -11.413 1.00 65.91  ? 367  LYS B CD  1 
ATOM   6405 C  CE  . LYS B 1 368 ? 11.192  26.132  -12.185 1.00 72.75  ? 367  LYS B CE  1 
ATOM   6406 N  NZ  . LYS B 1 368 ? 11.204  25.959  -13.668 1.00 72.21  ? 367  LYS B NZ  1 
ATOM   6407 N  N   . MET B 1 369 ? 8.762   19.713  -10.767 1.00 42.76  ? 368  MET B N   1 
ATOM   6408 C  CA  . MET B 1 369 ? 8.550   18.490  -10.000 1.00 45.95  ? 368  MET B CA  1 
ATOM   6409 C  C   . MET B 1 369 ? 7.516   17.570  -10.680 1.00 43.88  ? 368  MET B C   1 
ATOM   6410 O  O   . MET B 1 369 ? 6.641   18.060  -11.406 1.00 46.11  ? 368  MET B O   1 
ATOM   6411 C  CB  . MET B 1 369 ? 8.040   18.865  -8.609  1.00 51.39  ? 368  MET B CB  1 
ATOM   6412 C  CG  . MET B 1 369 ? 6.632   19.458  -8.601  1.00 54.42  ? 368  MET B CG  1 
ATOM   6413 S  SD  . MET B 1 369 ? 6.047   19.809  -6.956  0.97 56.55  ? 368  MET B SD  1 
ATOM   6414 C  CE  . MET B 1 369 ? 6.733   21.435  -6.702  1.00 59.22  ? 368  MET B CE  1 
ATOM   6415 N  N   . ASP B 1 370 ? 7.593   16.265  -10.441 1.00 41.20  ? 369  ASP B N   1 
ATOM   6416 C  CA  . ASP B 1 370 ? 6.581   15.371  -11.002 1.00 43.74  ? 369  ASP B CA  1 
ATOM   6417 C  C   . ASP B 1 370 ? 5.291   15.386  -10.190 1.00 48.44  ? 369  ASP B C   1 
ATOM   6418 O  O   . ASP B 1 370 ? 5.237   15.910  -9.095  1.00 60.07  ? 369  ASP B O   1 
ATOM   6419 C  CB  . ASP B 1 370 ? 7.095   13.937  -11.211 1.00 44.36  ? 369  ASP B CB  1 
ATOM   6420 C  CG  . ASP B 1 370 ? 7.499   13.254  -9.938  1.00 45.89  ? 369  ASP B CG  1 
ATOM   6421 O  OD1 . ASP B 1 370 ? 7.437   13.878  -8.902  1.00 55.31  ? 369  ASP B OD1 1 
ATOM   6422 O  OD2 . ASP B 1 370 ? 7.916   12.075  -9.954  1.00 49.06  ? 369  ASP B OD2 1 
ATOM   6423 N  N   . GLU B 1 371 ? 4.251   14.819  -10.762 1.00 52.03  ? 370  GLU B N   1 
ATOM   6424 C  CA  . GLU B 1 371 ? 2.963   14.615  -10.100 1.00 54.04  ? 370  GLU B CA  1 
ATOM   6425 C  C   . GLU B 1 371 ? 3.049   13.978  -8.709  1.00 55.05  ? 370  GLU B C   1 
ATOM   6426 O  O   . GLU B 1 371 ? 2.105   14.092  -7.948  1.00 58.77  ? 370  GLU B O   1 
ATOM   6427 C  CB  . GLU B 1 371 ? 2.125   13.651  -10.942 1.00 51.71  ? 370  GLU B CB  1 
ATOM   6428 C  CG  . GLU B 1 371 ? 2.751   12.261  -10.971 1.00 53.36  ? 370  GLU B CG  1 
ATOM   6429 C  CD  . GLU B 1 371 ? 2.126   11.351  -11.966 1.00 52.99  ? 370  GLU B CD  1 
ATOM   6430 O  OE1 . GLU B 1 371 ? 1.068   11.702  -12.510 1.00 66.07  ? 370  GLU B OE1 1 
ATOM   6431 O  OE2 . GLU B 1 371 ? 2.688   10.281  -12.208 1.00 52.31  ? 370  GLU B OE2 1 
ATOM   6432 N  N   . ASN B 1 372 ? 4.108   13.220  -8.431  1.00 51.00  ? 371  ASN B N   1 
ATOM   6433 C  CA  . ASN B 1 372 ? 4.208   12.451  -7.188  1.00 48.87  ? 371  ASN B CA  1 
ATOM   6434 C  C   . ASN B 1 372 ? 4.769   13.321  -6.068  1.00 50.24  ? 371  ASN B C   1 
ATOM   6435 O  O   . ASN B 1 372 ? 4.376   13.240  -4.908  1.00 46.93  ? 371  ASN B O   1 
ATOM   6436 C  CB  . ASN B 1 372 ? 5.091   11.231  -7.398  1.00 45.53  ? 371  ASN B CB  1 
ATOM   6437 C  CG  . ASN B 1 372 ? 4.556   10.331  -8.467  1.00 46.75  ? 371  ASN B CG  1 
ATOM   6438 O  OD1 . ASN B 1 372 ? 5.217   10.053  -9.451  1.00 49.80  ? 371  ASN B OD1 1 
ATOM   6439 N  ND2 . ASN B 1 372 ? 3.339   9.878   -8.290  1.00 49.47  ? 371  ASN B ND2 1 
ATOM   6440 N  N   . ARG B 1 373 ? 5.718   14.155  -6.436  1.00 50.01  ? 372  ARG B N   1 
ATOM   6441 C  CA  . ARG B 1 373 ? 6.218   15.169  -5.541  1.00 47.87  ? 372  ARG B CA  1 
ATOM   6442 C  C   . ARG B 1 373 ? 5.121   16.182  -5.203  1.00 46.78  ? 372  ARG B C   1 
ATOM   6443 O  O   . ARG B 1 373 ? 5.097   16.752  -4.086  1.00 46.89  ? 372  ARG B O   1 
ATOM   6444 C  CB  . ARG B 1 373 ? 7.392   15.881  -6.191  1.00 42.49  ? 372  ARG B CB  1 
ATOM   6445 C  CG  . ARG B 1 373 ? 8.049   16.885  -5.286  1.00 43.44  ? 372  ARG B CG  1 
ATOM   6446 C  CD  . ARG B 1 373 ? 8.568   16.258  -3.995  1.00 42.37  ? 372  ARG B CD  1 
ATOM   6447 N  NE  . ARG B 1 373 ? 8.950   17.310  -3.061  1.00 42.64  ? 372  ARG B NE  1 
ATOM   6448 C  CZ  . ARG B 1 373 ? 9.241   17.128  -1.779  1.00 38.32  ? 372  ARG B CZ  1 
ATOM   6449 N  NH1 . ARG B 1 373 ? 9.221   15.915  -1.230  1.00 35.61  ? 372  ARG B NH1 1 
ATOM   6450 N  NH2 . ARG B 1 373 ? 9.553   18.183  -1.049  1.00 35.87  ? 372  ARG B NH2 1 
ATOM   6451 N  N   . PHE B 1 374 ? 4.251   16.426  -6.182  1.00 40.01  ? 373  PHE B N   1 
ATOM   6452 C  CA  . PHE B 1 374 ? 3.132   17.328  -6.010  1.00 38.86  ? 373  PHE B CA  1 
ATOM   6453 C  C   . PHE B 1 374 ? 2.238   16.835  -4.880  1.00 39.76  ? 373  PHE B C   1 
ATOM   6454 O  O   . PHE B 1 374 ? 1.741   17.622  -4.072  1.00 38.45  ? 373  PHE B O   1 
ATOM   6455 C  CB  . PHE B 1 374 ? 2.332   17.451  -7.316  1.00 39.11  ? 373  PHE B CB  1 
ATOM   6456 C  CG  . PHE B 1 374 ? 1.004   18.112  -7.154  1.00 37.58  ? 373  PHE B CG  1 
ATOM   6457 C  CD1 . PHE B 1 374 ? 0.888   19.501  -7.248  1.00 37.95  ? 373  PHE B CD1 1 
ATOM   6458 C  CD2 . PHE B 1 374 ? -0.114  17.367  -6.878  1.00 37.79  ? 373  PHE B CD2 1 
ATOM   6459 C  CE1 . PHE B 1 374 ? -0.328  20.129  -7.077  1.00 36.38  ? 373  PHE B CE1 1 
ATOM   6460 C  CE2 . PHE B 1 374 ? -1.342  17.989  -6.717  1.00 39.82  ? 373  PHE B CE2 1 
ATOM   6461 C  CZ  . PHE B 1 374 ? -1.440  19.372  -6.813  1.00 39.27  ? 373  PHE B CZ  1 
ATOM   6462 N  N   . VAL B 1 375 ? 1.997   15.534  -4.841  1.00 39.12  ? 374  VAL B N   1 
ATOM   6463 C  CA  . VAL B 1 375 ? 1.241   14.951  -3.745  1.00 37.61  ? 374  VAL B CA  1 
ATOM   6464 C  C   . VAL B 1 375 ? 2.027   15.124  -2.458  1.00 35.56  ? 374  VAL B C   1 
ATOM   6465 O  O   . VAL B 1 375 ? 1.472   15.509  -1.427  1.00 37.32  ? 374  VAL B O   1 
ATOM   6466 C  CB  . VAL B 1 375 ? 0.897   13.465  -3.999  1.00 37.70  ? 374  VAL B CB  1 
ATOM   6467 C  CG1 . VAL B 1 375 ? 0.288   12.816  -2.773  1.00 37.91  ? 374  VAL B CG1 1 
ATOM   6468 C  CG2 . VAL B 1 375 ? -0.074  13.341  -5.164  1.00 39.89  ? 374  VAL B CG2 1 
ATOM   6469 N  N   . ALA B 1 376 ? 3.327   14.873  -2.529  1.00 36.82  ? 375  ALA B N   1 
ATOM   6470 C  CA  . ALA B 1 376 ? 4.192   14.980  -1.354  1.00 35.39  ? 375  ALA B CA  1 
ATOM   6471 C  C   . ALA B 1 376 ? 4.015   16.341  -0.694  1.00 38.36  ? 375  ALA B C   1 
ATOM   6472 O  O   . ALA B 1 376 ? 3.717   16.427  0.511   1.00 41.40  ? 375  ALA B O   1 
ATOM   6473 C  CB  . ALA B 1 376 ? 5.630   14.771  -1.723  1.00 32.66  ? 375  ALA B CB  1 
ATOM   6474 N  N   . VAL B 1 377 ? 4.149   17.398  -1.498  1.00 36.47  ? 376  VAL B N   1 
ATOM   6475 C  CA  . VAL B 1 377 ? 4.206   18.745  -0.956  1.00 36.76  ? 376  VAL B CA  1 
ATOM   6476 C  C   . VAL B 1 377 ? 2.839   19.300  -0.626  1.00 38.33  ? 376  VAL B C   1 
ATOM   6477 O  O   . VAL B 1 377 ? 2.742   20.238  0.163   1.00 42.98  ? 376  VAL B O   1 
ATOM   6478 C  CB  . VAL B 1 377 ? 4.966   19.720  -1.873  1.00 36.19  ? 376  VAL B CB  1 
ATOM   6479 C  CG1 . VAL B 1 377 ? 6.357   19.181  -2.138  1.00 35.88  ? 376  VAL B CG1 1 
ATOM   6480 C  CG2 . VAL B 1 377 ? 4.188   20.002  -3.171  1.00 37.05  ? 376  VAL B CG2 1 
ATOM   6481 N  N   . THR B 1 378 ? 1.793   18.734  -1.220  1.00 39.65  ? 377  THR B N   1 
ATOM   6482 C  CA  . THR B 1 378 ? 0.443   19.211  -0.963  1.00 40.39  ? 377  THR B CA  1 
ATOM   6483 C  C   . THR B 1 378 ? -0.349  18.407  0.051   1.00 42.86  ? 377  THR B C   1 
ATOM   6484 O  O   . THR B 1 378 ? -1.262  18.969  0.662   1.00 43.84  ? 377  THR B O   1 
ATOM   6485 C  CB  . THR B 1 378 ? -0.391  19.340  -2.249  1.00 40.00  ? 377  THR B CB  1 
ATOM   6486 O  OG1 . THR B 1 378 ? -0.620  18.066  -2.817  1.00 40.74  ? 377  THR B OG1 1 
ATOM   6487 C  CG2 . THR B 1 378 ? 0.292   20.280  -3.213  1.00 38.69  ? 377  THR B CG2 1 
ATOM   6488 N  N   . SER B 1 379 ? -0.043  17.122  0.247   1.00 44.87  ? 378  SER B N   1 
ATOM   6489 C  CA  . SER B 1 379 ? -0.737  16.347  1.309   1.00 42.46  ? 378  SER B CA  1 
ATOM   6490 C  C   . SER B 1 379 ? 0.134   15.439  2.154   1.00 38.95  ? 378  SER B C   1 
ATOM   6491 O  O   . SER B 1 379 ? 0.006   15.437  3.357   1.00 39.60  ? 378  SER B O   1 
ATOM   6492 C  CB  . SER B 1 379 ? -1.846  15.510  0.717   1.00 45.90  ? 378  SER B CB  1 
ATOM   6493 O  OG  . SER B 1 379 ? -1.314  14.391  0.033   1.00 53.58  ? 378  SER B OG  1 
ATOM   6494 N  N   . SER B 1 380 ? 1.009   14.664  1.523   1.00 37.90  ? 379  SER B N   1 
ATOM   6495 C  CA  . SER B 1 380 ? 1.703   13.590  2.220   1.00 37.28  ? 379  SER B CA  1 
ATOM   6496 C  C   . SER B 1 380 ? 2.596   14.017  3.352   1.00 36.86  ? 379  SER B C   1 
ATOM   6497 O  O   . SER B 1 380 ? 2.569   13.453  4.432   1.00 36.25  ? 379  SER B O   1 
ATOM   6498 C  CB  . SER B 1 380 ? 2.577   12.793  1.264   1.00 35.32  ? 379  SER B CB  1 
ATOM   6499 O  OG  . SER B 1 380 ? 1.803   11.867  0.569   1.00 38.94  ? 379  SER B OG  1 
ATOM   6500 N  N   . ASN B 1 381 ? 3.461   14.954  3.061   1.00 37.49  ? 380  ASN B N   1 
ATOM   6501 C  CA  . ASN B 1 381 ? 4.410   15.354  4.046   1.00 39.97  ? 380  ASN B CA  1 
ATOM   6502 C  C   . ASN B 1 381 ? 3.654   15.975  5.197   1.00 42.30  ? 380  ASN B C   1 
ATOM   6503 O  O   . ASN B 1 381 ? 4.000   15.757  6.365   1.00 38.88  ? 380  ASN B O   1 
ATOM   6504 C  CB  . ASN B 1 381 ? 5.405   16.357  3.459   1.00 43.51  ? 380  ASN B CB  1 
ATOM   6505 C  CG  . ASN B 1 381 ? 6.445   15.693  2.581   1.00 41.09  ? 380  ASN B CG  1 
ATOM   6506 O  OD1 . ASN B 1 381 ? 6.560   14.455  2.590   1.00 35.87  ? 380  ASN B OD1 1 
ATOM   6507 N  ND2 . ASN B 1 381 ? 7.240   16.504  1.853   1.00 39.19  ? 380  ASN B ND2 1 
ATOM   6508 N  N   . ALA B 1 382 ? 2.587   16.716  4.869   1.00 40.77  ? 381  ALA B N   1 
ATOM   6509 C  CA  . ALA B 1 382 ? 1.719   17.303  5.901   1.00 36.90  ? 381  ALA B CA  1 
ATOM   6510 C  C   . ALA B 1 382 ? 1.190   16.245  6.837   1.00 34.30  ? 381  ALA B C   1 
ATOM   6511 O  O   . ALA B 1 382 ? 1.273   16.357  8.048   1.00 33.07  ? 381  ALA B O   1 
ATOM   6512 C  CB  . ALA B 1 382 ? 0.550   18.005  5.257   1.00 35.77  ? 381  ALA B CB  1 
ATOM   6513 N  N   . ALA B 1 383 ? 0.633   15.218  6.234   1.00 33.01  ? 382  ALA B N   1 
ATOM   6514 C  CA  . ALA B 1 383 ? 0.062   14.122  6.957   1.00 33.21  ? 382  ALA B CA  1 
ATOM   6515 C  C   . ALA B 1 383 ? 1.075   13.412  7.871   1.00 32.74  ? 382  ALA B C   1 
ATOM   6516 O  O   . ALA B 1 383 ? 0.732   12.987  8.976   1.00 33.65  ? 382  ALA B O   1 
ATOM   6517 C  CB  . ALA B 1 383 ? -0.529  13.133  5.963   1.00 33.52  ? 382  ALA B CB  1 
ATOM   6518 N  N   . LYS B 1 384 ? 2.295   13.258  7.393   1.00 29.13  ? 383  LYS B N   1 
ATOM   6519 C  CA  . LYS B 1 384 ? 3.313   12.596  8.154   1.00 30.72  ? 383  LYS B CA  1 
ATOM   6520 C  C   . LYS B 1 384 ? 3.672   13.372  9.437   1.00 29.64  ? 383  LYS B C   1 
ATOM   6521 O  O   . LYS B 1 384 ? 3.952   12.812  10.523  1.00 25.27  ? 383  LYS B O   1 
ATOM   6522 C  CB  . LYS B 1 384 ? 4.568   12.434  7.271   1.00 34.78  ? 383  LYS B CB  1 
ATOM   6523 C  CG  . LYS B 1 384 ? 4.578   11.182  6.410   1.00 35.23  ? 383  LYS B CG  1 
ATOM   6524 C  CD  . LYS B 1 384 ? 5.529   11.296  5.236   1.00 36.34  ? 383  LYS B CD  1 
ATOM   6525 C  CE  . LYS B 1 384 ? 5.694   9.947   4.568   1.00 37.17  ? 383  LYS B CE  1 
ATOM   6526 N  NZ  . LYS B 1 384 ? 5.730   10.065  3.086   1.00 38.44  ? 383  LYS B NZ  1 
ATOM   6527 N  N   . LEU B 1 385 ? 3.710   14.680  9.261   1.00 30.08  ? 384  LEU B N   1 
ATOM   6528 C  CA  . LEU B 1 385 ? 4.154   15.617  10.289  1.00 32.45  ? 384  LEU B CA  1 
ATOM   6529 C  C   . LEU B 1 385 ? 3.085   15.854  11.336  1.00 33.75  ? 384  LEU B C   1 
ATOM   6530 O  O   . LEU B 1 385 ? 3.382   16.037  12.501  1.00 37.33  ? 384  LEU B O   1 
ATOM   6531 C  CB  . LEU B 1 385 ? 4.405   16.925  9.590   1.00 36.60  ? 384  LEU B CB  1 
ATOM   6532 C  CG  . LEU B 1 385 ? 5.248   17.970  10.252  1.00 38.96  ? 384  LEU B CG  1 
ATOM   6533 C  CD1 . LEU B 1 385 ? 6.630   17.953  9.559   1.00 41.02  ? 384  LEU B CD1 1 
ATOM   6534 C  CD2 . LEU B 1 385 ? 4.568   19.326  10.089  1.00 39.09  ? 384  LEU B CD2 1 
ATOM   6535 N  N   . LEU B 1 386 ? 1.833   15.914  10.882  1.00 32.70  ? 385  LEU B N   1 
ATOM   6536 C  CA  . LEU B 1 386 ? 0.672   16.046  11.736  1.00 32.83  ? 385  LEU B CA  1 
ATOM   6537 C  C   . LEU B 1 386 ? 0.368   14.744  12.461  1.00 34.76  ? 385  LEU B C   1 
ATOM   6538 O  O   . LEU B 1 386 ? -0.439  14.711  13.395  1.00 35.46  ? 385  LEU B O   1 
ATOM   6539 C  CB  . LEU B 1 386 ? -0.536  16.404  10.880  1.00 32.95  ? 385  LEU B CB  1 
ATOM   6540 C  CG  . LEU B 1 386 ? -0.383  17.709  10.098  1.00 31.02  ? 385  LEU B CG  1 
ATOM   6541 C  CD1 . LEU B 1 386 ? -1.313  17.731  8.913   1.00 29.07  ? 385  LEU B CD1 1 
ATOM   6542 C  CD2 . LEU B 1 386 ? -0.664  18.891  10.999  1.00 32.14  ? 385  LEU B CD2 1 
ATOM   6543 N  N   . ASN B 1 387 ? 1.015   13.678  12.016  1.00 37.36  ? 386  ASN B N   1 
ATOM   6544 C  CA  . ASN B 1 387 ? 0.865   12.343  12.577  1.00 39.32  ? 386  ASN B CA  1 
ATOM   6545 C  C   . ASN B 1 387 ? -0.442  11.686  12.152  1.00 40.83  ? 386  ASN B C   1 
ATOM   6546 O  O   . ASN B 1 387 ? -1.078  11.003  12.917  1.00 39.56  ? 386  ASN B O   1 
ATOM   6547 C  CB  . ASN B 1 387 ? 1.033   12.386  14.088  1.00 40.13  ? 386  ASN B CB  1 
ATOM   6548 C  CG  . ASN B 1 387 ? 1.723   11.173  14.629  1.00 41.30  ? 386  ASN B CG  1 
ATOM   6549 O  OD1 . ASN B 1 387 ? 2.062   10.249  13.904  1.00 39.41  ? 386  ASN B OD1 1 
ATOM   6550 N  ND2 . ASN B 1 387 ? 1.919   11.158  15.935  1.00 45.77  ? 386  ASN B ND2 1 
ATOM   6551 N  N   . LEU B 1 388 ? -0.817  11.898  10.900  1.00 45.83  ? 387  LEU B N   1 
ATOM   6552 C  CA  . LEU B 1 388 ? -2.052  11.343  10.360  1.00 47.92  ? 387  LEU B CA  1 
ATOM   6553 C  C   . LEU B 1 388 ? -1.793  10.420  9.190   1.00 49.08  ? 387  LEU B C   1 
ATOM   6554 O  O   . LEU B 1 388 ? -2.722  10.026  8.507   1.00 50.94  ? 387  LEU B O   1 
ATOM   6555 C  CB  . LEU B 1 388 ? -2.970  12.473  9.890   1.00 46.56  ? 387  LEU B CB  1 
ATOM   6556 C  CG  . LEU B 1 388 ? -3.606  13.263  11.019  1.00 44.78  ? 387  LEU B CG  1 
ATOM   6557 C  CD1 . LEU B 1 388 ? -4.159  14.560  10.474  1.00 45.44  ? 387  LEU B CD1 1 
ATOM   6558 C  CD2 . LEU B 1 388 ? -4.694  12.460  11.707  1.00 44.73  ? 387  LEU B CD2 1 
ATOM   6559 N  N   . TYR B 1 389 ? -0.539  10.051  8.957   1.00 50.78  ? 388  TYR B N   1 
ATOM   6560 C  CA  . TYR B 1 389 ? -0.192  9.271   7.749   1.00 48.79  ? 388  TYR B CA  1 
ATOM   6561 C  C   . TYR B 1 389 ? -0.185  7.814   8.085   1.00 43.13  ? 388  TYR B C   1 
ATOM   6562 O  O   . TYR B 1 389 ? 0.334   7.449   9.104   1.00 45.96  ? 388  TYR B O   1 
ATOM   6563 C  CB  . TYR B 1 389 ? 1.195   9.671   7.241   1.00 51.94  ? 388  TYR B CB  1 
ATOM   6564 C  CG  . TYR B 1 389 ? 1.686   8.934   6.008   1.00 53.79  ? 388  TYR B CG  1 
ATOM   6565 C  CD1 . TYR B 1 389 ? 2.398   7.740   6.111   1.00 54.99  ? 388  TYR B CD1 1 
ATOM   6566 C  CD2 . TYR B 1 389 ? 1.465   9.446   4.743   1.00 54.44  ? 388  TYR B CD2 1 
ATOM   6567 C  CE1 . TYR B 1 389 ? 2.845   7.077   4.989   1.00 52.96  ? 388  TYR B CE1 1 
ATOM   6568 C  CE2 . TYR B 1 389 ? 1.923   8.793   3.615   1.00 53.39  ? 388  TYR B CE2 1 
ATOM   6569 C  CZ  . TYR B 1 389 ? 2.601   7.606   3.743   1.00 51.58  ? 388  TYR B CZ  1 
ATOM   6570 O  OH  . TYR B 1 389 ? 3.044   6.951   2.612   1.00 53.62  ? 388  TYR B OH  1 
ATOM   6571 N  N   . PRO B 1 390 ? -0.716  6.964   7.217   1.00 41.61  ? 389  PRO B N   1 
ATOM   6572 C  CA  . PRO B 1 390 ? -1.316  7.178   5.924   1.00 41.87  ? 389  PRO B CA  1 
ATOM   6573 C  C   . PRO B 1 390 ? -2.843  7.222   5.998   1.00 43.34  ? 389  PRO B C   1 
ATOM   6574 O  O   . PRO B 1 390 ? -3.497  7.002   5.002   1.00 42.07  ? 389  PRO B O   1 
ATOM   6575 C  CB  . PRO B 1 390 ? -0.890  5.921   5.179   1.00 41.60  ? 389  PRO B CB  1 
ATOM   6576 C  CG  . PRO B 1 390 ? -1.014  4.866   6.220   1.00 40.54  ? 389  PRO B CG  1 
ATOM   6577 C  CD  . PRO B 1 390 ? -0.637  5.526   7.522   1.00 40.06  ? 389  PRO B CD  1 
ATOM   6578 N  N   . ARG B 1 391 ? -3.395  7.462   7.182   1.00 47.60  ? 390  ARG B N   1 
ATOM   6579 C  CA  . ARG B 1 391 ? -4.843  7.686   7.366   1.00 48.79  ? 390  ARG B CA  1 
ATOM   6580 C  C   . ARG B 1 391 ? -5.329  8.808   6.448   1.00 47.52  ? 390  ARG B C   1 
ATOM   6581 O  O   . ARG B 1 391 ? -6.436  8.761   5.919   1.00 49.41  ? 390  ARG B O   1 
ATOM   6582 C  CB  . ARG B 1 391 ? -5.117  8.067   8.820   1.00 56.90  ? 390  ARG B CB  1 
ATOM   6583 C  CG  . ARG B 1 391 ? -6.537  7.862   9.295   1.00 60.70  ? 390  ARG B CG  1 
ATOM   6584 C  CD  . ARG B 1 391 ? -6.828  8.626   10.594  1.00 62.93  ? 390  ARG B CD  1 
ATOM   6585 N  NE  . ARG B 1 391 ? -8.031  9.453   10.441  1.00 66.87  ? 390  ARG B NE  1 
ATOM   6586 C  CZ  . ARG B 1 391 ? -8.423  10.404  11.288  1.00 69.93  ? 390  ARG B CZ  1 
ATOM   6587 N  NH1 . ARG B 1 391 ? -7.727  10.650  12.403  1.00 68.13  ? 390  ARG B NH1 1 
ATOM   6588 N  NH2 . ARG B 1 391 ? -9.531  11.116  11.018  1.00 63.61  ? 390  ARG B NH2 1 
ATOM   6589 N  N   . LYS B 1 392 ? -4.470  9.806   6.258   1.00 44.86  ? 391  LYS B N   1 
ATOM   6590 C  CA  . LYS B 1 392 ? -4.653  10.836  5.246   1.00 41.29  ? 391  LYS B CA  1 
ATOM   6591 C  C   . LYS B 1 392 ? -3.391  10.974  4.399   1.00 40.30  ? 391  LYS B C   1 
ATOM   6592 O  O   . LYS B 1 392 ? -2.366  10.375  4.700   1.00 43.01  ? 391  LYS B O   1 
ATOM   6593 C  CB  . LYS B 1 392 ? -4.991  12.178  5.913   1.00 38.49  ? 391  LYS B CB  1 
ATOM   6594 C  CG  . LYS B 1 392 ? -6.345  12.139  6.598   1.00 40.20  ? 391  LYS B CG  1 
ATOM   6595 C  CD  . LYS B 1 392 ? -6.732  13.458  7.241   1.00 40.97  ? 391  LYS B CD  1 
ATOM   6596 C  CE  . LYS B 1 392 ? -7.993  13.332  8.090   1.00 38.54  ? 391  LYS B CE  1 
ATOM   6597 N  NZ  . LYS B 1 392 ? -9.226  12.962  7.341   1.00 39.13  ? 391  LYS B NZ  1 
ATOM   6598 N  N   . GLY B 1 393 ? -3.466  11.769  3.342   1.00 38.26  ? 392  GLY B N   1 
ATOM   6599 C  CA  . GLY B 1 393 ? -2.330  11.967  2.465   1.00 39.32  ? 392  GLY B CA  1 
ATOM   6600 C  C   . GLY B 1 393 ? -1.908  10.761  1.641   1.00 41.84  ? 392  GLY B C   1 
ATOM   6601 O  O   . GLY B 1 393 ? -0.873  10.799  0.992   1.00 44.92  ? 392  GLY B O   1 
ATOM   6602 N  N   . ARG B 1 394 ? -2.693  9.686   1.660   1.00 47.56  ? 393  ARG B N   1 
ATOM   6603 C  CA  . ARG B 1 394 ? -2.417  8.509   0.807   1.00 47.41  ? 393  ARG B CA  1 
ATOM   6604 C  C   . ARG B 1 394 ? -3.667  7.718   0.466   1.00 43.18  ? 393  ARG B C   1 
ATOM   6605 O  O   . ARG B 1 394 ? -4.534  7.486   1.335   1.00 48.37  ? 393  ARG B O   1 
ATOM   6606 C  CB  . ARG B 1 394 ? -1.432  7.556   1.475   1.00 53.50  ? 393  ARG B CB  1 
ATOM   6607 C  CG  . ARG B 1 394 ? -0.913  6.466   0.542   1.00 58.47  ? 393  ARG B CG  1 
ATOM   6608 C  CD  . ARG B 1 394 ? 0.057   5.537   1.263   1.00 62.78  ? 393  ARG B CD  1 
ATOM   6609 N  NE  . ARG B 1 394 ? 0.840   4.683   0.354   1.00 66.60  ? 393  ARG B NE  1 
ATOM   6610 C  CZ  . ARG B 1 394 ? 1.948   5.061   -0.287  1.00 67.78  ? 393  ARG B CZ  1 
ATOM   6611 N  NH1 . ARG B 1 394 ? 2.418   6.298   -0.152  1.00 70.88  ? 393  ARG B NH1 1 
ATOM   6612 N  NH2 . ARG B 1 394 ? 2.579   4.199   -1.070  1.00 66.82  ? 393  ARG B NH2 1 
ATOM   6613 N  N   . ILE B 1 395 ? -3.728  7.307   -0.794  1.00 39.13  ? 394  ILE B N   1 
ATOM   6614 C  CA  . ILE B 1 395 ? -4.747  6.419   -1.312  1.00 40.66  ? 394  ILE B CA  1 
ATOM   6615 C  C   . ILE B 1 395 ? -4.284  4.981   -1.123  1.00 43.16  ? 394  ILE B C   1 
ATOM   6616 O  O   . ILE B 1 395 ? -3.613  4.443   -1.974  1.00 43.99  ? 394  ILE B O   1 
ATOM   6617 C  CB  . ILE B 1 395 ? -4.991  6.671   -2.821  1.00 40.32  ? 394  ILE B CB  1 
ATOM   6618 C  CG1 . ILE B 1 395 ? -5.312  8.164   -3.086  1.00 42.92  ? 394  ILE B CG1 1 
ATOM   6619 C  CG2 . ILE B 1 395 ? -6.098  5.764   -3.358  1.00 39.99  ? 394  ILE B CG2 1 
ATOM   6620 C  CD1 . ILE B 1 395 ? -6.531  8.706   -2.363  1.00 42.77  ? 394  ILE B CD1 1 
ATOM   6621 N  N   . ILE B 1 396 ? -4.595  4.401   0.031   1.00 47.69  ? 395  ILE B N   1 
ATOM   6622 C  CA  . ILE B 1 396 ? -4.555  2.960   0.229   1.00 48.87  ? 395  ILE B CA  1 
ATOM   6623 C  C   . ILE B 1 396 ? -5.732  2.470   1.087   1.00 47.84  ? 395  ILE B C   1 
ATOM   6624 O  O   . ILE B 1 396 ? -6.419  3.248   1.730   1.00 39.95  ? 395  ILE B O   1 
ATOM   6625 C  CB  . ILE B 1 396 ? -3.271  2.475   0.923   1.00 56.74  ? 395  ILE B CB  1 
ATOM   6626 C  CG1 . ILE B 1 396 ? -3.043  3.174   2.278   1.00 56.66  ? 395  ILE B CG1 1 
ATOM   6627 C  CG2 . ILE B 1 396 ? -2.078  2.605   -0.010  1.00 64.71  ? 395  ILE B CG2 1 
ATOM   6628 C  CD1 . ILE B 1 396 ? -2.391  2.227   3.276   1.00 54.38  ? 395  ILE B CD1 1 
ATOM   6629 N  N   . PRO B 1 397 ? -5.964  1.154   1.091   1.00 50.64  ? 396  PRO B N   1 
ATOM   6630 C  CA  . PRO B 1 397 ? -7.023  0.653   1.953   1.00 49.30  ? 396  PRO B CA  1 
ATOM   6631 C  C   . PRO B 1 397 ? -6.777  0.958   3.428   1.00 43.66  ? 396  PRO B C   1 
ATOM   6632 O  O   . PRO B 1 397 ? -5.636  0.904   3.902   1.00 36.89  ? 396  PRO B O   1 
ATOM   6633 C  CB  . PRO B 1 397 ? -6.994  -0.864  1.696   1.00 52.02  ? 396  PRO B CB  1 
ATOM   6634 C  CG  . PRO B 1 397 ? -6.465  -0.979  0.305   1.00 51.54  ? 396  PRO B CG  1 
ATOM   6635 C  CD  . PRO B 1 397 ? -5.437  0.102   0.191   1.00 50.21  ? 396  PRO B CD  1 
ATOM   6636 N  N   . GLY B 1 398 ? -7.866  1.257   4.124   1.00 43.28  ? 397  GLY B N   1 
ATOM   6637 C  CA  . GLY B 1 398 ? -7.842  1.684   5.519   1.00 46.48  ? 397  GLY B CA  1 
ATOM   6638 C  C   . GLY B 1 398 ? -7.865  3.206   5.661   1.00 47.06  ? 397  GLY B C   1 
ATOM   6639 O  O   . GLY B 1 398 ? -8.327  3.733   6.675   1.00 52.63  ? 397  GLY B O   1 
ATOM   6640 N  N   . ALA B 1 399 ? -7.332  3.908   4.663   1.00 42.56  ? 398  ALA B N   1 
ATOM   6641 C  CA  . ALA B 1 399 ? -7.195  5.351   4.714   1.00 41.39  ? 398  ALA B CA  1 
ATOM   6642 C  C   . ALA B 1 399 ? -8.562  5.986   4.823   1.00 41.10  ? 398  ALA B C   1 
ATOM   6643 O  O   . ALA B 1 399 ? -9.561  5.379   4.447   1.00 41.44  ? 398  ALA B O   1 
ATOM   6644 C  CB  . ALA B 1 399 ? -6.466  5.870   3.465   1.00 42.51  ? 398  ALA B CB  1 
ATOM   6645 N  N   . ASP B 1 400 ? -8.592  7.206   5.335   1.00 38.98  ? 399  ASP B N   1 
ATOM   6646 C  CA  . ASP B 1 400 ? -9.776  8.016   5.276   1.00 40.54  ? 399  ASP B CA  1 
ATOM   6647 C  C   . ASP B 1 400 ? -10.024 8.313   3.813   1.00 41.28  ? 399  ASP B C   1 
ATOM   6648 O  O   . ASP B 1 400 ? -9.112  8.618   3.073   1.00 43.47  ? 399  ASP B O   1 
ATOM   6649 C  CB  . ASP B 1 400 ? -9.597  9.347   6.027   1.00 43.74  ? 399  ASP B CB  1 
ATOM   6650 C  CG  . ASP B 1 400 ? -9.471  9.172   7.533   1.00 43.48  ? 399  ASP B CG  1 
ATOM   6651 O  OD1 . ASP B 1 400 ? -9.658  8.031   8.026   1.00 43.23  ? 399  ASP B OD1 1 
ATOM   6652 O  OD2 . ASP B 1 400 ? -9.148  10.165  8.208   1.00 38.36  ? 399  ASP B OD2 1 
ATOM   6653 N  N   . ALA B 1 401 ? -11.277 8.284   3.402   1.00 42.32  ? 400  ALA B N   1 
ATOM   6654 C  CA  . ALA B 1 401 ? -11.635 8.580   2.034   1.00 42.79  ? 400  ALA B CA  1 
ATOM   6655 C  C   . ALA B 1 401 ? -11.660 10.090  1.819   1.00 42.85  ? 400  ALA B C   1 
ATOM   6656 O  O   . ALA B 1 401 ? -12.695 10.682  1.532   1.00 43.06  ? 400  ALA B O   1 
ATOM   6657 C  CB  . ALA B 1 401 ? -12.972 7.973   1.724   1.00 41.99  ? 400  ALA B CB  1 
ATOM   6658 N  N   . ASP B 1 402 ? -10.509 10.722  1.987   1.00 40.65  ? 401  ASP B N   1 
ATOM   6659 C  CA  . ASP B 1 402 ? -10.339 12.089  1.539   1.00 41.82  ? 401  ASP B CA  1 
ATOM   6660 C  C   . ASP B 1 402 ? -9.591  11.987  0.215   1.00 39.72  ? 401  ASP B C   1 
ATOM   6661 O  O   . ASP B 1 402 ? -8.363  11.839  0.205   1.00 38.14  ? 401  ASP B O   1 
ATOM   6662 C  CB  . ASP B 1 402 ? -9.516  12.878  2.550   1.00 41.17  ? 401  ASP B CB  1 
ATOM   6663 C  CG  . ASP B 1 402 ? -10.207 13.064  3.847   1.00 37.18  ? 401  ASP B CG  1 
ATOM   6664 O  OD1 . ASP B 1 402 ? -11.386 12.717  3.988   1.00 38.53  ? 401  ASP B OD1 1 
ATOM   6665 O  OD2 . ASP B 1 402 ? -9.525  13.550  4.742   1.00 36.77  ? 401  ASP B OD2 1 
ATOM   6666 N  N   . VAL B 1 403 ? -10.338 12.061  -0.880  1.00 37.47  ? 402  VAL B N   1 
ATOM   6667 C  CA  . VAL B 1 403 ? -9.829  11.738  -2.214  1.00 37.66  ? 402  VAL B CA  1 
ATOM   6668 C  C   . VAL B 1 403 ? -10.265 12.767  -3.209  1.00 36.55  ? 402  VAL B C   1 
ATOM   6669 O  O   . VAL B 1 403 ? -11.393 13.188  -3.150  1.00 44.23  ? 402  VAL B O   1 
ATOM   6670 C  CB  . VAL B 1 403 ? -10.412 10.405  -2.720  1.00 36.45  ? 402  VAL B CB  1 
ATOM   6671 C  CG1 . VAL B 1 403 ? -9.940  10.103  -4.147  1.00 35.73  ? 402  VAL B CG1 1 
ATOM   6672 C  CG2 . VAL B 1 403 ? -10.058 9.284   -1.742  1.00 36.63  ? 402  VAL B CG2 1 
ATOM   6673 N  N   . VAL B 1 404 ? -9.395  13.142  -4.132  1.00 35.84  ? 403  VAL B N   1 
ATOM   6674 C  CA  . VAL B 1 404 ? -9.748  14.090  -5.176  1.00 38.10  ? 403  VAL B CA  1 
ATOM   6675 C  C   . VAL B 1 404 ? -9.483  13.486  -6.562  1.00 39.96  ? 403  VAL B C   1 
ATOM   6676 O  O   . VAL B 1 404 ? -8.433  12.896  -6.821  1.00 37.24  ? 403  VAL B O   1 
ATOM   6677 C  CB  . VAL B 1 404 ? -8.971  15.423  -5.054  1.00 41.49  ? 403  VAL B CB  1 
ATOM   6678 C  CG1 . VAL B 1 404 ? -9.206  16.322  -6.272  1.00 43.85  ? 403  VAL B CG1 1 
ATOM   6679 C  CG2 . VAL B 1 404 ? -9.358  16.180  -3.794  1.00 43.80  ? 403  VAL B CG2 1 
ATOM   6680 N  N   . VAL B 1 405 ? -10.489 13.585  -7.430  1.00 41.60  ? 404  VAL B N   1 
ATOM   6681 C  CA  . VAL B 1 405 ? -10.348 13.179  -8.795  1.00 41.71  ? 404  VAL B CA  1 
ATOM   6682 C  C   . VAL B 1 405 ? -9.872  14.436  -9.468  1.00 48.34  ? 404  VAL B C   1 
ATOM   6683 O  O   . VAL B 1 405 ? -10.622 15.397  -9.641  1.00 51.83  ? 404  VAL B O   1 
ATOM   6684 C  CB  . VAL B 1 405 ? -11.652 12.648  -9.423  1.00 39.51  ? 404  VAL B CB  1 
ATOM   6685 C  CG1 . VAL B 1 405 ? -11.513 12.530  -10.934 1.00 42.62  ? 404  VAL B CG1 1 
ATOM   6686 C  CG2 . VAL B 1 405 ? -12.009 11.289  -8.849  1.00 38.67  ? 404  VAL B CG2 1 
ATOM   6687 N  N   . TRP B 1 406 ? -8.601  14.396  -9.852  1.00 55.62  ? 405  TRP B N   1 
ATOM   6688 C  CA  . TRP B 1 406 ? -7.870  15.540  -10.389 1.00 55.20  ? 405  TRP B CA  1 
ATOM   6689 C  C   . TRP B 1 406 ? -7.792  15.431  -11.900 1.00 59.86  ? 405  TRP B C   1 
ATOM   6690 O  O   . TRP B 1 406 ? -7.373  14.404  -12.412 1.00 69.73  ? 405  TRP B O   1 
ATOM   6691 C  CB  . TRP B 1 406 ? -6.449  15.583  -9.781  1.00 50.79  ? 405  TRP B CB  1 
ATOM   6692 C  CG  . TRP B 1 406 ? -5.670  16.812  -10.125 1.00 47.08  ? 405  TRP B CG  1 
ATOM   6693 C  CD1 . TRP B 1 406 ? -4.670  16.919  -11.046 1.00 46.40  ? 405  TRP B CD1 1 
ATOM   6694 C  CD2 . TRP B 1 406 ? -5.819  18.115  -9.549  1.00 50.64  ? 405  TRP B CD2 1 
ATOM   6695 N  NE1 . TRP B 1 406 ? -4.191  18.201  -11.082 1.00 48.05  ? 405  TRP B NE1 1 
ATOM   6696 C  CE2 . TRP B 1 406 ? -4.869  18.959  -10.166 1.00 51.55  ? 405  TRP B CE2 1 
ATOM   6697 C  CE3 . TRP B 1 406 ? -6.655  18.656  -8.565  1.00 52.09  ? 405  TRP B CE3 1 
ATOM   6698 C  CZ2 . TRP B 1 406 ? -4.736  20.315  -9.828  1.00 48.19  ? 405  TRP B CZ2 1 
ATOM   6699 C  CZ3 . TRP B 1 406 ? -6.516  20.006  -8.240  1.00 50.03  ? 405  TRP B CZ3 1 
ATOM   6700 C  CH2 . TRP B 1 406 ? -5.573  20.813  -8.876  1.00 47.65  ? 405  TRP B CH2 1 
ATOM   6701 N  N   . ASP B 1 407 ? -8.143  16.514  -12.596 1.00 62.89  ? 406  ASP B N   1 
ATOM   6702 C  CA  . ASP B 1 407 ? -8.077  16.588  -14.059 1.00 59.71  ? 406  ASP B CA  1 
ATOM   6703 C  C   . ASP B 1 407 ? -6.842  17.339  -14.530 1.00 60.31  ? 406  ASP B C   1 
ATOM   6704 O  O   . ASP B 1 407 ? -6.743  18.561  -14.373 1.00 57.36  ? 406  ASP B O   1 
ATOM   6705 C  CB  . ASP B 1 407 ? -9.298  17.313  -14.608 1.00 63.18  ? 406  ASP B CB  1 
ATOM   6706 C  CG  . ASP B 1 407 ? -9.474  17.120  -16.102 1.00 63.49  ? 406  ASP B CG  1 
ATOM   6707 O  OD1 . ASP B 1 407 ? -8.491  16.720  -16.797 1.00 63.13  ? 406  ASP B OD1 1 
ATOM   6708 O  OD2 . ASP B 1 407 ? -10.616 17.371  -16.560 1.00 60.72  ? 406  ASP B OD2 1 
ATOM   6709 N  N   . PRO B 1 408 ? -5.906  16.614  -15.144 1.00 59.79  ? 407  PRO B N   1 
ATOM   6710 C  CA  . PRO B 1 408 ? -4.641  17.194  -15.557 1.00 63.02  ? 407  PRO B CA  1 
ATOM   6711 C  C   . PRO B 1 408 ? -4.732  17.830  -16.933 1.00 61.01  ? 407  PRO B C   1 
ATOM   6712 O  O   . PRO B 1 408 ? -3.757  18.414  -17.382 1.00 62.81  ? 407  PRO B O   1 
ATOM   6713 C  CB  . PRO B 1 408 ? -3.710  15.991  -15.562 1.00 62.48  ? 407  PRO B CB  1 
ATOM   6714 C  CG  . PRO B 1 408 ? -4.608  14.900  -15.982 1.00 63.42  ? 407  PRO B CG  1 
ATOM   6715 C  CD  . PRO B 1 408 ? -5.895  15.157  -15.273 1.00 62.18  ? 407  PRO B CD  1 
ATOM   6716 N  N   . GLU B 1 409 ? -5.887  17.726  -17.572 1.00 61.07  ? 408  GLU B N   1 
ATOM   6717 C  CA  . GLU B 1 409 ? -6.094  18.334  -18.897 1.00 66.51  ? 408  GLU B CA  1 
ATOM   6718 C  C   . GLU B 1 409 ? -7.183  19.401  -18.919 1.00 65.88  ? 408  GLU B C   1 
ATOM   6719 O  O   . GLU B 1 409 ? -7.871  19.546  -19.910 1.00 62.02  ? 408  GLU B O   1 
ATOM   6720 C  CB  . GLU B 1 409 ? -6.432  17.250  -19.917 1.00 71.51  ? 408  GLU B CB  1 
ATOM   6721 C  CG  . GLU B 1 409 ? -5.306  16.258  -20.160 1.00 74.65  ? 408  GLU B CG  1 
ATOM   6722 C  CD  . GLU B 1 409 ? -5.831  14.918  -20.677 1.00 75.86  ? 408  GLU B CD  1 
ATOM   6723 O  OE1 . GLU B 1 409 ? -6.825  14.388  -20.132 1.00 72.07  ? 408  GLU B OE1 1 
ATOM   6724 O  OE2 . GLU B 1 409 ? -5.257  14.378  -21.631 1.00 76.17  ? 408  GLU B OE2 1 
ATOM   6725 N  N   . ALA B 1 410 ? -7.297  20.168  -17.837 1.00 72.46  ? 409  ALA B N   1 
ATOM   6726 C  CA  . ALA B 1 410 ? -8.392  21.146  -17.610 1.00 67.50  ? 409  ALA B CA  1 
ATOM   6727 C  C   . ALA B 1 410 ? -8.244  22.496  -18.306 1.00 65.32  ? 409  ALA B C   1 
ATOM   6728 O  O   . ALA B 1 410 ? -7.193  22.836  -18.828 1.00 68.11  ? 409  ALA B O   1 
ATOM   6729 C  CB  . ALA B 1 410 ? -8.485  21.434  -16.130 1.00 70.09  ? 409  ALA B CB  1 
ATOM   6730 N  N   . THR B 1 411 ? -9.292  23.304  -18.205 1.00 66.90  ? 410  THR B N   1 
ATOM   6731 C  CA  . THR B 1 411 ? -9.336  24.616  -18.857 1.00 66.88  ? 410  THR B CA  1 
ATOM   6732 C  C   . THR B 1 411 ? -9.381  25.888  -17.977 1.00 62.81  ? 410  THR B C   1 
ATOM   6733 O  O   . THR B 1 411 ? -9.160  26.981  -18.489 1.00 67.23  ? 410  THR B O   1 
ATOM   6734 C  CB  . THR B 1 411 ? -10.492 24.653  -19.920 1.00 68.53  ? 410  THR B CB  1 
ATOM   6735 O  OG1 . THR B 1 411 ? -11.784 24.703  -19.290 1.00 53.46  ? 410  THR B OG1 1 
ATOM   6736 C  CG2 . THR B 1 411 ? -10.426 23.422  -20.848 1.00 64.79  ? 410  THR B CG2 1 
ATOM   6737 N  N   . LYS B 1 412 ? -9.606  25.793  -16.679 1.00 60.83  ? 411  LYS B N   1 
ATOM   6738 C  CA  . LYS B 1 412 ? -10.018 27.013  -15.951 1.00 63.94  ? 411  LYS B CA  1 
ATOM   6739 C  C   . LYS B 1 412 ? -9.002  28.169  -16.002 1.00 59.71  ? 411  LYS B C   1 
ATOM   6740 O  O   . LYS B 1 412 ? -7.805  27.958  -15.983 1.00 58.23  ? 411  LYS B O   1 
ATOM   6741 C  CB  . LYS B 1 412 ? -10.325 26.669  -14.484 1.00 66.05  ? 411  LYS B CB  1 
ATOM   6742 C  CG  . LYS B 1 412 ? -10.939 27.770  -13.598 1.00 61.10  ? 411  LYS B CG  1 
ATOM   6743 C  CD  . LYS B 1 412 ? -10.549 27.560  -12.132 1.00 59.40  ? 411  LYS B CD  1 
ATOM   6744 C  CE  . LYS B 1 412 ? -11.523 28.141  -11.111 1.00 58.36  ? 411  LYS B CE  1 
ATOM   6745 N  NZ  . LYS B 1 412 ? -12.658 27.233  -10.736 1.00 59.68  ? 411  LYS B NZ  1 
ATOM   6746 N  N   . THR B 1 413 ? -9.504  29.390  -16.091 1.00 58.46  ? 412  THR B N   1 
ATOM   6747 C  CA  . THR B 1 413 ? -8.667  30.560  -15.934 1.00 60.45  ? 412  THR B CA  1 
ATOM   6748 C  C   . THR B 1 413 ? -9.047  31.255  -14.645 1.00 62.95  ? 412  THR B C   1 
ATOM   6749 O  O   . THR B 1 413 ? -10.192 31.652  -14.467 1.00 69.17  ? 412  THR B O   1 
ATOM   6750 C  CB  . THR B 1 413 ? -8.835  31.516  -17.120 1.00 64.52  ? 412  THR B CB  1 
ATOM   6751 O  OG1 . THR B 1 413 ? -8.174  30.953  -18.260 1.00 67.60  ? 412  THR B OG1 1 
ATOM   6752 C  CG2 . THR B 1 413 ? -8.226  32.898  -16.815 1.00 67.72  ? 412  THR B CG2 1 
ATOM   6753 N  N   . ILE B 1 414 ? -8.091  31.409  -13.733 1.00 66.18  ? 413  ILE B N   1 
ATOM   6754 C  CA  . ILE B 1 414 ? -8.414  31.985  -12.424 1.00 60.89  ? 413  ILE B CA  1 
ATOM   6755 C  C   . ILE B 1 414 ? -8.880  33.426  -12.545 1.00 55.92  ? 413  ILE B C   1 
ATOM   6756 O  O   . ILE B 1 414 ? -8.204  34.275  -13.130 1.00 52.79  ? 413  ILE B O   1 
ATOM   6757 C  CB  . ILE B 1 414 ? -7.251  31.937  -11.414 1.00 61.24  ? 413  ILE B CB  1 
ATOM   6758 C  CG1 . ILE B 1 414 ? -6.776  30.492  -11.206 1.00 59.85  ? 413  ILE B CG1 1 
ATOM   6759 C  CG2 . ILE B 1 414 ? -7.705  32.537  -10.086 1.00 60.06  ? 413  ILE B CG2 1 
ATOM   6760 C  CD1 . ILE B 1 414 ? -5.778  30.339  -10.075 1.00 59.52  ? 413  ILE B CD1 1 
ATOM   6761 N  N   . SER B 1 415 ? -10.036 33.681  -11.947 1.00 52.18  ? 414  SER B N   1 
ATOM   6762 C  CA  . SER B 1 415 ? -10.552 35.014  -11.779 1.00 50.54  ? 414  SER B CA  1 
ATOM   6763 C  C   . SER B 1 415 ? -11.200 35.184  -10.415 1.00 51.60  ? 414  SER B C   1 
ATOM   6764 O  O   . SER B 1 415 ? -11.784 34.245  -9.852  1.00 55.93  ? 414  SER B O   1 
ATOM   6765 C  CB  . SER B 1 415 ? -11.598 35.297  -12.834 1.00 53.08  ? 414  SER B CB  1 
ATOM   6766 O  OG  . SER B 1 415 ? -12.305 36.487  -12.516 1.00 51.46  ? 414  SER B OG  1 
ATOM   6767 N  N   . ALA B 1 416 ? -11.110 36.395  -9.886  1.00 53.92  ? 415  ALA B N   1 
ATOM   6768 C  CA  . ALA B 1 416 ? -11.771 36.726  -8.630  1.00 53.94  ? 415  ALA B CA  1 
ATOM   6769 C  C   . ALA B 1 416 ? -13.278 36.598  -8.780  1.00 58.83  ? 415  ALA B C   1 
ATOM   6770 O  O   . ALA B 1 416 ? -13.966 36.117  -7.889  1.00 67.63  ? 415  ALA B O   1 
ATOM   6771 C  CB  . ALA B 1 416 ? -11.403 38.132  -8.214  1.00 54.26  ? 415  ALA B CB  1 
ATOM   6772 N  N   . SER B 1 417 ? -13.789 37.023  -9.932  1.00 66.75  ? 416  SER B N   1 
ATOM   6773 C  CA  . SER B 1 417 ? -15.241 37.024  -10.210 1.00 66.39  ? 416  SER B CA  1 
ATOM   6774 C  C   . SER B 1 417 ? -15.901 35.628  -10.194 1.00 63.91  ? 416  SER B C   1 
ATOM   6775 O  O   . SER B 1 417 ? -17.118 35.531  -10.251 1.00 55.87  ? 416  SER B O   1 
ATOM   6776 C  CB  . SER B 1 417 ? -15.523 37.721  -11.554 1.00 63.62  ? 416  SER B CB  1 
ATOM   6777 O  OG  . SER B 1 417 ? -14.999 36.954  -12.624 1.00 63.81  ? 416  SER B OG  1 
ATOM   6778 N  N   . THR B 1 418 ? -15.107 34.555  -10.139 1.00 63.59  ? 417  THR B N   1 
ATOM   6779 C  CA  . THR B 1 418 ? -15.676 33.196  -10.052 1.00 60.41  ? 417  THR B CA  1 
ATOM   6780 C  C   . THR B 1 418 ? -15.206 32.405  -8.836  1.00 58.19  ? 417  THR B C   1 
ATOM   6781 O  O   . THR B 1 418 ? -15.598 31.269  -8.672  1.00 59.08  ? 417  THR B O   1 
ATOM   6782 C  CB  . THR B 1 418 ? -15.352 32.361  -11.311 1.00 59.79  ? 417  THR B CB  1 
ATOM   6783 O  OG1 . THR B 1 418 ? -13.960 32.025  -11.328 1.00 59.47  ? 417  THR B OG1 1 
ATOM   6784 C  CG2 . THR B 1 418 ? -15.711 33.142  -12.570 1.00 60.91  ? 417  THR B CG2 1 
ATOM   6785 N  N   . GLN B 1 419 ? -14.384 32.992  -7.980  1.00 52.63  ? 418  GLN B N   1 
ATOM   6786 C  CA  . GLN B 1 419 ? -13.848 32.249  -6.861  1.00 47.68  ? 418  GLN B CA  1 
ATOM   6787 C  C   . GLN B 1 419 ? -14.881 32.175  -5.767  1.00 44.91  ? 418  GLN B C   1 
ATOM   6788 O  O   . GLN B 1 419 ? -15.712 33.033  -5.627  1.00 43.32  ? 418  GLN B O   1 
ATOM   6789 C  CB  . GLN B 1 419 ? -12.572 32.900  -6.323  1.00 47.65  ? 418  GLN B CB  1 
ATOM   6790 C  CG  . GLN B 1 419 ? -12.816 34.170  -5.519  1.00 49.62  ? 418  GLN B CG  1 
ATOM   6791 C  CD  . GLN B 1 419 ? -11.538 34.864  -5.123  1.00 51.25  ? 418  GLN B CD  1 
ATOM   6792 O  OE1 . GLN B 1 419 ? -10.452 34.468  -5.547  1.00 54.18  ? 418  GLN B OE1 1 
ATOM   6793 N  NE2 . GLN B 1 419 ? -11.658 35.914  -4.324  1.00 51.07  ? 418  GLN B NE2 1 
ATOM   6794 N  N   . VAL B 1 420 ? -14.786 31.149  -4.950  1.00 49.08  ? 419  VAL B N   1 
ATOM   6795 C  CA  . VAL B 1 420 ? -15.693 30.971  -3.821  1.00 46.45  ? 419  VAL B CA  1 
ATOM   6796 C  C   . VAL B 1 420 ? -15.006 31.260  -2.498  1.00 42.57  ? 419  VAL B C   1 
ATOM   6797 O  O   . VAL B 1 420 ? -15.619 31.120  -1.449  1.00 44.38  ? 419  VAL B O   1 
ATOM   6798 C  CB  . VAL B 1 420 ? -16.276 29.523  -3.795  1.00 48.60  ? 419  VAL B CB  1 
ATOM   6799 C  CG1 . VAL B 1 420 ? -16.938 29.206  -5.129  1.00 46.76  ? 419  VAL B CG1 1 
ATOM   6800 C  CG2 . VAL B 1 420 ? -15.221 28.473  -3.457  1.00 47.07  ? 419  VAL B CG2 1 
ATOM   6801 N  N   . GLN B 1 421 ? -13.724 31.609  -2.546  1.00 41.87  ? 420  GLN B N   1 
ATOM   6802 C  CA  . GLN B 1 421 ? -12.975 32.052  -1.370  1.00 45.16  ? 420  GLN B CA  1 
ATOM   6803 C  C   . GLN B 1 421 ? -13.094 33.571  -1.215  1.00 43.34  ? 420  GLN B C   1 
ATOM   6804 O  O   . GLN B 1 421 ? -13.407 34.287  -2.157  1.00 41.40  ? 420  GLN B O   1 
ATOM   6805 C  CB  . GLN B 1 421 ? -11.488 31.708  -1.484  1.00 49.68  ? 420  GLN B CB  1 
ATOM   6806 C  CG  . GLN B 1 421 ? -10.827 32.276  -2.748  1.00 53.96  ? 420  GLN B CG  1 
ATOM   6807 C  CD  . GLN B 1 421 ? -9.330  32.038  -2.789  1.00 55.44  ? 420  GLN B CD  1 
ATOM   6808 O  OE1 . GLN B 1 421 ? -8.781  31.308  -1.980  1.00 58.90  ? 420  GLN B OE1 1 
ATOM   6809 N  NE2 . GLN B 1 421 ? -8.676  32.651  -3.744  1.00 58.67  ? 420  GLN B NE2 1 
ATOM   6810 N  N   . GLY B 1 422 ? -12.808 34.043  -0.010  1.00 43.57  ? 421  GLY B N   1 
ATOM   6811 C  CA  . GLY B 1 422 ? -12.980 35.430  0.334   1.00 43.94  ? 421  GLY B CA  1 
ATOM   6812 C  C   . GLY B 1 422 ? -11.951 36.302  -0.312  1.00 44.36  ? 421  GLY B C   1 
ATOM   6813 O  O   . GLY B 1 422 ? -10.909 35.814  -0.720  1.00 42.55  ? 421  GLY B O   1 
ATOM   6814 N  N   . GLY B 1 423 ? -12.248 37.601  -0.389  1.00 46.07  ? 422  GLY B N   1 
ATOM   6815 C  CA  . GLY B 1 423 ? -11.318 38.585  -0.940  1.00 45.89  ? 422  GLY B CA  1 
ATOM   6816 C  C   . GLY B 1 423 ? -11.839 39.261  -2.196  1.00 43.66  ? 422  GLY B C   1 
ATOM   6817 O  O   . GLY B 1 423 ? -12.376 38.608  -3.074  1.00 42.85  ? 422  GLY B O   1 
ATOM   6818 N  N   . ASP B 1 424 ? -11.662 40.573  -2.274  1.00 41.74  ? 423  ASP B N   1 
ATOM   6819 C  CA  . ASP B 1 424 ? -11.892 41.299  -3.503  1.00 44.91  ? 423  ASP B CA  1 
ATOM   6820 C  C   . ASP B 1 424 ? -11.036 40.762  -4.632  1.00 49.94  ? 423  ASP B C   1 
ATOM   6821 O  O   . ASP B 1 424 ? -11.454 40.774  -5.778  1.00 49.09  ? 423  ASP B O   1 
ATOM   6822 C  CB  . ASP B 1 424 ? -11.487 42.756  -3.341  1.00 49.30  ? 423  ASP B CB  1 
ATOM   6823 C  CG  . ASP B 1 424 ? -12.337 43.480  -2.395  1.00 53.28  ? 423  ASP B CG  1 
ATOM   6824 O  OD1 . ASP B 1 424 ? -13.292 42.873  -1.906  1.00 67.79  ? 423  ASP B OD1 1 
ATOM   6825 O  OD2 . ASP B 1 424 ? -12.074 44.671  -2.156  1.00 59.48  ? 423  ASP B OD2 1 
ATOM   6826 N  N   . PHE B 1 425 ? -9.822  40.324  -4.294  1.00 54.38  ? 424  PHE B N   1 
ATOM   6827 C  CA  . PHE B 1 425 ? -8.802  40.006  -5.274  1.00 53.70  ? 424  PHE B CA  1 
ATOM   6828 C  C   . PHE B 1 425 ? -8.404  38.530  -5.247  1.00 54.48  ? 424  PHE B C   1 
ATOM   6829 O  O   . PHE B 1 425 ? -8.534  37.849  -4.225  1.00 48.06  ? 424  PHE B O   1 
ATOM   6830 C  CB  . PHE B 1 425 ? -7.557  40.829  -4.983  1.00 57.06  ? 424  PHE B CB  1 
ATOM   6831 C  CG  . PHE B 1 425 ? -7.611  42.225  -5.509  1.00 63.84  ? 424  PHE B CG  1 
ATOM   6832 C  CD1 . PHE B 1 425 ? -8.187  43.237  -4.761  1.00 64.95  ? 424  PHE B CD1 1 
ATOM   6833 C  CD2 . PHE B 1 425 ? -7.045  42.541  -6.738  1.00 68.06  ? 424  PHE B CD2 1 
ATOM   6834 C  CE1 . PHE B 1 425 ? -8.224  44.539  -5.236  1.00 66.40  ? 424  PHE B CE1 1 
ATOM   6835 C  CE2 . PHE B 1 425 ? -7.075  43.841  -7.216  1.00 67.66  ? 424  PHE B CE2 1 
ATOM   6836 C  CZ  . PHE B 1 425 ? -7.675  44.841  -6.467  1.00 65.62  ? 424  PHE B CZ  1 
ATOM   6837 N  N   . ASN B 1 426 ? -7.912  38.062  -6.394  1.00 54.04  ? 425  ASN B N   1 
ATOM   6838 C  CA  . ASN B 1 426 ? -7.163  36.827  -6.505  1.00 56.35  ? 425  ASN B CA  1 
ATOM   6839 C  C   . ASN B 1 426 ? -5.749  37.186  -6.957  1.00 59.05  ? 425  ASN B C   1 
ATOM   6840 O  O   . ASN B 1 426 ? -5.572  37.871  -7.972  1.00 61.58  ? 425  ASN B O   1 
ATOM   6841 C  CB  . ASN B 1 426 ? -7.785  35.905  -7.538  1.00 58.01  ? 425  ASN B CB  1 
ATOM   6842 C  CG  . ASN B 1 426 ? -7.332  34.443  -7.371  1.00 60.76  ? 425  ASN B CG  1 
ATOM   6843 O  OD1 . ASN B 1 426 ? -6.272  34.055  -7.852  1.00 54.23  ? 425  ASN B OD1 1 
ATOM   6844 N  ND2 . ASN B 1 426 ? -8.139  33.646  -6.714  1.00 62.52  ? 425  ASN B ND2 1 
ATOM   6845 N  N   . LEU B 1 427 ? -4.735  36.724  -6.226  1.00 58.25  ? 426  LEU B N   1 
ATOM   6846 C  CA  . LEU B 1 427 ? -3.344  37.037  -6.577  1.00 53.69  ? 426  LEU B CA  1 
ATOM   6847 C  C   . LEU B 1 427 ? -2.953  36.455  -7.942  1.00 52.53  ? 426  LEU B C   1 
ATOM   6848 O  O   . LEU B 1 427 ? -1.985  36.905  -8.566  1.00 49.71  ? 426  LEU B O   1 
ATOM   6849 C  CB  . LEU B 1 427 ? -2.395  36.487  -5.525  1.00 50.36  ? 426  LEU B CB  1 
ATOM   6850 C  CG  . LEU B 1 427 ? -2.696  36.853  -4.078  1.00 49.34  ? 426  LEU B CG  1 
ATOM   6851 C  CD1 . LEU B 1 427 ? -1.574  36.319  -3.197  1.00 49.76  ? 426  LEU B CD1 1 
ATOM   6852 C  CD2 . LEU B 1 427 ? -2.875  38.358  -3.898  1.00 47.08  ? 426  LEU B CD2 1 
ATOM   6853 N  N   . TYR B 1 428 ? -3.732  35.478  -8.400  1.00 49.80  ? 427  TYR B N   1 
ATOM   6854 C  CA  . TYR B 1 428 ? -3.446  34.751  -9.630  1.00 47.07  ? 427  TYR B CA  1 
ATOM   6855 C  C   . TYR B 1 428 ? -4.386  35.109  -10.758 1.00 45.65  ? 427  TYR B C   1 
ATOM   6856 O  O   . TYR B 1 428 ? -4.533  34.346  -11.695 1.00 44.53  ? 427  TYR B O   1 
ATOM   6857 C  CB  . TYR B 1 428 ? -3.540  33.265  -9.332  1.00 46.91  ? 427  TYR B CB  1 
ATOM   6858 C  CG  . TYR B 1 428 ? -2.779  32.920  -8.082  1.00 48.23  ? 427  TYR B CG  1 
ATOM   6859 C  CD1 . TYR B 1 428 ? -1.387  32.938  -8.070  1.00 52.71  ? 427  TYR B CD1 1 
ATOM   6860 C  CD2 . TYR B 1 428 ? -3.438  32.636  -6.896  1.00 48.84  ? 427  TYR B CD2 1 
ATOM   6861 C  CE1 . TYR B 1 428 ? -0.674  32.664  -6.909  1.00 52.20  ? 427  TYR B CE1 1 
ATOM   6862 C  CE2 . TYR B 1 428 ? -2.739  32.346  -5.731  1.00 49.65  ? 427  TYR B CE2 1 
ATOM   6863 C  CZ  . TYR B 1 428 ? -1.356  32.367  -5.740  1.00 52.89  ? 427  TYR B CZ  1 
ATOM   6864 O  OH  . TYR B 1 428 ? -0.666  32.064  -4.604  1.00 47.16  ? 427  TYR B OH  1 
ATOM   6865 N  N   . GLU B 1 429 ? -5.011  36.283  -10.687 1.00 49.68  ? 428  GLU B N   1 
ATOM   6866 C  CA  . GLU B 1 429 ? -5.949  36.703  -11.726 1.00 51.13  ? 428  GLU B CA  1 
ATOM   6867 C  C   . GLU B 1 429 ? -5.394  36.427  -13.125 1.00 49.58  ? 428  GLU B C   1 
ATOM   6868 O  O   . GLU B 1 429 ? -4.239  36.689  -13.408 1.00 45.29  ? 428  GLU B O   1 
ATOM   6869 C  CB  . GLU B 1 429 ? -6.276  38.194  -11.619 1.00 49.95  ? 428  GLU B CB  1 
ATOM   6870 C  CG  . GLU B 1 429 ? -7.497  38.615  -12.436 1.00 50.72  ? 428  GLU B CG  1 
ATOM   6871 C  CD  . GLU B 1 429 ? -8.816  38.373  -11.719 1.00 52.18  ? 428  GLU B CD  1 
ATOM   6872 O  OE1 . GLU B 1 429 ? -8.849  38.541  -10.475 1.00 50.16  ? 428  GLU B OE1 1 
ATOM   6873 O  OE2 . GLU B 1 429 ? -9.819  38.030  -12.402 1.00 51.59  ? 428  GLU B OE2 1 
ATOM   6874 N  N   . ASN B 1 430 ? -6.240  35.871  -13.981 1.00 55.39  ? 429  ASN B N   1 
ATOM   6875 C  CA  . ASN B 1 430 ? -5.911  35.623  -15.389 1.00 60.65  ? 429  ASN B CA  1 
ATOM   6876 C  C   . ASN B 1 430 ? -4.978  34.460  -15.611 1.00 63.65  ? 429  ASN B C   1 
ATOM   6877 O  O   . ASN B 1 430 ? -4.703  34.114  -16.749 1.00 78.57  ? 429  ASN B O   1 
ATOM   6878 C  CB  . ASN B 1 430 ? -5.344  36.879  -16.058 1.00 60.96  ? 429  ASN B CB  1 
ATOM   6879 C  CG  . ASN B 1 430 ? -6.386  37.970  -16.185 1.00 63.78  ? 429  ASN B CG  1 
ATOM   6880 O  OD1 . ASN B 1 430 ? -7.594  37.692  -16.214 1.00 57.75  ? 429  ASN B OD1 1 
ATOM   6881 N  ND2 . ASN B 1 430 ? -5.933  39.228  -16.213 1.00 64.97  ? 429  ASN B ND2 1 
ATOM   6882 N  N   . MET B 1 431 ? -4.499  33.838  -14.541 1.00 63.64  ? 430  MET B N   1 
ATOM   6883 C  CA  . MET B 1 431 ? -3.607  32.699  -14.672 1.00 60.66  ? 430  MET B CA  1 
ATOM   6884 C  C   . MET B 1 431 ? -4.331  31.488  -15.256 1.00 59.82  ? 430  MET B C   1 
ATOM   6885 O  O   . MET B 1 431 ? -5.329  31.002  -14.738 1.00 55.63  ? 430  MET B O   1 
ATOM   6886 C  CB  . MET B 1 431 ? -2.967  32.340  -13.335 1.00 62.48  ? 430  MET B CB  1 
ATOM   6887 C  CG  . MET B 1 431 ? -1.775  31.402  -13.472 1.00 62.51  ? 430  MET B CG  1 
ATOM   6888 S  SD  . MET B 1 431 ? -1.592  30.196  -12.144 1.00 57.00  ? 430  MET B SD  1 
ATOM   6889 C  CE  . MET B 1 431 ? -0.378  31.087  -11.158 1.00 66.10  ? 430  MET B CE  1 
ATOM   6890 N  N   . ARG B 1 432 ? -3.800  31.044  -16.379 1.00 67.62  ? 431  ARG B N   1 
ATOM   6891 C  CA  . ARG B 1 432 ? -4.266  29.875  -17.091 1.00 74.90  ? 431  ARG B CA  1 
ATOM   6892 C  C   . ARG B 1 432 ? -3.782  28.613  -16.358 1.00 70.49  ? 431  ARG B C   1 
ATOM   6893 O  O   . ARG B 1 432 ? -2.579  28.389  -16.253 1.00 69.98  ? 431  ARG B O   1 
ATOM   6894 C  CB  . ARG B 1 432 ? -3.689  29.958  -18.515 1.00 80.53  ? 431  ARG B CB  1 
ATOM   6895 C  CG  . ARG B 1 432 ? -3.956  28.761  -19.414 1.00 91.08  ? 431  ARG B CG  1 
ATOM   6896 C  CD  . ARG B 1 432 ? -5.377  28.739  -19.961 1.00 96.22  ? 431  ARG B CD  1 
ATOM   6897 N  NE  . ARG B 1 432 ? -5.697  27.422  -20.533 1.00 99.08  ? 431  ARG B NE  1 
ATOM   6898 C  CZ  . ARG B 1 432 ? -5.971  26.317  -19.825 1.00 96.94  ? 431  ARG B CZ  1 
ATOM   6899 N  NH1 . ARG B 1 432 ? -5.989  26.328  -18.493 1.00 105.02 ? 431  ARG B NH1 1 
ATOM   6900 N  NH2 . ARG B 1 432 ? -6.244  25.185  -20.460 1.00 89.07  ? 431  ARG B NH2 1 
ATOM   6901 N  N   . CYS B 1 433 ? -4.719  27.795  -15.869 1.00 67.44  ? 432  CYS B N   1 
ATOM   6902 C  CA  . CYS B 1 433 ? -4.421  26.552  -15.097 1.00 64.49  ? 432  CYS B CA  1 
ATOM   6903 C  C   . CYS B 1 433 ? -4.886  25.262  -15.767 1.00 62.18  ? 432  CYS B C   1 
ATOM   6904 O  O   . CYS B 1 433 ? -6.041  25.188  -16.187 1.00 63.13  ? 432  CYS B O   1 
ATOM   6905 C  CB  . CYS B 1 433 ? -5.125  26.624  -13.740 1.00 62.29  ? 432  CYS B CB  1 
ATOM   6906 S  SG  . CYS B 1 433 ? -4.273  27.616  -12.500 0.37 61.93  ? 432  CYS B SG  1 
ATOM   6907 N  N   . HIS B 1 434 ? -4.029  24.245  -15.847 1.00 66.08  ? 433  HIS B N   1 
ATOM   6908 C  CA  . HIS B 1 434 ? -4.471  22.933  -16.336 1.00 66.74  ? 433  HIS B CA  1 
ATOM   6909 C  C   . HIS B 1 434 ? -4.739  21.927  -15.226 1.00 62.47  ? 433  HIS B C   1 
ATOM   6910 O  O   . HIS B 1 434 ? -5.101  20.790  -15.485 1.00 62.10  ? 433  HIS B O   1 
ATOM   6911 C  CB  . HIS B 1 434 ? -3.427  22.372  -17.287 1.00 70.48  ? 433  HIS B CB  1 
ATOM   6912 C  CG  . HIS B 1 434 ? -2.989  23.344  -18.333 1.00 74.77  ? 433  HIS B CG  1 
ATOM   6913 N  ND1 . HIS B 1 434 ? -1.802  24.051  -18.263 1.00 81.30  ? 433  HIS B ND1 1 
ATOM   6914 C  CD2 . HIS B 1 434 ? -3.581  23.723  -19.486 1.00 78.16  ? 433  HIS B CD2 1 
ATOM   6915 C  CE1 . HIS B 1 434 ? -1.690  24.829  -19.326 1.00 82.07  ? 433  HIS B CE1 1 
ATOM   6916 N  NE2 . HIS B 1 434 ? -2.757  24.649  -20.083 1.00 84.34  ? 433  HIS B NE2 1 
ATOM   6917 N  N   . GLY B 1 435 ? -4.592  22.335  -13.982 1.00 59.31  ? 434  GLY B N   1 
ATOM   6918 C  CA  . GLY B 1 435 ? -4.943  21.441  -12.907 1.00 57.13  ? 434  GLY B CA  1 
ATOM   6919 C  C   . GLY B 1 435 ? -6.264  21.869  -12.337 1.00 52.48  ? 434  GLY B C   1 
ATOM   6920 O  O   . GLY B 1 435 ? -6.448  23.034  -12.016 1.00 57.48  ? 434  GLY B O   1 
ATOM   6921 N  N   . VAL B 1 436 ? -7.209  20.946  -12.259 1.00 48.69  ? 435  VAL B N   1 
ATOM   6922 C  CA  . VAL B 1 436 ? -8.511  21.270  -11.704 1.00 49.59  ? 435  VAL B CA  1 
ATOM   6923 C  C   . VAL B 1 436 ? -9.130  20.037  -11.096 1.00 43.23  ? 435  VAL B C   1 
ATOM   6924 O  O   . VAL B 1 436 ? -9.164  18.996  -11.730 1.00 41.05  ? 435  VAL B O   1 
ATOM   6925 C  CB  . VAL B 1 436 ? -9.460  21.857  -12.785 1.00 57.96  ? 435  VAL B CB  1 
ATOM   6926 C  CG1 . VAL B 1 436 ? -10.933 21.478  -12.554 1.00 61.28  ? 435  VAL B CG1 1 
ATOM   6927 C  CG2 . VAL B 1 436 ? -9.300  23.373  -12.861 1.00 56.76  ? 435  VAL B CG2 1 
ATOM   6928 N  N   . PRO B 1 437 ? -9.642  20.162  -9.872  1.00 38.81  ? 436  PRO B N   1 
ATOM   6929 C  CA  . PRO B 1 437 ? -10.378 19.034  -9.357  1.00 37.07  ? 436  PRO B CA  1 
ATOM   6930 C  C   . PRO B 1 437 ? -11.724 18.937  -10.043 1.00 41.39  ? 436  PRO B C   1 
ATOM   6931 O  O   . PRO B 1 437 ? -12.452 19.917  -10.121 1.00 44.71  ? 436  PRO B O   1 
ATOM   6932 C  CB  . PRO B 1 437 ? -10.528 19.361  -7.875  1.00 34.82  ? 436  PRO B CB  1 
ATOM   6933 C  CG  . PRO B 1 437 ? -10.473 20.852  -7.807  1.00 34.35  ? 436  PRO B CG  1 
ATOM   6934 C  CD  . PRO B 1 437 ? -9.557  21.280  -8.905  1.00 35.91  ? 436  PRO B CD  1 
ATOM   6935 N  N   . LEU B 1 438 ? -12.062 17.748  -10.520 1.00 47.13  ? 437  LEU B N   1 
ATOM   6936 C  CA  . LEU B 1 438 ? -13.407 17.481  -11.034 1.00 49.58  ? 437  LEU B CA  1 
ATOM   6937 C  C   . LEU B 1 438 ? -14.310 17.076  -9.902  1.00 43.72  ? 437  LEU B C   1 
ATOM   6938 O  O   . LEU B 1 438 ? -15.426 17.545  -9.817  1.00 39.07  ? 437  LEU B O   1 
ATOM   6939 C  CB  . LEU B 1 438 ? -13.442 16.340  -12.056 1.00 57.43  ? 437  LEU B CB  1 
ATOM   6940 C  CG  . LEU B 1 438 ? -13.152 16.628  -13.528 1.00 63.96  ? 437  LEU B CG  1 
ATOM   6941 C  CD1 . LEU B 1 438 ? -13.561 15.414  -14.363 1.00 68.80  ? 437  LEU B CD1 1 
ATOM   6942 C  CD2 . LEU B 1 438 ? -13.899 17.861  -14.002 1.00 65.05  ? 437  LEU B CD2 1 
ATOM   6943 N  N   . VAL B 1 439 ? -13.827 16.161  -9.062  1.00 41.71  ? 438  VAL B N   1 
ATOM   6944 C  CA  . VAL B 1 439 ? -14.587 15.656  -7.922  1.00 41.98  ? 438  VAL B CA  1 
ATOM   6945 C  C   . VAL B 1 439 ? -13.768 15.746  -6.658  1.00 39.60  ? 438  VAL B C   1 
ATOM   6946 O  O   . VAL B 1 439 ? -12.591 15.405  -6.655  1.00 39.34  ? 438  VAL B O   1 
ATOM   6947 C  CB  . VAL B 1 439 ? -15.019 14.174  -8.109  1.00 44.82  ? 438  VAL B CB  1 
ATOM   6948 C  CG1 . VAL B 1 439 ? -15.850 13.683  -6.928  1.00 42.73  ? 438  VAL B CG1 1 
ATOM   6949 C  CG2 . VAL B 1 439 ? -15.768 13.990  -9.429  1.00 45.87  ? 438  VAL B CG2 1 
ATOM   6950 N  N   . THR B 1 440 ? -14.411 16.172  -5.576  1.00 41.97  ? 439  THR B N   1 
ATOM   6951 C  CA  . THR B 1 440 ? -13.776 16.190  -4.245  1.00 40.17  ? 439  THR B CA  1 
ATOM   6952 C  C   . THR B 1 440 ? -14.582 15.374  -3.283  1.00 35.46  ? 439  THR B C   1 
ATOM   6953 O  O   . THR B 1 440 ? -15.664 15.773  -2.909  1.00 38.09  ? 439  THR B O   1 
ATOM   6954 C  CB  . THR B 1 440 ? -13.622 17.612  -3.640  1.00 38.97  ? 439  THR B CB  1 
ATOM   6955 O  OG1 . THR B 1 440 ? -12.848 18.451  -4.519  1.00 39.13  ? 439  THR B OG1 1 
ATOM   6956 C  CG2 . THR B 1 440 ? -12.939 17.531  -2.272  1.00 36.02  ? 439  THR B CG2 1 
ATOM   6957 N  N   . ILE B 1 441 ? -14.025 14.242  -2.880  1.00 34.83  ? 440  ILE B N   1 
ATOM   6958 C  CA  . ILE B 1 441 ? -14.590 13.387  -1.845  1.00 37.61  ? 440  ILE B CA  1 
ATOM   6959 C  C   . ILE B 1 441 ? -13.917 13.622  -0.492  1.00 37.27  ? 440  ILE B C   1 
ATOM   6960 O  O   . ILE B 1 441 ? -12.699 13.538  -0.356  1.00 38.24  ? 440  ILE B O   1 
ATOM   6961 C  CB  . ILE B 1 441 ? -14.465 11.902  -2.215  1.00 41.01  ? 440  ILE B CB  1 
ATOM   6962 C  CG1 . ILE B 1 441 ? -15.279 11.604  -3.512  1.00 41.42  ? 440  ILE B CG1 1 
ATOM   6963 C  CG2 . ILE B 1 441 ? -14.916 11.005  -1.046  1.00 41.05  ? 440  ILE B CG2 1 
ATOM   6964 C  CD1 . ILE B 1 441 ? -14.651 10.560  -4.408  1.00 41.85  ? 440  ILE B CD1 1 
ATOM   6965 N  N   . SER B 1 442 ? -14.744 13.941  0.495   1.00 38.69  ? 441  SER B N   1 
ATOM   6966 C  CA  . SER B 1 442 ? -14.336 14.176  1.887   1.00 38.82  ? 441  SER B CA  1 
ATOM   6967 C  C   . SER B 1 442 ? -15.140 13.222  2.782   1.00 43.77  ? 441  SER B C   1 
ATOM   6968 O  O   . SER B 1 442 ? -16.362 13.109  2.662   1.00 46.68  ? 441  SER B O   1 
ATOM   6969 C  CB  . SER B 1 442 ? -14.608 15.635  2.305   1.00 38.15  ? 441  SER B CB  1 
ATOM   6970 O  OG  . SER B 1 442 ? -14.297 15.876  3.669   1.00 36.97  ? 441  SER B OG  1 
ATOM   6971 N  N   . ARG B 1 443 ? -14.452 12.522  3.673   1.00 51.54  ? 442  ARG B N   1 
ATOM   6972 C  CA  . ARG B 1 443 ? -15.096 11.554  4.573   1.00 54.57  ? 442  ARG B CA  1 
ATOM   6973 C  C   . ARG B 1 443 ? -16.001 10.567  3.813   1.00 55.37  ? 442  ARG B C   1 
ATOM   6974 O  O   . ARG B 1 443 ? -17.093 10.219  4.263   1.00 68.11  ? 442  ARG B O   1 
ATOM   6975 C  CB  . ARG B 1 443 ? -15.886 12.288  5.655   1.00 57.38  ? 442  ARG B CB  1 
ATOM   6976 C  CG  . ARG B 1 443 ? -15.069 13.259  6.489   1.00 56.07  ? 442  ARG B CG  1 
ATOM   6977 C  CD  . ARG B 1 443 ? -15.929 13.895  7.568   1.00 54.24  ? 442  ARG B CD  1 
ATOM   6978 N  NE  . ARG B 1 443 ? -16.413 12.917  8.546   1.00 48.35  ? 442  ARG B NE  1 
ATOM   6979 C  CZ  . ARG B 1 443 ? -15.693 12.402  9.544   1.00 47.84  ? 442  ARG B CZ  1 
ATOM   6980 N  NH1 . ARG B 1 443 ? -14.422 12.756  9.738   1.00 47.34  ? 442  ARG B NH1 1 
ATOM   6981 N  NH2 . ARG B 1 443 ? -16.256 11.523  10.363  1.00 44.89  ? 442  ARG B NH2 1 
ATOM   6982 N  N   . GLY B 1 444 ? -15.527 10.114  2.661   1.00 50.72  ? 443  GLY B N   1 
ATOM   6983 C  CA  . GLY B 1 444 ? -16.261 9.175   1.838   1.00 47.76  ? 443  GLY B CA  1 
ATOM   6984 C  C   . GLY B 1 444 ? -17.612 9.672   1.389   1.00 43.64  ? 443  GLY B C   1 
ATOM   6985 O  O   . GLY B 1 444 ? -18.518 8.867   1.191   1.00 46.50  ? 443  GLY B O   1 
ATOM   6986 N  N   . ARG B 1 445 ? -17.732 10.983  1.219   1.00 40.42  ? 444  ARG B N   1 
ATOM   6987 C  CA  . ARG B 1 445 ? -18.884 11.590  0.574   1.00 43.22  ? 444  ARG B CA  1 
ATOM   6988 C  C   . ARG B 1 445 ? -18.418 12.529  -0.529  1.00 41.78  ? 444  ARG B C   1 
ATOM   6989 O  O   . ARG B 1 445 ? -17.367 13.169  -0.431  1.00 37.48  ? 444  ARG B O   1 
ATOM   6990 C  CB  . ARG B 1 445 ? -19.693 12.382  1.581   1.00 51.14  ? 444  ARG B CB  1 
ATOM   6991 C  CG  . ARG B 1 445 ? -20.400 11.535  2.619   1.00 65.46  ? 444  ARG B CG  1 
ATOM   6992 C  CD  . ARG B 1 445 ? -21.198 12.394  3.603   1.00 81.06  ? 444  ARG B CD  1 
ATOM   6993 N  NE  . ARG B 1 445 ? -21.919 11.571  4.597   1.00 90.34  ? 444  ARG B NE  1 
ATOM   6994 C  CZ  . ARG B 1 445 ? -23.088 10.957  4.394   1.00 91.55  ? 444  ARG B CZ  1 
ATOM   6995 N  NH1 . ARG B 1 445 ? -23.726 11.065  3.228   1.00 88.51  ? 444  ARG B NH1 1 
ATOM   6996 N  NH2 . ARG B 1 445 ? -23.630 10.232  5.370   1.00 93.19  ? 444  ARG B NH2 1 
ATOM   6997 N  N   . VAL B 1 446 ? -19.204 12.646  -1.581  1.00 40.44  ? 445  VAL B N   1 
ATOM   6998 C  CA  . VAL B 1 446 ? -18.850 13.572  -2.651  1.00 42.53  ? 445  VAL B CA  1 
ATOM   6999 C  C   . VAL B 1 446 ? -19.339 14.970  -2.280  1.00 42.46  ? 445  VAL B C   1 
ATOM   7000 O  O   . VAL B 1 446 ? -20.541 15.203  -2.158  1.00 47.45  ? 445  VAL B O   1 
ATOM   7001 C  CB  . VAL B 1 446 ? -19.472 13.139  -4.000  1.00 42.83  ? 445  VAL B CB  1 
ATOM   7002 C  CG1 . VAL B 1 446 ? -19.215 14.196  -5.071  1.00 44.37  ? 445  VAL B CG1 1 
ATOM   7003 C  CG2 . VAL B 1 446 ? -18.902 11.802  -4.418  1.00 41.53  ? 445  VAL B CG2 1 
ATOM   7004 N  N   . VAL B 1 447 ? -18.431 15.903  -2.083  1.00 40.69  ? 446  VAL B N   1 
ATOM   7005 C  CA  . VAL B 1 447 ? -18.859 17.238  -1.673  1.00 42.38  ? 446  VAL B CA  1 
ATOM   7006 C  C   . VAL B 1 447 ? -18.816 18.242  -2.806  1.00 39.85  ? 446  VAL B C   1 
ATOM   7007 O  O   . VAL B 1 447 ? -19.389 19.312  -2.698  1.00 45.52  ? 446  VAL B O   1 
ATOM   7008 C  CB  . VAL B 1 447 ? -18.074 17.766  -0.443  1.00 45.05  ? 446  VAL B CB  1 
ATOM   7009 C  CG1 . VAL B 1 447 ? -18.339 16.891  0.768   1.00 46.00  ? 446  VAL B CG1 1 
ATOM   7010 C  CG2 . VAL B 1 447 ? -16.585 17.833  -0.702  1.00 47.85  ? 446  VAL B CG2 1 
ATOM   7011 N  N   . TYR B 1 448 ? -18.137 17.902  -3.885  1.00 42.01  ? 447  TYR B N   1 
ATOM   7012 C  CA  . TYR B 1 448 ? -18.036 18.794  -5.040  1.00 43.51  ? 447  TYR B CA  1 
ATOM   7013 C  C   . TYR B 1 448 ? -17.855 18.023  -6.319  1.00 49.97  ? 447  TYR B C   1 
ATOM   7014 O  O   . TYR B 1 448 ? -16.900 17.273  -6.457  1.00 56.49  ? 447  TYR B O   1 
ATOM   7015 C  CB  . TYR B 1 448 ? -16.847 19.694  -4.859  1.00 44.60  ? 447  TYR B CB  1 
ATOM   7016 C  CG  . TYR B 1 448 ? -16.519 20.574  -6.032  1.00 44.19  ? 447  TYR B CG  1 
ATOM   7017 C  CD1 . TYR B 1 448 ? -17.246 21.719  -6.285  1.00 44.65  ? 447  TYR B CD1 1 
ATOM   7018 C  CD2 . TYR B 1 448 ? -15.437 20.294  -6.851  1.00 46.24  ? 447  TYR B CD2 1 
ATOM   7019 C  CE1 . TYR B 1 448 ? -16.934 22.550  -7.344  1.00 45.29  ? 447  TYR B CE1 1 
ATOM   7020 C  CE2 . TYR B 1 448 ? -15.102 21.130  -7.920  1.00 44.78  ? 447  TYR B CE2 1 
ATOM   7021 C  CZ  . TYR B 1 448 ? -15.860 22.253  -8.164  1.00 45.38  ? 447  TYR B CZ  1 
ATOM   7022 O  OH  . TYR B 1 448 ? -15.561 23.091  -9.216  1.00 41.95  ? 447  TYR B OH  1 
ATOM   7023 N  N   . GLU B 1 449 ? -18.788 18.205  -7.246  1.00 55.53  ? 448  GLU B N   1 
ATOM   7024 C  CA  . GLU B 1 449 ? -18.813 17.492  -8.534  1.00 55.82  ? 448  GLU B CA  1 
ATOM   7025 C  C   . GLU B 1 449 ? -19.469 18.383  -9.596  1.00 60.26  ? 448  GLU B C   1 
ATOM   7026 O  O   . GLU B 1 449 ? -20.331 19.196  -9.260  1.00 61.62  ? 448  GLU B O   1 
ATOM   7027 C  CB  . GLU B 1 449 ? -19.583 16.169  -8.384  1.00 54.51  ? 448  GLU B CB  1 
ATOM   7028 C  CG  . GLU B 1 449 ? -19.615 15.266  -9.619  1.00 55.49  ? 448  GLU B CG  1 
ATOM   7029 C  CD  . GLU B 1 449 ? -20.281 13.912  -9.338  1.00 61.05  ? 448  GLU B CD  1 
ATOM   7030 O  OE1 . GLU B 1 449 ? -20.980 13.769  -8.307  1.00 66.76  ? 448  GLU B OE1 1 
ATOM   7031 O  OE2 . GLU B 1 449 ? -20.121 12.966  -10.134 1.00 62.84  ? 448  GLU B OE2 1 
ATOM   7032 N  N   . ASN B 1 450 ? -19.072 18.232  -10.864 1.00 64.62  ? 449  ASN B N   1 
ATOM   7033 C  CA  . ASN B 1 450 ? -19.670 19.001  -11.974 1.00 69.44  ? 449  ASN B CA  1 
ATOM   7034 C  C   . ASN B 1 450 ? -19.608 20.516  -11.738 1.00 65.39  ? 449  ASN B C   1 
ATOM   7035 O  O   . ASN B 1 450 ? -20.417 21.275  -12.280 1.00 65.85  ? 449  ASN B O   1 
ATOM   7036 C  CB  . ASN B 1 450 ? -21.158 18.591  -12.231 1.00 72.97  ? 449  ASN B CB  1 
ATOM   7037 C  CG  . ASN B 1 450 ? -21.296 17.204  -12.854 1.00 75.65  ? 449  ASN B CG  1 
ATOM   7038 O  OD1 . ASN B 1 450 ? -21.946 16.301  -12.291 1.00 73.33  ? 449  ASN B OD1 1 
ATOM   7039 N  ND2 . ASN B 1 450 ? -20.666 17.017  -14.005 1.00 72.46  ? 449  ASN B ND2 1 
ATOM   7040 N  N   . GLY B 1 451 ? -18.658 20.966  -10.933 1.00 63.12  ? 450  GLY B N   1 
ATOM   7041 C  CA  . GLY B 1 451 ? -18.631 22.384  -10.530 1.00 62.88  ? 450  GLY B CA  1 
ATOM   7042 C  C   . GLY B 1 451 ? -19.688 22.779  -9.497  1.00 51.72  ? 450  GLY B C   1 
ATOM   7043 O  O   . GLY B 1 451 ? -19.944 23.956  -9.278  1.00 46.70  ? 450  GLY B O   1 
ATOM   7044 N  N   . VAL B 1 452 ? -20.276 21.790  -8.846  1.00 47.38  ? 451  VAL B N   1 
ATOM   7045 C  CA  . VAL B 1 452 ? -21.357 22.031  -7.918  1.00 51.03  ? 451  VAL B CA  1 
ATOM   7046 C  C   . VAL B 1 452 ? -20.985 21.574  -6.522  1.00 53.84  ? 451  VAL B C   1 
ATOM   7047 O  O   . VAL B 1 452 ? -20.684 20.406  -6.295  1.00 53.44  ? 451  VAL B O   1 
ATOM   7048 C  CB  . VAL B 1 452 ? -22.667 21.347  -8.384  1.00 50.48  ? 451  VAL B CB  1 
ATOM   7049 C  CG1 . VAL B 1 452 ? -23.792 21.609  -7.388  1.00 47.38  ? 451  VAL B CG1 1 
ATOM   7050 C  CG2 . VAL B 1 452 ? -23.047 21.870  -9.776  1.00 52.13  ? 451  VAL B CG2 1 
ATOM   7051 N  N   . PHE B 1 453 ? -21.018 22.509  -5.577  1.00 52.75  ? 452  PHE B N   1 
ATOM   7052 C  CA  . PHE B 1 453 ? -20.688 22.186  -4.206  1.00 49.90  ? 452  PHE B CA  1 
ATOM   7053 C  C   . PHE B 1 453 ? -21.931 21.742  -3.490  1.00 48.16  ? 452  PHE B C   1 
ATOM   7054 O  O   . PHE B 1 453 ? -22.959 22.356  -3.637  1.00 48.43  ? 452  PHE B O   1 
ATOM   7055 C  CB  . PHE B 1 453 ? -20.144 23.395  -3.491  1.00 52.75  ? 452  PHE B CB  1 
ATOM   7056 C  CG  . PHE B 1 453 ? -19.699 23.098  -2.100  1.00 54.69  ? 452  PHE B CG  1 
ATOM   7057 C  CD1 . PHE B 1 453 ? -18.501 22.438  -1.882  1.00 56.00  ? 452  PHE B CD1 1 
ATOM   7058 C  CD2 . PHE B 1 453 ? -20.487 23.435  -1.009  1.00 55.39  ? 452  PHE B CD2 1 
ATOM   7059 C  CE1 . PHE B 1 453 ? -18.070 22.141  -0.600  1.00 58.26  ? 452  PHE B CE1 1 
ATOM   7060 C  CE2 . PHE B 1 453 ? -20.062 23.145  0.274   1.00 58.68  ? 452  PHE B CE2 1 
ATOM   7061 C  CZ  . PHE B 1 453 ? -18.853 22.494  0.484   1.00 58.29  ? 452  PHE B CZ  1 
ATOM   7062 N  N   . MET B 1 454 ? -21.832 20.701  -2.686  1.00 52.11  ? 453  MET B N   1 
ATOM   7063 C  CA  . MET B 1 454 ? -22.966 20.249  -1.883  1.00 57.50  ? 453  MET B CA  1 
ATOM   7064 C  C   . MET B 1 454 ? -22.469 19.657  -0.563  1.00 52.73  ? 453  MET B C   1 
ATOM   7065 O  O   . MET B 1 454 ? -21.905 18.581  -0.563  1.00 51.98  ? 453  MET B O   1 
ATOM   7066 C  CB  . MET B 1 454 ? -23.803 19.223  -2.681  1.00 62.77  ? 453  MET B CB  1 
ATOM   7067 C  CG  . MET B 1 454 ? -22.989 18.038  -3.240  1.00 67.46  ? 453  MET B CG  1 
ATOM   7068 S  SD  . MET B 1 454 ? -23.392 17.437  -4.914  0.69 68.04  ? 453  MET B SD  1 
ATOM   7069 C  CE  . MET B 1 454 ? -22.536 18.593  -5.989  1.00 69.24  ? 453  MET B CE  1 
ATOM   7070 N  N   . CYS B 1 455 ? -22.682 20.354  0.557   1.00 51.46  ? 454  CYS B N   1 
ATOM   7071 C  CA  . CYS B 1 455 ? -22.263 19.856  1.886   1.00 48.40  ? 454  CYS B CA  1 
ATOM   7072 C  C   . CYS B 1 455 ? -22.849 20.646  3.054   1.00 45.97  ? 454  CYS B C   1 
ATOM   7073 O  O   . CYS B 1 455 ? -22.861 21.896  3.043   1.00 46.76  ? 454  CYS B O   1 
ATOM   7074 C  CB  . CYS B 1 455 ? -20.734 19.916  2.020   1.00 51.06  ? 454  CYS B CB  1 
ATOM   7075 S  SG  . CYS B 1 455 ? -20.036 18.984  3.413   0.75 48.22  ? 454  CYS B SG  1 
ATOM   7076 N  N   . ALA B 1 456 ? -23.289 19.917  4.075   1.00 43.47  ? 455  ALA B N   1 
ATOM   7077 C  CA  . ALA B 1 456 ? -23.793 20.528  5.317   1.00 45.76  ? 455  ALA B CA  1 
ATOM   7078 C  C   . ALA B 1 456 ? -22.681 21.087  6.237   1.00 44.80  ? 455  ALA B C   1 
ATOM   7079 O  O   . ALA B 1 456 ? -21.654 20.438  6.469   1.00 42.38  ? 455  ALA B O   1 
ATOM   7080 C  CB  . ALA B 1 456 ? -24.643 19.521  6.094   1.00 45.08  ? 455  ALA B CB  1 
ATOM   7081 N  N   . GLU B 1 457 ? -22.903 22.291  6.763   1.00 45.71  ? 456  GLU B N   1 
ATOM   7082 C  CA  . GLU B 1 457 ? -22.081 22.827  7.859   1.00 47.82  ? 456  GLU B CA  1 
ATOM   7083 C  C   . GLU B 1 457 ? -21.930 21.753  8.918   1.00 42.52  ? 456  GLU B C   1 
ATOM   7084 O  O   . GLU B 1 457 ? -22.890 21.047  9.211   1.00 39.17  ? 456  GLU B O   1 
ATOM   7085 C  CB  . GLU B 1 457 ? -22.740 24.029  8.549   1.00 52.37  ? 456  GLU B CB  1 
ATOM   7086 C  CG  . GLU B 1 457 ? -23.504 25.039  7.687   1.00 52.42  ? 456  GLU B CG  1 
ATOM   7087 C  CD  . GLU B 1 457 ? -24.052 26.186  8.520   1.00 52.99  ? 456  GLU B CD  1 
ATOM   7088 O  OE1 . GLU B 1 457 ? -24.315 26.003  9.721   1.00 51.43  ? 456  GLU B OE1 1 
ATOM   7089 O  OE2 . GLU B 1 457 ? -24.239 27.289  7.996   1.00 61.68  ? 456  GLU B OE2 1 
ATOM   7090 N  N   . GLY B 1 458 ? -20.721 21.597  9.442   1.00 41.58  ? 457  GLY B N   1 
ATOM   7091 C  CA  . GLY B 1 458 ? -20.482 20.691  10.580  1.00 43.24  ? 457  GLY B CA  1 
ATOM   7092 C  C   . GLY B 1 458 ? -20.269 19.213  10.273  1.00 40.06  ? 457  GLY B C   1 
ATOM   7093 O  O   . GLY B 1 458 ? -20.027 18.408  11.159  1.00 38.89  ? 457  GLY B O   1 
ATOM   7094 N  N   . THR B 1 459 ? -20.387 18.869  9.006   1.00 41.39  ? 458  THR B N   1 
ATOM   7095 C  CA  . THR B 1 459 ? -20.091 17.542  8.493   1.00 41.16  ? 458  THR B CA  1 
ATOM   7096 C  C   . THR B 1 459 ? -18.653 17.111  8.743   1.00 41.51  ? 458  THR B C   1 
ATOM   7097 O  O   . THR B 1 459 ? -18.378 15.921  8.946   1.00 48.81  ? 458  THR B O   1 
ATOM   7098 C  CB  . THR B 1 459 ? -20.325 17.535  6.977   1.00 43.87  ? 458  THR B CB  1 
ATOM   7099 O  OG1 . THR B 1 459 ? -21.668 17.979  6.716   1.00 40.60  ? 458  THR B OG1 1 
ATOM   7100 C  CG2 . THR B 1 459 ? -20.092 16.135  6.387   1.00 47.52  ? 458  THR B CG2 1 
ATOM   7101 N  N   . GLY B 1 460 ? -17.743 18.084  8.718   1.00 40.06  ? 459  GLY B N   1 
ATOM   7102 C  CA  . GLY B 1 460 ? -16.339 17.872  9.025   1.00 38.02  ? 459  GLY B CA  1 
ATOM   7103 C  C   . GLY B 1 460 ? -16.045 17.663  10.500  1.00 39.96  ? 459  GLY B C   1 
ATOM   7104 O  O   . GLY B 1 460 ? -16.823 18.026  11.387  1.00 42.42  ? 459  GLY B O   1 
ATOM   7105 N  N   . LYS B 1 461 ? -14.907 17.063  10.776  1.00 44.23  ? 460  LYS B N   1 
ATOM   7106 C  CA  . LYS B 1 461 ? -14.556 16.728  12.144  1.00 46.58  ? 460  LYS B CA  1 
ATOM   7107 C  C   . LYS B 1 461 ? -13.142 17.164  12.508  1.00 40.09  ? 460  LYS B C   1 
ATOM   7108 O  O   . LYS B 1 461 ? -12.195 16.920  11.798  1.00 36.62  ? 460  LYS B O   1 
ATOM   7109 C  CB  . LYS B 1 461 ? -14.733 15.212  12.410  1.00 49.74  ? 460  LYS B CB  1 
ATOM   7110 C  CG  . LYS B 1 461 ? -16.170 14.708  12.302  1.00 56.27  ? 460  LYS B CG  1 
ATOM   7111 C  CD  . LYS B 1 461 ? -17.057 15.155  13.477  1.00 65.71  ? 460  LYS B CD  1 
ATOM   7112 C  CE  . LYS B 1 461 ? -18.569 15.236  13.126  1.00 61.73  ? 460  LYS B CE  1 
ATOM   7113 N  NZ  . LYS B 1 461 ? -19.345 14.212  13.881  1.00 61.68  ? 460  LYS B NZ  1 
ATOM   7114 N  N   . PHE B 1 462 ? -13.042 17.792  13.670  1.00 40.04  ? 461  PHE B N   1 
ATOM   7115 C  CA  . PHE B 1 462 ? -11.794 17.942  14.356  1.00 37.53  ? 461  PHE B CA  1 
ATOM   7116 C  C   . PHE B 1 462 ? -11.121 16.566  14.430  1.00 36.17  ? 461  PHE B C   1 
ATOM   7117 O  O   . PHE B 1 462 ? -11.771 15.580  14.734  1.00 34.86  ? 461  PHE B O   1 
ATOM   7118 C  CB  . PHE B 1 462 ? -12.008 18.503  15.768  1.00 36.47  ? 461  PHE B CB  1 
ATOM   7119 C  CG  . PHE B 1 462 ? -10.727 18.715  16.528  1.00 35.64  ? 461  PHE B CG  1 
ATOM   7120 C  CD1 . PHE B 1 462 ? -9.926  19.813  16.243  1.00 34.44  ? 461  PHE B CD1 1 
ATOM   7121 C  CD2 . PHE B 1 462 ? -10.310 17.811  17.518  1.00 34.06  ? 461  PHE B CD2 1 
ATOM   7122 C  CE1 . PHE B 1 462 ? -8.732  20.006  16.927  1.00 34.06  ? 461  PHE B CE1 1 
ATOM   7123 C  CE2 . PHE B 1 462 ? -9.125  18.009  18.198  1.00 32.71  ? 461  PHE B CE2 1 
ATOM   7124 C  CZ  . PHE B 1 462 ? -8.340  19.111  17.910  1.00 31.74  ? 461  PHE B CZ  1 
ATOM   7125 N  N   . CYS B 1 463 ? -9.827  16.521  14.108  1.00 35.50  ? 462  CYS B N   1 
ATOM   7126 C  CA  . CYS B 1 463 ? -9.051  15.301  14.129  1.00 34.18  ? 462  CYS B CA  1 
ATOM   7127 C  C   . CYS B 1 463 ? -7.969  15.484  15.165  1.00 35.68  ? 462  CYS B C   1 
ATOM   7128 O  O   . CYS B 1 463 ? -6.926  16.068  14.890  1.00 35.64  ? 462  CYS B O   1 
ATOM   7129 C  CB  . CYS B 1 463 ? -8.440  15.027  12.765  1.00 33.70  ? 462  CYS B CB  1 
ATOM   7130 S  SG  . CYS B 1 463 ? -9.700  14.769  11.524  1.00 35.46  ? 462  CYS B SG  1 
ATOM   7131 N  N   . PRO B 1 464 ? -8.206  14.966  16.378  1.00 37.16  ? 463  PRO B N   1 
ATOM   7132 C  CA  . PRO B 1 464 ? -7.131  14.978  17.349  1.00 36.80  ? 463  PRO B CA  1 
ATOM   7133 C  C   . PRO B 1 464 ? -5.808  14.547  16.722  1.00 37.19  ? 463  PRO B C   1 
ATOM   7134 O  O   . PRO B 1 464 ? -5.764  13.523  16.043  1.00 35.71  ? 463  PRO B O   1 
ATOM   7135 C  CB  . PRO B 1 464 ? -7.601  13.952  18.374  1.00 34.07  ? 463  PRO B CB  1 
ATOM   7136 C  CG  . PRO B 1 464 ? -9.066  14.080  18.337  1.00 32.91  ? 463  PRO B CG  1 
ATOM   7137 C  CD  . PRO B 1 464 ? -9.392  14.257  16.894  1.00 34.09  ? 463  PRO B CD  1 
ATOM   7138 N  N   . LEU B 1 465 ? -4.762  15.338  16.938  1.00 38.51  ? 464  LEU B N   1 
ATOM   7139 C  CA  . LEU B 1 465 ? -3.412  15.045  16.427  1.00 41.33  ? 464  LEU B CA  1 
ATOM   7140 C  C   . LEU B 1 465 ? -2.496  14.436  17.477  1.00 43.67  ? 464  LEU B C   1 
ATOM   7141 O  O   . LEU B 1 465 ? -2.287  15.053  18.506  1.00 44.85  ? 464  LEU B O   1 
ATOM   7142 C  CB  . LEU B 1 465 ? -2.776  16.346  15.918  1.00 40.85  ? 464  LEU B CB  1 
ATOM   7143 C  CG  . LEU B 1 465 ? -3.470  17.015  14.734  1.00 36.09  ? 464  LEU B CG  1 
ATOM   7144 C  CD1 . LEU B 1 465 ? -2.597  18.128  14.179  1.00 35.00  ? 464  LEU B CD1 1 
ATOM   7145 C  CD2 . LEU B 1 465 ? -3.769  16.000  13.654  1.00 35.73  ? 464  LEU B CD2 1 
ATOM   7146 N  N   . ARG B 1 466 ? -1.918  13.260  17.213  1.00 48.73  ? 465  ARG B N   1 
ATOM   7147 C  CA  . ARG B 1 466 ? -1.129  12.580  18.259  1.00 51.79  ? 465  ARG B CA  1 
ATOM   7148 C  C   . ARG B 1 466 ? 0.278   13.183  18.395  1.00 44.19  ? 465  ARG B C   1 
ATOM   7149 O  O   . ARG B 1 466 ? 0.922   13.505  17.403  1.00 40.32  ? 465  ARG B O   1 
ATOM   7150 C  CB  . ARG B 1 466 ? -1.054  11.060  18.020  1.00 60.34  ? 465  ARG B CB  1 
ATOM   7151 C  CG  . ARG B 1 466 ? -0.727  10.247  19.290  1.00 70.16  ? 465  ARG B CG  1 
ATOM   7152 C  CD  . ARG B 1 466 ? -0.039  8.885   19.025  1.00 83.34  ? 465  ARG B CD  1 
ATOM   7153 N  NE  . ARG B 1 466 ? 1.329   9.030   18.455  1.00 96.51  ? 465  ARG B NE  1 
ATOM   7154 C  CZ  . ARG B 1 466 ? 2.010   8.095   17.757  1.00 86.12  ? 465  ARG B CZ  1 
ATOM   7155 N  NH1 . ARG B 1 466 ? 1.469   6.900   17.513  1.00 84.32  ? 465  ARG B NH1 1 
ATOM   7156 N  NH2 . ARG B 1 466 ? 3.243   8.360   17.291  1.00 71.37  ? 465  ARG B NH2 1 
ATOM   7157 N  N   . SER B 1 467 ? 0.739   13.332  19.636  1.00 41.78  ? 466  SER B N   1 
ATOM   7158 C  CA  . SER B 1 467 ? 2.049   13.908  19.923  1.00 39.33  ? 466  SER B CA  1 
ATOM   7159 C  C   . SER B 1 467 ? 3.158   12.997  19.439  1.00 36.95  ? 466  SER B C   1 
ATOM   7160 O  O   . SER B 1 467 ? 2.895   11.867  19.064  1.00 39.24  ? 466  SER B O   1 
ATOM   7161 C  CB  . SER B 1 467 ? 2.209   14.118  21.418  1.00 40.74  ? 466  SER B CB  1 
ATOM   7162 O  OG  . SER B 1 467 ? 2.398   12.876  22.090  1.00 44.54  ? 466  SER B OG  1 
ATOM   7163 N  N   . PHE B 1 468 ? 4.392   13.496  19.444  1.00 35.23  ? 467  PHE B N   1 
ATOM   7164 C  CA  . PHE B 1 468 ? 5.565   12.745  19.011  1.00 34.17  ? 467  PHE B CA  1 
ATOM   7165 C  C   . PHE B 1 468 ? 5.445   12.161  17.615  1.00 32.49  ? 467  PHE B C   1 
ATOM   7166 O  O   . PHE B 1 468 ? 5.592   10.965  17.414  1.00 29.81  ? 467  PHE B O   1 
ATOM   7167 C  CB  . PHE B 1 468 ? 5.866   11.653  20.016  1.00 36.48  ? 467  PHE B CB  1 
ATOM   7168 C  CG  . PHE B 1 468 ? 6.450   12.163  21.287  1.00 42.00  ? 467  PHE B CG  1 
ATOM   7169 C  CD1 . PHE B 1 468 ? 7.775   12.575  21.328  1.00 43.29  ? 467  PHE B CD1 1 
ATOM   7170 C  CD2 . PHE B 1 468 ? 5.687   12.218  22.457  1.00 47.08  ? 467  PHE B CD2 1 
ATOM   7171 C  CE1 . PHE B 1 468 ? 8.337   13.036  22.511  1.00 46.26  ? 467  PHE B CE1 1 
ATOM   7172 C  CE2 . PHE B 1 468 ? 6.240   12.679  23.651  1.00 48.67  ? 467  PHE B CE2 1 
ATOM   7173 C  CZ  . PHE B 1 468 ? 7.566   13.093  23.680  1.00 47.83  ? 467  PHE B CZ  1 
ATOM   7174 N  N   . PRO B 1 469 ? 5.177   13.010  16.630  1.00 34.74  ? 468  PRO B N   1 
ATOM   7175 C  CA  . PRO B 1 469 ? 5.037   12.509  15.261  1.00 37.14  ? 468  PRO B CA  1 
ATOM   7176 C  C   . PRO B 1 469 ? 6.246   11.717  14.833  1.00 38.31  ? 468  PRO B C   1 
ATOM   7177 O  O   . PRO B 1 469 ? 7.342   12.277  14.785  1.00 36.57  ? 468  PRO B O   1 
ATOM   7178 C  CB  . PRO B 1 469 ? 4.957   13.781  14.420  1.00 40.86  ? 468  PRO B CB  1 
ATOM   7179 C  CG  . PRO B 1 469 ? 5.062   14.944  15.364  1.00 38.08  ? 468  PRO B CG  1 
ATOM   7180 C  CD  . PRO B 1 469 ? 4.905   14.448  16.751  1.00 35.06  ? 468  PRO B CD  1 
ATOM   7181 N  N   . ASP B 1 470 ? 6.034   10.438  14.500  1.00 41.06  ? 469  ASP B N   1 
ATOM   7182 C  CA  . ASP B 1 470 ? 7.121   9.487   14.169  1.00 40.39  ? 469  ASP B CA  1 
ATOM   7183 C  C   . ASP B 1 470 ? 8.149   9.997   13.163  1.00 38.37  ? 469  ASP B C   1 
ATOM   7184 O  O   . ASP B 1 470 ? 9.312   9.703   13.275  1.00 37.62  ? 469  ASP B O   1 
ATOM   7185 C  CB  . ASP B 1 470 ? 6.543   8.192   13.605  1.00 45.32  ? 469  ASP B CB  1 
ATOM   7186 C  CG  . ASP B 1 470 ? 6.190   7.153   14.672  1.00 51.60  ? 469  ASP B CG  1 
ATOM   7187 O  OD1 . ASP B 1 470 ? 5.627   7.488   15.716  1.00 54.62  ? 469  ASP B OD1 1 
ATOM   7188 O  OD2 . ASP B 1 470 ? 6.435   5.953   14.431  1.00 61.86  ? 469  ASP B OD2 1 
ATOM   7189 N  N   . THR B 1 471 ? 7.715   10.781  12.185  1.00 39.55  ? 470  THR B N   1 
ATOM   7190 C  CA  . THR B 1 471 ? 8.580   11.201  11.088  1.00 40.73  ? 470  THR B CA  1 
ATOM   7191 C  C   . THR B 1 471 ? 9.694   12.172  11.502  1.00 39.80  ? 470  THR B C   1 
ATOM   7192 O  O   . THR B 1 471 ? 10.693  12.243  10.850  1.00 43.11  ? 470  THR B O   1 
ATOM   7193 C  CB  . THR B 1 471 ? 7.734   11.798  9.928   1.00 44.88  ? 470  THR B CB  1 
ATOM   7194 O  OG1 . THR B 1 471 ? 8.488   11.802  8.729   1.00 44.99  ? 470  THR B OG1 1 
ATOM   7195 C  CG2 . THR B 1 471 ? 7.281   13.225  10.214  1.00 46.76  ? 470  THR B CG2 1 
ATOM   7196 N  N   . VAL B 1 472 ? 9.498   12.924  12.579  1.00 42.91  ? 471  VAL B N   1 
ATOM   7197 C  CA  . VAL B 1 472 ? 10.513  13.799  13.185  1.00 41.34  ? 471  VAL B CA  1 
ATOM   7198 C  C   . VAL B 1 472 ? 11.170  13.155  14.411  1.00 42.63  ? 471  VAL B C   1 
ATOM   7199 O  O   . VAL B 1 472 ? 12.397  13.138  14.537  1.00 42.89  ? 471  VAL B O   1 
ATOM   7200 C  CB  . VAL B 1 472 ? 9.875   15.086  13.701  1.00 44.54  ? 471  VAL B CB  1 
ATOM   7201 C  CG1 . VAL B 1 472 ? 10.859  15.891  14.518  1.00 45.43  ? 471  VAL B CG1 1 
ATOM   7202 C  CG2 . VAL B 1 472 ? 9.366   15.922  12.540  1.00 49.40  ? 471  VAL B CG2 1 
ATOM   7203 N  N   . TYR B 1 473 ? 10.359  12.641  15.329  1.00 40.13  ? 472  TYR B N   1 
ATOM   7204 C  CA  . TYR B 1 473 ? 10.861  12.299  16.668  1.00 38.72  ? 472  TYR B CA  1 
ATOM   7205 C  C   . TYR B 1 473 ? 11.598  11.020  16.826  1.00 39.20  ? 472  TYR B C   1 
ATOM   7206 O  O   . TYR B 1 473 ? 12.239  10.817  17.854  1.00 41.85  ? 472  TYR B O   1 
ATOM   7207 C  CB  . TYR B 1 473 ? 9.721   12.302  17.677  1.00 37.12  ? 472  TYR B CB  1 
ATOM   7208 C  CG  . TYR B 1 473 ? 9.517   13.665  18.201  1.00 35.94  ? 472  TYR B CG  1 
ATOM   7209 C  CD1 . TYR B 1 473 ? 10.292  14.141  19.227  1.00 34.66  ? 472  TYR B CD1 1 
ATOM   7210 C  CD2 . TYR B 1 473 ? 8.577   14.509  17.615  1.00 35.68  ? 472  TYR B CD2 1 
ATOM   7211 C  CE1 . TYR B 1 473 ? 10.100  15.421  19.699  1.00 36.16  ? 472  TYR B CE1 1 
ATOM   7212 C  CE2 . TYR B 1 473 ? 8.386   15.780  18.075  1.00 35.77  ? 472  TYR B CE2 1 
ATOM   7213 C  CZ  . TYR B 1 473 ? 9.153   16.231  19.119  1.00 35.78  ? 472  TYR B CZ  1 
ATOM   7214 O  OH  . TYR B 1 473 ? 8.965   17.515  19.555  1.00 37.58  ? 472  TYR B OH  1 
ATOM   7215 N  N   . LYS B 1 474 ? 11.441  10.118  15.868  1.00 41.70  ? 473  LYS B N   1 
ATOM   7216 C  CA  . LYS B 1 474 ? 11.962  8.752   16.003  1.00 42.42  ? 473  LYS B CA  1 
ATOM   7217 C  C   . LYS B 1 474 ? 13.487  8.819   15.865  1.00 43.62  ? 473  LYS B C   1 
ATOM   7218 O  O   . LYS B 1 474 ? 14.201  8.190   16.624  1.00 38.06  ? 473  LYS B O   1 
ATOM   7219 C  CB  . LYS B 1 474 ? 11.337  7.837   14.944  1.00 44.57  ? 473  LYS B CB  1 
ATOM   7220 C  CG  . LYS B 1 474 ? 10.983  6.422   15.382  1.00 47.93  ? 473  LYS B CG  1 
ATOM   7221 C  CD  . LYS B 1 474 ? 9.855   5.811   14.534  1.00 48.89  ? 473  LYS B CD  1 
ATOM   7222 C  CE  . LYS B 1 474 ? 10.189  5.759   13.051  1.00 49.06  ? 473  LYS B CE  1 
ATOM   7223 N  NZ  . LYS B 1 474 ? 9.075   5.134   12.283  1.00 48.56  ? 473  LYS B NZ  1 
ATOM   7224 N  N   . LYS B 1 475 ? 13.983  9.627   14.920  1.00 49.72  ? 474  LYS B N   1 
ATOM   7225 C  CA  . LYS B 1 475 ? 15.425  9.840   14.809  1.00 54.14  ? 474  LYS B CA  1 
ATOM   7226 C  C   . LYS B 1 475 ? 15.948  10.645  15.995  1.00 50.37  ? 474  LYS B C   1 
ATOM   7227 O  O   . LYS B 1 475 ? 16.938  10.257  16.598  1.00 47.97  ? 474  LYS B O   1 
ATOM   7228 C  CB  . LYS B 1 475 ? 15.845  10.493  13.474  1.00 62.22  ? 474  LYS B CB  1 
ATOM   7229 C  CG  . LYS B 1 475 ? 15.191  11.823  13.162  1.00 74.11  ? 474  LYS B CG  1 
ATOM   7230 C  CD  . LYS B 1 475 ? 15.621  12.419  11.810  1.00 83.08  ? 474  LYS B CD  1 
ATOM   7231 C  CE  . LYS B 1 475 ? 14.606  13.482  11.321  1.00 82.84  ? 474  LYS B CE  1 
ATOM   7232 N  NZ  . LYS B 1 475 ? 14.446  13.630  9.829   1.00 76.78  ? 474  LYS B NZ  1 
ATOM   7233 N  N   . LEU B 1 476 ? 15.270  11.749  16.316  1.00 51.46  ? 475  LEU B N   1 
ATOM   7234 C  CA  . LEU B 1 476 ? 15.679  12.633  17.392  1.00 53.64  ? 475  LEU B CA  1 
ATOM   7235 C  C   . LEU B 1 476 ? 15.920  11.849  18.643  1.00 55.90  ? 475  LEU B C   1 
ATOM   7236 O  O   . LEU B 1 476 ? 16.922  12.071  19.306  1.00 58.48  ? 475  LEU B O   1 
ATOM   7237 C  CB  . LEU B 1 476 ? 14.625  13.698  17.705  1.00 55.26  ? 475  LEU B CB  1 
ATOM   7238 C  CG  . LEU B 1 476 ? 14.829  15.055  17.063  1.00 57.56  ? 475  LEU B CG  1 
ATOM   7239 C  CD1 . LEU B 1 476 ? 13.548  15.862  17.246  1.00 59.34  ? 475  LEU B CD1 1 
ATOM   7240 C  CD2 . LEU B 1 476 ? 16.046  15.800  17.625  1.00 58.05  ? 475  LEU B CD2 1 
ATOM   7241 N  N   . VAL B 1 477 ? 14.982  10.975  18.992  1.00 52.95  ? 476  VAL B N   1 
ATOM   7242 C  CA  . VAL B 1 477 ? 15.083  10.215  20.222  1.00 59.22  ? 476  VAL B CA  1 
ATOM   7243 C  C   . VAL B 1 477 ? 16.341  9.338   20.190  1.00 59.92  ? 476  VAL B C   1 
ATOM   7244 O  O   . VAL B 1 477 ? 17.119  9.315   21.155  1.00 61.60  ? 476  VAL B O   1 
ATOM   7245 C  CB  . VAL B 1 477 ? 13.786  9.417   20.513  1.00 64.08  ? 476  VAL B CB  1 
ATOM   7246 C  CG1 . VAL B 1 477 ? 13.861  8.019   19.894  1.00 68.84  ? 476  VAL B CG1 1 
ATOM   7247 C  CG2 . VAL B 1 477 ? 13.509  9.361   22.030  1.00 62.01  ? 476  VAL B CG2 1 
ATOM   7248 N  N   . GLN B 1 478 ? 16.553  8.665   19.062  1.00 62.03  ? 477  GLN B N   1 
ATOM   7249 C  CA  . GLN B 1 478 ? 17.705  7.795   18.872  1.00 61.17  ? 477  GLN B CA  1 
ATOM   7250 C  C   . GLN B 1 478 ? 19.007  8.583   18.900  1.00 61.02  ? 477  GLN B C   1 
ATOM   7251 O  O   . GLN B 1 478 ? 19.945  8.210   19.581  1.00 60.64  ? 477  GLN B O   1 
ATOM   7252 C  CB  . GLN B 1 478 ? 17.576  7.050   17.541  1.00 59.63  ? 477  GLN B CB  1 
ATOM   7253 C  CG  . GLN B 1 478 ? 18.663  6.029   17.269  1.00 58.72  ? 477  GLN B CG  1 
ATOM   7254 C  CD  . GLN B 1 478 ? 18.758  4.979   18.351  1.00 56.72  ? 477  GLN B CD  1 
ATOM   7255 O  OE1 . GLN B 1 478 ? 17.773  4.676   19.014  1.00 60.27  ? 477  GLN B OE1 1 
ATOM   7256 N  NE2 . GLN B 1 478 ? 19.945  4.424   18.547  1.00 54.68  ? 477  GLN B NE2 1 
ATOM   7257 N  N   . ARG B 1 479 ? 19.041  9.689   18.170  1.00 65.80  ? 478  ARG B N   1 
ATOM   7258 C  CA  . ARG B 1 479 ? 20.226  10.537  18.057  1.00 63.00  ? 478  ARG B CA  1 
ATOM   7259 C  C   . ARG B 1 479 ? 20.652  11.151  19.365  1.00 62.51  ? 478  ARG B C   1 
ATOM   7260 O  O   . ARG B 1 479 ? 21.842  11.353  19.594  1.00 64.39  ? 478  ARG B O   1 
ATOM   7261 C  CB  . ARG B 1 479 ? 19.973  11.626  17.016  1.00 66.26  ? 478  ARG B CB  1 
ATOM   7262 C  CG  . ARG B 1 479 ? 20.752  12.914  17.149  1.00 69.28  ? 478  ARG B CG  1 
ATOM   7263 C  CD  . ARG B 1 479 ? 20.247  13.875  16.092  1.00 77.78  ? 478  ARG B CD  1 
ATOM   7264 N  NE  . ARG B 1 479 ? 20.992  15.126  16.108  1.00 87.58  ? 478  ARG B NE  1 
ATOM   7265 C  CZ  . ARG B 1 479 ? 20.969  16.026  15.129  1.00 87.04  ? 478  ARG B CZ  1 
ATOM   7266 N  NH1 . ARG B 1 479 ? 20.233  15.798  14.046  1.00 83.55  ? 478  ARG B NH1 1 
ATOM   7267 N  NH2 . ARG B 1 479 ? 21.694  17.149  15.232  1.00 82.88  ? 478  ARG B NH2 1 
ATOM   7268 N  N   . GLU B 1 480 ? 19.689  11.445  20.233  1.00 64.70  ? 479  GLU B N   1 
ATOM   7269 C  CA  . GLU B 1 480 ? 20.006  11.944  21.556  1.00 66.53  ? 479  GLU B CA  1 
ATOM   7270 C  C   . GLU B 1 480 ? 20.736  10.893  22.419  1.00 63.82  ? 479  GLU B C   1 
ATOM   7271 O  O   . GLU B 1 480 ? 21.370  11.240  23.388  1.00 62.84  ? 479  GLU B O   1 
ATOM   7272 C  CB  . GLU B 1 480 ? 18.748  12.476  22.262  1.00 73.27  ? 479  GLU B CB  1 
ATOM   7273 C  CG  . GLU B 1 480 ? 18.305  13.892  21.847  1.00 79.97  ? 479  GLU B CG  1 
ATOM   7274 C  CD  . GLU B 1 480 ? 17.066  14.402  22.611  1.00 84.41  ? 479  GLU B CD  1 
ATOM   7275 O  OE1 . GLU B 1 480 ? 16.787  13.897  23.714  1.00 93.39  ? 479  GLU B OE1 1 
ATOM   7276 O  OE2 . GLU B 1 480 ? 16.340  15.290  22.114  1.00 79.15  ? 479  GLU B OE2 1 
ATOM   7277 N  N   . LYS B 1 481 ? 20.673  9.617   22.054  1.00 65.29  ? 480  LYS B N   1 
ATOM   7278 C  CA  . LYS B 1 481 ? 21.468  8.597   22.740  1.00 63.82  ? 480  LYS B CA  1 
ATOM   7279 C  C   . LYS B 1 481 ? 22.953  8.869   22.525  1.00 72.53  ? 480  LYS B C   1 
ATOM   7280 O  O   . LYS B 1 481 ? 23.713  8.991   23.476  1.00 80.32  ? 480  LYS B O   1 
ATOM   7281 C  CB  . LYS B 1 481 ? 21.143  7.187   22.252  1.00 62.72  ? 480  LYS B CB  1 
ATOM   7282 C  CG  . LYS B 1 481 ? 19.679  6.785   22.369  1.00 65.77  ? 480  LYS B CG  1 
ATOM   7283 C  CD  . LYS B 1 481 ? 19.436  5.323   22.035  1.00 65.66  ? 480  LYS B CD  1 
ATOM   7284 C  CE  . LYS B 1 481 ? 17.970  4.971   22.247  1.00 63.85  ? 480  LYS B CE  1 
ATOM   7285 N  NZ  . LYS B 1 481 ? 17.562  3.643   21.698  1.00 61.23  ? 480  LYS B NZ  1 
ATOM   7286 N  N   . THR B 1 482 ? 23.368  9.026   21.274  1.00 80.04  ? 481  THR B N   1 
ATOM   7287 C  CA  . THR B 1 482 ? 24.797  9.258   20.984  1.00 87.70  ? 481  THR B CA  1 
ATOM   7288 C  C   . THR B 1 482 ? 25.114  10.687  21.411  1.00 84.34  ? 481  THR B C   1 
ATOM   7289 O  O   . THR B 1 482 ? 26.276  11.044  21.610  1.00 81.46  ? 481  THR B O   1 
ATOM   7290 C  CB  . THR B 1 482 ? 25.193  9.031   19.494  1.00 92.29  ? 481  THR B CB  1 
ATOM   7291 O  OG1 . THR B 1 482 ? 24.590  10.041  18.671  1.00 88.39  ? 481  THR B OG1 1 
ATOM   7292 C  CG2 . THR B 1 482 ? 24.762  7.622   19.031  1.00 86.60  ? 481  THR B CG2 1 
ATOM   7293 N  N   . LEU B 1 483 ? 24.053  11.487  21.527  1.00 83.59  ? 482  LEU B N   1 
ATOM   7294 C  CA  . LEU B 1 483 ? 24.093  12.828  22.117  1.00 97.76  ? 482  LEU B CA  1 
ATOM   7295 C  C   . LEU B 1 483 ? 24.919  13.798  21.271  1.00 86.82  ? 482  LEU B C   1 
ATOM   7296 O  O   . LEU B 1 483 ? 24.359  14.502  20.440  1.00 66.32  ? 482  LEU B O   1 
ATOM   7297 C  CB  . LEU B 1 483 ? 24.596  12.775  23.584  1.00 109.20 ? 482  LEU B CB  1 
ATOM   7298 C  CG  . LEU B 1 483 ? 24.255  13.914  24.574  1.00 112.07 ? 482  LEU B CG  1 
ATOM   7299 C  CD1 . LEU B 1 483 ? 22.790  14.334  24.501  1.00 108.17 ? 482  LEU B CD1 1 
ATOM   7300 C  CD2 . LEU B 1 483 ? 24.611  13.516  26.011  1.00 110.20 ? 482  LEU B CD2 1 
HETATM 7301 ZN ZN  . ZN  C 2 .   ? 23.120  14.360  47.944  1.00 83.26  ? 1483 ZN  A ZN  1 
HETATM 7302 ZN ZN  . ZN  D 2 .   ? -3.398  -24.469 36.692  0.64 108.46 ? 1484 ZN  A ZN  1 
HETATM 7303 ZN ZN  . ZN  E 2 .   ? 12.783  19.335  30.071  0.67 91.72  ? 1483 ZN  B ZN  1 
HETATM 7304 ZN ZN  . ZN  F 2 .   ? 0.368   43.133  -9.930  0.67 98.59  ? 1484 ZN  B ZN  1 
HETATM 7305 O  O   . HOH G 3 .   ? 23.362  14.348  50.429  1.00 25.38  ? 2001 HOH A O   1 
HETATM 7306 O  O   . HOH G 3 .   ? -2.025  -27.015 37.364  1.00 27.35  ? 2002 HOH A O   1 
HETATM 7307 O  O   . HOH H 3 .   ? 2.657   44.689  -10.613 1.00 52.49  ? 2001 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   LEU 3   2   ?   ?   ?   A . n 
A 1 4   ALA 4   3   ?   ?   ?   A . n 
A 1 5   ASN 5   4   ?   ?   ?   A . n 
A 1 6   SER 6   5   ?   ?   ?   A . n 
A 1 7   ALA 7   6   ?   ?   ?   A . n 
A 1 8   SER 8   7   7   SER SER A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  ARG 10  9   9   ARG ARG A . n 
A 1 11  ILE 11  10  10  ILE ILE A . n 
A 1 12  LEU 12  11  11  LEU LEU A . n 
A 1 13  ILE 13  12  12  ILE ILE A . n 
A 1 14  LYS 14  13  13  LYS LYS A . n 
A 1 15  GLY 15  14  14  GLY GLY A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  VAL 19  18  18  VAL VAL A . n 
A 1 20  ASN 20  19  19  ASN ASN A . n 
A 1 21  ASP 21  20  20  ASP ASP A . n 
A 1 22  ASP 22  21  21  ASP ASP A . n 
A 1 23  CYS 23  22  22  CYS CYS A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  HIS 25  24  24  HIS HIS A . n 
A 1 26  GLU 26  25  25  GLU GLU A . n 
A 1 27  ALA 27  26  26  ALA ALA A . n 
A 1 28  ASP 28  27  27  ASP ASP A . n 
A 1 29  VAL 29  28  28  VAL VAL A . n 
A 1 30  TYR 30  29  29  TYR TYR A . n 
A 1 31  ILE 31  30  30  ILE ILE A . n 
A 1 32  GLU 32  31  31  GLU GLU A . n 
A 1 33  ASN 33  32  32  ASN ASN A . n 
A 1 34  GLY 34  33  33  GLY GLY A . n 
A 1 35  ILE 35  34  34  ILE ILE A . n 
A 1 36  ILE 36  35  35  ILE ILE A . n 
A 1 37  GLN 37  36  36  GLN GLN A . n 
A 1 38  GLN 38  37  37  GLN GLN A . n 
A 1 39  VAL 39  38  38  VAL VAL A . n 
A 1 40  GLY 40  39  39  GLY GLY A . n 
A 1 41  ARG 41  40  40  ARG ARG A . n 
A 1 42  GLU 42  41  41  GLU GLU A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  MET 44  43  43  MET MET A . n 
A 1 45  ILE 45  44  44  ILE ILE A . n 
A 1 46  PRO 46  45  45  PRO PRO A . n 
A 1 47  GLY 47  46  46  GLY GLY A . n 
A 1 48  GLY 48  47  47  GLY GLY A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  LYS 50  49  49  LYS LYS A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  ILE 52  51  51  ILE ILE A . n 
A 1 53  ASP 53  52  52  ASP ASP A . n 
A 1 54  ALA 54  53  53  ALA ALA A . n 
A 1 55  THR 55  54  54  THR THR A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  LEU 58  57  57  LEU LEU A . n 
A 1 59  VAL 59  58  58  VAL VAL A . n 
A 1 60  ILE 60  59  59  ILE ILE A . n 
A 1 61  PRO 61  60  60  PRO PRO A . n 
A 1 62  GLY 62  61  61  GLY GLY A . n 
A 1 63  GLY 63  62  62  GLY GLY A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  ASP 65  64  64  ASP ASP A . n 
A 1 66  THR 66  65  65  THR THR A . n 
A 1 67  SER 67  66  66  SER SER A . n 
A 1 68  THR 68  67  67  THR THR A . n 
A 1 69  HIS 69  68  68  HIS HIS A . n 
A 1 70  PHE 70  69  69  PHE PHE A . n 
A 1 71  HIS 71  70  70  HIS HIS A . n 
A 1 72  GLN 72  71  71  GLN GLN A . n 
A 1 73  THR 73  72  72  THR THR A . n 
A 1 74  PHE 74  73  73  PHE PHE A . n 
A 1 75  MET 75  74  74  MET MET A . n 
A 1 76  ASN 76  75  75  ASN ASN A . n 
A 1 77  ALA 77  76  76  ALA ALA A . n 
A 1 78  THR 78  77  77  THR THR A . n 
A 1 79  CYS 79  78  78  CYS CYS A . n 
A 1 80  VAL 80  79  79  VAL VAL A . n 
A 1 81  ASP 81  80  80  ASP ASP A . n 
A 1 82  ASP 82  81  81  ASP ASP A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  TYR 84  83  83  TYR TYR A . n 
A 1 85  HIS 85  84  84  HIS HIS A . n 
A 1 86  GLY 86  85  85  GLY GLY A . n 
A 1 87  THR 87  86  86  THR THR A . n 
A 1 88  LYS 88  87  87  LYS LYS A . n 
A 1 89  ALA 89  88  88  ALA ALA A . n 
A 1 90  ALA 90  89  89  ALA ALA A . n 
A 1 91  LEU 91  90  90  LEU LEU A . n 
A 1 92  VAL 92  91  91  VAL VAL A . n 
A 1 93  GLY 93  92  92  GLY GLY A . n 
A 1 94  GLY 94  93  93  GLY GLY A . n 
A 1 95  THR 95  94  94  THR THR A . n 
A 1 96  THR 96  95  95  THR THR A . n 
A 1 97  MET 97  96  96  MET MET A . n 
A 1 98  ILE 98  97  97  ILE ILE A . n 
A 1 99  ILE 99  98  98  ILE ILE A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 HIS 101 100 100 HIS HIS A . n 
A 1 102 VAL 102 101 101 VAL VAL A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 PRO 104 103 103 PRO PRO A . n 
A 1 105 ASP 105 104 104 ASP ASP A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 GLU 107 106 106 GLU GLU A . n 
A 1 108 THR 108 107 107 THR THR A . n 
A 1 109 SER 109 108 108 SER SER A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 VAL 111 110 110 VAL VAL A . n 
A 1 112 ASP 112 111 111 ASP ASP A . n 
A 1 113 ALA 113 112 112 ALA ALA A . n 
A 1 114 TYR 114 113 113 TYR TYR A . n 
A 1 115 GLU 115 114 114 GLU GLU A . n 
A 1 116 LYS 116 115 115 LYS LYS A . n 
A 1 117 CYS 117 116 116 CYS CYS A . n 
A 1 118 ARG 118 117 117 ARG ARG A . n 
A 1 119 GLY 119 118 118 GLY GLY A . n 
A 1 120 LEU 120 119 119 LEU LEU A . n 
A 1 121 ALA 121 120 120 ALA ALA A . n 
A 1 122 ASP 122 121 121 ASP ASP A . n 
A 1 123 PRO 123 122 122 PRO PRO A . n 
A 1 124 LYS 124 123 123 LYS LYS A . n 
A 1 125 VAL 125 124 124 VAL VAL A . n 
A 1 126 CYS 126 125 125 CYS CYS A . n 
A 1 127 CYS 127 126 126 CYS CYS A . n 
A 1 128 ASP 128 127 127 ASP ASP A . n 
A 1 129 TYR 129 128 128 TYR TYR A . n 
A 1 130 ALA 130 129 129 ALA ALA A . n 
A 1 131 LEU 131 130 130 LEU LEU A . n 
A 1 132 HIS 132 131 131 HIS HIS A . n 
A 1 133 VAL 133 132 132 VAL VAL A . n 
A 1 134 GLY 134 133 133 GLY GLY A . n 
A 1 135 ILE 135 134 134 ILE ILE A . n 
A 1 136 THR 136 135 135 THR THR A . n 
A 1 137 TRP 137 136 136 TRP TRP A . n 
A 1 138 TRP 138 137 137 TRP TRP A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 PRO 140 139 139 PRO PRO A . n 
A 1 141 LYS 141 140 140 LYS LYS A . n 
A 1 142 VAL 142 141 141 VAL VAL A . n 
A 1 143 LYS 143 142 142 LYS LYS A . n 
A 1 144 ALA 144 143 143 ALA ALA A . n 
A 1 145 GLU 145 144 144 GLU GLU A . n 
A 1 146 MET 146 145 145 MET MET A . n 
A 1 147 GLU 147 146 146 GLU GLU A . n 
A 1 148 THR 148 147 147 THR THR A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 VAL 150 149 149 VAL VAL A . n 
A 1 151 ARG 151 150 150 ARG ARG A . n 
A 1 152 GLU 152 151 151 GLU GLU A . n 
A 1 153 LYS 153 152 152 LYS LYS A . n 
A 1 154 GLY 154 153 153 GLY GLY A . n 
A 1 155 VAL 155 154 154 VAL VAL A . n 
A 1 156 ASN 156 155 155 ASN ASN A . n 
A 1 157 SER 157 156 156 SER SER A . n 
A 1 158 PHE 158 157 157 PHE PHE A . n 
A 1 159 GLN 159 158 158 GLN GLN A . n 
A 1 160 MET 160 159 159 MET MET A . n 
A 1 161 PHE 161 160 160 PHE PHE A . n 
A 1 162 MET 162 161 161 MET MET A . n 
A 1 163 THR 163 162 162 THR THR A . n 
A 1 164 TYR 164 163 163 TYR TYR A . n 
A 1 165 LYS 165 164 164 LYS LYS A . n 
A 1 166 ASP 166 165 165 ASP ASP A . n 
A 1 167 LEU 167 166 166 LEU LEU A . n 
A 1 168 TYR 168 167 167 TYR TYR A . n 
A 1 169 MET 169 168 168 MET MET A . n 
A 1 170 LEU 170 169 169 LEU LEU A . n 
A 1 171 ARG 171 170 170 ARG ARG A . n 
A 1 172 ASP 172 171 171 ASP ASP A . n 
A 1 173 SER 173 172 172 SER SER A . n 
A 1 174 GLU 174 173 173 GLU GLU A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 TYR 176 175 175 TYR TYR A . n 
A 1 177 GLN 177 176 176 GLN GLN A . n 
A 1 178 VAL 178 177 177 VAL VAL A . n 
A 1 179 LEU 179 178 178 LEU LEU A . n 
A 1 180 HIS 180 179 179 HIS HIS A . n 
A 1 181 ALA 181 180 180 ALA ALA A . n 
A 1 182 CYS 182 181 181 CYS CYS A . n 
A 1 183 LYS 183 182 182 LYS LYS A . n 
A 1 184 ASP 184 183 183 ASP ASP A . n 
A 1 185 ILE 185 184 184 ILE ILE A . n 
A 1 186 GLY 186 185 185 GLY GLY A . n 
A 1 187 ALA 187 186 186 ALA ALA A . n 
A 1 188 ILE 188 187 187 ILE ILE A . n 
A 1 189 ALA 189 188 188 ALA ALA A . n 
A 1 190 ARG 190 189 189 ARG ARG A . n 
A 1 191 VAL 191 190 190 VAL VAL A . n 
A 1 192 HIS 192 191 191 HIS HIS A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 GLU 194 193 193 GLU GLU A . n 
A 1 195 ASN 195 194 194 ASN ASN A . n 
A 1 196 GLY 196 195 195 GLY GLY A . n 
A 1 197 GLU 197 196 196 GLU GLU A . n 
A 1 198 LEU 198 197 197 LEU LEU A . n 
A 1 199 VAL 199 198 198 VAL VAL A . n 
A 1 200 ALA 200 199 199 ALA ALA A . n 
A 1 201 GLU 201 200 200 GLU GLU A . n 
A 1 202 GLY 202 201 201 GLY GLY A . n 
A 1 203 ALA 203 202 202 ALA ALA A . n 
A 1 204 LYS 204 203 203 LYS LYS A . n 
A 1 205 GLU 205 204 204 GLU GLU A . n 
A 1 206 ALA 206 205 205 ALA ALA A . n 
A 1 207 LEU 207 206 206 LEU LEU A . n 
A 1 208 ASP 208 207 207 ASP ASP A . n 
A 1 209 LEU 209 208 208 LEU LEU A . n 
A 1 210 GLY 210 209 209 GLY GLY A . n 
A 1 211 ILE 211 210 210 ILE ILE A . n 
A 1 212 THR 212 211 211 THR THR A . n 
A 1 213 GLY 213 212 212 GLY GLY A . n 
A 1 214 PRO 214 213 213 PRO PRO A . n 
A 1 215 GLU 215 214 214 GLU GLU A . n 
A 1 216 GLY 216 215 215 GLY GLY A . n 
A 1 217 ILE 217 216 216 ILE ILE A . n 
A 1 218 GLU 218 217 217 GLU GLU A . n 
A 1 219 ILE 219 218 218 ILE ILE A . n 
A 1 220 SER 220 219 219 SER SER A . n 
A 1 221 ARG 221 220 220 ARG ARG A . n 
A 1 222 PRO 222 221 221 PRO PRO A . n 
A 1 223 GLU 223 222 222 GLU GLU A . n 
A 1 224 GLU 224 223 223 GLU GLU A . n 
A 1 225 LEU 225 224 224 LEU LEU A . n 
A 1 226 GLU 226 225 225 GLU GLU A . n 
A 1 227 ALA 227 226 226 ALA ALA A . n 
A 1 228 GLU 228 227 227 GLU GLU A . n 
A 1 229 ALA 229 228 228 ALA ALA A . n 
A 1 230 THR 230 229 229 THR THR A . n 
A 1 231 HIS 231 230 230 HIS HIS A . n 
A 1 232 ARG 232 231 231 ARG ARG A . n 
A 1 233 VAL 233 232 232 VAL VAL A . n 
A 1 234 ILE 234 233 233 ILE ILE A . n 
A 1 235 THR 235 234 234 THR THR A . n 
A 1 236 ILE 236 235 235 ILE ILE A . n 
A 1 237 ALA 237 236 236 ALA ALA A . n 
A 1 238 ASN 238 237 237 ASN ASN A . n 
A 1 239 ARG 239 238 238 ARG ARG A . n 
A 1 240 THR 240 239 239 THR THR A . n 
A 1 241 HIS 241 240 240 HIS HIS A . n 
A 1 242 CYS 242 241 241 CYS CYS A . n 
A 1 243 PRO 243 242 242 PRO PRO A . n 
A 1 244 ILE 244 243 243 ILE ILE A . n 
A 1 245 TYR 245 244 244 TYR TYR A . n 
A 1 246 LEU 246 245 245 LEU LEU A . n 
A 1 247 VAL 247 246 246 VAL VAL A . n 
A 1 248 ASN 248 247 247 ASN ASN A . n 
A 1 249 VAL 249 248 248 VAL VAL A . n 
A 1 250 SER 250 249 249 SER SER A . n 
A 1 251 SER 251 250 250 SER SER A . n 
A 1 252 ILE 252 251 251 ILE ILE A . n 
A 1 253 SER 253 252 252 SER SER A . n 
A 1 254 ALA 254 253 253 ALA ALA A . n 
A 1 255 GLY 255 254 254 GLY GLY A . n 
A 1 256 ASP 256 255 255 ASP ASP A . n 
A 1 257 VAL 257 256 256 VAL VAL A . n 
A 1 258 ILE 258 257 257 ILE ILE A . n 
A 1 259 ALA 259 258 258 ALA ALA A . n 
A 1 260 ALA 260 259 259 ALA ALA A . n 
A 1 261 ALA 261 260 260 ALA ALA A . n 
A 1 262 LYS 262 261 261 LYS LYS A . n 
A 1 263 MET 263 262 262 MET MET A . n 
A 1 264 GLN 264 263 263 GLN GLN A . n 
A 1 265 GLY 265 264 264 GLY GLY A . n 
A 1 266 LYS 266 265 265 LYS LYS A . n 
A 1 267 VAL 267 266 266 VAL VAL A . n 
A 1 268 VAL 268 267 267 VAL VAL A . n 
A 1 269 LEU 269 268 268 LEU LEU A . n 
A 1 270 ALA 270 269 269 ALA ALA A . n 
A 1 271 GLU 271 270 270 GLU GLU A . n 
A 1 272 THR 272 271 271 THR THR A . n 
A 1 273 THR 273 272 272 THR THR A . n 
A 1 274 THR 274 273 273 THR THR A . n 
A 1 275 ALA 275 274 274 ALA ALA A . n 
A 1 276 HIS 276 275 275 HIS HIS A . n 
A 1 277 ALA 277 276 276 ALA ALA A . n 
A 1 278 THR 278 277 277 THR THR A . n 
A 1 279 LEU 279 278 278 LEU LEU A . n 
A 1 280 THR 280 279 279 THR THR A . n 
A 1 281 GLY 281 280 280 GLY GLY A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 HIS 283 282 282 HIS HIS A . n 
A 1 284 TYR 284 283 283 TYR TYR A . n 
A 1 285 TYR 285 284 284 TYR TYR A . n 
A 1 286 HIS 286 285 285 HIS HIS A . n 
A 1 287 GLN 287 286 286 GLN GLN A . n 
A 1 288 ASP 288 287 287 ASP ASP A . n 
A 1 289 TRP 289 288 288 TRP TRP A . n 
A 1 290 SER 290 289 289 SER SER A . n 
A 1 291 HIS 291 290 290 HIS HIS A . n 
A 1 292 ALA 292 291 291 ALA ALA A . n 
A 1 293 ALA 293 292 292 ALA ALA A . n 
A 1 294 ALA 294 293 293 ALA ALA A . n 
A 1 295 TYR 295 294 294 TYR TYR A . n 
A 1 296 VAL 296 295 295 VAL VAL A . n 
A 1 297 THR 297 296 296 THR THR A . n 
A 1 298 VAL 298 297 297 VAL VAL A . n 
A 1 299 PRO 299 298 298 PRO PRO A . n 
A 1 300 PRO 300 299 299 PRO PRO A . n 
A 1 301 LEU 301 300 300 LEU LEU A . n 
A 1 302 ARG 302 301 301 ARG ARG A . n 
A 1 303 LEU 303 302 302 LEU LEU A . n 
A 1 304 ASP 304 303 303 ASP ASP A . n 
A 1 305 THR 305 304 304 THR THR A . n 
A 1 306 ASN 306 305 305 ASN ASN A . n 
A 1 307 THR 307 306 306 THR THR A . n 
A 1 308 SER 308 307 307 SER SER A . n 
A 1 309 THR 309 308 308 THR THR A . n 
A 1 310 TYR 310 309 309 TYR TYR A . n 
A 1 311 LEU 311 310 310 LEU LEU A . n 
A 1 312 MET 312 311 311 MET MET A . n 
A 1 313 SER 313 312 312 SER SER A . n 
A 1 314 LEU 314 313 313 LEU LEU A . n 
A 1 315 LEU 315 314 314 LEU LEU A . n 
A 1 316 ALA 316 315 315 ALA ALA A . n 
A 1 317 ASN 317 316 316 ASN ASN A . n 
A 1 318 ASP 318 317 317 ASP ASP A . n 
A 1 319 THR 319 318 318 THR THR A . n 
A 1 320 LEU 320 319 319 LEU LEU A . n 
A 1 321 ASN 321 320 320 ASN ASN A . n 
A 1 322 ILE 322 321 321 ILE ILE A . n 
A 1 323 VAL 323 322 322 VAL VAL A . n 
A 1 324 ALA 324 323 323 ALA ALA A . n 
A 1 325 SER 325 324 324 SER SER A . n 
A 1 326 ASP 326 325 325 ASP ASP A . n 
A 1 327 HIS 327 326 326 HIS HIS A . n 
A 1 328 ARG 328 327 327 ARG ARG A . n 
A 1 329 PRO 329 328 328 PRO PRO A . n 
A 1 330 PHE 330 329 329 PHE PHE A . n 
A 1 331 THR 331 330 330 THR THR A . n 
A 1 332 THR 332 331 331 THR THR A . n 
A 1 333 LYS 333 332 332 LYS LYS A . n 
A 1 334 GLN 334 333 333 GLN GLN A . n 
A 1 335 LYS 335 334 334 LYS LYS A . n 
A 1 336 ALA 336 335 335 ALA ALA A . n 
A 1 337 MET 337 336 336 MET MET A . n 
A 1 338 GLY 338 337 337 GLY GLY A . n 
A 1 339 LYS 339 338 338 LYS LYS A . n 
A 1 340 GLU 340 339 339 GLU GLU A . n 
A 1 341 ASP 341 340 340 ASP ASP A . n 
A 1 342 PHE 342 341 341 PHE PHE A . n 
A 1 343 THR 343 342 342 THR THR A . n 
A 1 344 LYS 344 343 343 LYS LYS A . n 
A 1 345 ILE 345 344 344 ILE ILE A . n 
A 1 346 PRO 346 345 345 PRO PRO A . n 
A 1 347 HIS 347 346 346 HIS HIS A . n 
A 1 348 GLY 348 347 347 GLY GLY A . n 
A 1 349 VAL 349 348 348 VAL VAL A . n 
A 1 350 SER 350 349 349 SER SER A . n 
A 1 351 GLY 351 350 350 GLY GLY A . n 
A 1 352 VAL 352 351 351 VAL VAL A . n 
A 1 353 GLN 353 352 352 GLN GLN A . n 
A 1 354 ASP 354 353 353 ASP ASP A . n 
A 1 355 ARG 355 354 354 ARG ARG A . n 
A 1 356 MET 356 355 355 MET MET A . n 
A 1 357 SER 357 356 356 SER SER A . n 
A 1 358 VAL 358 357 357 VAL VAL A . n 
A 1 359 ILE 359 358 358 ILE ILE A . n 
A 1 360 TRP 360 359 359 TRP TRP A . n 
A 1 361 GLU 361 360 360 GLU GLU A . n 
A 1 362 ARG 362 361 361 ARG ARG A . n 
A 1 363 GLY 363 362 362 GLY GLY A . n 
A 1 364 VAL 364 363 363 VAL VAL A . n 
A 1 365 VAL 365 364 364 VAL VAL A . n 
A 1 366 GLY 366 365 365 GLY GLY A . n 
A 1 367 GLY 367 366 366 GLY GLY A . n 
A 1 368 LYS 368 367 367 LYS LYS A . n 
A 1 369 MET 369 368 368 MET MET A . n 
A 1 370 ASP 370 369 369 ASP ASP A . n 
A 1 371 GLU 371 370 370 GLU GLU A . n 
A 1 372 ASN 372 371 371 ASN ASN A . n 
A 1 373 ARG 373 372 372 ARG ARG A . n 
A 1 374 PHE 374 373 373 PHE PHE A . n 
A 1 375 VAL 375 374 374 VAL VAL A . n 
A 1 376 ALA 376 375 375 ALA ALA A . n 
A 1 377 VAL 377 376 376 VAL VAL A . n 
A 1 378 THR 378 377 377 THR THR A . n 
A 1 379 SER 379 378 378 SER SER A . n 
A 1 380 SER 380 379 379 SER SER A . n 
A 1 381 ASN 381 380 380 ASN ASN A . n 
A 1 382 ALA 382 381 381 ALA ALA A . n 
A 1 383 ALA 383 382 382 ALA ALA A . n 
A 1 384 LYS 384 383 383 LYS LYS A . n 
A 1 385 LEU 385 384 384 LEU LEU A . n 
A 1 386 LEU 386 385 385 LEU LEU A . n 
A 1 387 ASN 387 386 386 ASN ASN A . n 
A 1 388 LEU 388 387 387 LEU LEU A . n 
A 1 389 TYR 389 388 388 TYR TYR A . n 
A 1 390 PRO 390 389 389 PRO PRO A . n 
A 1 391 ARG 391 390 390 ARG ARG A . n 
A 1 392 LYS 392 391 391 LYS LYS A . n 
A 1 393 GLY 393 392 392 GLY GLY A . n 
A 1 394 ARG 394 393 393 ARG ARG A . n 
A 1 395 ILE 395 394 394 ILE ILE A . n 
A 1 396 ILE 396 395 395 ILE ILE A . n 
A 1 397 PRO 397 396 396 PRO PRO A . n 
A 1 398 GLY 398 397 397 GLY GLY A . n 
A 1 399 ALA 399 398 398 ALA ALA A . n 
A 1 400 ASP 400 399 399 ASP ASP A . n 
A 1 401 ALA 401 400 400 ALA ALA A . n 
A 1 402 ASP 402 401 401 ASP ASP A . n 
A 1 403 VAL 403 402 402 VAL VAL A . n 
A 1 404 VAL 404 403 403 VAL VAL A . n 
A 1 405 VAL 405 404 404 VAL VAL A . n 
A 1 406 TRP 406 405 405 TRP TRP A . n 
A 1 407 ASP 407 406 406 ASP ASP A . n 
A 1 408 PRO 408 407 407 PRO PRO A . n 
A 1 409 GLU 409 408 408 GLU GLU A . n 
A 1 410 ALA 410 409 409 ALA ALA A . n 
A 1 411 THR 411 410 410 THR THR A . n 
A 1 412 LYS 412 411 411 LYS LYS A . n 
A 1 413 THR 413 412 412 THR THR A . n 
A 1 414 ILE 414 413 413 ILE ILE A . n 
A 1 415 SER 415 414 414 SER SER A . n 
A 1 416 ALA 416 415 415 ALA ALA A . n 
A 1 417 SER 417 416 416 SER SER A . n 
A 1 418 THR 418 417 417 THR THR A . n 
A 1 419 GLN 419 418 418 GLN GLN A . n 
A 1 420 VAL 420 419 419 VAL VAL A . n 
A 1 421 GLN 421 420 420 GLN GLN A . n 
A 1 422 GLY 422 421 421 GLY GLY A . n 
A 1 423 GLY 423 422 422 GLY GLY A . n 
A 1 424 ASP 424 423 423 ASP ASP A . n 
A 1 425 PHE 425 424 424 PHE PHE A . n 
A 1 426 ASN 426 425 425 ASN ASN A . n 
A 1 427 LEU 427 426 426 LEU LEU A . n 
A 1 428 TYR 428 427 427 TYR TYR A . n 
A 1 429 GLU 429 428 428 GLU GLU A . n 
A 1 430 ASN 430 429 429 ASN ASN A . n 
A 1 431 MET 431 430 430 MET MET A . n 
A 1 432 ARG 432 431 431 ARG ARG A . n 
A 1 433 CYS 433 432 432 CYS CYS A . n 
A 1 434 HIS 434 433 433 HIS HIS A . n 
A 1 435 GLY 435 434 434 GLY GLY A . n 
A 1 436 VAL 436 435 435 VAL VAL A . n 
A 1 437 PRO 437 436 436 PRO PRO A . n 
A 1 438 LEU 438 437 437 LEU LEU A . n 
A 1 439 VAL 439 438 438 VAL VAL A . n 
A 1 440 THR 440 439 439 THR THR A . n 
A 1 441 ILE 441 440 440 ILE ILE A . n 
A 1 442 SER 442 441 441 SER SER A . n 
A 1 443 ARG 443 442 442 ARG ARG A . n 
A 1 444 GLY 444 443 443 GLY GLY A . n 
A 1 445 ARG 445 444 444 ARG ARG A . n 
A 1 446 VAL 446 445 445 VAL VAL A . n 
A 1 447 VAL 447 446 446 VAL VAL A . n 
A 1 448 TYR 448 447 447 TYR TYR A . n 
A 1 449 GLU 449 448 448 GLU GLU A . n 
A 1 450 ASN 450 449 449 ASN ASN A . n 
A 1 451 GLY 451 450 450 GLY GLY A . n 
A 1 452 VAL 452 451 451 VAL VAL A . n 
A 1 453 PHE 453 452 452 PHE PHE A . n 
A 1 454 MET 454 453 453 MET MET A . n 
A 1 455 CYS 455 454 454 CYS CYS A . n 
A 1 456 ALA 456 455 455 ALA ALA A . n 
A 1 457 GLU 457 456 456 GLU GLU A . n 
A 1 458 GLY 458 457 457 GLY GLY A . n 
A 1 459 THR 459 458 458 THR THR A . n 
A 1 460 GLY 460 459 459 GLY GLY A . n 
A 1 461 LYS 461 460 460 LYS LYS A . n 
A 1 462 PHE 462 461 461 PHE PHE A . n 
A 1 463 CYS 463 462 462 CYS CYS A . n 
A 1 464 PRO 464 463 463 PRO PRO A . n 
A 1 465 LEU 465 464 464 LEU LEU A . n 
A 1 466 ARG 466 465 465 ARG ARG A . n 
A 1 467 SER 467 466 466 SER SER A . n 
A 1 468 PHE 468 467 467 PHE PHE A . n 
A 1 469 PRO 469 468 468 PRO PRO A . n 
A 1 470 ASP 470 469 469 ASP ASP A . n 
A 1 471 THR 471 470 470 THR THR A . n 
A 1 472 VAL 472 471 471 VAL VAL A . n 
A 1 473 TYR 473 472 472 TYR TYR A . n 
A 1 474 LYS 474 473 473 LYS LYS A . n 
A 1 475 LYS 475 474 474 LYS LYS A . n 
A 1 476 LEU 476 475 475 LEU LEU A . n 
A 1 477 VAL 477 476 476 VAL VAL A . n 
A 1 478 GLN 478 477 477 GLN GLN A . n 
A 1 479 ARG 479 478 478 ARG ARG A . n 
A 1 480 GLU 480 479 479 GLU GLU A . n 
A 1 481 LYS 481 480 480 LYS LYS A . n 
A 1 482 THR 482 481 481 THR THR A . n 
A 1 483 LEU 483 482 482 LEU LEU A . n 
A 1 484 LYS 484 483 ?   ?   ?   A . n 
B 1 1   SER 1   0   ?   ?   ?   B . n 
B 1 2   MET 2   1   ?   ?   ?   B . n 
B 1 3   LEU 3   2   ?   ?   ?   B . n 
B 1 4   ALA 4   3   ?   ?   ?   B . n 
B 1 5   ASN 5   4   ?   ?   ?   B . n 
B 1 6   SER 6   5   ?   ?   ?   B . n 
B 1 7   ALA 7   6   ?   ?   ?   B . n 
B 1 8   SER 8   7   ?   ?   ?   B . n 
B 1 9   VAL 9   8   8   VAL VAL B . n 
B 1 10  ARG 10  9   9   ARG ARG B . n 
B 1 11  ILE 11  10  10  ILE ILE B . n 
B 1 12  LEU 12  11  11  LEU LEU B . n 
B 1 13  ILE 13  12  12  ILE ILE B . n 
B 1 14  LYS 14  13  13  LYS LYS B . n 
B 1 15  GLY 15  14  14  GLY GLY B . n 
B 1 16  GLY 16  15  15  GLY GLY B . n 
B 1 17  LYS 17  16  16  LYS LYS B . n 
B 1 18  VAL 18  17  17  VAL VAL B . n 
B 1 19  VAL 19  18  18  VAL VAL B . n 
B 1 20  ASN 20  19  19  ASN ASN B . n 
B 1 21  ASP 21  20  20  ASP ASP B . n 
B 1 22  ASP 22  21  21  ASP ASP B . n 
B 1 23  CYS 23  22  22  CYS CYS B . n 
B 1 24  THR 24  23  23  THR THR B . n 
B 1 25  HIS 25  24  24  HIS HIS B . n 
B 1 26  GLU 26  25  25  GLU GLU B . n 
B 1 27  ALA 27  26  26  ALA ALA B . n 
B 1 28  ASP 28  27  27  ASP ASP B . n 
B 1 29  VAL 29  28  28  VAL VAL B . n 
B 1 30  TYR 30  29  29  TYR TYR B . n 
B 1 31  ILE 31  30  30  ILE ILE B . n 
B 1 32  GLU 32  31  31  GLU GLU B . n 
B 1 33  ASN 33  32  32  ASN ASN B . n 
B 1 34  GLY 34  33  33  GLY GLY B . n 
B 1 35  ILE 35  34  34  ILE ILE B . n 
B 1 36  ILE 36  35  35  ILE ILE B . n 
B 1 37  GLN 37  36  36  GLN GLN B . n 
B 1 38  GLN 38  37  37  GLN GLN B . n 
B 1 39  VAL 39  38  38  VAL VAL B . n 
B 1 40  GLY 40  39  39  GLY GLY B . n 
B 1 41  ARG 41  40  40  ARG ARG B . n 
B 1 42  GLU 42  41  41  GLU GLU B . n 
B 1 43  LEU 43  42  42  LEU LEU B . n 
B 1 44  MET 44  43  43  MET MET B . n 
B 1 45  ILE 45  44  44  ILE ILE B . n 
B 1 46  PRO 46  45  45  PRO PRO B . n 
B 1 47  GLY 47  46  46  GLY GLY B . n 
B 1 48  GLY 48  47  47  GLY GLY B . n 
B 1 49  ALA 49  48  48  ALA ALA B . n 
B 1 50  LYS 50  49  49  LYS LYS B . n 
B 1 51  VAL 51  50  50  VAL VAL B . n 
B 1 52  ILE 52  51  51  ILE ILE B . n 
B 1 53  ASP 53  52  52  ASP ASP B . n 
B 1 54  ALA 54  53  53  ALA ALA B . n 
B 1 55  THR 55  54  54  THR THR B . n 
B 1 56  GLY 56  55  55  GLY GLY B . n 
B 1 57  LYS 57  56  56  LYS LYS B . n 
B 1 58  LEU 58  57  57  LEU LEU B . n 
B 1 59  VAL 59  58  58  VAL VAL B . n 
B 1 60  ILE 60  59  59  ILE ILE B . n 
B 1 61  PRO 61  60  60  PRO PRO B . n 
B 1 62  GLY 62  61  61  GLY GLY B . n 
B 1 63  GLY 63  62  62  GLY GLY B . n 
B 1 64  ILE 64  63  63  ILE ILE B . n 
B 1 65  ASP 65  64  64  ASP ASP B . n 
B 1 66  THR 66  65  65  THR THR B . n 
B 1 67  SER 67  66  66  SER SER B . n 
B 1 68  THR 68  67  67  THR THR B . n 
B 1 69  HIS 69  68  68  HIS HIS B . n 
B 1 70  PHE 70  69  69  PHE PHE B . n 
B 1 71  HIS 71  70  70  HIS HIS B . n 
B 1 72  GLN 72  71  71  GLN GLN B . n 
B 1 73  THR 73  72  72  THR THR B . n 
B 1 74  PHE 74  73  73  PHE PHE B . n 
B 1 75  MET 75  74  74  MET MET B . n 
B 1 76  ASN 76  75  75  ASN ASN B . n 
B 1 77  ALA 77  76  76  ALA ALA B . n 
B 1 78  THR 78  77  77  THR THR B . n 
B 1 79  CYS 79  78  78  CYS CYS B . n 
B 1 80  VAL 80  79  79  VAL VAL B . n 
B 1 81  ASP 81  80  80  ASP ASP B . n 
B 1 82  ASP 82  81  81  ASP ASP B . n 
B 1 83  PHE 83  82  82  PHE PHE B . n 
B 1 84  TYR 84  83  83  TYR TYR B . n 
B 1 85  HIS 85  84  84  HIS HIS B . n 
B 1 86  GLY 86  85  85  GLY GLY B . n 
B 1 87  THR 87  86  86  THR THR B . n 
B 1 88  LYS 88  87  87  LYS LYS B . n 
B 1 89  ALA 89  88  88  ALA ALA B . n 
B 1 90  ALA 90  89  89  ALA ALA B . n 
B 1 91  LEU 91  90  90  LEU LEU B . n 
B 1 92  VAL 92  91  91  VAL VAL B . n 
B 1 93  GLY 93  92  92  GLY GLY B . n 
B 1 94  GLY 94  93  93  GLY GLY B . n 
B 1 95  THR 95  94  94  THR THR B . n 
B 1 96  THR 96  95  95  THR THR B . n 
B 1 97  MET 97  96  96  MET MET B . n 
B 1 98  ILE 98  97  97  ILE ILE B . n 
B 1 99  ILE 99  98  98  ILE ILE B . n 
B 1 100 GLY 100 99  99  GLY GLY B . n 
B 1 101 HIS 101 100 100 HIS HIS B . n 
B 1 102 VAL 102 101 101 VAL VAL B . n 
B 1 103 LEU 103 102 102 LEU LEU B . n 
B 1 104 PRO 104 103 103 PRO PRO B . n 
B 1 105 ASP 105 104 104 ASP ASP B . n 
B 1 106 LYS 106 105 105 LYS LYS B . n 
B 1 107 GLU 107 106 106 GLU GLU B . n 
B 1 108 THR 108 107 107 THR THR B . n 
B 1 109 SER 109 108 108 SER SER B . n 
B 1 110 LEU 110 109 109 LEU LEU B . n 
B 1 111 VAL 111 110 110 VAL VAL B . n 
B 1 112 ASP 112 111 111 ASP ASP B . n 
B 1 113 ALA 113 112 112 ALA ALA B . n 
B 1 114 TYR 114 113 113 TYR TYR B . n 
B 1 115 GLU 115 114 114 GLU GLU B . n 
B 1 116 LYS 116 115 115 LYS LYS B . n 
B 1 117 CYS 117 116 116 CYS CYS B . n 
B 1 118 ARG 118 117 117 ARG ARG B . n 
B 1 119 GLY 119 118 118 GLY GLY B . n 
B 1 120 LEU 120 119 119 LEU LEU B . n 
B 1 121 ALA 121 120 120 ALA ALA B . n 
B 1 122 ASP 122 121 121 ASP ASP B . n 
B 1 123 PRO 123 122 122 PRO PRO B . n 
B 1 124 LYS 124 123 123 LYS LYS B . n 
B 1 125 VAL 125 124 124 VAL VAL B . n 
B 1 126 CYS 126 125 125 CYS CYS B . n 
B 1 127 CYS 127 126 126 CYS CYS B . n 
B 1 128 ASP 128 127 127 ASP ASP B . n 
B 1 129 TYR 129 128 128 TYR TYR B . n 
B 1 130 ALA 130 129 129 ALA ALA B . n 
B 1 131 LEU 131 130 130 LEU LEU B . n 
B 1 132 HIS 132 131 131 HIS HIS B . n 
B 1 133 VAL 133 132 132 VAL VAL B . n 
B 1 134 GLY 134 133 133 GLY GLY B . n 
B 1 135 ILE 135 134 134 ILE ILE B . n 
B 1 136 THR 136 135 135 THR THR B . n 
B 1 137 TRP 137 136 136 TRP TRP B . n 
B 1 138 TRP 138 137 137 TRP TRP B . n 
B 1 139 ALA 139 138 138 ALA ALA B . n 
B 1 140 PRO 140 139 139 PRO PRO B . n 
B 1 141 LYS 141 140 140 LYS LYS B . n 
B 1 142 VAL 142 141 141 VAL VAL B . n 
B 1 143 LYS 143 142 142 LYS LYS B . n 
B 1 144 ALA 144 143 143 ALA ALA B . n 
B 1 145 GLU 145 144 144 GLU GLU B . n 
B 1 146 MET 146 145 145 MET MET B . n 
B 1 147 GLU 147 146 146 GLU GLU B . n 
B 1 148 THR 148 147 147 THR THR B . n 
B 1 149 LEU 149 148 148 LEU LEU B . n 
B 1 150 VAL 150 149 149 VAL VAL B . n 
B 1 151 ARG 151 150 150 ARG ARG B . n 
B 1 152 GLU 152 151 151 GLU GLU B . n 
B 1 153 LYS 153 152 152 LYS LYS B . n 
B 1 154 GLY 154 153 153 GLY GLY B . n 
B 1 155 VAL 155 154 154 VAL VAL B . n 
B 1 156 ASN 156 155 155 ASN ASN B . n 
B 1 157 SER 157 156 156 SER SER B . n 
B 1 158 PHE 158 157 157 PHE PHE B . n 
B 1 159 GLN 159 158 158 GLN GLN B . n 
B 1 160 MET 160 159 159 MET MET B . n 
B 1 161 PHE 161 160 160 PHE PHE B . n 
B 1 162 MET 162 161 161 MET MET B . n 
B 1 163 THR 163 162 162 THR THR B . n 
B 1 164 TYR 164 163 163 TYR TYR B . n 
B 1 165 LYS 165 164 164 LYS LYS B . n 
B 1 166 ASP 166 165 165 ASP ASP B . n 
B 1 167 LEU 167 166 166 LEU LEU B . n 
B 1 168 TYR 168 167 167 TYR TYR B . n 
B 1 169 MET 169 168 168 MET MET B . n 
B 1 170 LEU 170 169 169 LEU LEU B . n 
B 1 171 ARG 171 170 170 ARG ARG B . n 
B 1 172 ASP 172 171 171 ASP ASP B . n 
B 1 173 SER 173 172 172 SER SER B . n 
B 1 174 GLU 174 173 173 GLU GLU B . n 
B 1 175 LEU 175 174 174 LEU LEU B . n 
B 1 176 TYR 176 175 175 TYR TYR B . n 
B 1 177 GLN 177 176 176 GLN GLN B . n 
B 1 178 VAL 178 177 177 VAL VAL B . n 
B 1 179 LEU 179 178 178 LEU LEU B . n 
B 1 180 HIS 180 179 179 HIS HIS B . n 
B 1 181 ALA 181 180 180 ALA ALA B . n 
B 1 182 CYS 182 181 181 CYS CYS B . n 
B 1 183 LYS 183 182 182 LYS LYS B . n 
B 1 184 ASP 184 183 183 ASP ASP B . n 
B 1 185 ILE 185 184 184 ILE ILE B . n 
B 1 186 GLY 186 185 185 GLY GLY B . n 
B 1 187 ALA 187 186 186 ALA ALA B . n 
B 1 188 ILE 188 187 187 ILE ILE B . n 
B 1 189 ALA 189 188 188 ALA ALA B . n 
B 1 190 ARG 190 189 189 ARG ARG B . n 
B 1 191 VAL 191 190 190 VAL VAL B . n 
B 1 192 HIS 192 191 191 HIS HIS B . n 
B 1 193 ALA 193 192 192 ALA ALA B . n 
B 1 194 GLU 194 193 193 GLU GLU B . n 
B 1 195 ASN 195 194 194 ASN ASN B . n 
B 1 196 GLY 196 195 195 GLY GLY B . n 
B 1 197 GLU 197 196 196 GLU GLU B . n 
B 1 198 LEU 198 197 197 LEU LEU B . n 
B 1 199 VAL 199 198 198 VAL VAL B . n 
B 1 200 ALA 200 199 199 ALA ALA B . n 
B 1 201 GLU 201 200 200 GLU GLU B . n 
B 1 202 GLY 202 201 201 GLY GLY B . n 
B 1 203 ALA 203 202 202 ALA ALA B . n 
B 1 204 LYS 204 203 203 LYS LYS B . n 
B 1 205 GLU 205 204 204 GLU GLU B . n 
B 1 206 ALA 206 205 205 ALA ALA B . n 
B 1 207 LEU 207 206 206 LEU LEU B . n 
B 1 208 ASP 208 207 207 ASP ASP B . n 
B 1 209 LEU 209 208 208 LEU LEU B . n 
B 1 210 GLY 210 209 209 GLY GLY B . n 
B 1 211 ILE 211 210 210 ILE ILE B . n 
B 1 212 THR 212 211 211 THR THR B . n 
B 1 213 GLY 213 212 212 GLY GLY B . n 
B 1 214 PRO 214 213 213 PRO PRO B . n 
B 1 215 GLU 215 214 214 GLU GLU B . n 
B 1 216 GLY 216 215 215 GLY GLY B . n 
B 1 217 ILE 217 216 216 ILE ILE B . n 
B 1 218 GLU 218 217 217 GLU GLU B . n 
B 1 219 ILE 219 218 218 ILE ILE B . n 
B 1 220 SER 220 219 219 SER SER B . n 
B 1 221 ARG 221 220 220 ARG ARG B . n 
B 1 222 PRO 222 221 221 PRO PRO B . n 
B 1 223 GLU 223 222 222 GLU GLU B . n 
B 1 224 GLU 224 223 223 GLU GLU B . n 
B 1 225 LEU 225 224 224 LEU LEU B . n 
B 1 226 GLU 226 225 225 GLU GLU B . n 
B 1 227 ALA 227 226 226 ALA ALA B . n 
B 1 228 GLU 228 227 227 GLU GLU B . n 
B 1 229 ALA 229 228 228 ALA ALA B . n 
B 1 230 THR 230 229 229 THR THR B . n 
B 1 231 HIS 231 230 230 HIS HIS B . n 
B 1 232 ARG 232 231 231 ARG ARG B . n 
B 1 233 VAL 233 232 232 VAL VAL B . n 
B 1 234 ILE 234 233 233 ILE ILE B . n 
B 1 235 THR 235 234 234 THR THR B . n 
B 1 236 ILE 236 235 235 ILE ILE B . n 
B 1 237 ALA 237 236 236 ALA ALA B . n 
B 1 238 ASN 238 237 237 ASN ASN B . n 
B 1 239 ARG 239 238 238 ARG ARG B . n 
B 1 240 THR 240 239 239 THR THR B . n 
B 1 241 HIS 241 240 240 HIS HIS B . n 
B 1 242 CYS 242 241 241 CYS CYS B . n 
B 1 243 PRO 243 242 242 PRO PRO B . n 
B 1 244 ILE 244 243 243 ILE ILE B . n 
B 1 245 TYR 245 244 244 TYR TYR B . n 
B 1 246 LEU 246 245 245 LEU LEU B . n 
B 1 247 VAL 247 246 246 VAL VAL B . n 
B 1 248 ASN 248 247 247 ASN ASN B . n 
B 1 249 VAL 249 248 248 VAL VAL B . n 
B 1 250 SER 250 249 249 SER SER B . n 
B 1 251 SER 251 250 250 SER SER B . n 
B 1 252 ILE 252 251 251 ILE ILE B . n 
B 1 253 SER 253 252 252 SER SER B . n 
B 1 254 ALA 254 253 253 ALA ALA B . n 
B 1 255 GLY 255 254 254 GLY GLY B . n 
B 1 256 ASP 256 255 255 ASP ASP B . n 
B 1 257 VAL 257 256 256 VAL VAL B . n 
B 1 258 ILE 258 257 257 ILE ILE B . n 
B 1 259 ALA 259 258 258 ALA ALA B . n 
B 1 260 ALA 260 259 259 ALA ALA B . n 
B 1 261 ALA 261 260 260 ALA ALA B . n 
B 1 262 LYS 262 261 261 LYS LYS B . n 
B 1 263 MET 263 262 262 MET MET B . n 
B 1 264 GLN 264 263 263 GLN GLN B . n 
B 1 265 GLY 265 264 264 GLY GLY B . n 
B 1 266 LYS 266 265 265 LYS LYS B . n 
B 1 267 VAL 267 266 266 VAL VAL B . n 
B 1 268 VAL 268 267 267 VAL VAL B . n 
B 1 269 LEU 269 268 268 LEU LEU B . n 
B 1 270 ALA 270 269 269 ALA ALA B . n 
B 1 271 GLU 271 270 270 GLU GLU B . n 
B 1 272 THR 272 271 271 THR THR B . n 
B 1 273 THR 273 272 272 THR THR B . n 
B 1 274 THR 274 273 273 THR THR B . n 
B 1 275 ALA 275 274 274 ALA ALA B . n 
B 1 276 HIS 276 275 275 HIS HIS B . n 
B 1 277 ALA 277 276 276 ALA ALA B . n 
B 1 278 THR 278 277 277 THR THR B . n 
B 1 279 LEU 279 278 278 LEU LEU B . n 
B 1 280 THR 280 279 279 THR THR B . n 
B 1 281 GLY 281 280 280 GLY GLY B . n 
B 1 282 LEU 282 281 281 LEU LEU B . n 
B 1 283 HIS 283 282 282 HIS HIS B . n 
B 1 284 TYR 284 283 283 TYR TYR B . n 
B 1 285 TYR 285 284 284 TYR TYR B . n 
B 1 286 HIS 286 285 285 HIS HIS B . n 
B 1 287 GLN 287 286 286 GLN GLN B . n 
B 1 288 ASP 288 287 287 ASP ASP B . n 
B 1 289 TRP 289 288 288 TRP TRP B . n 
B 1 290 SER 290 289 289 SER SER B . n 
B 1 291 HIS 291 290 290 HIS HIS B . n 
B 1 292 ALA 292 291 291 ALA ALA B . n 
B 1 293 ALA 293 292 292 ALA ALA B . n 
B 1 294 ALA 294 293 293 ALA ALA B . n 
B 1 295 TYR 295 294 294 TYR TYR B . n 
B 1 296 VAL 296 295 295 VAL VAL B . n 
B 1 297 THR 297 296 296 THR THR B . n 
B 1 298 VAL 298 297 297 VAL VAL B . n 
B 1 299 PRO 299 298 298 PRO PRO B . n 
B 1 300 PRO 300 299 299 PRO PRO B . n 
B 1 301 LEU 301 300 300 LEU LEU B . n 
B 1 302 ARG 302 301 301 ARG ARG B . n 
B 1 303 LEU 303 302 302 LEU LEU B . n 
B 1 304 ASP 304 303 303 ASP ASP B . n 
B 1 305 THR 305 304 304 THR THR B . n 
B 1 306 ASN 306 305 305 ASN ASN B . n 
B 1 307 THR 307 306 306 THR THR B . n 
B 1 308 SER 308 307 307 SER SER B . n 
B 1 309 THR 309 308 308 THR THR B . n 
B 1 310 TYR 310 309 309 TYR TYR B . n 
B 1 311 LEU 311 310 310 LEU LEU B . n 
B 1 312 MET 312 311 311 MET MET B . n 
B 1 313 SER 313 312 312 SER SER B . n 
B 1 314 LEU 314 313 313 LEU LEU B . n 
B 1 315 LEU 315 314 314 LEU LEU B . n 
B 1 316 ALA 316 315 315 ALA ALA B . n 
B 1 317 ASN 317 316 316 ASN ASN B . n 
B 1 318 ASP 318 317 317 ASP ASP B . n 
B 1 319 THR 319 318 318 THR THR B . n 
B 1 320 LEU 320 319 319 LEU LEU B . n 
B 1 321 ASN 321 320 320 ASN ASN B . n 
B 1 322 ILE 322 321 321 ILE ILE B . n 
B 1 323 VAL 323 322 322 VAL VAL B . n 
B 1 324 ALA 324 323 323 ALA ALA B . n 
B 1 325 SER 325 324 324 SER SER B . n 
B 1 326 ASP 326 325 325 ASP ASP B . n 
B 1 327 HIS 327 326 326 HIS HIS B . n 
B 1 328 ARG 328 327 327 ARG ARG B . n 
B 1 329 PRO 329 328 328 PRO PRO B . n 
B 1 330 PHE 330 329 329 PHE PHE B . n 
B 1 331 THR 331 330 330 THR THR B . n 
B 1 332 THR 332 331 331 THR THR B . n 
B 1 333 LYS 333 332 332 LYS LYS B . n 
B 1 334 GLN 334 333 333 GLN GLN B . n 
B 1 335 LYS 335 334 334 LYS LYS B . n 
B 1 336 ALA 336 335 335 ALA ALA B . n 
B 1 337 MET 337 336 336 MET MET B . n 
B 1 338 GLY 338 337 337 GLY GLY B . n 
B 1 339 LYS 339 338 338 LYS LYS B . n 
B 1 340 GLU 340 339 339 GLU GLU B . n 
B 1 341 ASP 341 340 340 ASP ASP B . n 
B 1 342 PHE 342 341 341 PHE PHE B . n 
B 1 343 THR 343 342 342 THR THR B . n 
B 1 344 LYS 344 343 343 LYS LYS B . n 
B 1 345 ILE 345 344 344 ILE ILE B . n 
B 1 346 PRO 346 345 345 PRO PRO B . n 
B 1 347 HIS 347 346 346 HIS HIS B . n 
B 1 348 GLY 348 347 347 GLY GLY B . n 
B 1 349 VAL 349 348 348 VAL VAL B . n 
B 1 350 SER 350 349 349 SER SER B . n 
B 1 351 GLY 351 350 350 GLY GLY B . n 
B 1 352 VAL 352 351 351 VAL VAL B . n 
B 1 353 GLN 353 352 352 GLN GLN B . n 
B 1 354 ASP 354 353 353 ASP ASP B . n 
B 1 355 ARG 355 354 354 ARG ARG B . n 
B 1 356 MET 356 355 355 MET MET B . n 
B 1 357 SER 357 356 356 SER SER B . n 
B 1 358 VAL 358 357 357 VAL VAL B . n 
B 1 359 ILE 359 358 358 ILE ILE B . n 
B 1 360 TRP 360 359 359 TRP TRP B . n 
B 1 361 GLU 361 360 360 GLU GLU B . n 
B 1 362 ARG 362 361 361 ARG ARG B . n 
B 1 363 GLY 363 362 362 GLY GLY B . n 
B 1 364 VAL 364 363 363 VAL VAL B . n 
B 1 365 VAL 365 364 364 VAL VAL B . n 
B 1 366 GLY 366 365 365 GLY GLY B . n 
B 1 367 GLY 367 366 366 GLY GLY B . n 
B 1 368 LYS 368 367 367 LYS LYS B . n 
B 1 369 MET 369 368 368 MET MET B . n 
B 1 370 ASP 370 369 369 ASP ASP B . n 
B 1 371 GLU 371 370 370 GLU GLU B . n 
B 1 372 ASN 372 371 371 ASN ASN B . n 
B 1 373 ARG 373 372 372 ARG ARG B . n 
B 1 374 PHE 374 373 373 PHE PHE B . n 
B 1 375 VAL 375 374 374 VAL VAL B . n 
B 1 376 ALA 376 375 375 ALA ALA B . n 
B 1 377 VAL 377 376 376 VAL VAL B . n 
B 1 378 THR 378 377 377 THR THR B . n 
B 1 379 SER 379 378 378 SER SER B . n 
B 1 380 SER 380 379 379 SER SER B . n 
B 1 381 ASN 381 380 380 ASN ASN B . n 
B 1 382 ALA 382 381 381 ALA ALA B . n 
B 1 383 ALA 383 382 382 ALA ALA B . n 
B 1 384 LYS 384 383 383 LYS LYS B . n 
B 1 385 LEU 385 384 384 LEU LEU B . n 
B 1 386 LEU 386 385 385 LEU LEU B . n 
B 1 387 ASN 387 386 386 ASN ASN B . n 
B 1 388 LEU 388 387 387 LEU LEU B . n 
B 1 389 TYR 389 388 388 TYR TYR B . n 
B 1 390 PRO 390 389 389 PRO PRO B . n 
B 1 391 ARG 391 390 390 ARG ARG B . n 
B 1 392 LYS 392 391 391 LYS LYS B . n 
B 1 393 GLY 393 392 392 GLY GLY B . n 
B 1 394 ARG 394 393 393 ARG ARG B . n 
B 1 395 ILE 395 394 394 ILE ILE B . n 
B 1 396 ILE 396 395 395 ILE ILE B . n 
B 1 397 PRO 397 396 396 PRO PRO B . n 
B 1 398 GLY 398 397 397 GLY GLY B . n 
B 1 399 ALA 399 398 398 ALA ALA B . n 
B 1 400 ASP 400 399 399 ASP ASP B . n 
B 1 401 ALA 401 400 400 ALA ALA B . n 
B 1 402 ASP 402 401 401 ASP ASP B . n 
B 1 403 VAL 403 402 402 VAL VAL B . n 
B 1 404 VAL 404 403 403 VAL VAL B . n 
B 1 405 VAL 405 404 404 VAL VAL B . n 
B 1 406 TRP 406 405 405 TRP TRP B . n 
B 1 407 ASP 407 406 406 ASP ASP B . n 
B 1 408 PRO 408 407 407 PRO PRO B . n 
B 1 409 GLU 409 408 408 GLU GLU B . n 
B 1 410 ALA 410 409 409 ALA ALA B . n 
B 1 411 THR 411 410 410 THR THR B . n 
B 1 412 LYS 412 411 411 LYS LYS B . n 
B 1 413 THR 413 412 412 THR THR B . n 
B 1 414 ILE 414 413 413 ILE ILE B . n 
B 1 415 SER 415 414 414 SER SER B . n 
B 1 416 ALA 416 415 415 ALA ALA B . n 
B 1 417 SER 417 416 416 SER SER B . n 
B 1 418 THR 418 417 417 THR THR B . n 
B 1 419 GLN 419 418 418 GLN GLN B . n 
B 1 420 VAL 420 419 419 VAL VAL B . n 
B 1 421 GLN 421 420 420 GLN GLN B . n 
B 1 422 GLY 422 421 421 GLY GLY B . n 
B 1 423 GLY 423 422 422 GLY GLY B . n 
B 1 424 ASP 424 423 423 ASP ASP B . n 
B 1 425 PHE 425 424 424 PHE PHE B . n 
B 1 426 ASN 426 425 425 ASN ASN B . n 
B 1 427 LEU 427 426 426 LEU LEU B . n 
B 1 428 TYR 428 427 427 TYR TYR B . n 
B 1 429 GLU 429 428 428 GLU GLU B . n 
B 1 430 ASN 430 429 429 ASN ASN B . n 
B 1 431 MET 431 430 430 MET MET B . n 
B 1 432 ARG 432 431 431 ARG ARG B . n 
B 1 433 CYS 433 432 432 CYS CYS B . n 
B 1 434 HIS 434 433 433 HIS HIS B . n 
B 1 435 GLY 435 434 434 GLY GLY B . n 
B 1 436 VAL 436 435 435 VAL VAL B . n 
B 1 437 PRO 437 436 436 PRO PRO B . n 
B 1 438 LEU 438 437 437 LEU LEU B . n 
B 1 439 VAL 439 438 438 VAL VAL B . n 
B 1 440 THR 440 439 439 THR THR B . n 
B 1 441 ILE 441 440 440 ILE ILE B . n 
B 1 442 SER 442 441 441 SER SER B . n 
B 1 443 ARG 443 442 442 ARG ARG B . n 
B 1 444 GLY 444 443 443 GLY GLY B . n 
B 1 445 ARG 445 444 444 ARG ARG B . n 
B 1 446 VAL 446 445 445 VAL VAL B . n 
B 1 447 VAL 447 446 446 VAL VAL B . n 
B 1 448 TYR 448 447 447 TYR TYR B . n 
B 1 449 GLU 449 448 448 GLU GLU B . n 
B 1 450 ASN 450 449 449 ASN ASN B . n 
B 1 451 GLY 451 450 450 GLY GLY B . n 
B 1 452 VAL 452 451 451 VAL VAL B . n 
B 1 453 PHE 453 452 452 PHE PHE B . n 
B 1 454 MET 454 453 453 MET MET B . n 
B 1 455 CYS 455 454 454 CYS CYS B . n 
B 1 456 ALA 456 455 455 ALA ALA B . n 
B 1 457 GLU 457 456 456 GLU GLU B . n 
B 1 458 GLY 458 457 457 GLY GLY B . n 
B 1 459 THR 459 458 458 THR THR B . n 
B 1 460 GLY 460 459 459 GLY GLY B . n 
B 1 461 LYS 461 460 460 LYS LYS B . n 
B 1 462 PHE 462 461 461 PHE PHE B . n 
B 1 463 CYS 463 462 462 CYS CYS B . n 
B 1 464 PRO 464 463 463 PRO PRO B . n 
B 1 465 LEU 465 464 464 LEU LEU B . n 
B 1 466 ARG 466 465 465 ARG ARG B . n 
B 1 467 SER 467 466 466 SER SER B . n 
B 1 468 PHE 468 467 467 PHE PHE B . n 
B 1 469 PRO 469 468 468 PRO PRO B . n 
B 1 470 ASP 470 469 469 ASP ASP B . n 
B 1 471 THR 471 470 470 THR THR B . n 
B 1 472 VAL 472 471 471 VAL VAL B . n 
B 1 473 TYR 473 472 472 TYR TYR B . n 
B 1 474 LYS 474 473 473 LYS LYS B . n 
B 1 475 LYS 475 474 474 LYS LYS B . n 
B 1 476 LEU 476 475 475 LEU LEU B . n 
B 1 477 VAL 477 476 476 VAL VAL B . n 
B 1 478 GLN 478 477 477 GLN GLN B . n 
B 1 479 ARG 479 478 478 ARG ARG B . n 
B 1 480 GLU 480 479 479 GLU GLU B . n 
B 1 481 LYS 481 480 480 LYS LYS B . n 
B 1 482 THR 482 481 481 THR THR B . n 
B 1 483 LEU 483 482 482 LEU LEU B . n 
B 1 484 LYS 484 483 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1 1483 1483 ZN  ZN  A . 
D 2 ZN  1 1484 1484 ZN  ZN  A . 
E 2 ZN  1 1483 1483 ZN  ZN  B . 
F 2 ZN  1 1484 1484 ZN  ZN  B . 
G 3 HOH 1 2001 2001 HOH HOH A . 
G 3 HOH 2 2002 2002 HOH HOH A . 
H 3 HOH 1 2001 2001 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,C,D,G 
1 3,4 B,E,F,H 
2 1,5 B,E,F,H 
2 6,7 A,C,D,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9500   ? 
1 MORE         -274.8 ? 
1 'SSA (A^2)'  61200  ? 
2 'ABSA (A^2)' 9500   ? 
2 MORE         -274.8 ? 
2 'SSA (A^2)'  61200  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z               1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2        0.0000000000  -1.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 123.2300000000 
3 'crystal symmetry operation' 5_545 -x+1/2,y-1/2,-z+1/4 -1.0000000000 0.0000000000  0.0000000000 44.7500000000 0.0000000000  
1.0000000000 0.0000000000 -44.7500000000 0.0000000000 0.0000000000 -1.0000000000 61.6150000000  
4 'crystal symmetry operation' 3_545 -y+1/2,x-1/2,z+1/4  0.0000000000  -1.0000000000 0.0000000000 44.7500000000 1.0000000000  
0.0000000000 0.0000000000 -44.7500000000 0.0000000000 0.0000000000 1.0000000000  61.6150000000  
5 'crystal symmetry operation' 7_555 y,x,-z              0.0000000000  1.0000000000  0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 0.0000000000   
6 'crystal symmetry operation' 4_554 y+1/2,-x+1/2,z-1/4  0.0000000000  1.0000000000  0.0000000000 44.7500000000 -1.0000000000 
0.0000000000 0.0000000000 44.7500000000  0.0000000000 0.0000000000 1.0000000000  -61.6150000000 
7 'crystal symmetry operation' 5_555 -x+1/2,y+1/2,-z+1/4 -1.0000000000 0.0000000000  0.0000000000 44.7500000000 0.0000000000  
1.0000000000 0.0000000000 44.7500000000  0.0000000000 0.0000000000 -1.0000000000 61.6150000000  
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 180 ? A HIS 179 ? 1_555 ZN ? C ZN . ? A ZN 1483 ? 1_555 OD2 ? A ASP 184 ? A ASP 183  ? 1_555 92.8  ? 
2 NE2 ? A HIS 180 ? A HIS 179 ? 1_555 ZN ? C ZN . ? A ZN 1483 ? 1_555 O   ? G HOH .   ? A HOH 2001 ? 1_555 107.1 ? 
3 OD2 ? A ASP 184 ? A ASP 183 ? 1_555 ZN ? C ZN . ? A ZN 1483 ? 1_555 O   ? G HOH .   ? A HOH 2001 ? 1_555 127.1 ? 
4 NE2 ? A HIS 291 ? A HIS 290 ? 1_555 ZN ? D ZN . ? A ZN 1484 ? 1_555 ND1 ? A HIS 283 ? A HIS 282  ? 1_555 101.5 ? 
5 NE2 ? B HIS 180 ? B HIS 179 ? 1_555 ZN ? E ZN . ? B ZN 1483 ? 1_555 OD2 ? B ASP 184 ? B ASP 183  ? 1_555 105.0 ? 
6 ND1 ? B HIS 283 ? B HIS 282 ? 1_555 ZN ? F ZN . ? B ZN 1484 ? 1_555 NE2 ? B HIS 291 ? B HIS 290  ? 1_555 104.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-02-13 
2 'Structure model' 1 1 2013-06-19 
3 'Structure model' 1 2 2013-09-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Derived calculations' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.7.0029 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              317 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              317 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              317 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                125.49 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            7.19 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 70  ? ? 56.67   16.60   
2  1 LEU A 166 ? ? -122.33 -66.72  
3  1 ASP A 317 ? ? 87.37   10.04   
4  1 ARG A 327 ? ? -160.21 68.75   
5  1 MET A 336 ? ? -59.82  -8.30   
6  1 SER A 378 ? ? -139.26 -47.22  
7  1 ASN A 386 ? ? 71.84   39.33   
8  1 ASN A 429 ? ? 73.33   -5.46   
9  1 HIS B 70  ? ? 56.79   18.82   
10 1 THR B 162 ? ? -126.62 -166.39 
11 1 LEU B 166 ? ? -127.82 -59.79  
12 1 ASP B 317 ? ? 88.41   13.24   
13 1 ARG B 327 ? ? -160.13 68.66   
14 1 SER B 378 ? ? -137.09 -46.45  
15 1 ASN B 386 ? ? 75.81   39.06   
16 1 ASN B 429 ? ? 74.72   -3.59   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1   
2  1 Y 1 A MET 1   ? A MET 2   
3  1 Y 1 A LEU 2   ? A LEU 3   
4  1 Y 1 A ALA 3   ? A ALA 4   
5  1 Y 1 A ASN 4   ? A ASN 5   
6  1 Y 1 A SER 5   ? A SER 6   
7  1 Y 1 A ALA 6   ? A ALA 7   
8  1 Y 1 A LYS 483 ? A LYS 484 
9  1 Y 1 B SER 0   ? B SER 1   
10 1 Y 1 B MET 1   ? B MET 2   
11 1 Y 1 B LEU 2   ? B LEU 3   
12 1 Y 1 B ALA 3   ? B ALA 4   
13 1 Y 1 B ASN 4   ? B ASN 5   
14 1 Y 1 B SER 5   ? B SER 6   
15 1 Y 1 B ALA 6   ? B ALA 7   
16 1 Y 1 B SER 7   ? B SER 8   
17 1 Y 1 B LYS 483 ? B LYS 484 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
#