data_4B9V
# 
_entry.id   4B9V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4B9V         
PDBE  EBI-54000    
WWPDB D_1290054000 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2XO7 unspecified 
;CRYSTAL STRUCTURE OF A DA:O-ALLYLHYDROXYLAMINE-DC BASEPAIR IN COMPLEX WITH FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS
;
PDB 2XY5 unspecified 
'CRYSTAL STRUCTURE OF AN ARTIFICIAL SALEN-COPPER BASEPAIR IN COMPLEX WITH FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS' 
PDB 2XY6 unspecified 
'CRYSTAL STRUCTURE OF A SALICYLIC ALDEHYDE BASEPAIR IN COMPLEX WITH FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS' 
PDB 2XY7 unspecified 
;CRYSTAL STRUCTURE OF A SALICYLIC ALDEHYDE BASE IN THE PRE-INSERTION SITE OF FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS
;
PDB 2Y1I unspecified 
;CRYSTAL STRUCTURE OF A S-DIASTEREOMER ANALOGUE OF THE SPORE PHOTOPRODUCT IN COMPLEX WITH FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS
;
PDB 2Y1J unspecified 
;CRYSTAL STRUCTURE OF A R-DIASTEREOMER ANALOGUE OF THE SPORE PHOTOPRODUCT IN COMPLEX WITH FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS
;
PDB 4B9L unspecified 
'STRUCTURE OF THE HIGH FIDELITY DNA POLYMERASE I WITH THE OXIDATIVE FORMAMIDOPYRIMIDINE-DA DNA LESION IN THE PRE-INSERTION SITE.' 
PDB 4B9M unspecified 
;STRUCTURE OF THE HIGH FIDELITY DNA POLYMERASE I WITH AN OXIDATIVE FORMAMIDOPYRIMIDINE-DA DNA LESION -THYMINE BASEPAIR IN THE POST-INSERTION SITE.
;
PDB 4B9N unspecified 
'STRUCTURE OF THE HIGH FIDELITY DNA POLYMERASE I CORRECTLY BYPASSING THE OXIDATIVE FORMAMIDOPYRIMIDINE-DA DNA LESION.' 
PDB 4B9S unspecified 
;STRUCTURE OF THE HIGH FIDELITY DNA POLYMERASE I WITH AN OXIDATIVE FORMAMIDOPYRIMIDINE-DG DNA LESION OUTSIDE OF THE PRE-INSERTION SITE.
;
PDB 4B9T unspecified 
;STRUCTURE OF THE HIGH FIDELITY DNA POLYMERASE I WITH AN OXIDATIVE FORMAMIDOPYRIMIDINE-DG DNA LESION -DC BASEPAIR IN THE POST-INSERTION SITE.
;
PDB 4B9U unspecified 
;STRUCTURE OF THE HIGH FIDELITY DNA POLYMERASE I WITH AN OXIDATIVE FORMAMIDOPYRIMIDINE-DG DNA LESION -DA BASEPAIR IN THE POST-INSERTION SITE.
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4B9V 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-09-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gehrke, T.H.'  1 
'Lischke, U.'   2 
'Arnold, S.'    3 
'Schneider, S.' 4 
'Carell, T.'    5 
# 
_citation.id                        primary 
_citation.title                     'Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            9 
_citation.page_first                455 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23685671 
_citation.pdbx_database_id_DOI      10.1038/NCHEMBIO.1254 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gehrke, T.H.'     1 
primary 'Lischke, U.'      2 
primary 'Gasteiger, K.L.'  3 
primary 'Schneider, S.'    4 
primary 'Arnold, S.'       5 
primary 'Muller, H.C.'     6 
primary 'Stephenson, D.S.' 7 
primary 'Zipse, H.'        8 
primary 'Carell, T.'       9 
# 
_cell.entry_id           4B9V 
_cell.length_a           87.901 
_cell.length_b           94.035 
_cell.length_c           105.341 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4B9V 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE'                                           70446.594 1   2.7.7.7 ? ? ? 
2 polymer     syn "5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*TP*AP*AP)-3'"               3293.174  1   ?       ? ? 
'OXIDATIVE DNA LESION FAPYG AT C4' 
3 polymer     syn "5'-D(*CP*AP*TP*FOXP*AP*GP*AP*GP*TP*CP*AP*GP*GP*CP*TP)-3'" 4650.065  1   ?       ? ? 
'OXIDATIVE DNA LESION FAPYG AT C4' 
4 non-polymer syn 'SULFATE ION'                                              96.063    6   ?       ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                            24.305    1   ?       ? ? ? 
6 water       nat water                                                      18.015    175 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DNA POLYMERASE I' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MASWSHPQFEKGASTSLYKKAGSAAAVLEENLYFQGSFTAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAV
VNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMK
QYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDT
KRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHY
RQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQI
ELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIE
RYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKE
ERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
;
;MASWSHPQFEKGASTSLYKKAGSAAAVLEENLYFQGSFTAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAV
VNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMK
QYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDT
KRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHY
RQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQI
ELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIE
RYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKE
ERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
;
A ? 
2 polydeoxyribonucleotide no no  '(DC)(DC)(DT)(DG)(DA)(DC)(DT)(DC)(DT)(DA)(DA)' CCTGACTCTAA B ? 
3 polydeoxyribonucleotide no yes '(DC)(DA)(DT)(FOX)(DA)(DG)(DA)(DG)(DT)(DC)(DA)(DG)(DG)(DC)(DT)' CATGAGAGTCAGGCT C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   TRP n 
1 5   SER n 
1 6   HIS n 
1 7   PRO n 
1 8   GLN n 
1 9   PHE n 
1 10  GLU n 
1 11  LYS n 
1 12  GLY n 
1 13  ALA n 
1 14  SER n 
1 15  THR n 
1 16  SER n 
1 17  LEU n 
1 18  TYR n 
1 19  LYS n 
1 20  LYS n 
1 21  ALA n 
1 22  GLY n 
1 23  SER n 
1 24  ALA n 
1 25  ALA n 
1 26  ALA n 
1 27  VAL n 
1 28  LEU n 
1 29  GLU n 
1 30  GLU n 
1 31  ASN n 
1 32  LEU n 
1 33  TYR n 
1 34  PHE n 
1 35  GLN n 
1 36  GLY n 
1 37  SER n 
1 38  PHE n 
1 39  THR n 
1 40  ALA n 
1 41  LYS n 
1 42  MET n 
1 43  ALA n 
1 44  PHE n 
1 45  THR n 
1 46  LEU n 
1 47  ALA n 
1 48  ASP n 
1 49  ARG n 
1 50  VAL n 
1 51  THR n 
1 52  GLU n 
1 53  GLU n 
1 54  MET n 
1 55  LEU n 
1 56  ALA n 
1 57  ASP n 
1 58  LYS n 
1 59  ALA n 
1 60  ALA n 
1 61  LEU n 
1 62  VAL n 
1 63  VAL n 
1 64  GLU n 
1 65  VAL n 
1 66  VAL n 
1 67  GLU n 
1 68  GLU n 
1 69  ASN n 
1 70  TYR n 
1 71  HIS n 
1 72  ASP n 
1 73  ALA n 
1 74  PRO n 
1 75  ILE n 
1 76  VAL n 
1 77  GLY n 
1 78  ILE n 
1 79  ALA n 
1 80  VAL n 
1 81  VAL n 
1 82  ASN n 
1 83  GLU n 
1 84  HIS n 
1 85  GLY n 
1 86  ARG n 
1 87  PHE n 
1 88  PHE n 
1 89  LEU n 
1 90  ARG n 
1 91  PRO n 
1 92  GLU n 
1 93  THR n 
1 94  ALA n 
1 95  LEU n 
1 96  ALA n 
1 97  ASP n 
1 98  PRO n 
1 99  GLN n 
1 100 PHE n 
1 101 VAL n 
1 102 ALA n 
1 103 TRP n 
1 104 LEU n 
1 105 GLY n 
1 106 ASP n 
1 107 GLU n 
1 108 THR n 
1 109 LYS n 
1 110 LYS n 
1 111 LYS n 
1 112 SER n 
1 113 MET n 
1 114 PHE n 
1 115 ASP n 
1 116 SER n 
1 117 LYS n 
1 118 ARG n 
1 119 ALA n 
1 120 ALA n 
1 121 VAL n 
1 122 ALA n 
1 123 LEU n 
1 124 LYS n 
1 125 TRP n 
1 126 LYS n 
1 127 GLY n 
1 128 ILE n 
1 129 GLU n 
1 130 LEU n 
1 131 CYS n 
1 132 GLY n 
1 133 VAL n 
1 134 SER n 
1 135 PHE n 
1 136 ASP n 
1 137 LEU n 
1 138 LEU n 
1 139 LEU n 
1 140 ALA n 
1 141 ALA n 
1 142 TYR n 
1 143 LEU n 
1 144 LEU n 
1 145 ASP n 
1 146 PRO n 
1 147 ALA n 
1 148 GLN n 
1 149 GLY n 
1 150 VAL n 
1 151 ASP n 
1 152 ASP n 
1 153 VAL n 
1 154 ALA n 
1 155 ALA n 
1 156 ALA n 
1 157 ALA n 
1 158 LYS n 
1 159 MET n 
1 160 LYS n 
1 161 GLN n 
1 162 TYR n 
1 163 GLU n 
1 164 ALA n 
1 165 VAL n 
1 166 ARG n 
1 167 PRO n 
1 168 ASP n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 TYR n 
1 173 GLY n 
1 174 LYS n 
1 175 GLY n 
1 176 ALA n 
1 177 LYS n 
1 178 ARG n 
1 179 ALA n 
1 180 VAL n 
1 181 PRO n 
1 182 ASP n 
1 183 GLU n 
1 184 PRO n 
1 185 VAL n 
1 186 LEU n 
1 187 ALA n 
1 188 GLU n 
1 189 HIS n 
1 190 LEU n 
1 191 VAL n 
1 192 ARG n 
1 193 LYS n 
1 194 ALA n 
1 195 ALA n 
1 196 ALA n 
1 197 ILE n 
1 198 TRP n 
1 199 ALA n 
1 200 LEU n 
1 201 GLU n 
1 202 ARG n 
1 203 PRO n 
1 204 PHE n 
1 205 LEU n 
1 206 ASP n 
1 207 GLU n 
1 208 LEU n 
1 209 ARG n 
1 210 ARG n 
1 211 ASN n 
1 212 GLU n 
1 213 GLN n 
1 214 ASP n 
1 215 ARG n 
1 216 LEU n 
1 217 LEU n 
1 218 VAL n 
1 219 GLU n 
1 220 LEU n 
1 221 GLU n 
1 222 GLN n 
1 223 PRO n 
1 224 LEU n 
1 225 SER n 
1 226 SER n 
1 227 ILE n 
1 228 LEU n 
1 229 ALA n 
1 230 GLU n 
1 231 MET n 
1 232 GLU n 
1 233 PHE n 
1 234 ALA n 
1 235 GLY n 
1 236 VAL n 
1 237 LYS n 
1 238 VAL n 
1 239 ASP n 
1 240 THR n 
1 241 LYS n 
1 242 ARG n 
1 243 LEU n 
1 244 GLU n 
1 245 GLN n 
1 246 MET n 
1 247 GLY n 
1 248 GLU n 
1 249 GLU n 
1 250 LEU n 
1 251 ALA n 
1 252 GLU n 
1 253 GLN n 
1 254 LEU n 
1 255 ARG n 
1 256 THR n 
1 257 VAL n 
1 258 GLU n 
1 259 GLN n 
1 260 ARG n 
1 261 ILE n 
1 262 TYR n 
1 263 GLU n 
1 264 LEU n 
1 265 ALA n 
1 266 GLY n 
1 267 GLN n 
1 268 GLU n 
1 269 PHE n 
1 270 ASN n 
1 271 ILE n 
1 272 ASN n 
1 273 SER n 
1 274 PRO n 
1 275 LYS n 
1 276 GLN n 
1 277 LEU n 
1 278 GLY n 
1 279 VAL n 
1 280 ILE n 
1 281 LEU n 
1 282 PHE n 
1 283 GLU n 
1 284 LYS n 
1 285 LEU n 
1 286 GLN n 
1 287 LEU n 
1 288 PRO n 
1 289 VAL n 
1 290 LEU n 
1 291 LYS n 
1 292 LYS n 
1 293 SER n 
1 294 LYS n 
1 295 THR n 
1 296 GLY n 
1 297 TYR n 
1 298 SER n 
1 299 THR n 
1 300 SER n 
1 301 ALA n 
1 302 ASP n 
1 303 VAL n 
1 304 LEU n 
1 305 GLU n 
1 306 LYS n 
1 307 LEU n 
1 308 ALA n 
1 309 PRO n 
1 310 TYR n 
1 311 HIS n 
1 312 GLU n 
1 313 ILE n 
1 314 VAL n 
1 315 GLU n 
1 316 ASN n 
1 317 ILE n 
1 318 LEU n 
1 319 HIS n 
1 320 TYR n 
1 321 ARG n 
1 322 GLN n 
1 323 LEU n 
1 324 GLY n 
1 325 LYS n 
1 326 LEU n 
1 327 GLN n 
1 328 SER n 
1 329 THR n 
1 330 TYR n 
1 331 ILE n 
1 332 GLU n 
1 333 GLY n 
1 334 LEU n 
1 335 LEU n 
1 336 LYS n 
1 337 VAL n 
1 338 VAL n 
1 339 ARG n 
1 340 PRO n 
1 341 ASP n 
1 342 THR n 
1 343 LYS n 
1 344 LYS n 
1 345 VAL n 
1 346 HIS n 
1 347 THR n 
1 348 ILE n 
1 349 PHE n 
1 350 ASN n 
1 351 GLN n 
1 352 ALA n 
1 353 LEU n 
1 354 THR n 
1 355 GLN n 
1 356 THR n 
1 357 GLY n 
1 358 ARG n 
1 359 LEU n 
1 360 SER n 
1 361 SER n 
1 362 THR n 
1 363 GLU n 
1 364 PRO n 
1 365 ASN n 
1 366 LEU n 
1 367 GLN n 
1 368 ASN n 
1 369 ILE n 
1 370 PRO n 
1 371 ILE n 
1 372 ARG n 
1 373 LEU n 
1 374 GLU n 
1 375 GLU n 
1 376 GLY n 
1 377 ARG n 
1 378 LYS n 
1 379 ILE n 
1 380 ARG n 
1 381 GLN n 
1 382 ALA n 
1 383 PHE n 
1 384 VAL n 
1 385 PRO n 
1 386 SER n 
1 387 GLU n 
1 388 SER n 
1 389 ASP n 
1 390 TRP n 
1 391 LEU n 
1 392 ILE n 
1 393 PHE n 
1 394 ALA n 
1 395 ALA n 
1 396 ASP n 
1 397 TYR n 
1 398 SER n 
1 399 GLN n 
1 400 ILE n 
1 401 GLU n 
1 402 LEU n 
1 403 ARG n 
1 404 VAL n 
1 405 LEU n 
1 406 ALA n 
1 407 HIS n 
1 408 ILE n 
1 409 ALA n 
1 410 GLU n 
1 411 ASP n 
1 412 ASP n 
1 413 ASN n 
1 414 LEU n 
1 415 MET n 
1 416 GLU n 
1 417 ALA n 
1 418 PHE n 
1 419 ARG n 
1 420 ARG n 
1 421 ASP n 
1 422 LEU n 
1 423 ASP n 
1 424 ILE n 
1 425 HIS n 
1 426 THR n 
1 427 LYS n 
1 428 THR n 
1 429 ALA n 
1 430 MET n 
1 431 ASP n 
1 432 ILE n 
1 433 PHE n 
1 434 GLN n 
1 435 VAL n 
1 436 SER n 
1 437 GLU n 
1 438 ASP n 
1 439 GLU n 
1 440 VAL n 
1 441 THR n 
1 442 PRO n 
1 443 ASN n 
1 444 MET n 
1 445 ARG n 
1 446 ARG n 
1 447 GLN n 
1 448 ALA n 
1 449 LYS n 
1 450 ALA n 
1 451 VAL n 
1 452 ASN n 
1 453 PHE n 
1 454 GLY n 
1 455 ILE n 
1 456 VAL n 
1 457 TYR n 
1 458 GLY n 
1 459 ILE n 
1 460 SER n 
1 461 ASP n 
1 462 TYR n 
1 463 GLY n 
1 464 LEU n 
1 465 ALA n 
1 466 GLN n 
1 467 ASN n 
1 468 LEU n 
1 469 ASN n 
1 470 ILE n 
1 471 SER n 
1 472 ARG n 
1 473 LYS n 
1 474 GLU n 
1 475 ALA n 
1 476 ALA n 
1 477 GLU n 
1 478 PHE n 
1 479 ILE n 
1 480 GLU n 
1 481 ARG n 
1 482 TYR n 
1 483 PHE n 
1 484 GLU n 
1 485 SER n 
1 486 PHE n 
1 487 PRO n 
1 488 GLY n 
1 489 VAL n 
1 490 LYS n 
1 491 ARG n 
1 492 TYR n 
1 493 MET n 
1 494 GLU n 
1 495 ASN n 
1 496 ILE n 
1 497 VAL n 
1 498 GLN n 
1 499 GLU n 
1 500 ALA n 
1 501 LYS n 
1 502 GLN n 
1 503 LYS n 
1 504 GLY n 
1 505 TYR n 
1 506 VAL n 
1 507 THR n 
1 508 THR n 
1 509 LEU n 
1 510 LEU n 
1 511 HIS n 
1 512 ARG n 
1 513 ARG n 
1 514 ARG n 
1 515 TYR n 
1 516 LEU n 
1 517 PRO n 
1 518 ASP n 
1 519 ILE n 
1 520 THR n 
1 521 SER n 
1 522 ARG n 
1 523 ASN n 
1 524 PHE n 
1 525 ASN n 
1 526 VAL n 
1 527 ARG n 
1 528 SER n 
1 529 PHE n 
1 530 ALA n 
1 531 GLU n 
1 532 ARG n 
1 533 MET n 
1 534 ALA n 
1 535 MET n 
1 536 ASN n 
1 537 THR n 
1 538 PRO n 
1 539 ILE n 
1 540 GLN n 
1 541 GLY n 
1 542 SER n 
1 543 ALA n 
1 544 ALA n 
1 545 ASP n 
1 546 ILE n 
1 547 ILE n 
1 548 LYS n 
1 549 LYS n 
1 550 ALA n 
1 551 MET n 
1 552 ILE n 
1 553 ASP n 
1 554 LEU n 
1 555 ASN n 
1 556 ALA n 
1 557 ARG n 
1 558 LEU n 
1 559 LYS n 
1 560 GLU n 
1 561 GLU n 
1 562 ARG n 
1 563 LEU n 
1 564 GLN n 
1 565 ALA n 
1 566 ARG n 
1 567 LEU n 
1 568 LEU n 
1 569 LEU n 
1 570 GLN n 
1 571 VAL n 
1 572 HIS n 
1 573 ASP n 
1 574 GLU n 
1 575 LEU n 
1 576 ILE n 
1 577 LEU n 
1 578 GLU n 
1 579 ALA n 
1 580 PRO n 
1 581 LYS n 
1 582 GLU n 
1 583 GLU n 
1 584 MET n 
1 585 GLU n 
1 586 ARG n 
1 587 LEU n 
1 588 CYS n 
1 589 ARG n 
1 590 LEU n 
1 591 VAL n 
1 592 PRO n 
1 593 GLU n 
1 594 VAL n 
1 595 MET n 
1 596 GLU n 
1 597 GLN n 
1 598 ALA n 
1 599 VAL n 
1 600 THR n 
1 601 LEU n 
1 602 ARG n 
1 603 VAL n 
1 604 PRO n 
1 605 LEU n 
1 606 LYS n 
1 607 VAL n 
1 608 ASP n 
1 609 TYR n 
1 610 HIS n 
1 611 TYR n 
1 612 GLY n 
1 613 SER n 
1 614 THR n 
1 615 TRP n 
1 616 TYR n 
1 617 ASP n 
1 618 ALA n 
1 619 LYS n 
2 1   DC  n 
2 2   DC  n 
2 3   DT  n 
2 4   DG  n 
2 5   DA  n 
2 6   DC  n 
2 7   DT  n 
2 8   DC  n 
2 9   DT  n 
2 10  DA  n 
2 11  DA  n 
3 1   DC  n 
3 2   DA  n 
3 3   DT  n 
3 4   FOX n 
3 5   DA  n 
3 6   DG  n 
3 7   DA  n 
3 8   DG  n 
3 9   DT  n 
3 10  DC  n 
3 11  DA  n 
3 12  DG  n 
3 13  DG  n 
3 14  DC  n 
3 15  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'GEOBACILLUS STEAROTHERMOPHILUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PDEST007 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GERMAN COLLECTION OF MICROORGANISMS DSM NO. 22' 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'GEOBACILLUS STEAROTHERMOPHILUS' ? 1422 ? 
3 1 sample ? ? 'GEOBACILLUS STEAROTHERMOPHILUS' ? 1422 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP E1C9K5_GEOSE 1 ? ? E1C9K5 ? 
2 PDB 4B9V         2 ? ? 4B9V   ? 
3 PDB 4B9V         3 ? ? 4B9V   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4B9V A 40 ? 619 ? E1C9K5 1 ? 580 ? 297 876 
2 2 4B9V B 1  ? 11  ? 4B9V   1 ? 11  ? 1   11  
3 3 4B9V C 1  ? 15  ? 4B9V   2 ? 16  ? 2   16  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4B9V MET A 1  ? UNP E1C9K5 ? ? 'expression tag' 258 1  
1 4B9V ALA A 2  ? UNP E1C9K5 ? ? 'expression tag' 259 2  
1 4B9V SER A 3  ? UNP E1C9K5 ? ? 'expression tag' 260 3  
1 4B9V TRP A 4  ? UNP E1C9K5 ? ? 'expression tag' 261 4  
1 4B9V SER A 5  ? UNP E1C9K5 ? ? 'expression tag' 262 5  
1 4B9V HIS A 6  ? UNP E1C9K5 ? ? 'expression tag' 263 6  
1 4B9V PRO A 7  ? UNP E1C9K5 ? ? 'expression tag' 264 7  
1 4B9V GLN A 8  ? UNP E1C9K5 ? ? 'expression tag' 265 8  
1 4B9V PHE A 9  ? UNP E1C9K5 ? ? 'expression tag' 266 9  
1 4B9V GLU A 10 ? UNP E1C9K5 ? ? 'expression tag' 267 10 
1 4B9V LYS A 11 ? UNP E1C9K5 ? ? 'expression tag' 268 11 
1 4B9V GLY A 12 ? UNP E1C9K5 ? ? 'expression tag' 269 12 
1 4B9V ALA A 13 ? UNP E1C9K5 ? ? 'expression tag' 270 13 
1 4B9V SER A 14 ? UNP E1C9K5 ? ? 'expression tag' 271 14 
1 4B9V THR A 15 ? UNP E1C9K5 ? ? 'expression tag' 272 15 
1 4B9V SER A 16 ? UNP E1C9K5 ? ? 'expression tag' 273 16 
1 4B9V LEU A 17 ? UNP E1C9K5 ? ? 'expression tag' 274 17 
1 4B9V TYR A 18 ? UNP E1C9K5 ? ? 'expression tag' 275 18 
1 4B9V LYS A 19 ? UNP E1C9K5 ? ? 'expression tag' 276 19 
1 4B9V LYS A 20 ? UNP E1C9K5 ? ? 'expression tag' 277 20 
1 4B9V ALA A 21 ? UNP E1C9K5 ? ? 'expression tag' 278 21 
1 4B9V GLY A 22 ? UNP E1C9K5 ? ? 'expression tag' 279 22 
1 4B9V SER A 23 ? UNP E1C9K5 ? ? 'expression tag' 280 23 
1 4B9V ALA A 24 ? UNP E1C9K5 ? ? 'expression tag' 281 24 
1 4B9V ALA A 25 ? UNP E1C9K5 ? ? 'expression tag' 282 25 
1 4B9V ALA A 26 ? UNP E1C9K5 ? ? 'expression tag' 283 26 
1 4B9V VAL A 27 ? UNP E1C9K5 ? ? 'expression tag' 284 27 
1 4B9V LEU A 28 ? UNP E1C9K5 ? ? 'expression tag' 285 28 
1 4B9V GLU A 29 ? UNP E1C9K5 ? ? 'expression tag' 286 29 
1 4B9V GLU A 30 ? UNP E1C9K5 ? ? 'expression tag' 287 30 
1 4B9V ASN A 31 ? UNP E1C9K5 ? ? 'expression tag' 288 31 
1 4B9V LEU A 32 ? UNP E1C9K5 ? ? 'expression tag' 289 32 
1 4B9V TYR A 33 ? UNP E1C9K5 ? ? 'expression tag' 290 33 
1 4B9V PHE A 34 ? UNP E1C9K5 ? ? 'expression tag' 291 34 
1 4B9V GLN A 35 ? UNP E1C9K5 ? ? 'expression tag' 292 35 
1 4B9V GLY A 36 ? UNP E1C9K5 ? ? 'expression tag' 293 36 
1 4B9V SER A 37 ? UNP E1C9K5 ? ? 'expression tag' 294 37 
1 4B9V PHE A 38 ? UNP E1C9K5 ? ? 'expression tag' 295 38 
1 4B9V THR A 39 ? UNP E1C9K5 ? ? 'expression tag' 296 39 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 
FOX 'DNA linking'       n 
;((1R,2S,4R)-4-{[2-AMINO-5-(FORMYLAMINO)-6-OXO-3,6-DIHYDROPYRIMIDIN-4-YL]AMINO}-2-HYDROXYCYCLOPENTYL)METHYL 5'-PHOSPHATE
;
? 'C11 H18 N5 O7 P' 363.264 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4B9V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_percent_sol   55.71 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-03-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.999 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4B9V 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47.00 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   59511 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.44 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.60 
_reflns_shell.pdbx_redundancy        6.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4B9V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     56504 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.02 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.66 
_refine.ls_R_factor_obs                          0.18824 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18682 
_refine.ls_R_factor_R_free                       0.21529 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2965 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               16.399 
_refine.aniso_B[1][1]                            2.12 
_refine.aniso_B[2][2]                            -1.19 
_refine.aniso_B[3][3]                            -0.93 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES RESIDUAL ONLY' 
_refine.pdbx_starting_model                      'PDN ENTRY 4B9M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.149 
_refine.pdbx_overall_ESU_R_Free                  0.135 
_refine.overall_SU_ML                            0.089 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.150 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4648 
_refine_hist.pdbx_number_atoms_nucleic_acid   473 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             175 
_refine_hist.number_atoms_total               5327 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        47.02 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.019  ? 5325 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 3562 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.593  1.920  ? 7307 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.995  3.000  ? 8673 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.545  5.000  ? 592  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.474 24.052 ? 232  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.573 15.000 ? 887  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.352 15.000 ? 41   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.095  0.200  ? 805  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 5563 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1081 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             3897 
_refine_ls_shell.R_factor_R_work                  0.211 
_refine_ls_shell.percent_reflns_obs               99.59 
_refine_ls_shell.R_factor_R_free                  0.260 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             198 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4B9V 
_struct.title                     
'Structure of the high fidelity DNA polymerase I with extending from an oxidative formamidopyrimidine-dG DNA lesion -dA basepair.' 
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4B9V 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
'TRANSFERASE-DNA COMPLEX, DNA POLYMERASE, OXIDATIVE DNA LESION, DNA DAMAGE, TRANSLESION DNA SYNTHESIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 51  ? ALA A 56  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  2  ARG A 90  ? LEU A 95  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP A 97  ? ASP A 106 ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  4  ASP A 115 ? TRP A 125 ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU A 137 ? ASP A 145 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO A 146 ? GLY A 149 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP A 152 ? MET A 159 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO A 167 ? GLY A 173 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  LYS A 174 ? ARG A 178 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP A 182 ? ASN A 211 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN A 213 ? LEU A 220 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 12 LEU A 220 ? GLY A 235 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP A 239 ? GLY A 266 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P14 14 SER A 273 ? GLU A 283 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 15 SER A 300 ? ALA A 308 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 16 PRO A 309 ? HIS A 311 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P17 17 GLU A 312 ? TYR A 330 ? GLU A 569 TYR A 587 1 ? 19 
HELX_P HELX_P18 18 ILE A 331 ? LYS A 336 ? ILE A 588 LYS A 593 1 ? 6  
HELX_P HELX_P19 19 LEU A 373 ? LYS A 378 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P20 20 ILE A 379 ? GLN A 381 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P21 21 GLN A 399 ? GLU A 410 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P22 22 ASP A 411 ? ARG A 420 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P23 23 ASP A 423 ? GLN A 434 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P24 24 SER A 436 ? VAL A 440 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P25 25 THR A 441 ? GLY A 458 ? THR A 698 GLY A 715 1 ? 18 
HELX_P HELX_P26 26 SER A 460 ? ASN A 469 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P27 27 SER A 471 ? PHE A 486 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P28 28 PHE A 486 ? GLY A 504 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P29 29 PRO A 517 ? THR A 520 ? PRO A 774 THR A 777 5 ? 4  
HELX_P HELX_P30 30 ASN A 523 ? GLU A 561 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P31 31 GLU A 583 ? GLN A 597 ? GLU A 840 GLN A 854 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? J MG  .  MG    ? ? ? 1_555 A ASP 396 OD2   ? ? A MG  1883 A ASP 653 1_555 ? ? ? ? ? ? ?            2.812 ? 
metalc2  metalc ? ? J MG  .  MG    ? ? ? 1_555 A TYR 397 O     ? ? A MG  1883 A TYR 654 1_555 ? ? ? ? ? ? ?            2.745 ? 
metalc3  metalc ? ? J MG  .  MG    ? ? ? 1_555 A ASP 573 OD2   ? ? A MG  1883 A ASP 830 1_555 ? ? ? ? ? ? ?            2.940 ? 
covale1  covale ? ? C FOX 4  "O3'" ? ? ? 1_555 C DA  5   P     ? ? C FOX 5    C DA  6   1_555 ? ? ? ? ? ? ?            1.596 ? 
covale2  covale ? ? C FOX 4  P     ? ? ? 1_555 C DT  3   "O3'" ? ? C FOX 5    C DT  4   1_555 ? ? ? ? ? ? ?            1.599 ? 
hydrog1  hydrog ? ? B DC  1  N3    ? ? ? 1_555 C DG  13  N1    ? ? B DC  1    C DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1  N4    ? ? ? 1_555 C DG  13  O6    ? ? B DC  1    C DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1  O2    ? ? ? 1_555 C DG  13  N2    ? ? B DC  1    C DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DC  2  N3    ? ? ? 1_555 C DG  12  N1    ? ? B DC  2    C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DC  2  N4    ? ? ? 1_555 C DG  12  O6    ? ? B DC  2    C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  2  O2    ? ? ? 1_555 C DG  12  N2    ? ? B DC  2    C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DT  3  N3    ? ? ? 1_555 C DA  11  N1    ? ? B DT  3    C DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DT  3  O4    ? ? ? 1_555 C DA  11  N6    ? ? B DT  3    C DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  4  N1    ? ? ? 1_555 C DC  10  N3    ? ? B DG  4    C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4  N2    ? ? ? 1_555 C DC  10  O2    ? ? B DG  4    C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  4  O6    ? ? ? 1_555 C DC  10  N4    ? ? B DG  4    C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  5  N1    ? ? ? 1_555 C DT  9   N3    ? ? B DA  5    C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  5  N6    ? ? ? 1_555 C DT  9   O4    ? ? B DA  5    C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  6  N3    ? ? ? 1_555 C DG  8   N1    ? ? B DC  6    C DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  6  N4    ? ? ? 1_555 C DG  8   O6    ? ? B DC  6    C DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  6  O2    ? ? ? 1_555 C DG  8   N2    ? ? B DC  6    C DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  7  N3    ? ? ? 1_555 C DA  7   N1    ? ? B DT  7    C DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  7  O4    ? ? ? 1_555 C DA  7   N6    ? ? B DT  7    C DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8  N3    ? ? ? 1_555 C DG  6   N1    ? ? B DC  8    C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  8  N4    ? ? ? 1_555 C DG  6   O6    ? ? B DC  8    C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  8  O2    ? ? ? 1_555 C DG  6   N2    ? ? B DC  8    C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  9  N3    ? ? ? 1_555 C DA  5   N1    ? ? B DT  9    C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  9  O4    ? ? ? 1_555 C DA  5   N6    ? ? B DT  9    C DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DA  10 N1    ? ? ? 1_555 C FOX 4   N1    ? ? B DA  10   C FOX 5   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog25 hydrog ? ? B DA  10 N6    ? ? ? 1_555 C FOX 4   O6    ? ? B DA  10   C FOX 5   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog26 hydrog ? ? B DA  11 N1    ? ? ? 1_555 C DT  3   N3    ? ? B DA  11   C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  11 N6    ? ? ? 1_555 C DT  3   O4    ? ? B DA  11   C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           363 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    364 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       6.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 3 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 45  ? ALA A 47  ? THR A 302 ALA A 304 
AA 2 GLY A 85  ? LEU A 89  ? GLY A 342 LEU A 346 
AA 3 GLY A 77  ? ASN A 82  ? GLY A 334 ASN A 339 
AA 4 LYS A 58  ? GLU A 64  ? LYS A 315 GLU A 321 
AA 5 LYS A 110 ? MET A 113 ? LYS A 367 MET A 370 
AA 6 VAL A 133 ? ASP A 136 ? VAL A 390 ASP A 393 
AB 1 LYS A 344 ? VAL A 345 ? LYS A 601 VAL A 602 
AB 2 VAL A 236 ? VAL A 238 ? VAL A 493 VAL A 495 
AB 3 PHE A 383 ? VAL A 384 ? PHE A 640 VAL A 641 
AC 1 ILE A 348 ? ASN A 350 ? ILE A 605 ASN A 607 
AC 2 SER A 360 ? THR A 362 ? SER A 617 THR A 619 
AD 1 ARG A 566 ? GLN A 570 ? ARG A 823 GLN A 827 
AD 2 GLU A 574 ? PRO A 580 ? GLU A 831 PRO A 837 
AD 3 TRP A 390 ? TYR A 397 ? TRP A 647 TYR A 654 
AD 4 VAL A 607 ? GLY A 612 ? VAL A 864 GLY A 869 
AE 1 TYR A 505 ? THR A 507 ? TYR A 762 THR A 764 
AE 2 ARG A 513 ? TYR A 515 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 45  ? N THR A 302 O ARG A 86  ? O ARG A 343 
AA 2 3 N LEU A 89  ? N LEU A 346 O ILE A 78  ? O ILE A 335 
AA 3 4 N VAL A 81  ? N VAL A 338 O ALA A 60  ? O ALA A 317 
AA 4 5 N ALA A 59  ? N ALA A 316 O LYS A 110 ? O LYS A 367 
AA 5 6 O LYS A 111 ? O LYS A 368 N SER A 134 ? N SER A 391 
AB 1 2 N VAL A 345 ? N VAL A 602 O VAL A 236 ? O VAL A 493 
AB 2 3 N LYS A 237 ? N LYS A 494 O VAL A 384 ? O VAL A 641 
AC 1 2 N ASN A 350 ? N ASN A 607 O SER A 360 ? O SER A 617 
AD 1 2 N LEU A 568 ? N LEU A 825 O ILE A 576 ? O ILE A 833 
AD 2 3 N ALA A 579 ? N ALA A 836 O LEU A 391 ? O LEU A 648 
AD 3 4 N ASP A 396 ? N ASP A 653 O ASP A 608 ? O ASP A 865 
AE 1 2 N VAL A 506 ? N VAL A 763 O ARG A 514 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1877' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1878' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1879' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 1880' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 1881' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1882' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 1883'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 425 ? HIS A 682  . ? 1_555 ? 
2  AC1 4 ARG A 445 ? ARG A 702  . ? 1_555 ? 
3  AC1 4 LYS A 449 ? LYS A 706  . ? 1_555 ? 
4  AC1 4 HOH K .   ? HOH A 2123 . ? 1_555 ? 
5  AC2 4 MET A 42  ? MET A 299  . ? 3_545 ? 
6  AC2 4 ALA A 43  ? ALA A 300  . ? 3_545 ? 
7  AC2 4 ARG A 86  ? ARG A 343  . ? 3_545 ? 
8  AC2 4 ARG A 420 ? ARG A 677  . ? 1_555 ? 
9  AC3 4 GLU A 64  ? GLU A 321  . ? 1_555 ? 
10 AC3 4 VAL A 65  ? VAL A 322  . ? 1_555 ? 
11 AC3 4 ASP A 168 ? ASP A 425  . ? 1_555 ? 
12 AC3 4 TYR A 172 ? TYR A 429  . ? 1_555 ? 
13 AC4 6 GLU A 410 ? GLU A 667  . ? 1_555 ? 
14 AC4 6 ASP A 411 ? ASP A 668  . ? 1_555 ? 
15 AC4 6 ASP A 412 ? ASP A 669  . ? 1_555 ? 
16 AC4 6 GLY A 488 ? GLY A 745  . ? 1_555 ? 
17 AC4 6 ARG A 491 ? ARG A 748  . ? 1_555 ? 
18 AC4 6 HOH K .   ? HOH A 2128 . ? 1_555 ? 
19 AC5 3 HIS A 311 ? HIS A 568  . ? 4_455 ? 
20 AC5 3 ARG A 522 ? ARG A 779  . ? 1_555 ? 
21 AC5 3 ARG A 562 ? ARG A 819  . ? 3_555 ? 
22 AC6 4 SER A 398 ? SER A 655  . ? 1_555 ? 
23 AC6 4 GLN A 399 ? GLN A 656  . ? 1_555 ? 
24 AC6 4 MG  J .   ? MG  A 1883 . ? 1_555 ? 
25 AC6 4 HOH K .   ? HOH A 2118 . ? 1_555 ? 
26 AC7 4 ASP A 396 ? ASP A 653  . ? 1_555 ? 
27 AC7 4 TYR A 397 ? TYR A 654  . ? 1_555 ? 
28 AC7 4 ASP A 573 ? ASP A 830  . ? 1_555 ? 
29 AC7 4 SO4 I .   ? SO4 A 1882 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4B9V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4B9V 
_atom_sites.fract_transf_matrix[1][1]   0.011376 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010634 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009493 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 41  ? 11.005  39.412  51.470  1.00 52.71  ? 298  LYS A N     1 
ATOM   2    C  CA    . LYS A 1 41  ? 11.542  38.355  52.380  1.00 52.14  ? 298  LYS A CA    1 
ATOM   3    C  C     . LYS A 1 41  ? 10.386  37.522  52.977  1.00 48.15  ? 298  LYS A C     1 
ATOM   4    O  O     . LYS A 1 41  ? 9.794   37.929  53.969  1.00 52.45  ? 298  LYS A O     1 
ATOM   5    C  CB    . LYS A 1 41  ? 12.359  39.039  53.484  1.00 53.93  ? 298  LYS A CB    1 
ATOM   6    N  N     . MET A 1 42  ? 10.073  36.376  52.373  1.00 42.95  ? 299  MET A N     1 
ATOM   7    C  CA    . MET A 1 42  ? 8.849   35.585  52.689  1.00 38.53  ? 299  MET A CA    1 
ATOM   8    C  C     . MET A 1 42  ? 8.918   35.002  54.088  1.00 37.90  ? 299  MET A C     1 
ATOM   9    O  O     . MET A 1 42  ? 9.958   34.432  54.457  1.00 39.14  ? 299  MET A O     1 
ATOM   10   C  CB    . MET A 1 42  ? 8.689   34.416  51.693  1.00 34.67  ? 299  MET A CB    1 
ATOM   11   C  CG    . MET A 1 42  ? 7.589   33.395  52.000  1.00 31.24  ? 299  MET A CG    1 
ATOM   12   S  SD    . MET A 1 42  ? 7.298   32.325  50.576  1.00 28.61  ? 299  MET A SD    1 
ATOM   13   C  CE    . MET A 1 42  ? 6.398   33.466  49.475  1.00 28.02  ? 299  MET A CE    1 
ATOM   14   N  N     . ALA A 1 43  ? 7.815   35.080  54.830  1.00 36.16  ? 300  ALA A N     1 
ATOM   15   C  CA    . ALA A 1 43  ? 7.791   34.573  56.197  1.00 35.97  ? 300  ALA A CA    1 
ATOM   16   C  C     . ALA A 1 43  ? 7.884   33.054  56.283  1.00 33.51  ? 300  ALA A C     1 
ATOM   17   O  O     . ALA A 1 43  ? 7.189   32.307  55.567  1.00 31.15  ? 300  ALA A O     1 
ATOM   18   C  CB    . ALA A 1 43  ? 6.560   35.090  56.948  1.00 36.83  ? 300  ALA A CB    1 
ATOM   19   N  N     . PHE A 1 44  ? 8.775   32.568  57.134  1.00 32.82  ? 301  PHE A N     1 
ATOM   20   C  CA    . PHE A 1 44  ? 8.814   31.126  57.395  1.00 31.47  ? 301  PHE A CA    1 
ATOM   21   C  C     . PHE A 1 44  ? 9.514   30.878  58.716  1.00 32.73  ? 301  PHE A C     1 
ATOM   22   O  O     . PHE A 1 44  ? 10.156  31.778  59.250  1.00 34.83  ? 301  PHE A O     1 
ATOM   23   C  CB    . PHE A 1 44  ? 9.510   30.362  56.258  1.00 29.75  ? 301  PHE A CB    1 
ATOM   24   C  CG    . PHE A 1 44  ? 10.964  30.704  56.085  1.00 30.78  ? 301  PHE A CG    1 
ATOM   25   C  CD1   . PHE A 1 44  ? 11.348  31.752  55.292  1.00 32.99  ? 301  PHE A CD1   1 
ATOM   26   C  CD2   . PHE A 1 44  ? 11.937  29.945  56.693  1.00 31.25  ? 301  PHE A CD2   1 
ATOM   27   C  CE1   . PHE A 1 44  ? 12.703  32.075  55.118  1.00 35.14  ? 301  PHE A CE1   1 
ATOM   28   C  CE2   . PHE A 1 44  ? 13.278  30.250  56.544  1.00 33.46  ? 301  PHE A CE2   1 
ATOM   29   C  CZ    . PHE A 1 44  ? 13.667  31.308  55.737  1.00 34.43  ? 301  PHE A CZ    1 
ATOM   30   N  N     . THR A 1 45  ? 9.409   29.657  59.223  1.00 31.68  ? 302  THR A N     1 
ATOM   31   C  CA    . THR A 1 45  ? 10.077  29.300  60.460  1.00 34.47  ? 302  THR A CA    1 
ATOM   32   C  C     . THR A 1 45  ? 11.272  28.411  60.153  1.00 34.54  ? 302  THR A C     1 
ATOM   33   O  O     . THR A 1 45  ? 11.130  27.356  59.538  1.00 31.45  ? 302  THR A O     1 
ATOM   34   C  CB    . THR A 1 45  ? 9.131   28.538  61.404  1.00 35.35  ? 302  THR A CB    1 
ATOM   35   O  OG1   . THR A 1 45  ? 8.025   29.376  61.757  1.00 36.85  ? 302  THR A OG1   1 
ATOM   36   C  CG2   . THR A 1 45  ? 9.864   28.111  62.663  1.00 38.20  ? 302  THR A CG2   1 
ATOM   37   N  N     . LEU A 1 46  ? 12.450  28.843  60.589  1.00 36.81  ? 303  LEU A N     1 
ATOM   38   C  CA    . LEU A 1 46  ? 13.653  28.041  60.434  1.00 39.32  ? 303  LEU A CA    1 
ATOM   39   C  C     . LEU A 1 46  ? 13.742  27.086  61.610  1.00 41.01  ? 303  LEU A C     1 
ATOM   40   O  O     . LEU A 1 46  ? 14.505  27.305  62.549  1.00 41.88  ? 303  LEU A O     1 
ATOM   41   C  CB    . LEU A 1 46  ? 14.895  28.928  60.370  1.00 42.33  ? 303  LEU A CB    1 
ATOM   42   C  CG    . LEU A 1 46  ? 16.054  28.380  59.535  1.00 43.05  ? 303  LEU A CG    1 
ATOM   43   C  CD1   . LEU A 1 46  ? 16.556  29.426  58.552  1.00 44.19  ? 303  LEU A CD1   1 
ATOM   44   C  CD2   . LEU A 1 46  ? 17.181  27.895  60.432  1.00 47.45  ? 303  LEU A CD2   1 
ATOM   45   N  N     . ALA A 1 47  ? 12.938  26.031  61.557  1.00 41.60  ? 304  ALA A N     1 
ATOM   46   C  CA    . ALA A 1 47  ? 12.846  25.081  62.654  1.00 45.47  ? 304  ALA A CA    1 
ATOM   47   C  C     . ALA A 1 47  ? 14.136  24.303  62.873  1.00 48.18  ? 304  ALA A C     1 
ATOM   48   O  O     . ALA A 1 47  ? 14.806  23.904  61.923  1.00 47.53  ? 304  ALA A O     1 
ATOM   49   C  CB    . ALA A 1 47  ? 11.686  24.124  62.425  1.00 43.82  ? 304  ALA A CB    1 
ATOM   50   N  N     . ASP A 1 48  ? 14.468  24.085  64.140  1.00 53.27  ? 305  ASP A N     1 
ATOM   51   C  CA    . ASP A 1 48  ? 15.574  23.195  64.518  1.00 56.20  ? 305  ASP A CA    1 
ATOM   52   C  C     . ASP A 1 48  ? 15.091  21.898  65.184  1.00 54.73  ? 305  ASP A C     1 
ATOM   53   O  O     . ASP A 1 48  ? 15.907  21.108  65.644  1.00 57.06  ? 305  ASP A O     1 
ATOM   54   C  CB    . ASP A 1 48  ? 16.585  23.939  65.391  1.00 63.01  ? 305  ASP A CB    1 
ATOM   55   C  CG    . ASP A 1 48  ? 15.940  24.684  66.484  1.00 68.10  ? 305  ASP A CG    1 
ATOM   56   O  OD1   . ASP A 1 48  ? 14.980  24.142  67.077  1.00 74.59  ? 305  ASP A OD1   1 
ATOM   57   O  OD2   . ASP A 1 48  ? 16.375  25.822  66.751  1.00 74.74  ? 305  ASP A OD2   1 
ATOM   58   N  N     . ARG A 1 49  ? 13.773  21.705  65.254  1.00 51.48  ? 306  ARG A N     1 
ATOM   59   C  CA    . ARG A 1 49  ? 13.171  20.388  65.498  1.00 50.05  ? 306  ARG A CA    1 
ATOM   60   C  C     . ARG A 1 49  ? 11.839  20.240  64.739  1.00 44.90  ? 306  ARG A C     1 
ATOM   61   O  O     . ARG A 1 49  ? 11.229  21.229  64.373  1.00 42.09  ? 306  ARG A O     1 
ATOM   62   C  CB    . ARG A 1 49  ? 12.974  20.131  66.993  1.00 54.70  ? 306  ARG A CB    1 
ATOM   63   C  CG    . ARG A 1 49  ? 11.902  20.967  67.670  1.00 58.62  ? 306  ARG A CG    1 
ATOM   64   C  CD    . ARG A 1 49  ? 11.654  20.527  69.129  1.00 64.94  ? 306  ARG A CD    1 
ATOM   65   N  NE    . ARG A 1 49  ? 10.374  21.045  69.658  1.00 68.26  ? 306  ARG A NE    1 
ATOM   66   C  CZ    . ARG A 1 49  ? 9.159   20.608  69.295  1.00 69.06  ? 306  ARG A CZ    1 
ATOM   67   N  NH1   . ARG A 1 49  ? 9.018   19.637  68.392  1.00 70.85  ? 306  ARG A NH1   1 
ATOM   68   N  NH2   . ARG A 1 49  ? 8.068   21.147  69.816  1.00 71.42  ? 306  ARG A NH2   1 
ATOM   69   N  N     . VAL A 1 50  ? 11.425  19.000  64.474  1.00 42.30  ? 307  VAL A N     1 
ATOM   70   C  CA    . VAL A 1 50  ? 10.141  18.709  63.847  1.00 40.13  ? 307  VAL A CA    1 
ATOM   71   C  C     . VAL A 1 50  ? 8.986   18.817  64.851  1.00 40.85  ? 307  VAL A C     1 
ATOM   72   O  O     . VAL A 1 50  ? 9.099   18.334  65.957  1.00 42.97  ? 307  VAL A O     1 
ATOM   73   C  CB    . VAL A 1 50  ? 10.144  17.298  63.220  1.00 40.19  ? 307  VAL A CB    1 
ATOM   74   C  CG1   . VAL A 1 50  ? 8.784   16.956  62.629  1.00 39.02  ? 307  VAL A CG1   1 
ATOM   75   C  CG2   . VAL A 1 50  ? 11.222  17.193  62.147  1.00 37.28  ? 307  VAL A CG2   1 
ATOM   76   N  N     . THR A 1 51  ? 7.885   19.441  64.437  1.00 38.38  ? 308  THR A N     1 
ATOM   77   C  CA    . THR A 1 51  ? 6.683   19.607  65.247  1.00 41.32  ? 308  THR A CA    1 
ATOM   78   C  C     . THR A 1 51  ? 5.466   19.017  64.531  1.00 40.50  ? 308  THR A C     1 
ATOM   79   O  O     . THR A 1 51  ? 5.459   18.834  63.304  1.00 38.05  ? 308  THR A O     1 
ATOM   80   C  CB    . THR A 1 51  ? 6.422   21.099  65.530  1.00 41.46  ? 308  THR A CB    1 
ATOM   81   O  OG1   . THR A 1 51  ? 6.176   21.786  64.297  1.00 40.83  ? 308  THR A OG1   1 
ATOM   82   C  CG2   . THR A 1 51  ? 7.628   21.732  66.184  1.00 43.65  ? 308  THR A CG2   1 
ATOM   83   N  N     . GLU A 1 52  ? 4.432   18.741  65.298  1.00 43.97  ? 309  GLU A N     1 
ATOM   84   C  CA    . GLU A 1 52  ? 3.237   18.103  64.770  1.00 45.86  ? 309  GLU A CA    1 
ATOM   85   C  C     . GLU A 1 52  ? 2.623   18.891  63.612  1.00 42.48  ? 309  GLU A C     1 
ATOM   86   O  O     . GLU A 1 52  ? 2.138   18.299  62.650  1.00 40.35  ? 309  GLU A O     1 
ATOM   87   C  CB    . GLU A 1 52  ? 2.200   17.889  65.889  1.00 51.66  ? 309  GLU A CB    1 
ATOM   88   C  CG    . GLU A 1 52  ? 1.144   16.812  65.614  1.00 56.38  ? 309  GLU A CG    1 
ATOM   89   C  CD    . GLU A 1 52  ? 1.694   15.551  64.914  1.00 59.40  ? 309  GLU A CD    1 
ATOM   90   O  OE1   . GLU A 1 52  ? 2.447   14.757  65.541  1.00 63.96  ? 309  GLU A OE1   1 
ATOM   91   O  OE2   . GLU A 1 52  ? 1.363   15.352  63.715  1.00 60.42  ? 309  GLU A OE2   1 
ATOM   92   N  N     . GLU A 1 53  ? 2.680   20.213  63.667  1.00 42.22  ? 310  GLU A N     1 
ATOM   93   C  CA    . GLU A 1 53  ? 2.025   21.018  62.624  1.00 41.51  ? 310  GLU A CA    1 
ATOM   94   C  C     . GLU A 1 53  ? 2.727   20.955  61.274  1.00 37.19  ? 310  GLU A C     1 
ATOM   95   O  O     . GLU A 1 53  ? 2.141   21.308  60.243  1.00 36.06  ? 310  GLU A O     1 
ATOM   96   C  CB    . GLU A 1 53  ? 1.821   22.450  63.082  1.00 44.73  ? 310  GLU A CB    1 
ATOM   97   C  CG    . GLU A 1 53  ? 3.038   23.355  63.091  1.00 46.14  ? 310  GLU A CG    1 
ATOM   98   C  CD    . GLU A 1 53  ? 2.680   24.737  63.646  1.00 50.28  ? 310  GLU A CD    1 
ATOM   99   O  OE1   . GLU A 1 53  ? 1.491   24.916  64.045  1.00 52.95  ? 310  GLU A OE1   1 
ATOM   100  O  OE2   . GLU A 1 53  ? 3.573   25.637  63.693  1.00 51.32  ? 310  GLU A OE2   1 
ATOM   101  N  N     . MET A 1 54  ? 3.962   20.476  61.261  1.00 35.33  ? 311  MET A N     1 
ATOM   102  C  CA    . MET A 1 54  ? 4.668   20.218  60.005  1.00 32.87  ? 311  MET A CA    1 
ATOM   103  C  C     . MET A 1 54  ? 4.241   18.935  59.313  1.00 30.54  ? 311  MET A C     1 
ATOM   104  O  O     . MET A 1 54  ? 4.615   18.704  58.183  1.00 30.64  ? 311  MET A O     1 
ATOM   105  C  CB    . MET A 1 54  ? 6.178   20.133  60.232  1.00 33.73  ? 311  MET A CB    1 
ATOM   106  C  CG    . MET A 1 54  ? 6.780   21.373  60.842  1.00 34.78  ? 311  MET A CG    1 
ATOM   107  S  SD    . MET A 1 54  ? 8.498   21.087  61.291  1.00 35.85  ? 311  MET A SD    1 
ATOM   108  C  CE    . MET A 1 54  ? 8.762   22.514  62.325  1.00 37.51  ? 311  MET A CE    1 
ATOM   109  N  N     . LEU A 1 55  ? 3.451   18.113  59.979  1.00 31.64  ? 312  LEU A N     1 
ATOM   110  C  CA    . LEU A 1 55  ? 3.065   16.800  59.476  1.00 31.03  ? 312  LEU A CA    1 
ATOM   111  C  C     . LEU A 1 55  ? 1.559   16.709  59.164  1.00 31.09  ? 312  LEU A C     1 
ATOM   112  O  O     . LEU A 1 55  ? 0.945   15.672  59.371  1.00 31.45  ? 312  LEU A O     1 
ATOM   113  C  CB    . LEU A 1 55  ? 3.461   15.742  60.520  1.00 33.31  ? 312  LEU A CB    1 
ATOM   114  C  CG    . LEU A 1 55  ? 4.880   15.840  61.095  1.00 33.24  ? 312  LEU A CG    1 
ATOM   115  C  CD1   . LEU A 1 55  ? 5.078   14.859  62.237  1.00 36.28  ? 312  LEU A CD1   1 
ATOM   116  C  CD2   . LEU A 1 55  ? 5.898   15.650  59.979  1.00 31.35  ? 312  LEU A CD2   1 
ATOM   117  N  N     . ALA A 1 56  ? 0.991   17.785  58.605  1.00 30.61  ? 313  ALA A N     1 
ATOM   118  C  CA    . ALA A 1 56  ? -0.434  17.849  58.184  1.00 30.66  ? 313  ALA A CA    1 
ATOM   119  C  C     . ALA A 1 56  ? -0.656  16.899  57.030  1.00 28.94  ? 313  ALA A C     1 
ATOM   120  O  O     . ALA A 1 56  ? 0.283   16.532  56.361  1.00 27.49  ? 313  ALA A O     1 
ATOM   121  C  CB    . ALA A 1 56  ? -0.786  19.259  57.733  1.00 30.62  ? 313  ALA A CB    1 
ATOM   122  N  N     . ASP A 1 57  ? -1.891  16.552  56.729  1.00 30.15  ? 314  ASP A N     1 
ATOM   123  C  CA    . ASP A 1 57  ? -2.115  15.531  55.726  1.00 31.07  ? 314  ASP A CA    1 
ATOM   124  C  C     . ASP A 1 57  ? -2.147  16.073  54.287  1.00 28.06  ? 314  ASP A C     1 
ATOM   125  O  O     . ASP A 1 57  ? -2.425  15.353  53.349  1.00 26.98  ? 314  ASP A O     1 
ATOM   126  C  CB    . ASP A 1 57  ? -3.352  14.718  56.033  1.00 35.37  ? 314  ASP A CB    1 
ATOM   127  C  CG    . ASP A 1 57  ? -4.566  15.541  56.106  1.00 38.18  ? 314  ASP A CG    1 
ATOM   128  O  OD1   . ASP A 1 57  ? -4.434  16.720  55.781  1.00 40.02  ? 314  ASP A OD1   1 
ATOM   129  O  OD2   . ASP A 1 57  ? -5.633  15.034  56.543  1.00 43.17  ? 314  ASP A OD2   1 
ATOM   130  N  N     . LYS A 1 58  ? -1.835  17.336  54.141  1.00 26.98  ? 315  LYS A N     1 
ATOM   131  C  CA    . LYS A 1 58  ? -1.659  17.938  52.804  1.00 25.94  ? 315  LYS A CA    1 
ATOM   132  C  C     . LYS A 1 58  ? -0.568  18.979  52.853  1.00 23.17  ? 315  LYS A C     1 
ATOM   133  O  O     . LYS A 1 58  ? -0.638  19.918  53.644  1.00 23.11  ? 315  LYS A O     1 
ATOM   134  C  CB    . LYS A 1 58  ? -2.967  18.602  52.398  1.00 27.98  ? 315  LYS A CB    1 
ATOM   135  C  CG    . LYS A 1 58  ? -2.834  19.470  51.164  1.00 28.10  ? 315  LYS A CG    1 
ATOM   136  C  CD    . LYS A 1 58  ? -2.639  18.681  49.903  1.00 27.20  ? 315  LYS A CD    1 
ATOM   137  C  CE    . LYS A 1 58  ? -3.358  19.388  48.725  1.00 28.93  ? 315  LYS A CE    1 
ATOM   138  N  NZ    . LYS A 1 58  ? -3.063  18.622  47.483  1.00 28.34  ? 315  LYS A NZ    1 
ATOM   139  N  N     . ALA A 1 59  ? 0.430   18.853  51.995  1.00 20.97  ? 316  ALA A N     1 
ATOM   140  C  CA    . ALA A 1 59  ? 1.541   19.795  52.042  1.00 20.13  ? 316  ALA A CA    1 
ATOM   141  C  C     . ALA A 1 59  ? 2.220   19.923  50.683  1.00 19.13  ? 316  ALA A C     1 
ATOM   142  O  O     . ALA A 1 59  ? 2.247   18.947  49.898  1.00 19.43  ? 316  ALA A O     1 
ATOM   143  C  CB    . ALA A 1 59  ? 2.572   19.305  53.045  1.00 19.45  ? 316  ALA A CB    1 
ATOM   144  N  N     . ALA A 1 60  ? 2.876   21.060  50.477  1.00 18.03  ? 317  ALA A N     1 
ATOM   145  C  CA    . ALA A 1 60  ? 3.862   21.204  49.425  1.00 17.28  ? 317  ALA A CA    1 
ATOM   146  C  C     . ALA A 1 60  ? 5.223   20.939  50.066  1.00 16.93  ? 317  ALA A C     1 
ATOM   147  O  O     . ALA A 1 60  ? 5.576   21.543  51.077  1.00 18.09  ? 317  ALA A O     1 
ATOM   148  C  CB    . ALA A 1 60  ? 3.813   22.599  48.828  1.00 15.97  ? 317  ALA A CB    1 
ATOM   149  N  N     . LEU A 1 61  ? 5.969   20.016  49.472  1.00 16.38  ? 318  LEU A N     1 
ATOM   150  C  CA    . LEU A 1 61  ? 7.215   19.545  49.995  1.00 16.67  ? 318  LEU A CA    1 
ATOM   151  C  C     . LEU A 1 61  ? 8.367   19.728  48.965  1.00 17.03  ? 318  LEU A C     1 
ATOM   152  O  O     . LEU A 1 61  ? 8.215   19.391  47.780  1.00 16.29  ? 318  LEU A O     1 
ATOM   153  C  CB    . LEU A 1 61  ? 7.049   18.069  50.343  1.00 16.65  ? 318  LEU A CB    1 
ATOM   154  C  CG    . LEU A 1 61  ? 8.310   17.303  50.685  1.00 17.49  ? 318  LEU A CG    1 
ATOM   155  C  CD1   . LEU A 1 61  ? 8.794   17.870  52.020  1.00 18.05  ? 318  LEU A CD1   1 
ATOM   156  C  CD2   . LEU A 1 61  ? 8.045   15.782  50.711  1.00 17.17  ? 318  LEU A CD2   1 
ATOM   157  N  N     . VAL A 1 62  ? 9.492   20.254  49.448  1.00 17.69  ? 319  VAL A N     1 
ATOM   158  C  CA    . VAL A 1 62  ? 10.701  20.405  48.685  1.00 18.83  ? 319  VAL A CA    1 
ATOM   159  C  C     . VAL A 1 62  ? 11.778  19.604  49.422  1.00 18.26  ? 319  VAL A C     1 
ATOM   160  O  O     . VAL A 1 62  ? 12.015  19.844  50.607  1.00 18.41  ? 319  VAL A O     1 
ATOM   161  C  CB    . VAL A 1 62  ? 11.138  21.878  48.587  1.00 20.50  ? 319  VAL A CB    1 
ATOM   162  C  CG1   . VAL A 1 62  ? 12.535  22.032  47.968  1.00 19.64  ? 319  VAL A CG1   1 
ATOM   163  C  CG2   . VAL A 1 62  ? 10.136  22.657  47.743  1.00 20.04  ? 319  VAL A CG2   1 
ATOM   164  N  N     . VAL A 1 63  ? 12.359  18.638  48.733  1.00 16.74  ? 320  VAL A N     1 
ATOM   165  C  CA    . VAL A 1 63  ? 13.467  17.831  49.262  1.00 18.14  ? 320  VAL A CA    1 
ATOM   166  C  C     . VAL A 1 63  ? 14.592  18.075  48.256  1.00 18.80  ? 320  VAL A C     1 
ATOM   167  O  O     . VAL A 1 63  ? 14.616  17.463  47.185  1.00 18.77  ? 320  VAL A O     1 
ATOM   168  C  CB    . VAL A 1 63  ? 13.119  16.347  49.359  1.00 18.10  ? 320  VAL A CB    1 
ATOM   169  C  CG1   . VAL A 1 63  ? 14.355  15.510  49.777  1.00 18.83  ? 320  VAL A CG1   1 
ATOM   170  C  CG2   . VAL A 1 63  ? 11.990  16.125  50.349  1.00 17.99  ? 320  VAL A CG2   1 
ATOM   171  N  N     . GLU A 1 64  ? 15.500  18.971  48.586  1.00 18.43  ? 321  GLU A N     1 
ATOM   172  C  CA    . GLU A 1 64  ? 16.351  19.585  47.552  1.00 20.23  ? 321  GLU A CA    1 
ATOM   173  C  C     . GLU A 1 64  ? 17.650  18.842  47.348  1.00 20.31  ? 321  GLU A C     1 
ATOM   174  O  O     . GLU A 1 64  ? 18.470  18.742  48.277  1.00 20.75  ? 321  GLU A O     1 
ATOM   175  C  CB    . GLU A 1 64  ? 16.667  21.028  47.920  1.00 21.75  ? 321  GLU A CB    1 
ATOM   176  C  CG    . GLU A 1 64  ? 17.406  21.852  46.851  1.00 24.07  ? 321  GLU A CG    1 
ATOM   177  C  CD    . GLU A 1 64  ? 16.470  22.517  45.803  1.00 25.17  ? 321  GLU A CD    1 
ATOM   178  O  OE1   . GLU A 1 64  ? 15.340  22.027  45.616  1.00 26.55  ? 321  GLU A OE1   1 
ATOM   179  O  OE2   . GLU A 1 64  ? 16.873  23.502  45.139  1.00 25.77  ? 321  GLU A OE2   1 
ATOM   180  N  N     . VAL A 1 65  ? 17.845  18.375  46.123  1.00 18.64  ? 322  VAL A N     1 
ATOM   181  C  CA    . VAL A 1 65  ? 19.058  17.718  45.680  1.00 19.91  ? 322  VAL A CA    1 
ATOM   182  C  C     . VAL A 1 65  ? 19.625  18.535  44.529  1.00 20.18  ? 322  VAL A C     1 
ATOM   183  O  O     . VAL A 1 65  ? 19.056  18.537  43.447  1.00 18.54  ? 322  VAL A O     1 
ATOM   184  C  CB    . VAL A 1 65  ? 18.740  16.293  45.164  1.00 19.56  ? 322  VAL A CB    1 
ATOM   185  C  CG1   . VAL A 1 65  ? 20.013  15.612  44.625  1.00 19.58  ? 322  VAL A CG1   1 
ATOM   186  C  CG2   . VAL A 1 65  ? 18.031  15.485  46.250  1.00 18.86  ? 322  VAL A CG2   1 
ATOM   187  N  N     . VAL A 1 66  ? 20.725  19.236  44.773  1.00 21.22  ? 323  VAL A N     1 
ATOM   188  C  CA    . VAL A 1 66  ? 21.246  20.199  43.837  1.00 23.32  ? 323  VAL A CA    1 
ATOM   189  C  C     . VAL A 1 66  ? 22.122  19.555  42.788  1.00 25.46  ? 323  VAL A C     1 
ATOM   190  O  O     . VAL A 1 66  ? 22.214  20.070  41.664  1.00 25.90  ? 323  VAL A O     1 
ATOM   191  C  CB    . VAL A 1 66  ? 22.036  21.301  44.581  1.00 24.74  ? 323  VAL A CB    1 
ATOM   192  C  CG1   . VAL A 1 66  ? 22.681  22.269  43.597  1.00 27.20  ? 323  VAL A CG1   1 
ATOM   193  C  CG2   . VAL A 1 66  ? 21.107  22.051  45.545  1.00 24.80  ? 323  VAL A CG2   1 
ATOM   194  N  N     . GLU A 1 67  ? 22.824  18.475  43.146  1.00 25.39  ? 324  GLU A N     1 
ATOM   195  C  CA    . GLU A 1 67  ? 23.667  17.752  42.175  1.00 28.16  ? 324  GLU A CA    1 
ATOM   196  C  C     . GLU A 1 67  ? 22.788  17.260  41.021  1.00 26.40  ? 324  GLU A C     1 
ATOM   197  O  O     . GLU A 1 67  ? 21.722  16.723  41.266  1.00 23.29  ? 324  GLU A O     1 
ATOM   198  C  CB    . GLU A 1 67  ? 24.313  16.517  42.789  1.00 31.10  ? 324  GLU A CB    1 
ATOM   199  C  CG    . GLU A 1 67  ? 25.459  16.765  43.740  1.00 36.60  ? 324  GLU A CG    1 
ATOM   200  C  CD    . GLU A 1 67  ? 26.681  17.337  43.041  1.00 42.26  ? 324  GLU A CD    1 
ATOM   201  O  OE1   . GLU A 1 67  ? 26.854  17.144  41.814  1.00 47.29  ? 324  GLU A OE1   1 
ATOM   202  O  OE2   . GLU A 1 67  ? 27.484  17.988  43.721  1.00 51.65  ? 324  GLU A OE2   1 
ATOM   203  N  N     . GLU A 1 68  ? 23.248  17.430  39.794  1.00 27.23  ? 325  GLU A N     1 
ATOM   204  C  CA    . GLU A 1 68  ? 22.468  17.111  38.616  1.00 28.84  ? 325  GLU A CA    1 
ATOM   205  C  C     . GLU A 1 68  ? 22.111  15.621  38.604  1.00 25.10  ? 325  GLU A C     1 
ATOM   206  O  O     . GLU A 1 68  ? 20.966  15.279  38.427  1.00 23.18  ? 325  GLU A O     1 
ATOM   207  C  CB    . GLU A 1 68  ? 23.252  17.513  37.346  1.00 35.18  ? 325  GLU A CB    1 
ATOM   208  C  CG    . GLU A 1 68  ? 22.596  17.014  36.080  1.00 41.94  ? 325  GLU A CG    1 
ATOM   209  C  CD    . GLU A 1 68  ? 22.857  17.910  34.878  1.00 50.28  ? 325  GLU A CD    1 
ATOM   210  O  OE1   . GLU A 1 68  ? 23.986  17.898  34.354  1.00 57.20  ? 325  GLU A OE1   1 
ATOM   211  O  OE2   . GLU A 1 68  ? 21.916  18.606  34.443  1.00 59.40  ? 325  GLU A OE2   1 
ATOM   212  N  N     . ASN A 1 69  ? 23.099  14.767  38.856  1.00 23.00  ? 326  ASN A N     1 
ATOM   213  C  CA    . ASN A 1 69  ? 22.879  13.320  39.024  1.00 21.97  ? 326  ASN A CA    1 
ATOM   214  C  C     . ASN A 1 69  ? 22.534  13.063  40.482  1.00 20.03  ? 326  ASN A C     1 
ATOM   215  O  O     . ASN A 1 69  ? 23.391  13.209  41.360  1.00 19.42  ? 326  ASN A O     1 
ATOM   216  C  CB    . ASN A 1 69  ? 24.150  12.540  38.600  1.00 23.03  ? 326  ASN A CB    1 
ATOM   217  C  CG    . ASN A 1 69  ? 23.948  11.041  38.614  1.00 23.59  ? 326  ASN A CG    1 
ATOM   218  O  OD1   . ASN A 1 69  ? 23.326  10.507  39.532  1.00 22.28  ? 326  ASN A OD1   1 
ATOM   219  N  ND2   . ASN A 1 69  ? 24.482  10.351  37.607  1.00 24.24  ? 326  ASN A ND2   1 
ATOM   220  N  N     . TYR A 1 70  ? 21.290  12.720  40.751  1.00 17.02  ? 327  TYR A N     1 
ATOM   221  C  CA    . TYR A 1 70  ? 20.838  12.579  42.102  1.00 17.18  ? 327  TYR A CA    1 
ATOM   222  C  C     . TYR A 1 70  ? 21.091  11.220  42.798  1.00 17.11  ? 327  TYR A C     1 
ATOM   223  O  O     . TYR A 1 70  ? 20.716  11.067  43.943  1.00 16.50  ? 327  TYR A O     1 
ATOM   224  C  CB    . TYR A 1 70  ? 19.341  12.919  42.207  1.00 16.91  ? 327  TYR A CB    1 
ATOM   225  C  CG    . TYR A 1 70  ? 18.487  12.247  41.145  1.00 18.18  ? 327  TYR A CG    1 
ATOM   226  C  CD1   . TYR A 1 70  ? 18.239  10.880  41.185  1.00 18.29  ? 327  TYR A CD1   1 
ATOM   227  C  CD2   . TYR A 1 70  ? 17.864  12.997  40.142  1.00 18.83  ? 327  TYR A CD2   1 
ATOM   228  C  CE1   . TYR A 1 70  ? 17.445  10.258  40.242  1.00 19.21  ? 327  TYR A CE1   1 
ATOM   229  C  CE2   . TYR A 1 70  ? 17.052  12.384  39.190  1.00 18.71  ? 327  TYR A CE2   1 
ATOM   230  C  CZ    . TYR A 1 70  ? 16.829  11.036  39.253  1.00 19.26  ? 327  TYR A CZ    1 
ATOM   231  O  OH    . TYR A 1 70  ? 16.058  10.431  38.325  1.00 19.65  ? 327  TYR A OH    1 
ATOM   232  N  N     . HIS A 1 71  ? 21.747  10.281  42.134  1.00 17.25  ? 328  HIS A N     1 
ATOM   233  C  CA    . HIS A 1 71  ? 22.019  9.033   42.802  1.00 17.72  ? 328  HIS A CA    1 
ATOM   234  C  C     . HIS A 1 71  ? 23.007  9.243   43.916  1.00 17.50  ? 328  HIS A C     1 
ATOM   235  O  O     . HIS A 1 71  ? 24.090  9.829   43.721  1.00 17.62  ? 328  HIS A O     1 
ATOM   236  C  CB    . HIS A 1 71  ? 22.517  7.991   41.810  1.00 18.83  ? 328  HIS A CB    1 
ATOM   237  C  CG    . HIS A 1 71  ? 21.467  7.553   40.818  1.00 19.23  ? 328  HIS A CG    1 
ATOM   238  N  ND1   . HIS A 1 71  ? 20.441  6.754   41.158  1.00 18.94  ? 328  HIS A ND1   1 
ATOM   239  C  CD2   . HIS A 1 71  ? 21.307  7.843   39.465  1.00 19.89  ? 328  HIS A CD2   1 
ATOM   240  C  CE1   . HIS A 1 71  ? 19.666  6.537   40.080  1.00 19.21  ? 328  HIS A CE1   1 
ATOM   241  N  NE2   . HIS A 1 71  ? 20.197  7.204   39.045  1.00 19.61  ? 328  HIS A NE2   1 
ATOM   242  N  N     . ASP A 1 72  ? 22.649  8.744   45.093  1.00 17.41  ? 329  ASP A N     1 
ATOM   243  C  CA    . ASP A 1 72  ? 23.506  8.786   46.298  1.00 18.49  ? 329  ASP A CA    1 
ATOM   244  C  C     . ASP A 1 72  ? 24.000  10.193  46.590  1.00 19.15  ? 329  ASP A C     1 
ATOM   245  O  O     . ASP A 1 72  ? 25.039  10.356  47.163  1.00 20.69  ? 329  ASP A O     1 
ATOM   246  C  CB    . ASP A 1 72  ? 24.643  7.770   46.175  1.00 20.14  ? 329  ASP A CB    1 
ATOM   247  C  CG    . ASP A 1 72  ? 25.046  7.132   47.525  1.00 21.79  ? 329  ASP A CG    1 
ATOM   248  O  OD1   . ASP A 1 72  ? 24.329  7.351   48.537  1.00 21.95  ? 329  ASP A OD1   1 
ATOM   249  O  OD2   . ASP A 1 72  ? 26.120  6.466   47.567  1.00 22.46  ? 329  ASP A OD2   1 
ATOM   250  N  N     . ALA A 1 73  ? 23.198  11.201  46.211  1.00 18.74  ? 330  ALA A N     1 
ATOM   251  C  CA    . ALA A 1 73  ? 23.566  12.595  46.301  1.00 20.01  ? 330  ALA A CA    1 
ATOM   252  C  C     . ALA A 1 73  ? 23.036  13.198  47.574  1.00 20.49  ? 330  ALA A C     1 
ATOM   253  O  O     . ALA A 1 73  ? 22.059  12.711  48.117  1.00 19.83  ? 330  ALA A O     1 
ATOM   254  C  CB    . ALA A 1 73  ? 23.004  13.377  45.098  1.00 18.50  ? 330  ALA A CB    1 
ATOM   255  N  N     . PRO A 1 74  ? 23.639  14.304  48.019  1.00 22.16  ? 331  PRO A N     1 
ATOM   256  C  CA    . PRO A 1 74  ? 23.202  14.971  49.253  1.00 22.64  ? 331  PRO A CA    1 
ATOM   257  C  C     . PRO A 1 74  ? 21.838  15.664  49.112  1.00 22.61  ? 331  PRO A C     1 
ATOM   258  O  O     . PRO A 1 74  ? 21.513  16.158  48.031  1.00 21.18  ? 331  PRO A O     1 
ATOM   259  C  CB    . PRO A 1 74  ? 24.296  15.996  49.500  1.00 24.82  ? 331  PRO A CB    1 
ATOM   260  C  CG    . PRO A 1 74  ? 25.469  15.531  48.716  1.00 25.81  ? 331  PRO A CG    1 
ATOM   261  C  CD    . PRO A 1 74  ? 24.900  14.862  47.506  1.00 24.00  ? 331  PRO A CD    1 
ATOM   262  N  N     . ILE A 1 75  ? 21.023  15.622  50.180  1.00 22.45  ? 332  ILE A N     1 
ATOM   263  C  CA    . ILE A 1 75  ? 19.827  16.468  50.288  1.00 21.01  ? 332  ILE A CA    1 
ATOM   264  C  C     . ILE A 1 75  ? 20.274  17.698  51.087  1.00 23.52  ? 332  ILE A C     1 
ATOM   265  O  O     . ILE A 1 75  ? 20.806  17.548  52.200  1.00 23.53  ? 332  ILE A O     1 
ATOM   266  C  CB    . ILE A 1 75  ? 18.700  15.713  50.993  1.00 21.13  ? 332  ILE A CB    1 
ATOM   267  C  CG1   . ILE A 1 75  ? 18.262  14.551  50.115  1.00 20.45  ? 332  ILE A CG1   1 
ATOM   268  C  CG2   . ILE A 1 75  ? 17.554  16.666  51.382  1.00 20.26  ? 332  ILE A CG2   1 
ATOM   269  C  CD1   . ILE A 1 75  ? 17.423  13.460  50.803  1.00 19.81  ? 332  ILE A CD1   1 
ATOM   270  N  N     . VAL A 1 76  ? 20.137  18.905  50.522  1.00 21.99  ? 333  VAL A N     1 
ATOM   271  C  CA    . VAL A 1 76  ? 20.720  20.061  51.145  1.00 24.33  ? 333  VAL A CA    1 
ATOM   272  C  C     . VAL A 1 76  ? 19.782  20.798  52.042  1.00 23.94  ? 333  VAL A C     1 
ATOM   273  O  O     . VAL A 1 76  ? 20.210  21.610  52.774  1.00 24.81  ? 333  VAL A O     1 
ATOM   274  C  CB    . VAL A 1 76  ? 21.366  21.043  50.126  1.00 26.69  ? 333  VAL A CB    1 
ATOM   275  C  CG1   . VAL A 1 76  ? 22.380  20.309  49.250  1.00 26.00  ? 333  VAL A CG1   1 
ATOM   276  C  CG2   . VAL A 1 76  ? 20.294  21.695  49.268  1.00 24.50  ? 333  VAL A CG2   1 
ATOM   277  N  N     . GLY A 1 77  ? 18.500  20.506  51.990  1.00 22.04  ? 334  GLY A N     1 
ATOM   278  C  CA    . GLY A 1 77  ? 17.523  21.256  52.757  1.00 21.80  ? 334  GLY A CA    1 
ATOM   279  C  C     . GLY A 1 77  ? 16.140  20.772  52.406  1.00 19.87  ? 334  GLY A C     1 
ATOM   280  O  O     . GLY A 1 77  ? 15.929  20.176  51.345  1.00 19.35  ? 334  GLY A O     1 
ATOM   281  N  N     . ILE A 1 78  ? 15.202  21.016  53.298  1.00 20.56  ? 335  ILE A N     1 
ATOM   282  C  CA    . ILE A 1 78  ? 13.839  20.583  53.180  1.00 19.70  ? 335  ILE A CA    1 
ATOM   283  C  C     . ILE A 1 78  ? 12.924  21.761  53.512  1.00 20.61  ? 335  ILE A C     1 
ATOM   284  O  O     . ILE A 1 78  ? 13.179  22.521  54.442  1.00 23.06  ? 335  ILE A O     1 
ATOM   285  C  CB    . ILE A 1 78  ? 13.555  19.383  54.142  1.00 21.39  ? 335  ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 78  ? 14.316  18.124  53.711  1.00 22.22  ? 335  ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 78  ? 12.061  19.042  54.194  1.00 21.34  ? 335  ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 78  ? 14.459  17.096  54.814  1.00 24.79  ? 335  ILE A CD1   1 
ATOM   289  N  N     . ALA A 1 79  ? 11.887  21.955  52.715  1.00 19.18  ? 336  ALA A N     1 
ATOM   290  C  CA    . ALA A 1 79  ? 10.850  22.914  53.039  1.00 19.26  ? 336  ALA A CA    1 
ATOM   291  C  C     . ALA A 1 79  ? 9.484   22.261  52.942  1.00 18.62  ? 336  ALA A C     1 
ATOM   292  O  O     . ALA A 1 79  ? 9.223   21.436  52.066  1.00 17.79  ? 336  ALA A O     1 
ATOM   293  C  CB    . ALA A 1 79  ? 10.921  24.153  52.148  1.00 19.53  ? 336  ALA A CB    1 
ATOM   294  N  N     . VAL A 1 80  ? 8.618   22.645  53.869  1.00 19.44  ? 337  VAL A N     1 
ATOM   295  C  CA    . VAL A 1 80  ? 7.249   22.224  53.911  1.00 19.95  ? 337  VAL A CA    1 
ATOM   296  C  C     . VAL A 1 80  ? 6.356   23.454  53.976  1.00 20.40  ? 337  VAL A C     1 
ATOM   297  O  O     . VAL A 1 80  ? 6.561   24.328  54.822  1.00 22.17  ? 337  VAL A O     1 
ATOM   298  C  CB    . VAL A 1 80  ? 6.956   21.384  55.190  1.00 21.73  ? 337  VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1 80  ? 5.466   21.029  55.253  1.00 22.33  ? 337  VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1 80  ? 7.813   20.117  55.240  1.00 21.00  ? 337  VAL A CG2   1 
ATOM   301  N  N     . VAL A 1 81  ? 5.335   23.503  53.126  1.00 19.76  ? 338  VAL A N     1 
ATOM   302  C  CA    . VAL A 1 81  ? 4.320   24.549  53.233  1.00 19.82  ? 338  VAL A CA    1 
ATOM   303  C  C     . VAL A 1 81  ? 2.970   23.858  53.372  1.00 20.22  ? 338  VAL A C     1 
ATOM   304  O  O     . VAL A 1 81  ? 2.622   22.947  52.599  1.00 19.46  ? 338  VAL A O     1 
ATOM   305  C  CB    . VAL A 1 81  ? 4.335   25.520  52.035  1.00 20.16  ? 338  VAL A CB    1 
ATOM   306  C  CG1   . VAL A 1 81  ? 3.024   26.335  52.014  1.00 20.02  ? 338  VAL A CG1   1 
ATOM   307  C  CG2   . VAL A 1 81  ? 5.540   26.463  52.103  1.00 19.53  ? 338  VAL A CG2   1 
ATOM   308  N  N     . ASN A 1 82  ? 2.221   24.225  54.397  1.00 21.17  ? 339  ASN A N     1 
ATOM   309  C  CA    . ASN A 1 82  ? 0.930   23.634  54.574  1.00 22.33  ? 339  ASN A CA    1 
ATOM   310  C  C     . ASN A 1 82  ? -0.032  24.651  55.184  1.00 24.84  ? 339  ASN A C     1 
ATOM   311  O  O     . ASN A 1 82  ? 0.281   25.830  55.247  1.00 24.88  ? 339  ASN A O     1 
ATOM   312  C  CB    . ASN A 1 82  ? 1.030   22.335  55.402  1.00 22.42  ? 339  ASN A CB    1 
ATOM   313  C  CG    . ASN A 1 82  ? 1.558   22.570  56.798  1.00 23.64  ? 339  ASN A CG    1 
ATOM   314  O  OD1   . ASN A 1 82  ? 1.364   23.644  57.358  1.00 23.98  ? 339  ASN A OD1   1 
ATOM   315  N  ND2   . ASN A 1 82  ? 2.249   21.576  57.362  1.00 23.37  ? 339  ASN A ND2   1 
ATOM   316  N  N     . GLU A 1 83  ? -1.192  24.189  55.642  1.00 27.20  ? 340  GLU A N     1 
ATOM   317  C  CA    . GLU A 1 83  ? -2.225  25.080  56.155  1.00 30.62  ? 340  GLU A CA    1 
ATOM   318  C  C     . GLU A 1 83  ? -1.756  25.823  57.415  1.00 31.15  ? 340  GLU A C     1 
ATOM   319  O  O     . GLU A 1 83  ? -2.306  26.859  57.743  1.00 31.17  ? 340  GLU A O     1 
ATOM   320  C  CB    . GLU A 1 83  ? -3.513  24.286  56.456  1.00 35.36  ? 340  GLU A CB    1 
ATOM   321  C  CG    . GLU A 1 83  ? -3.361  23.308  57.632  1.00 39.68  ? 340  GLU A CG    1 
ATOM   322  C  CD    . GLU A 1 83  ? -4.269  22.074  57.561  1.00 45.45  ? 340  GLU A CD    1 
ATOM   323  O  OE1   . GLU A 1 83  ? -5.399  22.201  58.057  1.00 49.08  ? 340  GLU A OE1   1 
ATOM   324  O  OE2   . GLU A 1 83  ? -3.856  20.970  57.037  1.00 50.07  ? 340  GLU A OE2   1 
ATOM   325  N  N     . HIS A 1 84  ? -0.773  25.284  58.128  1.00 29.54  ? 341  HIS A N     1 
ATOM   326  C  CA    . HIS A 1 84  ? -0.285  25.891  59.360  1.00 31.19  ? 341  HIS A CA    1 
ATOM   327  C  C     . HIS A 1 84  ? 0.881   26.834  59.189  1.00 30.25  ? 341  HIS A C     1 
ATOM   328  O  O     . HIS A 1 84  ? 1.211   27.565  60.099  1.00 32.60  ? 341  HIS A O     1 
ATOM   329  C  CB    . HIS A 1 84  ? 0.148   24.818  60.357  1.00 32.13  ? 341  HIS A CB    1 
ATOM   330  C  CG    . HIS A 1 84  ? -0.913  23.806  60.663  1.00 33.85  ? 341  HIS A CG    1 
ATOM   331  N  ND1   . HIS A 1 84  ? -0.830  22.498  60.244  1.00 34.38  ? 341  HIS A ND1   1 
ATOM   332  C  CD2   . HIS A 1 84  ? -2.114  23.931  61.326  1.00 35.42  ? 341  HIS A CD2   1 
ATOM   333  C  CE1   . HIS A 1 84  ? -1.932  21.844  60.668  1.00 35.84  ? 341  HIS A CE1   1 
ATOM   334  N  NE2   . HIS A 1 84  ? -2.703  22.720  61.328  1.00 36.96  ? 341  HIS A NE2   1 
ATOM   335  N  N     . GLY A 1 85  ? 1.538   26.831  58.056  1.00 28.09  ? 342  GLY A N     1 
ATOM   336  C  CA    . GLY A 1 85  ? 2.611   27.784  57.813  1.00 27.18  ? 342  GLY A CA    1 
ATOM   337  C  C     . GLY A 1 85  ? 3.656   27.297  56.846  1.00 24.58  ? 342  GLY A C     1 
ATOM   338  O  O     . GLY A 1 85  ? 3.440   26.370  56.080  1.00 22.92  ? 342  GLY A O     1 
ATOM   339  N  N     . ARG A 1 86  ? 4.815   27.924  56.919  1.00 24.56  ? 343  ARG A N     1 
ATOM   340  C  CA    . ARG A 1 86  ? 5.922   27.601  56.059  1.00 23.83  ? 343  ARG A CA    1 
ATOM   341  C  C     . ARG A 1 86  ? 7.102   27.271  56.947  1.00 24.80  ? 343  ARG A C     1 
ATOM   342  O  O     . ARG A 1 86  ? 7.413   28.024  57.877  1.00 25.07  ? 343  ARG A O     1 
ATOM   343  C  CB    . ARG A 1 86  ? 6.287   28.793  55.163  1.00 24.10  ? 343  ARG A CB    1 
ATOM   344  C  CG    . ARG A 1 86  ? 5.087   29.488  54.467  1.00 24.30  ? 343  ARG A CG    1 
ATOM   345  C  CD    . ARG A 1 86  ? 5.537   30.313  53.289  1.00 24.63  ? 343  ARG A CD    1 
ATOM   346  N  NE    . ARG A 1 86  ? 4.450   31.159  52.801  1.00 25.66  ? 343  ARG A NE    1 
ATOM   347  C  CZ    . ARG A 1 86  ? 4.179   32.399  53.189  1.00 27.29  ? 343  ARG A CZ    1 
ATOM   348  N  NH1   . ARG A 1 86  ? 4.918   33.060  54.079  1.00 28.21  ? 343  ARG A NH1   1 
ATOM   349  N  NH2   . ARG A 1 86  ? 3.125   32.992  52.663  1.00 27.97  ? 343  ARG A NH2   1 
ATOM   350  N  N     . PHE A 1 87  ? 7.809   26.204  56.578  1.00 23.75  ? 344  PHE A N     1 
ATOM   351  C  CA    . PHE A 1 87  ? 8.862   25.657  57.425  1.00 24.69  ? 344  PHE A CA    1 
ATOM   352  C  C     . PHE A 1 87  ? 10.076  25.279  56.600  1.00 23.51  ? 344  PHE A C     1 
ATOM   353  O  O     . PHE A 1 87  ? 9.956   24.725  55.476  1.00 22.23  ? 344  PHE A O     1 
ATOM   354  C  CB    . PHE A 1 87  ? 8.349   24.426  58.234  1.00 25.30  ? 344  PHE A CB    1 
ATOM   355  C  CG    . PHE A 1 87  ? 7.031   24.639  58.930  1.00 26.40  ? 344  PHE A CG    1 
ATOM   356  C  CD1   . PHE A 1 87  ? 6.970   25.165  60.214  1.00 29.01  ? 344  PHE A CD1   1 
ATOM   357  C  CD2   . PHE A 1 87  ? 5.852   24.284  58.302  1.00 26.18  ? 344  PHE A CD2   1 
ATOM   358  C  CE1   . PHE A 1 87  ? 5.762   25.357  60.851  1.00 30.07  ? 344  PHE A CE1   1 
ATOM   359  C  CE2   . PHE A 1 87  ? 4.637   24.490  58.925  1.00 27.68  ? 344  PHE A CE2   1 
ATOM   360  C  CZ    . PHE A 1 87  ? 4.594   25.027  60.197  1.00 29.55  ? 344  PHE A CZ    1 
ATOM   361  N  N     . PHE A 1 88  ? 11.249  25.593  57.129  1.00 24.08  ? 345  PHE A N     1 
ATOM   362  C  CA    . PHE A 1 88  ? 12.483  25.036  56.615  1.00 24.48  ? 345  PHE A CA    1 
ATOM   363  C  C     . PHE A 1 88  ? 13.092  24.118  57.675  1.00 25.73  ? 345  PHE A C     1 
ATOM   364  O  O     . PHE A 1 88  ? 13.183  24.502  58.864  1.00 26.83  ? 345  PHE A O     1 
ATOM   365  C  CB    . PHE A 1 88  ? 13.465  26.148  56.298  1.00 26.43  ? 345  PHE A CB    1 
ATOM   366  C  CG    . PHE A 1 88  ? 14.801  25.662  55.889  1.00 27.26  ? 345  PHE A CG    1 
ATOM   367  C  CD1   . PHE A 1 88  ? 15.037  25.279  54.578  1.00 26.19  ? 345  PHE A CD1   1 
ATOM   368  C  CD2   . PHE A 1 88  ? 15.834  25.550  56.821  1.00 30.24  ? 345  PHE A CD2   1 
ATOM   369  C  CE1   . PHE A 1 88  ? 16.289  24.829  54.173  1.00 26.51  ? 345  PHE A CE1   1 
ATOM   370  C  CE2   . PHE A 1 88  ? 17.077  25.084  56.440  1.00 29.78  ? 345  PHE A CE2   1 
ATOM   371  C  CZ    . PHE A 1 88  ? 17.300  24.712  55.114  1.00 28.89  ? 345  PHE A CZ    1 
ATOM   372  N  N     . LEU A 1 89  ? 13.499  22.928  57.245  1.00 25.31  ? 346  LEU A N     1 
ATOM   373  C  CA    . LEU A 1 89  ? 14.188  21.956  58.097  1.00 27.63  ? 346  LEU A CA    1 
ATOM   374  C  C     . LEU A 1 89  ? 15.511  21.573  57.504  1.00 28.09  ? 346  LEU A C     1 
ATOM   375  O  O     . LEU A 1 89  ? 15.631  21.338  56.278  1.00 25.82  ? 346  LEU A O     1 
ATOM   376  C  CB    . LEU A 1 89  ? 13.370  20.687  58.212  1.00 27.78  ? 346  LEU A CB    1 
ATOM   377  C  CG    . LEU A 1 89  ? 12.145  20.769  59.117  1.00 28.95  ? 346  LEU A CG    1 
ATOM   378  C  CD1   . LEU A 1 89  ? 11.148  19.682  58.708  1.00 29.26  ? 346  LEU A CD1   1 
ATOM   379  C  CD2   . LEU A 1 89  ? 12.577  20.647  60.568  1.00 32.47  ? 346  LEU A CD2   1 
ATOM   380  N  N     . ARG A 1 90  ? 16.487  21.456  58.382  1.00 31.07  ? 347  ARG A N     1 
ATOM   381  C  CA    . ARG A 1 90  ? 17.796  20.943  58.048  1.00 32.15  ? 347  ARG A CA    1 
ATOM   382  C  C     . ARG A 1 90  ? 17.644  19.427  57.896  1.00 31.65  ? 347  ARG A C     1 
ATOM   383  O  O     . ARG A 1 90  ? 16.992  18.776  58.698  1.00 31.95  ? 347  ARG A O     1 
ATOM   384  C  CB    . ARG A 1 90  ? 18.791  21.275  59.158  1.00 37.02  ? 347  ARG A CB    1 
ATOM   385  C  CG    . ARG A 1 90  ? 19.159  22.734  59.266  1.00 40.09  ? 347  ARG A CG    1 
ATOM   386  C  CD    . ARG A 1 90  ? 20.032  23.016  60.474  1.00 45.41  ? 347  ARG A CD    1 
ATOM   387  N  NE    . ARG A 1 90  ? 20.047  24.457  60.727  1.00 49.96  ? 347  ARG A NE    1 
ATOM   388  C  CZ    . ARG A 1 90  ? 19.305  25.097  61.631  1.00 53.73  ? 347  ARG A CZ    1 
ATOM   389  N  NH1   . ARG A 1 90  ? 18.490  24.441  62.451  1.00 55.38  ? 347  ARG A NH1   1 
ATOM   390  N  NH2   . ARG A 1 90  ? 19.398  26.417  61.732  1.00 57.26  ? 347  ARG A NH2   1 
ATOM   391  N  N     . PRO A 1 91  ? 18.223  18.852  56.852  1.00 31.58  ? 348  PRO A N     1 
ATOM   392  C  CA    . PRO A 1 91  ? 18.048  17.432  56.557  1.00 31.40  ? 348  PRO A CA    1 
ATOM   393  C  C     . PRO A 1 91  ? 18.625  16.500  57.609  1.00 34.08  ? 348  PRO A C     1 
ATOM   394  O  O     . PRO A 1 91  ? 18.064  15.448  57.873  1.00 34.13  ? 348  PRO A O     1 
ATOM   395  C  CB    . PRO A 1 91  ? 18.825  17.245  55.249  1.00 31.32  ? 348  PRO A CB    1 
ATOM   396  C  CG    . PRO A 1 91  ? 19.163  18.615  54.788  1.00 31.92  ? 348  PRO A CG    1 
ATOM   397  C  CD    . PRO A 1 91  ? 19.205  19.489  55.979  1.00 32.99  ? 348  PRO A CD    1 
ATOM   398  N  N     . GLU A 1 92  ? 19.738  16.859  58.211  1.00 37.59  ? 349  GLU A N     1 
ATOM   399  C  CA    . GLU A 1 92  ? 20.239  16.001  59.293  1.00 42.22  ? 349  GLU A CA    1 
ATOM   400  C  C     . GLU A 1 92  ? 19.265  15.960  60.491  1.00 43.10  ? 349  GLU A C     1 
ATOM   401  O  O     . GLU A 1 92  ? 19.286  15.046  61.280  1.00 46.57  ? 349  GLU A O     1 
ATOM   402  C  CB    . GLU A 1 92  ? 21.647  16.407  59.721  1.00 44.27  ? 349  GLU A CB    1 
ATOM   403  C  CG    . GLU A 1 92  ? 21.733  17.740  60.449  1.00 49.27  ? 349  GLU A CG    1 
ATOM   404  C  CD    . GLU A 1 92  ? 21.761  18.962  59.530  1.00 50.73  ? 349  GLU A CD    1 
ATOM   405  O  OE1   . GLU A 1 92  ? 21.617  18.825  58.263  1.00 46.09  ? 349  GLU A OE1   1 
ATOM   406  O  OE2   . GLU A 1 92  ? 21.928  20.074  60.117  1.00 54.87  ? 349  GLU A OE2   1 
ATOM   407  N  N     . THR A 1 93  ? 18.405  16.957  60.615  1.00 42.91  ? 350  THR A N     1 
ATOM   408  C  CA    . THR A 1 93  ? 17.407  16.980  61.681  1.00 43.76  ? 350  THR A CA    1 
ATOM   409  C  C     . THR A 1 93  ? 16.197  16.159  61.224  1.00 41.19  ? 350  THR A C     1 
ATOM   410  O  O     . THR A 1 93  ? 15.825  15.157  61.850  1.00 41.32  ? 350  THR A O     1 
ATOM   411  C  CB    . THR A 1 93  ? 16.974  18.433  61.967  1.00 44.89  ? 350  THR A CB    1 
ATOM   412  O  OG1   . THR A 1 93  ? 18.142  19.188  62.323  1.00 46.45  ? 350  THR A OG1   1 
ATOM   413  C  CG2   . THR A 1 93  ? 15.945  18.502  63.095  1.00 47.89  ? 350  THR A CG2   1 
ATOM   414  N  N     . ALA A 1 94  ? 15.621  16.576  60.102  1.00 37.01  ? 351  ALA A N     1 
ATOM   415  C  CA    . ALA A 1 94  ? 14.387  15.993  59.597  1.00 34.45  ? 351  ALA A CA    1 
ATOM   416  C  C     . ALA A 1 94  ? 14.538  14.497  59.301  1.00 32.85  ? 351  ALA A C     1 
ATOM   417  O  O     . ALA A 1 94  ? 13.698  13.723  59.691  1.00 33.18  ? 351  ALA A O     1 
ATOM   418  C  CB    . ALA A 1 94  ? 13.942  16.725  58.356  1.00 32.15  ? 351  ALA A CB    1 
ATOM   419  N  N     . LEU A 1 95  ? 15.620  14.095  58.647  1.00 31.53  ? 352  LEU A N     1 
ATOM   420  C  CA    . LEU A 1 95  ? 15.734  12.722  58.181  1.00 31.44  ? 352  LEU A CA    1 
ATOM   421  C  C     . LEU A 1 95  ? 16.145  11.724  59.250  1.00 33.22  ? 352  LEU A C     1 
ATOM   422  O  O     . LEU A 1 95  ? 16.089  10.540  58.967  1.00 35.21  ? 352  LEU A O     1 
ATOM   423  C  CB    . LEU A 1 95  ? 16.641  12.607  56.952  1.00 29.54  ? 352  LEU A CB    1 
ATOM   424  C  CG    . LEU A 1 95  ? 16.205  13.448  55.742  1.00 28.61  ? 352  LEU A CG    1 
ATOM   425  C  CD1   . LEU A 1 95  ? 17.078  13.231  54.517  1.00 27.89  ? 352  LEU A CD1   1 
ATOM   426  C  CD2   . LEU A 1 95  ? 14.767  13.127  55.346  1.00 27.10  ? 352  LEU A CD2   1 
ATOM   427  N  N     . ALA A 1 96  ? 16.531  12.188  60.442  1.00 34.24  ? 353  ALA A N     1 
ATOM   428  C  CA    . ALA A 1 96  ? 16.793  11.337  61.609  1.00 36.11  ? 353  ALA A CA    1 
ATOM   429  C  C     . ALA A 1 96  ? 15.597  11.347  62.562  1.00 36.93  ? 353  ALA A C     1 
ATOM   430  O  O     . ALA A 1 96  ? 15.640  10.733  63.607  1.00 38.06  ? 353  ALA A O     1 
ATOM   431  C  CB    . ALA A 1 96  ? 18.035  11.823  62.367  1.00 37.77  ? 353  ALA A CB    1 
ATOM   432  N  N     . ASP A 1 97  ? 14.540  12.075  62.223  1.00 36.28  ? 354  ASP A N     1 
ATOM   433  C  CA    . ASP A 1 97  ? 13.400  12.197  63.118  1.00 37.80  ? 354  ASP A CA    1 
ATOM   434  C  C     . ASP A 1 97  ? 12.393  11.134  62.713  1.00 36.79  ? 354  ASP A C     1 
ATOM   435  O  O     . ASP A 1 97  ? 11.941  11.140  61.567  1.00 33.22  ? 354  ASP A O     1 
ATOM   436  C  CB    . ASP A 1 97  ? 12.757  13.590  62.984  1.00 38.79  ? 354  ASP A CB    1 
ATOM   437  C  CG    . ASP A 1 97  ? 11.575  13.771  63.894  1.00 41.61  ? 354  ASP A CG    1 
ATOM   438  O  OD1   . ASP A 1 97  ? 10.454  13.332  63.525  1.00 44.35  ? 354  ASP A OD1   1 
ATOM   439  O  OD2   . ASP A 1 97  ? 11.754  14.376  64.965  1.00 42.88  ? 354  ASP A OD2   1 
ATOM   440  N  N     . PRO A 1 98  ? 12.004  10.247  63.649  1.00 37.63  ? 355  PRO A N     1 
ATOM   441  C  CA    . PRO A 1 98  ? 11.086  9.156   63.255  1.00 37.82  ? 355  PRO A CA    1 
ATOM   442  C  C     . PRO A 1 98  ? 9.711   9.593   62.770  1.00 36.91  ? 355  PRO A C     1 
ATOM   443  O  O     . PRO A 1 98  ? 9.183   8.988   61.868  1.00 35.73  ? 355  PRO A O     1 
ATOM   444  C  CB    . PRO A 1 98  ? 10.927  8.314   64.533  1.00 40.20  ? 355  PRO A CB    1 
ATOM   445  C  CG    . PRO A 1 98  ? 11.986  8.759   65.443  1.00 41.63  ? 355  PRO A CG    1 
ATOM   446  C  CD    . PRO A 1 98  ? 12.572  10.052  64.986  1.00 40.28  ? 355  PRO A CD    1 
ATOM   447  N  N     . GLN A 1 99  ? 9.137   10.626  63.372  1.00 38.18  ? 356  GLN A N     1 
ATOM   448  C  CA    . GLN A 1 99  ? 7.809   11.081  62.978  1.00 38.10  ? 356  GLN A CA    1 
ATOM   449  C  C     . GLN A 1 99  ? 7.862   11.708  61.561  1.00 34.77  ? 356  GLN A C     1 
ATOM   450  O  O     . GLN A 1 99  ? 6.937   11.499  60.742  1.00 33.87  ? 356  GLN A O     1 
ATOM   451  C  CB    . GLN A 1 99  ? 7.239   12.055  64.018  1.00 41.22  ? 356  GLN A CB    1 
ATOM   452  C  CG    . GLN A 1 99  ? 6.873   11.422  65.370  1.00 45.65  ? 356  GLN A CG    1 
ATOM   453  C  CD    . GLN A 1 99  ? 8.086   11.067  66.223  1.00 49.84  ? 356  GLN A CD    1 
ATOM   454  O  OE1   . GLN A 1 99  ? 8.059   10.104  67.027  1.00 57.27  ? 356  GLN A OE1   1 
ATOM   455  N  NE2   . GLN A 1 99  ? 9.156   11.854  66.090  1.00 50.32  ? 356  GLN A NE2   1 
ATOM   456  N  N     . PHE A 1 100 ? 8.947   12.422  61.249  1.00 32.71  ? 357  PHE A N     1 
ATOM   457  C  CA    . PHE A 1 100 ? 9.094   13.007  59.911  1.00 30.39  ? 357  PHE A CA    1 
ATOM   458  C  C     . PHE A 1 100 ? 9.251   11.931  58.852  1.00 29.00  ? 357  PHE A C     1 
ATOM   459  O  O     . PHE A 1 100 ? 8.607   11.986  57.801  1.00 26.41  ? 357  PHE A O     1 
ATOM   460  C  CB    . PHE A 1 100 ? 10.271  13.983  59.794  1.00 29.84  ? 357  PHE A CB    1 
ATOM   461  C  CG    . PHE A 1 100 ? 10.253  14.782  58.513  1.00 28.22  ? 357  PHE A CG    1 
ATOM   462  C  CD1   . PHE A 1 100 ? 9.402   15.883  58.370  1.00 28.87  ? 357  PHE A CD1   1 
ATOM   463  C  CD2   . PHE A 1 100 ? 11.006  14.398  57.428  1.00 26.82  ? 357  PHE A CD2   1 
ATOM   464  C  CE1   . PHE A 1 100 ? 9.356   16.606  57.187  1.00 27.63  ? 357  PHE A CE1   1 
ATOM   465  C  CE2   . PHE A 1 100 ? 10.957  15.110  56.240  1.00 25.84  ? 357  PHE A CE2   1 
ATOM   466  C  CZ    . PHE A 1 100 ? 10.136  16.224  56.114  1.00 25.38  ? 357  PHE A CZ    1 
ATOM   467  N  N     . VAL A 1 101 ? 10.088  10.929  59.148  1.00 29.97  ? 358  VAL A N     1 
ATOM   468  C  CA    . VAL A 1 101 ? 10.271  9.839   58.202  1.00 28.65  ? 358  VAL A CA    1 
ATOM   469  C  C     . VAL A 1 101 ? 8.980   9.048   58.029  1.00 28.01  ? 358  VAL A C     1 
ATOM   470  O  O     . VAL A 1 101 ? 8.655   8.701   56.906  1.00 26.60  ? 358  VAL A O     1 
ATOM   471  C  CB    . VAL A 1 101 ? 11.451  8.927   58.606  1.00 30.32  ? 358  VAL A CB    1 
ATOM   472  C  CG1   . VAL A 1 101 ? 11.529  7.691   57.702  1.00 29.57  ? 358  VAL A CG1   1 
ATOM   473  C  CG2   . VAL A 1 101 ? 12.763  9.720   58.546  1.00 29.90  ? 358  VAL A CG2   1 
ATOM   474  N  N     . ALA A 1 102 ? 8.245   8.775   59.108  1.00 29.70  ? 359  ALA A N     1 
ATOM   475  C  CA    . ALA A 1 102 ? 6.950   8.089   58.990  1.00 30.21  ? 359  ALA A CA    1 
ATOM   476  C  C     . ALA A 1 102 ? 5.996   8.927   58.131  1.00 29.10  ? 359  ALA A C     1 
ATOM   477  O  O     . ALA A 1 102 ? 5.261   8.405   57.295  1.00 28.89  ? 359  ALA A O     1 
ATOM   478  C  CB    . ALA A 1 102 ? 6.331   7.808   60.359  1.00 33.08  ? 359  ALA A CB    1 
ATOM   479  N  N     . TRP A 1 103 ? 6.008   10.244  58.329  1.00 28.48  ? 360  TRP A N     1 
ATOM   480  C  CA    . TRP A 1 103 ? 5.192   11.130  57.506  1.00 27.56  ? 360  TRP A CA    1 
ATOM   481  C  C     . TRP A 1 103 ? 5.552   11.047  56.046  1.00 25.06  ? 360  TRP A C     1 
ATOM   482  O  O     . TRP A 1 103 ? 4.705   10.955  55.221  1.00 25.36  ? 360  TRP A O     1 
ATOM   483  C  CB    . TRP A 1 103 ? 5.253   12.561  58.059  1.00 27.12  ? 360  TRP A CB    1 
ATOM   484  C  CG    . TRP A 1 103 ? 4.476   13.555  57.260  1.00 26.09  ? 360  TRP A CG    1 
ATOM   485  C  CD1   . TRP A 1 103 ? 3.128   13.871  57.361  1.00 26.72  ? 360  TRP A CD1   1 
ATOM   486  C  CD2   . TRP A 1 103 ? 5.003   14.431  56.232  1.00 23.92  ? 360  TRP A CD2   1 
ATOM   487  N  NE1   . TRP A 1 103 ? 2.812   14.851  56.475  1.00 25.09  ? 360  TRP A NE1   1 
ATOM   488  C  CE2   . TRP A 1 103 ? 3.904   15.216  55.766  1.00 23.86  ? 360  TRP A CE2   1 
ATOM   489  C  CE3   . TRP A 1 103 ? 6.264   14.622  55.672  1.00 23.23  ? 360  TRP A CE3   1 
ATOM   490  C  CZ2   . TRP A 1 103 ? 4.054   16.165  54.770  1.00 22.75  ? 360  TRP A CZ2   1 
ATOM   491  C  CZ3   . TRP A 1 103 ? 6.417   15.568  54.668  1.00 22.05  ? 360  TRP A CZ3   1 
ATOM   492  C  CH2   . TRP A 1 103 ? 5.344   16.333  54.236  1.00 21.97  ? 360  TRP A CH2   1 
ATOM   493  N  N     . LEU A 1 104 ? 6.827   11.017  55.719  1.00 24.63  ? 361  LEU A N     1 
ATOM   494  C  CA    . LEU A 1 104 ? 7.230   10.951  54.332  1.00 23.85  ? 361  LEU A CA    1 
ATOM   495  C  C     . LEU A 1 104 ? 6.718   9.661   53.674  1.00 24.00  ? 361  LEU A C     1 
ATOM   496  O  O     . LEU A 1 104 ? 6.330   9.699   52.516  1.00 22.36  ? 361  LEU A O     1 
ATOM   497  C  CB    . LEU A 1 104 ? 8.756   10.984  54.205  1.00 23.50  ? 361  LEU A CB    1 
ATOM   498  C  CG    . LEU A 1 104 ? 9.516   12.284  54.358  1.00 24.29  ? 361  LEU A CG    1 
ATOM   499  C  CD1   . LEU A 1 104 ? 11.034  11.947  54.386  1.00 24.71  ? 361  LEU A CD1   1 
ATOM   500  C  CD2   . LEU A 1 104 ? 9.154   13.293  53.240  1.00 21.80  ? 361  LEU A CD2   1 
ATOM   501  N  N     . GLY A 1 105 ? 6.748   8.556   54.425  1.00 25.23  ? 362  GLY A N     1 
ATOM   502  C  CA    . GLY A 1 105 ? 6.335   7.248   53.921  1.00 26.45  ? 362  GLY A CA    1 
ATOM   503  C  C     . GLY A 1 105 ? 4.846   6.912   54.048  1.00 28.90  ? 362  GLY A C     1 
ATOM   504  O  O     . GLY A 1 105 ? 4.421   5.822   53.656  1.00 28.79  ? 362  GLY A O     1 
ATOM   505  N  N     . ASP A 1 106 ? 4.047   7.831   54.591  1.00 28.99  ? 363  ASP A N     1 
ATOM   506  C  CA    . ASP A 1 106 ? 2.599   7.598   54.750  1.00 31.18  ? 363  ASP A CA    1 
ATOM   507  C  C     . ASP A 1 106 ? 1.851   8.065   53.508  1.00 30.50  ? 363  ASP A C     1 
ATOM   508  O  O     . ASP A 1 106 ? 1.763   9.292   53.189  1.00 27.62  ? 363  ASP A O     1 
ATOM   509  C  CB    . ASP A 1 106 ? 2.106   8.310   55.992  1.00 32.11  ? 363  ASP A CB    1 
ATOM   510  C  CG    . ASP A 1 106 ? 0.692   7.958   56.366  1.00 33.72  ? 363  ASP A CG    1 
ATOM   511  O  OD1   . ASP A 1 106 ? -0.130  7.519   55.538  1.00 33.72  ? 363  ASP A OD1   1 
ATOM   512  O  OD2   . ASP A 1 106 ? 0.399   8.202   57.523  1.00 34.94  ? 363  ASP A OD2   1 
ATOM   513  N  N     . GLU A 1 107 ? 1.326   7.084   52.784  1.00 31.48  ? 364  GLU A N     1 
ATOM   514  C  CA    . GLU A 1 107 ? 0.594   7.345   51.550  1.00 32.84  ? 364  GLU A CA    1 
ATOM   515  C  C     . GLU A 1 107 ? -0.649  8.216   51.795  1.00 32.15  ? 364  GLU A C     1 
ATOM   516  O  O     . GLU A 1 107 ? -1.107  8.887   50.888  1.00 32.77  ? 364  GLU A O     1 
ATOM   517  C  CB    . GLU A 1 107 ? 0.229   6.015   50.909  1.00 37.50  ? 364  GLU A CB    1 
ATOM   518  C  CG    . GLU A 1 107 ? -0.630  6.037   49.643  1.00 42.33  ? 364  GLU A CG    1 
ATOM   519  C  CD    . GLU A 1 107 ? -0.026  6.760   48.429  1.00 45.27  ? 364  GLU A CD    1 
ATOM   520  O  OE1   . GLU A 1 107 ? 1.238   6.926   48.316  1.00 50.56  ? 364  GLU A OE1   1 
ATOM   521  O  OE2   . GLU A 1 107 ? -0.849  7.173   47.555  1.00 49.23  ? 364  GLU A OE2   1 
ATOM   522  N  N     . THR A 1 108 ? -1.181  8.235   53.009  1.00 32.41  ? 365  THR A N     1 
ATOM   523  C  CA    . THR A 1 108 ? -2.385  9.013   53.263  1.00 32.99  ? 365  THR A CA    1 
ATOM   524  C  C     . THR A 1 108 ? -2.070  10.495  53.547  1.00 31.92  ? 365  THR A C     1 
ATOM   525  O  O     . THR A 1 108 ? -2.980  11.303  53.667  1.00 31.60  ? 365  THR A O     1 
ATOM   526  C  CB    . THR A 1 108 ? -3.200  8.482   54.457  1.00 35.70  ? 365  THR A CB    1 
ATOM   527  O  OG1   . THR A 1 108 ? -2.492  8.739   55.673  1.00 37.23  ? 365  THR A OG1   1 
ATOM   528  C  CG2   . THR A 1 108 ? -3.515  6.973   54.332  1.00 38.00  ? 365  THR A CG2   1 
ATOM   529  N  N     . LYS A 1 109 ? -0.789  10.833  53.692  1.00 30.93  ? 366  LYS A N     1 
ATOM   530  C  CA    . LYS A 1 109 ? -0.335  12.213  53.868  1.00 29.58  ? 366  LYS A CA    1 
ATOM   531  C  C     . LYS A 1 109 ? 0.109   12.714  52.517  1.00 27.43  ? 366  LYS A C     1 
ATOM   532  O  O     . LYS A 1 109 ? 1.168   12.312  52.002  1.00 27.00  ? 366  LYS A O     1 
ATOM   533  C  CB    . LYS A 1 109 ? 0.802   12.293  54.910  1.00 30.20  ? 366  LYS A CB    1 
ATOM   534  C  CG    . LYS A 1 109 ? 0.539   11.616  56.264  1.00 32.85  ? 366  LYS A CG    1 
ATOM   535  C  CD    . LYS A 1 109 ? -0.454  12.358  57.154  1.00 35.14  ? 366  LYS A CD    1 
ATOM   536  C  CE    . LYS A 1 109 ? -0.655  11.609  58.465  1.00 38.55  ? 366  LYS A CE    1 
ATOM   537  N  NZ    . LYS A 1 109 ? -2.012  11.040  58.415  1.00 41.19  ? 366  LYS A NZ    1 
ATOM   538  N  N     . LYS A 1 110 ? -0.684  13.607  51.920  1.00 26.70  ? 367  LYS A N     1 
ATOM   539  C  CA    . LYS A 1 110 ? -0.498  13.951  50.530  1.00 25.00  ? 367  LYS A CA    1 
ATOM   540  C  C     . LYS A 1 110 ? 0.508   15.082  50.334  1.00 23.39  ? 367  LYS A C     1 
ATOM   541  O  O     . LYS A 1 110 ? 0.470   16.085  51.052  1.00 24.05  ? 367  LYS A O     1 
ATOM   542  C  CB    . LYS A 1 110 ? -1.863  14.344  49.927  1.00 27.02  ? 367  LYS A CB    1 
ATOM   543  C  CG    . LYS A 1 110 ? -2.886  13.237  50.049  1.00 29.12  ? 367  LYS A CG    1 
ATOM   544  C  CD    . LYS A 1 110 ? -2.405  11.921  49.410  1.00 30.46  ? 367  LYS A CD    1 
ATOM   545  C  CE    . LYS A 1 110 ? -3.500  10.836  49.553  1.00 34.27  ? 367  LYS A CE    1 
ATOM   546  N  NZ    . LYS A 1 110 ? -2.925  9.490   49.237  1.00 36.95  ? 367  LYS A NZ    1 
ATOM   547  N  N     . LYS A 1 111 ? 1.414   14.910  49.388  1.00 20.85  ? 368  LYS A N     1 
ATOM   548  C  CA    . LYS A 1 111 ? 2.401   15.904  49.093  1.00 20.41  ? 368  LYS A CA    1 
ATOM   549  C  C     . LYS A 1 111 ? 2.292   16.392  47.660  1.00 19.14  ? 368  LYS A C     1 
ATOM   550  O  O     . LYS A 1 111 ? 2.041   15.623  46.718  1.00 19.16  ? 368  LYS A O     1 
ATOM   551  C  CB    . LYS A 1 111 ? 3.814   15.365  49.329  1.00 20.12  ? 368  LYS A CB    1 
ATOM   552  C  CG    . LYS A 1 111 ? 4.105   14.928  50.748  1.00 21.37  ? 368  LYS A CG    1 
ATOM   553  C  CD    . LYS A 1 111 ? 4.012   13.434  50.904  1.00 22.01  ? 368  LYS A CD    1 
ATOM   554  C  CE    . LYS A 1 111 ? 4.244   12.997  52.334  1.00 24.00  ? 368  LYS A CE    1 
ATOM   555  N  NZ    . LYS A 1 111 ? 3.648   11.643  52.587  1.00 25.13  ? 368  LYS A NZ    1 
ATOM   556  N  N     . SER A 1 112 ? 2.529   17.675  47.485  1.00 18.24  ? 369  SER A N     1 
ATOM   557  C  CA    . SER A 1 112 ? 2.700   18.265  46.165  1.00 17.65  ? 369  SER A CA    1 
ATOM   558  C  C     . SER A 1 112 ? 4.182   18.673  46.041  1.00 17.09  ? 369  SER A C     1 
ATOM   559  O  O     . SER A 1 112 ? 4.755   19.304  46.951  1.00 17.35  ? 369  SER A O     1 
ATOM   560  C  CB    . SER A 1 112 ? 1.774   19.469  46.041  1.00 18.51  ? 369  SER A CB    1 
ATOM   561  O  OG    . SER A 1 112 ? 0.418   19.015  46.140  1.00 20.34  ? 369  SER A OG    1 
ATOM   562  N  N     . MET A 1 113 ? 4.793   18.286  44.937  1.00 16.19  ? 370  MET A N     1 
ATOM   563  C  CA    . MET A 1 113 ? 6.216   18.504  44.704  1.00 16.54  ? 370  MET A CA    1 
ATOM   564  C  C     . MET A 1 113 ? 6.518   18.909  43.296  1.00 15.91  ? 370  MET A C     1 
ATOM   565  O  O     . MET A 1 113 ? 5.649   18.867  42.410  1.00 17.89  ? 370  MET A O     1 
ATOM   566  C  CB    . MET A 1 113 ? 6.993   17.219  44.987  1.00 16.55  ? 370  MET A CB    1 
ATOM   567  C  CG    . MET A 1 113 ? 6.677   16.639  46.373  1.00 17.67  ? 370  MET A CG    1 
ATOM   568  S  SD    . MET A 1 113 ? 7.749   15.232  46.820  1.00 18.63  ? 370  MET A SD    1 
ATOM   569  C  CE    . MET A 1 113 ? 9.371   15.980  46.992  1.00 16.84  ? 370  MET A CE    1 
ATOM   570  N  N     . PHE A 1 114 ? 7.789   19.219  43.067  1.00 16.74  ? 371  PHE A N     1 
ATOM   571  C  CA    . PHE A 1 114 ? 8.326   19.381  41.718  1.00 16.69  ? 371  PHE A CA    1 
ATOM   572  C  C     . PHE A 1 114 ? 9.471   18.393  41.524  1.00 18.01  ? 371  PHE A C     1 
ATOM   573  O  O     . PHE A 1 114 ? 10.462  18.438  42.256  1.00 19.62  ? 371  PHE A O     1 
ATOM   574  C  CB    . PHE A 1 114 ? 8.806   20.796  41.546  1.00 16.96  ? 371  PHE A CB    1 
ATOM   575  C  CG    . PHE A 1 114 ? 9.334   21.115  40.152  1.00 17.44  ? 371  PHE A CG    1 
ATOM   576  C  CD1   . PHE A 1 114 ? 10.660  20.771  39.768  1.00 17.25  ? 371  PHE A CD1   1 
ATOM   577  C  CD2   . PHE A 1 114 ? 8.552   21.816  39.234  1.00 16.95  ? 371  PHE A CD2   1 
ATOM   578  C  CE1   . PHE A 1 114 ? 11.135  21.116  38.498  1.00 18.05  ? 371  PHE A CE1   1 
ATOM   579  C  CE2   . PHE A 1 114 ? 9.042   22.134  37.960  1.00 16.70  ? 371  PHE A CE2   1 
ATOM   580  C  CZ    . PHE A 1 114 ? 10.296  21.746  37.579  1.00 17.22  ? 371  PHE A CZ    1 
ATOM   581  N  N     . ASP A 1 115 ? 9.344   17.534  40.540  1.00 19.01  ? 372  ASP A N     1 
ATOM   582  C  CA    . ASP A 1 115 ? 10.383  16.507  40.238  1.00 20.39  ? 372  ASP A CA    1 
ATOM   583  C  C     . ASP A 1 115 ? 10.522  15.573  41.408  1.00 18.87  ? 372  ASP A C     1 
ATOM   584  O  O     . ASP A 1 115 ? 11.577  15.461  42.033  1.00 20.07  ? 372  ASP A O     1 
ATOM   585  C  CB    . ASP A 1 115 ? 11.735  17.101  39.883  1.00 20.94  ? 372  ASP A CB    1 
ATOM   586  C  CG    . ASP A 1 115 ? 12.704  16.032  39.231  1.00 24.27  ? 372  ASP A CG    1 
ATOM   587  O  OD1   . ASP A 1 115 ? 12.319  14.808  39.054  1.00 22.71  ? 372  ASP A OD1   1 
ATOM   588  O  OD2   . ASP A 1 115 ? 13.865  16.418  38.906  1.00 26.11  ? 372  ASP A OD2   1 
ATOM   589  N  N     . SER A 1 116 ? 9.424   14.912  41.713  1.00 19.42  ? 373  SER A N     1 
ATOM   590  C  CA    . SER A 1 116 ? 9.378   14.043  42.860  1.00 19.47  ? 373  SER A CA    1 
ATOM   591  C  C     . SER A 1 116 ? 10.271  12.771  42.688  1.00 18.96  ? 373  SER A C     1 
ATOM   592  O  O     . SER A 1 116 ? 10.743  12.245  43.690  1.00 18.34  ? 373  SER A O     1 
ATOM   593  C  CB    . SER A 1 116 ? 7.945   13.677  43.209  1.00 20.11  ? 373  SER A CB    1 
ATOM   594  O  OG    . SER A 1 116 ? 7.373   12.950  42.138  1.00 19.96  ? 373  SER A OG    1 
ATOM   595  N  N     . LYS A 1 117 ? 10.537  12.337  41.456  1.00 17.16  ? 374  LYS A N     1 
ATOM   596  C  CA    . LYS A 1 117 ? 11.480  11.221  41.255  1.00 17.88  ? 374  LYS A CA    1 
ATOM   597  C  C     . LYS A 1 117 ? 12.865  11.516  41.785  1.00 16.92  ? 374  LYS A C     1 
ATOM   598  O  O     . LYS A 1 117 ? 13.515  10.648  42.322  1.00 16.90  ? 374  LYS A O     1 
ATOM   599  C  CB    . LYS A 1 117 ? 11.587  10.862  39.782  1.00 17.40  ? 374  LYS A CB    1 
ATOM   600  C  CG    . LYS A 1 117 ? 12.516  9.723   39.437  1.00 16.38  ? 374  LYS A CG    1 
ATOM   601  C  CD    . LYS A 1 117 ? 12.126  9.035   38.139  1.00 16.54  ? 374  LYS A CD    1 
ATOM   602  C  CE    . LYS A 1 117 ? 12.273  9.874   36.873  1.00 16.30  ? 374  LYS A CE    1 
ATOM   603  N  NZ    . LYS A 1 117 ? 13.712  10.310  36.572  1.00 15.89  ? 374  LYS A NZ    1 
ATOM   604  N  N     . ARG A 1 118 ? 13.340  12.730  41.583  1.00 16.81  ? 375  ARG A N     1 
ATOM   605  C  CA    . ARG A 1 118 ? 14.662  13.138  42.087  1.00 16.75  ? 375  ARG A CA    1 
ATOM   606  C  C     . ARG A 1 118 ? 14.724  12.964  43.608  1.00 18.61  ? 375  ARG A C     1 
ATOM   607  O  O     . ARG A 1 118 ? 15.659  12.381  44.149  1.00 17.43  ? 375  ARG A O     1 
ATOM   608  C  CB    . ARG A 1 118 ? 14.946  14.588  41.680  1.00 16.83  ? 375  ARG A CB    1 
ATOM   609  C  CG    . ARG A 1 118 ? 16.000  15.391  42.436  1.00 17.62  ? 375  ARG A CG    1 
ATOM   610  C  CD    . ARG A 1 118 ? 16.194  16.850  41.865  1.00 18.67  ? 375  ARG A CD    1 
ATOM   611  N  NE    . ARG A 1 118 ? 16.725  16.719  40.525  1.00 19.04  ? 375  ARG A NE    1 
ATOM   612  C  CZ    . ARG A 1 118 ? 17.998  16.591  40.198  1.00 20.26  ? 375  ARG A CZ    1 
ATOM   613  N  NH1   . ARG A 1 118 ? 18.968  16.706  41.072  1.00 21.50  ? 375  ARG A NH1   1 
ATOM   614  N  NH2   . ARG A 1 118 ? 18.303  16.346  38.952  1.00 21.80  ? 375  ARG A NH2   1 
ATOM   615  N  N     . ALA A 1 119 ? 13.694  13.479  44.296  1.00 18.19  ? 376  ALA A N     1 
ATOM   616  C  CA    . ALA A 1 119 ? 13.648  13.385  45.725  1.00 18.66  ? 376  ALA A CA    1 
ATOM   617  C  C     . ALA A 1 119 ? 13.462  11.927  46.143  1.00 17.38  ? 376  ALA A C     1 
ATOM   618  O  O     . ALA A 1 119 ? 14.117  11.475  47.058  1.00 17.98  ? 376  ALA A O     1 
ATOM   619  C  CB    . ALA A 1 119 ? 12.503  14.247  46.277  1.00 18.74  ? 376  ALA A CB    1 
ATOM   620  N  N     . ALA A 1 120 ? 12.574  11.186  45.470  1.00 17.28  ? 377  ALA A N     1 
ATOM   621  C  CA    . ALA A 1 120 ? 12.340  9.788   45.832  1.00 17.76  ? 377  ALA A CA    1 
ATOM   622  C  C     . ALA A 1 120 ? 13.609  8.937   45.742  1.00 17.45  ? 377  ALA A C     1 
ATOM   623  O  O     . ALA A 1 120 ? 13.889  8.132   46.635  1.00 18.23  ? 377  ALA A O     1 
ATOM   624  C  CB    . ALA A 1 120 ? 11.223  9.161   44.975  1.00 17.81  ? 377  ALA A CB    1 
ATOM   625  N  N     . VAL A 1 121 ? 14.361  9.110   44.666  1.00 16.35  ? 378  VAL A N     1 
ATOM   626  C  CA    . VAL A 1 121 ? 15.586  8.345   44.482  1.00 17.05  ? 378  VAL A CA    1 
ATOM   627  C  C     . VAL A 1 121 ? 16.659  8.738   45.497  1.00 17.72  ? 378  VAL A C     1 
ATOM   628  O  O     . VAL A 1 121 ? 17.279  7.864   46.114  1.00 17.64  ? 378  VAL A O     1 
ATOM   629  C  CB    . VAL A 1 121 ? 16.099  8.436   43.025  1.00 16.43  ? 378  VAL A CB    1 
ATOM   630  C  CG1   . VAL A 1 121 ? 17.495  7.864   42.947  1.00 16.49  ? 378  VAL A CG1   1 
ATOM   631  C  CG2   . VAL A 1 121 ? 15.119  7.755   42.075  1.00 16.03  ? 378  VAL A CG2   1 
ATOM   632  N  N     . ALA A 1 122 ? 16.862  10.045  45.745  1.00 17.77  ? 379  ALA A N     1 
ATOM   633  C  CA    . ALA A 1 122 ? 17.853  10.439  46.717  1.00 18.24  ? 379  ALA A CA    1 
ATOM   634  C  C     . ALA A 1 122 ? 17.519  9.882   48.099  1.00 18.64  ? 379  ALA A C     1 
ATOM   635  O  O     . ALA A 1 122 ? 18.416  9.508   48.864  1.00 19.47  ? 379  ALA A O     1 
ATOM   636  C  CB    . ALA A 1 122 ? 18.002  11.965  46.790  1.00 18.59  ? 379  ALA A CB    1 
ATOM   637  N  N     . LEU A 1 123 ? 16.236  9.825   48.406  1.00 18.43  ? 380  LEU A N     1 
ATOM   638  C  CA    . LEU A 1 123 ? 15.765  9.263   49.642  1.00 18.93  ? 380  LEU A CA    1 
ATOM   639  C  C     . LEU A 1 123 ? 15.929  7.723   49.680  1.00 19.56  ? 380  LEU A C     1 
ATOM   640  O  O     . LEU A 1 123 ? 16.290  7.193   50.723  1.00 19.93  ? 380  LEU A O     1 
ATOM   641  C  CB    . LEU A 1 123 ? 14.319  9.683   49.895  1.00 19.17  ? 380  LEU A CB    1 
ATOM   642  C  CG    . LEU A 1 123 ? 14.126  11.152  50.342  1.00 19.02  ? 380  LEU A CG    1 
ATOM   643  C  CD1   . LEU A 1 123 ? 12.639  11.546  50.283  1.00 19.36  ? 380  LEU A CD1   1 
ATOM   644  C  CD2   . LEU A 1 123 ? 14.687  11.488  51.736  1.00 19.16  ? 380  LEU A CD2   1 
ATOM   645  N  N     . LYS A 1 124 ? 15.700  7.042   48.554  1.00 19.03  ? 381  LYS A N     1 
ATOM   646  C  CA    . LYS A 1 124 ? 15.916  5.634   48.444  1.00 20.65  ? 381  LYS A CA    1 
ATOM   647  C  C     . LYS A 1 124 ? 17.365  5.291   48.843  1.00 20.46  ? 381  LYS A C     1 
ATOM   648  O  O     . LYS A 1 124 ? 17.607  4.352   49.583  1.00 19.78  ? 381  LYS A O     1 
ATOM   649  C  CB    . LYS A 1 124 ? 15.621  5.093   47.044  1.00 22.55  ? 381  LYS A CB    1 
ATOM   650  C  CG    . LYS A 1 124 ? 14.161  4.693   46.793  1.00 25.43  ? 381  LYS A CG    1 
ATOM   651  C  CD    . LYS A 1 124 ? 13.957  4.283   45.314  1.00 26.68  ? 381  LYS A CD    1 
ATOM   652  C  CE    . LYS A 1 124 ? 12.487  4.203   44.884  1.00 28.49  ? 381  LYS A CE    1 
ATOM   653  N  NZ    . LYS A 1 124 ? 11.772  3.108   45.602  1.00 32.30  ? 381  LYS A NZ    1 
ATOM   654  N  N     . TRP A 1 125 ? 18.315  6.076   48.373  1.00 19.72  ? 382  TRP A N     1 
ATOM   655  C  CA    . TRP A 1 125 ? 19.703  5.843   48.721  1.00 20.15  ? 382  TRP A CA    1 
ATOM   656  C  C     . TRP A 1 125 ? 19.984  6.027   50.193  1.00 21.18  ? 382  TRP A C     1 
ATOM   657  O  O     . TRP A 1 125 ? 20.969  5.518   50.661  1.00 21.88  ? 382  TRP A O     1 
ATOM   658  C  CB    . TRP A 1 125 ? 20.630  6.728   47.892  1.00 19.33  ? 382  TRP A CB    1 
ATOM   659  C  CG    . TRP A 1 125 ? 20.838  6.253   46.474  1.00 18.95  ? 382  TRP A CG    1 
ATOM   660  C  CD1   . TRP A 1 125 ? 20.109  6.630   45.373  1.00 17.73  ? 382  TRP A CD1   1 
ATOM   661  C  CD2   . TRP A 1 125 ? 21.862  5.317   45.963  1.00 18.85  ? 382  TRP A CD2   1 
ATOM   662  N  NE1   . TRP A 1 125 ? 20.611  6.065   44.241  1.00 18.13  ? 382  TRP A NE1   1 
ATOM   663  C  CE2   . TRP A 1 125 ? 21.660  5.251   44.523  1.00 19.07  ? 382  TRP A CE2   1 
ATOM   664  C  CE3   . TRP A 1 125 ? 22.871  4.553   46.533  1.00 20.17  ? 382  TRP A CE3   1 
ATOM   665  C  CZ2   . TRP A 1 125 ? 22.435  4.443   43.706  1.00 19.31  ? 382  TRP A CZ2   1 
ATOM   666  C  CZ3   . TRP A 1 125 ? 23.672  3.755   45.691  1.00 20.67  ? 382  TRP A CZ3   1 
ATOM   667  C  CH2   . TRP A 1 125 ? 23.466  3.706   44.328  1.00 20.32  ? 382  TRP A CH2   1 
ATOM   668  N  N     . LYS A 1 126 ? 19.122  6.722   50.927  1.00 22.41  ? 383  LYS A N     1 
ATOM   669  C  CA    . LYS A 1 126 ? 19.257  6.859   52.366  1.00 24.26  ? 383  LYS A CA    1 
ATOM   670  C  C     . LYS A 1 126 ? 18.345  5.900   53.133  1.00 25.83  ? 383  LYS A C     1 
ATOM   671  O  O     . LYS A 1 126 ? 18.216  6.033   54.333  1.00 25.52  ? 383  LYS A O     1 
ATOM   672  C  CB    . LYS A 1 126 ? 18.953  8.290   52.790  1.00 25.39  ? 383  LYS A CB    1 
ATOM   673  C  CG    . LYS A 1 126 ? 19.880  9.304   52.132  1.00 25.67  ? 383  LYS A CG    1 
ATOM   674  C  CD    . LYS A 1 126 ? 19.650  10.679  52.687  1.00 27.81  ? 383  LYS A CD    1 
ATOM   675  C  CE    . LYS A 1 126 ? 20.666  11.663  52.139  1.00 28.49  ? 383  LYS A CE    1 
ATOM   676  N  NZ    . LYS A 1 126 ? 21.866  11.612  52.993  1.00 33.11  ? 383  LYS A NZ    1 
ATOM   677  N  N     . GLY A 1 127 ? 17.661  4.988   52.446  1.00 24.48  ? 384  GLY A N     1 
ATOM   678  C  CA    . GLY A 1 127 ? 16.823  4.012   53.124  1.00 25.52  ? 384  GLY A CA    1 
ATOM   679  C  C     . GLY A 1 127 ? 15.466  4.554   53.582  1.00 25.92  ? 384  GLY A C     1 
ATOM   680  O  O     . GLY A 1 127 ? 14.890  3.994   54.487  1.00 25.47  ? 384  GLY A O     1 
ATOM   681  N  N     . ILE A 1 128 ? 14.952  5.592   52.914  1.00 24.30  ? 385  ILE A N     1 
ATOM   682  C  CA    . ILE A 1 128 ? 13.741  6.279   53.310  1.00 25.44  ? 385  ILE A CA    1 
ATOM   683  C  C     . ILE A 1 128 ? 12.774  6.252   52.129  1.00 25.46  ? 385  ILE A C     1 
ATOM   684  O  O     . ILE A 1 128 ? 13.180  6.577   50.970  1.00 23.56  ? 385  ILE A O     1 
ATOM   685  C  CB    . ILE A 1 128 ? 14.051  7.746   53.700  1.00 25.88  ? 385  ILE A CB    1 
ATOM   686  C  CG1   . ILE A 1 128 ? 14.885  7.794   54.982  1.00 27.35  ? 385  ILE A CG1   1 
ATOM   687  C  CG2   . ILE A 1 128 ? 12.770  8.567   53.841  1.00 25.50  ? 385  ILE A CG2   1 
ATOM   688  C  CD1   . ILE A 1 128 ? 15.429  9.171   55.245  1.00 26.54  ? 385  ILE A CD1   1 
ATOM   689  N  N     . GLU A 1 129 ? 11.529  5.817   52.381  1.00 26.46  ? 386  GLU A N     1 
ATOM   690  C  CA    . GLU A 1 129 ? 10.511  5.768   51.338  1.00 28.58  ? 386  GLU A CA    1 
ATOM   691  C  C     . GLU A 1 129 ? 9.666   7.064   51.309  1.00 27.09  ? 386  GLU A C     1 
ATOM   692  O  O     . GLU A 1 129 ? 9.221   7.595   52.335  1.00 26.66  ? 386  GLU A O     1 
ATOM   693  C  CB    . GLU A 1 129 ? 9.596   4.537   51.458  1.00 35.15  ? 386  GLU A CB    1 
ATOM   694  C  CG    . GLU A 1 129 ? 10.323  3.202   51.299  1.00 42.20  ? 386  GLU A CG    1 
ATOM   695  C  CD    . GLU A 1 129 ? 10.995  2.992   49.918  1.00 48.26  ? 386  GLU A CD    1 
ATOM   696  O  OE1   . GLU A 1 129 ? 10.409  3.386   48.874  1.00 53.16  ? 386  GLU A OE1   1 
ATOM   697  O  OE2   . GLU A 1 129 ? 12.104  2.403   49.864  1.00 52.56  ? 386  GLU A OE2   1 
ATOM   698  N  N     . LEU A 1 130 ? 9.474   7.575   50.111  1.00 24.92  ? 387  LEU A N     1 
ATOM   699  C  CA    . LEU A 1 130 ? 8.626   8.733   49.896  1.00 24.75  ? 387  LEU A CA    1 
ATOM   700  C  C     . LEU A 1 130 ? 7.354   8.239   49.263  1.00 25.28  ? 387  LEU A C     1 
ATOM   701  O  O     . LEU A 1 130 ? 7.418   7.642   48.216  1.00 24.37  ? 387  LEU A O     1 
ATOM   702  C  CB    . LEU A 1 130 ? 9.332   9.726   48.965  1.00 23.69  ? 387  LEU A CB    1 
ATOM   703  C  CG    . LEU A 1 130 ? 8.524   10.954  48.479  1.00 23.47  ? 387  LEU A CG    1 
ATOM   704  C  CD1   . LEU A 1 130 ? 8.110   11.823  49.670  1.00 23.44  ? 387  LEU A CD1   1 
ATOM   705  C  CD2   . LEU A 1 130 ? 9.335   11.729  47.427  1.00 22.98  ? 387  LEU A CD2   1 
ATOM   706  N  N     . CYS A 1 131 ? 6.211   8.449   49.919  1.00 25.48  ? 388  CYS A N     1 
ATOM   707  C  CA    . CYS A 1 131 ? 4.913   8.048   49.389  1.00 25.74  ? 388  CYS A CA    1 
ATOM   708  C  C     . CYS A 1 131 ? 3.937   9.238   49.478  1.00 24.21  ? 388  CYS A C     1 
ATOM   709  O  O     . CYS A 1 131 ? 4.232   10.257  50.096  1.00 22.12  ? 388  CYS A O     1 
ATOM   710  C  CB    . CYS A 1 131 ? 4.314   6.901   50.225  1.00 28.03  ? 388  CYS A CB    1 
ATOM   711  S  SG    . CYS A 1 131 ? 5.275   5.375   50.278  1.00 33.25  ? 388  CYS A SG    1 
ATOM   712  N  N     . GLY A 1 132 ? 2.772   9.052   48.888  1.00 23.50  ? 389  GLY A N     1 
ATOM   713  C  CA    . GLY A 1 132 ? 1.708   10.029  48.970  1.00 24.96  ? 389  GLY A CA    1 
ATOM   714  C  C     . GLY A 1 132 ? 1.876   11.265  48.086  1.00 22.40  ? 389  GLY A C     1 
ATOM   715  O  O     . GLY A 1 132 ? 1.193   12.250  48.303  1.00 23.22  ? 389  GLY A O     1 
ATOM   716  N  N     . VAL A 1 133 ? 2.746   11.224  47.093  1.00 21.54  ? 390  VAL A N     1 
ATOM   717  C  CA    . VAL A 1 133 ? 2.923   12.379  46.199  1.00 20.37  ? 390  VAL A CA    1 
ATOM   718  C  C     . VAL A 1 133 ? 1.741   12.414  45.221  1.00 21.76  ? 390  VAL A C     1 
ATOM   719  O  O     . VAL A 1 133 ? 1.626   11.571  44.357  1.00 22.39  ? 390  VAL A O     1 
ATOM   720  C  CB    . VAL A 1 133 ? 4.276   12.353  45.461  1.00 20.36  ? 390  VAL A CB    1 
ATOM   721  C  CG1   . VAL A 1 133 ? 4.393   13.596  44.592  1.00 18.23  ? 390  VAL A CG1   1 
ATOM   722  C  CG2   . VAL A 1 133 ? 5.472   12.330  46.452  1.00 18.73  ? 390  VAL A CG2   1 
ATOM   723  N  N     . SER A 1 134 ? 0.796   13.330  45.413  1.00 20.07  ? 391  SER A N     1 
ATOM   724  C  CA    . SER A 1 134 ? -0.419  13.283  44.623  1.00 20.27  ? 391  SER A CA    1 
ATOM   725  C  C     . SER A 1 134 ? -0.346  14.320  43.517  1.00 18.92  ? 391  SER A C     1 
ATOM   726  O  O     . SER A 1 134 ? -1.185  14.318  42.646  1.00 18.56  ? 391  SER A O     1 
ATOM   727  C  CB    . SER A 1 134 ? -1.630  13.502  45.535  1.00 21.88  ? 391  SER A CB    1 
ATOM   728  O  OG    . SER A 1 134 ? -1.453  14.736  46.218  1.00 23.03  ? 391  SER A OG    1 
ATOM   729  N  N     . PHE A 1 135 ? 0.656   15.205  43.515  1.00 17.88  ? 392  PHE A N     1 
ATOM   730  C  CA    . PHE A 1 135 ? 0.769   16.204  42.437  1.00 17.31  ? 392  PHE A CA    1 
ATOM   731  C  C     . PHE A 1 135 ? 2.239   16.542  42.217  1.00 16.87  ? 392  PHE A C     1 
ATOM   732  O  O     . PHE A 1 135 ? 2.927   16.918  43.152  1.00 15.72  ? 392  PHE A O     1 
ATOM   733  C  CB    . PHE A 1 135 ? 0.046   17.491  42.805  1.00 18.36  ? 392  PHE A CB    1 
ATOM   734  C  CG    . PHE A 1 135 ? 0.183   18.589  41.771  1.00 17.45  ? 392  PHE A CG    1 
ATOM   735  C  CD1   . PHE A 1 135 ? -0.503  18.521  40.581  1.00 18.19  ? 392  PHE A CD1   1 
ATOM   736  C  CD2   . PHE A 1 135 ? 1.039   19.670  41.985  1.00 17.78  ? 392  PHE A CD2   1 
ATOM   737  C  CE1   . PHE A 1 135 ? -0.388  19.538  39.627  1.00 17.33  ? 392  PHE A CE1   1 
ATOM   738  C  CE2   . PHE A 1 135 ? 1.161   20.665  41.038  1.00 18.16  ? 392  PHE A CE2   1 
ATOM   739  C  CZ    . PHE A 1 135 ? 0.452   20.600  39.863  1.00 17.53  ? 392  PHE A CZ    1 
ATOM   740  N  N     . ASP A 1 136 ? 2.695   16.342  40.994  1.00 15.85  ? 393  ASP A N     1 
ATOM   741  C  CA    . ASP A 1 136 ? 4.045   16.705  40.575  1.00 16.12  ? 393  ASP A CA    1 
ATOM   742  C  C     . ASP A 1 136 ? 3.960   17.807  39.511  1.00 15.25  ? 393  ASP A C     1 
ATOM   743  O  O     . ASP A 1 136 ? 3.565   17.566  38.348  1.00 15.75  ? 393  ASP A O     1 
ATOM   744  C  CB    . ASP A 1 136 ? 4.775   15.488  40.031  1.00 16.19  ? 393  ASP A CB    1 
ATOM   745  C  CG    . ASP A 1 136 ? 6.279   15.755  39.810  1.00 18.07  ? 393  ASP A CG    1 
ATOM   746  O  OD1   . ASP A 1 136 ? 6.664   16.921  39.454  1.00 19.01  ? 393  ASP A OD1   1 
ATOM   747  O  OD2   . ASP A 1 136 ? 7.065   14.809  40.087  1.00 18.75  ? 393  ASP A OD2   1 
ATOM   748  N  N     . LEU A 1 137 ? 4.405   18.994  39.903  1.00 15.34  ? 394  LEU A N     1 
ATOM   749  C  CA    . LEU A 1 137 ? 4.331   20.208  39.089  1.00 15.54  ? 394  LEU A CA    1 
ATOM   750  C  C     . LEU A 1 137 ? 5.178   20.132  37.835  1.00 15.18  ? 394  LEU A C     1 
ATOM   751  O  O     . LEU A 1 137 ? 4.843   20.719  36.818  1.00 15.56  ? 394  LEU A O     1 
ATOM   752  C  CB    . LEU A 1 137 ? 4.757   21.459  39.905  1.00 16.01  ? 394  LEU A CB    1 
ATOM   753  C  CG    . LEU A 1 137 ? 4.738   22.825  39.246  1.00 16.84  ? 394  LEU A CG    1 
ATOM   754  C  CD1   . LEU A 1 137 ? 3.285   23.092  38.753  1.00 17.51  ? 394  LEU A CD1   1 
ATOM   755  C  CD2   . LEU A 1 137 ? 5.274   23.992  40.141  1.00 16.72  ? 394  LEU A CD2   1 
ATOM   756  N  N     . LEU A 1 138 ? 6.298   19.427  37.898  1.00 15.84  ? 395  LEU A N     1 
ATOM   757  C  CA    . LEU A 1 138 ? 7.114   19.200  36.711  1.00 15.68  ? 395  LEU A CA    1 
ATOM   758  C  C     . LEU A 1 138 ? 6.360   18.438  35.631  1.00 15.15  ? 395  LEU A C     1 
ATOM   759  O  O     . LEU A 1 138 ? 6.329   18.841  34.486  1.00 15.50  ? 395  LEU A O     1 
ATOM   760  C  CB    . LEU A 1 138 ? 8.411   18.497  37.063  1.00 16.76  ? 395  LEU A CB    1 
ATOM   761  C  CG    . LEU A 1 138 ? 9.255   18.075  35.813  1.00 18.06  ? 395  LEU A CG    1 
ATOM   762  C  CD1   . LEU A 1 138 ? 9.700   19.258  34.985  1.00 19.07  ? 395  LEU A CD1   1 
ATOM   763  C  CD2   . LEU A 1 138 ? 10.465  17.238  36.238  1.00 19.30  ? 395  LEU A CD2   1 
ATOM   764  N  N     . LEU A 1 139 ? 5.719   17.346  36.006  1.00 14.49  ? 396  LEU A N     1 
ATOM   765  C  CA    . LEU A 1 139 ? 4.985   16.546  35.057  1.00 14.32  ? 396  LEU A CA    1 
ATOM   766  C  C     . LEU A 1 139 ? 3.721   17.238  34.600  1.00 14.40  ? 396  LEU A C     1 
ATOM   767  O  O     . LEU A 1 139 ? 3.347   17.122  33.440  1.00 14.23  ? 396  LEU A O     1 
ATOM   768  C  CB    . LEU A 1 139 ? 4.657   15.220  35.690  1.00 14.76  ? 396  LEU A CB    1 
ATOM   769  C  CG    . LEU A 1 139 ? 5.904   14.425  36.032  1.00 14.82  ? 396  LEU A CG    1 
ATOM   770  C  CD1   . LEU A 1 139 ? 5.516   13.120  36.789  1.00 15.10  ? 396  LEU A CD1   1 
ATOM   771  C  CD2   . LEU A 1 139 ? 6.688   14.095  34.740  1.00 15.79  ? 396  LEU A CD2   1 
ATOM   772  N  N     . ALA A 1 140 ? 3.095   18.010  35.489  1.00 14.70  ? 397  ALA A N     1 
ATOM   773  C  CA    . ALA A 1 140 ? 1.927   18.824  35.104  1.00 14.78  ? 397  ALA A CA    1 
ATOM   774  C  C     . ALA A 1 140 ? 2.302   19.825  34.027  1.00 15.62  ? 397  ALA A C     1 
ATOM   775  O  O     . ALA A 1 140 ? 1.577   19.980  33.055  1.00 16.52  ? 397  ALA A O     1 
ATOM   776  C  CB    . ALA A 1 140 ? 1.295   19.566  36.312  1.00 13.73  ? 397  ALA A CB    1 
ATOM   777  N  N     . ALA A 1 141 ? 3.369   20.583  34.240  1.00 15.95  ? 398  ALA A N     1 
ATOM   778  C  CA    . ALA A 1 141 ? 3.801   21.592  33.277  1.00 17.15  ? 398  ALA A CA    1 
ATOM   779  C  C     . ALA A 1 141 ? 4.208   20.953  31.980  1.00 17.75  ? 398  ALA A C     1 
ATOM   780  O  O     . ALA A 1 141 ? 3.877   21.438  30.893  1.00 17.57  ? 398  ALA A O     1 
ATOM   781  C  CB    . ALA A 1 141 ? 4.957   22.421  33.848  1.00 17.01  ? 398  ALA A CB    1 
ATOM   782  N  N     . TYR A 1 142 ? 4.925   19.831  32.062  1.00 17.60  ? 399  TYR A N     1 
ATOM   783  C  CA    . TYR A 1 142 ? 5.288   19.084  30.847  1.00 18.37  ? 399  TYR A CA    1 
ATOM   784  C  C     . TYR A 1 142 ? 4.106   18.657  30.002  1.00 18.86  ? 399  TYR A C     1 
ATOM   785  O  O     . TYR A 1 142 ? 4.132   18.784  28.763  1.00 19.69  ? 399  TYR A O     1 
ATOM   786  C  CB    . TYR A 1 142 ? 6.063   17.852  31.246  1.00 18.96  ? 399  TYR A CB    1 
ATOM   787  C  CG    . TYR A 1 142 ? 6.406   16.904  30.144  1.00 20.54  ? 399  TYR A CG    1 
ATOM   788  C  CD1   . TYR A 1 142 ? 7.285   17.288  29.139  1.00 21.63  ? 399  TYR A CD1   1 
ATOM   789  C  CD2   . TYR A 1 142 ? 5.937   15.603  30.145  1.00 20.93  ? 399  TYR A CD2   1 
ATOM   790  C  CE1   . TYR A 1 142 ? 7.631   16.430  28.123  1.00 23.84  ? 399  TYR A CE1   1 
ATOM   791  C  CE2   . TYR A 1 142 ? 6.289   14.714  29.121  1.00 22.28  ? 399  TYR A CE2   1 
ATOM   792  C  CZ    . TYR A 1 142 ? 7.153   15.123  28.125  1.00 23.43  ? 399  TYR A CZ    1 
ATOM   793  O  OH    . TYR A 1 142 ? 7.557   14.263  27.143  1.00 24.48  ? 399  TYR A OH    1 
ATOM   794  N  N     . LEU A 1 143 ? 3.048   18.174  30.654  1.00 17.64  ? 400  LEU A N     1 
ATOM   795  C  CA    . LEU A 1 143 ? 1.849   17.780  29.908  1.00 18.57  ? 400  LEU A CA    1 
ATOM   796  C  C     . LEU A 1 143 ? 1.103   18.954  29.268  1.00 19.52  ? 400  LEU A C     1 
ATOM   797  O  O     . LEU A 1 143 ? 0.585   18.844  28.142  1.00 20.42  ? 400  LEU A O     1 
ATOM   798  C  CB    . LEU A 1 143 ? 0.901   16.973  30.806  1.00 17.97  ? 400  LEU A CB    1 
ATOM   799  C  CG    . LEU A 1 143 ? 1.398   15.578  31.202  1.00 17.76  ? 400  LEU A CG    1 
ATOM   800  C  CD1   . LEU A 1 143 ? 0.331   14.925  32.134  1.00 17.20  ? 400  LEU A CD1   1 
ATOM   801  C  CD2   . LEU A 1 143 ? 1.645   14.719  29.968  1.00 18.23  ? 400  LEU A CD2   1 
ATOM   802  N  N     . LEU A 1 144 ? 1.054   20.064  29.988  1.00 19.61  ? 401  LEU A N     1 
ATOM   803  C  CA    . LEU A 1 144 ? 0.410   21.268  29.505  1.00 20.88  ? 401  LEU A CA    1 
ATOM   804  C  C     . LEU A 1 144 ? 1.106   21.875  28.277  1.00 22.70  ? 401  LEU A C     1 
ATOM   805  O  O     . LEU A 1 144 ? 0.421   22.400  27.386  1.00 23.82  ? 401  LEU A O     1 
ATOM   806  C  CB    . LEU A 1 144 ? 0.304   22.304  30.621  1.00 21.05  ? 401  LEU A CB    1 
ATOM   807  C  CG    . LEU A 1 144 ? -0.739  22.002  31.693  1.00 20.45  ? 401  LEU A CG    1 
ATOM   808  C  CD1   . LEU A 1 144 ? -0.784  23.161  32.676  1.00 21.01  ? 401  LEU A CD1   1 
ATOM   809  C  CD2   . LEU A 1 144 ? -2.149  21.758  31.133  1.00 20.31  ? 401  LEU A CD2   1 
ATOM   810  N  N     . ASP A 1 145 ? 2.437   21.836  28.231  1.00 22.44  ? 402  ASP A N     1 
ATOM   811  C  CA    . ASP A 1 145 ? 3.175   22.265  27.015  1.00 24.73  ? 402  ASP A CA    1 
ATOM   812  C  C     . ASP A 1 145 ? 4.633   21.845  27.073  1.00 24.32  ? 402  ASP A C     1 
ATOM   813  O  O     . ASP A 1 145 ? 5.479   22.552  27.675  1.00 25.04  ? 402  ASP A O     1 
ATOM   814  C  CB    . ASP A 1 145 ? 3.072   23.779  26.863  1.00 26.35  ? 402  ASP A CB    1 
ATOM   815  C  CG    . ASP A 1 145 ? 3.668   24.283  25.574  1.00 28.33  ? 402  ASP A CG    1 
ATOM   816  O  OD1   . ASP A 1 145 ? 4.119   23.497  24.710  1.00 30.16  ? 402  ASP A OD1   1 
ATOM   817  O  OD2   . ASP A 1 145 ? 3.667   25.501  25.423  1.00 29.97  ? 402  ASP A OD2   1 
ATOM   818  N  N     . PRO A 1 146 ? 4.946   20.697  26.450  1.00 23.87  ? 403  PRO A N     1 
ATOM   819  C  CA    . PRO A 1 146 ? 6.299   20.200  26.472  1.00 24.15  ? 403  PRO A CA    1 
ATOM   820  C  C     . PRO A 1 146 ? 7.291   21.117  25.782  1.00 25.83  ? 403  PRO A C     1 
ATOM   821  O  O     . PRO A 1 146 ? 8.471   21.049  26.080  1.00 26.42  ? 403  PRO A O     1 
ATOM   822  C  CB    . PRO A 1 146 ? 6.227   18.833  25.762  1.00 24.59  ? 403  PRO A CB    1 
ATOM   823  C  CG    . PRO A 1 146 ? 4.867   18.699  25.251  1.00 24.85  ? 403  PRO A CG    1 
ATOM   824  C  CD    . PRO A 1 146 ? 4.032   19.876  25.624  1.00 24.11  ? 403  PRO A CD    1 
ATOM   825  N  N     . ALA A 1 147 ? 6.842   21.950  24.875  1.00 26.45  ? 404  ALA A N     1 
ATOM   826  C  CA    . ALA A 1 147 ? 7.778   22.865  24.181  1.00 30.44  ? 404  ALA A CA    1 
ATOM   827  C  C     . ALA A 1 147 ? 8.332   24.015  25.090  1.00 31.98  ? 404  ALA A C     1 
ATOM   828  O  O     . ALA A 1 147 ? 9.305   24.684  24.712  1.00 31.90  ? 404  ALA A O     1 
ATOM   829  C  CB    . ALA A 1 147 ? 7.152   23.444  22.915  1.00 30.17  ? 404  ALA A CB    1 
ATOM   830  N  N     . GLN A 1 148 ? 7.712   24.226  26.253  1.00 31.64  ? 405  GLN A N     1 
ATOM   831  C  CA    . GLN A 1 148 ? 8.154   25.279  27.184  1.00 34.17  ? 405  GLN A CA    1 
ATOM   832  C  C     . GLN A 1 148 ? 9.501   24.996  27.807  1.00 33.32  ? 405  GLN A C     1 
ATOM   833  O  O     . GLN A 1 148 ? 10.173  25.918  28.195  1.00 33.96  ? 405  GLN A O     1 
ATOM   834  C  CB    . GLN A 1 148 ? 7.119   25.545  28.302  1.00 34.93  ? 405  GLN A CB    1 
ATOM   835  C  CG    . GLN A 1 148 ? 5.940   26.363  27.832  1.00 38.90  ? 405  GLN A CG    1 
ATOM   836  C  CD    . GLN A 1 148 ? 6.346   27.786  27.471  1.00 43.78  ? 405  GLN A CD    1 
ATOM   837  O  OE1   . GLN A 1 148 ? 6.706   28.573  28.344  1.00 49.97  ? 405  GLN A OE1   1 
ATOM   838  N  NE2   . GLN A 1 148 ? 6.337   28.101  26.188  1.00 45.31  ? 405  GLN A NE2   1 
ATOM   839  N  N     . GLY A 1 149 ? 9.912   23.738  27.912  1.00 32.18  ? 406  GLY A N     1 
ATOM   840  C  CA    . GLY A 1 149 ? 11.217  23.457  28.454  1.00 31.67  ? 406  GLY A CA    1 
ATOM   841  C  C     . GLY A 1 149 ? 11.278  23.668  29.976  1.00 31.40  ? 406  GLY A C     1 
ATOM   842  O  O     . GLY A 1 149 ? 12.323  23.998  30.523  1.00 31.03  ? 406  GLY A O     1 
ATOM   843  N  N     . VAL A 1 150 ? 10.182  23.414  30.672  1.00 27.77  ? 407  VAL A N     1 
ATOM   844  C  CA    . VAL A 1 150 ? 10.121  23.688  32.098  1.00 27.64  ? 407  VAL A CA    1 
ATOM   845  C  C     . VAL A 1 150 ? 11.043  22.721  32.812  1.00 28.41  ? 407  VAL A C     1 
ATOM   846  O  O     . VAL A 1 150 ? 10.903  21.515  32.676  1.00 27.72  ? 407  VAL A O     1 
ATOM   847  C  CB    . VAL A 1 150 ? 8.689   23.533  32.634  1.00 26.30  ? 407  VAL A CB    1 
ATOM   848  C  CG1   . VAL A 1 150 ? 8.699   23.553  34.147  1.00 24.70  ? 407  VAL A CG1   1 
ATOM   849  C  CG2   . VAL A 1 150 ? 7.793   24.641  32.058  1.00 26.33  ? 407  VAL A CG2   1 
ATOM   850  N  N     . ASP A 1 151 ? 12.025  23.262  33.496  1.00 27.60  ? 408  ASP A N     1 
ATOM   851  C  CA    . ASP A 1 151 ? 12.964  22.471  34.246  1.00 30.36  ? 408  ASP A CA    1 
ATOM   852  C  C     . ASP A 1 151 ? 13.254  23.026  35.628  1.00 28.06  ? 408  ASP A C     1 
ATOM   853  O  O     . ASP A 1 151 ? 14.140  22.550  36.295  1.00 25.68  ? 408  ASP A O     1 
ATOM   854  C  CB    . ASP A 1 151 ? 14.273  22.447  33.520  1.00 34.32  ? 408  ASP A CB    1 
ATOM   855  C  CG    . ASP A 1 151 ? 14.822  23.833  33.317  1.00 40.43  ? 408  ASP A CG    1 
ATOM   856  O  OD1   . ASP A 1 151 ? 14.030  24.826  33.295  1.00 46.13  ? 408  ASP A OD1   1 
ATOM   857  O  OD2   . ASP A 1 151 ? 16.032  23.932  33.142  1.00 48.19  ? 408  ASP A OD2   1 
ATOM   858  N  N     . ASP A 1 152 ? 12.550  24.068  36.038  1.00 21.97  ? 409  ASP A N     1 
ATOM   859  C  CA    . ASP A 1 152 ? 12.572  24.411  37.422  1.00 22.09  ? 409  ASP A CA    1 
ATOM   860  C  C     . ASP A 1 152 ? 11.223  25.024  37.791  1.00 20.05  ? 409  ASP A C     1 
ATOM   861  O  O     . ASP A 1 152 ? 10.390  25.321  36.939  1.00 18.67  ? 409  ASP A O     1 
ATOM   862  C  CB    . ASP A 1 152 ? 13.807  25.237  37.764  1.00 24.62  ? 409  ASP A CB    1 
ATOM   863  C  CG    . ASP A 1 152 ? 13.794  26.623  37.163  1.00 28.22  ? 409  ASP A CG    1 
ATOM   864  O  OD1   . ASP A 1 152 ? 12.835  26.999  36.451  1.00 29.25  ? 409  ASP A OD1   1 
ATOM   865  O  OD2   . ASP A 1 152 ? 14.767  27.373  37.413  1.00 30.52  ? 409  ASP A OD2   1 
ATOM   866  N  N     . VAL A 1 153 ? 10.999  25.134  39.084  1.00 19.16  ? 410  VAL A N     1 
ATOM   867  C  CA    . VAL A 1 153 ? 9.736   25.658  39.589  1.00 17.43  ? 410  VAL A CA    1 
ATOM   868  C  C     . VAL A 1 153 ? 9.414   27.040  39.004  1.00 16.98  ? 410  VAL A C     1 
ATOM   869  O  O     . VAL A 1 153 ? 8.258   27.324  38.681  1.00 17.08  ? 410  VAL A O     1 
ATOM   870  C  CB    . VAL A 1 153 ? 9.756   25.699  41.132  1.00 17.58  ? 410  VAL A CB    1 
ATOM   871  C  CG1   . VAL A 1 153 ? 8.590   26.517  41.656  1.00 16.80  ? 410  VAL A CG1   1 
ATOM   872  C  CG2   . VAL A 1 153 ? 9.775   24.266  41.732  1.00 16.50  ? 410  VAL A CG2   1 
ATOM   873  N  N     . ALA A 1 154 ? 10.405  27.916  38.932  1.00 17.88  ? 411  ALA A N     1 
ATOM   874  C  CA    . ALA A 1 154 ? 10.204  29.256  38.423  1.00 17.98  ? 411  ALA A CA    1 
ATOM   875  C  C     . ALA A 1 154 ? 9.678   29.272  36.984  1.00 19.08  ? 411  ALA A C     1 
ATOM   876  O  O     . ALA A 1 154 ? 8.821   30.118  36.647  1.00 18.92  ? 411  ALA A O     1 
ATOM   877  C  CB    . ALA A 1 154 ? 11.487  30.054  38.522  1.00 17.98  ? 411  ALA A CB    1 
ATOM   878  N  N     . ALA A 1 155 ? 10.248  28.416  36.109  1.00 19.54  ? 412  ALA A N     1 
ATOM   879  C  CA    . ALA A 1 155 ? 9.747   28.282  34.739  1.00 20.45  ? 412  ALA A CA    1 
ATOM   880  C  C     . ALA A 1 155 ? 8.271   27.811  34.725  1.00 18.95  ? 412  ALA A C     1 
ATOM   881  O  O     . ALA A 1 155 ? 7.475   28.336  33.942  1.00 21.75  ? 412  ALA A O     1 
ATOM   882  C  CB    . ALA A 1 155 ? 10.616  27.329  33.901  1.00 19.22  ? 412  ALA A CB    1 
ATOM   883  N  N     . ALA A 1 156 ? 7.900   26.843  35.566  1.00 18.20  ? 413  ALA A N     1 
ATOM   884  C  CA    . ALA A 1 156 ? 6.491   26.446  35.692  1.00 17.67  ? 413  ALA A CA    1 
ATOM   885  C  C     . ALA A 1 156 ? 5.599   27.571  36.177  1.00 18.28  ? 413  ALA A C     1 
ATOM   886  O  O     . ALA A 1 156 ? 4.496   27.817  35.625  1.00 18.51  ? 413  ALA A O     1 
ATOM   887  C  CB    . ALA A 1 156 ? 6.344   25.217  36.611  1.00 16.87  ? 413  ALA A CB    1 
ATOM   888  N  N     . ALA A 1 157 ? 6.051   28.251  37.211  1.00 17.16  ? 414  ALA A N     1 
ATOM   889  C  CA    . ALA A 1 157 ? 5.324   29.315  37.821  1.00 17.99  ? 414  ALA A CA    1 
ATOM   890  C  C     . ALA A 1 157 ? 5.080   30.475  36.844  1.00 19.59  ? 414  ALA A C     1 
ATOM   891  O  O     . ALA A 1 157 ? 3.995   31.030  36.808  1.00 18.95  ? 414  ALA A O     1 
ATOM   892  C  CB    . ALA A 1 157 ? 6.098   29.778  39.058  1.00 18.15  ? 414  ALA A CB    1 
ATOM   893  N  N     . LYS A 1 158 ? 6.046   30.764  35.970  1.00 21.28  ? 415  LYS A N     1 
ATOM   894  C  CA    . LYS A 1 158 ? 5.881   31.831  34.978  1.00 24.02  ? 415  LYS A CA    1 
ATOM   895  C  C     . LYS A 1 158 ? 4.709   31.558  33.994  1.00 25.08  ? 415  LYS A C     1 
ATOM   896  O  O     . LYS A 1 158 ? 4.033   32.483  33.549  1.00 25.08  ? 415  LYS A O     1 
ATOM   897  C  CB    . LYS A 1 158 ? 7.221   32.044  34.254  1.00 26.98  ? 415  LYS A CB    1 
ATOM   898  C  CG    . LYS A 1 158 ? 7.427   33.414  33.667  1.00 33.10  ? 415  LYS A CG    1 
ATOM   899  C  CD    . LYS A 1 158 ? 8.891   33.619  33.272  1.00 37.46  ? 415  LYS A CD    1 
ATOM   900  C  CE    . LYS A 1 158 ? 9.162   35.064  32.895  1.00 41.63  ? 415  LYS A CE    1 
ATOM   901  N  NZ    . LYS A 1 158 ? 10.372  35.148  32.022  1.00 46.44  ? 415  LYS A NZ    1 
ATOM   902  N  N     . MET A 1 159 ? 4.396   30.290  33.752  1.00 25.94  ? 416  MET A N     1 
ATOM   903  C  CA    . MET A 1 159 ? 3.271   29.937  32.900  1.00 27.44  ? 416  MET A CA    1 
ATOM   904  C  C     . MET A 1 159 ? 1.921   30.451  33.439  1.00 26.51  ? 416  MET A C     1 
ATOM   905  O  O     . MET A 1 159 ? 0.975   30.594  32.665  1.00 26.44  ? 416  MET A O     1 
ATOM   906  C  CB    . MET A 1 159 ? 3.141   28.418  32.725  1.00 27.86  ? 416  MET A CB    1 
ATOM   907  C  CG    . MET A 1 159 ? 4.301   27.695  32.040  1.00 30.52  ? 416  MET A CG    1 
ATOM   908  S  SD    . MET A 1 159 ? 4.087   25.862  32.167  1.00 34.18  ? 416  MET A SD    1 
ATOM   909  C  CE    . MET A 1 159 ? 2.818   25.436  31.007  1.00 36.01  ? 416  MET A CE    1 
ATOM   910  N  N     . LYS A 1 160 ? 1.822   30.684  34.745  1.00 24.47  ? 417  LYS A N     1 
ATOM   911  C  CA    . LYS A 1 160 ? 0.627   31.245  35.341  1.00 23.82  ? 417  LYS A CA    1 
ATOM   912  C  C     . LYS A 1 160 ? 0.918   32.610  35.972  1.00 23.16  ? 417  LYS A C     1 
ATOM   913  O  O     . LYS A 1 160 ? 0.316   32.951  36.961  1.00 22.54  ? 417  LYS A O     1 
ATOM   914  C  CB    . LYS A 1 160 ? 0.086   30.271  36.408  1.00 24.98  ? 417  LYS A CB    1 
ATOM   915  C  CG    . LYS A 1 160 ? -0.240  28.853  35.881  1.00 26.72  ? 417  LYS A CG    1 
ATOM   916  C  CD    . LYS A 1 160 ? -1.424  28.840  34.961  1.00 28.55  ? 417  LYS A CD    1 
ATOM   917  C  CE    . LYS A 1 160 ? -1.645  27.485  34.282  1.00 29.91  ? 417  LYS A CE    1 
ATOM   918  N  NZ    . LYS A 1 160 ? -2.844  27.575  33.409  1.00 31.46  ? 417  LYS A NZ    1 
ATOM   919  N  N     . GLN A 1 161 ? 1.854   33.375  35.426  1.00 23.53  ? 418  GLN A N     1 
ATOM   920  C  CA    . GLN A 1 161 ? 2.131   34.741  35.857  1.00 23.72  ? 418  GLN A CA    1 
ATOM   921  C  C     . GLN A 1 161 ? 2.480   34.870  37.368  1.00 22.53  ? 418  GLN A C     1 
ATOM   922  O  O     . GLN A 1 161 ? 2.166   35.851  38.006  1.00 23.65  ? 418  GLN A O     1 
ATOM   923  C  CB    . GLN A 1 161 ? 0.966   35.664  35.465  1.00 27.49  ? 418  GLN A CB    1 
ATOM   924  C  CG    . GLN A 1 161 ? 0.521   35.631  34.000  1.00 29.04  ? 418  GLN A CG    1 
ATOM   925  C  CD    . GLN A 1 161 ? 1.663   35.830  32.995  1.00 33.25  ? 418  GLN A CD    1 
ATOM   926  O  OE1   . GLN A 1 161 ? 2.149   36.971  32.743  1.00 36.71  ? 418  GLN A OE1   1 
ATOM   927  N  NE2   . GLN A 1 161 ? 2.067   34.723  32.363  1.00 33.31  ? 418  GLN A NE2   1 
ATOM   928  N  N     . TYR A 1 162 ? 3.122   33.840  37.904  1.00 21.39  ? 419  TYR A N     1 
ATOM   929  C  CA    . TYR A 1 162 ? 3.634   33.769  39.281  1.00 20.46  ? 419  TYR A CA    1 
ATOM   930  C  C     . TYR A 1 162 ? 5.142   33.875  39.171  1.00 20.72  ? 419  TYR A C     1 
ATOM   931  O  O     . TYR A 1 162 ? 5.836   32.994  38.555  1.00 19.69  ? 419  TYR A O     1 
ATOM   932  C  CB    . TYR A 1 162 ? 3.221   32.438  39.908  1.00 19.57  ? 419  TYR A CB    1 
ATOM   933  C  CG    . TYR A 1 162 ? 3.557   32.275  41.377  1.00 18.72  ? 419  TYR A CG    1 
ATOM   934  C  CD1   . TYR A 1 162 ? 4.870   32.168  41.816  1.00 17.96  ? 419  TYR A CD1   1 
ATOM   935  C  CD2   . TYR A 1 162 ? 2.544   32.304  42.342  1.00 18.42  ? 419  TYR A CD2   1 
ATOM   936  C  CE1   . TYR A 1 162 ? 5.170   32.079  43.186  1.00 18.34  ? 419  TYR A CE1   1 
ATOM   937  C  CE2   . TYR A 1 162 ? 2.841   32.202  43.694  1.00 18.47  ? 419  TYR A CE2   1 
ATOM   938  C  CZ    . TYR A 1 162 ? 4.141   32.085  44.120  1.00 18.45  ? 419  TYR A CZ    1 
ATOM   939  O  OH    . TYR A 1 162 ? 4.389   31.983  45.483  1.00 20.33  ? 419  TYR A OH    1 
ATOM   940  N  N     . GLU A 1 163 ? 5.659   34.958  39.716  1.00 20.87  ? 420  GLU A N     1 
ATOM   941  C  CA    . GLU A 1 163 ? 7.057   35.273  39.654  1.00 23.05  ? 420  GLU A CA    1 
ATOM   942  C  C     . GLU A 1 163 ? 7.728   35.495  41.027  1.00 23.04  ? 420  GLU A C     1 
ATOM   943  O  O     . GLU A 1 163 ? 8.843   36.017  41.080  1.00 23.40  ? 420  GLU A O     1 
ATOM   944  C  CB    . GLU A 1 163 ? 7.254   36.487  38.739  1.00 26.08  ? 420  GLU A CB    1 
ATOM   945  C  CG    . GLU A 1 163 ? 6.938   36.115  37.313  1.00 29.08  ? 420  GLU A CG    1 
ATOM   946  C  CD    . GLU A 1 163 ? 7.306   37.147  36.281  1.00 33.67  ? 420  GLU A CD    1 
ATOM   947  O  OE1   . GLU A 1 163 ? 7.856   38.231  36.609  1.00 39.16  ? 420  GLU A OE1   1 
ATOM   948  O  OE2   . GLU A 1 163 ? 6.991   36.856  35.106  1.00 36.18  ? 420  GLU A OE2   1 
ATOM   949  N  N     . ALA A 1 164 ? 7.107   35.064  42.124  1.00 21.53  ? 421  ALA A N     1 
ATOM   950  C  CA    . ALA A 1 164 ? 7.693   35.285  43.480  1.00 22.41  ? 421  ALA A CA    1 
ATOM   951  C  C     . ALA A 1 164 ? 8.603   34.117  43.920  1.00 22.00  ? 421  ALA A C     1 
ATOM   952  O  O     . ALA A 1 164 ? 8.533   33.606  45.077  1.00 21.33  ? 421  ALA A O     1 
ATOM   953  C  CB    . ALA A 1 164 ? 6.573   35.541  44.505  1.00 21.11  ? 421  ALA A CB    1 
ATOM   954  N  N     . VAL A 1 165 ? 9.419   33.661  42.975  1.00 22.21  ? 422  VAL A N     1 
ATOM   955  C  CA    . VAL A 1 165 ? 10.321  32.496  43.134  1.00 21.33  ? 422  VAL A CA    1 
ATOM   956  C  C     . VAL A 1 165 ? 11.468  32.704  42.120  1.00 22.28  ? 422  VAL A C     1 
ATOM   957  O  O     . VAL A 1 165 ? 11.236  33.144  41.002  1.00 22.17  ? 422  VAL A O     1 
ATOM   958  C  CB    . VAL A 1 165 ? 9.612   31.101  42.973  1.00 20.46  ? 422  VAL A CB    1 
ATOM   959  C  CG1   . VAL A 1 165 ? 9.017   30.901  41.594  1.00 19.10  ? 422  VAL A CG1   1 
ATOM   960  C  CG2   . VAL A 1 165 ? 10.558  29.949  43.326  1.00 19.99  ? 422  VAL A CG2   1 
ATOM   961  N  N     . ARG A 1 166 ? 12.706  32.477  42.532  1.00 22.66  ? 423  ARG A N     1 
ATOM   962  C  CA    . ARG A 1 166 ? 13.811  32.647  41.658  1.00 24.20  ? 423  ARG A CA    1 
ATOM   963  C  C     . ARG A 1 166 ? 14.108  31.363  40.866  1.00 22.38  ? 423  ARG A C     1 
ATOM   964  O  O     . ARG A 1 166 ? 13.868  30.254  41.344  1.00 20.98  ? 423  ARG A O     1 
ATOM   965  C  CB    . ARG A 1 166 ? 15.048  33.025  42.452  1.00 26.56  ? 423  ARG A CB    1 
ATOM   966  C  CG    . ARG A 1 166 ? 14.901  34.347  43.202  1.00 30.35  ? 423  ARG A CG    1 
ATOM   967  C  CD    . ARG A 1 166 ? 15.927  34.380  44.315  1.00 33.82  ? 423  ARG A CD    1 
ATOM   968  N  NE    . ARG A 1 166 ? 17.207  34.779  43.816  1.00 38.42  ? 423  ARG A NE    1 
ATOM   969  C  CZ    . ARG A 1 166 ? 18.382  34.608  44.441  1.00 43.20  ? 423  ARG A CZ    1 
ATOM   970  N  NH1   . ARG A 1 166 ? 18.504  33.963  45.621  1.00 42.53  ? 423  ARG A NH1   1 
ATOM   971  N  NH2   . ARG A 1 166 ? 19.460  35.081  43.845  1.00 43.81  ? 423  ARG A NH2   1 
ATOM   972  N  N     . PRO A 1 167 ? 14.663  31.519  39.669  1.00 22.90  ? 424  PRO A N     1 
ATOM   973  C  CA    . PRO A 1 167 ? 15.196  30.348  38.976  1.00 22.31  ? 424  PRO A CA    1 
ATOM   974  C  C     . PRO A 1 167 ? 16.328  29.735  39.781  1.00 23.22  ? 424  PRO A C     1 
ATOM   975  O  O     . PRO A 1 167 ? 17.167  30.461  40.348  1.00 23.44  ? 424  PRO A O     1 
ATOM   976  C  CB    . PRO A 1 167 ? 15.706  30.905  37.649  1.00 23.77  ? 424  PRO A CB    1 
ATOM   977  C  CG    . PRO A 1 167 ? 15.160  32.303  37.523  1.00 25.27  ? 424  PRO A CG    1 
ATOM   978  C  CD    . PRO A 1 167 ? 14.784  32.777  38.892  1.00 24.70  ? 424  PRO A CD    1 
ATOM   979  N  N     . ASP A 1 168 ? 16.368  28.409  39.807  1.00 22.86  ? 425  ASP A N     1 
ATOM   980  C  CA    . ASP A 1 168 ? 17.436  27.663  40.433  1.00 24.69  ? 425  ASP A CA    1 
ATOM   981  C  C     . ASP A 1 168 ? 18.831  28.146  40.009  1.00 27.10  ? 425  ASP A C     1 
ATOM   982  O  O     . ASP A 1 168 ? 19.739  28.280  40.844  1.00 27.30  ? 425  ASP A O     1 
ATOM   983  C  CB    . ASP A 1 168 ? 17.289  26.183  40.116  1.00 24.65  ? 425  ASP A CB    1 
ATOM   984  C  CG    . ASP A 1 168 ? 16.169  25.528  40.902  1.00 25.15  ? 425  ASP A CG    1 
ATOM   985  O  OD1   . ASP A 1 168 ? 15.733  26.093  41.895  1.00 25.62  ? 425  ASP A OD1   1 
ATOM   986  O  OD2   . ASP A 1 168 ? 15.701  24.454  40.514  1.00 27.70  ? 425  ASP A OD2   1 
ATOM   987  N  N     . GLU A 1 169 ? 18.984  28.440  38.720  1.00 29.55  ? 426  GLU A N     1 
ATOM   988  C  CA    . GLU A 1 169 ? 20.255  28.937  38.204  1.00 32.37  ? 426  GLU A CA    1 
ATOM   989  C  C     . GLU A 1 169 ? 20.698  30.266  38.824  1.00 32.78  ? 426  GLU A C     1 
ATOM   990  O  O     . GLU A 1 169 ? 21.897  30.508  39.011  1.00 31.90  ? 426  GLU A O     1 
ATOM   991  C  CB    . GLU A 1 169 ? 20.176  29.094  36.685  1.00 37.43  ? 426  GLU A CB    1 
ATOM   992  C  CG    . GLU A 1 169 ? 21.516  29.440  36.037  1.00 42.61  ? 426  GLU A CG    1 
ATOM   993  C  CD    . GLU A 1 169 ? 21.440  29.425  34.506  1.00 46.02  ? 426  GLU A CD    1 
ATOM   994  O  OE1   . GLU A 1 169 ? 20.813  28.496  33.943  1.00 50.09  ? 426  GLU A OE1   1 
ATOM   995  O  OE2   . GLU A 1 169 ? 22.010  30.343  33.873  1.00 49.70  ? 426  GLU A OE2   1 
ATOM   996  N  N     . ALA A 1 170 ? 19.736  31.138  39.142  1.00 30.74  ? 427  ALA A N     1 
ATOM   997  C  CA    . ALA A 1 170 ? 20.056  32.373  39.822  1.00 30.67  ? 427  ALA A CA    1 
ATOM   998  C  C     . ALA A 1 170 ? 20.552  32.145  41.256  1.00 30.35  ? 427  ALA A C     1 
ATOM   999  O  O     . ALA A 1 170 ? 21.289  32.924  41.749  1.00 31.72  ? 427  ALA A O     1 
ATOM   1000 C  CB    . ALA A 1 170 ? 18.880  33.339  39.819  1.00 30.39  ? 427  ALA A CB    1 
ATOM   1001 N  N     . VAL A 1 171 ? 20.133  31.086  41.925  1.00 28.41  ? 428  VAL A N     1 
ATOM   1002 C  CA    . VAL A 1 171 ? 20.478  30.870  43.325  1.00 28.33  ? 428  VAL A CA    1 
ATOM   1003 C  C     . VAL A 1 171 ? 21.754  30.046  43.422  1.00 28.93  ? 428  VAL A C     1 
ATOM   1004 O  O     . VAL A 1 171 ? 22.627  30.336  44.236  1.00 28.10  ? 428  VAL A O     1 
ATOM   1005 C  CB    . VAL A 1 171 ? 19.328  30.083  44.026  1.00 26.82  ? 428  VAL A CB    1 
ATOM   1006 C  CG1   . VAL A 1 171 ? 19.688  29.648  45.445  1.00 26.67  ? 428  VAL A CG1   1 
ATOM   1007 C  CG2   . VAL A 1 171 ? 18.033  30.890  44.015  1.00 25.62  ? 428  VAL A CG2   1 
ATOM   1008 N  N     . TYR A 1 172 ? 21.844  29.000  42.614  1.00 27.47  ? 429  TYR A N     1 
ATOM   1009 C  CA    . TYR A 1 172 ? 22.992  28.069  42.660  1.00 29.75  ? 429  TYR A CA    1 
ATOM   1010 C  C     . TYR A 1 172 ? 24.159  28.441  41.755  1.00 31.97  ? 429  TYR A C     1 
ATOM   1011 O  O     . TYR A 1 172 ? 25.265  27.924  41.933  1.00 32.63  ? 429  TYR A O     1 
ATOM   1012 C  CB    . TYR A 1 172 ? 22.530  26.646  42.349  1.00 28.34  ? 429  TYR A CB    1 
ATOM   1013 C  CG    . TYR A 1 172 ? 21.465  26.163  43.318  1.00 28.01  ? 429  TYR A CG    1 
ATOM   1014 C  CD1   . TYR A 1 172 ? 21.730  26.113  44.679  1.00 29.15  ? 429  TYR A CD1   1 
ATOM   1015 C  CD2   . TYR A 1 172 ? 20.183  25.806  42.889  1.00 26.85  ? 429  TYR A CD2   1 
ATOM   1016 C  CE1   . TYR A 1 172 ? 20.771  25.696  45.590  1.00 28.99  ? 429  TYR A CE1   1 
ATOM   1017 C  CE2   . TYR A 1 172 ? 19.230  25.361  43.786  1.00 25.50  ? 429  TYR A CE2   1 
ATOM   1018 C  CZ    . TYR A 1 172 ? 19.522  25.328  45.138  1.00 26.80  ? 429  TYR A CZ    1 
ATOM   1019 O  OH    . TYR A 1 172 ? 18.609  24.922  46.072  1.00 25.11  ? 429  TYR A OH    1 
ATOM   1020 N  N     . GLY A 1 173 ? 23.946  29.344  40.798  1.00 32.70  ? 430  GLY A N     1 
ATOM   1021 C  CA    . GLY A 1 173 ? 25.016  29.688  39.848  1.00 34.78  ? 430  GLY A CA    1 
ATOM   1022 C  C     . GLY A 1 173 ? 25.058  28.632  38.757  1.00 36.13  ? 430  GLY A C     1 
ATOM   1023 O  O     . GLY A 1 173 ? 24.289  27.692  38.783  1.00 31.41  ? 430  GLY A O     1 
ATOM   1024 N  N     . LYS A 1 174 ? 25.942  28.793  37.785  1.00 42.51  ? 431  LYS A N     1 
ATOM   1025 C  CA    . LYS A 1 174 ? 26.061  27.830  36.674  1.00 45.55  ? 431  LYS A CA    1 
ATOM   1026 C  C     . LYS A 1 174 ? 27.480  27.330  36.516  1.00 46.52  ? 431  LYS A C     1 
ATOM   1027 O  O     . LYS A 1 174 ? 28.421  28.055  36.793  1.00 44.90  ? 431  LYS A O     1 
ATOM   1028 C  CB    . LYS A 1 174 ? 25.630  28.471  35.358  1.00 49.96  ? 431  LYS A CB    1 
ATOM   1029 C  CG    . LYS A 1 174 ? 25.514  27.463  34.219  1.00 54.89  ? 431  LYS A CG    1 
ATOM   1030 C  CD    . LYS A 1 174 ? 24.656  27.974  33.058  1.00 59.49  ? 431  LYS A CD    1 
ATOM   1031 C  CE    . LYS A 1 174 ? 25.213  29.261  32.459  1.00 63.65  ? 431  LYS A CE    1 
ATOM   1032 N  NZ    . LYS A 1 174 ? 24.340  29.796  31.377  1.00 67.84  ? 431  LYS A NZ    1 
ATOM   1033 N  N     . GLY A 1 175 ? 27.604  26.081  36.075  1.00 47.19  ? 432  GLY A N     1 
ATOM   1034 C  CA    . GLY A 1 175 ? 28.877  25.470  35.716  1.00 50.44  ? 432  GLY A CA    1 
ATOM   1035 C  C     . GLY A 1 175 ? 29.886  25.352  36.843  1.00 52.50  ? 432  GLY A C     1 
ATOM   1036 O  O     . GLY A 1 175 ? 29.570  24.898  37.932  1.00 51.21  ? 432  GLY A O     1 
ATOM   1037 N  N     . ALA A 1 176 ? 31.121  25.744  36.564  1.00 53.71  ? 433  ALA A N     1 
ATOM   1038 C  CA    . ALA A 1 176 ? 32.168  25.764  37.581  1.00 55.31  ? 433  ALA A CA    1 
ATOM   1039 C  C     . ALA A 1 176 ? 31.743  26.560  38.826  1.00 54.87  ? 433  ALA A C     1 
ATOM   1040 O  O     . ALA A 1 176 ? 32.087  26.174  39.924  1.00 58.83  ? 433  ALA A O     1 
ATOM   1041 C  CB    . ALA A 1 176 ? 33.472  26.320  37.003  1.00 53.76  ? 433  ALA A CB    1 
ATOM   1042 N  N     . LYS A 1 177 ? 30.974  27.635  38.655  1.00 53.26  ? 434  LYS A N     1 
ATOM   1043 C  CA    . LYS A 1 177 ? 30.571  28.515  39.764  1.00 51.52  ? 434  LYS A CA    1 
ATOM   1044 C  C     . LYS A 1 177 ? 29.388  28.019  40.609  1.00 48.85  ? 434  LYS A C     1 
ATOM   1045 O  O     . LYS A 1 177 ? 29.001  28.657  41.583  1.00 46.60  ? 434  LYS A O     1 
ATOM   1046 C  CB    . LYS A 1 177 ? 30.286  29.914  39.222  1.00 53.14  ? 434  LYS A CB    1 
ATOM   1047 C  CG    . LYS A 1 177 ? 31.575  30.601  38.811  1.00 57.91  ? 434  LYS A CG    1 
ATOM   1048 C  CD    . LYS A 1 177 ? 31.388  31.706  37.787  1.00 60.98  ? 434  LYS A CD    1 
ATOM   1049 C  CE    . LYS A 1 177 ? 32.703  31.935  37.047  1.00 64.23  ? 434  LYS A CE    1 
ATOM   1050 N  NZ    . LYS A 1 177 ? 32.641  33.144  36.184  1.00 69.09  ? 434  LYS A NZ    1 
ATOM   1051 N  N     . ARG A 1 178 ? 28.840  26.870  40.236  1.00 45.55  ? 435  ARG A N     1 
ATOM   1052 C  CA    . ARG A 1 178 ? 27.689  26.279  40.899  1.00 44.63  ? 435  ARG A CA    1 
ATOM   1053 C  C     . ARG A 1 178 ? 28.041  26.001  42.357  1.00 43.93  ? 435  ARG A C     1 
ATOM   1054 O  O     . ARG A 1 178 ? 29.103  25.459  42.655  1.00 44.41  ? 435  ARG A O     1 
ATOM   1055 C  CB    . ARG A 1 178 ? 27.306  25.003  40.164  1.00 45.09  ? 435  ARG A CB    1 
ATOM   1056 C  CG    . ARG A 1 178 ? 25.909  24.505  40.378  1.00 45.81  ? 435  ARG A CG    1 
ATOM   1057 C  CD    . ARG A 1 178 ? 25.704  23.227  39.563  1.00 46.81  ? 435  ARG A CD    1 
ATOM   1058 N  NE    . ARG A 1 178 ? 24.521  22.477  40.013  1.00 45.30  ? 435  ARG A NE    1 
ATOM   1059 C  CZ    . ARG A 1 178 ? 23.287  22.898  39.820  1.00 43.66  ? 435  ARG A CZ    1 
ATOM   1060 N  NH1   . ARG A 1 178 ? 23.073  24.044  39.177  1.00 50.64  ? 435  ARG A NH1   1 
ATOM   1061 N  NH2   . ARG A 1 178 ? 22.262  22.197  40.268  1.00 44.07  ? 435  ARG A NH2   1 
ATOM   1062 N  N     . ALA A 1 179 ? 27.187  26.434  43.272  1.00 39.88  ? 436  ALA A N     1 
ATOM   1063 C  CA    . ALA A 1 179 ? 27.454  26.269  44.700  1.00 38.50  ? 436  ALA A CA    1 
ATOM   1064 C  C     . ALA A 1 179 ? 26.177  26.424  45.511  1.00 36.67  ? 436  ALA A C     1 
ATOM   1065 O  O     . ALA A 1 179 ? 25.267  27.156  45.116  1.00 34.21  ? 436  ALA A O     1 
ATOM   1066 C  CB    . ALA A 1 179 ? 28.506  27.258  45.170  1.00 38.62  ? 436  ALA A CB    1 
ATOM   1067 N  N     . VAL A 1 180 ? 26.104  25.701  46.626  1.00 36.94  ? 437  VAL A N     1 
ATOM   1068 C  CA    . VAL A 1 180 ? 24.982  25.832  47.568  1.00 36.53  ? 437  VAL A CA    1 
ATOM   1069 C  C     . VAL A 1 180 ? 25.250  27.119  48.330  1.00 36.20  ? 437  VAL A C     1 
ATOM   1070 O  O     . VAL A 1 180 ? 26.342  27.285  48.784  1.00 36.24  ? 437  VAL A O     1 
ATOM   1071 C  CB    . VAL A 1 180 ? 24.946  24.638  48.562  1.00 36.89  ? 437  VAL A CB    1 
ATOM   1072 C  CG1   . VAL A 1 180 ? 23.746  24.759  49.491  1.00 34.88  ? 437  VAL A CG1   1 
ATOM   1073 C  CG2   . VAL A 1 180 ? 24.892  23.314  47.808  1.00 34.40  ? 437  VAL A CG2   1 
ATOM   1074 N  N     . PRO A 1 181 ? 24.268  28.040  48.441  1.00 34.51  ? 438  PRO A N     1 
ATOM   1075 C  CA    . PRO A 1 181 ? 24.533  29.253  49.201  1.00 35.84  ? 438  PRO A CA    1 
ATOM   1076 C  C     . PRO A 1 181 ? 24.331  29.072  50.702  1.00 36.37  ? 438  PRO A C     1 
ATOM   1077 O  O     . PRO A 1 181 ? 23.959  28.002  51.147  1.00 35.73  ? 438  PRO A O     1 
ATOM   1078 C  CB    . PRO A 1 181 ? 23.557  30.270  48.612  1.00 35.24  ? 438  PRO A CB    1 
ATOM   1079 C  CG    . PRO A 1 181 ? 22.417  29.437  48.122  1.00 33.12  ? 438  PRO A CG    1 
ATOM   1080 C  CD    . PRO A 1 181 ? 22.986  28.101  47.713  1.00 32.50  ? 438  PRO A CD    1 
ATOM   1081 N  N     . ASP A 1 182 ? 24.604  30.120  51.449  1.00 39.68  ? 439  ASP A N     1 
ATOM   1082 C  CA    . ASP A 1 182 ? 24.448  30.149  52.898  1.00 41.46  ? 439  ASP A CA    1 
ATOM   1083 C  C     . ASP A 1 182 ? 23.026  29.832  53.289  1.00 38.57  ? 439  ASP A C     1 
ATOM   1084 O  O     . ASP A 1 182 ? 22.102  30.101  52.542  1.00 34.15  ? 439  ASP A O     1 
ATOM   1085 C  CB    . ASP A 1 182 ? 24.770  31.536  53.447  1.00 45.53  ? 439  ASP A CB    1 
ATOM   1086 C  CG    . ASP A 1 182 ? 26.250  31.827  53.498  1.00 50.99  ? 439  ASP A CG    1 
ATOM   1087 O  OD1   . ASP A 1 182 ? 27.067  30.883  53.356  1.00 53.37  ? 439  ASP A OD1   1 
ATOM   1088 O  OD2   . ASP A 1 182 ? 26.587  33.019  53.699  1.00 56.25  ? 439  ASP A OD2   1 
ATOM   1089 N  N     . GLU A 1 183 ? 22.868  29.297  54.492  1.00 39.08  ? 440  GLU A N     1 
ATOM   1090 C  CA    . GLU A 1 183 ? 21.569  28.822  54.961  1.00 39.08  ? 440  GLU A CA    1 
ATOM   1091 C  C     . GLU A 1 183 ? 20.409  29.820  54.783  1.00 36.91  ? 440  GLU A C     1 
ATOM   1092 O  O     . GLU A 1 183 ? 19.342  29.418  54.356  1.00 34.87  ? 440  GLU A O     1 
ATOM   1093 C  CB    . GLU A 1 183 ? 21.665  28.375  56.419  1.00 41.80  ? 440  GLU A CB    1 
ATOM   1094 C  CG    . GLU A 1 183 ? 20.338  27.924  57.011  1.00 41.80  ? 440  GLU A CG    1 
ATOM   1095 C  CD    . GLU A 1 183 ? 20.506  27.207  58.340  1.00 43.95  ? 440  GLU A CD    1 
ATOM   1096 O  OE1   . GLU A 1 183 ? 20.766  25.987  58.298  1.00 42.40  ? 440  GLU A OE1   1 
ATOM   1097 O  OE2   . GLU A 1 183 ? 20.381  27.870  59.406  1.00 44.75  ? 440  GLU A OE2   1 
ATOM   1098 N  N     . PRO A 1 184 ? 20.607  31.113  55.103  1.00 37.61  ? 441  PRO A N     1 
ATOM   1099 C  CA    . PRO A 1 184 ? 19.447  31.997  54.930  1.00 36.60  ? 441  PRO A CA    1 
ATOM   1100 C  C     . PRO A 1 184 ? 18.980  32.115  53.482  1.00 33.80  ? 441  PRO A C     1 
ATOM   1101 O  O     . PRO A 1 184 ? 17.774  32.212  53.233  1.00 31.81  ? 441  PRO A O     1 
ATOM   1102 C  CB    . PRO A 1 184 ? 19.946  33.337  55.427  1.00 38.42  ? 441  PRO A CB    1 
ATOM   1103 C  CG    . PRO A 1 184 ? 21.038  33.012  56.397  1.00 41.20  ? 441  PRO A CG    1 
ATOM   1104 C  CD    . PRO A 1 184 ? 21.700  31.777  55.827  1.00 40.76  ? 441  PRO A CD    1 
ATOM   1105 N  N     . VAL A 1 185 ? 19.927  32.110  52.539  1.00 32.73  ? 442  VAL A N     1 
ATOM   1106 C  CA    . VAL A 1 185 ? 19.590  32.287  51.145  1.00 30.56  ? 442  VAL A CA    1 
ATOM   1107 C  C     . VAL A 1 185 ? 18.972  30.984  50.639  1.00 28.62  ? 442  VAL A C     1 
ATOM   1108 O  O     . VAL A 1 185 ? 17.938  30.982  49.939  1.00 27.38  ? 442  VAL A O     1 
ATOM   1109 C  CB    . VAL A 1 185 ? 20.814  32.715  50.301  1.00 31.80  ? 442  VAL A CB    1 
ATOM   1110 C  CG1   . VAL A 1 185 ? 20.511  32.629  48.799  1.00 29.96  ? 442  VAL A CG1   1 
ATOM   1111 C  CG2   . VAL A 1 185 ? 21.265  34.116  50.691  1.00 33.20  ? 442  VAL A CG2   1 
ATOM   1112 N  N     . LEU A 1 186 ? 19.569  29.870  51.028  1.00 27.06  ? 443  LEU A N     1 
ATOM   1113 C  CA    . LEU A 1 186 ? 19.052  28.568  50.632  1.00 25.46  ? 443  LEU A CA    1 
ATOM   1114 C  C     . LEU A 1 186 ? 17.646  28.380  51.178  1.00 24.72  ? 443  LEU A C     1 
ATOM   1115 O  O     . LEU A 1 186 ? 16.715  27.952  50.436  1.00 22.18  ? 443  LEU A O     1 
ATOM   1116 C  CB    . LEU A 1 186 ? 19.964  27.448  51.134  1.00 26.13  ? 443  LEU A CB    1 
ATOM   1117 C  CG    . LEU A 1 186 ? 19.473  26.015  50.981  1.00 24.58  ? 443  LEU A CG    1 
ATOM   1118 C  CD1   . LEU A 1 186 ? 19.345  25.704  49.489  1.00 23.90  ? 443  LEU A CD1   1 
ATOM   1119 C  CD2   . LEU A 1 186 ? 20.432  25.060  51.705  1.00 25.60  ? 443  LEU A CD2   1 
ATOM   1120 N  N     . ALA A 1 187 ? 17.464  28.738  52.453  1.00 25.63  ? 444  ALA A N     1 
ATOM   1121 C  CA    . ALA A 1 187 ? 16.181  28.458  53.133  1.00 25.50  ? 444  ALA A CA    1 
ATOM   1122 C  C     . ALA A 1 187 ? 15.045  29.247  52.496  1.00 25.44  ? 444  ALA A C     1 
ATOM   1123 O  O     . ALA A 1 187 ? 13.963  28.706  52.243  1.00 23.40  ? 444  ALA A O     1 
ATOM   1124 C  CB    . ALA A 1 187 ? 16.250  28.724  54.640  1.00 27.34  ? 444  ALA A CB    1 
ATOM   1125 N  N     . GLU A 1 188 ? 15.289  30.510  52.206  1.00 27.01  ? 445  GLU A N     1 
ATOM   1126 C  CA    . GLU A 1 188 ? 14.267  31.307  51.563  1.00 28.87  ? 445  GLU A CA    1 
ATOM   1127 C  C     . GLU A 1 188 ? 13.889  30.811  50.165  1.00 25.50  ? 445  GLU A C     1 
ATOM   1128 O  O     . GLU A 1 188 ? 12.725  30.804  49.817  1.00 24.86  ? 445  GLU A O     1 
ATOM   1129 C  CB    . GLU A 1 188 ? 14.670  32.787  51.506  1.00 33.27  ? 445  GLU A CB    1 
ATOM   1130 C  CG    . GLU A 1 188 ? 13.434  33.695  51.494  1.00 38.22  ? 445  GLU A CG    1 
ATOM   1131 C  CD    . GLU A 1 188 ? 13.408  34.704  50.363  1.00 42.41  ? 445  GLU A CD    1 
ATOM   1132 O  OE1   . GLU A 1 188 ? 14.004  34.392  49.313  1.00 48.87  ? 445  GLU A OE1   1 
ATOM   1133 O  OE2   . GLU A 1 188 ? 12.742  35.774  50.496  1.00 46.99  ? 445  GLU A OE2   1 
ATOM   1134 N  N     . HIS A 1 189 ? 14.885  30.406  49.368  1.00 24.21  ? 446  HIS A N     1 
ATOM   1135 C  CA    . HIS A 1 189 ? 14.660  29.745  48.086  1.00 22.15  ? 446  HIS A CA    1 
ATOM   1136 C  C     . HIS A 1 189 ? 13.786  28.532  48.214  1.00 20.93  ? 446  HIS A C     1 
ATOM   1137 O  O     . HIS A 1 189 ? 12.732  28.459  47.559  1.00 20.57  ? 446  HIS A O     1 
ATOM   1138 C  CB    . HIS A 1 189 ? 15.980  29.383  47.387  1.00 22.27  ? 446  HIS A CB    1 
ATOM   1139 C  CG    . HIS A 1 189 ? 15.789  28.878  45.983  1.00 21.47  ? 446  HIS A CG    1 
ATOM   1140 N  ND1   . HIS A 1 189 ? 14.963  29.487  45.100  1.00 20.74  ? 446  HIS A ND1   1 
ATOM   1141 C  CD2   . HIS A 1 189 ? 16.289  27.754  45.341  1.00 21.19  ? 446  HIS A CD2   1 
ATOM   1142 C  CE1   . HIS A 1 189 ? 14.965  28.802  43.945  1.00 20.69  ? 446  HIS A CE1   1 
ATOM   1143 N  NE2   . HIS A 1 189 ? 15.778  27.750  44.078  1.00 20.70  ? 446  HIS A NE2   1 
ATOM   1144 N  N     . LEU A 1 190 ? 14.124  27.596  49.110  1.00 19.52  ? 447  LEU A N     1 
ATOM   1145 C  CA    . LEU A 1 190 ? 13.297  26.407  49.203  1.00 18.81  ? 447  LEU A CA    1 
ATOM   1146 C  C     . LEU A 1 190 ? 11.878  26.677  49.648  1.00 17.62  ? 447  LEU A C     1 
ATOM   1147 O  O     . LEU A 1 190 ? 10.933  26.013  49.138  1.00 16.34  ? 447  LEU A O     1 
ATOM   1148 C  CB    . LEU A 1 190 ? 13.927  25.314  50.070  1.00 19.56  ? 447  LEU A CB    1 
ATOM   1149 C  CG    . LEU A 1 190 ? 15.343  24.916  49.701  1.00 19.51  ? 447  LEU A CG    1 
ATOM   1150 C  CD1   . LEU A 1 190 ? 15.764  23.672  50.483  1.00 20.74  ? 447  LEU A CD1   1 
ATOM   1151 C  CD2   . LEU A 1 190 ? 15.524  24.665  48.202  1.00 19.10  ? 447  LEU A CD2   1 
ATOM   1152 N  N     . VAL A 1 191 ? 11.715  27.602  50.582  1.00 17.80  ? 448  VAL A N     1 
ATOM   1153 C  CA    . VAL A 1 191 ? 10.387  27.977  51.027  1.00 18.26  ? 448  VAL A CA    1 
ATOM   1154 C  C     . VAL A 1 191 ? 9.576   28.660  49.893  1.00 17.50  ? 448  VAL A C     1 
ATOM   1155 O  O     . VAL A 1 191 ? 8.411   28.355  49.723  1.00 16.89  ? 448  VAL A O     1 
ATOM   1156 C  CB    . VAL A 1 191 ? 10.446  28.869  52.276  1.00 20.00  ? 448  VAL A CB    1 
ATOM   1157 C  CG1   . VAL A 1 191 ? 9.084   29.506  52.583  1.00 19.64  ? 448  VAL A CG1   1 
ATOM   1158 C  CG2   . VAL A 1 191 ? 10.988  28.069  53.481  1.00 21.25  ? 448  VAL A CG2   1 
ATOM   1159 N  N     . ARG A 1 192 ? 10.212  29.541  49.112  1.00 17.83  ? 449  ARG A N     1 
ATOM   1160 C  CA    . ARG A 1 192 ? 9.577   30.152  47.949  1.00 17.51  ? 449  ARG A CA    1 
ATOM   1161 C  C     . ARG A 1 192 ? 9.152   29.115  46.916  1.00 16.45  ? 449  ARG A C     1 
ATOM   1162 O  O     . ARG A 1 192 ? 8.069   29.190  46.375  1.00 15.09  ? 449  ARG A O     1 
ATOM   1163 C  CB    . ARG A 1 192 ? 10.444  31.257  47.318  1.00 18.12  ? 449  ARG A CB    1 
ATOM   1164 C  CG    . ARG A 1 192 ? 10.401  32.545  48.100  1.00 20.08  ? 449  ARG A CG    1 
ATOM   1165 C  CD    . ARG A 1 192 ? 11.230  33.685  47.506  1.00 21.29  ? 449  ARG A CD    1 
ATOM   1166 N  NE    . ARG A 1 192 ? 11.018  34.930  48.254  1.00 22.40  ? 449  ARG A NE    1 
ATOM   1167 C  CZ    . ARG A 1 192 ? 9.955   35.736  48.145  1.00 22.20  ? 449  ARG A CZ    1 
ATOM   1168 N  NH1   . ARG A 1 192 ? 8.958   35.455  47.307  1.00 21.29  ? 449  ARG A NH1   1 
ATOM   1169 N  NH2   . ARG A 1 192 ? 9.880   36.838  48.918  1.00 22.67  ? 449  ARG A NH2   1 
ATOM   1170 N  N     . LYS A 1 193 ? 9.967   28.094  46.703  1.00 16.89  ? 450  LYS A N     1 
ATOM   1171 C  CA    . LYS A 1 193 ? 9.558   27.018  45.779  1.00 16.06  ? 450  LYS A CA    1 
ATOM   1172 C  C     . LYS A 1 193 ? 8.354   26.238  46.287  1.00 16.75  ? 450  LYS A C     1 
ATOM   1173 O  O     . LYS A 1 193 ? 7.364   25.936  45.538  1.00 16.42  ? 450  LYS A O     1 
ATOM   1174 C  CB    . LYS A 1 193 ? 10.743  26.094  45.495  1.00 16.92  ? 450  LYS A CB    1 
ATOM   1175 C  CG    . LYS A 1 193 ? 11.783  26.735  44.615  1.00 17.78  ? 450  LYS A CG    1 
ATOM   1176 C  CD    . LYS A 1 193 ? 12.700  25.759  43.860  1.00 19.06  ? 450  LYS A CD    1 
ATOM   1177 C  CE    . LYS A 1 193 ? 13.416  24.694  44.663  1.00 20.54  ? 450  LYS A CE    1 
ATOM   1178 N  NZ    . LYS A 1 193 ? 14.520  24.060  43.844  1.00 20.67  ? 450  LYS A NZ    1 
ATOM   1179 N  N     . ALA A 1 194 ? 8.395   25.898  47.571  1.00 17.46  ? 451  ALA A N     1 
ATOM   1180 C  CA    . ALA A 1 194 ? 7.281   25.191  48.179  1.00 17.33  ? 451  ALA A CA    1 
ATOM   1181 C  C     . ALA A 1 194 ? 6.007   26.037  48.139  1.00 16.91  ? 451  ALA A C     1 
ATOM   1182 O  O     . ALA A 1 194 ? 4.901   25.517  47.856  1.00 17.02  ? 451  ALA A O     1 
ATOM   1183 C  CB    . ALA A 1 194 ? 7.646   24.788  49.608  1.00 17.22  ? 451  ALA A CB    1 
ATOM   1184 N  N     . ALA A 1 195 ? 6.158   27.329  48.405  1.00 17.01  ? 452  ALA A N     1 
ATOM   1185 C  CA    . ALA A 1 195 ? 5.003   28.248  48.373  1.00 17.19  ? 452  ALA A CA    1 
ATOM   1186 C  C     . ALA A 1 195 ? 4.399   28.339  46.972  1.00 16.32  ? 452  ALA A C     1 
ATOM   1187 O  O     . ALA A 1 195 ? 3.187   28.408  46.828  1.00 15.00  ? 452  ALA A O     1 
ATOM   1188 C  CB    . ALA A 1 195 ? 5.353   29.627  48.880  1.00 16.62  ? 452  ALA A CB    1 
ATOM   1189 N  N     . ALA A 1 196 ? 5.265   28.343  45.963  1.00 16.72  ? 453  ALA A N     1 
ATOM   1190 C  CA    . ALA A 1 196 ? 4.833   28.379  44.532  1.00 16.67  ? 453  ALA A CA    1 
ATOM   1191 C  C     . ALA A 1 196 ? 4.072   27.107  44.216  1.00 17.10  ? 453  ALA A C     1 
ATOM   1192 O  O     . ALA A 1 196 ? 2.972   27.144  43.635  1.00 17.95  ? 453  ALA A O     1 
ATOM   1193 C  CB    . ALA A 1 196 ? 6.043   28.539  43.591  1.00 15.03  ? 453  ALA A CB    1 
ATOM   1194 N  N     . ILE A 1 197 ? 4.618   25.968  44.642  1.00 16.44  ? 454  ILE A N     1 
ATOM   1195 C  CA    . ILE A 1 197 ? 3.953   24.683  44.426  1.00 16.31  ? 454  ILE A CA    1 
ATOM   1196 C  C     . ILE A 1 197 ? 2.574   24.671  45.062  1.00 16.44  ? 454  ILE A C     1 
ATOM   1197 O  O     . ILE A 1 197 ? 1.604   24.313  44.426  1.00 17.16  ? 454  ILE A O     1 
ATOM   1198 C  CB    . ILE A 1 197 ? 4.785   23.511  44.971  1.00 16.08  ? 454  ILE A CB    1 
ATOM   1199 C  CG1   . ILE A 1 197 ? 6.033   23.328  44.113  1.00 16.35  ? 454  ILE A CG1   1 
ATOM   1200 C  CG2   . ILE A 1 197 ? 3.991   22.206  45.001  1.00 16.17  ? 454  ILE A CG2   1 
ATOM   1201 C  CD1   . ILE A 1 197 ? 7.177   22.619  44.865  1.00 15.52  ? 454  ILE A CD1   1 
ATOM   1202 N  N     . TRP A 1 198 ? 2.492   25.110  46.309  1.00 17.08  ? 455  TRP A N     1 
ATOM   1203 C  CA    . TRP A 1 198 ? 1.245   25.214  47.024  1.00 17.84  ? 455  TRP A CA    1 
ATOM   1204 C  C     . TRP A 1 198 ? 0.256   26.063  46.290  1.00 18.94  ? 455  TRP A C     1 
ATOM   1205 O  O     . TRP A 1 198 ? -0.942  25.740  46.223  1.00 19.80  ? 455  TRP A O     1 
ATOM   1206 C  CB    . TRP A 1 198 ? 1.536   25.830  48.375  1.00 19.18  ? 455  TRP A CB    1 
ATOM   1207 C  CG    . TRP A 1 198 ? 0.414   25.863  49.375  1.00 20.57  ? 455  TRP A CG    1 
ATOM   1208 C  CD1   . TRP A 1 198 ? -0.204  26.970  49.897  1.00 24.07  ? 455  TRP A CD1   1 
ATOM   1209 C  CD2   . TRP A 1 198 ? -0.191  24.714  50.087  1.00 21.52  ? 455  TRP A CD2   1 
ATOM   1210 N  NE1   . TRP A 1 198 ? -1.130  26.609  50.863  1.00 24.43  ? 455  TRP A NE1   1 
ATOM   1211 C  CE2   . TRP A 1 198 ? -1.171  25.264  51.001  1.00 23.77  ? 455  TRP A CE2   1 
ATOM   1212 C  CE3   . TRP A 1 198 ? -0.012  23.335  50.040  1.00 21.70  ? 455  TRP A CE3   1 
ATOM   1213 C  CZ2   . TRP A 1 198 ? -1.947  24.463  51.824  1.00 24.20  ? 455  TRP A CZ2   1 
ATOM   1214 C  CZ3   . TRP A 1 198 ? -0.783  22.537  50.892  1.00 22.91  ? 455  TRP A CZ3   1 
ATOM   1215 C  CH2   . TRP A 1 198 ? -1.750  23.085  51.738  1.00 23.04  ? 455  TRP A CH2   1 
ATOM   1216 N  N     . ALA A 1 199 ? 0.712   27.195  45.754  1.00 18.71  ? 456  ALA A N     1 
ATOM   1217 C  CA    . ALA A 1 199 ? -0.207  28.119  45.047  1.00 19.20  ? 456  ALA A CA    1 
ATOM   1218 C  C     . ALA A 1 199 ? -0.609  27.613  43.678  1.00 19.50  ? 456  ALA A C     1 
ATOM   1219 O  O     . ALA A 1 199 ? -1.655  27.958  43.180  1.00 20.00  ? 456  ALA A O     1 
ATOM   1220 C  CB    . ALA A 1 199 ? 0.420   29.504  44.871  1.00 19.05  ? 456  ALA A CB    1 
ATOM   1221 N  N     . LEU A 1 200 ? 0.260   26.871  43.018  1.00 18.55  ? 457  LEU A N     1 
ATOM   1222 C  CA    . LEU A 1 200 ? 0.062   26.567  41.590  1.00 18.90  ? 457  LEU A CA    1 
ATOM   1223 C  C     . LEU A 1 200 ? -0.672  25.249  41.316  1.00 18.72  ? 457  LEU A C     1 
ATOM   1224 O  O     . LEU A 1 200 ? -1.109  24.986  40.180  1.00 18.69  ? 457  LEU A O     1 
ATOM   1225 C  CB    . LEU A 1 200 ? 1.439   26.550  40.906  1.00 18.60  ? 457  LEU A CB    1 
ATOM   1226 C  CG    . LEU A 1 200 ? 2.121   27.900  40.796  1.00 19.51  ? 457  LEU A CG    1 
ATOM   1227 C  CD1   . LEU A 1 200 ? 3.588   27.687  40.440  1.00 20.08  ? 457  LEU A CD1   1 
ATOM   1228 C  CD2   . LEU A 1 200 ? 1.433   28.770  39.772  1.00 19.31  ? 457  LEU A CD2   1 
ATOM   1229 N  N     . GLU A 1 201 ? -0.802  24.392  42.319  1.00 18.83  ? 458  GLU A N     1 
ATOM   1230 C  CA    . GLU A 1 201 ? -1.465  23.100  42.141  1.00 19.84  ? 458  GLU A CA    1 
ATOM   1231 C  C     . GLU A 1 201 ? -2.842  23.261  41.499  1.00 20.74  ? 458  GLU A C     1 
ATOM   1232 O  O     . GLU A 1 201 ? -3.137  22.645  40.494  1.00 18.39  ? 458  GLU A O     1 
ATOM   1233 C  CB    . GLU A 1 201 ? -1.622  22.380  43.481  1.00 21.53  ? 458  GLU A CB    1 
ATOM   1234 C  CG    . GLU A 1 201 ? -2.253  21.006  43.345  1.00 23.83  ? 458  GLU A CG    1 
ATOM   1235 C  CD    . GLU A 1 201 ? -2.382  20.236  44.672  1.00 27.84  ? 458  GLU A CD    1 
ATOM   1236 O  OE1   . GLU A 1 201 ? -1.688  20.564  45.639  1.00 30.23  ? 458  GLU A OE1   1 
ATOM   1237 O  OE2   . GLU A 1 201 ? -3.211  19.306  44.756  1.00 29.98  ? 458  GLU A OE2   1 
ATOM   1238 N  N     . ARG A 1 202 ? -3.683  24.066  42.118  1.00 21.72  ? 459  ARG A N     1 
ATOM   1239 C  CA    . ARG A 1 202 ? -5.059  24.245  41.636  1.00 24.93  ? 459  ARG A CA    1 
ATOM   1240 C  C     . ARG A 1 202 ? -5.143  24.786  40.195  1.00 24.06  ? 459  ARG A C     1 
ATOM   1241 O  O     . ARG A 1 202 ? -5.831  24.194  39.377  1.00 22.68  ? 459  ARG A O     1 
ATOM   1242 C  CB    . ARG A 1 202 ? -5.876  25.102  42.588  1.00 30.06  ? 459  ARG A CB    1 
ATOM   1243 C  CG    . ARG A 1 202 ? -7.268  25.432  42.074  1.00 37.32  ? 459  ARG A CG    1 
ATOM   1244 C  CD    . ARG A 1 202 ? -8.063  26.162  43.130  1.00 47.04  ? 459  ARG A CD    1 
ATOM   1245 N  NE    . ARG A 1 202 ? -9.398  26.480  42.637  1.00 58.39  ? 459  ARG A NE    1 
ATOM   1246 C  CZ    . ARG A 1 202 ? -10.339 27.117  43.330  1.00 65.91  ? 459  ARG A CZ    1 
ATOM   1247 N  NH1   . ARG A 1 202 ? -10.112 27.525  44.582  1.00 70.66  ? 459  ARG A NH1   1 
ATOM   1248 N  NH2   . ARG A 1 202 ? -11.521 27.347  42.762  1.00 69.16  ? 459  ARG A NH2   1 
ATOM   1249 N  N     . PRO A 1 203 ? -4.466  25.889  39.879  1.00 23.79  ? 460  PRO A N     1 
ATOM   1250 C  CA    . PRO A 1 203 ? -4.551  26.320  38.452  1.00 23.32  ? 460  PRO A CA    1 
ATOM   1251 C  C     . PRO A 1 203 ? -3.972  25.325  37.443  1.00 21.60  ? 460  PRO A C     1 
ATOM   1252 O  O     . PRO A 1 203 ? -4.486  25.205  36.318  1.00 22.05  ? 460  PRO A O     1 
ATOM   1253 C  CB    . PRO A 1 203 ? -3.782  27.659  38.415  1.00 23.95  ? 460  PRO A CB    1 
ATOM   1254 C  CG    . PRO A 1 203 ? -3.151  27.789  39.759  1.00 24.42  ? 460  PRO A CG    1 
ATOM   1255 C  CD    . PRO A 1 203 ? -3.932  26.963  40.737  1.00 24.92  ? 460  PRO A CD    1 
ATOM   1256 N  N     . PHE A 1 204 ? -2.925  24.591  37.801  1.00 19.07  ? 461  PHE A N     1 
ATOM   1257 C  CA    . PHE A 1 204 ? -2.428  23.571  36.889  1.00 18.23  ? 461  PHE A CA    1 
ATOM   1258 C  C     . PHE A 1 204 ? -3.443  22.414  36.717  1.00 18.62  ? 461  PHE A C     1 
ATOM   1259 O  O     . PHE A 1 204 ? -3.762  21.984  35.590  1.00 16.90  ? 461  PHE A O     1 
ATOM   1260 C  CB    . PHE A 1 204 ? -1.041  23.085  37.324  1.00 16.81  ? 461  PHE A CB    1 
ATOM   1261 C  CG    . PHE A 1 204 ? 0.081   23.905  36.775  1.00 16.98  ? 461  PHE A CG    1 
ATOM   1262 C  CD1   . PHE A 1 204 ? 0.389   25.133  37.331  1.00 17.76  ? 461  PHE A CD1   1 
ATOM   1263 C  CD2   . PHE A 1 204 ? 0.874   23.418  35.749  1.00 17.08  ? 461  PHE A CD2   1 
ATOM   1264 C  CE1   . PHE A 1 204 ? 1.405   25.892  36.815  1.00 17.91  ? 461  PHE A CE1   1 
ATOM   1265 C  CE2   . PHE A 1 204 ? 1.893   24.199  35.210  1.00 18.47  ? 461  PHE A CE2   1 
ATOM   1266 C  CZ    . PHE A 1 204 ? 2.146   25.431  35.756  1.00 18.21  ? 461  PHE A CZ    1 
ATOM   1267 N  N     . LEU A 1 205 ? -4.003  21.948  37.825  1.00 19.58  ? 462  LEU A N     1 
ATOM   1268 C  CA    . LEU A 1 205 ? -4.987  20.860  37.751  1.00 21.44  ? 462  LEU A CA    1 
ATOM   1269 C  C     . LEU A 1 205 ? -6.251  21.293  36.969  1.00 22.60  ? 462  LEU A C     1 
ATOM   1270 O  O     . LEU A 1 205 ? -6.823  20.509  36.196  1.00 22.11  ? 462  LEU A O     1 
ATOM   1271 C  CB    . LEU A 1 205 ? -5.388  20.389  39.148  1.00 22.04  ? 462  LEU A CB    1 
ATOM   1272 C  CG    . LEU A 1 205 ? -4.348  19.505  39.873  1.00 21.42  ? 462  LEU A CG    1 
ATOM   1273 C  CD1   . LEU A 1 205 ? -4.819  19.203  41.293  1.00 22.55  ? 462  LEU A CD1   1 
ATOM   1274 C  CD2   . LEU A 1 205 ? -4.121  18.166  39.141  1.00 20.68  ? 462  LEU A CD2   1 
ATOM   1275 N  N     . ASP A 1 206 ? -6.690  22.520  37.174  1.00 24.00  ? 463  ASP A N     1 
ATOM   1276 C  CA    . ASP A 1 206 ? -7.828  23.063  36.394  1.00 25.77  ? 463  ASP A CA    1 
ATOM   1277 C  C     . ASP A 1 206 ? -7.514  23.060  34.874  1.00 23.80  ? 463  ASP A C     1 
ATOM   1278 O  O     . ASP A 1 206 ? -8.327  22.644  34.106  1.00 22.33  ? 463  ASP A O     1 
ATOM   1279 C  CB    . ASP A 1 206 ? -8.172  24.475  36.842  1.00 28.79  ? 463  ASP A CB    1 
ATOM   1280 C  CG    . ASP A 1 206 ? -8.847  24.515  38.222  1.00 33.90  ? 463  ASP A CG    1 
ATOM   1281 O  OD1   . ASP A 1 206 ? -9.371  23.477  38.687  1.00 39.70  ? 463  ASP A OD1   1 
ATOM   1282 O  OD2   . ASP A 1 206 ? -8.847  25.602  38.858  1.00 40.02  ? 463  ASP A OD2   1 
ATOM   1283 N  N     . GLU A 1 207 ? -6.316  23.474  34.451  1.00 21.93  ? 464  GLU A N     1 
ATOM   1284 C  CA    . GLU A 1 207 ? -6.025  23.463  33.022  1.00 22.70  ? 464  GLU A CA    1 
ATOM   1285 C  C     . GLU A 1 207 ? -5.912  22.042  32.462  1.00 20.84  ? 464  GLU A C     1 
ATOM   1286 O  O     . GLU A 1 207 ? -6.419  21.751  31.389  1.00 21.22  ? 464  GLU A O     1 
ATOM   1287 C  CB    . GLU A 1 207 ? -4.745  24.250  32.674  1.00 23.72  ? 464  GLU A CB    1 
ATOM   1288 C  CG    . GLU A 1 207 ? -4.686  24.520  31.171  1.00 26.64  ? 464  GLU A CG    1 
ATOM   1289 C  CD    . GLU A 1 207 ? -3.483  25.340  30.730  1.00 29.53  ? 464  GLU A CD    1 
ATOM   1290 O  OE1   . GLU A 1 207 ? -2.750  25.864  31.627  1.00 30.05  ? 464  GLU A OE1   1 
ATOM   1291 O  OE2   . GLU A 1 207 ? -3.288  25.445  29.482  1.00 33.72  ? 464  GLU A OE2   1 
ATOM   1292 N  N     . LEU A 1 208 ? -5.226  21.162  33.187  1.00 19.52  ? 465  LEU A N     1 
ATOM   1293 C  CA    . LEU A 1 208 ? -5.160  19.741  32.823  1.00 19.32  ? 465  LEU A CA    1 
ATOM   1294 C  C     . LEU A 1 208 ? -6.552  19.182  32.599  1.00 20.22  ? 465  LEU A C     1 
ATOM   1295 O  O     . LEU A 1 208 ? -6.826  18.480  31.626  1.00 19.79  ? 465  LEU A O     1 
ATOM   1296 C  CB    . LEU A 1 208 ? -4.441  18.949  33.922  1.00 17.88  ? 465  LEU A CB    1 
ATOM   1297 C  CG    . LEU A 1 208 ? -2.946  19.227  33.897  1.00 17.48  ? 465  LEU A CG    1 
ATOM   1298 C  CD1   . LEU A 1 208 ? -2.327  18.773  35.204  1.00 17.15  ? 465  LEU A CD1   1 
ATOM   1299 C  CD2   . LEU A 1 208 ? -2.331  18.490  32.707  1.00 17.79  ? 465  LEU A CD2   1 
ATOM   1300 N  N     . ARG A 1 209 ? -7.455  19.517  33.494  1.00 21.70  ? 466  ARG A N     1 
ATOM   1301 C  CA    . ARG A 1 209 ? -8.824  19.002  33.368  1.00 24.24  ? 466  ARG A CA    1 
ATOM   1302 C  C     . ARG A 1 209 ? -9.551  19.581  32.127  1.00 24.19  ? 466  ARG A C     1 
ATOM   1303 O  O     . ARG A 1 209 ? -10.277 18.854  31.440  1.00 23.46  ? 466  ARG A O     1 
ATOM   1304 C  CB    . ARG A 1 209 ? -9.569  19.307  34.661  1.00 28.61  ? 466  ARG A CB    1 
ATOM   1305 C  CG    . ARG A 1 209 ? -11.034 19.002  34.650  1.00 35.99  ? 466  ARG A CG    1 
ATOM   1306 C  CD    . ARG A 1 209 ? -11.322 17.501  34.679  1.00 44.65  ? 466  ARG A CD    1 
ATOM   1307 N  NE    . ARG A 1 209 ? -12.535 17.271  35.481  1.00 51.87  ? 466  ARG A NE    1 
ATOM   1308 C  CZ    . ARG A 1 209 ? -13.348 16.224  35.391  1.00 56.60  ? 466  ARG A CZ    1 
ATOM   1309 N  NH1   . ARG A 1 209 ? -13.127 15.247  34.514  1.00 58.00  ? 466  ARG A NH1   1 
ATOM   1310 N  NH2   . ARG A 1 209 ? -14.412 16.175  36.190  1.00 58.99  ? 466  ARG A NH2   1 
ATOM   1311 N  N     . ARG A 1 210 ? -9.360  20.865  31.839  1.00 23.81  ? 467  ARG A N     1 
ATOM   1312 C  CA    . ARG A 1 210 ? -9.953  21.484  30.631  1.00 26.87  ? 467  ARG A CA    1 
ATOM   1313 C  C     . ARG A 1 210 ? -9.384  20.826  29.370  1.00 25.87  ? 467  ARG A C     1 
ATOM   1314 O  O     . ARG A 1 210 ? -10.083 20.607  28.407  1.00 26.29  ? 467  ARG A O     1 
ATOM   1315 C  CB    . ARG A 1 210 ? -9.700  23.004  30.596  1.00 28.72  ? 467  ARG A CB    1 
ATOM   1316 C  CG    . ARG A 1 210 ? -10.520 23.775  31.607  1.00 31.86  ? 467  ARG A CG    1 
ATOM   1317 C  CD    . ARG A 1 210 ? -10.524 25.281  31.350  1.00 34.69  ? 467  ARG A CD    1 
ATOM   1318 N  NE    . ARG A 1 210 ? -9.169  25.841  31.390  1.00 36.65  ? 467  ARG A NE    1 
ATOM   1319 C  CZ    . ARG A 1 210 ? -8.518  26.242  32.488  1.00 36.98  ? 467  ARG A CZ    1 
ATOM   1320 N  NH1   . ARG A 1 210 ? -9.057  26.173  33.691  1.00 39.19  ? 467  ARG A NH1   1 
ATOM   1321 N  NH2   . ARG A 1 210 ? -7.308  26.750  32.381  1.00 37.05  ? 467  ARG A NH2   1 
ATOM   1322 N  N     . ASN A 1 211 ? -8.116  20.449  29.426  1.00 23.52  ? 468  ASN A N     1 
ATOM   1323 C  CA    . ASN A 1 211 ? -7.494  19.712  28.340  1.00 24.01  ? 468  ASN A CA    1 
ATOM   1324 C  C     . ASN A 1 211 ? -7.800  18.185  28.295  1.00 24.30  ? 468  ASN A C     1 
ATOM   1325 O  O     . ASN A 1 211 ? -7.251  17.505  27.457  1.00 23.15  ? 468  ASN A O     1 
ATOM   1326 C  CB    . ASN A 1 211 ? -5.975  19.847  28.470  1.00 22.34  ? 468  ASN A CB    1 
ATOM   1327 C  CG    . ASN A 1 211 ? -5.430  21.237  28.100  1.00 22.17  ? 468  ASN A CG    1 
ATOM   1328 O  OD1   . ASN A 1 211 ? -6.163  22.143  27.816  1.00 23.17  ? 468  ASN A OD1   1 
ATOM   1329 N  ND2   . ASN A 1 211 ? -4.092  21.382  28.188  1.00 21.39  ? 468  ASN A ND2   1 
ATOM   1330 N  N     . GLU A 1 212 ? -8.622  17.649  29.207  1.00 25.24  ? 469  GLU A N     1 
ATOM   1331 C  CA    . GLU A 1 212 ? -8.788  16.177  29.354  1.00 26.41  ? 469  GLU A CA    1 
ATOM   1332 C  C     . GLU A 1 212 ? -7.474  15.406  29.571  1.00 23.85  ? 469  GLU A C     1 
ATOM   1333 O  O     . GLU A 1 212 ? -7.280  14.312  29.051  1.00 24.18  ? 469  GLU A O     1 
ATOM   1334 C  CB    . GLU A 1 212 ? -9.575  15.592  28.169  1.00 29.44  ? 469  GLU A CB    1 
ATOM   1335 C  CG    . GLU A 1 212 ? -10.931 16.276  28.089  1.00 34.74  ? 469  GLU A CG    1 
ATOM   1336 C  CD    . GLU A 1 212 ? -11.845 15.721  26.997  1.00 39.09  ? 469  GLU A CD    1 
ATOM   1337 O  OE1   . GLU A 1 212 ? -11.481 14.722  26.313  1.00 44.02  ? 469  GLU A OE1   1 
ATOM   1338 O  OE2   . GLU A 1 212 ? -12.926 16.302  26.840  1.00 46.10  ? 469  GLU A OE2   1 
ATOM   1339 N  N     . GLN A 1 213 ? -6.593  15.994  30.337  1.00 21.57  ? 470  GLN A N     1 
ATOM   1340 C  CA    . GLN A 1 213 ? -5.306  15.430  30.668  1.00 20.79  ? 470  GLN A CA    1 
ATOM   1341 C  C     . GLN A 1 213 ? -5.136  15.141  32.168  1.00 20.79  ? 470  GLN A C     1 
ATOM   1342 O  O     . GLN A 1 213 ? -4.081  14.765  32.624  1.00 18.51  ? 470  GLN A O     1 
ATOM   1343 C  CB    . GLN A 1 213 ? -4.218  16.402  30.255  1.00 20.20  ? 470  GLN A CB    1 
ATOM   1344 C  CG    . GLN A 1 213 ? -4.073  16.594  28.769  1.00 20.73  ? 470  GLN A CG    1 
ATOM   1345 C  CD    . GLN A 1 213 ? -2.956  17.558  28.491  1.00 20.93  ? 470  GLN A CD    1 
ATOM   1346 O  OE1   . GLN A 1 213 ? -2.960  18.679  29.010  1.00 21.55  ? 470  GLN A OE1   1 
ATOM   1347 N  NE2   . GLN A 1 213 ? -1.983  17.134  27.680  1.00 19.68  ? 470  GLN A NE2   1 
ATOM   1348 N  N     . ASP A 1 214 ? -6.177  15.296  32.950  1.00 23.00  ? 471  ASP A N     1 
ATOM   1349 C  CA    . ASP A 1 214 ? -6.000  15.091  34.425  1.00 25.11  ? 471  ASP A CA    1 
ATOM   1350 C  C     . ASP A 1 214 ? -5.748  13.623  34.784  1.00 23.04  ? 471  ASP A C     1 
ATOM   1351 O  O     . ASP A 1 214 ? -4.939  13.349  35.665  1.00 20.72  ? 471  ASP A O     1 
ATOM   1352 C  CB    . ASP A 1 214 ? -7.192  15.655  35.196  1.00 28.37  ? 471  ASP A CB    1 
ATOM   1353 C  CG    . ASP A 1 214 ? -8.491  15.153  34.653  1.00 32.88  ? 471  ASP A CG    1 
ATOM   1354 O  OD1   . ASP A 1 214 ? -8.740  15.311  33.414  1.00 36.22  ? 471  ASP A OD1   1 
ATOM   1355 O  OD2   . ASP A 1 214 ? -9.247  14.537  35.427  1.00 40.23  ? 471  ASP A OD2   1 
ATOM   1356 N  N     . ARG A 1 215 ? -6.407  12.696  34.100  1.00 23.46  ? 472  ARG A N     1 
ATOM   1357 C  CA    . ARG A 1 215 ? -6.110  11.277  34.250  1.00 24.86  ? 472  ARG A CA    1 
ATOM   1358 C  C     . ARG A 1 215 ? -4.752  10.890  33.678  1.00 22.78  ? 472  ARG A C     1 
ATOM   1359 O  O     . ARG A 1 215 ? -4.063  10.049  34.244  1.00 21.65  ? 472  ARG A O     1 
ATOM   1360 C  CB    . ARG A 1 215 ? -7.171  10.431  33.601  1.00 28.36  ? 472  ARG A CB    1 
ATOM   1361 C  CG    . ARG A 1 215 ? -8.534  10.661  34.215  1.00 31.25  ? 472  ARG A CG    1 
ATOM   1362 C  CD    . ARG A 1 215 ? -9.550  9.784   33.522  1.00 35.99  ? 472  ARG A CD    1 
ATOM   1363 N  NE    . ARG A 1 215 ? -9.224  8.389   33.771  1.00 38.13  ? 472  ARG A NE    1 
ATOM   1364 C  CZ    . ARG A 1 215 ? -9.797  7.355   33.165  1.00 42.31  ? 472  ARG A CZ    1 
ATOM   1365 N  NH1   . ARG A 1 215 ? -10.752 7.538   32.258  1.00 45.98  ? 472  ARG A NH1   1 
ATOM   1366 N  NH2   . ARG A 1 215 ? -9.425  6.120   33.491  1.00 41.95  ? 472  ARG A NH2   1 
ATOM   1367 N  N     . LEU A 1 216 ? -4.352  11.520  32.573  1.00 20.81  ? 473  LEU A N     1 
ATOM   1368 C  CA    . LEU A 1 216 ? -2.987  11.349  32.084  1.00 19.33  ? 473  LEU A CA    1 
ATOM   1369 C  C     . LEU A 1 216 ? -1.925  11.637  33.144  1.00 17.69  ? 473  LEU A C     1 
ATOM   1370 O  O     . LEU A 1 216 ? -0.916  10.896  33.267  1.00 17.38  ? 473  LEU A O     1 
ATOM   1371 C  CB    . LEU A 1 216 ? -2.747  12.192  30.815  1.00 18.78  ? 473  LEU A CB    1 
ATOM   1372 C  CG    . LEU A 1 216 ? -1.410  12.092  30.046  1.00 18.23  ? 473  LEU A CG    1 
ATOM   1373 C  CD1   . LEU A 1 216 ? -1.147  10.672  29.578  1.00 18.47  ? 473  LEU A CD1   1 
ATOM   1374 C  CD2   . LEU A 1 216 ? -1.425  13.078  28.825  1.00 18.20  ? 473  LEU A CD2   1 
ATOM   1375 N  N     . LEU A 1 217 ? -2.084  12.727  33.899  1.00 17.73  ? 474  LEU A N     1 
ATOM   1376 C  CA    . LEU A 1 217 ? -1.140  13.017  34.956  1.00 17.23  ? 474  LEU A CA    1 
ATOM   1377 C  C     . LEU A 1 217 ? -1.259  11.990  36.091  1.00 17.59  ? 474  LEU A C     1 
ATOM   1378 O  O     . LEU A 1 217 ? -0.273  11.408  36.507  1.00 18.26  ? 474  LEU A O     1 
ATOM   1379 C  CB    . LEU A 1 217 ? -1.359  14.443  35.528  1.00 17.48  ? 474  LEU A CB    1 
ATOM   1380 C  CG    . LEU A 1 217 ? -0.522  14.881  36.708  1.00 17.30  ? 474  LEU A CG    1 
ATOM   1381 C  CD1   . LEU A 1 217 ? 0.947   15.006  36.287  1.00 15.82  ? 474  LEU A CD1   1 
ATOM   1382 C  CD2   . LEU A 1 217 ? -1.063  16.201  37.307  1.00 18.07  ? 474  LEU A CD2   1 
ATOM   1383 N  N     . VAL A 1 218 ? -2.472  11.817  36.599  1.00 19.11  ? 475  VAL A N     1 
ATOM   1384 C  CA    . VAL A 1 218 ? -2.728  11.075  37.843  1.00 20.90  ? 475  VAL A CA    1 
ATOM   1385 C  C     . VAL A 1 218 ? -2.650  9.550   37.696  1.00 20.54  ? 475  VAL A C     1 
ATOM   1386 O  O     . VAL A 1 218 ? -2.145  8.889   38.599  1.00 19.60  ? 475  VAL A O     1 
ATOM   1387 C  CB    . VAL A 1 218 ? -4.037  11.584  38.496  1.00 22.22  ? 475  VAL A CB    1 
ATOM   1388 C  CG1   . VAL A 1 218 ? -4.425  10.771  39.699  1.00 25.53  ? 475  VAL A CG1   1 
ATOM   1389 C  CG2   . VAL A 1 218 ? -3.827  13.038  38.965  1.00 23.56  ? 475  VAL A CG2   1 
ATOM   1390 N  N     . GLU A 1 219 ? -3.074  9.017   36.552  1.00 19.62  ? 476  GLU A N     1 
ATOM   1391 C  CA    . GLU A 1 219 ? -3.112  7.594   36.317  1.00 21.45  ? 476  GLU A CA    1 
ATOM   1392 C  C     . GLU A 1 219 ? -1.998  7.101   35.466  1.00 21.65  ? 476  GLU A C     1 
ATOM   1393 O  O     . GLU A 1 219 ? -1.806  5.897   35.409  1.00 21.55  ? 476  GLU A O     1 
ATOM   1394 C  CB    . GLU A 1 219 ? -4.449  7.163   35.716  1.00 23.54  ? 476  GLU A CB    1 
ATOM   1395 C  CG    . GLU A 1 219 ? -5.601  7.576   36.623  1.00 26.31  ? 476  GLU A CG    1 
ATOM   1396 C  CD    . GLU A 1 219 ? -6.969  7.230   36.102  1.00 29.98  ? 476  GLU A CD    1 
ATOM   1397 O  OE1   . GLU A 1 219 ? -7.176  6.158   35.539  1.00 35.86  ? 476  GLU A OE1   1 
ATOM   1398 O  OE2   . GLU A 1 219 ? -7.880  8.035   36.295  1.00 34.46  ? 476  GLU A OE2   1 
ATOM   1399 N  N     . LEU A 1 220 ? -1.239  7.987   34.803  1.00 20.10  ? 477  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 220 ? -0.172  7.499   33.952  1.00 20.40  ? 477  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 220 ? 1.182   8.063   34.330  1.00 18.90  ? 477  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 220 ? 2.049   7.291   34.724  1.00 17.62  ? 477  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 220 ? -0.470  7.723   32.473  1.00 22.59  ? 477  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 220 ? 0.482   7.094   31.440  1.00 25.15  ? 477  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 220 ? -0.055  5.720   31.094  1.00 28.62  ? 477  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 220 ? 0.550   7.857   30.109  1.00 28.53  ? 477  LEU A CD2   1 
ATOM   1407 N  N     . GLU A 1 221 ? 1.396   9.384   34.183  1.00 18.17  ? 478  GLU A N     1 
ATOM   1408 C  CA    . GLU A 1 221 ? 2.746   9.915   34.347  1.00 17.34  ? 478  GLU A CA    1 
ATOM   1409 C  C     . GLU A 1 221 ? 3.219   9.837   35.821  1.00 16.06  ? 478  GLU A C     1 
ATOM   1410 O  O     . GLU A 1 221 ? 4.362   9.494   36.074  1.00 14.54  ? 478  GLU A O     1 
ATOM   1411 C  CB    . GLU A 1 221 ? 2.912   11.347  33.801  1.00 18.81  ? 478  GLU A CB    1 
ATOM   1412 C  CG    . GLU A 1 221 ? 2.656   11.544  32.310  1.00 20.34  ? 478  GLU A CG    1 
ATOM   1413 C  CD    . GLU A 1 221 ? 3.680   10.911  31.363  1.00 21.70  ? 478  GLU A CD    1 
ATOM   1414 O  OE1   . GLU A 1 221 ? 4.693   10.339  31.810  1.00 24.11  ? 478  GLU A OE1   1 
ATOM   1415 O  OE2   . GLU A 1 221 ? 3.449   10.961  30.134  1.00 23.02  ? 478  GLU A OE2   1 
ATOM   1416 N  N     . GLN A 1 222 ? 2.350   10.136  36.787  1.00 16.20  ? 479  GLN A N     1 
ATOM   1417 C  CA    . GLN A 1 222 ? 2.800   10.091  38.168  1.00 17.18  ? 479  GLN A CA    1 
ATOM   1418 C  C     . GLN A 1 222 ? 3.096   8.622   38.607  1.00 17.19  ? 479  GLN A C     1 
ATOM   1419 O  O     . GLN A 1 222 ? 4.155   8.358   39.166  1.00 16.32  ? 479  GLN A O     1 
ATOM   1420 C  CB    . GLN A 1 222 ? 1.864   10.866  39.111  1.00 18.30  ? 479  GLN A CB    1 
ATOM   1421 C  CG    . GLN A 1 222 ? 1.950   12.371  38.876  1.00 17.56  ? 479  GLN A CG    1 
ATOM   1422 C  CD    . GLN A 1 222 ? 1.016   13.232  39.707  1.00 17.64  ? 479  GLN A CD    1 
ATOM   1423 O  OE1   . GLN A 1 222 ? 1.160   14.448  39.646  1.00 18.60  ? 479  GLN A OE1   1 
ATOM   1424 N  NE2   . GLN A 1 222 ? 0.023   12.639  40.427  1.00 17.66  ? 479  GLN A NE2   1 
ATOM   1425 N  N     . PRO A 1 223 ? 2.215   7.658   38.318  1.00 18.14  ? 480  PRO A N     1 
ATOM   1426 C  CA    . PRO A 1 223 ? 2.555   6.279   38.724  1.00 18.48  ? 480  PRO A CA    1 
ATOM   1427 C  C     . PRO A 1 223 ? 3.813   5.815   37.979  1.00 17.46  ? 480  PRO A C     1 
ATOM   1428 O  O     . PRO A 1 223 ? 4.640   5.086   38.522  1.00 15.69  ? 480  PRO A O     1 
ATOM   1429 C  CB    . PRO A 1 223 ? 1.337   5.468   38.281  1.00 20.01  ? 480  PRO A CB    1 
ATOM   1430 C  CG    . PRO A 1 223 ? 0.242   6.451   38.333  1.00 20.46  ? 480  PRO A CG    1 
ATOM   1431 C  CD    . PRO A 1 223 ? 0.807   7.769   37.913  1.00 19.27  ? 480  PRO A CD    1 
ATOM   1432 N  N     . LEU A 1 224 ? 4.002   6.297   36.763  1.00 17.54  ? 481  LEU A N     1 
ATOM   1433 C  CA    . LEU A 1 224 ? 5.174   5.863   35.992  1.00 17.00  ? 481  LEU A CA    1 
ATOM   1434 C  C     . LEU A 1 224 ? 6.438   6.385   36.663  1.00 17.00  ? 481  LEU A C     1 
ATOM   1435 O  O     . LEU A 1 224 ? 7.474   5.757   36.636  1.00 16.32  ? 481  LEU A O     1 
ATOM   1436 C  CB    . LEU A 1 224 ? 5.111   6.347   34.540  1.00 16.41  ? 481  LEU A CB    1 
ATOM   1437 C  CG    . LEU A 1 224 ? 6.317   6.038   33.648  1.00 16.52  ? 481  LEU A CG    1 
ATOM   1438 C  CD1   . LEU A 1 224 ? 6.377   4.518   33.360  1.00 18.48  ? 481  LEU A CD1   1 
ATOM   1439 C  CD2   . LEU A 1 224 ? 6.302   6.774   32.305  1.00 18.12  ? 481  LEU A CD2   1 
ATOM   1440 N  N     . SER A 1 225 ? 6.349   7.577   37.249  1.00 18.78  ? 482  SER A N     1 
ATOM   1441 C  CA    . SER A 1 225 ? 7.505   8.215   37.813  1.00 18.16  ? 482  SER A CA    1 
ATOM   1442 C  C     . SER A 1 225 ? 8.057   7.327   38.980  1.00 17.64  ? 482  SER A C     1 
ATOM   1443 O  O     . SER A 1 225 ? 9.259   7.179   39.151  1.00 18.40  ? 482  SER A O     1 
ATOM   1444 C  CB    . SER A 1 225 ? 7.052   9.606   38.327  1.00 19.19  ? 482  SER A CB    1 
ATOM   1445 O  OG    . SER A 1 225 ? 8.124   10.337  38.732  1.00 22.85  ? 482  SER A OG    1 
ATOM   1446 N  N     . SER A 1 226 ? 7.163   6.772   39.783  1.00 18.82  ? 483  SER A N     1 
ATOM   1447 C  CA    . SER A 1 226 ? 7.533   5.779   40.837  1.00 19.71  ? 483  SER A CA    1 
ATOM   1448 C  C     . SER A 1 226 ? 8.238   4.527   40.316  1.00 18.80  ? 483  SER A C     1 
ATOM   1449 O  O     . SER A 1 226 ? 9.223   4.062   40.902  1.00 17.81  ? 483  SER A O     1 
ATOM   1450 C  CB    . SER A 1 226 ? 6.307   5.378   41.649  1.00 20.41  ? 483  SER A CB    1 
ATOM   1451 O  OG    . SER A 1 226 ? 5.699   6.547   42.100  1.00 22.49  ? 483  SER A OG    1 
ATOM   1452 N  N     . ILE A 1 227 ? 7.740   4.024   39.193  1.00 17.05  ? 484  ILE A N     1 
ATOM   1453 C  CA    . ILE A 1 227 ? 8.296   2.851   38.513  1.00 16.16  ? 484  ILE A CA    1 
ATOM   1454 C  C     . ILE A 1 227 ? 9.678   3.168   37.957  1.00 15.61  ? 484  ILE A C     1 
ATOM   1455 O  O     . ILE A 1 227 ? 10.649  2.387   38.136  1.00 14.23  ? 484  ILE A O     1 
ATOM   1456 C  CB    . ILE A 1 227 ? 7.307   2.356   37.421  1.00 16.62  ? 484  ILE A CB    1 
ATOM   1457 C  CG1   . ILE A 1 227 ? 6.028   1.844   38.104  1.00 16.87  ? 484  ILE A CG1   1 
ATOM   1458 C  CG2   . ILE A 1 227 ? 7.962   1.332   36.482  1.00 16.88  ? 484  ILE A CG2   1 
ATOM   1459 C  CD1   . ILE A 1 227 ? 4.931   1.463   37.136  1.00 18.57  ? 484  ILE A CD1   1 
ATOM   1460 N  N     . LEU A 1 228 ? 9.822   4.351   37.366  1.00 14.94  ? 485  LEU A N     1 
ATOM   1461 C  CA    . LEU A 1 228 ? 11.145  4.725   36.874  1.00 14.94  ? 485  LEU A CA    1 
ATOM   1462 C  C     . LEU A 1 228 ? 12.150  4.925   38.018  1.00 14.69  ? 485  LEU A C     1 
ATOM   1463 O  O     . LEU A 1 228 ? 13.302  4.612   37.889  1.00 14.83  ? 485  LEU A O     1 
ATOM   1464 C  CB    . LEU A 1 228 ? 11.038  6.011   36.032  1.00 15.00  ? 485  LEU A CB    1 
ATOM   1465 C  CG    . LEU A 1 228 ? 10.203  5.887   34.743  1.00 16.34  ? 485  LEU A CG    1 
ATOM   1466 C  CD1   . LEU A 1 228 ? 10.036  7.321   34.165  1.00 15.72  ? 485  LEU A CD1   1 
ATOM   1467 C  CD2   . LEU A 1 228 ? 10.934  4.924   33.781  1.00 14.78  ? 485  LEU A CD2   1 
ATOM   1468 N  N     . ALA A 1 229 ? 11.687  5.434   39.130  1.00 15.43  ? 486  ALA A N     1 
ATOM   1469 C  CA    . ALA A 1 229 ? 12.558  5.670   40.296  1.00 16.03  ? 486  ALA A CA    1 
ATOM   1470 C  C     . ALA A 1 229 ? 13.098  4.292   40.747  1.00 17.94  ? 486  ALA A C     1 
ATOM   1471 O  O     . ALA A 1 229 ? 14.279  4.200   41.087  1.00 17.85  ? 486  ALA A O     1 
ATOM   1472 C  CB    . ALA A 1 229 ? 11.786  6.323   41.438  1.00 13.80  ? 486  ALA A CB    1 
ATOM   1473 N  N     . GLU A 1 230 ? 12.228  3.269   40.781  1.00 18.21  ? 487  GLU A N     1 
ATOM   1474 C  CA    . GLU A 1 230 ? 12.639  1.926   41.201  1.00 21.63  ? 487  GLU A CA    1 
ATOM   1475 C  C     . GLU A 1 230 ? 13.646  1.364   40.192  1.00 19.91  ? 487  GLU A C     1 
ATOM   1476 O  O     . GLU A 1 230 ? 14.616  0.725   40.588  1.00 18.21  ? 487  GLU A O     1 
ATOM   1477 C  CB    . GLU A 1 230 ? 11.436  0.950   41.318  1.00 27.15  ? 487  GLU A CB    1 
ATOM   1478 C  CG    . GLU A 1 230 ? 10.413  1.284   42.392  1.00 31.87  ? 487  GLU A CG    1 
ATOM   1479 C  CD    . GLU A 1 230 ? 9.009   0.597   42.190  1.00 42.34  ? 487  GLU A CD    1 
ATOM   1480 O  OE1   . GLU A 1 230 ? 8.850   -0.372  41.375  1.00 46.68  ? 487  GLU A OE1   1 
ATOM   1481 O  OE2   . GLU A 1 230 ? 8.026   1.051   42.843  1.00 48.09  ? 487  GLU A OE2   1 
ATOM   1482 N  N     . MET A 1 231 ? 13.414  1.605   38.906  1.00 17.33  ? 488  MET A N     1 
ATOM   1483 C  CA    . MET A 1 231 ? 14.309  1.079   37.838  1.00 18.31  ? 488  MET A CA    1 
ATOM   1484 C  C     . MET A 1 231 ? 15.699  1.730   37.936  1.00 18.18  ? 488  MET A C     1 
ATOM   1485 O  O     . MET A 1 231 ? 16.737  1.060   37.810  1.00 19.06  ? 488  MET A O     1 
ATOM   1486 C  CB    . MET A 1 231 ? 13.739  1.354   36.431  1.00 17.83  ? 488  MET A CB    1 
ATOM   1487 C  CG    . MET A 1 231 ? 12.413  0.609   36.149  1.00 19.07  ? 488  MET A CG    1 
ATOM   1488 S  SD    . MET A 1 231 ? 11.482  1.259   34.751  1.00 18.45  ? 488  MET A SD    1 
ATOM   1489 C  CE    . MET A 1 231 ? 12.643  0.998   33.394  1.00 16.22  ? 488  MET A CE    1 
ATOM   1490 N  N     . GLU A 1 232 ? 15.708  3.038   38.137  1.00 16.76  ? 489  GLU A N     1 
ATOM   1491 C  CA    . GLU A 1 232 ? 16.987  3.760   38.251  1.00 17.74  ? 489  GLU A CA    1 
ATOM   1492 C  C     . GLU A 1 232 ? 17.754  3.335   39.501  1.00 17.49  ? 489  GLU A C     1 
ATOM   1493 O  O     . GLU A 1 232 ? 18.963  3.118   39.480  1.00 18.31  ? 489  GLU A O     1 
ATOM   1494 C  CB    . GLU A 1 232 ? 16.752  5.245   38.292  1.00 17.29  ? 489  GLU A CB    1 
ATOM   1495 C  CG    . GLU A 1 232 ? 16.054  5.843   37.075  1.00 18.13  ? 489  GLU A CG    1 
ATOM   1496 C  CD    . GLU A 1 232 ? 15.657  7.300   37.295  1.00 18.27  ? 489  GLU A CD    1 
ATOM   1497 O  OE1   . GLU A 1 232 ? 15.895  7.802   38.426  1.00 19.32  ? 489  GLU A OE1   1 
ATOM   1498 O  OE2   . GLU A 1 232 ? 15.085  7.929   36.372  1.00 18.82  ? 489  GLU A OE2   1 
ATOM   1499 N  N     . PHE A 1 233 ? 17.037  3.206   40.603  1.00 18.50  ? 490  PHE A N     1 
ATOM   1500 C  CA    . PHE A 1 233 ? 17.645  2.781   41.860  1.00 18.65  ? 490  PHE A CA    1 
ATOM   1501 C  C     . PHE A 1 233 ? 18.207  1.372   41.765  1.00 19.61  ? 490  PHE A C     1 
ATOM   1502 O  O     . PHE A 1 233 ? 19.314  1.105   42.251  1.00 17.71  ? 490  PHE A O     1 
ATOM   1503 C  CB    . PHE A 1 233 ? 16.649  2.884   43.010  1.00 18.63  ? 490  PHE A CB    1 
ATOM   1504 C  CG    . PHE A 1 233 ? 17.244  2.567   44.356  1.00 19.49  ? 490  PHE A CG    1 
ATOM   1505 C  CD1   . PHE A 1 233 ? 18.227  3.390   44.914  1.00 19.41  ? 490  PHE A CD1   1 
ATOM   1506 C  CD2   . PHE A 1 233 ? 16.852  1.423   45.054  1.00 20.60  ? 490  PHE A CD2   1 
ATOM   1507 C  CE1   . PHE A 1 233 ? 18.744  3.144   46.163  1.00 20.91  ? 490  PHE A CE1   1 
ATOM   1508 C  CE2   . PHE A 1 233 ? 17.381  1.148   46.320  1.00 22.85  ? 490  PHE A CE2   1 
ATOM   1509 C  CZ    . PHE A 1 233 ? 18.337  2.003   46.875  1.00 22.50  ? 490  PHE A CZ    1 
ATOM   1510 N  N     . ALA A 1 234 ? 17.483  0.462   41.120  1.00 19.44  ? 491  ALA A N     1 
ATOM   1511 C  CA    . ALA A 1 234 ? 17.971  -0.930  40.951  1.00 19.28  ? 491  ALA A CA    1 
ATOM   1512 C  C     . ALA A 1 234 ? 19.259  -0.984  40.130  1.00 19.86  ? 491  ALA A C     1 
ATOM   1513 O  O     . ALA A 1 234 ? 20.217  -1.704  40.490  1.00 20.07  ? 491  ALA A O     1 
ATOM   1514 C  CB    . ALA A 1 234 ? 16.905  -1.788  40.273  1.00 18.78  ? 491  ALA A CB    1 
ATOM   1515 N  N     . GLY A 1 235 ? 19.305  -0.211  39.053  1.00 18.58  ? 492  GLY A N     1 
ATOM   1516 C  CA    . GLY A 1 235 ? 20.498  -0.134  38.231  1.00 19.63  ? 492  GLY A CA    1 
ATOM   1517 C  C     . GLY A 1 235 ? 20.634  -1.398  37.378  1.00 20.38  ? 492  GLY A C     1 
ATOM   1518 O  O     . GLY A 1 235 ? 19.823  -2.313  37.477  1.00 21.51  ? 492  GLY A O     1 
ATOM   1519 N  N     . VAL A 1 236 ? 21.611  -1.406  36.490  1.00 20.83  ? 493  VAL A N     1 
ATOM   1520 C  CA    . VAL A 1 236 ? 21.946  -2.578  35.668  1.00 21.07  ? 493  VAL A CA    1 
ATOM   1521 C  C     . VAL A 1 236 ? 23.423  -2.910  35.952  1.00 22.21  ? 493  VAL A C     1 
ATOM   1522 O  O     . VAL A 1 236 ? 24.311  -2.036  35.879  1.00 22.15  ? 493  VAL A O     1 
ATOM   1523 C  CB    . VAL A 1 236 ? 21.766  -2.302  34.164  1.00 21.48  ? 493  VAL A CB    1 
ATOM   1524 C  CG1   . VAL A 1 236 ? 22.090  -3.546  33.324  1.00 21.12  ? 493  VAL A CG1   1 
ATOM   1525 C  CG2   . VAL A 1 236 ? 20.355  -1.802  33.827  1.00 20.18  ? 493  VAL A CG2   1 
ATOM   1526 N  N     . LYS A 1 237 ? 23.694  -4.184  36.187  1.00 21.98  ? 494  LYS A N     1 
ATOM   1527 C  CA    . LYS A 1 237 ? 25.013  -4.655  36.528  1.00 21.91  ? 494  LYS A CA    1 
ATOM   1528 C  C     . LYS A 1 237 ? 25.825  -4.717  35.266  1.00 21.68  ? 494  LYS A C     1 
ATOM   1529 O  O     . LYS A 1 237 ? 25.329  -5.148  34.225  1.00 21.02  ? 494  LYS A O     1 
ATOM   1530 C  CB    . LYS A 1 237 ? 24.910  -6.059  37.164  1.00 23.52  ? 494  LYS A CB    1 
ATOM   1531 C  CG    . LYS A 1 237 ? 26.137  -6.637  37.777  1.00 25.02  ? 494  LYS A CG    1 
ATOM   1532 C  CD    . LYS A 1 237 ? 26.329  -6.067  39.157  1.00 28.11  ? 494  LYS A CD    1 
ATOM   1533 C  CE    . LYS A 1 237 ? 27.098  -6.942  40.096  1.00 31.10  ? 494  LYS A CE    1 
ATOM   1534 N  NZ    . LYS A 1 237 ? 27.117  -6.313  41.471  1.00 32.15  ? 494  LYS A NZ    1 
ATOM   1535 N  N     . VAL A 1 238 ? 27.094  -4.321  35.371  1.00 22.15  ? 495  VAL A N     1 
ATOM   1536 C  CA    . VAL A 1 238 ? 28.043  -4.361  34.282  1.00 22.49  ? 495  VAL A CA    1 
ATOM   1537 C  C     . VAL A 1 238 ? 29.215  -5.216  34.615  1.00 23.99  ? 495  VAL A C     1 
ATOM   1538 O  O     . VAL A 1 238 ? 29.753  -5.113  35.729  1.00 24.28  ? 495  VAL A O     1 
ATOM   1539 C  CB    . VAL A 1 238 ? 28.590  -2.951  33.959  1.00 23.37  ? 495  VAL A CB    1 
ATOM   1540 C  CG1   . VAL A 1 238 ? 29.622  -3.053  32.838  1.00 23.55  ? 495  VAL A CG1   1 
ATOM   1541 C  CG2   . VAL A 1 238 ? 27.446  -2.048  33.555  1.00 22.55  ? 495  VAL A CG2   1 
ATOM   1542 N  N     . ASP A 1 239 ? 29.601  -6.060  33.653  1.00 24.54  ? 496  ASP A N     1 
ATOM   1543 C  CA    . ASP A 1 239 ? 30.787  -6.888  33.711  1.00 26.93  ? 496  ASP A CA    1 
ATOM   1544 C  C     . ASP A 1 239 ? 31.944  -5.991  33.251  1.00 28.07  ? 496  ASP A C     1 
ATOM   1545 O  O     . ASP A 1 239 ? 32.291  -5.930  32.085  1.00 27.74  ? 496  ASP A O     1 
ATOM   1546 C  CB    . ASP A 1 239 ? 30.580  -8.121  32.817  1.00 27.70  ? 496  ASP A CB    1 
ATOM   1547 C  CG    . ASP A 1 239 ? 31.748  -9.048  32.792  1.00 29.90  ? 496  ASP A CG    1 
ATOM   1548 O  OD1   . ASP A 1 239 ? 32.815  -8.743  33.331  1.00 31.97  ? 496  ASP A OD1   1 
ATOM   1549 O  OD2   . ASP A 1 239 ? 31.590  -10.115 32.185  1.00 31.71  ? 496  ASP A OD2   1 
ATOM   1550 N  N     . THR A 1 240 ? 32.509  -5.258  34.199  1.00 29.21  ? 497  THR A N     1 
ATOM   1551 C  CA    . THR A 1 240 ? 33.544  -4.288  33.858  1.00 30.70  ? 497  THR A CA    1 
ATOM   1552 C  C     . THR A 1 240 ? 34.752  -4.973  33.298  1.00 32.77  ? 497  THR A C     1 
ATOM   1553 O  O     . THR A 1 240 ? 35.433  -4.418  32.440  1.00 33.74  ? 497  THR A O     1 
ATOM   1554 C  CB    . THR A 1 240 ? 33.947  -3.438  35.062  1.00 30.29  ? 497  THR A CB    1 
ATOM   1555 O  OG1   . THR A 1 240 ? 34.244  -4.305  36.161  1.00 31.99  ? 497  THR A OG1   1 
ATOM   1556 C  CG2   . THR A 1 240 ? 32.875  -2.522  35.422  1.00 28.42  ? 497  THR A CG2   1 
ATOM   1557 N  N     . LYS A 1 241 ? 35.027  -6.186  33.763  1.00 34.82  ? 498  LYS A N     1 
ATOM   1558 C  CA    . LYS A 1 241 ? 36.201  -6.909  33.296  1.00 38.76  ? 498  LYS A CA    1 
ATOM   1559 C  C     . LYS A 1 241 ? 36.103  -7.176  31.800  1.00 36.04  ? 498  LYS A C     1 
ATOM   1560 O  O     . LYS A 1 241 ? 37.080  -7.025  31.071  1.00 36.24  ? 498  LYS A O     1 
ATOM   1561 C  CB    . LYS A 1 241 ? 36.361  -8.225  34.058  1.00 42.82  ? 498  LYS A CB    1 
ATOM   1562 C  CG    . LYS A 1 241 ? 37.344  -8.155  35.215  1.00 48.08  ? 498  LYS A CG    1 
ATOM   1563 C  CD    . LYS A 1 241 ? 36.910  -9.051  36.364  1.00 51.90  ? 498  LYS A CD    1 
ATOM   1564 C  CE    . LYS A 1 241 ? 37.751  -8.802  37.606  1.00 54.06  ? 498  LYS A CE    1 
ATOM   1565 N  NZ    . LYS A 1 241 ? 39.083  -8.227  37.268  1.00 58.42  ? 498  LYS A NZ    1 
ATOM   1566 N  N     . ARG A 1 242 ? 34.916  -7.562  31.346  1.00 40.15  ? 499  ARG A N     1 
ATOM   1567 C  CA    . ARG A 1 242 ? 34.688  -7.794  29.926  1.00 40.76  ? 499  ARG A CA    1 
ATOM   1568 C  C     . ARG A 1 242 ? 34.858  -6.507  29.126  1.00 38.17  ? 499  ARG A C     1 
ATOM   1569 O  O     . ARG A 1 242 ? 35.449  -6.508  28.048  1.00 37.01  ? 499  ARG A O     1 
ATOM   1570 C  CB    . ARG A 1 242 ? 33.295  -8.378  29.691  1.00 43.12  ? 499  ARG A CB    1 
ATOM   1571 C  CG    . ARG A 1 242 ? 32.827  -8.298  28.248  1.00 46.10  ? 499  ARG A CG    1 
ATOM   1572 C  CD    . ARG A 1 242 ? 33.157  -9.571  27.487  1.00 52.83  ? 499  ARG A CD    1 
ATOM   1573 N  NE    . ARG A 1 242 ? 32.117  -10.582 27.644  1.00 58.15  ? 499  ARG A NE    1 
ATOM   1574 C  CZ    . ARG A 1 242 ? 32.073  -11.723 26.965  1.00 65.07  ? 499  ARG A CZ    1 
ATOM   1575 N  NH1   . ARG A 1 242 ? 33.015  -12.005 26.076  1.00 68.50  ? 499  ARG A NH1   1 
ATOM   1576 N  NH2   . ARG A 1 242 ? 31.087  -12.584 27.176  1.00 68.00  ? 499  ARG A NH2   1 
ATOM   1577 N  N     . LEU A 1 243 ? 34.343  -5.409  29.669  1.00 35.60  ? 500  LEU A N     1 
ATOM   1578 C  CA    . LEU A 1 243 ? 34.436  -4.112  29.011  1.00 33.99  ? 500  LEU A CA    1 
ATOM   1579 C  C     . LEU A 1 243 ? 35.889  -3.685  28.872  1.00 33.84  ? 500  LEU A C     1 
ATOM   1580 O  O     . LEU A 1 243 ? 36.297  -3.155  27.840  1.00 31.60  ? 500  LEU A O     1 
ATOM   1581 C  CB    . LEU A 1 243 ? 33.667  -3.055  29.805  1.00 32.91  ? 500  LEU A CB    1 
ATOM   1582 C  CG    . LEU A 1 243 ? 32.207  -2.813  29.425  1.00 32.54  ? 500  LEU A CG    1 
ATOM   1583 C  CD1   . LEU A 1 243 ? 31.677  -1.577  30.136  1.00 31.08  ? 500  LEU A CD1   1 
ATOM   1584 C  CD2   . LEU A 1 243 ? 32.056  -2.677  27.919  1.00 31.34  ? 500  LEU A CD2   1 
ATOM   1585 N  N     . GLU A 1 244 ? 36.666  -3.925  29.921  1.00 35.03  ? 501  GLU A N     1 
ATOM   1586 C  CA    . GLU A 1 244 ? 38.077  -3.534  29.941  1.00 37.58  ? 501  GLU A CA    1 
ATOM   1587 C  C     . GLU A 1 244 ? 38.892  -4.308  28.919  1.00 38.57  ? 501  GLU A C     1 
ATOM   1588 O  O     . GLU A 1 244 ? 39.737  -3.736  28.228  1.00 38.62  ? 501  GLU A O     1 
ATOM   1589 C  CB    . GLU A 1 244 ? 38.675  -3.692  31.345  1.00 39.93  ? 501  GLU A CB    1 
ATOM   1590 C  CG    . GLU A 1 244 ? 38.337  -2.503  32.215  1.00 40.37  ? 501  GLU A CG    1 
ATOM   1591 C  CD    . GLU A 1 244 ? 38.490  -2.789  33.687  1.00 43.88  ? 501  GLU A CD    1 
ATOM   1592 O  OE1   . GLU A 1 244 ? 38.932  -3.906  34.041  1.00 45.40  ? 501  GLU A OE1   1 
ATOM   1593 O  OE2   . GLU A 1 244 ? 38.101  -1.912  34.498  1.00 46.43  ? 501  GLU A OE2   1 
ATOM   1594 N  N     . GLN A 1 245 ? 38.640  -5.599  28.790  1.00 40.19  ? 502  GLN A N     1 
ATOM   1595 C  CA    . GLN A 1 245 ? 39.452  -6.384  27.869  1.00 43.44  ? 502  GLN A CA    1 
ATOM   1596 C  C     . GLN A 1 245 ? 39.069  -6.064  26.422  1.00 41.48  ? 502  GLN A C     1 
ATOM   1597 O  O     . GLN A 1 245 ? 39.932  -6.019  25.551  1.00 40.04  ? 502  GLN A O     1 
ATOM   1598 C  CB    . GLN A 1 245 ? 39.370  -7.864  28.171  1.00 47.40  ? 502  GLN A CB    1 
ATOM   1599 C  CG    . GLN A 1 245 ? 39.996  -8.248  29.489  1.00 51.64  ? 502  GLN A CG    1 
ATOM   1600 C  CD    . GLN A 1 245 ? 39.826  -9.717  29.779  1.00 56.47  ? 502  GLN A CD    1 
ATOM   1601 O  OE1   . GLN A 1 245 ? 38.894  -10.347 29.276  1.00 60.14  ? 502  GLN A OE1   1 
ATOM   1602 N  NE2   . GLN A 1 245 ? 40.739  -10.285 30.584  1.00 60.13  ? 502  GLN A NE2   1 
ATOM   1603 N  N     . MET A 1 246 ? 37.785  -5.802  26.187  1.00 39.81  ? 503  MET A N     1 
ATOM   1604 C  CA    . MET A 1 246 ? 37.333  -5.282  24.900  1.00 39.23  ? 503  MET A CA    1 
ATOM   1605 C  C     . MET A 1 246 ? 38.059  -3.983  24.574  1.00 36.79  ? 503  MET A C     1 
ATOM   1606 O  O     . MET A 1 246 ? 38.525  -3.812  23.467  1.00 35.21  ? 503  MET A O     1 
ATOM   1607 C  CB    . MET A 1 246 ? 35.833  -4.987  24.899  1.00 40.23  ? 503  MET A CB    1 
ATOM   1608 C  CG    . MET A 1 246 ? 34.960  -6.177  24.610  1.00 43.33  ? 503  MET A CG    1 
ATOM   1609 S  SD    . MET A 1 246 ? 33.205  -5.775  24.811  1.00 47.53  ? 503  MET A SD    1 
ATOM   1610 C  CE    . MET A 1 246 ? 32.510  -7.409  24.535  1.00 47.62  ? 503  MET A CE    1 
ATOM   1611 N  N     . GLY A 1 247 ? 38.139  -3.086  25.550  1.00 35.24  ? 504  GLY A N     1 
ATOM   1612 C  CA    . GLY A 1 247 ? 38.849  -1.823  25.402  1.00 35.33  ? 504  GLY A CA    1 
ATOM   1613 C  C     . GLY A 1 247 ? 40.318  -2.015  25.032  1.00 37.51  ? 504  GLY A C     1 
ATOM   1614 O  O     . GLY A 1 247 ? 40.848  -1.309  24.150  1.00 36.15  ? 504  GLY A O     1 
ATOM   1615 N  N     . GLU A 1 248 ? 40.964  -2.993  25.666  1.00 39.87  ? 505  GLU A N     1 
ATOM   1616 C  CA    . GLU A 1 248 ? 42.354  -3.342  25.329  1.00 43.95  ? 505  GLU A CA    1 
ATOM   1617 C  C     . GLU A 1 248 ? 42.495  -3.791  23.871  1.00 45.45  ? 505  GLU A C     1 
ATOM   1618 O  O     . GLU A 1 248 ? 43.421  -3.376  23.166  1.00 45.97  ? 505  GLU A O     1 
ATOM   1619 C  CB    . GLU A 1 248 ? 42.889  -4.423  26.274  1.00 46.61  ? 505  GLU A CB    1 
ATOM   1620 C  CG    . GLU A 1 248 ? 42.956  -3.934  27.712  1.00 47.66  ? 505  GLU A CG    1 
ATOM   1621 C  CD    . GLU A 1 248 ? 43.361  -5.000  28.723  1.00 52.24  ? 505  GLU A CD    1 
ATOM   1622 O  OE1   . GLU A 1 248 ? 44.462  -5.570  28.571  1.00 55.14  ? 505  GLU A OE1   1 
ATOM   1623 O  OE2   . GLU A 1 248 ? 42.590  -5.244  29.698  1.00 54.28  ? 505  GLU A OE2   1 
ATOM   1624 N  N     . GLU A 1 249 ? 41.583  -4.644  23.419  1.00 46.90  ? 506  GLU A N     1 
ATOM   1625 C  CA    . GLU A 1 249 ? 41.616  -5.114  22.045  1.00 48.95  ? 506  GLU A CA    1 
ATOM   1626 C  C     . GLU A 1 249 ? 41.371  -3.971  21.083  1.00 46.27  ? 506  GLU A C     1 
ATOM   1627 O  O     . GLU A 1 249 ? 42.070  -3.866  20.075  1.00 46.93  ? 506  GLU A O     1 
ATOM   1628 C  CB    . GLU A 1 249 ? 40.592  -6.209  21.819  1.00 52.79  ? 506  GLU A CB    1 
ATOM   1629 C  CG    . GLU A 1 249 ? 40.947  -7.481  22.565  1.00 58.86  ? 506  GLU A CG    1 
ATOM   1630 C  CD    . GLU A 1 249 ? 39.832  -8.514  22.545  1.00 63.70  ? 506  GLU A CD    1 
ATOM   1631 O  OE1   . GLU A 1 249 ? 39.534  -9.027  21.437  1.00 67.53  ? 506  GLU A OE1   1 
ATOM   1632 O  OE2   . GLU A 1 249 ? 39.259  -8.806  23.632  1.00 65.76  ? 506  GLU A OE2   1 
ATOM   1633 N  N     . LEU A 1 250 ? 40.424  -3.095  21.399  1.00 41.31  ? 507  LEU A N     1 
ATOM   1634 C  CA    . LEU A 1 250 ? 40.142  -1.947  20.543  1.00 40.25  ? 507  LEU A CA    1 
ATOM   1635 C  C     . LEU A 1 250 ? 41.337  -0.998  20.430  1.00 40.02  ? 507  LEU A C     1 
ATOM   1636 O  O     . LEU A 1 250 ? 41.634  -0.489  19.351  1.00 37.38  ? 507  LEU A O     1 
ATOM   1637 C  CB    . LEU A 1 250 ? 38.925  -1.181  21.065  1.00 37.82  ? 507  LEU A CB    1 
ATOM   1638 C  CG    . LEU A 1 250 ? 37.552  -1.665  20.600  1.00 37.52  ? 507  LEU A CG    1 
ATOM   1639 C  CD1   . LEU A 1 250 ? 36.452  -0.853  21.264  1.00 36.34  ? 507  LEU A CD1   1 
ATOM   1640 C  CD2   . LEU A 1 250 ? 37.439  -1.587  19.087  1.00 37.24  ? 507  LEU A CD2   1 
ATOM   1641 N  N     . ALA A 1 251 ? 42.015  -0.767  21.549  1.00 40.33  ? 508  ALA A N     1 
ATOM   1642 C  CA    . ALA A 1 251 ? 43.139  0.155   21.600  1.00 41.80  ? 508  ALA A CA    1 
ATOM   1643 C  C     . ALA A 1 251 ? 44.235  -0.364  20.677  1.00 43.71  ? 508  ALA A C     1 
ATOM   1644 O  O     . ALA A 1 251 ? 44.821  0.400   19.938  1.00 45.28  ? 508  ALA A O     1 
ATOM   1645 C  CB    . ALA A 1 251 ? 43.657  0.319   23.024  1.00 42.34  ? 508  ALA A CB    1 
ATOM   1646 N  N     . GLU A 1 252 ? 44.461  -1.671  20.695  1.00 46.33  ? 509  GLU A N     1 
ATOM   1647 C  CA    . GLU A 1 252 ? 45.437  -2.298  19.819  1.00 49.06  ? 509  GLU A CA    1 
ATOM   1648 C  C     . GLU A 1 252 ? 45.050  -2.136  18.346  1.00 47.23  ? 509  GLU A C     1 
ATOM   1649 O  O     . GLU A 1 252 ? 45.918  -1.825  17.516  1.00 46.04  ? 509  GLU A O     1 
ATOM   1650 C  CB    . GLU A 1 252 ? 45.626  -3.774  20.182  1.00 53.21  ? 509  GLU A CB    1 
ATOM   1651 C  CG    . GLU A 1 252 ? 46.464  -4.558  19.177  1.00 57.98  ? 509  GLU A CG    1 
ATOM   1652 C  CD    . GLU A 1 252 ? 46.893  -5.927  19.691  1.00 63.87  ? 509  GLU A CD    1 
ATOM   1653 O  OE1   . GLU A 1 252 ? 46.806  -6.172  20.921  1.00 67.01  ? 509  GLU A OE1   1 
ATOM   1654 O  OE2   . GLU A 1 252 ? 47.326  -6.775  18.867  1.00 69.75  ? 509  GLU A OE2   1 
ATOM   1655 N  N     . GLN A 1 253 ? 43.778  -2.350  18.023  1.00 44.64  ? 510  GLN A N     1 
ATOM   1656 C  CA    . GLN A 1 253 ? 43.290  -2.156  16.658  1.00 44.46  ? 510  GLN A CA    1 
ATOM   1657 C  C     . GLN A 1 253 ? 43.384  -0.699  16.193  1.00 41.91  ? 510  GLN A C     1 
ATOM   1658 O  O     . GLN A 1 253 ? 43.756  -0.426  15.053  1.00 42.61  ? 510  GLN A O     1 
ATOM   1659 C  CB    . GLN A 1 253 ? 41.858  -2.678  16.518  1.00 44.68  ? 510  GLN A CB    1 
ATOM   1660 C  CG    . GLN A 1 253 ? 41.780  -4.109  16.012  1.00 48.09  ? 510  GLN A CG    1 
ATOM   1661 C  CD    . GLN A 1 253 ? 40.440  -4.759  16.288  1.00 49.19  ? 510  GLN A CD    1 
ATOM   1662 O  OE1   . GLN A 1 253 ? 39.506  -4.642  15.496  1.00 50.16  ? 510  GLN A OE1   1 
ATOM   1663 N  NE2   . GLN A 1 253 ? 40.339  -5.452  17.416  1.00 50.40  ? 510  GLN A NE2   1 
ATOM   1664 N  N     . LEU A 1 254 ? 43.047  0.229   17.085  1.00 39.77  ? 511  LEU A N     1 
ATOM   1665 C  CA    . LEU A 1 254 ? 43.146  1.655   16.805  1.00 38.29  ? 511  LEU A CA    1 
ATOM   1666 C  C     . LEU A 1 254 ? 44.568  2.080   16.474  1.00 39.57  ? 511  LEU A C     1 
ATOM   1667 O  O     . LEU A 1 254 ? 44.769  2.829   15.536  1.00 39.00  ? 511  LEU A O     1 
ATOM   1668 C  CB    . LEU A 1 254 ? 42.614  2.489   17.960  1.00 37.05  ? 511  LEU A CB    1 
ATOM   1669 C  CG    . LEU A 1 254 ? 41.085  2.622   17.977  1.00 35.55  ? 511  LEU A CG    1 
ATOM   1670 C  CD1   . LEU A 1 254 ? 40.608  3.242   19.294  1.00 34.49  ? 511  LEU A CD1   1 
ATOM   1671 C  CD2   . LEU A 1 254 ? 40.616  3.432   16.769  1.00 33.74  ? 511  LEU A CD2   1 
ATOM   1672 N  N     . ARG A 1 255 ? 45.531  1.611   17.257  1.00 41.69  ? 512  ARG A N     1 
ATOM   1673 C  CA    . ARG A 1 255 ? 46.941  1.936   17.046  1.00 44.13  ? 512  ARG A CA    1 
ATOM   1674 C  C     . ARG A 1 255 ? 47.383  1.464   15.678  1.00 44.04  ? 512  ARG A C     1 
ATOM   1675 O  O     . ARG A 1 255 ? 48.040  2.207   14.962  1.00 45.30  ? 512  ARG A O     1 
ATOM   1676 C  CB    . ARG A 1 255 ? 47.825  1.290   18.118  1.00 47.97  ? 512  ARG A CB    1 
ATOM   1677 C  CG    . ARG A 1 255 ? 47.738  1.961   19.494  1.00 49.48  ? 512  ARG A CG    1 
ATOM   1678 C  CD    . ARG A 1 255 ? 48.909  1.559   20.397  1.00 53.91  ? 512  ARG A CD    1 
ATOM   1679 N  NE    . ARG A 1 255 ? 48.687  0.228   20.966  1.00 56.43  ? 512  ARG A NE    1 
ATOM   1680 C  CZ    . ARG A 1 255 ? 47.872  -0.031  21.995  1.00 55.57  ? 512  ARG A CZ    1 
ATOM   1681 N  NH1   . ARG A 1 255 ? 47.208  0.954   22.589  1.00 54.17  ? 512  ARG A NH1   1 
ATOM   1682 N  NH2   . ARG A 1 255 ? 47.725  -1.281  22.439  1.00 56.26  ? 512  ARG A NH2   1 
ATOM   1683 N  N     . THR A 1 256 ? 47.031  0.234   15.314  1.00 43.35  ? 513  THR A N     1 
ATOM   1684 C  CA    . THR A 1 256 ? 47.364  -0.265  13.981  1.00 44.37  ? 513  THR A CA    1 
ATOM   1685 C  C     . THR A 1 256 ? 46.772  0.614   12.868  1.00 41.50  ? 513  THR A C     1 
ATOM   1686 O  O     . THR A 1 256 ? 47.512  1.096   12.011  1.00 41.09  ? 513  THR A O     1 
ATOM   1687 C  CB    . THR A 1 256 ? 46.946  -1.744  13.780  1.00 45.38  ? 513  THR A CB    1 
ATOM   1688 O  OG1   . THR A 1 256 ? 47.531  -2.532  14.821  1.00 48.03  ? 513  THR A OG1   1 
ATOM   1689 C  CG2   . THR A 1 256 ? 47.434  -2.270  12.444  1.00 46.03  ? 513  THR A CG2   1 
ATOM   1690 N  N     . VAL A 1 257 ? 45.465  0.869   12.897  1.00 38.51  ? 514  VAL A N     1 
ATOM   1691 C  CA    A VAL A 1 257 ? 44.832  1.634   11.820  0.50 37.30  ? 514  VAL A CA    1 
ATOM   1692 C  CA    B VAL A 1 257 ? 44.845  1.634   11.815  0.50 37.34  ? 514  VAL A CA    1 
ATOM   1693 C  C     . VAL A 1 257 ? 45.333  3.098   11.809  1.00 37.07  ? 514  VAL A C     1 
ATOM   1694 O  O     . VAL A 1 257 ? 45.526  3.695   10.752  1.00 35.48  ? 514  VAL A O     1 
ATOM   1695 C  CB    A VAL A 1 257 ? 43.284  1.592   11.899  0.50 35.50  ? 514  VAL A CB    1 
ATOM   1696 C  CB    B VAL A 1 257 ? 43.297  1.572   11.847  0.50 35.59  ? 514  VAL A CB    1 
ATOM   1697 C  CG1   A VAL A 1 257 ? 42.666  2.110   10.604  0.50 34.10  ? 514  VAL A CG1   1 
ATOM   1698 C  CG1   B VAL A 1 257 ? 42.825  0.129   11.874  0.50 36.60  ? 514  VAL A CG1   1 
ATOM   1699 C  CG2   A VAL A 1 257 ? 42.801  0.177   12.162  0.50 36.49  ? 514  VAL A CG2   1 
ATOM   1700 C  CG2   B VAL A 1 257 ? 42.737  2.351   13.025  0.50 33.97  ? 514  VAL A CG2   1 
ATOM   1701 N  N     . GLU A 1 258 ? 45.551  3.676   12.983  1.00 37.93  ? 515  GLU A N     1 
ATOM   1702 C  CA    . GLU A 1 258 ? 46.033  5.043   13.071  1.00 39.93  ? 515  GLU A CA    1 
ATOM   1703 C  C     . GLU A 1 258 ? 47.355  5.186   12.331  1.00 42.59  ? 515  GLU A C     1 
ATOM   1704 O  O     . GLU A 1 258 ? 47.573  6.153   11.581  1.00 41.80  ? 515  GLU A O     1 
ATOM   1705 C  CB    . GLU A 1 258 ? 46.211  5.430   14.535  1.00 43.12  ? 515  GLU A CB    1 
ATOM   1706 C  CG    . GLU A 1 258 ? 46.625  6.862   14.794  1.00 46.38  ? 515  GLU A CG    1 
ATOM   1707 C  CD    . GLU A 1 258 ? 46.903  7.131   16.275  1.00 51.00  ? 515  GLU A CD    1 
ATOM   1708 O  OE1   . GLU A 1 258 ? 46.053  6.749   17.129  1.00 51.72  ? 515  GLU A OE1   1 
ATOM   1709 O  OE2   . GLU A 1 258 ? 47.977  7.710   16.578  1.00 54.11  ? 515  GLU A OE2   1 
ATOM   1710 N  N     . GLN A 1 259 ? 48.231  4.205   12.540  1.00 45.12  ? 516  GLN A N     1 
ATOM   1711 C  CA    . GLN A 1 259 ? 49.535  4.204   11.909  1.00 48.30  ? 516  GLN A CA    1 
ATOM   1712 C  C     . GLN A 1 259 ? 49.369  4.086   10.419  1.00 46.46  ? 516  GLN A C     1 
ATOM   1713 O  O     . GLN A 1 259 ? 50.044  4.776   9.700   1.00 46.68  ? 516  GLN A O     1 
ATOM   1714 C  CB    . GLN A 1 259 ? 50.451  3.087   12.443  1.00 51.81  ? 516  GLN A CB    1 
ATOM   1715 C  CG    . GLN A 1 259 ? 51.059  3.398   13.813  1.00 55.25  ? 516  GLN A CG    1 
ATOM   1716 C  CD    . GLN A 1 259 ? 51.787  4.742   13.845  1.00 57.92  ? 516  GLN A CD    1 
ATOM   1717 O  OE1   . GLN A 1 259 ? 52.675  4.995   13.029  1.00 61.73  ? 516  GLN A OE1   1 
ATOM   1718 N  NE2   . GLN A 1 259 ? 51.390  5.619   14.772  1.00 57.36  ? 516  GLN A NE2   1 
ATOM   1719 N  N     . ARG A 1 260 ? 48.447  3.238   9.980   1.00 45.50  ? 517  ARG A N     1 
ATOM   1720 C  CA    . ARG A 1 260 ? 48.205  3.016   8.559   1.00 45.24  ? 517  ARG A CA    1 
ATOM   1721 C  C     . ARG A 1 260 ? 47.727  4.310   7.907   1.00 42.03  ? 517  ARG A C     1 
ATOM   1722 O  O     . ARG A 1 260 ? 48.165  4.667   6.822   1.00 40.89  ? 517  ARG A O     1 
ATOM   1723 C  CB    . ARG A 1 260 ? 47.215  1.855   8.365   1.00 46.36  ? 517  ARG A CB    1 
ATOM   1724 C  CG    . ARG A 1 260 ? 46.892  1.466   6.923   1.00 48.56  ? 517  ARG A CG    1 
ATOM   1725 C  CD    . ARG A 1 260 ? 48.136  1.259   6.053   1.00 53.12  ? 517  ARG A CD    1 
ATOM   1726 N  NE    . ARG A 1 260 ? 47.837  0.848   4.673   1.00 54.03  ? 517  ARG A NE    1 
ATOM   1727 C  CZ    . ARG A 1 260 ? 48.735  0.809   3.684   1.00 57.76  ? 517  ARG A CZ    1 
ATOM   1728 N  NH1   . ARG A 1 260 ? 50.000  1.154   3.897   1.00 59.89  ? 517  ARG A NH1   1 
ATOM   1729 N  NH2   . ARG A 1 260 ? 48.376  0.418   2.465   1.00 58.93  ? 517  ARG A NH2   1 
ATOM   1730 N  N     . ILE A 1 261 ? 46.880  5.042   8.616   1.00 38.43  ? 518  ILE A N     1 
ATOM   1731 C  CA    . ILE A 1 261 ? 46.376  6.307   8.137   1.00 36.23  ? 518  ILE A CA    1 
ATOM   1732 C  C     . ILE A 1 261 ? 47.474  7.350   7.964   1.00 37.93  ? 518  ILE A C     1 
ATOM   1733 O  O     . ILE A 1 261 ? 47.460  8.090   6.971   1.00 36.00  ? 518  ILE A O     1 
ATOM   1734 C  CB    . ILE A 1 261 ? 45.240  6.841   9.042   1.00 33.89  ? 518  ILE A CB    1 
ATOM   1735 C  CG1   . ILE A 1 261 ? 43.981  5.975   8.892   1.00 32.60  ? 518  ILE A CG1   1 
ATOM   1736 C  CG2   . ILE A 1 261 ? 44.897  8.287   8.723   1.00 33.27  ? 518  ILE A CG2   1 
ATOM   1737 C  CD1   . ILE A 1 261 ? 42.917  6.199   9.984   1.00 31.02  ? 518  ILE A CD1   1 
ATOM   1738 N  N     . TYR A 1 262 ? 48.417  7.418   8.910   1.00 40.32  ? 519  TYR A N     1 
ATOM   1739 C  CA    . TYR A 1 262 ? 49.514  8.395   8.823   1.00 43.03  ? 519  TYR A CA    1 
ATOM   1740 C  C     . TYR A 1 262 ? 50.419  8.058   7.666   1.00 45.23  ? 519  TYR A C     1 
ATOM   1741 O  O     . TYR A 1 262 ? 50.870  8.966   6.961   1.00 46.14  ? 519  TYR A O     1 
ATOM   1742 C  CB    . TYR A 1 262 ? 50.351  8.472   10.109  1.00 44.83  ? 519  TYR A CB    1 
ATOM   1743 C  CG    . TYR A 1 262 ? 49.573  8.892   11.333  1.00 44.15  ? 519  TYR A CG    1 
ATOM   1744 C  CD1   . TYR A 1 262 ? 48.410  9.669   11.225  1.00 42.03  ? 519  TYR A CD1   1 
ATOM   1745 C  CD2   . TYR A 1 262 ? 50.004  8.536   12.599  1.00 45.43  ? 519  TYR A CD2   1 
ATOM   1746 C  CE1   . TYR A 1 262 ? 47.705  10.062  12.338  1.00 41.73  ? 519  TYR A CE1   1 
ATOM   1747 C  CE2   . TYR A 1 262 ? 49.293  8.933   13.723  1.00 44.97  ? 519  TYR A CE2   1 
ATOM   1748 C  CZ    . TYR A 1 262 ? 48.148  9.698   13.582  1.00 42.28  ? 519  TYR A CZ    1 
ATOM   1749 O  OH    . TYR A 1 262 ? 47.435  10.068  14.686  1.00 40.79  ? 519  TYR A OH    1 
ATOM   1750 N  N     . GLU A 1 263 ? 50.688  6.761   7.487   1.00 47.67  ? 520  GLU A N     1 
ATOM   1751 C  CA    . GLU A 1 263 ? 51.462  6.270   6.347   1.00 51.34  ? 520  GLU A CA    1 
ATOM   1752 C  C     . GLU A 1 263 ? 50.790  6.716   5.056   1.00 48.94  ? 520  GLU A C     1 
ATOM   1753 O  O     . GLU A 1 263 ? 51.428  7.323   4.195   1.00 49.61  ? 520  GLU A O     1 
ATOM   1754 C  CB    . GLU A 1 263 ? 51.539  4.732   6.335   1.00 54.95  ? 520  GLU A CB    1 
ATOM   1755 C  CG    . GLU A 1 263 ? 52.409  4.077   7.402   1.00 60.07  ? 520  GLU A CG    1 
ATOM   1756 C  CD    . GLU A 1 263 ? 52.078  2.588   7.594   1.00 63.11  ? 520  GLU A CD    1 
ATOM   1757 O  OE1   . GLU A 1 263 ? 52.027  1.838   6.578   1.00 64.61  ? 520  GLU A OE1   1 
ATOM   1758 O  OE2   . GLU A 1 263 ? 51.833  2.164   8.757   1.00 64.49  ? 520  GLU A OE2   1 
ATOM   1759 N  N     . LEU A 1 264 ? 49.494  6.430   4.927   1.00 45.17  ? 521  LEU A N     1 
ATOM   1760 C  CA    . LEU A 1 264 ? 48.779  6.756   3.697   1.00 43.92  ? 521  LEU A CA    1 
ATOM   1761 C  C     . LEU A 1 264 ? 48.652  8.269   3.482   1.00 42.58  ? 521  LEU A C     1 
ATOM   1762 O  O     . LEU A 1 264 ? 48.673  8.726   2.346   1.00 41.96  ? 521  LEU A O     1 
ATOM   1763 C  CB    . LEU A 1 264 ? 47.402  6.064   3.651   1.00 42.89  ? 521  LEU A CB    1 
ATOM   1764 C  CG    . LEU A 1 264 ? 47.445  4.565   3.296   1.00 43.64  ? 521  LEU A CG    1 
ATOM   1765 C  CD1   . LEU A 1 264 ? 46.194  3.856   3.798   1.00 40.26  ? 521  LEU A CD1   1 
ATOM   1766 C  CD2   . LEU A 1 264 ? 47.608  4.387   1.785   1.00 43.77  ? 521  LEU A CD2   1 
ATOM   1767 N  N     . ALA A 1 265 ? 48.535  9.043   4.559   1.00 41.46  ? 522  ALA A N     1 
ATOM   1768 C  CA    . ALA A 1 265 ? 48.520  10.511  4.454   1.00 41.63  ? 522  ALA A CA    1 
ATOM   1769 C  C     . ALA A 1 265 ? 49.920  11.108  4.220   1.00 45.01  ? 522  ALA A C     1 
ATOM   1770 O  O     . ALA A 1 265 ? 50.034  12.294  3.850   1.00 45.05  ? 522  ALA A O     1 
ATOM   1771 C  CB    . ALA A 1 265 ? 47.921  11.152  5.692   1.00 39.95  ? 522  ALA A CB    1 
ATOM   1772 N  N     . GLY A 1 266 ? 50.962  10.304  4.444   1.00 47.03  ? 523  GLY A N     1 
ATOM   1773 C  CA    . GLY A 1 266 ? 52.331  10.794  4.434   1.00 50.12  ? 523  GLY A CA    1 
ATOM   1774 C  C     . GLY A 1 266 ? 52.579  11.769  5.567   1.00 52.21  ? 523  GLY A C     1 
ATOM   1775 O  O     . GLY A 1 266 ? 53.447  12.606  5.460   1.00 54.82  ? 523  GLY A O     1 
ATOM   1776 N  N     . GLN A 1 267 ? 51.846  11.655  6.670   1.00 52.56  ? 524  GLN A N     1 
ATOM   1777 C  CA    . GLN A 1 267 ? 51.854  12.718  7.676   1.00 54.17  ? 524  GLN A CA    1 
ATOM   1778 C  C     . GLN A 1 267 ? 51.007  12.377  8.922   1.00 52.02  ? 524  GLN A C     1 
ATOM   1779 O  O     . GLN A 1 267 ? 49.991  11.722  8.798   1.00 47.55  ? 524  GLN A O     1 
ATOM   1780 C  CB    . GLN A 1 267 ? 51.299  13.958  6.989   1.00 54.90  ? 524  GLN A CB    1 
ATOM   1781 C  CG    . GLN A 1 267 ? 51.152  15.184  7.849   1.00 57.15  ? 524  GLN A CG    1 
ATOM   1782 C  CD    . GLN A 1 267 ? 50.432  16.268  7.093   1.00 58.19  ? 524  GLN A CD    1 
ATOM   1783 O  OE1   . GLN A 1 267 ? 50.418  16.278  5.860   1.00 58.81  ? 524  GLN A OE1   1 
ATOM   1784 N  NE2   . GLN A 1 267 ? 49.824  17.189  7.823   1.00 60.80  ? 524  GLN A NE2   1 
ATOM   1785 N  N     . GLU A 1 268 ? 51.437  12.823  10.106  1.00 53.25  ? 525  GLU A N     1 
ATOM   1786 C  CA    . GLU A 1 268 ? 50.613  12.727  11.314  1.00 52.90  ? 525  GLU A CA    1 
ATOM   1787 C  C     . GLU A 1 268 ? 49.662  13.915  11.417  1.00 50.57  ? 525  GLU A C     1 
ATOM   1788 O  O     . GLU A 1 268 ? 49.994  15.018  11.001  1.00 50.98  ? 525  GLU A O     1 
ATOM   1789 C  CB    . GLU A 1 268 ? 51.454  12.610  12.590  1.00 57.44  ? 525  GLU A CB    1 
ATOM   1790 C  CG    . GLU A 1 268 ? 52.233  11.296  12.704  1.00 60.75  ? 525  GLU A CG    1 
ATOM   1791 C  CD    . GLU A 1 268 ? 52.793  11.017  14.103  1.00 64.37  ? 525  GLU A CD    1 
ATOM   1792 O  OE1   . GLU A 1 268 ? 52.319  11.604  15.098  1.00 65.93  ? 525  GLU A OE1   1 
ATOM   1793 O  OE2   . GLU A 1 268 ? 53.706  10.178  14.218  1.00 67.60  ? 525  GLU A OE2   1 
ATOM   1794 N  N     . PHE A 1 269 ? 48.452  13.661  11.910  1.00 46.38  ? 526  PHE A N     1 
ATOM   1795 C  CA    . PHE A 1 269 ? 47.455  14.706  12.075  1.00 45.15  ? 526  PHE A CA    1 
ATOM   1796 C  C     . PHE A 1 269 ? 46.410  14.176  13.046  1.00 43.85  ? 526  PHE A C     1 
ATOM   1797 O  O     . PHE A 1 269 ? 46.433  12.987  13.375  1.00 41.84  ? 526  PHE A O     1 
ATOM   1798 C  CB    . PHE A 1 269 ? 46.838  15.107  10.715  1.00 44.08  ? 526  PHE A CB    1 
ATOM   1799 C  CG    . PHE A 1 269 ? 46.044  14.020  10.045  1.00 41.65  ? 526  PHE A CG    1 
ATOM   1800 C  CD1   . PHE A 1 269 ? 46.680  13.002  9.333   1.00 42.38  ? 526  PHE A CD1   1 
ATOM   1801 C  CD2   . PHE A 1 269 ? 44.657  14.040  10.076  1.00 39.91  ? 526  PHE A CD2   1 
ATOM   1802 C  CE1   . PHE A 1 269 ? 45.944  12.017  8.685   1.00 40.10  ? 526  PHE A CE1   1 
ATOM   1803 C  CE2   . PHE A 1 269 ? 43.921  13.045  9.462   1.00 38.51  ? 526  PHE A CE2   1 
ATOM   1804 C  CZ    . PHE A 1 269 ? 44.567  12.030  8.771   1.00 38.52  ? 526  PHE A CZ    1 
ATOM   1805 N  N     . ASN A 1 270 ? 45.518  15.036  13.528  1.00 43.03  ? 527  ASN A N     1 
ATOM   1806 C  CA    . ASN A 1 270 ? 44.487  14.566  14.440  1.00 41.30  ? 527  ASN A CA    1 
ATOM   1807 C  C     . ASN A 1 270 ? 43.321  14.033  13.610  1.00 39.70  ? 527  ASN A C     1 
ATOM   1808 O  O     . ASN A 1 270 ? 42.574  14.795  12.996  1.00 38.73  ? 527  ASN A O     1 
ATOM   1809 C  CB    . ASN A 1 270 ? 44.036  15.661  15.408  1.00 42.06  ? 527  ASN A CB    1 
ATOM   1810 C  CG    . ASN A 1 270 ? 43.112  15.136  16.488  1.00 40.58  ? 527  ASN A CG    1 
ATOM   1811 O  OD1   . ASN A 1 270 ? 42.616  14.006  16.412  1.00 38.68  ? 527  ASN A OD1   1 
ATOM   1812 N  ND2   . ASN A 1 270 ? 42.869  15.946  17.500  1.00 41.42  ? 527  ASN A ND2   1 
ATOM   1813 N  N     . ILE A 1 271 ? 43.189  12.713  13.599  1.00 38.15  ? 528  ILE A N     1 
ATOM   1814 C  CA    . ILE A 1 271 ? 42.223  12.057  12.754  1.00 37.45  ? 528  ILE A CA    1 
ATOM   1815 C  C     . ILE A 1 271 ? 40.835  12.374  13.268  1.00 38.74  ? 528  ILE A C     1 
ATOM   1816 O  O     . ILE A 1 271 ? 39.877  12.335  12.503  1.00 39.45  ? 528  ILE A O     1 
ATOM   1817 C  CB    . ILE A 1 271 ? 42.442  10.525  12.736  1.00 36.12  ? 528  ILE A CB    1 
ATOM   1818 C  CG1   . ILE A 1 271 ? 43.872  10.183  12.306  1.00 36.27  ? 528  ILE A CG1   1 
ATOM   1819 C  CG2   . ILE A 1 271 ? 41.450  9.852   11.799  1.00 35.60  ? 528  ILE A CG2   1 
ATOM   1820 C  CD1   . ILE A 1 271 ? 44.225  8.731   12.453  1.00 35.59  ? 528  ILE A CD1   1 
ATOM   1821 N  N     . ASN A 1 272 ? 40.732  12.679  14.569  1.00 39.72  ? 529  ASN A N     1 
ATOM   1822 C  CA    . ASN A 1 272 ? 39.463  13.052  15.213  1.00 39.79  ? 529  ASN A CA    1 
ATOM   1823 C  C     . ASN A 1 272 ? 38.971  14.465  14.922  1.00 39.84  ? 529  ASN A C     1 
ATOM   1824 O  O     . ASN A 1 272 ? 37.878  14.839  15.352  1.00 38.63  ? 529  ASN A O     1 
ATOM   1825 C  CB    . ASN A 1 272 ? 39.568  12.877  16.723  1.00 41.12  ? 529  ASN A CB    1 
ATOM   1826 C  CG    . ASN A 1 272 ? 39.668  11.429  17.124  1.00 41.95  ? 529  ASN A CG    1 
ATOM   1827 O  OD1   . ASN A 1 272 ? 40.128  11.120  18.191  1.00 49.89  ? 529  ASN A OD1   1 
ATOM   1828 N  ND2   . ASN A 1 272 ? 39.214  10.551  16.282  1.00 41.44  ? 529  ASN A ND2   1 
ATOM   1829 N  N     . SER A 1 273 ? 39.765  15.233  14.187  1.00 38.59  ? 530  SER A N     1 
ATOM   1830 C  CA    . SER A 1 273 ? 39.411  16.586  13.862  1.00 40.43  ? 530  SER A CA    1 
ATOM   1831 C  C     . SER A 1 273 ? 38.879  16.625  12.433  1.00 41.17  ? 530  SER A C     1 
ATOM   1832 O  O     . SER A 1 273 ? 39.652  16.500  11.493  1.00 40.66  ? 530  SER A O     1 
ATOM   1833 C  CB    . SER A 1 273 ? 40.632  17.502  13.979  1.00 41.15  ? 530  SER A CB    1 
ATOM   1834 O  OG    . SER A 1 273 ? 40.364  18.751  13.374  1.00 42.62  ? 530  SER A OG    1 
ATOM   1835 N  N     . PRO A 1 274 ? 37.560  16.824  12.267  1.00 42.12  ? 531  PRO A N     1 
ATOM   1836 C  CA    . PRO A 1 274 ? 37.027  16.949  10.902  1.00 41.69  ? 531  PRO A CA    1 
ATOM   1837 C  C     . PRO A 1 274 ? 37.732  18.040  10.063  1.00 43.43  ? 531  PRO A C     1 
ATOM   1838 O  O     . PRO A 1 274 ? 37.807  17.913  8.826   1.00 43.21  ? 531  PRO A O     1 
ATOM   1839 C  CB    . PRO A 1 274 ? 35.534  17.267  11.125  1.00 42.07  ? 531  PRO A CB    1 
ATOM   1840 C  CG    . PRO A 1 274 ? 35.219  16.764  12.484  1.00 42.11  ? 531  PRO A CG    1 
ATOM   1841 C  CD    . PRO A 1 274 ? 36.491  16.859  13.291  1.00 41.29  ? 531  PRO A CD    1 
ATOM   1842 N  N     . LYS A 1 275 ? 38.272  19.066  10.723  1.00 42.84  ? 532  LYS A N     1 
ATOM   1843 C  CA    . LYS A 1 275 ? 38.942  20.149  10.021  1.00 44.44  ? 532  LYS A CA    1 
ATOM   1844 C  C     . LYS A 1 275 ? 40.302  19.737  9.445   1.00 43.56  ? 532  LYS A C     1 
ATOM   1845 O  O     . LYS A 1 275 ? 40.648  20.108  8.322   1.00 43.10  ? 532  LYS A O     1 
ATOM   1846 C  CB    . LYS A 1 275 ? 39.134  21.335  10.970  1.00 47.54  ? 532  LYS A CB    1 
ATOM   1847 C  CG    . LYS A 1 275 ? 39.725  22.564  10.302  1.00 50.19  ? 532  LYS A CG    1 
ATOM   1848 C  CD    . LYS A 1 275 ? 40.255  23.581  11.316  1.00 54.33  ? 532  LYS A CD    1 
ATOM   1849 C  CE    . LYS A 1 275 ? 41.013  24.701  10.583  1.00 56.61  ? 532  LYS A CE    1 
ATOM   1850 N  NZ    . LYS A 1 275 ? 41.322  25.847  11.485  1.00 60.97  ? 532  LYS A NZ    1 
ATOM   1851 N  N     . GLN A 1 276 ? 41.081  19.004  10.242  1.00 42.53  ? 533  GLN A N     1 
ATOM   1852 C  CA    . GLN A 1 276 ? 42.395  18.521  9.824   1.00 41.82  ? 533  GLN A CA    1 
ATOM   1853 C  C     . GLN A 1 276 ? 42.242  17.388  8.816   1.00 39.47  ? 533  GLN A C     1 
ATOM   1854 O  O     . GLN A 1 276 ? 42.969  17.312  7.834   1.00 39.14  ? 533  GLN A O     1 
ATOM   1855 C  CB    . GLN A 1 276 ? 43.178  18.022  11.027  1.00 42.46  ? 533  GLN A CB    1 
ATOM   1856 C  CG    . GLN A 1 276 ? 43.558  19.132  12.000  1.00 45.54  ? 533  GLN A CG    1 
ATOM   1857 C  CD    . GLN A 1 276 ? 44.390  18.596  13.135  1.00 46.44  ? 533  GLN A CD    1 
ATOM   1858 O  OE1   . GLN A 1 276 ? 45.352  17.868  12.915  1.00 46.33  ? 533  GLN A OE1   1 
ATOM   1859 N  NE2   . GLN A 1 276 ? 43.980  18.888  14.359  1.00 48.61  ? 533  GLN A NE2   1 
ATOM   1860 N  N     . LEU A 1 277 ? 41.255  16.528  9.046   1.00 37.78  ? 534  LEU A N     1 
ATOM   1861 C  CA    . LEU A 1 277 ? 40.959  15.443  8.119   1.00 36.44  ? 534  LEU A CA    1 
ATOM   1862 C  C     . LEU A 1 277 ? 40.537  16.001  6.761   1.00 36.57  ? 534  LEU A C     1 
ATOM   1863 O  O     . LEU A 1 277 ? 40.951  15.501  5.717   1.00 35.68  ? 534  LEU A O     1 
ATOM   1864 C  CB    . LEU A 1 277 ? 39.858  14.549  8.685   1.00 35.83  ? 534  LEU A CB    1 
ATOM   1865 C  CG    . LEU A 1 277 ? 39.488  13.325  7.849   1.00 35.06  ? 534  LEU A CG    1 
ATOM   1866 C  CD1   . LEU A 1 277 ? 40.674  12.382  7.736   1.00 34.80  ? 534  LEU A CD1   1 
ATOM   1867 C  CD2   . LEU A 1 277 ? 38.287  12.615  8.455   1.00 35.09  ? 534  LEU A CD2   1 
ATOM   1868 N  N     . GLY A 1 278 ? 39.719  17.048  6.789   1.00 36.54  ? 535  GLY A N     1 
ATOM   1869 C  CA    . GLY A 1 278 ? 39.346  17.783  5.592   1.00 36.76  ? 535  GLY A CA    1 
ATOM   1870 C  C     . GLY A 1 278 ? 40.528  18.302  4.782   1.00 37.15  ? 535  GLY A C     1 
ATOM   1871 O  O     . GLY A 1 278 ? 40.539  18.174  3.554   1.00 36.14  ? 535  GLY A O     1 
ATOM   1872 N  N     . VAL A 1 279 ? 41.529  18.884  5.445   1.00 37.79  ? 536  VAL A N     1 
ATOM   1873 C  CA    . VAL A 1 279 ? 42.725  19.329  4.728   1.00 38.94  ? 536  VAL A CA    1 
ATOM   1874 C  C     . VAL A 1 279 ? 43.430  18.129  4.053   1.00 37.79  ? 536  VAL A C     1 
ATOM   1875 O  O     . VAL A 1 279 ? 43.880  18.227  2.884   1.00 37.64  ? 536  VAL A O     1 
ATOM   1876 C  CB    . VAL A 1 279 ? 43.715  20.068  5.647   1.00 40.96  ? 536  VAL A CB    1 
ATOM   1877 C  CG1   . VAL A 1 279 ? 44.985  20.419  4.901   1.00 41.76  ? 536  VAL A CG1   1 
ATOM   1878 C  CG2   . VAL A 1 279 ? 43.072  21.327  6.235   1.00 42.66  ? 536  VAL A CG2   1 
ATOM   1879 N  N     . ILE A 1 280 ? 43.529  17.004  4.763   1.00 35.88  ? 537  ILE A N     1 
ATOM   1880 C  CA    . ILE A 1 280 ? 44.222  15.823  4.198   1.00 34.96  ? 537  ILE A CA    1 
ATOM   1881 C  C     . ILE A 1 280 ? 43.455  15.314  2.968   1.00 33.12  ? 537  ILE A C     1 
ATOM   1882 O  O     . ILE A 1 280 ? 44.012  15.148  1.904   1.00 33.12  ? 537  ILE A O     1 
ATOM   1883 C  CB    . ILE A 1 280 ? 44.362  14.671  5.227   1.00 34.50  ? 537  ILE A CB    1 
ATOM   1884 C  CG1   . ILE A 1 280 ? 45.249  15.085  6.410   1.00 36.16  ? 537  ILE A CG1   1 
ATOM   1885 C  CG2   . ILE A 1 280 ? 44.931  13.415  4.555   1.00 34.38  ? 537  ILE A CG2   1 
ATOM   1886 C  CD1   . ILE A 1 280 ? 46.640  15.545  6.026   1.00 37.39  ? 537  ILE A CD1   1 
ATOM   1887 N  N     . LEU A 1 281 ? 42.155  15.143  3.125   1.00 31.46  ? 538  LEU A N     1 
ATOM   1888 C  CA    . LEU A 1 281 ? 41.353  14.511  2.107   1.00 31.06  ? 538  LEU A CA    1 
ATOM   1889 C  C     . LEU A 1 281 ? 41.208  15.413  0.883   1.00 31.65  ? 538  LEU A C     1 
ATOM   1890 O  O     . LEU A 1 281 ? 41.456  14.959  -0.248  1.00 31.02  ? 538  LEU A O     1 
ATOM   1891 C  CB    . LEU A 1 281 ? 39.965  14.120  2.650   1.00 29.94  ? 538  LEU A CB    1 
ATOM   1892 C  CG    . LEU A 1 281 ? 39.988  13.040  3.749   1.00 29.87  ? 538  LEU A CG    1 
ATOM   1893 C  CD1   . LEU A 1 281 ? 38.553  12.629  4.106   1.00 29.24  ? 538  LEU A CD1   1 
ATOM   1894 C  CD2   . LEU A 1 281 ? 40.848  11.807  3.437   1.00 28.93  ? 538  LEU A CD2   1 
ATOM   1895 N  N     . PHE A 1 282 ? 40.826  16.665  1.125   1.00 32.14  ? 539  PHE A N     1 
ATOM   1896 C  CA    . PHE A 1 282 ? 40.330  17.531  0.074   1.00 33.92  ? 539  PHE A CA    1 
ATOM   1897 C  C     . PHE A 1 282 ? 41.340  18.486  -0.474  1.00 36.13  ? 539  PHE A C     1 
ATOM   1898 O  O     . PHE A 1 282 ? 41.160  18.956  -1.581  1.00 37.80  ? 539  PHE A O     1 
ATOM   1899 C  CB    . PHE A 1 282 ? 39.086  18.241  0.538   1.00 33.83  ? 539  PHE A CB    1 
ATOM   1900 C  CG    . PHE A 1 282 ? 38.063  17.295  1.011   1.00 32.93  ? 539  PHE A CG    1 
ATOM   1901 C  CD1   . PHE A 1 282 ? 37.576  16.307  0.140   1.00 32.04  ? 539  PHE A CD1   1 
ATOM   1902 C  CD2   . PHE A 1 282 ? 37.593  17.333  2.317   1.00 32.71  ? 539  PHE A CD2   1 
ATOM   1903 C  CE1   . PHE A 1 282 ? 36.669  15.375  0.571   1.00 31.44  ? 539  PHE A CE1   1 
ATOM   1904 C  CE2   . PHE A 1 282 ? 36.685  16.399  2.741   1.00 31.70  ? 539  PHE A CE2   1 
ATOM   1905 C  CZ    . PHE A 1 282 ? 36.237  15.410  1.876   1.00 31.47  ? 539  PHE A CZ    1 
ATOM   1906 N  N     . GLU A 1 283 ? 42.417  18.726  0.267   1.00 38.25  ? 540  GLU A N     1 
ATOM   1907 C  CA    . GLU A 1 283 ? 43.514  19.567  -0.201  1.00 40.70  ? 540  GLU A CA    1 
ATOM   1908 C  C     . GLU A 1 283 ? 44.735  18.749  -0.552  1.00 40.88  ? 540  GLU A C     1 
ATOM   1909 O  O     . GLU A 1 283 ? 45.198  18.803  -1.686  1.00 41.73  ? 540  GLU A O     1 
ATOM   1910 C  CB    . GLU A 1 283 ? 43.847  20.612  0.857   1.00 43.88  ? 540  GLU A CB    1 
ATOM   1911 C  CG    . GLU A 1 283 ? 42.681  21.567  1.018   1.00 45.89  ? 540  GLU A CG    1 
ATOM   1912 C  CD    . GLU A 1 283 ? 42.891  22.653  2.036   1.00 49.19  ? 540  GLU A CD    1 
ATOM   1913 O  OE1   . GLU A 1 283 ? 44.061  22.956  2.398   1.00 51.82  ? 540  GLU A OE1   1 
ATOM   1914 O  OE2   . GLU A 1 283 ? 41.849  23.191  2.468   1.00 50.43  ? 540  GLU A OE2   1 
ATOM   1915 N  N     . LYS A 1 284 ? 45.271  17.971  0.386   1.00 40.31  ? 541  LYS A N     1 
ATOM   1916 C  CA    . LYS A 1 284 ? 46.512  17.244  0.084   1.00 40.82  ? 541  LYS A CA    1 
ATOM   1917 C  C     . LYS A 1 284 ? 46.241  16.126  -0.948  1.00 39.06  ? 541  LYS A C     1 
ATOM   1918 O  O     . LYS A 1 284 ? 46.944  16.027  -1.941  1.00 38.34  ? 541  LYS A O     1 
ATOM   1919 C  CB    . LYS A 1 284 ? 47.145  16.697  1.351   1.00 42.26  ? 541  LYS A CB    1 
ATOM   1920 C  CG    . LYS A 1 284 ? 48.517  16.056  1.192   1.00 44.44  ? 541  LYS A CG    1 
ATOM   1921 C  CD    . LYS A 1 284 ? 49.061  15.698  2.583   1.00 46.20  ? 541  LYS A CD    1 
ATOM   1922 C  CE    . LYS A 1 284 ? 50.547  15.341  2.605   1.00 49.01  ? 541  LYS A CE    1 
ATOM   1923 N  NZ    . LYS A 1 284 ? 50.829  14.172  1.725   1.00 49.69  ? 541  LYS A NZ    1 
ATOM   1924 N  N     . LEU A 1 285 ? 45.200  15.327  -0.730  1.00 35.62  ? 542  LEU A N     1 
ATOM   1925 C  CA    . LEU A 1 285 ? 44.920  14.181  -1.613  1.00 34.67  ? 542  LEU A CA    1 
ATOM   1926 C  C     . LEU A 1 285 ? 43.961  14.524  -2.765  1.00 34.35  ? 542  LEU A C     1 
ATOM   1927 O  O     . LEU A 1 285 ? 43.776  13.721  -3.663  1.00 33.28  ? 542  LEU A O     1 
ATOM   1928 C  CB    . LEU A 1 285 ? 44.376  13.018  -0.777  1.00 33.48  ? 542  LEU A CB    1 
ATOM   1929 C  CG    . LEU A 1 285 ? 45.400  12.443  0.236   1.00 34.07  ? 542  LEU A CG    1 
ATOM   1930 C  CD1   . LEU A 1 285 ? 44.766  11.278  1.009   1.00 32.85  ? 542  LEU A CD1   1 
ATOM   1931 C  CD2   . LEU A 1 285 ? 46.714  12.009  -0.444  1.00 34.72  ? 542  LEU A CD2   1 
ATOM   1932 N  N     . GLN A 1 286 ? 43.334  15.703  -2.701  1.00 35.36  ? 543  GLN A N     1 
ATOM   1933 C  CA    . GLN A 1 286 ? 42.531  16.242  -3.778  1.00 36.25  ? 543  GLN A CA    1 
ATOM   1934 C  C     . GLN A 1 286 ? 41.303  15.381  -4.122  1.00 35.46  ? 543  GLN A C     1 
ATOM   1935 O  O     . GLN A 1 286 ? 40.857  15.350  -5.278  1.00 34.32  ? 543  GLN A O     1 
ATOM   1936 C  CB    . GLN A 1 286 ? 43.416  16.407  -5.030  1.00 39.33  ? 543  GLN A CB    1 
ATOM   1937 C  CG    . GLN A 1 286 ? 44.563  17.375  -4.855  1.00 40.92  ? 543  GLN A CG    1 
ATOM   1938 C  CD    . GLN A 1 286 ? 44.102  18.784  -5.041  1.00 43.59  ? 543  GLN A CD    1 
ATOM   1939 O  OE1   . GLN A 1 286 ? 43.684  19.146  -6.133  1.00 45.60  ? 543  GLN A OE1   1 
ATOM   1940 N  NE2   . GLN A 1 286 ? 44.192  19.605  -3.979  1.00 44.35  ? 543  GLN A NE2   1 
ATOM   1941 N  N     . LEU A 1 287 ? 40.737  14.704  -3.122  1.00 33.82  ? 544  LEU A N     1 
ATOM   1942 C  CA    . LEU A 1 287 ? 39.498  13.972  -3.331  1.00 33.19  ? 544  LEU A CA    1 
ATOM   1943 C  C     . LEU A 1 287 ? 38.387  14.966  -3.668  1.00 34.10  ? 544  LEU A C     1 
ATOM   1944 O  O     . LEU A 1 287 ? 38.428  16.092  -3.169  1.00 33.97  ? 544  LEU A O     1 
ATOM   1945 C  CB    . LEU A 1 287 ? 39.158  13.185  -2.070  1.00 32.02  ? 544  LEU A CB    1 
ATOM   1946 C  CG    . LEU A 1 287 ? 40.255  12.223  -1.609  1.00 31.82  ? 544  LEU A CG    1 
ATOM   1947 C  CD1   . LEU A 1 287 ? 39.744  11.288  -0.505  1.00 30.68  ? 544  LEU A CD1   1 
ATOM   1948 C  CD2   . LEU A 1 287 ? 40.825  11.399  -2.767  1.00 31.18  ? 544  LEU A CD2   1 
ATOM   1949 N  N     . PRO A 1 288 ? 37.402  14.572  -4.506  1.00 34.30  ? 545  PRO A N     1 
ATOM   1950 C  CA    . PRO A 1 288 ? 36.272  15.488  -4.790  1.00 35.96  ? 545  PRO A CA    1 
ATOM   1951 C  C     . PRO A 1 288 ? 35.483  15.865  -3.535  1.00 36.27  ? 545  PRO A C     1 
ATOM   1952 O  O     . PRO A 1 288 ? 35.239  15.023  -2.672  1.00 34.82  ? 545  PRO A O     1 
ATOM   1953 C  CB    . PRO A 1 288 ? 35.341  14.687  -5.716  1.00 36.87  ? 545  PRO A CB    1 
ATOM   1954 C  CG    . PRO A 1 288 ? 36.040  13.402  -6.022  1.00 36.04  ? 545  PRO A CG    1 
ATOM   1955 C  CD    . PRO A 1 288 ? 37.216  13.241  -5.103  1.00 34.90  ? 545  PRO A CD    1 
ATOM   1956 N  N     . VAL A 1 289 ? 35.070  17.120  -3.481  1.00 38.62  ? 546  VAL A N     1 
ATOM   1957 C  CA    . VAL A 1 289 ? 34.199  17.634  -2.451  1.00 39.61  ? 546  VAL A CA    1 
ATOM   1958 C  C     . VAL A 1 289 ? 32.765  17.394  -2.905  1.00 41.42  ? 546  VAL A C     1 
ATOM   1959 O  O     . VAL A 1 289 ? 32.253  18.101  -3.751  1.00 42.26  ? 546  VAL A O     1 
ATOM   1960 C  CB    . VAL A 1 289 ? 34.457  19.145  -2.240  1.00 41.27  ? 546  VAL A CB    1 
ATOM   1961 C  CG1   . VAL A 1 289 ? 33.552  19.705  -1.150  1.00 41.41  ? 546  VAL A CG1   1 
ATOM   1962 C  CG2   . VAL A 1 289 ? 35.936  19.360  -1.912  1.00 40.51  ? 546  VAL A CG2   1 
ATOM   1963 N  N     . LEU A 1 290 ? 32.129  16.384  -2.328  1.00 41.73  ? 547  LEU A N     1 
ATOM   1964 C  CA    . LEU A 1 290 ? 30.763  15.997  -2.686  1.00 44.04  ? 547  LEU A CA    1 
ATOM   1965 C  C     . LEU A 1 290 ? 29.725  16.695  -1.827  1.00 46.73  ? 547  LEU A C     1 
ATOM   1966 O  O     . LEU A 1 290 ? 28.554  16.706  -2.181  1.00 48.16  ? 547  LEU A O     1 
ATOM   1967 C  CB    . LEU A 1 290 ? 30.566  14.491  -2.465  1.00 43.00  ? 547  LEU A CB    1 
ATOM   1968 C  CG    . LEU A 1 290 ? 31.488  13.549  -3.242  1.00 42.32  ? 547  LEU A CG    1 
ATOM   1969 C  CD1   . LEU A 1 290 ? 31.141  12.114  -2.823  1.00 41.09  ? 547  LEU A CD1   1 
ATOM   1970 C  CD2   . LEU A 1 290 ? 31.377  13.794  -4.746  1.00 43.00  ? 547  LEU A CD2   1 
ATOM   1971 N  N     . LYS A 1 291 ? 30.150  17.238  -0.689  1.00 47.00  ? 548  LYS A N     1 
ATOM   1972 C  CA    . LYS A 1 291 ? 29.228  17.819  0.269   1.00 50.72  ? 548  LYS A CA    1 
ATOM   1973 C  C     . LYS A 1 291 ? 29.971  18.759  1.218   1.00 50.90  ? 548  LYS A C     1 
ATOM   1974 O  O     . LYS A 1 291 ? 31.068  18.450  1.692   1.00 46.51  ? 548  LYS A O     1 
ATOM   1975 C  CB    . LYS A 1 291 ? 28.548  16.691  1.048   1.00 52.45  ? 548  LYS A CB    1 
ATOM   1976 C  CG    . LYS A 1 291 ? 27.438  17.124  1.994   1.00 56.15  ? 548  LYS A CG    1 
ATOM   1977 C  CD    . LYS A 1 291 ? 26.657  15.903  2.462   1.00 57.78  ? 548  LYS A CD    1 
ATOM   1978 C  CE    . LYS A 1 291 ? 25.925  16.173  3.764   1.00 60.40  ? 548  LYS A CE    1 
ATOM   1979 N  NZ    . LYS A 1 291 ? 25.015  15.050  4.092   1.00 62.44  ? 548  LYS A NZ    1 
ATOM   1980 N  N     . LYS A 1 292 ? 29.360  19.909  1.489   1.00 54.61  ? 549  LYS A N     1 
ATOM   1981 C  CA    . LYS A 1 292 ? 29.915  20.876  2.425   1.00 56.49  ? 549  LYS A CA    1 
ATOM   1982 C  C     . LYS A 1 292 ? 29.039  20.974  3.661   1.00 57.86  ? 549  LYS A C     1 
ATOM   1983 O  O     . LYS A 1 292 ? 27.865  20.584  3.649   1.00 57.92  ? 549  LYS A O     1 
ATOM   1984 C  CB    . LYS A 1 292 ? 30.059  22.250  1.779   1.00 60.59  ? 549  LYS A CB    1 
ATOM   1985 C  CG    . LYS A 1 292 ? 30.878  22.228  0.494   1.00 61.37  ? 549  LYS A CG    1 
ATOM   1986 C  CD    . LYS A 1 292 ? 31.537  23.565  0.151   1.00 64.13  ? 549  LYS A CD    1 
ATOM   1987 C  CE    . LYS A 1 292 ? 30.554  24.728  0.105   1.00 69.10  ? 549  LYS A CE    1 
ATOM   1988 N  NZ    . LYS A 1 292 ? 29.474  24.548  -0.903  1.00 72.68  ? 549  LYS A NZ    1 
ATOM   1989 N  N     . SER A 1 293 ? 29.661  21.439  4.739   1.00 57.38  ? 550  SER A N     1 
ATOM   1990 C  CA    A SER A 1 293 ? 28.961  21.767  5.972   0.70 58.35  ? 550  SER A CA    1 
ATOM   1991 C  CA    B SER A 1 293 ? 28.959  21.767  5.970   0.30 58.27  ? 550  SER A CA    1 
ATOM   1992 C  C     . SER A 1 293 ? 28.938  23.285  6.077   1.00 61.31  ? 550  SER A C     1 
ATOM   1993 O  O     . SER A 1 293 ? 29.585  23.974  5.280   1.00 60.68  ? 550  SER A O     1 
ATOM   1994 C  CB    A SER A 1 293 ? 29.700  21.173  7.171   0.70 55.99  ? 550  SER A CB    1 
ATOM   1995 C  CB    B SER A 1 293 ? 29.678  21.162  7.180   0.30 55.90  ? 550  SER A CB    1 
ATOM   1996 O  OG    A SER A 1 293 ? 31.025  21.678  7.232   0.70 55.22  ? 550  SER A OG    1 
ATOM   1997 O  OG    B SER A 1 293 ? 30.037  19.811  6.943   0.30 52.95  ? 550  SER A OG    1 
ATOM   1998 N  N     . LYS A 1 294 ? 28.208  23.797  7.062   1.00 63.79  ? 551  LYS A N     1 
ATOM   1999 C  CA    . LYS A 1 294 ? 28.195  25.225  7.363   1.00 67.10  ? 551  LYS A CA    1 
ATOM   2000 C  C     . LYS A 1 294 ? 29.613  25.815  7.334   1.00 65.82  ? 551  LYS A C     1 
ATOM   2001 O  O     . LYS A 1 294 ? 29.858  26.812  6.685   1.00 66.44  ? 551  LYS A O     1 
ATOM   2002 C  CB    . LYS A 1 294 ? 27.558  25.450  8.744   1.00 69.50  ? 551  LYS A CB    1 
ATOM   2003 C  CG    . LYS A 1 294 ? 27.266  26.906  9.083   1.00 74.63  ? 551  LYS A CG    1 
ATOM   2004 C  CD    . LYS A 1 294 ? 26.826  27.055  10.542  1.00 76.39  ? 551  LYS A CD    1 
ATOM   2005 C  CE    . LYS A 1 294 ? 26.620  28.512  10.953  1.00 80.65  ? 551  LYS A CE    1 
ATOM   2006 N  NZ    . LYS A 1 294 ? 25.275  29.046  10.604  1.00 84.10  ? 551  LYS A NZ    1 
ATOM   2007 N  N     . THR A 1 295 ? 30.543  25.174  8.032   1.00 63.79  ? 552  THR A N     1 
ATOM   2008 C  CA    . THR A 1 295 ? 31.878  25.734  8.255   1.00 63.45  ? 552  THR A CA    1 
ATOM   2009 C  C     . THR A 1 295 ? 32.984  25.163  7.352   1.00 61.66  ? 552  THR A C     1 
ATOM   2010 O  O     . THR A 1 295 ? 34.100  25.676  7.372   1.00 63.57  ? 552  THR A O     1 
ATOM   2011 C  CB    . THR A 1 295 ? 32.301  25.574  9.746   1.00 63.07  ? 552  THR A CB    1 
ATOM   2012 O  OG1   . THR A 1 295 ? 32.218  24.196  10.137  1.00 58.97  ? 552  THR A OG1   1 
ATOM   2013 C  CG2   . THR A 1 295 ? 31.397  26.421  10.682  1.00 65.76  ? 552  THR A CG2   1 
ATOM   2014 N  N     . GLY A 1 296 ? 32.703  24.128  6.559   1.00 58.03  ? 553  GLY A N     1 
ATOM   2015 C  CA    . GLY A 1 296 ? 33.758  23.528  5.742   1.00 55.68  ? 553  GLY A CA    1 
ATOM   2016 C  C     . GLY A 1 296 ? 33.353  22.351  4.873   1.00 53.19  ? 553  GLY A C     1 
ATOM   2017 O  O     . GLY A 1 296 ? 32.277  22.357  4.265   1.00 54.30  ? 553  GLY A O     1 
ATOM   2018 N  N     . TYR A 1 297 ? 34.231  21.352  4.782   1.00 49.94  ? 554  TYR A N     1 
ATOM   2019 C  CA    . TYR A 1 297 ? 33.946  20.166  3.962   1.00 48.04  ? 554  TYR A CA    1 
ATOM   2020 C  C     . TYR A 1 297 ? 33.358  19.064  4.829   1.00 44.54  ? 554  TYR A C     1 
ATOM   2021 O  O     . TYR A 1 297 ? 33.868  18.829  5.907   1.00 43.10  ? 554  TYR A O     1 
ATOM   2022 C  CB    . TYR A 1 297 ? 35.212  19.566  3.360   1.00 48.34  ? 554  TYR A CB    1 
ATOM   2023 C  CG    . TYR A 1 297 ? 36.230  20.499  2.759   1.00 51.49  ? 554  TYR A CG    1 
ATOM   2024 C  CD1   . TYR A 1 297 ? 36.049  21.020  1.480   1.00 52.61  ? 554  TYR A CD1   1 
ATOM   2025 C  CD2   . TYR A 1 297 ? 37.433  20.786  3.439   1.00 52.52  ? 554  TYR A CD2   1 
ATOM   2026 C  CE1   . TYR A 1 297 ? 37.005  21.835  0.902   1.00 55.01  ? 554  TYR A CE1   1 
ATOM   2027 C  CE2   . TYR A 1 297 ? 38.395  21.609  2.876   1.00 53.92  ? 554  TYR A CE2   1 
ATOM   2028 C  CZ    . TYR A 1 297 ? 38.176  22.123  1.601   1.00 56.62  ? 554  TYR A CZ    1 
ATOM   2029 O  OH    . TYR A 1 297 ? 39.123  22.938  1.011   1.00 60.47  ? 554  TYR A OH    1 
ATOM   2030 N  N     . SER A 1 298 ? 32.357  18.346  4.323   1.00 42.91  ? 555  SER A N     1 
ATOM   2031 C  CA    . SER A 1 298 ? 31.803  17.214  5.034   1.00 41.55  ? 555  SER A CA    1 
ATOM   2032 C  C     . SER A 1 298 ? 32.762  16.033  5.041   1.00 38.45  ? 555  SER A C     1 
ATOM   2033 O  O     . SER A 1 298 ? 33.381  15.697  4.020   1.00 37.05  ? 555  SER A O     1 
ATOM   2034 C  CB    . SER A 1 298 ? 30.471  16.752  4.441   1.00 43.58  ? 555  SER A CB    1 
ATOM   2035 O  OG    . SER A 1 298 ? 29.971  15.613  5.163   1.00 44.62  ? 555  SER A OG    1 
ATOM   2036 N  N     . THR A 1 299 ? 32.859  15.394  6.198   1.00 34.99  ? 556  THR A N     1 
ATOM   2037 C  CA    . THR A 1 299 ? 33.610  14.166  6.329   1.00 33.51  ? 556  THR A CA    1 
ATOM   2038 C  C     . THR A 1 299 ? 32.704  13.089  6.963   1.00 33.18  ? 556  THR A C     1 
ATOM   2039 O  O     . THR A 1 299 ? 33.193  12.152  7.584   1.00 31.97  ? 556  THR A O     1 
ATOM   2040 C  CB    . THR A 1 299 ? 34.919  14.356  7.166   1.00 32.18  ? 556  THR A CB    1 
ATOM   2041 O  OG1   . THR A 1 299 ? 34.611  14.628  8.558   1.00 31.35  ? 556  THR A OG1   1 
ATOM   2042 C  CG2   . THR A 1 299 ? 35.820  15.485  6.592   1.00 31.90  ? 556  THR A CG2   1 
ATOM   2043 N  N     . SER A 1 300 ? 31.398  13.217  6.783   1.00 34.90  ? 557  SER A N     1 
ATOM   2044 C  CA    . SER A 1 300 ? 30.462  12.236  7.314   1.00 35.65  ? 557  SER A CA    1 
ATOM   2045 C  C     . SER A 1 300 ? 30.675  10.853  6.673   1.00 35.01  ? 557  SER A C     1 
ATOM   2046 O  O     . SER A 1 300 ? 31.230  10.752  5.581   1.00 33.60  ? 557  SER A O     1 
ATOM   2047 C  CB    . SER A 1 300 ? 29.024  12.724  7.151   1.00 38.07  ? 557  SER A CB    1 
ATOM   2048 O  OG    . SER A 1 300 ? 28.590  12.669  5.797   1.00 42.20  ? 557  SER A OG    1 
ATOM   2049 N  N     . ALA A 1 301 ? 30.243  9.796   7.364   1.00 34.92  ? 558  ALA A N     1 
ATOM   2050 C  CA    . ALA A 1 301 ? 30.492  8.443   6.899   1.00 35.25  ? 558  ALA A CA    1 
ATOM   2051 C  C     . ALA A 1 301 ? 29.926  8.215   5.498   1.00 37.65  ? 558  ALA A C     1 
ATOM   2052 O  O     . ALA A 1 301 ? 30.592  7.590   4.670   1.00 36.95  ? 558  ALA A O     1 
ATOM   2053 C  CB    . ALA A 1 301 ? 29.960  7.385   7.885   1.00 34.92  ? 558  ALA A CB    1 
ATOM   2054 N  N     . ASP A 1 302 ? 28.737  8.737   5.228   1.00 39.75  ? 559  ASP A N     1 
ATOM   2055 C  CA    . ASP A 1 302 ? 28.090  8.494   3.945   1.00 44.41  ? 559  ASP A CA    1 
ATOM   2056 C  C     . ASP A 1 302 ? 28.856  9.142   2.764   1.00 43.34  ? 559  ASP A C     1 
ATOM   2057 O  O     . ASP A 1 302 ? 28.920  8.569   1.666   1.00 45.11  ? 559  ASP A O     1 
ATOM   2058 C  CB    . ASP A 1 302 ? 26.615  8.941   3.980   1.00 50.17  ? 559  ASP A CB    1 
ATOM   2059 C  CG    . ASP A 1 302 ? 26.451  10.457  4.047   1.00 54.11  ? 559  ASP A CG    1 
ATOM   2060 O  OD1   . ASP A 1 302 ? 26.936  11.069  5.024   1.00 57.94  ? 559  ASP A OD1   1 
ATOM   2061 O  OD2   . ASP A 1 302 ? 25.818  11.032  3.120   1.00 62.66  ? 559  ASP A OD2   1 
ATOM   2062 N  N     . VAL A 1 303 ? 29.468  10.304  3.014   1.00 40.37  ? 560  VAL A N     1 
ATOM   2063 C  CA    . VAL A 1 303 ? 30.316  10.967  2.046   1.00 38.77  ? 560  VAL A CA    1 
ATOM   2064 C  C     . VAL A 1 303 ? 31.596  10.161  1.870   1.00 37.02  ? 560  VAL A C     1 
ATOM   2065 O  O     . VAL A 1 303 ? 32.008  9.875   0.740   1.00 36.20  ? 560  VAL A O     1 
ATOM   2066 C  CB    . VAL A 1 303 ? 30.662  12.394  2.486   1.00 38.84  ? 560  VAL A CB    1 
ATOM   2067 C  CG1   . VAL A 1 303 ? 31.665  13.053  1.525   1.00 38.13  ? 560  VAL A CG1   1 
ATOM   2068 C  CG2   . VAL A 1 303 ? 29.378  13.199  2.620   1.00 40.43  ? 560  VAL A CG2   1 
ATOM   2069 N  N     . LEU A 1 304 ? 32.200  9.735   2.972   1.00 34.77  ? 561  LEU A N     1 
ATOM   2070 C  CA    . LEU A 1 304 ? 33.429  8.970   2.865   1.00 34.72  ? 561  LEU A CA    1 
ATOM   2071 C  C     . LEU A 1 304 ? 33.243  7.663   2.093   1.00 34.90  ? 561  LEU A C     1 
ATOM   2072 O  O     . LEU A 1 304 ? 34.095  7.299   1.284   1.00 34.01  ? 561  LEU A O     1 
ATOM   2073 C  CB    . LEU A 1 304 ? 34.036  8.664   4.226   1.00 34.14  ? 561  LEU A CB    1 
ATOM   2074 C  CG    . LEU A 1 304 ? 34.579  9.852   5.000   1.00 34.04  ? 561  LEU A CG    1 
ATOM   2075 C  CD1   . LEU A 1 304 ? 35.140  9.301   6.301   1.00 33.23  ? 561  LEU A CD1   1 
ATOM   2076 C  CD2   . LEU A 1 304 ? 35.614  10.626  4.207   1.00 35.04  ? 561  LEU A CD2   1 
ATOM   2077 N  N     . GLU A 1 305 ? 32.150  6.963   2.339   1.00 36.93  ? 562  GLU A N     1 
ATOM   2078 C  CA    . GLU A 1 305 ? 31.840  5.764   1.551   1.00 39.80  ? 562  GLU A CA    1 
ATOM   2079 C  C     . GLU A 1 305 ? 31.947  6.013   0.048   1.00 39.72  ? 562  GLU A C     1 
ATOM   2080 O  O     . GLU A 1 305 ? 32.454  5.179   -0.675  1.00 40.79  ? 562  GLU A O     1 
ATOM   2081 C  CB    . GLU A 1 305 ? 30.448  5.244   1.889   1.00 43.54  ? 562  GLU A CB    1 
ATOM   2082 C  CG    . GLU A 1 305 ? 30.443  4.408   3.161   1.00 46.45  ? 562  GLU A CG    1 
ATOM   2083 C  CD    . GLU A 1 305 ? 29.054  4.201   3.732   1.00 50.97  ? 562  GLU A CD    1 
ATOM   2084 O  OE1   . GLU A 1 305 ? 28.110  3.908   2.948   1.00 55.54  ? 562  GLU A OE1   1 
ATOM   2085 O  OE2   . GLU A 1 305 ? 28.917  4.328   4.977   1.00 56.02  ? 562  GLU A OE2   1 
ATOM   2086 N  N     . LYS A 1 306 ? 31.463  7.162   -0.411  1.00 39.66  ? 563  LYS A N     1 
ATOM   2087 C  CA    . LYS A 1 306 ? 31.471  7.503   -1.839  1.00 40.17  ? 563  LYS A CA    1 
ATOM   2088 C  C     . LYS A 1 306 ? 32.868  7.855   -2.336  1.00 37.55  ? 563  LYS A C     1 
ATOM   2089 O  O     . LYS A 1 306 ? 33.144  7.734   -3.506  1.00 37.01  ? 563  LYS A O     1 
ATOM   2090 C  CB    . LYS A 1 306 ? 30.490  8.636   -2.134  1.00 42.79  ? 563  LYS A CB    1 
ATOM   2091 C  CG    . LYS A 1 306 ? 29.022  8.230   -1.957  1.00 46.35  ? 563  LYS A CG    1 
ATOM   2092 C  CD    . LYS A 1 306 ? 28.079  9.265   -2.559  1.00 49.76  ? 563  LYS A CD    1 
ATOM   2093 C  CE    . LYS A 1 306 ? 26.632  9.100   -2.093  1.00 52.41  ? 563  LYS A CE    1 
ATOM   2094 N  NZ    . LYS A 1 306 ? 26.435  9.480   -0.666  1.00 53.67  ? 563  LYS A NZ    1 
ATOM   2095 N  N     . LEU A 1 307 ? 33.767  8.256   -1.446  1.00 34.71  ? 564  LEU A N     1 
ATOM   2096 C  CA    . LEU A 1 307 ? 35.159  8.520   -1.830  1.00 33.55  ? 564  LEU A CA    1 
ATOM   2097 C  C     . LEU A 1 307 ? 36.136  7.308   -1.782  1.00 33.28  ? 564  LEU A C     1 
ATOM   2098 O  O     . LEU A 1 307 ? 37.287  7.397   -2.273  1.00 32.72  ? 564  LEU A O     1 
ATOM   2099 C  CB    . LEU A 1 307 ? 35.720  9.617   -0.934  1.00 32.54  ? 564  LEU A CB    1 
ATOM   2100 C  CG    . LEU A 1 307 ? 34.949  10.941  -0.912  1.00 33.16  ? 564  LEU A CG    1 
ATOM   2101 C  CD1   . LEU A 1 307 ? 35.575  11.878  0.132   1.00 32.09  ? 564  LEU A CD1   1 
ATOM   2102 C  CD2   . LEU A 1 307 ? 34.888  11.568  -2.299  1.00 32.97  ? 564  LEU A CD2   1 
ATOM   2103 N  N     . ALA A 1 308 ? 35.716  6.217   -1.147  1.00 33.50  ? 565  ALA A N     1 
ATOM   2104 C  CA    . ALA A 1 308 ? 36.579  5.025   -0.972  1.00 33.69  ? 565  ALA A CA    1 
ATOM   2105 C  C     . ALA A 1 308 ? 37.301  4.567   -2.238  1.00 35.19  ? 565  ALA A C     1 
ATOM   2106 O  O     . ALA A 1 308 ? 38.491  4.252   -2.170  1.00 36.21  ? 565  ALA A O     1 
ATOM   2107 C  CB    . ALA A 1 308 ? 35.804  3.864   -0.342  1.00 34.19  ? 565  ALA A CB    1 
ATOM   2108 N  N     . PRO A 1 309 ? 36.619  4.578   -3.400  1.00 36.01  ? 566  PRO A N     1 
ATOM   2109 C  CA    . PRO A 1 309 ? 37.317  4.147   -4.618  1.00 36.56  ? 566  PRO A CA    1 
ATOM   2110 C  C     . PRO A 1 309 ? 38.482  5.009   -5.034  1.00 35.77  ? 566  PRO A C     1 
ATOM   2111 O  O     . PRO A 1 309 ? 39.336  4.525   -5.780  1.00 36.91  ? 566  PRO A O     1 
ATOM   2112 C  CB    . PRO A 1 309 ? 36.227  4.224   -5.704  1.00 38.16  ? 566  PRO A CB    1 
ATOM   2113 C  CG    . PRO A 1 309 ? 34.945  4.035   -4.955  1.00 38.51  ? 566  PRO A CG    1 
ATOM   2114 C  CD    . PRO A 1 309 ? 35.165  4.705   -3.620  1.00 36.93  ? 566  PRO A CD    1 
ATOM   2115 N  N     . TYR A 1 310 ? 38.526  6.278   -4.610  1.00 33.12  ? 567  TYR A N     1 
ATOM   2116 C  CA    . TYR A 1 310 ? 39.651  7.154   -4.989  1.00 32.61  ? 567  TYR A CA    1 
ATOM   2117 C  C     . TYR A 1 310 ? 40.957  6.920   -4.243  1.00 31.94  ? 567  TYR A C     1 
ATOM   2118 O  O     . TYR A 1 310 ? 41.987  7.233   -4.766  1.00 31.06  ? 567  TYR A O     1 
ATOM   2119 C  CB    . TYR A 1 310 ? 39.307  8.660   -4.871  1.00 31.90  ? 567  TYR A CB    1 
ATOM   2120 C  CG    . TYR A 1 310 ? 38.172  9.069   -5.774  1.00 32.88  ? 567  TYR A CG    1 
ATOM   2121 C  CD1   . TYR A 1 310 ? 38.402  9.363   -7.127  1.00 34.03  ? 567  TYR A CD1   1 
ATOM   2122 C  CD2   . TYR A 1 310 ? 36.853  9.084   -5.305  1.00 33.50  ? 567  TYR A CD2   1 
ATOM   2123 C  CE1   . TYR A 1 310 ? 37.357  9.703   -7.979  1.00 34.84  ? 567  TYR A CE1   1 
ATOM   2124 C  CE2   . TYR A 1 310 ? 35.790  9.412   -6.155  1.00 35.17  ? 567  TYR A CE2   1 
ATOM   2125 C  CZ    . TYR A 1 310 ? 36.057  9.738   -7.486  1.00 35.20  ? 567  TYR A CZ    1 
ATOM   2126 O  OH    . TYR A 1 310 ? 35.033  10.089  -8.313  1.00 36.65  ? 567  TYR A OH    1 
ATOM   2127 N  N     . HIS A 1 311 ? 40.904  6.436   -3.007  1.00 31.71  ? 568  HIS A N     1 
ATOM   2128 C  CA    . HIS A 1 311 ? 42.094  6.386   -2.184  1.00 32.06  ? 568  HIS A CA    1 
ATOM   2129 C  C     . HIS A 1 311 ? 41.918  5.426   -1.047  1.00 32.53  ? 568  HIS A C     1 
ATOM   2130 O  O     . HIS A 1 311 ? 40.844  5.360   -0.419  1.00 31.92  ? 568  HIS A O     1 
ATOM   2131 C  CB    . HIS A 1 311 ? 42.437  7.752   -1.636  1.00 31.32  ? 568  HIS A CB    1 
ATOM   2132 C  CG    . HIS A 1 311 ? 43.910  7.908   -1.285  1.00 32.22  ? 568  HIS A CG    1 
ATOM   2133 N  ND1   . HIS A 1 311 ? 44.453  7.370   -0.165  1.00 32.42  ? 568  HIS A ND1   1 
ATOM   2134 C  CD2   . HIS A 1 311 ? 44.958  8.527   -1.970  1.00 32.70  ? 568  HIS A CD2   1 
ATOM   2135 C  CE1   . HIS A 1 311 ? 45.774  7.650   -0.126  1.00 33.42  ? 568  HIS A CE1   1 
ATOM   2136 N  NE2   . HIS A 1 311 ? 46.079  8.369   -1.226  1.00 33.94  ? 568  HIS A NE2   1 
ATOM   2137 N  N     . GLU A 1 312 ? 42.985  4.685   -0.774  1.00 33.86  ? 569  GLU A N     1 
ATOM   2138 C  CA    . GLU A 1 312 ? 42.975  3.630   0.254   1.00 35.67  ? 569  GLU A CA    1 
ATOM   2139 C  C     . GLU A 1 312 ? 42.813  4.205   1.666   1.00 34.42  ? 569  GLU A C     1 
ATOM   2140 O  O     . GLU A 1 312 ? 42.322  3.500   2.579   1.00 34.79  ? 569  GLU A O     1 
ATOM   2141 C  CB    . GLU A 1 312 ? 44.290  2.843   0.153   1.00 38.62  ? 569  GLU A CB    1 
ATOM   2142 C  CG    . GLU A 1 312 ? 44.471  1.765   1.211   1.00 41.43  ? 569  GLU A CG    1 
ATOM   2143 C  CD    . GLU A 1 312 ? 45.570  0.796   0.840   1.00 44.76  ? 569  GLU A CD    1 
ATOM   2144 O  OE1   . GLU A 1 312 ? 46.293  1.071   -0.151  1.00 47.68  ? 569  GLU A OE1   1 
ATOM   2145 O  OE2   . GLU A 1 312 ? 45.688  -0.240  1.521   1.00 46.42  ? 569  GLU A OE2   1 
ATOM   2146 N  N     . ILE A 1 313 ? 43.229  5.474   1.863   1.00 32.86  ? 570  ILE A N     1 
ATOM   2147 C  CA    . ILE A 1 313 ? 43.083  6.135   3.186   1.00 32.10  ? 570  ILE A CA    1 
ATOM   2148 C  C     . ILE A 1 313 ? 41.622  6.096   3.646   1.00 31.03  ? 570  ILE A C     1 
ATOM   2149 O  O     . ILE A 1 313 ? 41.352  5.903   4.829   1.00 31.00  ? 570  ILE A O     1 
ATOM   2150 C  CB    . ILE A 1 313 ? 43.601  7.603   3.215   1.00 31.38  ? 570  ILE A CB    1 
ATOM   2151 C  CG1   . ILE A 1 313 ? 44.014  8.007   4.643   1.00 31.32  ? 570  ILE A CG1   1 
ATOM   2152 C  CG2   . ILE A 1 313 ? 42.583  8.570   2.619   1.00 30.04  ? 570  ILE A CG2   1 
ATOM   2153 C  CD1   . ILE A 1 313 ? 44.482  9.430   4.799   1.00 31.38  ? 570  ILE A CD1   1 
ATOM   2154 N  N     . VAL A 1 314 ? 40.681  6.253   2.717   1.00 30.91  ? 571  VAL A N     1 
ATOM   2155 C  CA    . VAL A 1 314 ? 39.270  6.397   3.090   1.00 31.15  ? 571  VAL A CA    1 
ATOM   2156 C  C     . VAL A 1 314 ? 38.689  5.224   3.883   1.00 31.94  ? 571  VAL A C     1 
ATOM   2157 O  O     . VAL A 1 314 ? 38.087  5.431   4.948   1.00 31.03  ? 571  VAL A O     1 
ATOM   2158 C  CB    . VAL A 1 314 ? 38.376  6.644   1.864   1.00 31.87  ? 571  VAL A CB    1 
ATOM   2159 C  CG1   . VAL A 1 314 ? 36.921  6.729   2.313   1.00 31.93  ? 571  VAL A CG1   1 
ATOM   2160 C  CG2   . VAL A 1 314 ? 38.826  7.930   1.171   1.00 31.44  ? 571  VAL A CG2   1 
ATOM   2161 N  N     . GLU A 1 315 ? 38.842  4.000   3.379   1.00 33.84  ? 572  GLU A N     1 
ATOM   2162 C  CA    . GLU A 1 315 ? 38.357  2.832   4.137   1.00 34.88  ? 572  GLU A CA    1 
ATOM   2163 C  C     . GLU A 1 315 ? 39.018  2.761   5.539   1.00 32.73  ? 572  GLU A C     1 
ATOM   2164 O  O     . GLU A 1 315 ? 38.370  2.406   6.505   1.00 32.05  ? 572  GLU A O     1 
ATOM   2165 C  CB    . GLU A 1 315 ? 38.532  1.509   3.380   1.00 39.76  ? 572  GLU A CB    1 
ATOM   2166 C  CG    . GLU A 1 315 ? 39.962  1.145   3.026   1.00 45.02  ? 572  GLU A CG    1 
ATOM   2167 C  CD    . GLU A 1 315 ? 40.053  -0.099  2.144   1.00 51.52  ? 572  GLU A CD    1 
ATOM   2168 O  OE1   . GLU A 1 315 ? 39.460  -1.126  2.537   1.00 56.47  ? 572  GLU A OE1   1 
ATOM   2169 O  OE2   . GLU A 1 315 ? 40.709  -0.051  1.068   1.00 57.70  ? 572  GLU A OE2   1 
ATOM   2170 N  N     . ASN A 1 316 ? 40.283  3.148   5.640   1.00 31.35  ? 573  ASN A N     1 
ATOM   2171 C  CA    . ASN A 1 316 ? 40.985  3.147   6.910   1.00 30.94  ? 573  ASN A CA    1 
ATOM   2172 C  C     . ASN A 1 316 ? 40.405  4.174   7.882   1.00 29.21  ? 573  ASN A C     1 
ATOM   2173 O  O     . ASN A 1 316 ? 40.199  3.862   9.041   1.00 28.97  ? 573  ASN A O     1 
ATOM   2174 C  CB    . ASN A 1 316 ? 42.481  3.361   6.696   1.00 31.82  ? 573  ASN A CB    1 
ATOM   2175 C  CG    . ASN A 1 316 ? 43.193  2.097   6.208   1.00 34.06  ? 573  ASN A CG    1 
ATOM   2176 O  OD1   . ASN A 1 316 ? 43.494  1.200   7.003   1.00 34.78  ? 573  ASN A OD1   1 
ATOM   2177 N  ND2   . ASN A 1 316 ? 43.495  2.038   4.917   1.00 33.49  ? 573  ASN A ND2   1 
ATOM   2178 N  N     . ILE A 1 317 ? 40.100  5.379   7.405   1.00 28.04  ? 574  ILE A N     1 
ATOM   2179 C  CA    . ILE A 1 317 ? 39.369  6.392   8.225   1.00 27.40  ? 574  ILE A CA    1 
ATOM   2180 C  C     . ILE A 1 317 ? 37.995  5.929   8.722   1.00 26.95  ? 574  ILE A C     1 
ATOM   2181 O  O     . ILE A 1 317 ? 37.667  6.115   9.894   1.00 25.98  ? 574  ILE A O     1 
ATOM   2182 C  CB    . ILE A 1 317 ? 39.269  7.752   7.493   1.00 27.34  ? 574  ILE A CB    1 
ATOM   2183 C  CG1   . ILE A 1 317 ? 40.678  8.320   7.376   1.00 28.14  ? 574  ILE A CG1   1 
ATOM   2184 C  CG2   . ILE A 1 317 ? 38.317  8.740   8.194   1.00 26.13  ? 574  ILE A CG2   1 
ATOM   2185 C  CD1   . ILE A 1 317 ? 40.818  9.197   6.175   1.00 29.89  ? 574  ILE A CD1   1 
ATOM   2186 N  N     . LEU A 1 318 ? 37.236  5.277   7.851   1.00 27.78  ? 575  LEU A N     1 
ATOM   2187 C  CA    . LEU A 1 318 ? 35.950  4.697   8.230   1.00 28.13  ? 575  LEU A CA    1 
ATOM   2188 C  C     . LEU A 1 318 ? 36.136  3.666   9.330   1.00 28.64  ? 575  LEU A C     1 
ATOM   2189 O  O     . LEU A 1 318 ? 35.384  3.643   10.295  1.00 28.32  ? 575  LEU A O     1 
ATOM   2190 C  CB    . LEU A 1 318 ? 35.248  4.096   7.015   1.00 28.65  ? 575  LEU A CB    1 
ATOM   2191 C  CG    . LEU A 1 318 ? 34.723  5.067   5.938   1.00 28.55  ? 575  LEU A CG    1 
ATOM   2192 C  CD1   . LEU A 1 318 ? 34.440  4.350   4.591   1.00 29.46  ? 575  LEU A CD1   1 
ATOM   2193 C  CD2   . LEU A 1 318 ? 33.477  5.739   6.509   1.00 29.09  ? 575  LEU A CD2   1 
ATOM   2194 N  N     . HIS A 1 319 ? 37.151  2.819   9.202   1.00 30.36  ? 576  HIS A N     1 
ATOM   2195 C  CA    . HIS A 1 319 ? 37.422  1.794   10.220  1.00 31.89  ? 576  HIS A CA    1 
ATOM   2196 C  C     . HIS A 1 319 ? 37.834  2.448   11.535  1.00 31.02  ? 576  HIS A C     1 
ATOM   2197 O  O     . HIS A 1 319 ? 37.380  2.062   12.622  1.00 29.59  ? 576  HIS A O     1 
ATOM   2198 C  CB    . HIS A 1 319 ? 38.484  0.828   9.680   1.00 35.11  ? 576  HIS A CB    1 
ATOM   2199 C  CG    . HIS A 1 319 ? 38.670  -0.415  10.501  1.00 37.34  ? 576  HIS A CG    1 
ATOM   2200 N  ND1   . HIS A 1 319 ? 37.638  -1.061  11.091  1.00 40.34  ? 576  HIS A ND1   1 
ATOM   2201 C  CD2   . HIS A 1 319 ? 39.820  -1.149  10.797  1.00 39.83  ? 576  HIS A CD2   1 
ATOM   2202 C  CE1   . HIS A 1 319 ? 38.107  -2.140  11.767  1.00 41.42  ? 576  HIS A CE1   1 
ATOM   2203 N  NE2   . HIS A 1 319 ? 39.447  -2.193  11.582  1.00 42.85  ? 576  HIS A NE2   1 
ATOM   2204 N  N     . TYR A 1 320 ? 38.681  3.465   11.446  1.00 30.78  ? 577  TYR A N     1 
ATOM   2205 C  CA    . TYR A 1 320 ? 39.086  4.234   12.612  1.00 31.24  ? 577  TYR A CA    1 
ATOM   2206 C  C     . TYR A 1 320 ? 37.879  4.860   13.361  1.00 30.87  ? 577  TYR A C     1 
ATOM   2207 O  O     . TYR A 1 320 ? 37.748  4.706   14.573  1.00 30.32  ? 577  TYR A O     1 
ATOM   2208 C  CB    . TYR A 1 320 ? 40.120  5.273   12.221  1.00 32.44  ? 577  TYR A CB    1 
ATOM   2209 C  CG    . TYR A 1 320 ? 40.499  6.144   13.350  1.00 34.56  ? 577  TYR A CG    1 
ATOM   2210 C  CD1   . TYR A 1 320 ? 39.748  7.257   13.640  1.00 35.16  ? 577  TYR A CD1   1 
ATOM   2211 C  CD2   . TYR A 1 320 ? 41.579  5.834   14.166  1.00 36.89  ? 577  TYR A CD2   1 
ATOM   2212 C  CE1   . TYR A 1 320 ? 40.058  8.059   14.696  1.00 37.19  ? 577  TYR A CE1   1 
ATOM   2213 C  CE2   . TYR A 1 320 ? 41.922  6.652   15.223  1.00 38.52  ? 577  TYR A CE2   1 
ATOM   2214 C  CZ    . TYR A 1 320 ? 41.139  7.758   15.481  1.00 38.29  ? 577  TYR A CZ    1 
ATOM   2215 O  OH    . TYR A 1 320 ? 41.417  8.587   16.525  1.00 42.46  ? 577  TYR A OH    1 
ATOM   2216 N  N     . ARG A 1 321 ? 36.981  5.493   12.619  1.00 30.74  ? 578  ARG A N     1 
ATOM   2217 C  CA    . ARG A 1 321 ? 35.776  6.091   13.186  1.00 30.90  ? 578  ARG A CA    1 
ATOM   2218 C  C     . ARG A 1 321 ? 34.902  5.081   13.917  1.00 31.15  ? 578  ARG A C     1 
ATOM   2219 O  O     . ARG A 1 321 ? 34.379  5.395   14.954  1.00 30.10  ? 578  ARG A O     1 
ATOM   2220 C  CB    . ARG A 1 321 ? 34.934  6.699   12.093  1.00 31.28  ? 578  ARG A CB    1 
ATOM   2221 C  CG    . ARG A 1 321 ? 35.501  8.012   11.539  1.00 31.50  ? 578  ARG A CG    1 
ATOM   2222 C  CD    . ARG A 1 321 ? 34.733  9.206   12.064  1.00 31.13  ? 578  ARG A CD    1 
ATOM   2223 N  NE    . ARG A 1 321 ? 35.255  10.459  11.537  1.00 30.59  ? 578  ARG A NE    1 
ATOM   2224 C  CZ    . ARG A 1 321 ? 34.782  11.142  10.491  1.00 30.20  ? 578  ARG A CZ    1 
ATOM   2225 N  NH1   . ARG A 1 321 ? 33.745  10.705  9.782   1.00 29.54  ? 578  ARG A NH1   1 
ATOM   2226 N  NH2   . ARG A 1 321 ? 35.382  12.280  10.150  1.00 29.94  ? 578  ARG A NH2   1 
ATOM   2227 N  N     . GLN A 1 322 ? 34.721  3.895   13.327  1.00 33.18  ? 579  GLN A N     1 
ATOM   2228 C  CA    . GLN A 1 322 ? 33.872  2.848   13.897  1.00 34.46  ? 579  GLN A CA    1 
ATOM   2229 C  C     . GLN A 1 322 ? 34.490  2.369   15.209  1.00 32.47  ? 579  GLN A C     1 
ATOM   2230 O  O     . GLN A 1 322 ? 33.837  2.386   16.237  1.00 31.66  ? 579  GLN A O     1 
ATOM   2231 C  CB    . GLN A 1 322 ? 33.715  1.686   12.910  1.00 39.66  ? 579  GLN A CB    1 
ATOM   2232 C  CG    . GLN A 1 322 ? 32.678  0.643   13.349  1.00 44.85  ? 579  GLN A CG    1 
ATOM   2233 C  CD    . GLN A 1 322 ? 33.066  -0.787  12.985  1.00 51.24  ? 579  GLN A CD    1 
ATOM   2234 O  OE1   . GLN A 1 322 ? 32.632  -1.740  13.644  1.00 60.56  ? 579  GLN A OE1   1 
ATOM   2235 N  NE2   . GLN A 1 322 ? 33.895  -0.947  11.939  1.00 55.78  ? 579  GLN A NE2   1 
ATOM   2236 N  N     . LEU A 1 323 ? 35.778  2.018   15.184  1.00 31.20  ? 580  LEU A N     1 
ATOM   2237 C  CA    . LEU A 1 323 ? 36.501  1.603   16.401  1.00 31.48  ? 580  LEU A CA    1 
ATOM   2238 C  C     . LEU A 1 323 ? 36.541  2.689   17.470  1.00 30.08  ? 580  LEU A C     1 
ATOM   2239 O  O     . LEU A 1 323 ? 36.352  2.424   18.648  1.00 29.65  ? 580  LEU A O     1 
ATOM   2240 C  CB    . LEU A 1 323 ? 37.934  1.176   16.057  1.00 33.13  ? 580  LEU A CB    1 
ATOM   2241 C  CG    . LEU A 1 323 ? 38.011  -0.073  15.142  1.00 35.45  ? 580  LEU A CG    1 
ATOM   2242 C  CD1   . LEU A 1 323 ? 39.451  -0.389  14.725  1.00 37.14  ? 580  LEU A CD1   1 
ATOM   2243 C  CD2   . LEU A 1 323 ? 37.387  -1.279  15.831  1.00 36.44  ? 580  LEU A CD2   1 
ATOM   2244 N  N     . GLY A 1 324 ? 36.808  3.919   17.061  1.00 28.49  ? 581  GLY A N     1 
ATOM   2245 C  CA    . GLY A 1 324 ? 36.995  5.003   18.009  1.00 27.86  ? 581  GLY A CA    1 
ATOM   2246 C  C     . GLY A 1 324 ? 35.704  5.411   18.684  1.00 27.38  ? 581  GLY A C     1 
ATOM   2247 O  O     . GLY A 1 324 ? 35.695  5.868   19.829  1.00 26.55  ? 581  GLY A O     1 
ATOM   2248 N  N     . LYS A 1 325 ? 34.609  5.258   17.964  1.00 27.29  ? 582  LYS A N     1 
ATOM   2249 C  CA    . LYS A 1 325 ? 33.273  5.502   18.524  1.00 27.30  ? 582  LYS A CA    1 
ATOM   2250 C  C     . LYS A 1 325 ? 32.979  4.495   19.615  1.00 27.58  ? 582  LYS A C     1 
ATOM   2251 O  O     . LYS A 1 325 ? 32.527  4.863   20.698  1.00 27.43  ? 582  LYS A O     1 
ATOM   2252 C  CB    . LYS A 1 325 ? 32.222  5.404   17.431  1.00 28.87  ? 582  LYS A CB    1 
ATOM   2253 C  CG    . LYS A 1 325 ? 30.783  5.577   17.923  1.00 30.40  ? 582  LYS A CG    1 
ATOM   2254 C  CD    . LYS A 1 325 ? 30.566  6.961   18.534  1.00 31.22  ? 582  LYS A CD    1 
ATOM   2255 C  CE    . LYS A 1 325 ? 29.104  7.343   18.390  1.00 33.30  ? 582  LYS A CE    1 
ATOM   2256 N  NZ    . LYS A 1 325 ? 28.779  8.721   18.847  1.00 34.78  ? 582  LYS A NZ    1 
ATOM   2257 N  N     . LEU A 1 326 ? 33.240  3.224   19.340  1.00 27.72  ? 583  LEU A N     1 
ATOM   2258 C  CA    . LEU A 1 326 ? 33.072  2.189   20.362  1.00 28.94  ? 583  LEU A CA    1 
ATOM   2259 C  C     . LEU A 1 326 ? 33.947  2.462   21.574  1.00 29.13  ? 583  LEU A C     1 
ATOM   2260 O  O     . LEU A 1 326 ? 33.473  2.410   22.715  1.00 29.63  ? 583  LEU A O     1 
ATOM   2261 C  CB    . LEU A 1 326 ? 33.382  0.792   19.802  1.00 29.28  ? 583  LEU A CB    1 
ATOM   2262 C  CG    . LEU A 1 326 ? 32.383  0.399   18.728  1.00 30.59  ? 583  LEU A CG    1 
ATOM   2263 C  CD1   . LEU A 1 326 ? 32.848  -0.862  17.977  1.00 32.15  ? 583  LEU A CD1   1 
ATOM   2264 C  CD2   . LEU A 1 326 ? 30.997  0.217   19.347  1.00 31.47  ? 583  LEU A CD2   1 
ATOM   2265 N  N     . GLN A 1 327 ? 35.219  2.764   21.336  1.00 29.33  ? 584  GLN A N     1 
ATOM   2266 C  CA    . GLN A 1 327 ? 36.176  2.947   22.420  1.00 30.42  ? 584  GLN A CA    1 
ATOM   2267 C  C     . GLN A 1 327 ? 35.832  4.150   23.322  1.00 30.65  ? 584  GLN A C     1 
ATOM   2268 O  O     . GLN A 1 327 ? 35.794  4.031   24.559  1.00 30.94  ? 584  GLN A O     1 
ATOM   2269 C  CB    . GLN A 1 327 ? 37.589  3.105   21.849  1.00 32.06  ? 584  GLN A CB    1 
ATOM   2270 C  CG    . GLN A 1 327 ? 38.706  3.218   22.883  1.00 33.35  ? 584  GLN A CG    1 
ATOM   2271 C  CD    . GLN A 1 327 ? 39.033  1.888   23.543  1.00 36.08  ? 584  GLN A CD    1 
ATOM   2272 O  OE1   . GLN A 1 327 ? 38.146  1.191   24.074  1.00 36.62  ? 584  GLN A OE1   1 
ATOM   2273 N  NE2   . GLN A 1 327 ? 40.319  1.520   23.523  1.00 35.68  ? 584  GLN A NE2   1 
ATOM   2274 N  N     . SER A 1 328 ? 35.560  5.297   22.710  1.00 30.41  ? 585  SER A N     1 
ATOM   2275 C  CA    . SER A 1 328 ? 35.395  6.527   23.444  1.00 31.06  ? 585  SER A CA    1 
ATOM   2276 C  C     . SER A 1 328 ? 33.995  6.663   24.050  1.00 30.58  ? 585  SER A C     1 
ATOM   2277 O  O     . SER A 1 328 ? 33.843  7.067   25.200  1.00 29.96  ? 585  SER A O     1 
ATOM   2278 C  CB    . SER A 1 328 ? 35.707  7.708   22.532  1.00 33.29  ? 585  SER A CB    1 
ATOM   2279 O  OG    . SER A 1 328 ? 34.686  7.824   21.590  1.00 37.55  ? 585  SER A OG    1 
ATOM   2280 N  N     . THR A 1 329 ? 32.963  6.321   23.288  1.00 29.54  ? 586  THR A N     1 
ATOM   2281 C  CA    . THR A 1 329 ? 31.586  6.506   23.770  1.00 30.22  ? 586  THR A CA    1 
ATOM   2282 C  C     . THR A 1 329 ? 31.106  5.309   24.551  1.00 30.61  ? 586  THR A C     1 
ATOM   2283 O  O     . THR A 1 329 ? 30.537  5.471   25.591  1.00 33.13  ? 586  THR A O     1 
ATOM   2284 C  CB    . THR A 1 329 ? 30.615  6.803   22.635  1.00 30.63  ? 586  THR A CB    1 
ATOM   2285 O  OG1   . THR A 1 329 ? 30.983  8.057   22.075  1.00 29.84  ? 586  THR A OG1   1 
ATOM   2286 C  CG2   . THR A 1 329 ? 29.158  6.898   23.134  1.00 29.55  ? 586  THR A CG2   1 
ATOM   2287 N  N     . TYR A 1 330 ? 31.149  4.143   23.926  1.00 29.77  ? 587  TYR A N     1 
ATOM   2288 C  CA    . TYR A 1 330 ? 30.687  2.912   24.561  1.00 30.24  ? 587  TYR A CA    1 
ATOM   2289 C  C     . TYR A 1 330 ? 31.501  2.275   25.698  1.00 31.66  ? 587  TYR A C     1 
ATOM   2290 O  O     . TYR A 1 330 ? 30.927  1.816   26.683  1.00 37.30  ? 587  TYR A O     1 
ATOM   2291 C  CB    . TYR A 1 330 ? 30.215  1.918   23.501  1.00 29.18  ? 587  TYR A CB    1 
ATOM   2292 C  CG    . TYR A 1 330 ? 29.107  2.535   22.682  1.00 28.37  ? 587  TYR A CG    1 
ATOM   2293 C  CD1   . TYR A 1 330 ? 27.894  2.866   23.271  1.00 28.29  ? 587  TYR A CD1   1 
ATOM   2294 C  CD2   . TYR A 1 330 ? 29.289  2.845   21.343  1.00 27.87  ? 587  TYR A CD2   1 
ATOM   2295 C  CE1   . TYR A 1 330 ? 26.880  3.455   22.541  1.00 28.74  ? 587  TYR A CE1   1 
ATOM   2296 C  CE2   . TYR A 1 330 ? 28.280  3.433   20.604  1.00 28.20  ? 587  TYR A CE2   1 
ATOM   2297 C  CZ    . TYR A 1 330 ? 27.078  3.736   21.209  1.00 28.32  ? 587  TYR A CZ    1 
ATOM   2298 O  OH    . TYR A 1 330 ? 26.069  4.322   20.482  1.00 29.24  ? 587  TYR A OH    1 
ATOM   2299 N  N     . ILE A 1 331 ? 32.824  2.237   25.569  1.00 30.71  ? 588  ILE A N     1 
ATOM   2300 C  CA    . ILE A 1 331 ? 33.628  1.557   26.582  1.00 31.04  ? 588  ILE A CA    1 
ATOM   2301 C  C     . ILE A 1 331 ? 34.230  2.478   27.641  1.00 32.95  ? 588  ILE A C     1 
ATOM   2302 O  O     . ILE A 1 331 ? 34.068  2.238   28.836  1.00 32.40  ? 588  ILE A O     1 
ATOM   2303 C  CB    . ILE A 1 331 ? 34.759  0.732   25.937  1.00 32.07  ? 588  ILE A CB    1 
ATOM   2304 C  CG1   . ILE A 1 331 ? 34.193  -0.543  25.311  1.00 33.49  ? 588  ILE A CG1   1 
ATOM   2305 C  CG2   . ILE A 1 331 ? 35.825  0.395   26.966  1.00 32.17  ? 588  ILE A CG2   1 
ATOM   2306 C  CD1   . ILE A 1 331 ? 34.876  -0.945  24.024  1.00 34.65  ? 588  ILE A CD1   1 
ATOM   2307 N  N     . GLU A 1 332 ? 34.908  3.535   27.207  1.00 33.51  ? 589  GLU A N     1 
ATOM   2308 C  CA    . GLU A 1 332 ? 35.433  4.531   28.134  1.00 35.27  ? 589  GLU A CA    1 
ATOM   2309 C  C     . GLU A 1 332 ? 34.278  5.243   28.819  1.00 33.69  ? 589  GLU A C     1 
ATOM   2310 O  O     . GLU A 1 332 ? 34.302  5.510   30.018  1.00 33.26  ? 589  GLU A O     1 
ATOM   2311 C  CB    . GLU A 1 332 ? 36.322  5.535   27.402  1.00 38.73  ? 589  GLU A CB    1 
ATOM   2312 C  CG    . GLU A 1 332 ? 37.749  5.059   27.197  1.00 44.21  ? 589  GLU A CG    1 
ATOM   2313 C  CD    . GLU A 1 332 ? 38.536  5.957   26.264  1.00 50.73  ? 589  GLU A CD    1 
ATOM   2314 O  OE1   . GLU A 1 332 ? 38.097  7.102   26.027  1.00 53.50  ? 589  GLU A OE1   1 
ATOM   2315 O  OE2   . GLU A 1 332 ? 39.592  5.517   25.766  1.00 55.48  ? 589  GLU A OE2   1 
ATOM   2316 N  N     . GLY A 1 333 ? 33.261  5.535   28.020  1.00 33.19  ? 590  GLY A N     1 
ATOM   2317 C  CA    . GLY A 1 333 ? 32.052  6.212   28.469  1.00 33.27  ? 590  GLY A CA    1 
ATOM   2318 C  C     . GLY A 1 333 ? 31.230  5.476   29.501  1.00 32.81  ? 590  GLY A C     1 
ATOM   2319 O  O     . GLY A 1 333 ? 30.752  6.080   30.461  1.00 34.09  ? 590  GLY A O     1 
ATOM   2320 N  N     . LEU A 1 334 ? 31.061  4.174   29.311  1.00 31.47  ? 591  LEU A N     1 
ATOM   2321 C  CA    . LEU A 1 334 ? 30.332  3.358   30.272  1.00 30.94  ? 591  LEU A CA    1 
ATOM   2322 C  C     . LEU A 1 334 ? 31.123  3.194   31.537  1.00 29.75  ? 591  LEU A C     1 
ATOM   2323 O  O     . LEU A 1 334 ? 30.595  3.370   32.626  1.00 29.11  ? 591  LEU A O     1 
ATOM   2324 C  CB    . LEU A 1 334 ? 30.012  1.944   29.722  1.00 32.07  ? 591  LEU A CB    1 
ATOM   2325 C  CG    . LEU A 1 334 ? 28.687  1.915   28.990  1.00 33.53  ? 591  LEU A CG    1 
ATOM   2326 C  CD1   . LEU A 1 334 ? 28.523  0.642   28.141  1.00 33.70  ? 591  LEU A CD1   1 
ATOM   2327 C  CD2   . LEU A 1 334 ? 27.600  2.081   30.067  1.00 32.81  ? 591  LEU A CD2   1 
ATOM   2328 N  N     . LEU A 1 335 ? 32.395  2.837   31.382  1.00 28.59  ? 592  LEU A N     1 
ATOM   2329 C  CA    . LEU A 1 335 ? 33.255  2.557   32.518  1.00 28.33  ? 592  LEU A CA    1 
ATOM   2330 C  C     . LEU A 1 335 ? 33.298  3.733   33.484  1.00 28.91  ? 592  LEU A C     1 
ATOM   2331 O  O     . LEU A 1 335 ? 33.365  3.547   34.677  1.00 29.02  ? 592  LEU A O     1 
ATOM   2332 C  CB    . LEU A 1 335 ? 34.688  2.166   32.040  1.00 27.83  ? 592  LEU A CB    1 
ATOM   2333 C  CG    . LEU A 1 335 ? 34.831  0.734   31.481  1.00 27.94  ? 592  LEU A CG    1 
ATOM   2334 C  CD1   . LEU A 1 335 ? 36.215  0.417   30.886  1.00 28.74  ? 592  LEU A CD1   1 
ATOM   2335 C  CD2   . LEU A 1 335 ? 34.563  -0.275  32.608  1.00 29.02  ? 592  LEU A CD2   1 
ATOM   2336 N  N     . LYS A 1 336 ? 33.254  4.943   32.949  1.00 29.40  ? 593  LYS A N     1 
ATOM   2337 C  CA    . LYS A 1 336 ? 33.302  6.181   33.718  1.00 30.91  ? 593  LYS A CA    1 
ATOM   2338 C  C     . LYS A 1 336 ? 32.074  6.384   34.623  1.00 28.85  ? 593  LYS A C     1 
ATOM   2339 O  O     . LYS A 1 336 ? 32.144  7.072   35.613  1.00 29.16  ? 593  LYS A O     1 
ATOM   2340 C  CB    . LYS A 1 336 ? 33.405  7.311   32.686  1.00 34.86  ? 593  LYS A CB    1 
ATOM   2341 C  CG    . LYS A 1 336 ? 33.811  8.669   33.150  1.00 39.52  ? 593  LYS A CG    1 
ATOM   2342 C  CD    . LYS A 1 336 ? 34.042  9.596   31.933  1.00 42.36  ? 593  LYS A CD    1 
ATOM   2343 C  CE    . LYS A 1 336 ? 34.848  8.945   30.808  1.00 44.86  ? 593  LYS A CE    1 
ATOM   2344 N  NZ    . LYS A 1 336 ? 35.522  9.907   29.880  1.00 47.79  ? 593  LYS A NZ    1 
ATOM   2345 N  N     . VAL A 1 337 ? 30.947  5.784   34.296  1.00 27.01  ? 594  VAL A N     1 
ATOM   2346 C  CA    . VAL A 1 337 ? 29.728  5.969   35.065  1.00 26.60  ? 594  VAL A CA    1 
ATOM   2347 C  C     . VAL A 1 337 ? 29.219  4.689   35.782  1.00 26.11  ? 594  VAL A C     1 
ATOM   2348 O  O     . VAL A 1 337 ? 28.128  4.704   36.361  1.00 26.29  ? 594  VAL A O     1 
ATOM   2349 C  CB    . VAL A 1 337 ? 28.632  6.583   34.184  1.00 26.93  ? 594  VAL A CB    1 
ATOM   2350 C  CG1   . VAL A 1 337 ? 29.153  7.883   33.539  1.00 27.16  ? 594  VAL A CG1   1 
ATOM   2351 C  CG2   . VAL A 1 337 ? 28.194  5.604   33.105  1.00 25.99  ? 594  VAL A CG2   1 
ATOM   2352 N  N     . VAL A 1 338 ? 30.007  3.611   35.783  1.00 25.42  ? 595  VAL A N     1 
ATOM   2353 C  CA    . VAL A 1 338 ? 29.762  2.432   36.616  1.00 25.28  ? 595  VAL A CA    1 
ATOM   2354 C  C     . VAL A 1 338 ? 30.148  2.782   38.046  1.00 26.22  ? 595  VAL A C     1 
ATOM   2355 O  O     . VAL A 1 338 ? 31.223  3.300   38.300  1.00 25.86  ? 595  VAL A O     1 
ATOM   2356 C  CB    . VAL A 1 338 ? 30.602  1.209   36.159  1.00 25.45  ? 595  VAL A CB    1 
ATOM   2357 C  CG1   . VAL A 1 338 ? 30.381  0.009   37.069  1.00 26.38  ? 595  VAL A CG1   1 
ATOM   2358 C  CG2   . VAL A 1 338 ? 30.247  0.832   34.744  1.00 25.39  ? 595  VAL A CG2   1 
ATOM   2359 N  N     . ARG A 1 339 ? 29.273  2.518   38.996  1.00 26.99  ? 596  ARG A N     1 
ATOM   2360 C  CA    . ARG A 1 339 ? 29.629  2.739   40.393  1.00 28.40  ? 596  ARG A CA    1 
ATOM   2361 C  C     . ARG A 1 339 ? 30.508  1.608   40.859  1.00 29.42  ? 596  ARG A C     1 
ATOM   2362 O  O     . ARG A 1 339 ? 30.097  0.470   40.800  1.00 29.91  ? 596  ARG A O     1 
ATOM   2363 C  CB    . ARG A 1 339 ? 28.392  2.816   41.254  1.00 29.29  ? 596  ARG A CB    1 
ATOM   2364 C  CG    . ARG A 1 339 ? 27.375  3.741   40.633  1.00 30.24  ? 596  ARG A CG    1 
ATOM   2365 C  CD    . ARG A 1 339 ? 26.584  4.489   41.674  1.00 32.23  ? 596  ARG A CD    1 
ATOM   2366 N  NE    . ARG A 1 339 ? 26.201  5.711   41.023  1.00 32.55  ? 596  ARG A NE    1 
ATOM   2367 C  CZ    . ARG A 1 339 ? 26.243  6.902   41.591  1.00 32.53  ? 596  ARG A CZ    1 
ATOM   2368 N  NH1   . ARG A 1 339 ? 26.593  7.046   42.875  1.00 32.73  ? 596  ARG A NH1   1 
ATOM   2369 N  NH2   . ARG A 1 339 ? 25.899  7.937   40.854  1.00 32.78  ? 596  ARG A NH2   1 
ATOM   2370 N  N     . PRO A 1 340 ? 31.696  1.930   41.356  1.00 31.03  ? 597  PRO A N     1 
ATOM   2371 C  CA    . PRO A 1 340 ? 32.719  0.932   41.679  1.00 33.53  ? 597  PRO A CA    1 
ATOM   2372 C  C     . PRO A 1 340 ? 32.363  -0.001  42.823  1.00 35.36  ? 597  PRO A C     1 
ATOM   2373 O  O     . PRO A 1 340 ? 32.966  -1.037  42.978  1.00 37.64  ? 597  PRO A O     1 
ATOM   2374 C  CB    . PRO A 1 340 ? 33.947  1.763   42.085  1.00 34.18  ? 597  PRO A CB    1 
ATOM   2375 C  CG    . PRO A 1 340 ? 33.535  3.167   42.154  1.00 33.82  ? 597  PRO A CG    1 
ATOM   2376 C  CD    . PRO A 1 340 ? 32.161  3.316   41.566  1.00 32.15  ? 597  PRO A CD    1 
ATOM   2377 N  N     . ASP A 1 341 ? 31.410  0.356   43.628  1.00 34.64  ? 598  ASP A N     1 
ATOM   2378 C  CA    . ASP A 1 341 ? 31.178  -0.469  44.783  1.00 38.71  ? 598  ASP A CA    1 
ATOM   2379 C  C     . ASP A 1 341 ? 30.162  -1.562  44.528  1.00 39.51  ? 598  ASP A C     1 
ATOM   2380 O  O     . ASP A 1 341 ? 30.214  -2.622  45.166  1.00 45.18  ? 598  ASP A O     1 
ATOM   2381 C  CB    . ASP A 1 341 ? 30.732  0.391   45.925  1.00 40.10  ? 598  ASP A CB    1 
ATOM   2382 C  CG    . ASP A 1 341 ? 29.657  1.312   45.543  1.00 37.52  ? 598  ASP A CG    1 
ATOM   2383 O  OD1   . ASP A 1 341 ? 29.724  1.882   44.446  1.00 37.78  ? 598  ASP A OD1   1 
ATOM   2384 O  OD2   . ASP A 1 341 ? 28.784  1.500   46.373  1.00 41.52  ? 598  ASP A OD2   1 
ATOM   2385 N  N     . THR A 1 342 ? 29.281  -1.328  43.584  1.00 37.06  ? 599  THR A N     1 
ATOM   2386 C  CA    . THR A 1 342 ? 28.296  -2.344  43.173  1.00 35.98  ? 599  THR A CA    1 
ATOM   2387 C  C     . THR A 1 342 ? 28.377  -2.732  41.703  1.00 32.16  ? 599  THR A C     1 
ATOM   2388 O  O     . THR A 1 342 ? 27.632  -3.598  41.263  1.00 29.93  ? 599  THR A O     1 
ATOM   2389 C  CB    . THR A 1 342 ? 26.905  -1.785  43.356  1.00 34.29  ? 599  THR A CB    1 
ATOM   2390 O  OG1   . THR A 1 342 ? 26.790  -0.658  42.512  1.00 36.81  ? 599  THR A OG1   1 
ATOM   2391 C  CG2   . THR A 1 342 ? 26.666  -1.365  44.841  1.00 38.59  ? 599  THR A CG2   1 
ATOM   2392 N  N     . LYS A 1 343 ? 29.278  -2.100  40.952  1.00 29.53  ? 600  LYS A N     1 
ATOM   2393 C  CA    . LYS A 1 343 ? 29.418  -2.362  39.520  1.00 28.36  ? 600  LYS A CA    1 
ATOM   2394 C  C     . LYS A 1 343 ? 28.115  -2.257  38.769  1.00 24.74  ? 600  LYS A C     1 
ATOM   2395 O  O     . LYS A 1 343 ? 27.883  -3.028  37.844  1.00 23.59  ? 600  LYS A O     1 
ATOM   2396 C  CB    . LYS A 1 343 ? 30.062  -3.733  39.254  1.00 31.47  ? 600  LYS A CB    1 
ATOM   2397 C  CG    . LYS A 1 343 ? 31.474  -3.813  39.833  1.00 35.44  ? 600  LYS A CG    1 
ATOM   2398 C  CD    . LYS A 1 343 ? 32.170  -5.056  39.315  1.00 40.85  ? 600  LYS A CD    1 
ATOM   2399 C  CE    . LYS A 1 343 ? 33.623  -5.128  39.798  1.00 44.99  ? 600  LYS A CE    1 
ATOM   2400 N  NZ    . LYS A 1 343 ? 34.345  -6.250  39.140  1.00 49.90  ? 600  LYS A NZ    1 
ATOM   2401 N  N     . LYS A 1 344 ? 27.276  -1.300  39.139  1.00 22.15  ? 601  LYS A N     1 
ATOM   2402 C  CA    . LYS A 1 344 ? 26.107  -1.025  38.389  1.00 22.43  ? 601  LYS A CA    1 
ATOM   2403 C  C     . LYS A 1 344 ? 26.169  0.387   37.785  1.00 21.01  ? 601  LYS A C     1 
ATOM   2404 O  O     . LYS A 1 344 ? 26.856  1.266   38.274  1.00 21.44  ? 601  LYS A O     1 
ATOM   2405 C  CB    . LYS A 1 344 ? 24.857  -1.128  39.258  1.00 23.85  ? 601  LYS A CB    1 
ATOM   2406 C  CG    . LYS A 1 344 ? 24.533  -2.516  39.776  1.00 25.73  ? 601  LYS A CG    1 
ATOM   2407 C  CD    . LYS A 1 344 ? 23.447  -2.433  40.834  1.00 27.10  ? 601  LYS A CD    1 
ATOM   2408 C  CE    . LYS A 1 344 ? 23.036  -3.807  41.340  1.00 29.41  ? 601  LYS A CE    1 
ATOM   2409 N  NZ    . LYS A 1 344 ? 21.554  -3.869  41.456  1.00 29.19  ? 601  LYS A NZ    1 
ATOM   2410 N  N     . VAL A 1 345 ? 25.414  0.553   36.728  1.00 19.91  ? 602  VAL A N     1 
ATOM   2411 C  CA    . VAL A 1 345 ? 25.098  1.875   36.187  1.00 19.74  ? 602  VAL A CA    1 
ATOM   2412 C  C     . VAL A 1 345 ? 23.660  2.189   36.601  1.00 18.82  ? 602  VAL A C     1 
ATOM   2413 O  O     . VAL A 1 345 ? 22.804  1.303   36.531  1.00 19.43  ? 602  VAL A O     1 
ATOM   2414 C  CB    . VAL A 1 345 ? 25.279  1.936   34.641  1.00 19.05  ? 602  VAL A CB    1 
ATOM   2415 C  CG1   . VAL A 1 345 ? 26.751  1.813   34.257  1.00 19.99  ? 602  VAL A CG1   1 
ATOM   2416 C  CG2   . VAL A 1 345 ? 24.457  0.925   33.922  1.00 19.63  ? 602  VAL A CG2   1 
ATOM   2417 N  N     . HIS A 1 346 ? 23.425  3.426   37.006  1.00 17.90  ? 603  HIS A N     1 
ATOM   2418 C  CA    . HIS A 1 346 ? 22.086  3.889   37.428  1.00 18.01  ? 603  HIS A CA    1 
ATOM   2419 C  C     . HIS A 1 346 ? 21.732  5.068   36.533  1.00 16.83  ? 603  HIS A C     1 
ATOM   2420 O  O     . HIS A 1 346 ? 22.131  6.177   36.784  1.00 17.11  ? 603  HIS A O     1 
ATOM   2421 C  CB    . HIS A 1 346 ? 22.126  4.307   38.910  1.00 17.98  ? 603  HIS A CB    1 
ATOM   2422 C  CG    . HIS A 1 346 ? 22.509  3.182   39.854  1.00 19.33  ? 603  HIS A CG    1 
ATOM   2423 N  ND1   . HIS A 1 346 ? 21.600  2.373   40.471  1.00 18.91  ? 603  HIS A ND1   1 
ATOM   2424 C  CD2   . HIS A 1 346 ? 23.751  2.709   40.215  1.00 20.68  ? 603  HIS A CD2   1 
ATOM   2425 C  CE1   . HIS A 1 346 ? 22.242  1.484   41.226  1.00 20.09  ? 603  HIS A CE1   1 
ATOM   2426 N  NE2   . HIS A 1 346 ? 23.560  1.667   41.054  1.00 21.24  ? 603  HIS A NE2   1 
ATOM   2427 N  N     . THR A 1 347 ? 21.112  4.789   35.419  1.00 17.07  ? 604  THR A N     1 
ATOM   2428 C  CA    . THR A 1 347 ? 20.677  5.833   34.518  1.00 17.48  ? 604  THR A CA    1 
ATOM   2429 C  C     . THR A 1 347 ? 19.709  6.769   35.220  1.00 18.16  ? 604  THR A C     1 
ATOM   2430 O  O     . THR A 1 347 ? 19.139  6.468   36.299  1.00 17.76  ? 604  THR A O     1 
ATOM   2431 C  CB    . THR A 1 347 ? 20.063  5.227   33.226  1.00 17.37  ? 604  THR A CB    1 
ATOM   2432 O  OG1   . THR A 1 347 ? 19.998  6.217   32.167  1.00 18.34  ? 604  THR A OG1   1 
ATOM   2433 C  CG2   . THR A 1 347 ? 18.674  4.650   33.474  1.00 16.01  ? 604  THR A CG2   1 
ATOM   2434 N  N     . ILE A 1 348 ? 19.524  7.937   34.610  1.00 18.88  ? 605  ILE A N     1 
ATOM   2435 C  CA    . ILE A 1 348 ? 18.410  8.789   34.993  1.00 19.12  ? 605  ILE A CA    1 
ATOM   2436 C  C     . ILE A 1 348 ? 17.507  8.932   33.750  1.00 19.10  ? 605  ILE A C     1 
ATOM   2437 O  O     . ILE A 1 348 ? 17.956  9.403   32.701  1.00 17.65  ? 605  ILE A O     1 
ATOM   2438 C  CB    . ILE A 1 348 ? 18.913  10.142  35.494  1.00 20.53  ? 605  ILE A CB    1 
ATOM   2439 C  CG1   . ILE A 1 348 ? 19.748  9.953   36.780  1.00 20.98  ? 605  ILE A CG1   1 
ATOM   2440 C  CG2   . ILE A 1 348 ? 17.753  11.153  35.596  1.00 21.04  ? 605  ILE A CG2   1 
ATOM   2441 C  CD1   . ILE A 1 348 ? 20.243  11.270  37.397  1.00 21.50  ? 605  ILE A CD1   1 
ATOM   2442 N  N     . PHE A 1 349 ? 16.245  8.542   33.882  1.00 18.25  ? 606  PHE A N     1 
ATOM   2443 C  CA    . PHE A 1 349 ? 15.275  8.761   32.829  1.00 19.74  ? 606  PHE A CA    1 
ATOM   2444 C  C     . PHE A 1 349 ? 14.696  10.162  32.913  1.00 20.92  ? 606  PHE A C     1 
ATOM   2445 O  O     . PHE A 1 349 ? 14.223  10.594  33.978  1.00 23.56  ? 606  PHE A O     1 
ATOM   2446 C  CB    . PHE A 1 349 ? 14.159  7.751   32.883  1.00 20.06  ? 606  PHE A CB    1 
ATOM   2447 C  CG    . PHE A 1 349 ? 14.602  6.351   32.606  1.00 20.64  ? 606  PHE A CG    1 
ATOM   2448 C  CD1   . PHE A 1 349 ? 14.877  5.935   31.304  1.00 21.51  ? 606  PHE A CD1   1 
ATOM   2449 C  CD2   . PHE A 1 349 ? 14.729  5.436   33.634  1.00 21.01  ? 606  PHE A CD2   1 
ATOM   2450 C  CE1   . PHE A 1 349 ? 15.304  4.636   31.042  1.00 22.68  ? 606  PHE A CE1   1 
ATOM   2451 C  CE2   . PHE A 1 349 ? 15.101  4.112   33.366  1.00 21.17  ? 606  PHE A CE2   1 
ATOM   2452 C  CZ    . PHE A 1 349 ? 15.435  3.721   32.101  1.00 21.36  ? 606  PHE A CZ    1 
ATOM   2453 N  N     . ASN A 1 350 ? 14.746  10.894  31.809  1.00 20.14  ? 607  ASN A N     1 
ATOM   2454 C  CA    . ASN A 1 350 ? 14.082  12.216  31.780  1.00 20.31  ? 607  ASN A CA    1 
ATOM   2455 C  C     . ASN A 1 350 ? 12.696  11.969  31.220  1.00 20.56  ? 607  ASN A C     1 
ATOM   2456 O  O     . ASN A 1 350 ? 12.518  11.588  30.063  1.00 21.36  ? 607  ASN A O     1 
ATOM   2457 C  CB    . ASN A 1 350 ? 14.893  13.213  30.998  1.00 21.24  ? 607  ASN A CB    1 
ATOM   2458 C  CG    . ASN A 1 350 ? 14.419  14.652  31.220  1.00 22.28  ? 607  ASN A CG    1 
ATOM   2459 O  OD1   . ASN A 1 350 ? 13.262  14.888  31.561  1.00 21.17  ? 607  ASN A OD1   1 
ATOM   2460 N  ND2   . ASN A 1 350 ? 15.321  15.606  31.030  1.00 20.09  ? 607  ASN A ND2   1 
ATOM   2461 N  N     . GLN A 1 351 ? 11.712  12.095  32.091  1.00 19.17  ? 608  GLN A N     1 
ATOM   2462 C  CA    . GLN A 1 351 ? 10.316  11.885  31.754  1.00 19.66  ? 608  GLN A CA    1 
ATOM   2463 C  C     . GLN A 1 351 ? 9.621   13.154  31.253  1.00 19.55  ? 608  GLN A C     1 
ATOM   2464 O  O     . GLN A 1 351 ? 8.462   13.113  30.859  1.00 20.90  ? 608  GLN A O     1 
ATOM   2465 C  CB    . GLN A 1 351 ? 9.640   11.427  33.084  1.00 20.48  ? 608  GLN A CB    1 
ATOM   2466 C  CG    . GLN A 1 351 ? 8.238   10.920  32.921  1.00 21.30  ? 608  GLN A CG    1 
ATOM   2467 C  CD    . GLN A 1 351 ? 7.643   10.480  34.250  1.00 19.97  ? 608  GLN A CD    1 
ATOM   2468 O  OE1   . GLN A 1 351 ? 8.345   10.497  35.259  1.00 20.05  ? 608  GLN A OE1   1 
ATOM   2469 N  NE2   . GLN A 1 351 ? 6.350   10.093  34.248  1.00 18.88  ? 608  GLN A NE2   1 
ATOM   2470 N  N     . ALA A 1 352 ? 10.314  14.288  31.284  1.00 19.96  ? 609  ALA A N     1 
ATOM   2471 C  CA    . ALA A 1 352 ? 9.674   15.570  31.038  1.00 20.68  ? 609  ALA A CA    1 
ATOM   2472 C  C     . ALA A 1 352 ? 10.465  16.391  30.042  1.00 21.34  ? 609  ALA A C     1 
ATOM   2473 O  O     . ALA A 1 352 ? 10.582  17.607  30.200  1.00 21.90  ? 609  ALA A O     1 
ATOM   2474 C  CB    . ALA A 1 352 ? 9.503   16.358  32.355  1.00 20.31  ? 609  ALA A CB    1 
ATOM   2475 N  N     . LEU A 1 353 ? 10.980  15.752  29.004  1.00 20.14  ? 610  LEU A N     1 
ATOM   2476 C  CA    . LEU A 1 353 ? 11.857  16.424  28.050  1.00 21.84  ? 610  LEU A CA    1 
ATOM   2477 C  C     . LEU A 1 353 ? 11.326  16.379  26.630  1.00 21.93  ? 610  LEU A C     1 
ATOM   2478 O  O     . LEU A 1 353 ? 11.193  17.391  26.015  1.00 22.76  ? 610  LEU A O     1 
ATOM   2479 C  CB    . LEU A 1 353 ? 13.244  15.784  28.066  1.00 22.11  ? 610  LEU A CB    1 
ATOM   2480 C  CG    . LEU A 1 353 ? 14.164  16.429  27.037  1.00 24.48  ? 610  LEU A CG    1 
ATOM   2481 C  CD1   . LEU A 1 353 ? 14.458  17.869  27.467  1.00 26.83  ? 610  LEU A CD1   1 
ATOM   2482 C  CD2   . LEU A 1 353 ? 15.427  15.610  26.799  1.00 25.45  ? 610  LEU A CD2   1 
ATOM   2483 N  N     . THR A 1 354 ? 11.011  15.209  26.107  1.00 21.70  ? 611  THR A N     1 
ATOM   2484 C  CA    . THR A 1 354 ? 10.688  15.150  24.653  1.00 23.52  ? 611  THR A CA    1 
ATOM   2485 C  C     . THR A 1 354 ? 9.315   15.692  24.298  1.00 24.72  ? 611  THR A C     1 
ATOM   2486 O  O     . THR A 1 354 ? 8.353   15.670  25.086  1.00 23.01  ? 611  THR A O     1 
ATOM   2487 C  CB    . THR A 1 354 ? 10.729  13.705  24.109  1.00 22.17  ? 611  THR A CB    1 
ATOM   2488 O  OG1   . THR A 1 354 ? 9.663   12.960  24.706  1.00 22.23  ? 611  THR A OG1   1 
ATOM   2489 C  CG2   . THR A 1 354 ? 11.995  13.021  24.469  1.00 21.61  ? 611  THR A CG2   1 
ATOM   2490 N  N     . GLN A 1 355 ? 9.198   16.131  23.060  1.00 26.23  ? 612  GLN A N     1 
ATOM   2491 C  CA    . GLN A 1 355 ? 7.961   16.698  22.545  1.00 28.69  ? 612  GLN A CA    1 
ATOM   2492 C  C     . GLN A 1 355 ? 6.981   15.642  22.124  1.00 28.60  ? 612  GLN A C     1 
ATOM   2493 O  O     . GLN A 1 355 ? 5.837   15.948  21.812  1.00 32.26  ? 612  GLN A O     1 
ATOM   2494 C  CB    . GLN A 1 355 ? 8.284   17.564  21.333  1.00 32.99  ? 612  GLN A CB    1 
ATOM   2495 C  CG    . GLN A 1 355 ? 9.499   18.426  21.579  1.00 36.70  ? 612  GLN A CG    1 
ATOM   2496 C  CD    . GLN A 1 355 ? 9.221   19.435  22.664  1.00 40.50  ? 612  GLN A CD    1 
ATOM   2497 O  OE1   . GLN A 1 355 ? 8.323   20.255  22.514  1.00 44.86  ? 612  GLN A OE1   1 
ATOM   2498 N  NE2   . GLN A 1 355 ? 9.999   19.389  23.763  1.00 45.36  ? 612  GLN A NE2   1 
ATOM   2499 N  N     . THR A 1 356 ? 7.416   14.387  22.086  1.00 26.27  ? 613  THR A N     1 
ATOM   2500 C  CA    . THR A 1 356 ? 6.558   13.312  21.640  1.00 26.28  ? 613  THR A CA    1 
ATOM   2501 C  C     . THR A 1 356 ? 5.990   12.505  22.794  1.00 25.38  ? 613  THR A C     1 
ATOM   2502 O  O     . THR A 1 356 ? 5.027   11.784  22.581  1.00 27.85  ? 613  THR A O     1 
ATOM   2503 C  CB    . THR A 1 356 ? 7.344   12.329  20.755  1.00 26.21  ? 613  THR A CB    1 
ATOM   2504 O  OG1   . THR A 1 356 ? 8.494   11.888  21.496  1.00 25.12  ? 613  THR A OG1   1 
ATOM   2505 C  CG2   . THR A 1 356 ? 7.716   12.992  19.411  1.00 27.28  ? 613  THR A CG2   1 
ATOM   2506 N  N     . GLY A 1 357 ? 6.531   12.697  23.995  1.00 22.80  ? 614  GLY A N     1 
ATOM   2507 C  CA    . GLY A 1 357 ? 6.186   11.896  25.155  1.00 21.98  ? 614  GLY A CA    1 
ATOM   2508 C  C     . GLY A 1 357 ? 7.093   10.696  25.369  1.00 20.58  ? 614  GLY A C     1 
ATOM   2509 O  O     . GLY A 1 357 ? 6.883   9.904   26.286  1.00 22.33  ? 614  GLY A O     1 
ATOM   2510 N  N     . ARG A 1 358 ? 8.107   10.566  24.521  1.00 20.18  ? 615  ARG A N     1 
ATOM   2511 C  CA    . ARG A 1 358 ? 9.134   9.542   24.683  1.00 19.69  ? 615  ARG A CA    1 
ATOM   2512 C  C     . ARG A 1 358 ? 10.038  9.827   25.884  1.00 19.06  ? 615  ARG A C     1 
ATOM   2513 O  O     . ARG A 1 358 ? 10.304  10.981  26.209  1.00 20.74  ? 615  ARG A O     1 
ATOM   2514 C  CB    . ARG A 1 358 ? 9.990   9.448   23.419  1.00 19.84  ? 615  ARG A CB    1 
ATOM   2515 C  CG    . ARG A 1 358 ? 9.532   8.403   22.418  1.00 20.38  ? 615  ARG A CG    1 
ATOM   2516 C  CD    . ARG A 1 358 ? 10.483  8.346   21.235  1.00 20.61  ? 615  ARG A CD    1 
ATOM   2517 N  NE    . ARG A 1 358 ? 10.164  7.255   20.322  1.00 20.69  ? 615  ARG A NE    1 
ATOM   2518 C  CZ    . ARG A 1 358 ? 11.006  6.770   19.416  1.00 22.37  ? 615  ARG A CZ    1 
ATOM   2519 N  NH1   . ARG A 1 358 ? 12.224  7.281   19.301  1.00 22.38  ? 615  ARG A NH1   1 
ATOM   2520 N  NH2   . ARG A 1 358 ? 10.631  5.776   18.625  1.00 23.71  ? 615  ARG A NH2   1 
ATOM   2521 N  N     . LEU A 1 359 ? 10.498  8.767   26.542  1.00 18.62  ? 616  LEU A N     1 
ATOM   2522 C  CA    . LEU A 1 359 ? 11.504  8.872   27.599  1.00 18.34  ? 616  LEU A CA    1 
ATOM   2523 C  C     . LEU A 1 359 ? 12.900  9.148   27.033  1.00 20.64  ? 616  LEU A C     1 
ATOM   2524 O  O     . LEU A 1 359 ? 13.186  8.812   25.886  1.00 25.32  ? 616  LEU A O     1 
ATOM   2525 C  CB    . LEU A 1 359 ? 11.536  7.596   28.443  1.00 17.35  ? 616  LEU A CB    1 
ATOM   2526 C  CG    . LEU A 1 359 ? 10.314  7.278   29.305  1.00 18.08  ? 616  LEU A CG    1 
ATOM   2527 C  CD1   . LEU A 1 359 ? 10.571  6.037   30.144  1.00 18.88  ? 616  LEU A CD1   1 
ATOM   2528 C  CD2   . LEU A 1 359 ? 9.950   8.461   30.188  1.00 17.26  ? 616  LEU A CD2   1 
ATOM   2529 N  N     . SER A 1 360 ? 13.764  9.752   27.846  1.00 20.79  ? 617  SER A N     1 
ATOM   2530 C  CA    . SER A 1 360 ? 15.164  9.952   27.486  1.00 21.43  ? 617  SER A CA    1 
ATOM   2531 C  C     . SER A 1 360 ? 16.020  9.415   28.631  1.00 22.16  ? 617  SER A C     1 
ATOM   2532 O  O     . SER A 1 360 ? 15.552  9.332   29.765  1.00 19.98  ? 617  SER A O     1 
ATOM   2533 C  CB    . SER A 1 360 ? 15.460  11.430  27.227  1.00 22.38  ? 617  SER A CB    1 
ATOM   2534 O  OG    . SER A 1 360 ? 16.063  12.037  28.352  1.00 23.87  ? 617  SER A OG    1 
ATOM   2535 N  N     . SER A 1 361 ? 17.258  9.026   28.339  1.00 21.28  ? 618  SER A N     1 
ATOM   2536 C  CA    . SER A 1 361 ? 18.079  8.312   29.335  1.00 21.18  ? 618  SER A CA    1 
ATOM   2537 C  C     . SER A 1 361 ? 19.461  8.974   29.318  1.00 21.07  ? 618  SER A C     1 
ATOM   2538 O  O     . SER A 1 361 ? 19.981  9.272   28.214  1.00 20.27  ? 618  SER A O     1 
ATOM   2539 C  CB    . SER A 1 361 ? 18.118  6.817   28.936  1.00 22.21  ? 618  SER A CB    1 
ATOM   2540 O  OG    . SER A 1 361 ? 19.191  6.083   29.475  1.00 23.20  ? 618  SER A OG    1 
ATOM   2541 N  N     . THR A 1 362 ? 20.015  9.279   30.516  1.00 20.36  ? 619  THR A N     1 
ATOM   2542 C  CA    . THR A 1 362 ? 21.317  9.899   30.629  1.00 23.25  ? 619  THR A CA    1 
ATOM   2543 C  C     . THR A 1 362 ? 22.215  9.224   31.696  1.00 23.84  ? 619  THR A C     1 
ATOM   2544 O  O     . THR A 1 362 ? 21.726  8.607   32.649  1.00 20.82  ? 619  THR A O     1 
ATOM   2545 C  CB    . THR A 1 362 ? 21.187  11.382  30.996  1.00 25.65  ? 619  THR A CB    1 
ATOM   2546 O  OG1   . THR A 1 362 ? 20.533  11.474  32.238  1.00 24.91  ? 619  THR A OG1   1 
ATOM   2547 C  CG2   . THR A 1 362 ? 20.386  12.200  29.944  1.00 27.03  ? 619  THR A CG2   1 
ATOM   2548 N  N     . GLU A 1 363 ? 23.515  9.318   31.478  1.00 25.33  ? 620  GLU A N     1 
ATOM   2549 C  CA    . GLU A 1 363 ? 24.529  9.015   32.465  1.00 29.59  ? 620  GLU A CA    1 
ATOM   2550 C  C     . GLU A 1 363 ? 24.432  7.605   33.076  1.00 26.95  ? 620  GLU A C     1 
ATOM   2551 O  O     . GLU A 1 363 ? 24.429  7.456   34.255  1.00 27.80  ? 620  GLU A O     1 
ATOM   2552 C  CB    . GLU A 1 363 ? 24.494  10.070  33.572  1.00 33.02  ? 620  GLU A CB    1 
ATOM   2553 C  CG    . GLU A 1 363 ? 24.911  11.470  33.134  1.00 38.93  ? 620  GLU A CG    1 
ATOM   2554 C  CD    . GLU A 1 363 ? 25.261  12.394  34.336  1.00 44.43  ? 620  GLU A CD    1 
ATOM   2555 O  OE1   . GLU A 1 363 ? 26.172  12.052  35.125  1.00 44.39  ? 620  GLU A OE1   1 
ATOM   2556 O  OE2   . GLU A 1 363 ? 24.609  13.451  34.521  1.00 50.25  ? 620  GLU A OE2   1 
ATOM   2557 N  N     . PRO A 1 364 ? 24.425  6.572   32.251  1.00 25.09  ? 621  PRO A N     1 
ATOM   2558 C  CA    . PRO A 1 364 ? 24.627  6.632   30.803  1.00 25.05  ? 621  PRO A CA    1 
ATOM   2559 C  C     . PRO A 1 364 ? 23.319  6.637   30.045  1.00 22.80  ? 621  PRO A C     1 
ATOM   2560 O  O     . PRO A 1 364 ? 22.272  6.307   30.603  1.00 20.60  ? 621  PRO A O     1 
ATOM   2561 C  CB    . PRO A 1 364 ? 25.375  5.331   30.523  1.00 24.76  ? 621  PRO A CB    1 
ATOM   2562 C  CG    . PRO A 1 364 ? 24.760  4.377   31.510  1.00 25.19  ? 621  PRO A CG    1 
ATOM   2563 C  CD    . PRO A 1 364 ? 24.447  5.187   32.738  1.00 24.71  ? 621  PRO A CD    1 
ATOM   2564 N  N     . ASN A 1 365 ? 23.399  6.986   28.768  1.00 21.61  ? 622  ASN A N     1 
ATOM   2565 C  CA    . ASN A 1 365 ? 22.277  6.824   27.881  1.00 21.08  ? 622  ASN A CA    1 
ATOM   2566 C  C     . ASN A 1 365 ? 22.221  5.340   27.528  1.00 21.78  ? 622  ASN A C     1 
ATOM   2567 O  O     . ASN A 1 365 ? 23.145  4.801   26.956  1.00 21.37  ? 622  ASN A O     1 
ATOM   2568 C  CB    . ASN A 1 365 ? 22.450  7.694   26.655  1.00 21.12  ? 622  ASN A CB    1 
ATOM   2569 C  CG    . ASN A 1 365 ? 21.346  7.506   25.635  1.00 21.52  ? 622  ASN A CG    1 
ATOM   2570 O  OD1   . ASN A 1 365 ? 20.386  6.768   25.864  1.00 20.06  ? 622  ASN A OD1   1 
ATOM   2571 N  ND2   . ASN A 1 365 ? 21.493  8.166   24.492  1.00 20.85  ? 622  ASN A ND2   1 
ATOM   2572 N  N     . LEU A 1 366 ? 21.150  4.648   27.920  1.00 21.11  ? 623  LEU A N     1 
ATOM   2573 C  CA    . LEU A 1 366 ? 21.099  3.244   27.664  1.00 22.57  ? 623  LEU A CA    1 
ATOM   2574 C  C     . LEU A 1 366 ? 20.120  2.934   26.535  1.00 24.67  ? 623  LEU A C     1 
ATOM   2575 O  O     . LEU A 1 366 ? 19.758  1.779   26.327  1.00 23.81  ? 623  LEU A O     1 
ATOM   2576 C  CB    . LEU A 1 366 ? 20.742  2.504   28.934  1.00 23.26  ? 623  LEU A CB    1 
ATOM   2577 C  CG    . LEU A 1 366 ? 21.869  2.471   29.989  1.00 24.01  ? 623  LEU A CG    1 
ATOM   2578 C  CD1   . LEU A 1 366 ? 21.400  1.762   31.262  1.00 24.36  ? 623  LEU A CD1   1 
ATOM   2579 C  CD2   . LEU A 1 366 ? 23.139  1.786   29.453  1.00 26.20  ? 623  LEU A CD2   1 
ATOM   2580 N  N     . GLN A 1 367 ? 19.762  3.960   25.758  1.00 25.02  ? 624  GLN A N     1 
ATOM   2581 C  CA    . GLN A 1 367 ? 18.798  3.799   24.677  1.00 25.13  ? 624  GLN A CA    1 
ATOM   2582 C  C     . GLN A 1 367 ? 19.474  3.843   23.337  1.00 25.76  ? 624  GLN A C     1 
ATOM   2583 O  O     . GLN A 1 367 ? 18.813  3.808   22.293  1.00 26.79  ? 624  GLN A O     1 
ATOM   2584 C  CB    . GLN A 1 367 ? 17.712  4.907   24.794  1.00 24.36  ? 624  GLN A CB    1 
ATOM   2585 C  CG    . GLN A 1 367 ? 16.813  4.704   26.010  1.00 24.34  ? 624  GLN A CG    1 
ATOM   2586 C  CD    . GLN A 1 367 ? 15.726  5.765   26.203  1.00 25.28  ? 624  GLN A CD    1 
ATOM   2587 O  OE1   . GLN A 1 367 ? 15.915  6.932   25.858  1.00 24.65  ? 624  GLN A OE1   1 
ATOM   2588 N  NE2   . GLN A 1 367 ? 14.582  5.359   26.803  1.00 24.46  ? 624  GLN A NE2   1 
ATOM   2589 N  N     . ASN A 1 368 ? 20.808  3.934   23.333  1.00 25.07  ? 625  ASN A N     1 
ATOM   2590 C  CA    . ASN A 1 368 ? 21.520  3.941   22.066  1.00 25.26  ? 625  ASN A CA    1 
ATOM   2591 C  C     . ASN A 1 368 ? 22.741  2.995   22.060  1.00 24.55  ? 625  ASN A C     1 
ATOM   2592 O  O     . ASN A 1 368 ? 23.733  3.264   21.398  1.00 25.63  ? 625  ASN A O     1 
ATOM   2593 C  CB    . ASN A 1 368 ? 21.842  5.405   21.615  1.00 26.02  ? 625  ASN A CB    1 
ATOM   2594 C  CG    . ASN A 1 368 ? 22.901  6.065   22.465  1.00 25.97  ? 625  ASN A CG    1 
ATOM   2595 O  OD1   . ASN A 1 368 ? 23.242  5.570   23.568  1.00 25.05  ? 625  ASN A OD1   1 
ATOM   2596 N  ND2   . ASN A 1 368 ? 23.497  7.146   21.937  1.00 26.32  ? 625  ASN A ND2   1 
ATOM   2597 N  N     . ILE A 1 369 ? 22.652  1.897   22.817  1.00 23.41  ? 626  ILE A N     1 
ATOM   2598 C  CA    . ILE A 1 369 ? 23.735  0.905   22.892  1.00 24.01  ? 626  ILE A CA    1 
ATOM   2599 C  C     . ILE A 1 369 ? 23.770  0.159   21.547  1.00 24.93  ? 626  ILE A C     1 
ATOM   2600 O  O     . ILE A 1 369 ? 22.719  -0.214  21.007  1.00 23.92  ? 626  ILE A O     1 
ATOM   2601 C  CB    . ILE A 1 369 ? 23.571  -0.077  24.079  1.00 22.96  ? 626  ILE A CB    1 
ATOM   2602 C  CG1   . ILE A 1 369 ? 23.551  0.671   25.416  1.00 22.62  ? 626  ILE A CG1   1 
ATOM   2603 C  CG2   . ILE A 1 369 ? 24.732  -1.067  24.124  1.00 23.95  ? 626  ILE A CG2   1 
ATOM   2604 C  CD1   . ILE A 1 369 ? 24.753  1.536   25.741  1.00 22.71  ? 626  ILE A CD1   1 
ATOM   2605 N  N     . PRO A 1 370 ? 24.975  -0.029  20.966  1.00 26.71  ? 627  PRO A N     1 
ATOM   2606 C  CA    . PRO A 1 370 ? 24.968  -0.580  19.628  1.00 28.06  ? 627  PRO A CA    1 
ATOM   2607 C  C     . PRO A 1 370 ? 24.293  -1.928  19.495  1.00 28.66  ? 627  PRO A C     1 
ATOM   2608 O  O     . PRO A 1 370 ? 24.295  -2.738  20.425  1.00 27.37  ? 627  PRO A O     1 
ATOM   2609 C  CB    . PRO A 1 370 ? 26.463  -0.641  19.247  1.00 29.67  ? 627  PRO A CB    1 
ATOM   2610 C  CG    . PRO A 1 370 ? 27.110  0.393   20.112  1.00 29.02  ? 627  PRO A CG    1 
ATOM   2611 C  CD    . PRO A 1 370 ? 26.333  0.343   21.401  1.00 27.18  ? 627  PRO A CD    1 
ATOM   2612 N  N     . ILE A 1 371 ? 23.727  -2.152  18.313  1.00 30.89  ? 628  ILE A N     1 
ATOM   2613 C  CA    . ILE A 1 371 ? 23.035  -3.405  17.990  1.00 32.03  ? 628  ILE A CA    1 
ATOM   2614 C  C     . ILE A 1 371 ? 23.122  -3.775  16.505  1.00 33.86  ? 628  ILE A C     1 
ATOM   2615 O  O     . ILE A 1 371 ? 23.142  -4.963  16.175  1.00 32.02  ? 628  ILE A O     1 
ATOM   2616 C  CB    . ILE A 1 371 ? 21.542  -3.400  18.441  1.00 31.94  ? 628  ILE A CB    1 
ATOM   2617 C  CG1   . ILE A 1 371 ? 20.975  -4.841  18.447  1.00 35.03  ? 628  ILE A CG1   1 
ATOM   2618 C  CG2   . ILE A 1 371 ? 20.707  -2.480  17.552  1.00 32.10  ? 628  ILE A CG2   1 
ATOM   2619 C  CD1   . ILE A 1 371 ? 19.756  -5.061  19.341  1.00 35.51  ? 628  ILE A CD1   1 
ATOM   2620 N  N     . ARG A 1 372 ? 23.177  -2.775  15.619  1.00 36.34  ? 629  ARG A N     1 
ATOM   2621 C  CA    . ARG A 1 372 ? 23.092  -3.006  14.181  1.00 38.07  ? 629  ARG A CA    1 
ATOM   2622 C  C     . ARG A 1 372 ? 24.298  -3.784  13.620  1.00 37.65  ? 629  ARG A C     1 
ATOM   2623 O  O     . ARG A 1 372 ? 24.120  -4.685  12.818  1.00 37.78  ? 629  ARG A O     1 
ATOM   2624 C  CB    . ARG A 1 372 ? 22.916  -1.672  13.432  1.00 41.90  ? 629  ARG A CB    1 
ATOM   2625 C  CG    . ARG A 1 372 ? 22.619  -1.825  11.943  1.00 49.22  ? 629  ARG A CG    1 
ATOM   2626 C  CD    . ARG A 1 372 ? 22.532  -0.492  11.174  1.00 53.15  ? 629  ARG A CD    1 
ATOM   2627 N  NE    . ARG A 1 372 ? 23.848  0.122   10.956  1.00 57.68  ? 629  ARG A NE    1 
ATOM   2628 C  CZ    . ARG A 1 372 ? 24.687  -0.182  9.961   1.00 62.66  ? 629  ARG A CZ    1 
ATOM   2629 N  NH1   . ARG A 1 372 ? 24.368  -1.102  9.063   1.00 68.29  ? 629  ARG A NH1   1 
ATOM   2630 N  NH2   . ARG A 1 372 ? 25.861  0.430   9.861   1.00 64.44  ? 629  ARG A NH2   1 
ATOM   2631 N  N     . LEU A 1 373 ? 25.517  -3.401  13.986  1.00 36.50  ? 630  LEU A N     1 
ATOM   2632 C  CA    . LEU A 1 373 ? 26.699  -4.116  13.520  1.00 37.85  ? 630  LEU A CA    1 
ATOM   2633 C  C     . LEU A 1 373 ? 27.237  -4.991  14.659  1.00 36.59  ? 630  LEU A C     1 
ATOM   2634 O  O     . LEU A 1 373 ? 27.258  -4.558  15.816  1.00 33.26  ? 630  LEU A O     1 
ATOM   2635 C  CB    . LEU A 1 373 ? 27.747  -3.125  13.027  1.00 40.16  ? 630  LEU A CB    1 
ATOM   2636 C  CG    . LEU A 1 373 ? 27.285  -2.374  11.760  1.00 42.61  ? 630  LEU A CG    1 
ATOM   2637 C  CD1   . LEU A 1 373 ? 28.255  -1.254  11.409  1.00 45.25  ? 630  LEU A CD1   1 
ATOM   2638 C  CD2   . LEU A 1 373 ? 27.123  -3.342  10.601  1.00 44.03  ? 630  LEU A CD2   1 
ATOM   2639 N  N     . GLU A 1 374 ? 27.647  -6.208  14.311  1.00 36.82  ? 631  GLU A N     1 
ATOM   2640 C  CA    . GLU A 1 374 ? 28.061  -7.236  15.274  1.00 37.78  ? 631  GLU A CA    1 
ATOM   2641 C  C     . GLU A 1 374 ? 29.196  -6.794  16.216  1.00 37.41  ? 631  GLU A C     1 
ATOM   2642 O  O     . GLU A 1 374 ? 29.097  -7.016  17.429  1.00 34.76  ? 631  GLU A O     1 
ATOM   2643 C  CB    . GLU A 1 374 ? 28.384  -8.565  14.542  1.00 40.78  ? 631  GLU A CB    1 
ATOM   2644 C  CG    . GLU A 1 374 ? 28.883  -9.724  15.408  1.00 42.20  ? 631  GLU A CG    1 
ATOM   2645 C  CD    . GLU A 1 374 ? 28.004  -10.007 16.630  1.00 42.53  ? 631  GLU A CD    1 
ATOM   2646 O  OE1   . GLU A 1 374 ? 26.766  -9.799  16.563  1.00 46.51  ? 631  GLU A OE1   1 
ATOM   2647 O  OE2   . GLU A 1 374 ? 28.545  -10.411 17.682  1.00 44.70  ? 631  GLU A OE2   1 
ATOM   2648 N  N     . GLU A 1 375 ? 30.220  -6.125  15.676  1.00 40.40  ? 632  GLU A N     1 
ATOM   2649 C  CA    . GLU A 1 375 ? 31.347  -5.580  16.469  1.00 42.77  ? 632  GLU A CA    1 
ATOM   2650 C  C     . GLU A 1 375 ? 30.813  -4.751  17.618  1.00 38.98  ? 632  GLU A C     1 
ATOM   2651 O  O     . GLU A 1 375 ? 31.169  -4.974  18.779  1.00 39.42  ? 632  GLU A O     1 
ATOM   2652 C  CB    . GLU A 1 375 ? 32.295  -4.695  15.626  1.00 48.46  ? 632  GLU A CB    1 
ATOM   2653 C  CG    . GLU A 1 375 ? 33.121  -5.430  14.578  1.00 55.56  ? 632  GLU A CG    1 
ATOM   2654 C  CD    . GLU A 1 375 ? 34.349  -4.634  14.087  1.00 62.92  ? 632  GLU A CD    1 
ATOM   2655 O  OE1   . GLU A 1 375 ? 35.088  -4.069  14.928  1.00 65.12  ? 632  GLU A OE1   1 
ATOM   2656 O  OE2   . GLU A 1 375 ? 34.599  -4.564  12.855  1.00 69.14  ? 632  GLU A OE2   1 
ATOM   2657 N  N     . GLY A 1 376 ? 29.928  -3.826  17.300  1.00 35.03  ? 633  GLY A N     1 
ATOM   2658 C  CA    . GLY A 1 376 ? 29.350  -2.959  18.298  1.00 32.77  ? 633  GLY A CA    1 
ATOM   2659 C  C     . GLY A 1 376 ? 28.417  -3.672  19.259  1.00 31.18  ? 633  GLY A C     1 
ATOM   2660 O  O     . GLY A 1 376 ? 28.361  -3.360  20.448  1.00 28.41  ? 633  GLY A O     1 
ATOM   2661 N  N     . ARG A 1 377 ? 27.645  -4.596  18.716  1.00 30.94  ? 634  ARG A N     1 
ATOM   2662 C  CA    . ARG A 1 377 ? 26.636  -5.307  19.486  1.00 30.06  ? 634  ARG A CA    1 
ATOM   2663 C  C     . ARG A 1 377 ? 27.249  -6.073  20.654  1.00 28.72  ? 634  ARG A C     1 
ATOM   2664 O  O     . ARG A 1 377 ? 26.623  -6.233  21.672  1.00 25.60  ? 634  ARG A O     1 
ATOM   2665 C  CB    . ARG A 1 377 ? 25.952  -6.291  18.559  1.00 33.17  ? 634  ARG A CB    1 
ATOM   2666 C  CG    . ARG A 1 377 ? 24.720  -6.961  19.104  1.00 35.02  ? 634  ARG A CG    1 
ATOM   2667 C  CD    . ARG A 1 377 ? 24.106  -7.814  17.995  1.00 40.48  ? 634  ARG A CD    1 
ATOM   2668 N  NE    . ARG A 1 377 ? 22.760  -8.182  18.380  1.00 44.54  ? 634  ARG A NE    1 
ATOM   2669 C  CZ    . ARG A 1 377 ? 21.881  -8.799  17.601  1.00 50.16  ? 634  ARG A CZ    1 
ATOM   2670 N  NH1   . ARG A 1 377 ? 22.200  -9.153  16.357  1.00 52.69  ? 634  ARG A NH1   1 
ATOM   2671 N  NH2   . ARG A 1 377 ? 20.668  -9.069  18.088  1.00 50.95  ? 634  ARG A NH2   1 
ATOM   2672 N  N     . LYS A 1 378 ? 28.482  -6.536  20.490  1.00 29.60  ? 635  LYS A N     1 
ATOM   2673 C  CA    . LYS A 1 378 ? 29.159  -7.274  21.550  1.00 32.32  ? 635  LYS A CA    1 
ATOM   2674 C  C     . LYS A 1 378 ? 29.247  -6.454  22.843  1.00 31.59  ? 635  LYS A C     1 
ATOM   2675 O  O     . LYS A 1 378 ? 29.394  -7.017  23.912  1.00 30.90  ? 635  LYS A O     1 
ATOM   2676 C  CB    . LYS A 1 378 ? 30.538  -7.728  21.080  1.00 35.56  ? 635  LYS A CB    1 
ATOM   2677 C  CG    . LYS A 1 378 ? 30.508  -8.831  20.021  1.00 37.95  ? 635  LYS A CG    1 
ATOM   2678 C  CD    . LYS A 1 378 ? 31.882  -8.968  19.371  1.00 42.24  ? 635  LYS A CD    1 
ATOM   2679 C  CE    . LYS A 1 378 ? 32.200  -10.355 18.809  1.00 45.44  ? 635  LYS A CE    1 
ATOM   2680 N  NZ    . LYS A 1 378 ? 31.030  -11.064 18.214  1.00 46.75  ? 635  LYS A NZ    1 
ATOM   2681 N  N     . ILE A 1 379 ? 29.117  -5.130  22.742  1.00 31.58  ? 636  ILE A N     1 
ATOM   2682 C  CA    . ILE A 1 379 ? 29.079  -4.276  23.926  1.00 30.67  ? 636  ILE A CA    1 
ATOM   2683 C  C     . ILE A 1 379 ? 28.020  -4.767  24.877  1.00 27.48  ? 636  ILE A C     1 
ATOM   2684 O  O     . ILE A 1 379 ? 28.210  -4.714  26.086  1.00 24.58  ? 636  ILE A O     1 
ATOM   2685 C  CB    . ILE A 1 379 ? 28.807  -2.805  23.577  1.00 31.49  ? 636  ILE A CB    1 
ATOM   2686 C  CG1   . ILE A 1 379 ? 30.018  -2.154  22.881  1.00 34.60  ? 636  ILE A CG1   1 
ATOM   2687 C  CG2   . ILE A 1 379 ? 28.415  -1.986  24.794  1.00 30.86  ? 636  ILE A CG2   1 
ATOM   2688 C  CD1   . ILE A 1 379 ? 31.374  -2.577  23.397  1.00 38.26  ? 636  ILE A CD1   1 
ATOM   2689 N  N     . ARG A 1 380 ? 26.912  -5.280  24.343  1.00 26.99  ? 637  ARG A N     1 
ATOM   2690 C  CA    . ARG A 1 380 ? 25.808  -5.708  25.204  1.00 24.94  ? 637  ARG A CA    1 
ATOM   2691 C  C     . ARG A 1 380 ? 26.108  -6.956  25.997  1.00 24.46  ? 637  ARG A C     1 
ATOM   2692 O  O     . ARG A 1 380 ? 25.333  -7.298  26.889  1.00 23.85  ? 637  ARG A O     1 
ATOM   2693 C  CB    . ARG A 1 380 ? 24.537  -5.915  24.403  1.00 25.52  ? 637  ARG A CB    1 
ATOM   2694 C  CG    . ARG A 1 380 ? 24.031  -4.628  23.753  1.00 26.35  ? 637  ARG A CG    1 
ATOM   2695 C  CD    . ARG A 1 380 ? 22.907  -4.925  22.775  1.00 26.43  ? 637  ARG A CD    1 
ATOM   2696 N  NE    . ARG A 1 380 ? 22.331  -3.708  22.255  1.00 26.73  ? 637  ARG A NE    1 
ATOM   2697 C  CZ    . ARG A 1 380 ? 21.042  -3.376  22.315  1.00 26.38  ? 637  ARG A CZ    1 
ATOM   2698 N  NH1   . ARG A 1 380 ? 20.140  -4.180  22.835  1.00 25.53  ? 637  ARG A NH1   1 
ATOM   2699 N  NH2   . ARG A 1 380 ? 20.664  -2.240  21.802  1.00 27.29  ? 637  ARG A NH2   1 
ATOM   2700 N  N     . GLN A 1 381 ? 27.208  -7.635  25.704  1.00 25.72  ? 638  GLN A N     1 
ATOM   2701 C  CA    . GLN A 1 381 ? 27.621  -8.768  26.544  1.00 27.52  ? 638  GLN A CA    1 
ATOM   2702 C  C     . GLN A 1 381 ? 28.047  -8.326  27.950  1.00 27.37  ? 638  GLN A C     1 
ATOM   2703 O  O     . GLN A 1 381 ? 28.249  -9.158  28.826  1.00 28.05  ? 638  GLN A O     1 
ATOM   2704 C  CB    . GLN A 1 381 ? 28.776  -9.546  25.887  1.00 29.93  ? 638  GLN A CB    1 
ATOM   2705 C  CG    . GLN A 1 381 ? 28.385  -10.270 24.606  1.00 31.34  ? 638  GLN A CG    1 
ATOM   2706 C  CD    . GLN A 1 381 ? 29.566  -10.839 23.890  1.00 34.45  ? 638  GLN A CD    1 
ATOM   2707 O  OE1   . GLN A 1 381 ? 30.692  -10.511 24.209  1.00 37.37  ? 638  GLN A OE1   1 
ATOM   2708 N  NE2   . GLN A 1 381 ? 29.321  -11.696 22.914  1.00 36.51  ? 638  GLN A NE2   1 
ATOM   2709 N  N     . ALA A 1 382 ? 28.276  -7.032  28.131  1.00 26.11  ? 639  ALA A N     1 
ATOM   2710 C  CA    . ALA A 1 382 ? 28.774  -6.505  29.382  1.00 26.92  ? 639  ALA A CA    1 
ATOM   2711 C  C     . ALA A 1 382 ? 27.631  -6.174  30.328  1.00 24.08  ? 639  ALA A C     1 
ATOM   2712 O  O     . ALA A 1 382 ? 27.864  -5.847  31.470  1.00 24.10  ? 639  ALA A O     1 
ATOM   2713 C  CB    . ALA A 1 382 ? 29.616  -5.265  29.137  1.00 26.62  ? 639  ALA A CB    1 
ATOM   2714 N  N     . PHE A 1 383 ? 26.399  -6.233  29.856  1.00 23.34  ? 640  PHE A N     1 
ATOM   2715 C  CA    . PHE A 1 383 ? 25.252  -5.967  30.695  1.00 21.26  ? 640  PHE A CA    1 
ATOM   2716 C  C     . PHE A 1 383 ? 24.637  -7.283  31.133  1.00 21.18  ? 640  PHE A C     1 
ATOM   2717 O  O     . PHE A 1 383 ? 24.139  -8.076  30.301  1.00 19.63  ? 640  PHE A O     1 
ATOM   2718 C  CB    . PHE A 1 383 ? 24.215  -5.170  29.955  1.00 21.50  ? 640  PHE A CB    1 
ATOM   2719 C  CG    . PHE A 1 383 ? 24.662  -3.770  29.651  1.00 22.94  ? 640  PHE A CG    1 
ATOM   2720 C  CD1   . PHE A 1 383 ? 25.438  -3.513  28.545  1.00 23.91  ? 640  PHE A CD1   1 
ATOM   2721 C  CD2   . PHE A 1 383 ? 24.365  -2.747  30.498  1.00 22.59  ? 640  PHE A CD2   1 
ATOM   2722 C  CE1   . PHE A 1 383 ? 25.869  -2.223  28.289  1.00 25.97  ? 640  PHE A CE1   1 
ATOM   2723 C  CE2   . PHE A 1 383 ? 24.795  -1.456  30.257  1.00 23.86  ? 640  PHE A CE2   1 
ATOM   2724 C  CZ    . PHE A 1 383 ? 25.526  -1.188  29.135  1.00 24.77  ? 640  PHE A CZ    1 
ATOM   2725 N  N     . VAL A 1 384 ? 24.701  -7.516  32.441  1.00 20.09  ? 641  VAL A N     1 
ATOM   2726 C  CA    . VAL A 1 384 ? 24.477  -8.860  32.975  1.00 20.54  ? 641  VAL A CA    1 
ATOM   2727 C  C     . VAL A 1 384 ? 23.464  -8.785  34.097  1.00 19.68  ? 641  VAL A C     1 
ATOM   2728 O  O     . VAL A 1 384 ? 23.208  -7.687  34.625  1.00 21.52  ? 641  VAL A O     1 
ATOM   2729 C  CB    . VAL A 1 384 ? 25.800  -9.473  33.475  1.00 20.79  ? 641  VAL A CB    1 
ATOM   2730 C  CG1   . VAL A 1 384 ? 26.838  -9.599  32.325  1.00 22.83  ? 641  VAL A CG1   1 
ATOM   2731 C  CG2   . VAL A 1 384 ? 26.363  -8.684  34.640  1.00 20.55  ? 641  VAL A CG2   1 
ATOM   2732 N  N     . PRO A 1 385 ? 22.895  -9.916  34.497  1.00 20.25  ? 642  PRO A N     1 
ATOM   2733 C  CA    . PRO A 1 385 ? 21.970  -9.893  35.641  1.00 20.18  ? 642  PRO A CA    1 
ATOM   2734 C  C     . PRO A 1 385 ? 22.718  -9.553  36.933  1.00 21.72  ? 642  PRO A C     1 
ATOM   2735 O  O     . PRO A 1 385 ? 23.941  -9.793  37.023  1.00 22.06  ? 642  PRO A O     1 
ATOM   2736 C  CB    . PRO A 1 385 ? 21.436  -11.314 35.693  1.00 21.16  ? 642  PRO A CB    1 
ATOM   2737 C  CG    . PRO A 1 385 ? 21.789  -11.933 34.389  1.00 20.92  ? 642  PRO A CG    1 
ATOM   2738 C  CD    . PRO A 1 385 ? 23.061  -11.280 33.967  1.00 21.44  ? 642  PRO A CD    1 
ATOM   2739 N  N     . SER A 1 386 ? 22.010  -8.980  37.906  1.00 21.44  ? 643  SER A N     1 
ATOM   2740 C  CA    . SER A 1 386 ? 22.642  -8.489  39.132  1.00 22.83  ? 643  SER A CA    1 
ATOM   2741 C  C     . SER A 1 386 ? 22.792  -9.578  40.186  1.00 24.57  ? 643  SER A C     1 
ATOM   2742 O  O     . SER A 1 386 ? 23.427  -9.354  41.224  1.00 23.92  ? 643  SER A O     1 
ATOM   2743 C  CB    . SER A 1 386 ? 21.868  -7.294  39.725  1.00 23.09  ? 643  SER A CB    1 
ATOM   2744 O  OG    . SER A 1 386 ? 20.535  -7.663  40.059  1.00 23.73  ? 643  SER A OG    1 
ATOM   2745 N  N     . GLU A 1 387 ? 22.268  -10.765 39.935  1.00 25.09  ? 644  GLU A N     1 
ATOM   2746 C  CA    . GLU A 1 387 ? 22.359  -11.831 40.940  1.00 28.91  ? 644  GLU A CA    1 
ATOM   2747 C  C     . GLU A 1 387 ? 22.672  -13.142 40.256  1.00 28.17  ? 644  GLU A C     1 
ATOM   2748 O  O     . GLU A 1 387 ? 22.356  -13.315 39.081  1.00 23.77  ? 644  GLU A O     1 
ATOM   2749 C  CB    . GLU A 1 387 ? 21.022  -11.951 41.685  1.00 33.96  ? 644  GLU A CB    1 
ATOM   2750 C  CG    . GLU A 1 387 ? 20.722  -10.724 42.516  1.00 39.38  ? 644  GLU A CG    1 
ATOM   2751 C  CD    . GLU A 1 387 ? 19.475  -10.857 43.343  1.00 47.09  ? 644  GLU A CD    1 
ATOM   2752 O  OE1   . GLU A 1 387 ? 19.347  -11.869 44.077  1.00 55.21  ? 644  GLU A OE1   1 
ATOM   2753 O  OE2   . GLU A 1 387 ? 18.627  -9.936  43.257  1.00 55.45  ? 644  GLU A OE2   1 
ATOM   2754 N  N     . SER A 1 388 ? 23.240  -14.105 40.983  1.00 29.15  ? 645  SER A N     1 
ATOM   2755 C  CA    . SER A 1 388 ? 23.621  -15.310 40.301  1.00 30.93  ? 645  SER A CA    1 
ATOM   2756 C  C     . SER A 1 388 ? 22.357  -16.103 40.026  1.00 29.54  ? 645  SER A C     1 
ATOM   2757 O  O     . SER A 1 388 ? 21.381  -16.024 40.789  1.00 27.59  ? 645  SER A O     1 
ATOM   2758 C  CB    . SER A 1 388 ? 24.636  -16.146 41.087  1.00 35.12  ? 645  SER A CB    1 
ATOM   2759 O  OG    . SER A 1 388 ? 24.060  -16.592 42.283  1.00 39.74  ? 645  SER A OG    1 
ATOM   2760 N  N     . ASP A 1 389 ? 22.371  -16.855 38.932  1.00 29.83  ? 646  ASP A N     1 
ATOM   2761 C  CA    . ASP A 1 389 ? 21.201  -17.707 38.598  1.00 31.55  ? 646  ASP A CA    1 
ATOM   2762 C  C     . ASP A 1 389 ? 19.995  -16.869 38.159  1.00 27.70  ? 646  ASP A C     1 
ATOM   2763 O  O     . ASP A 1 389 ? 18.905  -17.393 38.045  1.00 27.23  ? 646  ASP A O     1 
ATOM   2764 C  CB    . ASP A 1 389 ? 20.830  -18.648 39.762  1.00 34.25  ? 646  ASP A CB    1 
ATOM   2765 C  CG    . ASP A 1 389 ? 21.992  -19.562 40.155  1.00 40.67  ? 646  ASP A CG    1 
ATOM   2766 O  OD1   . ASP A 1 389 ? 22.499  -20.255 39.254  1.00 45.85  ? 646  ASP A OD1   1 
ATOM   2767 O  OD2   . ASP A 1 389 ? 22.423  -19.591 41.335  1.00 44.95  ? 646  ASP A OD2   1 
ATOM   2768 N  N     . TRP A 1 390 ? 20.232  -15.590 37.883  1.00 25.64  ? 647  TRP A N     1 
ATOM   2769 C  CA    . TRP A 1 390 ? 19.274  -14.725 37.213  1.00 23.64  ? 647  TRP A CA    1 
ATOM   2770 C  C     . TRP A 1 390 ? 19.624  -14.565 35.753  1.00 22.04  ? 647  TRP A C     1 
ATOM   2771 O  O     . TRP A 1 390 ? 20.748  -14.798 35.371  1.00 21.62  ? 647  TRP A O     1 
ATOM   2772 C  CB    . TRP A 1 390 ? 19.191  -13.371 37.920  1.00 22.20  ? 647  TRP A CB    1 
ATOM   2773 C  CG    . TRP A 1 390 ? 18.438  -13.372 39.245  1.00 22.50  ? 647  TRP A CG    1 
ATOM   2774 C  CD1   . TRP A 1 390 ? 18.507  -14.302 40.276  1.00 24.27  ? 647  TRP A CD1   1 
ATOM   2775 C  CD2   . TRP A 1 390 ? 17.465  -12.376 39.725  1.00 21.49  ? 647  TRP A CD2   1 
ATOM   2776 N  NE1   . TRP A 1 390 ? 17.684  -13.938 41.317  1.00 23.71  ? 647  TRP A NE1   1 
ATOM   2777 C  CE2   . TRP A 1 390 ? 17.063  -12.796 41.055  1.00 24.09  ? 647  TRP A CE2   1 
ATOM   2778 C  CE3   . TRP A 1 390 ? 16.967  -11.179 39.224  1.00 21.82  ? 647  TRP A CE3   1 
ATOM   2779 C  CZ2   . TRP A 1 390 ? 16.142  -12.064 41.813  1.00 24.30  ? 647  TRP A CZ2   1 
ATOM   2780 C  CZ3   . TRP A 1 390 ? 16.050  -10.457 39.994  1.00 21.79  ? 647  TRP A CZ3   1 
ATOM   2781 C  CH2   . TRP A 1 390 ? 15.667  -10.893 41.260  1.00 22.45  ? 647  TRP A CH2   1 
ATOM   2782 N  N     . LEU A 1 391 ? 18.639  -14.168 34.948  1.00 20.17  ? 648  LEU A N     1 
ATOM   2783 C  CA    . LEU A 1 391 ? 18.769  -13.900 33.525  1.00 20.19  ? 648  LEU A CA    1 
ATOM   2784 C  C     . LEU A 1 391 ? 18.102  -12.588 33.107  1.00 19.54  ? 648  LEU A C     1 
ATOM   2785 O  O     . LEU A 1 391 ? 17.255  -12.049 33.821  1.00 20.12  ? 648  LEU A O     1 
ATOM   2786 C  CB    . LEU A 1 391 ? 18.106  -15.052 32.709  1.00 20.00  ? 648  LEU A CB    1 
ATOM   2787 C  CG    . LEU A 1 391 ? 18.731  -16.449 32.942  1.00 21.39  ? 648  LEU A CG    1 
ATOM   2788 C  CD1   . LEU A 1 391 ? 17.844  -17.584 32.376  1.00 22.39  ? 648  LEU A CD1   1 
ATOM   2789 C  CD2   . LEU A 1 391 ? 20.190  -16.554 32.420  1.00 22.07  ? 648  LEU A CD2   1 
ATOM   2790 N  N     . ILE A 1 392 ? 18.512  -12.092 31.937  1.00 18.57  ? 649  ILE A N     1 
ATOM   2791 C  CA    . ILE A 1 392 ? 17.961  -10.939 31.318  1.00 17.72  ? 649  ILE A CA    1 
ATOM   2792 C  C     . ILE A 1 392 ? 16.832  -11.387 30.377  1.00 17.90  ? 649  ILE A C     1 
ATOM   2793 O  O     . ILE A 1 392 ? 17.004  -12.293 29.564  1.00 18.37  ? 649  ILE A O     1 
ATOM   2794 C  CB    . ILE A 1 392 ? 19.048  -10.161 30.514  1.00 18.39  ? 649  ILE A CB    1 
ATOM   2795 C  CG1   . ILE A 1 392 ? 20.210  -9.757  31.436  1.00 19.97  ? 649  ILE A CG1   1 
ATOM   2796 C  CG2   . ILE A 1 392 ? 18.451  -8.931  29.757  1.00 17.27  ? 649  ILE A CG2   1 
ATOM   2797 C  CD1   . ILE A 1 392 ? 19.784  -8.879  32.611  1.00 18.32  ? 649  ILE A CD1   1 
ATOM   2798 N  N     . PHE A 1 393 ? 15.698  -10.704 30.461  1.00 17.72  ? 650  PHE A N     1 
ATOM   2799 C  CA    . PHE A 1 393 ? 14.505  -10.965 29.620  1.00 18.61  ? 650  PHE A CA    1 
ATOM   2800 C  C     . PHE A 1 393 ? 14.172  -9.642  28.935  1.00 17.52  ? 650  PHE A C     1 
ATOM   2801 O  O     . PHE A 1 393 ? 14.154  -8.621  29.605  1.00 17.79  ? 650  PHE A O     1 
ATOM   2802 C  CB    . PHE A 1 393 ? 13.348  -11.412 30.507  1.00 18.41  ? 650  PHE A CB    1 
ATOM   2803 C  CG    . PHE A 1 393 ? 12.096  -11.729 29.770  1.00 18.99  ? 650  PHE A CG    1 
ATOM   2804 C  CD1   . PHE A 1 393 ? 11.213  -10.739 29.416  1.00 19.25  ? 650  PHE A CD1   1 
ATOM   2805 C  CD2   . PHE A 1 393 ? 11.792  -13.029 29.440  1.00 20.71  ? 650  PHE A CD2   1 
ATOM   2806 C  CE1   . PHE A 1 393 ? 10.058  -11.036 28.713  1.00 18.63  ? 650  PHE A CE1   1 
ATOM   2807 C  CE2   . PHE A 1 393 ? 10.619  -13.330 28.747  1.00 20.99  ? 650  PHE A CE2   1 
ATOM   2808 C  CZ    . PHE A 1 393 ? 9.768   -12.328 28.383  1.00 20.29  ? 650  PHE A CZ    1 
ATOM   2809 N  N     . ALA A 1 394 ? 13.963  -9.668  27.615  1.00 17.26  ? 651  ALA A N     1 
ATOM   2810 C  CA    . ALA A 1 394 ? 13.683  -8.481  26.800  1.00 16.64  ? 651  ALA A CA    1 
ATOM   2811 C  C     . ALA A 1 394 ? 12.447  -8.756  25.962  1.00 17.09  ? 651  ALA A C     1 
ATOM   2812 O  O     . ALA A 1 394 ? 12.357  -9.813  25.301  1.00 18.36  ? 651  ALA A O     1 
ATOM   2813 C  CB    . ALA A 1 394 ? 14.858  -8.195  25.843  1.00 16.45  ? 651  ALA A CB    1 
ATOM   2814 N  N     . ALA A 1 395 ? 11.537  -7.809  25.928  1.00 16.80  ? 652  ALA A N     1 
ATOM   2815 C  CA    . ALA A 1 395 ? 10.311  -7.968  25.194  1.00 17.69  ? 652  ALA A CA    1 
ATOM   2816 C  C     . ALA A 1 395 ? 10.122  -6.674  24.403  1.00 18.57  ? 652  ALA A C     1 
ATOM   2817 O  O     . ALA A 1 395 ? 10.219  -5.589  25.011  1.00 19.33  ? 652  ALA A O     1 
ATOM   2818 C  CB    . ALA A 1 395 ? 9.125   -8.198  26.136  1.00 17.40  ? 652  ALA A CB    1 
ATOM   2819 N  N     . ASP A 1 396 ? 9.869   -6.803  23.090  1.00 19.10  ? 653  ASP A N     1 
ATOM   2820 C  CA    . ASP A 1 396 ? 9.660   -5.643  22.218  1.00 20.43  ? 653  ASP A CA    1 
ATOM   2821 C  C     . ASP A 1 396 ? 8.398   -5.750  21.383  1.00 19.07  ? 653  ASP A C     1 
ATOM   2822 O  O     . ASP A 1 396 ? 8.045   -6.857  20.837  1.00 18.05  ? 653  ASP A O     1 
ATOM   2823 C  CB    . ASP A 1 396 ? 10.893  -5.417  21.296  1.00 23.63  ? 653  ASP A CB    1 
ATOM   2824 C  CG    . ASP A 1 396 ? 11.055  -6.511  20.251  1.00 28.90  ? 653  ASP A CG    1 
ATOM   2825 O  OD1   . ASP A 1 396 ? 11.302  -7.676  20.631  1.00 32.42  ? 653  ASP A OD1   1 
ATOM   2826 O  OD2   . ASP A 1 396 ? 10.889  -6.254  19.023  1.00 37.43  ? 653  ASP A OD2   1 
ATOM   2827 N  N     . TYR A 1 397 ? 7.738   -4.609  21.223  1.00 17.44  ? 654  TYR A N     1 
ATOM   2828 C  CA    . TYR A 1 397 ? 6.668   -4.516  20.251  1.00 18.46  ? 654  TYR A CA    1 
ATOM   2829 C  C     . TYR A 1 397 ? 7.229   -4.631  18.855  1.00 19.86  ? 654  TYR A C     1 
ATOM   2830 O  O     . TYR A 1 397 ? 8.248   -4.006  18.523  1.00 20.77  ? 654  TYR A O     1 
ATOM   2831 C  CB    . TYR A 1 397 ? 5.900   -3.228  20.345  1.00 18.76  ? 654  TYR A CB    1 
ATOM   2832 C  CG    . TYR A 1 397 ? 5.091   -3.057  21.610  1.00 18.24  ? 654  TYR A CG    1 
ATOM   2833 C  CD1   . TYR A 1 397 ? 3.819   -3.574  21.712  1.00 19.62  ? 654  TYR A CD1   1 
ATOM   2834 C  CD2   . TYR A 1 397 ? 5.569   -2.304  22.653  1.00 18.63  ? 654  TYR A CD2   1 
ATOM   2835 C  CE1   . TYR A 1 397 ? 3.047   -3.373  22.852  1.00 19.54  ? 654  TYR A CE1   1 
ATOM   2836 C  CE2   . TYR A 1 397 ? 4.821   -2.109  23.816  1.00 18.56  ? 654  TYR A CE2   1 
ATOM   2837 C  CZ    . TYR A 1 397 ? 3.547   -2.678  23.904  1.00 18.42  ? 654  TYR A CZ    1 
ATOM   2838 O  OH    . TYR A 1 397 ? 2.761   -2.505  25.047  1.00 19.39  ? 654  TYR A OH    1 
ATOM   2839 N  N     . SER A 1 398 ? 6.515   -5.372  18.028  1.00 19.70  ? 655  SER A N     1 
ATOM   2840 C  CA    . SER A 1 398 ? 6.753   -5.447  16.627  1.00 19.68  ? 655  SER A CA    1 
ATOM   2841 C  C     . SER A 1 398 ? 5.955   -4.389  15.896  1.00 18.05  ? 655  SER A C     1 
ATOM   2842 O  O     . SER A 1 398 ? 4.727   -4.428  15.831  1.00 17.89  ? 655  SER A O     1 
ATOM   2843 C  CB    . SER A 1 398 ? 6.415   -6.863  16.081  1.00 21.50  ? 655  SER A CB    1 
ATOM   2844 O  OG    . SER A 1 398 ? 6.624   -6.893  14.661  1.00 22.34  ? 655  SER A OG    1 
ATOM   2845 N  N     . GLN A 1 399 ? 6.663   -3.460  15.278  1.00 17.16  ? 656  GLN A N     1 
ATOM   2846 C  CA    . GLN A 1 399 ? 6.074   -2.417  14.450  1.00 16.88  ? 656  GLN A CA    1 
ATOM   2847 C  C     . GLN A 1 399 ? 4.929   -1.664  15.143  1.00 16.17  ? 656  GLN A C     1 
ATOM   2848 O  O     . GLN A 1 399 ? 3.898   -1.419  14.550  1.00 15.73  ? 656  GLN A O     1 
ATOM   2849 C  CB    . GLN A 1 399 ? 5.587   -3.015  13.142  1.00 17.73  ? 656  GLN A CB    1 
ATOM   2850 C  CG    . GLN A 1 399 ? 6.680   -3.644  12.277  1.00 19.77  ? 656  GLN A CG    1 
ATOM   2851 C  CD    . GLN A 1 399 ? 7.779   -2.672  11.844  1.00 21.55  ? 656  GLN A CD    1 
ATOM   2852 O  OE1   . GLN A 1 399 ? 7.514   -1.510  11.594  1.00 25.55  ? 656  GLN A OE1   1 
ATOM   2853 N  NE2   . GLN A 1 399 ? 8.998   -3.167  11.679  1.00 23.70  ? 656  GLN A NE2   1 
ATOM   2854 N  N     . ILE A 1 400 ? 5.115   -1.290  16.395  1.00 16.95  ? 657  ILE A N     1 
ATOM   2855 C  CA    . ILE A 1 400 ? 4.067   -0.541  17.113  1.00 15.92  ? 657  ILE A CA    1 
ATOM   2856 C  C     . ILE A 1 400 ? 3.666   0.772   16.398  1.00 15.89  ? 657  ILE A C     1 
ATOM   2857 O  O     . ILE A 1 400 ? 2.498   1.068   16.324  1.00 14.85  ? 657  ILE A O     1 
ATOM   2858 C  CB    . ILE A 1 400 ? 4.363   -0.367  18.604  1.00 16.93  ? 657  ILE A CB    1 
ATOM   2859 C  CG1   . ILE A 1 400 ? 3.112   0.159   19.326  1.00 17.16  ? 657  ILE A CG1   1 
ATOM   2860 C  CG2   . ILE A 1 400 ? 5.611   0.449   18.880  1.00 17.58  ? 657  ILE A CG2   1 
ATOM   2861 C  CD1   . ILE A 1 400 ? 3.224   0.252   20.840  1.00 18.96  ? 657  ILE A CD1   1 
ATOM   2862 N  N     . GLU A 1 401 ? 4.611   1.498   15.825  1.00 16.93  ? 658  GLU A N     1 
ATOM   2863 C  CA    . GLU A 1 401 ? 4.282   2.778   15.218  1.00 17.59  ? 658  GLU A CA    1 
ATOM   2864 C  C     . GLU A 1 401 ? 3.398   2.597   14.010  1.00 16.78  ? 658  GLU A C     1 
ATOM   2865 O  O     . GLU A 1 401 ? 2.400   3.272   13.878  1.00 17.56  ? 658  GLU A O     1 
ATOM   2866 C  CB    . GLU A 1 401 ? 5.523   3.570   14.921  1.00 19.42  ? 658  GLU A CB    1 
ATOM   2867 C  CG    . GLU A 1 401 ? 6.384   3.797   16.139  1.00 22.27  ? 658  GLU A CG    1 
ATOM   2868 C  CD    . GLU A 1 401 ? 7.401   2.624   16.385  1.00 25.54  ? 658  GLU A CD    1 
ATOM   2869 O  OE1   . GLU A 1 401 ? 7.398   1.517   15.695  1.00 24.64  ? 658  GLU A OE1   1 
ATOM   2870 O  OE2   . GLU A 1 401 ? 8.203   2.805   17.323  1.00 28.46  ? 658  GLU A OE2   1 
ATOM   2871 N  N     . LEU A 1 402 ? 3.709   1.646   13.140  1.00 16.82  ? 659  LEU A N     1 
ATOM   2872 C  CA    . LEU A 1 402 ? 2.815   1.457   11.959  1.00 16.59  ? 659  LEU A CA    1 
ATOM   2873 C  C     . LEU A 1 402 ? 1.488   0.872   12.347  1.00 15.37  ? 659  LEU A C     1 
ATOM   2874 O  O     . LEU A 1 402 ? 0.474   1.113   11.683  1.00 16.24  ? 659  LEU A O     1 
ATOM   2875 C  CB    . LEU A 1 402 ? 3.536   0.614   10.903  1.00 16.06  ? 659  LEU A CB    1 
ATOM   2876 C  CG    . LEU A 1 402 ? 4.698   1.308   10.169  1.00 17.33  ? 659  LEU A CG    1 
ATOM   2877 C  CD1   . LEU A 1 402 ? 5.564   0.343   9.339   1.00 17.89  ? 659  LEU A CD1   1 
ATOM   2878 C  CD2   . LEU A 1 402 ? 4.151   2.441   9.305   1.00 17.15  ? 659  LEU A CD2   1 
ATOM   2879 N  N     . ARG A 1 403 ? 1.466   0.035   13.381  1.00 15.25  ? 660  ARG A N     1 
ATOM   2880 C  CA    . ARG A 1 403 ? 0.192   -0.452  13.877  1.00 14.99  ? 660  ARG A CA    1 
ATOM   2881 C  C     . ARG A 1 403 ? -0.682  0.660   14.432  1.00 14.90  ? 660  ARG A C     1 
ATOM   2882 O  O     . ARG A 1 403 ? -1.910  0.687   14.187  1.00 15.04  ? 660  ARG A O     1 
ATOM   2883 C  CB    . ARG A 1 403 ? 0.399   -1.563  14.937  1.00 15.60  ? 660  ARG A CB    1 
ATOM   2884 C  CG    . ARG A 1 403 ? 0.906   -2.878  14.375  1.00 16.59  ? 660  ARG A CG    1 
ATOM   2885 C  CD    . ARG A 1 403 ? 1.287   -3.883  15.481  1.00 17.75  ? 660  ARG A CD    1 
ATOM   2886 N  NE    . ARG A 1 403 ? 2.017   -4.990  14.875  1.00 18.62  ? 660  ARG A NE    1 
ATOM   2887 C  CZ    . ARG A 1 403 ? 1.482   -6.158  14.543  1.00 19.97  ? 660  ARG A CZ    1 
ATOM   2888 N  NH1   . ARG A 1 403 ? 0.201   -6.422  14.784  1.00 19.38  ? 660  ARG A NH1   1 
ATOM   2889 N  NH2   . ARG A 1 403 ? 2.223   -7.050  13.918  1.00 21.72  ? 660  ARG A NH2   1 
ATOM   2890 N  N     . VAL A 1 404 ? -0.085  1.568   15.188  1.00 15.23  ? 661  VAL A N     1 
ATOM   2891 C  CA    . VAL A 1 404 ? -0.807  2.792   15.634  1.00 15.08  ? 661  VAL A CA    1 
ATOM   2892 C  C     . VAL A 1 404 ? -1.341  3.600   14.459  1.00 15.51  ? 661  VAL A C     1 
ATOM   2893 O  O     . VAL A 1 404 ? -2.515  3.999   14.462  1.00 14.59  ? 661  VAL A O     1 
ATOM   2894 C  CB    . VAL A 1 404 ? 0.082   3.641   16.567  1.00 15.98  ? 661  VAL A CB    1 
ATOM   2895 C  CG1   . VAL A 1 404 ? -0.488  5.051   16.762  1.00 15.72  ? 661  VAL A CG1   1 
ATOM   2896 C  CG2   . VAL A 1 404 ? 0.260   2.876   17.908  1.00 16.33  ? 661  VAL A CG2   1 
ATOM   2897 N  N     . LEU A 1 405 ? -0.494  3.780   13.439  1.00 14.88  ? 662  LEU A N     1 
ATOM   2898 C  CA    . LEU A 1 405 ? -0.901  4.481   12.232  1.00 16.31  ? 662  LEU A CA    1 
ATOM   2899 C  C     . LEU A 1 405 ? -2.104  3.791   11.534  1.00 16.70  ? 662  LEU A C     1 
ATOM   2900 O  O     . LEU A 1 405 ? -3.068  4.467   11.180  1.00 16.95  ? 662  LEU A O     1 
ATOM   2901 C  CB    . LEU A 1 405 ? 0.274   4.630   11.263  1.00 16.60  ? 662  LEU A CB    1 
ATOM   2902 C  CG    . LEU A 1 405 ? -0.098  5.228   9.891   1.00 17.49  ? 662  LEU A CG    1 
ATOM   2903 C  CD1   . LEU A 1 405 ? -0.640  6.621   10.087  1.00 18.19  ? 662  LEU A CD1   1 
ATOM   2904 C  CD2   . LEU A 1 405 ? 1.125   5.289   9.010   1.00 16.92  ? 662  LEU A CD2   1 
ATOM   2905 N  N     . ALA A 1 406 ? -2.037  2.464   11.412  1.00 16.37  ? 663  ALA A N     1 
ATOM   2906 C  CA    . ALA A 1 406 ? -3.148  1.679   10.899  1.00 16.55  ? 663  ALA A CA    1 
ATOM   2907 C  C     . ALA A 1 406 ? -4.429  2.014   11.631  1.00 18.01  ? 663  ALA A C     1 
ATOM   2908 O  O     . ALA A 1 406 ? -5.479  2.241   11.025  1.00 19.60  ? 663  ALA A O     1 
ATOM   2909 C  CB    . ALA A 1 406 ? -2.862  0.186   11.001  1.00 15.25  ? 663  ALA A CB    1 
ATOM   2910 N  N     . HIS A 1 407 ? -4.353  1.984   12.945  1.00 18.63  ? 664  HIS A N     1 
ATOM   2911 C  CA    . HIS A 1 407 ? -5.506  2.270   13.775  1.00 17.99  ? 664  HIS A CA    1 
ATOM   2912 C  C     . HIS A 1 407 ? -5.996  3.685   13.629  1.00 18.63  ? 664  HIS A C     1 
ATOM   2913 O  O     . HIS A 1 407 ? -7.203  3.920   13.516  1.00 18.69  ? 664  HIS A O     1 
ATOM   2914 C  CB    . HIS A 1 407 ? -5.128  1.991   15.212  1.00 18.38  ? 664  HIS A CB    1 
ATOM   2915 C  CG    . HIS A 1 407 ? -6.118  2.494   16.219  1.00 19.15  ? 664  HIS A CG    1 
ATOM   2916 N  ND1   . HIS A 1 407 ? -7.130  1.736   16.669  1.00 19.77  ? 664  HIS A ND1   1 
ATOM   2917 C  CD2   . HIS A 1 407 ? -6.186  3.694   16.900  1.00 20.50  ? 664  HIS A CD2   1 
ATOM   2918 C  CE1   . HIS A 1 407 ? -7.846  2.434   17.569  1.00 20.93  ? 664  HIS A CE1   1 
ATOM   2919 N  NE2   . HIS A 1 407 ? -7.269  3.649   17.703  1.00 20.65  ? 664  HIS A NE2   1 
ATOM   2920 N  N     . ILE A 1 408 ? -5.111  4.663   13.708  1.00 17.99  ? 665  ILE A N     1 
ATOM   2921 C  CA    A ILE A 1 408 ? -5.589  6.022   13.698  0.70 19.62  ? 665  ILE A CA    1 
ATOM   2922 C  CA    B ILE A 1 408 ? -5.517  6.062   13.679  0.30 19.05  ? 665  ILE A CA    1 
ATOM   2923 C  C     . ILE A 1 408 ? -6.054  6.446   12.302  1.00 20.36  ? 665  ILE A C     1 
ATOM   2924 O  O     . ILE A 1 408 ? -6.978  7.216   12.196  1.00 21.04  ? 665  ILE A O     1 
ATOM   2925 C  CB    A ILE A 1 408 ? -4.564  7.033   14.290  0.70 20.79  ? 665  ILE A CB    1 
ATOM   2926 C  CB    B ILE A 1 408 ? -4.349  7.019   14.054  0.30 19.04  ? 665  ILE A CB    1 
ATOM   2927 C  CG1   A ILE A 1 408 ? -3.274  7.091   13.477  0.70 20.62  ? 665  ILE A CG1   1 
ATOM   2928 C  CG1   B ILE A 1 408 ? -3.905  6.802   15.512  0.30 18.55  ? 665  ILE A CG1   1 
ATOM   2929 C  CG2   A ILE A 1 408 ? -4.267  6.689   15.760  0.70 20.07  ? 665  ILE A CG2   1 
ATOM   2930 C  CG2   B ILE A 1 408 ? -4.764  8.478   13.885  0.30 20.04  ? 665  ILE A CG2   1 
ATOM   2931 C  CD1   A ILE A 1 408 ? -2.239  8.029   14.107  0.70 22.45  ? 665  ILE A CD1   1 
ATOM   2932 C  CD1   B ILE A 1 408 ? -2.684  7.605   15.909  0.30 18.74  ? 665  ILE A CD1   1 
ATOM   2933 N  N     . ALA A 1 409 ? -5.442  5.929   11.244  1.00 20.19  ? 666  ALA A N     1 
ATOM   2934 C  CA    . ALA A 1 409 ? -5.839  6.333   9.898   1.00 22.45  ? 666  ALA A CA    1 
ATOM   2935 C  C     . ALA A 1 409 ? -7.030  5.487   9.411   1.00 23.13  ? 666  ALA A C     1 
ATOM   2936 O  O     . ALA A 1 409 ? -7.659  5.852   8.446   1.00 23.80  ? 666  ALA A O     1 
ATOM   2937 C  CB    . ALA A 1 409 ? -4.669  6.214   8.916   1.00 21.17  ? 666  ALA A CB    1 
ATOM   2938 N  N     . GLU A 1 410 ? -7.286  4.345   10.053  1.00 22.99  ? 667  GLU A N     1 
ATOM   2939 C  CA    . GLU A 1 410 ? -8.245  3.348   9.554   1.00 23.66  ? 667  GLU A CA    1 
ATOM   2940 C  C     . GLU A 1 410 ? -7.952  3.042   8.078   1.00 22.76  ? 667  GLU A C     1 
ATOM   2941 O  O     . GLU A 1 410 ? -8.835  3.062   7.234   1.00 22.68  ? 667  GLU A O     1 
ATOM   2942 C  CB    . GLU A 1 410 ? -9.666  3.840   9.762   1.00 27.86  ? 667  GLU A CB    1 
ATOM   2943 C  CG    . GLU A 1 410 ? -9.980  4.024   11.261  1.00 30.61  ? 667  GLU A CG    1 
ATOM   2944 C  CD    . GLU A 1 410 ? -11.395 4.551   11.495  1.00 36.52  ? 667  GLU A CD    1 
ATOM   2945 O  OE1   . GLU A 1 410 ? -12.343 3.760   11.343  1.00 40.31  ? 667  GLU A OE1   1 
ATOM   2946 O  OE2   . GLU A 1 410 ? -11.557 5.749   11.800  1.00 40.22  ? 667  GLU A OE2   1 
ATOM   2947 N  N     . ASP A 1 411 ? -6.683  2.826   7.744   1.00 20.49  ? 668  ASP A N     1 
ATOM   2948 C  CA    . ASP A 1 411 ? -6.345  2.500   6.352   1.00 21.47  ? 668  ASP A CA    1 
ATOM   2949 C  C     . ASP A 1 411 ? -6.634  0.978   6.143   1.00 21.14  ? 668  ASP A C     1 
ATOM   2950 O  O     . ASP A 1 411 ? -6.057  0.156   6.836   1.00 18.85  ? 668  ASP A O     1 
ATOM   2951 C  CB    . ASP A 1 411 ? -4.877  2.780   6.052   1.00 21.65  ? 668  ASP A CB    1 
ATOM   2952 C  CG    . ASP A 1 411 ? -4.551  2.515   4.617   1.00 24.29  ? 668  ASP A CG    1 
ATOM   2953 O  OD1   . ASP A 1 411 ? -4.308  1.334   4.244   1.00 23.34  ? 668  ASP A OD1   1 
ATOM   2954 O  OD2   . ASP A 1 411 ? -4.628  3.468   3.797   1.00 26.83  ? 668  ASP A OD2   1 
ATOM   2955 N  N     . ASP A 1 412 ? -7.556  0.647   5.260   1.00 23.88  ? 669  ASP A N     1 
ATOM   2956 C  CA    . ASP A 1 412 ? -8.037  -0.751  5.110   1.00 25.34  ? 669  ASP A CA    1 
ATOM   2957 C  C     . ASP A 1 412 ? -6.896  -1.678  4.736   1.00 23.19  ? 669  ASP A C     1 
ATOM   2958 O  O     . ASP A 1 412 ? -6.797  -2.776  5.280   1.00 21.92  ? 669  ASP A O     1 
ATOM   2959 C  CB    . ASP A 1 412 ? -9.154  -0.866  4.072   1.00 28.98  ? 669  ASP A CB    1 
ATOM   2960 C  CG    . ASP A 1 412 ? -10.459 -0.220  4.533   1.00 33.81  ? 669  ASP A CG    1 
ATOM   2961 O  OD1   . ASP A 1 412 ? -10.699 -0.041  5.749   1.00 36.32  ? 669  ASP A OD1   1 
ATOM   2962 O  OD2   . ASP A 1 412 ? -11.255 0.107   3.647   1.00 39.74  ? 669  ASP A OD2   1 
ATOM   2963 N  N     . ASN A 1 413 ? -6.010  -1.218  3.850   1.00 22.98  ? 670  ASN A N     1 
ATOM   2964 C  CA    . ASN A 1 413 ? -4.865  -2.018  3.387   1.00 23.42  ? 670  ASN A CA    1 
ATOM   2965 C  C     . ASN A 1 413 ? -3.858  -2.268  4.486   1.00 21.23  ? 670  ASN A C     1 
ATOM   2966 O  O     . ASN A 1 413 ? -3.396  -3.412  4.693   1.00 17.85  ? 670  ASN A O     1 
ATOM   2967 C  CB    . ASN A 1 413 ? -4.200  -1.328  2.175   1.00 26.21  ? 670  ASN A CB    1 
ATOM   2968 C  CG    . ASN A 1 413 ? -3.223  -2.235  1.412   1.00 29.58  ? 670  ASN A CG    1 
ATOM   2969 O  OD1   . ASN A 1 413 ? -3.342  -3.467  1.432   1.00 30.48  ? 670  ASN A OD1   1 
ATOM   2970 N  ND2   . ASN A 1 413 ? -2.286  -1.615  0.666   1.00 29.46  ? 670  ASN A ND2   1 
ATOM   2971 N  N     . LEU A 1 414 ? -3.493  -1.209  5.215   1.00 19.05  ? 671  LEU A N     1 
ATOM   2972 C  CA    . LEU A 1 414 ? -2.580  -1.355  6.296   1.00 19.12  ? 671  LEU A CA    1 
ATOM   2973 C  C     . LEU A 1 414 ? -3.189  -2.184  7.422   1.00 17.58  ? 671  LEU A C     1 
ATOM   2974 O  O     . LEU A 1 414 ? -2.489  -2.969  8.028   1.00 18.71  ? 671  LEU A O     1 
ATOM   2975 C  CB    . LEU A 1 414 ? -2.151  0.035   6.853   1.00 19.28  ? 671  LEU A CB    1 
ATOM   2976 C  CG    . LEU A 1 414 ? -0.814  0.102   7.550   1.00 20.37  ? 671  LEU A CG    1 
ATOM   2977 C  CD1   . LEU A 1 414 ? 0.408   -0.470  6.790   1.00 20.29  ? 671  LEU A CD1   1 
ATOM   2978 C  CD2   . LEU A 1 414 ? -0.520  1.555   7.950   1.00 20.74  ? 671  LEU A CD2   1 
ATOM   2979 N  N     . MET A 1 415 ? -4.472  -1.991  7.733   1.00 18.75  ? 672  MET A N     1 
ATOM   2980 C  CA    . MET A 1 415 ? -5.095  -2.787  8.805   1.00 18.75  ? 672  MET A CA    1 
ATOM   2981 C  C     . MET A 1 415 ? -5.090  -4.238  8.427   1.00 19.23  ? 672  MET A C     1 
ATOM   2982 O  O     . MET A 1 415 ? -4.748  -5.060  9.285   1.00 19.03  ? 672  MET A O     1 
ATOM   2983 C  CB    . MET A 1 415 ? -6.494  -2.321  9.110   1.00 19.86  ? 672  MET A CB    1 
ATOM   2984 C  CG    . MET A 1 415 ? -6.490  -1.007  9.838   1.00 20.71  ? 672  MET A CG    1 
ATOM   2985 S  SD    . MET A 1 415 ? -8.148  -0.542  10.401  1.00 25.50  ? 672  MET A SD    1 
ATOM   2986 C  CE    . MET A 1 415 ? -9.075  -0.167  8.956   1.00 22.99  ? 672  MET A CE    1 
ATOM   2987 N  N     . GLU A 1 416 ? -5.411  -4.547  7.155   1.00 20.49  ? 673  GLU A N     1 
ATOM   2988 C  CA    . GLU A 1 416 ? -5.456  -5.963  6.658   1.00 21.29  ? 673  GLU A CA    1 
ATOM   2989 C  C     . GLU A 1 416 ? -4.059  -6.595  6.796   1.00 21.70  ? 673  GLU A C     1 
ATOM   2990 O  O     . GLU A 1 416 ? -3.926  -7.724  7.287   1.00 21.52  ? 673  GLU A O     1 
ATOM   2991 C  CB    . GLU A 1 416 ? -5.969  -6.086  5.217   1.00 22.89  ? 673  GLU A CB    1 
ATOM   2992 C  CG    . GLU A 1 416 ? -5.977  -7.493  4.597   1.00 23.94  ? 673  GLU A CG    1 
ATOM   2993 C  CD    . GLU A 1 416 ? -7.008  -8.431  5.253   1.00 25.83  ? 673  GLU A CD    1 
ATOM   2994 O  OE1   . GLU A 1 416 ? -7.788  -8.006  6.115   1.00 28.56  ? 673  GLU A OE1   1 
ATOM   2995 O  OE2   . GLU A 1 416 ? -7.040  -9.613  4.935   1.00 27.58  ? 673  GLU A OE2   1 
ATOM   2996 N  N     . ALA A 1 417 ? -3.029  -5.859  6.391   1.00 20.11  ? 674  ALA A N     1 
ATOM   2997 C  CA    . ALA A 1 417 ? -1.661  -6.326  6.518   1.00 19.70  ? 674  ALA A CA    1 
ATOM   2998 C  C     . ALA A 1 417 ? -1.294  -6.773  7.966   1.00 18.28  ? 674  ALA A C     1 
ATOM   2999 O  O     . ALA A 1 417 ? -0.680  -7.864  8.173   1.00 18.18  ? 674  ALA A O     1 
ATOM   3000 C  CB    . ALA A 1 417 ? -0.708  -5.242  6.025   1.00 18.87  ? 674  ALA A CB    1 
ATOM   3001 N  N     . PHE A 1 418 ? -1.592  -5.929  8.961   1.00 16.84  ? 675  PHE A N     1 
ATOM   3002 C  CA    . PHE A 1 418 ? -1.318  -6.279  10.341  1.00 17.19  ? 675  PHE A CA    1 
ATOM   3003 C  C     . PHE A 1 418 ? -2.251  -7.384  10.869  1.00 18.40  ? 675  PHE A C     1 
ATOM   3004 O  O     . PHE A 1 418 ? -1.812  -8.238  11.643  1.00 18.88  ? 675  PHE A O     1 
ATOM   3005 C  CB    . PHE A 1 418 ? -1.308  -5.025  11.221  1.00 15.50  ? 675  PHE A CB    1 
ATOM   3006 C  CG    . PHE A 1 418 ? -0.067  -4.202  11.026  1.00 15.29  ? 675  PHE A CG    1 
ATOM   3007 C  CD1   . PHE A 1 418 ? 1.175   -4.765  11.230  1.00 15.66  ? 675  PHE A CD1   1 
ATOM   3008 C  CD2   . PHE A 1 418 ? -0.135  -2.887  10.585  1.00 16.70  ? 675  PHE A CD2   1 
ATOM   3009 C  CE1   . PHE A 1 418 ? 2.312   -4.060  10.997  1.00 16.03  ? 675  PHE A CE1   1 
ATOM   3010 C  CE2   . PHE A 1 418 ? 1.011   -2.144  10.428  1.00 15.53  ? 675  PHE A CE2   1 
ATOM   3011 C  CZ    . PHE A 1 418 ? 2.235   -2.739  10.616  1.00 16.34  ? 675  PHE A CZ    1 
ATOM   3012 N  N     . ARG A 1 419 ? -3.508  -7.439  10.386  1.00 18.98  ? 676  ARG A N     1 
ATOM   3013 C  CA    . ARG A 1 419 ? -4.377  -8.516  10.799  1.00 19.98  ? 676  ARG A CA    1 
ATOM   3014 C  C     . ARG A 1 419 ? -3.878  -9.861  10.302  1.00 20.44  ? 676  ARG A C     1 
ATOM   3015 O  O     . ARG A 1 419 ? -4.134  -10.914 10.914  1.00 20.89  ? 676  ARG A O     1 
ATOM   3016 C  CB    . ARG A 1 419 ? -5.803  -8.236  10.363  1.00 21.74  ? 676  ARG A CB    1 
ATOM   3017 C  CG    . ARG A 1 419 ? -6.367  -7.057  11.082  1.00 22.15  ? 676  ARG A CG    1 
ATOM   3018 C  CD    . ARG A 1 419 ? -7.764  -6.714  10.578  1.00 25.64  ? 676  ARG A CD    1 
ATOM   3019 N  NE    . ARG A 1 419 ? -8.330  -5.670  11.418  1.00 27.50  ? 676  ARG A NE    1 
ATOM   3020 C  CZ    . ARG A 1 419 ? -9.312  -4.835  11.052  1.00 31.02  ? 676  ARG A CZ    1 
ATOM   3021 N  NH1   . ARG A 1 419 ? -9.831  -4.856  9.824   1.00 32.62  ? 676  ARG A NH1   1 
ATOM   3022 N  NH2   . ARG A 1 419 ? -9.776  -3.965  11.926  1.00 31.81  ? 676  ARG A NH2   1 
ATOM   3023 N  N     . ARG A 1 420 ? -3.156  -9.851  9.193   1.00 20.08  ? 677  ARG A N     1 
ATOM   3024 C  CA    . ARG A 1 420 ? -2.552  -11.043 8.668   1.00 21.82  ? 677  ARG A CA    1 
ATOM   3025 C  C     . ARG A 1 420 ? -1.127  -11.271 9.183   1.00 21.61  ? 677  ARG A C     1 
ATOM   3026 O  O     . ARG A 1 420 ? -0.492  -12.260 8.815   1.00 22.56  ? 677  ARG A O     1 
ATOM   3027 C  CB    . ARG A 1 420 ? -2.455  -10.958 7.160   1.00 23.67  ? 677  ARG A CB    1 
ATOM   3028 C  CG    . ARG A 1 420 ? -3.753  -11.023 6.390   1.00 24.70  ? 677  ARG A CG    1 
ATOM   3029 C  CD    . ARG A 1 420 ? -3.414  -10.926 4.902   1.00 26.11  ? 677  ARG A CD    1 
ATOM   3030 N  NE    . ARG A 1 420 ? -4.573  -10.589 4.090   1.00 28.34  ? 677  ARG A NE    1 
ATOM   3031 C  CZ    . ARG A 1 420 ? -4.581  -10.590 2.754   1.00 30.07  ? 677  ARG A CZ    1 
ATOM   3032 N  NH1   . ARG A 1 420 ? -3.501  -10.953 2.074   1.00 29.84  ? 677  ARG A NH1   1 
ATOM   3033 N  NH2   . ARG A 1 420 ? -5.700  -10.291 2.109   1.00 30.99  ? 677  ARG A NH2   1 
ATOM   3034 N  N     . ASP A 1 421 ? -0.667  -10.401 10.065  1.00 21.31  ? 678  ASP A N     1 
ATOM   3035 C  CA    . ASP A 1 421 ? 0.697   -10.413 10.567  1.00 23.09  ? 678  ASP A CA    1 
ATOM   3036 C  C     . ASP A 1 421 ? 1.774   -10.541 9.481   1.00 23.25  ? 678  ASP A C     1 
ATOM   3037 O  O     . ASP A 1 421 ? 2.735   -11.313 9.635   1.00 23.69  ? 678  ASP A O     1 
ATOM   3038 C  CB    . ASP A 1 421 ? 0.893   -11.483 11.633  1.00 25.72  ? 678  ASP A CB    1 
ATOM   3039 C  CG    . ASP A 1 421 ? 2.192   -11.261 12.447  1.00 27.32  ? 678  ASP A CG    1 
ATOM   3040 O  OD1   . ASP A 1 421 ? 2.606   -10.077 12.630  1.00 28.65  ? 678  ASP A OD1   1 
ATOM   3041 O  OD2   . ASP A 1 421 ? 2.779   -12.259 12.895  1.00 29.55  ? 678  ASP A OD2   1 
ATOM   3042 N  N     . LEU A 1 422 ? 1.602   -9.774  8.392   1.00 22.03  ? 679  LEU A N     1 
ATOM   3043 C  CA    . LEU A 1 422 ? 2.496   -9.812  7.253   1.00 22.93  ? 679  LEU A CA    1 
ATOM   3044 C  C     . LEU A 1 422 ? 3.802   -9.144  7.635   1.00 22.22  ? 679  LEU A C     1 
ATOM   3045 O  O     . LEU A 1 422 ? 3.833   -8.306  8.535   1.00 21.53  ? 679  LEU A O     1 
ATOM   3046 C  CB    . LEU A 1 422 ? 1.906   -9.043  6.045   1.00 22.74  ? 679  LEU A CB    1 
ATOM   3047 C  CG    . LEU A 1 422 ? 0.711   -9.702  5.365   1.00 24.41  ? 679  LEU A CG    1 
ATOM   3048 C  CD1   . LEU A 1 422 ? 0.275   -9.002  4.060   1.00 24.57  ? 679  LEU A CD1   1 
ATOM   3049 C  CD2   . LEU A 1 422 ? 1.054   -11.166 5.047   1.00 26.13  ? 679  LEU A CD2   1 
ATOM   3050 N  N     . ASP A 1 423 ? 4.862   -9.478  6.907   1.00 22.75  ? 680  ASP A N     1 
ATOM   3051 C  CA    . ASP A 1 423 ? 6.093   -8.680  6.916   1.00 23.02  ? 680  ASP A CA    1 
ATOM   3052 C  C     . ASP A 1 423 ? 5.764   -7.341  6.234   1.00 20.77  ? 680  ASP A C     1 
ATOM   3053 O  O     . ASP A 1 423 ? 5.477   -7.297  5.029   1.00 19.21  ? 680  ASP A O     1 
ATOM   3054 C  CB    . ASP A 1 423 ? 7.164   -9.385  6.125   1.00 25.93  ? 680  ASP A CB    1 
ATOM   3055 C  CG    . ASP A 1 423 ? 8.447   -8.577  6.038   1.00 29.85  ? 680  ASP A CG    1 
ATOM   3056 O  OD1   . ASP A 1 423 ? 8.443   -7.330  5.884   1.00 29.89  ? 680  ASP A OD1   1 
ATOM   3057 O  OD2   . ASP A 1 423 ? 9.495   -9.204  6.094   1.00 35.17  ? 680  ASP A OD2   1 
ATOM   3058 N  N     . ILE A 1 424 ? 5.764   -6.271  7.012   1.00 17.86  ? 681  ILE A N     1 
ATOM   3059 C  CA    . ILE A 1 424 ? 5.181   -5.038  6.539   1.00 18.66  ? 681  ILE A CA    1 
ATOM   3060 C  C     . ILE A 1 424 ? 6.050   -4.407  5.455   1.00 18.22  ? 681  ILE A C     1 
ATOM   3061 O  O     . ILE A 1 424 ? 5.539   -3.688  4.620   1.00 20.56  ? 681  ILE A O     1 
ATOM   3062 C  CB    . ILE A 1 424 ? 4.901   -4.068  7.726   1.00 18.59  ? 681  ILE A CB    1 
ATOM   3063 C  CG1   . ILE A 1 424 ? 4.089   -2.841  7.308   1.00 19.35  ? 681  ILE A CG1   1 
ATOM   3064 C  CG2   . ILE A 1 424 ? 6.203   -3.586  8.367   1.00 18.85  ? 681  ILE A CG2   1 
ATOM   3065 C  CD1   . ILE A 1 424 ? 2.832   -3.165  6.514   1.00 21.30  ? 681  ILE A CD1   1 
ATOM   3066 N  N     . HIS A 1 425 ? 7.364   -4.609  5.535   1.00 18.09  ? 682  HIS A N     1 
ATOM   3067 C  CA    . HIS A 1 425 ? 8.287   -4.118  4.517   1.00 18.88  ? 682  HIS A CA    1 
ATOM   3068 C  C     . HIS A 1 425 ? 8.145   -4.773  3.164   1.00 18.91  ? 682  HIS A C     1 
ATOM   3069 O  O     . HIS A 1 425 ? 8.147   -4.084  2.122   1.00 17.55  ? 682  HIS A O     1 
ATOM   3070 C  CB    . HIS A 1 425 ? 9.723   -4.201  5.017   1.00 20.20  ? 682  HIS A CB    1 
ATOM   3071 C  CG    . HIS A 1 425 ? 9.955   -3.451  6.306   1.00 19.74  ? 682  HIS A CG    1 
ATOM   3072 N  ND1   . HIS A 1 425 ? 9.374   -2.267  6.567   1.00 19.17  ? 682  HIS A ND1   1 
ATOM   3073 C  CD2   . HIS A 1 425 ? 10.730  -3.762  7.420   1.00 19.70  ? 682  HIS A CD2   1 
ATOM   3074 C  CE1   . HIS A 1 425 ? 9.757   -1.839  7.782   1.00 19.53  ? 682  HIS A CE1   1 
ATOM   3075 N  NE2   . HIS A 1 425 ? 10.587  -2.755  8.304   1.00 19.94  ? 682  HIS A NE2   1 
ATOM   3076 N  N     . THR A 1 426 ? 7.998   -6.096  3.153   1.00 18.27  ? 683  THR A N     1 
ATOM   3077 C  CA    . THR A 1 426 ? 7.685   -6.832  1.917   1.00 19.71  ? 683  THR A CA    1 
ATOM   3078 C  C     . THR A 1 426 ? 6.346   -6.448  1.310   1.00 19.56  ? 683  THR A C     1 
ATOM   3079 O  O     . THR A 1 426 ? 6.235   -6.248  0.099   1.00 19.83  ? 683  THR A O     1 
ATOM   3080 C  CB    . THR A 1 426 ? 7.778   -8.336  2.204   1.00 19.69  ? 683  THR A CB    1 
ATOM   3081 O  OG1   . THR A 1 426 ? 9.130   -8.544  2.640   1.00 20.69  ? 683  THR A OG1   1 
ATOM   3082 C  CG2   . THR A 1 426 ? 7.436   -9.142  1.016   1.00 21.50  ? 683  THR A CG2   1 
ATOM   3083 N  N     . LYS A 1 427 ? 5.332   -6.356  2.173   1.00 19.91  ? 684  LYS A N     1 
ATOM   3084 C  CA    . LYS A 1 427 ? 3.984   -6.014  1.727   1.00 20.26  ? 684  LYS A CA    1 
ATOM   3085 C  C     . LYS A 1 427 ? 3.986   -4.590  1.146   1.00 19.87  ? 684  LYS A C     1 
ATOM   3086 O  O     . LYS A 1 427 ? 3.407   -4.368  0.119   1.00 20.87  ? 684  LYS A O     1 
ATOM   3087 C  CB    . LYS A 1 427 ? 3.006   -6.092  2.890   1.00 21.28  ? 684  LYS A CB    1 
ATOM   3088 C  CG    . LYS A 1 427 ? 1.679   -5.385  2.644   1.00 22.61  ? 684  LYS A CG    1 
ATOM   3089 C  CD    . LYS A 1 427 ? 0.896   -6.052  1.556   1.00 26.20  ? 684  LYS A CD    1 
ATOM   3090 C  CE    . LYS A 1 427 ? -0.518  -5.428  1.539   1.00 29.65  ? 684  LYS A CE    1 
ATOM   3091 N  NZ    . LYS A 1 427 ? -1.160  -5.613  0.229   1.00 31.90  ? 684  LYS A NZ    1 
ATOM   3092 N  N     . THR A 1 428 ? 4.676   -3.651  1.779   1.00 18.46  ? 685  THR A N     1 
ATOM   3093 C  CA    . THR A 1 428 ? 4.769   -2.293  1.248   1.00 19.63  ? 685  THR A CA    1 
ATOM   3094 C  C     . THR A 1 428 ? 5.484   -2.260  -0.115  1.00 19.93  ? 685  THR A C     1 
ATOM   3095 O  O     . THR A 1 428 ? 5.000   -1.592  -1.035  1.00 21.39  ? 685  THR A O     1 
ATOM   3096 C  CB    . THR A 1 428 ? 5.419   -1.350  2.270   1.00 18.95  ? 685  THR A CB    1 
ATOM   3097 O  OG1   . THR A 1 428 ? 4.616   -1.335  3.454   1.00 20.06  ? 685  THR A OG1   1 
ATOM   3098 C  CG2   . THR A 1 428 ? 5.516   0.083   1.757   1.00 19.52  ? 685  THR A CG2   1 
ATOM   3099 N  N     . ALA A 1 429 ? 6.564   -3.052  -0.263  1.00 20.13  ? 686  ALA A N     1 
ATOM   3100 C  CA    . ALA A 1 429 ? 7.231   -3.226  -1.560  1.00 21.00  ? 686  ALA A CA    1 
ATOM   3101 C  C     . ALA A 1 429 ? 6.289   -3.776  -2.632  1.00 22.31  ? 686  ALA A C     1 
ATOM   3102 O  O     . ALA A 1 429 ? 6.262   -3.299  -3.799  1.00 22.33  ? 686  ALA A O     1 
ATOM   3103 C  CB    . ALA A 1 429 ? 8.467   -4.129  -1.428  1.00 19.84  ? 686  ALA A CB    1 
ATOM   3104 N  N     . MET A 1 430 ? 5.530   -4.812  -2.276  1.00 22.52  ? 687  MET A N     1 
ATOM   3105 C  CA    . MET A 1 430 ? 4.629   -5.433  -3.247  1.00 24.12  ? 687  MET A CA    1 
ATOM   3106 C  C     . MET A 1 430 ? 3.630   -4.394  -3.788  1.00 25.91  ? 687  MET A C     1 
ATOM   3107 O  O     . MET A 1 430 ? 3.339   -4.367  -4.996  1.00 26.53  ? 687  MET A O     1 
ATOM   3108 C  CB    . MET A 1 430 ? 3.866   -6.581  -2.608  1.00 25.76  ? 687  MET A CB    1 
ATOM   3109 C  CG    . MET A 1 430 ? 4.709   -7.829  -2.397  1.00 27.64  ? 687  MET A CG    1 
ATOM   3110 S  SD    . MET A 1 430 ? 3.870   -8.980  -1.295  1.00 30.65  ? 687  MET A SD    1 
ATOM   3111 C  CE    . MET A 1 430 ? 2.425   -9.436  -2.286  1.00 30.81  ? 687  MET A CE    1 
ATOM   3112 N  N     . ASP A 1 431 ? 3.114   -3.558  -2.889  1.00 24.80  ? 688  ASP A N     1 
ATOM   3113 C  CA    . ASP A 1 431 ? 2.119   -2.554  -3.254  1.00 27.92  ? 688  ASP A CA    1 
ATOM   3114 C  C     . ASP A 1 431 ? 2.713   -1.398  -4.055  1.00 28.16  ? 688  ASP A C     1 
ATOM   3115 O  O     . ASP A 1 431 ? 2.196   -1.058  -5.097  1.00 30.48  ? 688  ASP A O     1 
ATOM   3116 C  CB    . ASP A 1 431 ? 1.409   -2.023  -2.031  1.00 28.55  ? 688  ASP A CB    1 
ATOM   3117 C  CG    . ASP A 1 431 ? 0.465   -3.057  -1.389  1.00 31.90  ? 688  ASP A CG    1 
ATOM   3118 O  OD1   . ASP A 1 431 ? -0.022  -3.953  -2.070  1.00 35.53  ? 688  ASP A OD1   1 
ATOM   3119 O  OD2   . ASP A 1 431 ? 0.199   -2.937  -0.188  1.00 37.73  ? 688  ASP A OD2   1 
ATOM   3120 N  N     . ILE A 1 432 ? 3.813   -0.839  -3.591  1.00 26.93  ? 689  ILE A N     1 
ATOM   3121 C  CA    . ILE A 1 432 ? 4.407   0.291   -4.252  1.00 29.37  ? 689  ILE A CA    1 
ATOM   3122 C  C     . ILE A 1 432 ? 4.921   -0.094  -5.634  1.00 31.56  ? 689  ILE A C     1 
ATOM   3123 O  O     . ILE A 1 432 ? 4.721   0.635   -6.606  1.00 32.99  ? 689  ILE A O     1 
ATOM   3124 C  CB    . ILE A 1 432 ? 5.572   0.837   -3.418  1.00 29.73  ? 689  ILE A CB    1 
ATOM   3125 C  CG1   . ILE A 1 432 ? 5.069   1.654   -2.248  1.00 29.10  ? 689  ILE A CG1   1 
ATOM   3126 C  CG2   . ILE A 1 432 ? 6.479   1.695   -4.266  1.00 31.09  ? 689  ILE A CG2   1 
ATOM   3127 C  CD1   . ILE A 1 432 ? 6.260   2.128   -1.426  1.00 31.86  ? 689  ILE A CD1   1 
ATOM   3128 N  N     . PHE A 1 433 ? 5.597   -1.231  -5.736  1.00 30.90  ? 690  PHE A N     1 
ATOM   3129 C  CA    . PHE A 1 433 ? 6.136   -1.662  -7.050  1.00 33.51  ? 690  PHE A CA    1 
ATOM   3130 C  C     . PHE A 1 433 ? 5.180   -2.510  -7.856  1.00 35.71  ? 690  PHE A C     1 
ATOM   3131 O  O     . PHE A 1 433 ? 5.472   -2.843  -8.988  1.00 37.67  ? 690  PHE A O     1 
ATOM   3132 C  CB    . PHE A 1 433 ? 7.460   -2.389  -6.865  1.00 32.96  ? 690  PHE A CB    1 
ATOM   3133 C  CG    . PHE A 1 433 ? 8.460   -1.590  -6.099  1.00 32.40  ? 690  PHE A CG    1 
ATOM   3134 C  CD1   . PHE A 1 433 ? 8.977   -0.420  -6.625  1.00 35.06  ? 690  PHE A CD1   1 
ATOM   3135 C  CD2   . PHE A 1 433 ? 8.889   -2.002  -4.851  1.00 30.44  ? 690  PHE A CD2   1 
ATOM   3136 C  CE1   . PHE A 1 433 ? 9.880   0.328   -5.895  1.00 34.65  ? 690  PHE A CE1   1 
ATOM   3137 C  CE2   . PHE A 1 433 ? 9.812   -1.273  -4.137  1.00 31.10  ? 690  PHE A CE2   1 
ATOM   3138 C  CZ    . PHE A 1 433 ? 10.296  -0.097  -4.645  1.00 32.76  ? 690  PHE A CZ    1 
ATOM   3139 N  N     . GLN A 1 434 ? 4.022   -2.846  -7.288  1.00 36.44  ? 691  GLN A N     1 
ATOM   3140 C  CA    . GLN A 1 434 ? 3.027   -3.667  -7.969  1.00 39.55  ? 691  GLN A CA    1 
ATOM   3141 C  C     . GLN A 1 434 ? 3.571   -4.998  -8.433  1.00 39.07  ? 691  GLN A C     1 
ATOM   3142 O  O     . GLN A 1 434 ? 3.347   -5.393  -9.580  1.00 40.48  ? 691  GLN A O     1 
ATOM   3143 C  CB    . GLN A 1 434 ? 2.407   -2.952  -9.182  1.00 45.67  ? 691  GLN A CB    1 
ATOM   3144 C  CG    . GLN A 1 434 ? 1.863   -1.559  -8.925  1.00 48.70  ? 691  GLN A CG    1 
ATOM   3145 C  CD    . GLN A 1 434 ? 1.831   -0.674  -10.195 1.00 54.84  ? 691  GLN A CD    1 
ATOM   3146 O  OE1   . GLN A 1 434 ? 1.629   0.546   -10.105 1.00 57.99  ? 691  GLN A OE1   1 
ATOM   3147 N  NE2   . GLN A 1 434 ? 2.041   -1.281  -11.376 1.00 58.19  ? 691  GLN A NE2   1 
ATOM   3148 N  N     . VAL A 1 435 ? 4.236   -5.713  -7.539  1.00 36.21  ? 692  VAL A N     1 
ATOM   3149 C  CA    . VAL A 1 435 ? 4.738   -7.061  -7.845  1.00 36.28  ? 692  VAL A CA    1 
ATOM   3150 C  C     . VAL A 1 435 ? 4.215   -8.076  -6.828  1.00 35.21  ? 692  VAL A C     1 
ATOM   3151 O  O     . VAL A 1 435 ? 3.754   -7.695  -5.747  1.00 31.95  ? 692  VAL A O     1 
ATOM   3152 C  CB    . VAL A 1 435 ? 6.262   -7.085  -7.832  1.00 34.85  ? 692  VAL A CB    1 
ATOM   3153 C  CG1   . VAL A 1 435 ? 6.804   -6.105  -8.882  1.00 36.67  ? 692  VAL A CG1   1 
ATOM   3154 C  CG2   . VAL A 1 435 ? 6.788   -6.764  -6.449  1.00 32.60  ? 692  VAL A CG2   1 
ATOM   3155 N  N     . SER A 1 436 ? 4.316   -9.360  -7.176  1.00 35.85  ? 693  SER A N     1 
ATOM   3156 C  CA    . SER A 1 436 ? 3.960   -10.441 -6.263  1.00 36.73  ? 693  SER A CA    1 
ATOM   3157 C  C     . SER A 1 436 ? 5.090   -10.603 -5.266  1.00 36.16  ? 693  SER A C     1 
ATOM   3158 O  O     . SER A 1 436 ? 6.188   -10.085 -5.481  1.00 35.10  ? 693  SER A O     1 
ATOM   3159 C  CB    . SER A 1 436 ? 3.718   -11.747 -7.021  1.00 39.29  ? 693  SER A CB    1 
ATOM   3160 O  OG    . SER A 1 436 ? 4.818   -12.027 -7.854  1.00 40.55  ? 693  SER A OG    1 
ATOM   3161 N  N     . GLU A 1 437 ? 4.829   -11.333 -4.191  1.00 35.50  ? 694  GLU A N     1 
ATOM   3162 C  CA    . GLU A 1 437 ? 5.793   -11.532 -3.137  1.00 35.42  ? 694  GLU A CA    1 
ATOM   3163 C  C     . GLU A 1 437 ? 7.099   -12.150 -3.637  1.00 36.02  ? 694  GLU A C     1 
ATOM   3164 O  O     . GLU A 1 437 ? 8.181   -11.689 -3.277  1.00 32.26  ? 694  GLU A O     1 
ATOM   3165 C  CB    . GLU A 1 437 ? 5.215   -12.405 -2.019  1.00 37.99  ? 694  GLU A CB    1 
ATOM   3166 C  CG    . GLU A 1 437 ? 6.204   -12.622 -0.870  1.00 39.93  ? 694  GLU A CG    1 
ATOM   3167 C  CD    . GLU A 1 437 ? 5.585   -13.338 0.335   1.00 44.03  ? 694  GLU A CD    1 
ATOM   3168 O  OE1   . GLU A 1 437 ? 4.453   -13.846 0.236   1.00 53.21  ? 694  GLU A OE1   1 
ATOM   3169 O  OE2   . GLU A 1 437 ? 6.240   -13.415 1.381   1.00 46.24  ? 694  GLU A OE2   1 
ATOM   3170 N  N     . ASP A 1 438 ? 7.020   -13.162 -4.470  1.00 37.63  ? 695  ASP A N     1 
ATOM   3171 C  CA    . ASP A 1 438 ? 8.254   -13.762 -4.969  1.00 41.18  ? 695  ASP A CA    1 
ATOM   3172 C  C     . ASP A 1 438 ? 9.030   -12.880 -5.991  1.00 38.89  ? 695  ASP A C     1 
ATOM   3173 O  O     . ASP A 1 438 ? 10.123  -13.238 -6.380  1.00 40.25  ? 695  ASP A O     1 
ATOM   3174 C  CB    . ASP A 1 438 ? 7.988   -15.175 -5.516  1.00 47.49  ? 695  ASP A CB    1 
ATOM   3175 C  CG    . ASP A 1 438 ? 7.327   -15.174 -6.875  1.00 52.74  ? 695  ASP A CG    1 
ATOM   3176 O  OD1   . ASP A 1 438 ? 6.987   -14.092 -7.397  1.00 57.28  ? 695  ASP A OD1   1 
ATOM   3177 O  OD2   . ASP A 1 438 ? 7.142   -16.276 -7.440  1.00 61.07  ? 695  ASP A OD2   1 
ATOM   3178 N  N     . GLU A 1 439 ? 8.459   -11.765 -6.441  1.00 36.21  ? 696  GLU A N     1 
ATOM   3179 C  CA    . GLU A 1 439 ? 9.194   -10.792 -7.257  1.00 36.11  ? 696  GLU A CA    1 
ATOM   3180 C  C     . GLU A 1 439 ? 9.831   -9.649  -6.453  1.00 31.81  ? 696  GLU A C     1 
ATOM   3181 O  O     . GLU A 1 439 ? 10.481  -8.776  -7.027  1.00 30.86  ? 696  GLU A O     1 
ATOM   3182 C  CB    . GLU A 1 439 ? 8.258   -10.181 -8.285  1.00 38.92  ? 696  GLU A CB    1 
ATOM   3183 C  CG    . GLU A 1 439 ? 7.840   -11.157 -9.362  1.00 43.74  ? 696  GLU A CG    1 
ATOM   3184 C  CD    . GLU A 1 439 ? 6.721   -10.605 -10.214 1.00 46.63  ? 696  GLU A CD    1 
ATOM   3185 O  OE1   . GLU A 1 439 ? 5.727   -10.072 -9.674  1.00 47.89  ? 696  GLU A OE1   1 
ATOM   3186 O  OE2   . GLU A 1 439 ? 6.833   -10.715 -11.433 1.00 51.92  ? 696  GLU A OE2   1 
ATOM   3187 N  N     . VAL A 1 440 ? 9.627   -9.611  -5.140  1.00 27.53  ? 697  VAL A N     1 
ATOM   3188 C  CA    . VAL A 1 440 ? 10.245  -8.552  -4.310  1.00 24.95  ? 697  VAL A CA    1 
ATOM   3189 C  C     . VAL A 1 440 ? 11.731  -8.882  -4.154  1.00 24.65  ? 697  VAL A C     1 
ATOM   3190 O  O     . VAL A 1 440 ? 12.094  -9.866  -3.561  1.00 24.24  ? 697  VAL A O     1 
ATOM   3191 C  CB    . VAL A 1 440 ? 9.597   -8.404  -2.917  1.00 23.85  ? 697  VAL A CB    1 
ATOM   3192 C  CG1   . VAL A 1 440 ? 10.316  -7.365  -2.042  1.00 22.00  ? 697  VAL A CG1   1 
ATOM   3193 C  CG2   . VAL A 1 440 ? 8.135   -8.005  -3.073  1.00 23.48  ? 697  VAL A CG2   1 
ATOM   3194 N  N     . THR A 1 441 ? 12.583  -8.038  -4.687  1.00 23.07  ? 698  THR A N     1 
ATOM   3195 C  CA    . THR A 1 441 ? 14.001  -8.236  -4.535  1.00 22.92  ? 698  THR A CA    1 
ATOM   3196 C  C     . THR A 1 441 ? 14.481  -7.628  -3.231  1.00 21.66  ? 698  THR A C     1 
ATOM   3197 O  O     . THR A 1 441 ? 13.784  -6.781  -2.616  1.00 20.83  ? 698  THR A O     1 
ATOM   3198 C  CB    . THR A 1 441 ? 14.752  -7.544  -5.716  1.00 24.26  ? 698  THR A CB    1 
ATOM   3199 O  OG1   . THR A 1 441 ? 14.421  -6.155  -5.658  1.00 23.81  ? 698  THR A OG1   1 
ATOM   3200 C  CG2   . THR A 1 441 ? 14.398  -8.142  -7.113  1.00 25.28  ? 698  THR A CG2   1 
ATOM   3201 N  N     . PRO A 1 442 ? 15.684  -7.986  -2.779  1.00 21.92  ? 699  PRO A N     1 
ATOM   3202 C  CA    . PRO A 1 442 ? 16.187  -7.330  -1.570  1.00 21.41  ? 699  PRO A CA    1 
ATOM   3203 C  C     . PRO A 1 442 ? 16.258  -5.801  -1.634  1.00 21.06  ? 699  PRO A C     1 
ATOM   3204 O  O     . PRO A 1 442 ? 15.871  -5.126  -0.656  1.00 19.59  ? 699  PRO A O     1 
ATOM   3205 C  CB    . PRO A 1 442 ? 17.557  -7.928  -1.403  1.00 22.73  ? 699  PRO A CB    1 
ATOM   3206 C  CG    . PRO A 1 442 ? 17.372  -9.347  -1.919  1.00 23.84  ? 699  PRO A CG    1 
ATOM   3207 C  CD    . PRO A 1 442 ? 16.561  -9.098  -3.191  1.00 23.69  ? 699  PRO A CD    1 
ATOM   3208 N  N     . ASN A 1 443 ? 16.649  -5.237  -2.784  1.00 22.21  ? 700  ASN A N     1 
ATOM   3209 C  CA    . ASN A 1 443 ? 16.702  -3.771  -2.893  1.00 22.64  ? 700  ASN A CA    1 
ATOM   3210 C  C     . ASN A 1 443 ? 15.300  -3.145  -2.807  1.00 22.14  ? 700  ASN A C     1 
ATOM   3211 O  O     . ASN A 1 443 ? 15.115  -2.027  -2.273  1.00 21.08  ? 700  ASN A O     1 
ATOM   3212 C  CB    . ASN A 1 443 ? 17.432  -3.291  -4.163  1.00 24.02  ? 700  ASN A CB    1 
ATOM   3213 C  CG    . ASN A 1 443 ? 17.998  -1.886  -4.022  1.00 25.14  ? 700  ASN A CG    1 
ATOM   3214 O  OD1   . ASN A 1 443 ? 18.488  -1.509  -2.966  1.00 25.39  ? 700  ASN A OD1   1 
ATOM   3215 N  ND2   . ASN A 1 443 ? 17.925  -1.115  -5.077  1.00 25.52  ? 700  ASN A ND2   1 
ATOM   3216 N  N     . MET A 1 444 ? 14.308  -3.819  -3.368  1.00 22.86  ? 701  MET A N     1 
ATOM   3217 C  CA    . MET A 1 444 ? 12.930  -3.313  -3.304  1.00 23.31  ? 701  MET A CA    1 
ATOM   3218 C  C     . MET A 1 444 ? 12.476  -3.270  -1.872  1.00 22.16  ? 701  MET A C     1 
ATOM   3219 O  O     . MET A 1 444 ? 11.889  -2.270  -1.461  1.00 23.24  ? 701  MET A O     1 
ATOM   3220 C  CB    . MET A 1 444 ? 11.952  -4.149  -4.126  1.00 25.01  ? 701  MET A CB    1 
ATOM   3221 C  CG    . MET A 1 444 ? 12.198  -4.001  -5.619  1.00 28.65  ? 701  MET A CG    1 
ATOM   3222 S  SD    . MET A 1 444 ? 11.452  -5.293  -6.645  1.00 34.50  ? 701  MET A SD    1 
ATOM   3223 C  CE    . MET A 1 444 ? 9.835   -5.151  -6.064  1.00 29.99  ? 701  MET A CE    1 
ATOM   3224 N  N     . ARG A 1 445 ? 12.755  -4.322  -1.113  1.00 21.30  ? 702  ARG A N     1 
ATOM   3225 C  CA    . ARG A 1 445 ? 12.376  -4.323  0.282   1.00 20.97  ? 702  ARG A CA    1 
ATOM   3226 C  C     . ARG A 1 445 ? 13.098  -3.258  1.102   1.00 21.11  ? 702  ARG A C     1 
ATOM   3227 O  O     . ARG A 1 445 ? 12.486  -2.619  1.966   1.00 20.25  ? 702  ARG A O     1 
ATOM   3228 C  CB    . ARG A 1 445 ? 12.583  -5.702  0.899   1.00 22.18  ? 702  ARG A CB    1 
ATOM   3229 C  CG    . ARG A 1 445 ? 11.999  -5.812  2.307   1.00 22.28  ? 702  ARG A CG    1 
ATOM   3230 C  CD    . ARG A 1 445 ? 12.279  -7.164  2.913   1.00 24.59  ? 702  ARG A CD    1 
ATOM   3231 N  NE    . ARG A 1 445 ? 11.659  -7.369  4.214   1.00 25.38  ? 702  ARG A NE    1 
ATOM   3232 C  CZ    . ARG A 1 445 ? 12.177  -6.962  5.352   1.00 26.21  ? 702  ARG A CZ    1 
ATOM   3233 N  NH1   . ARG A 1 445 ? 13.290  -6.256  5.363   1.00 27.50  ? 702  ARG A NH1   1 
ATOM   3234 N  NH2   . ARG A 1 445 ? 11.567  -7.238  6.485   1.00 27.30  ? 702  ARG A NH2   1 
ATOM   3235 N  N     . ARG A 1 446 ? 14.379  -3.033  0.827   1.00 22.07  ? 703  ARG A N     1 
ATOM   3236 C  CA    . ARG A 1 446 ? 15.140  -2.012  1.513   1.00 23.86  ? 703  ARG A CA    1 
ATOM   3237 C  C     . ARG A 1 446 ? 14.538  -0.621  1.277   1.00 24.52  ? 703  ARG A C     1 
ATOM   3238 O  O     . ARG A 1 446 ? 14.369  0.165   2.222   1.00 23.77  ? 703  ARG A O     1 
ATOM   3239 C  CB    . ARG A 1 446 ? 16.599  -2.049  1.074   1.00 26.76  ? 703  ARG A CB    1 
ATOM   3240 C  CG    . ARG A 1 446 ? 17.444  -0.940  1.703   1.00 29.12  ? 703  ARG A CG    1 
ATOM   3241 C  CD    . ARG A 1 446 ? 18.885  -1.064  1.230   1.00 30.82  ? 703  ARG A CD    1 
ATOM   3242 N  NE    . ARG A 1 446 ? 18.940  -0.571  -0.135  1.00 32.07  ? 703  ARG A NE    1 
ATOM   3243 C  CZ    . ARG A 1 446 ? 18.973  0.723   -0.501  1.00 34.70  ? 703  ARG A CZ    1 
ATOM   3244 N  NH1   . ARG A 1 446 ? 18.993  1.715   0.404   1.00 34.71  ? 703  ARG A NH1   1 
ATOM   3245 N  NH2   . ARG A 1 446 ? 18.998  1.035   -1.791  1.00 34.14  ? 703  ARG A NH2   1 
ATOM   3246 N  N     . GLN A 1 447 ? 14.199  -0.321  0.026   1.00 24.25  ? 704  GLN A N     1 
ATOM   3247 C  CA    . GLN A 1 447 ? 13.575  0.948   -0.286  1.00 24.69  ? 704  GLN A CA    1 
ATOM   3248 C  C     . GLN A 1 447 ? 12.183  1.127   0.334   1.00 23.27  ? 704  GLN A C     1 
ATOM   3249 O  O     . GLN A 1 447 ? 11.874  2.213   0.860   1.00 22.26  ? 704  GLN A O     1 
ATOM   3250 C  CB    . GLN A 1 447 ? 13.604  1.193   -1.781  1.00 27.33  ? 704  GLN A CB    1 
ATOM   3251 C  CG    . GLN A 1 447 ? 15.064  1.266   -2.282  1.00 29.57  ? 704  GLN A CG    1 
ATOM   3252 C  CD    . GLN A 1 447 ? 15.140  1.811   -3.687  1.00 33.65  ? 704  GLN A CD    1 
ATOM   3253 O  OE1   . GLN A 1 447 ? 15.713  2.854   -3.932  1.00 38.58  ? 704  GLN A OE1   1 
ATOM   3254 N  NE2   . GLN A 1 447 ? 14.464  1.161   -4.582  1.00 37.57  ? 704  GLN A NE2   1 
ATOM   3255 N  N     . ALA A 1 448 ? 11.359  0.089   0.311   1.00 21.83  ? 705  ALA A N     1 
ATOM   3256 C  CA    . ALA A 1 448 ? 10.082  0.120   1.054   1.00 21.25  ? 705  ALA A CA    1 
ATOM   3257 C  C     . ALA A 1 448 ? 10.252  0.372   2.553   1.00 21.69  ? 705  ALA A C     1 
ATOM   3258 O  O     . ALA A 1 448 ? 9.445   1.086   3.146   1.00 22.58  ? 705  ALA A O     1 
ATOM   3259 C  CB    . ALA A 1 448 ? 9.313   -1.166  0.864   1.00 19.73  ? 705  ALA A CB    1 
ATOM   3260 N  N     . LYS A 1 449 ? 11.251  -0.263  3.159   1.00 21.92  ? 706  LYS A N     1 
ATOM   3261 C  CA    . LYS A 1 449 ? 11.523  -0.139  4.567   1.00 22.40  ? 706  LYS A CA    1 
ATOM   3262 C  C     . LYS A 1 449 ? 11.904  1.300   4.872   1.00 23.88  ? 706  LYS A C     1 
ATOM   3263 O  O     . LYS A 1 449 ? 11.495  1.853   5.932   1.00 24.34  ? 706  LYS A O     1 
ATOM   3264 C  CB    . LYS A 1 449 ? 12.624  -1.119  4.987   1.00 23.79  ? 706  LYS A CB    1 
ATOM   3265 C  CG    . LYS A 1 449 ? 13.035  -1.050  6.451   1.00 25.01  ? 706  LYS A CG    1 
ATOM   3266 C  CD    . LYS A 1 449 ? 13.970  -2.203  6.807   1.00 27.53  ? 706  LYS A CD    1 
ATOM   3267 C  CE    . LYS A 1 449 ? 14.434  -2.054  8.260   1.00 29.50  ? 706  LYS A CE    1 
ATOM   3268 N  NZ    . LYS A 1 449 ? 15.293  -3.172  8.720   1.00 31.33  ? 706  LYS A NZ    1 
ATOM   3269 N  N     . ALA A 1 450 ? 12.671  1.916   3.962   1.00 23.41  ? 707  ALA A N     1 
ATOM   3270 C  CA    . ALA A 1 450 ? 13.062  3.319   4.064   1.00 24.39  ? 707  ALA A CA    1 
ATOM   3271 C  C     . ALA A 1 450 ? 11.865  4.248   4.027   1.00 25.16  ? 707  ALA A C     1 
ATOM   3272 O  O     . ALA A 1 450 ? 11.811  5.216   4.837   1.00 25.45  ? 707  ALA A O     1 
ATOM   3273 C  CB    . ALA A 1 450 ? 14.110  3.718   2.999   1.00 26.17  ? 707  ALA A CB    1 
ATOM   3274 N  N     . VAL A 1 451 ? 10.903  3.968   3.147   1.00 23.76  ? 708  VAL A N     1 
ATOM   3275 C  CA    . VAL A 1 451 ? 9.660   4.726   3.109   1.00 24.80  ? 708  VAL A CA    1 
ATOM   3276 C  C     . VAL A 1 451 ? 8.934   4.572   4.458   1.00 25.32  ? 708  VAL A C     1 
ATOM   3277 O  O     . VAL A 1 451 ? 8.551   5.570   5.088   1.00 26.43  ? 708  VAL A O     1 
ATOM   3278 C  CB    . VAL A 1 451 ? 8.762   4.332   1.901   1.00 24.93  ? 708  VAL A CB    1 
ATOM   3279 C  CG1   . VAL A 1 451 ? 7.445   5.077   1.910   1.00 26.05  ? 708  VAL A CG1   1 
ATOM   3280 C  CG2   . VAL A 1 451 ? 9.474   4.624   0.582   1.00 25.89  ? 708  VAL A CG2   1 
ATOM   3281 N  N     . ASN A 1 452 ? 8.815   3.350   4.937   1.00 22.76  ? 709  ASN A N     1 
ATOM   3282 C  CA    . ASN A 1 452 ? 8.159   3.101   6.220   1.00 23.37  ? 709  ASN A CA    1 
ATOM   3283 C  C     . ASN A 1 452 ? 8.844   3.823   7.387   1.00 25.10  ? 709  ASN A C     1 
ATOM   3284 O  O     . ASN A 1 452 ? 8.175   4.415   8.242   1.00 25.08  ? 709  ASN A O     1 
ATOM   3285 C  CB    . ASN A 1 452 ? 8.040   1.610   6.518   1.00 21.69  ? 709  ASN A CB    1 
ATOM   3286 C  CG    . ASN A 1 452 ? 6.951   0.931   5.684   1.00 22.38  ? 709  ASN A CG    1 
ATOM   3287 O  OD1   . ASN A 1 452 ? 5.979   1.574   5.309   1.00 23.38  ? 709  ASN A OD1   1 
ATOM   3288 N  ND2   . ASN A 1 452 ? 7.088   -0.395  5.452   1.00 19.55  ? 709  ASN A ND2   1 
ATOM   3289 N  N     . PHE A 1 453 ? 10.167  3.811   7.397   1.00 26.16  ? 710  PHE A N     1 
ATOM   3290 C  CA    . PHE A 1 453 ? 10.944  4.492   8.414   1.00 27.87  ? 710  PHE A CA    1 
ATOM   3291 C  C     . PHE A 1 453 ? 10.671  5.983   8.377   1.00 29.04  ? 710  PHE A C     1 
ATOM   3292 O  O     . PHE A 1 453 ? 10.554  6.661   9.440   1.00 28.51  ? 710  PHE A O     1 
ATOM   3293 C  CB    . PHE A 1 453 ? 12.427  4.206   8.205   1.00 30.79  ? 710  PHE A CB    1 
ATOM   3294 C  CG    . PHE A 1 453 ? 13.338  4.937   9.156   1.00 36.73  ? 710  PHE A CG    1 
ATOM   3295 C  CD1   . PHE A 1 453 ? 13.822  6.228   8.842   1.00 40.46  ? 710  PHE A CD1   1 
ATOM   3296 C  CD2   . PHE A 1 453 ? 13.770  4.332   10.335  1.00 38.12  ? 710  PHE A CD2   1 
ATOM   3297 C  CE1   . PHE A 1 453 ? 14.693  6.907   9.709   1.00 43.54  ? 710  PHE A CE1   1 
ATOM   3298 C  CE2   . PHE A 1 453 ? 14.651  5.004   11.198  1.00 42.82  ? 710  PHE A CE2   1 
ATOM   3299 C  CZ    . PHE A 1 453 ? 15.104  6.294   10.891  1.00 43.69  ? 710  PHE A CZ    1 
ATOM   3300 N  N     . GLY A 1 454 ? 10.580  6.519   7.170   1.00 29.09  ? 711  GLY A N     1 
ATOM   3301 C  CA    . GLY A 1 454 ? 10.235  7.903   6.995   1.00 30.70  ? 711  GLY A CA    1 
ATOM   3302 C  C     . GLY A 1 454 ? 8.885   8.260   7.591   1.00 30.45  ? 711  GLY A C     1 
ATOM   3303 O  O     . GLY A 1 454 ? 8.689   9.340   8.172   1.00 30.39  ? 711  GLY A O     1 
ATOM   3304 N  N     . ILE A 1 455 ? 7.934   7.376   7.394   1.00 28.87  ? 712  ILE A N     1 
ATOM   3305 C  CA    . ILE A 1 455 ? 6.605   7.548   7.970   1.00 29.79  ? 712  ILE A CA    1 
ATOM   3306 C  C     . ILE A 1 455 ? 6.674   7.467   9.499   1.00 29.38  ? 712  ILE A C     1 
ATOM   3307 O  O     . ILE A 1 455 ? 6.170   8.326   10.172  1.00 31.97  ? 712  ILE A O     1 
ATOM   3308 C  CB    . ILE A 1 455 ? 5.639   6.561   7.290   1.00 32.01  ? 712  ILE A CB    1 
ATOM   3309 C  CG1   . ILE A 1 455 ? 5.414   7.034   5.848   1.00 31.85  ? 712  ILE A CG1   1 
ATOM   3310 C  CG2   . ILE A 1 455 ? 4.324   6.384   8.062   1.00 33.55  ? 712  ILE A CG2   1 
ATOM   3311 C  CD1   . ILE A 1 455 ? 4.757   5.994   5.004   1.00 33.47  ? 712  ILE A CD1   1 
ATOM   3312 N  N     . VAL A 1 456 ? 7.385   6.502   10.069  1.00 29.68  ? 713  VAL A N     1 
ATOM   3313 C  CA    . VAL A 1 456 ? 7.476   6.366   11.540  1.00 28.30  ? 713  VAL A CA    1 
ATOM   3314 C  C     . VAL A 1 456 ? 8.183   7.588   12.184  1.00 30.23  ? 713  VAL A C     1 
ATOM   3315 O  O     . VAL A 1 456 ? 7.806   8.002   13.254  1.00 29.89  ? 713  VAL A O     1 
ATOM   3316 C  CB    . VAL A 1 456 ? 8.200   5.044   11.957  1.00 28.25  ? 713  VAL A CB    1 
ATOM   3317 C  CG1   . VAL A 1 456 ? 8.558   5.027   13.472  1.00 27.06  ? 713  VAL A CG1   1 
ATOM   3318 C  CG2   . VAL A 1 456 ? 7.333   3.829   11.556  1.00 26.35  ? 713  VAL A CG2   1 
ATOM   3319 N  N     . TYR A 1 457 ? 9.178   8.175   11.528  1.00 30.09  ? 714  TYR A N     1 
ATOM   3320 C  CA    . TYR A 1 457 ? 9.967   9.258   12.129  1.00 34.05  ? 714  TYR A CA    1 
ATOM   3321 C  C     . TYR A 1 457 ? 9.689   10.663  11.577  1.00 34.14  ? 714  TYR A C     1 
ATOM   3322 O  O     . TYR A 1 457 ? 10.263  11.656  12.075  1.00 36.38  ? 714  TYR A O     1 
ATOM   3323 C  CB    . TYR A 1 457 ? 11.434  8.913   12.065  1.00 36.16  ? 714  TYR A CB    1 
ATOM   3324 C  CG    . TYR A 1 457 ? 11.717  7.739   12.962  1.00 38.77  ? 714  TYR A CG    1 
ATOM   3325 C  CD1   . TYR A 1 457 ? 11.593  7.855   14.355  1.00 41.09  ? 714  TYR A CD1   1 
ATOM   3326 C  CD2   . TYR A 1 457 ? 12.065  6.489   12.429  1.00 41.04  ? 714  TYR A CD2   1 
ATOM   3327 C  CE1   . TYR A 1 457 ? 11.812  6.769   15.186  1.00 41.87  ? 714  TYR A CE1   1 
ATOM   3328 C  CE2   . TYR A 1 457 ? 12.287  5.397   13.253  1.00 41.02  ? 714  TYR A CE2   1 
ATOM   3329 C  CZ    . TYR A 1 457 ? 12.165  5.550   14.625  1.00 43.48  ? 714  TYR A CZ    1 
ATOM   3330 O  OH    . TYR A 1 457 ? 12.391  4.478   15.425  1.00 47.96  ? 714  TYR A OH    1 
ATOM   3331 N  N     . GLY A 1 458 ? 8.771   10.750  10.616  1.00 31.60  ? 715  GLY A N     1 
ATOM   3332 C  CA    . GLY A 1 458 ? 8.366   12.038  10.047  1.00 33.78  ? 715  GLY A CA    1 
ATOM   3333 C  C     . GLY A 1 458 ? 9.497   12.744  9.316   1.00 36.33  ? 715  GLY A C     1 
ATOM   3334 O  O     . GLY A 1 458 ? 9.687   13.944  9.475   1.00 38.08  ? 715  GLY A O     1 
ATOM   3335 N  N     . ILE A 1 459 ? 10.269  11.990  8.517   1.00 35.61  ? 716  ILE A N     1 
ATOM   3336 C  CA    A ILE A 1 459 ? 11.348  12.612  7.721   0.50 37.76  ? 716  ILE A CA    1 
ATOM   3337 C  CA    B ILE A 1 459 ? 11.348  12.541  7.681   0.50 38.54  ? 716  ILE A CA    1 
ATOM   3338 C  C     . ILE A 1 459 ? 10.733  13.248  6.465   1.00 38.67  ? 716  ILE A C     1 
ATOM   3339 O  O     . ILE A 1 459 ? 9.637   12.866  6.020   1.00 38.01  ? 716  ILE A O     1 
ATOM   3340 C  CB    A ILE A 1 459 ? 12.496  11.615  7.365   0.50 36.62  ? 716  ILE A CB    1 
ATOM   3341 C  CB    B ILE A 1 459 ? 12.285  11.374  7.247   0.50 38.02  ? 716  ILE A CB    1 
ATOM   3342 C  CG1   A ILE A 1 459 ? 12.190  10.787  6.104   0.50 34.31  ? 716  ILE A CG1   1 
ATOM   3343 C  CG1   B ILE A 1 459 ? 13.427  11.225  8.256   0.50 39.32  ? 716  ILE A CG1   1 
ATOM   3344 C  CG2   A ILE A 1 459 ? 12.791  10.681  8.540   0.50 35.27  ? 716  ILE A CG2   1 
ATOM   3345 C  CG2   B ILE A 1 459 ? 12.818  11.534  5.835   0.50 38.80  ? 716  ILE A CG2   1 
ATOM   3346 C  CD1   A ILE A 1 459 ? 13.246  9.741   5.790   0.50 32.97  ? 716  ILE A CD1   1 
ATOM   3347 C  CD1   B ILE A 1 459 ? 12.992  10.585  9.550   0.50 37.98  ? 716  ILE A CD1   1 
ATOM   3348 N  N     . SER A 1 460 ? 11.424  14.232  5.911   1.00 42.83  ? 717  SER A N     1 
ATOM   3349 C  CA    . SER A 1 460 ? 10.983  14.925  4.691   1.00 45.22  ? 717  SER A CA    1 
ATOM   3350 C  C     . SER A 1 460 ? 11.275  14.082  3.458   1.00 46.46  ? 717  SER A C     1 
ATOM   3351 O  O     . SER A 1 460 ? 11.968  13.059  3.561   1.00 42.17  ? 717  SER A O     1 
ATOM   3352 C  CB    . SER A 1 460 ? 11.671  16.292  4.553   1.00 49.17  ? 717  SER A CB    1 
ATOM   3353 O  OG    . SER A 1 460 ? 13.087  16.203  4.609   1.00 49.59  ? 717  SER A OG    1 
ATOM   3354 N  N     . ASP A 1 461 ? 10.744  14.503  2.296   1.00 50.46  ? 718  ASP A N     1 
ATOM   3355 C  CA    . ASP A 1 461 ? 11.154  13.909  1.003   1.00 50.45  ? 718  ASP A CA    1 
ATOM   3356 C  C     . ASP A 1 461 ? 12.677  14.091  0.743   1.00 49.40  ? 718  ASP A C     1 
ATOM   3357 O  O     . ASP A 1 461 ? 13.316  13.216  0.146   1.00 48.30  ? 718  ASP A O     1 
ATOM   3358 C  CB    . ASP A 1 461 ? 10.291  14.408  -0.196  1.00 53.21  ? 718  ASP A CB    1 
ATOM   3359 C  CG    . ASP A 1 461 ? 10.339  15.914  -0.402  1.00 59.81  ? 718  ASP A CG    1 
ATOM   3360 O  OD1   . ASP A 1 461 ? 10.771  16.664  0.507   1.00 65.51  ? 718  ASP A OD1   1 
ATOM   3361 O  OD2   . ASP A 1 461 ? 9.918   16.374  -1.491  1.00 63.55  ? 718  ASP A OD2   1 
ATOM   3362 N  N     . TYR A 1 462 ? 13.251  15.198  1.208   1.00 50.54  ? 719  TYR A N     1 
ATOM   3363 C  CA    . TYR A 1 462 ? 14.701  15.439  1.122   1.00 52.19  ? 719  TYR A CA    1 
ATOM   3364 C  C     . TYR A 1 462 ? 15.412  14.419  1.965   1.00 49.14  ? 719  TYR A C     1 
ATOM   3365 O  O     . TYR A 1 462 ? 16.406  13.817  1.557   1.00 46.80  ? 719  TYR A O     1 
ATOM   3366 C  CB    . TYR A 1 462 ? 15.094  16.785  1.722   1.00 57.47  ? 719  TYR A CB    1 
ATOM   3367 C  CG    . TYR A 1 462 ? 14.852  17.999  0.873   1.00 63.05  ? 719  TYR A CG    1 
ATOM   3368 C  CD1   . TYR A 1 462 ? 15.825  18.474  0.010   1.00 66.25  ? 719  TYR A CD1   1 
ATOM   3369 C  CD2   . TYR A 1 462 ? 13.656  18.722  0.990   1.00 66.15  ? 719  TYR A CD2   1 
ATOM   3370 C  CE1   . TYR A 1 462 ? 15.607  19.633  -0.741  1.00 71.04  ? 719  TYR A CE1   1 
ATOM   3371 C  CE2   . TYR A 1 462 ? 13.424  19.866  0.242   1.00 68.98  ? 719  TYR A CE2   1 
ATOM   3372 C  CZ    . TYR A 1 462 ? 14.400  20.319  -0.616  1.00 71.79  ? 719  TYR A CZ    1 
ATOM   3373 O  OH    . TYR A 1 462 ? 14.151  21.455  -1.345  1.00 76.77  ? 719  TYR A OH    1 
ATOM   3374 N  N     . GLY A 1 463 ? 14.893  14.248  3.176   1.00 46.75  ? 720  GLY A N     1 
ATOM   3375 C  CA    . GLY A 1 463 ? 15.402  13.234  4.088   1.00 44.72  ? 720  GLY A CA    1 
ATOM   3376 C  C     . GLY A 1 463 ? 15.350  11.859  3.461   1.00 40.83  ? 720  GLY A C     1 
ATOM   3377 O  O     . GLY A 1 463 ? 16.306  11.112  3.593   1.00 39.93  ? 720  GLY A O     1 
ATOM   3378 N  N     . LEU A 1 464 ? 14.248  11.544  2.771   1.00 38.30  ? 721  LEU A N     1 
ATOM   3379 C  CA    . LEU A 1 464 ? 14.070  10.234  2.160   1.00 36.94  ? 721  LEU A CA    1 
ATOM   3380 C  C     . LEU A 1 464 ? 15.057  10.064  1.004   1.00 37.83  ? 721  LEU A C     1 
ATOM   3381 O  O     . LEU A 1 464 ? 15.691  9.012   0.896   1.00 38.13  ? 721  LEU A O     1 
ATOM   3382 C  CB    . LEU A 1 464 ? 12.621  9.993   1.658   1.00 35.50  ? 721  LEU A CB    1 
ATOM   3383 C  CG    . LEU A 1 464 ? 12.402  8.595   1.013   1.00 33.74  ? 721  LEU A CG    1 
ATOM   3384 C  CD1   . LEU A 1 464 ? 12.540  7.475   2.042   1.00 31.58  ? 721  LEU A CD1   1 
ATOM   3385 C  CD2   . LEU A 1 464 ? 11.076  8.439   0.277   1.00 32.56  ? 721  LEU A CD2   1 
ATOM   3386 N  N     . ALA A 1 465 ? 15.116  11.070  0.129   1.00 38.72  ? 722  ALA A N     1 
ATOM   3387 C  CA    . ALA A 1 465 ? 16.132  11.191  -0.917  1.00 40.92  ? 722  ALA A CA    1 
ATOM   3388 C  C     . ALA A 1 465 ? 17.543  10.916  -0.399  1.00 42.42  ? 722  ALA A C     1 
ATOM   3389 O  O     . ALA A 1 465 ? 18.304  10.168  -1.005  1.00 41.73  ? 722  ALA A O     1 
ATOM   3390 C  CB    . ALA A 1 465 ? 16.077  12.590  -1.528  1.00 42.69  ? 722  ALA A CB    1 
ATOM   3391 N  N     . GLN A 1 466 ? 17.873  11.547  0.723   1.00 44.82  ? 723  GLN A N     1 
ATOM   3392 C  CA    . GLN A 1 466 ? 19.176  11.445  1.368   1.00 47.36  ? 723  GLN A CA    1 
ATOM   3393 C  C     . GLN A 1 466 ? 19.375  10.025  1.884   1.00 45.83  ? 723  GLN A C     1 
ATOM   3394 O  O     . GLN A 1 466 ? 20.406  9.400   1.615   1.00 46.23  ? 723  GLN A O     1 
ATOM   3395 C  CB    . GLN A 1 466 ? 19.265  12.505  2.498   1.00 51.50  ? 723  GLN A CB    1 
ATOM   3396 C  CG    . GLN A 1 466 ? 20.441  12.406  3.454   1.00 54.37  ? 723  GLN A CG    1 
ATOM   3397 C  CD    . GLN A 1 466 ? 20.520  13.587  4.422   1.00 58.59  ? 723  GLN A CD    1 
ATOM   3398 O  OE1   . GLN A 1 466 ? 21.557  14.235  4.522   1.00 65.01  ? 723  GLN A OE1   1 
ATOM   3399 N  NE2   . GLN A 1 466 ? 19.429  13.866  5.144   1.00 59.17  ? 723  GLN A NE2   1 
ATOM   3400 N  N     . ASN A 1 467 ? 18.377  9.486   2.583   1.00 42.55  ? 724  ASN A N     1 
ATOM   3401 C  CA    . ASN A 1 467 ? 18.492  8.132   3.095   1.00 40.88  ? 724  ASN A CA    1 
ATOM   3402 C  C     . ASN A 1 467 ? 18.605  7.063   1.978   1.00 39.60  ? 724  ASN A C     1 
ATOM   3403 O  O     . ASN A 1 467 ? 19.172  5.997   2.215   1.00 40.39  ? 724  ASN A O     1 
ATOM   3404 C  CB    . ASN A 1 467 ? 17.306  7.796   4.010   1.00 39.27  ? 724  ASN A CB    1 
ATOM   3405 C  CG    . ASN A 1 467 ? 17.328  8.596   5.314   1.00 40.92  ? 724  ASN A CG    1 
ATOM   3406 O  OD1   . ASN A 1 467 ? 18.310  9.286   5.625   1.00 41.87  ? 724  ASN A OD1   1 
ATOM   3407 N  ND2   . ASN A 1 467 ? 16.246  8.502   6.081   1.00 37.92  ? 724  ASN A ND2   1 
ATOM   3408 N  N     . LEU A 1 468 ? 18.064  7.330   0.783   1.00 37.61  ? 725  LEU A N     1 
ATOM   3409 C  CA    . LEU A 1 468 ? 18.064  6.318   -0.292  1.00 36.12  ? 725  LEU A CA    1 
ATOM   3410 C  C     . LEU A 1 468 ? 19.063  6.651   -1.387  1.00 38.21  ? 725  LEU A C     1 
ATOM   3411 O  O     . LEU A 1 468 ? 19.148  5.933   -2.389  1.00 37.95  ? 725  LEU A O     1 
ATOM   3412 C  CB    . LEU A 1 468 ? 16.655  6.153   -0.908  1.00 34.14  ? 725  LEU A CB    1 
ATOM   3413 C  CG    . LEU A 1 468 ? 15.684  5.349   -0.040  1.00 32.04  ? 725  LEU A CG    1 
ATOM   3414 C  CD1   . LEU A 1 468 ? 14.300  5.254   -0.662  1.00 30.73  ? 725  LEU A CD1   1 
ATOM   3415 C  CD2   . LEU A 1 468 ? 16.275  3.971   0.239   1.00 31.09  ? 725  LEU A CD2   1 
ATOM   3416 N  N     . ASN A 1 469 ? 19.811  7.732   -1.203  1.00 40.17  ? 726  ASN A N     1 
ATOM   3417 C  CA    . ASN A 1 469 ? 20.730  8.229   -2.221  1.00 43.05  ? 726  ASN A CA    1 
ATOM   3418 C  C     . ASN A 1 469 ? 20.087  8.348   -3.615  1.00 41.48  ? 726  ASN A C     1 
ATOM   3419 O  O     . ASN A 1 469 ? 20.641  7.902   -4.613  1.00 40.51  ? 726  ASN A O     1 
ATOM   3420 C  CB    . ASN A 1 469 ? 21.991  7.358   -2.266  1.00 45.43  ? 726  ASN A CB    1 
ATOM   3421 C  CG    . ASN A 1 469 ? 23.110  8.017   -3.035  1.00 49.67  ? 726  ASN A CG    1 
ATOM   3422 O  OD1   . ASN A 1 469 ? 23.162  9.257   -3.160  1.00 55.00  ? 726  ASN A OD1   1 
ATOM   3423 N  ND2   . ASN A 1 469 ? 24.010  7.205   -3.586  1.00 52.53  ? 726  ASN A ND2   1 
ATOM   3424 N  N     . ILE A 1 470 ? 18.910  8.952   -3.663  1.00 39.87  ? 727  ILE A N     1 
ATOM   3425 C  CA    . ILE A 1 470 ? 18.199  9.189   -4.918  1.00 40.89  ? 727  ILE A CA    1 
ATOM   3426 C  C     . ILE A 1 470 ? 17.858  10.648  -4.985  1.00 42.31  ? 727  ILE A C     1 
ATOM   3427 O  O     . ILE A 1 470 ? 18.093  11.363  -4.023  1.00 43.17  ? 727  ILE A O     1 
ATOM   3428 C  CB    . ILE A 1 470 ? 16.908  8.348   -5.044  1.00 38.42  ? 727  ILE A CB    1 
ATOM   3429 C  CG1   . ILE A 1 470 ? 15.911  8.676   -3.884  1.00 38.37  ? 727  ILE A CG1   1 
ATOM   3430 C  CG2   . ILE A 1 470 ? 17.273  6.878   -5.122  1.00 36.70  ? 727  ILE A CG2   1 
ATOM   3431 C  CD1   . ILE A 1 470 ? 14.629  7.853   -3.856  1.00 35.32  ? 727  ILE A CD1   1 
ATOM   3432 N  N     . SER A 1 471 ? 17.291  11.089  -6.095  1.00 43.90  ? 728  SER A N     1 
ATOM   3433 C  CA    . SER A 1 471 ? 16.887  12.476  -6.225  1.00 47.36  ? 728  SER A CA    1 
ATOM   3434 C  C     . SER A 1 471 ? 15.608  12.778  -5.438  1.00 46.98  ? 728  SER A C     1 
ATOM   3435 O  O     . SER A 1 471 ? 14.822  11.878  -5.121  1.00 43.14  ? 728  SER A O     1 
ATOM   3436 C  CB    . SER A 1 471 ? 16.683  12.834  -7.699  1.00 49.87  ? 728  SER A CB    1 
ATOM   3437 O  OG    . SER A 1 471 ? 15.588  12.089  -8.199  1.00 49.10  ? 728  SER A OG    1 
ATOM   3438 N  N     . ARG A 1 472 ? 15.410  14.059  -5.128  1.00 50.49  ? 729  ARG A N     1 
ATOM   3439 C  CA    . ARG A 1 472 ? 14.205  14.519  -4.459  1.00 52.26  ? 729  ARG A CA    1 
ATOM   3440 C  C     . ARG A 1 472 ? 12.957  14.129  -5.239  1.00 51.38  ? 729  ARG A C     1 
ATOM   3441 O  O     . ARG A 1 472 ? 11.960  13.685  -4.650  1.00 49.51  ? 729  ARG A O     1 
ATOM   3442 C  CB    . ARG A 1 472 ? 14.218  16.039  -4.227  1.00 57.68  ? 729  ARG A CB    1 
ATOM   3443 C  CG    . ARG A 1 472 ? 13.145  16.482  -3.215  1.00 60.08  ? 729  ARG A CG    1 
ATOM   3444 C  CD    . ARG A 1 472 ? 12.986  17.996  -3.064  1.00 65.40  ? 729  ARG A CD    1 
ATOM   3445 N  NE    . ARG A 1 472 ? 13.426  18.781  -4.225  1.00 71.97  ? 729  ARG A NE    1 
ATOM   3446 C  CZ    . ARG A 1 472 ? 12.876  18.755  -5.449  1.00 75.45  ? 729  ARG A CZ    1 
ATOM   3447 N  NH1   . ARG A 1 472 ? 11.846  17.940  -5.718  1.00 74.38  ? 729  ARG A NH1   1 
ATOM   3448 N  NH2   . ARG A 1 472 ? 13.379  19.529  -6.423  1.00 76.98  ? 729  ARG A NH2   1 
ATOM   3449 N  N     . LYS A 1 473 ? 13.031  14.299  -6.551  1.00 53.76  ? 730  LYS A N     1 
ATOM   3450 C  CA    . LYS A 1 473 ? 11.955  13.952  -7.479  1.00 54.43  ? 730  LYS A CA    1 
ATOM   3451 C  C     . LYS A 1 473 ? 11.538  12.496  -7.360  1.00 51.26  ? 730  LYS A C     1 
ATOM   3452 O  O     . LYS A 1 473 ? 10.351  12.180  -7.243  1.00 48.73  ? 730  LYS A O     1 
ATOM   3453 C  CB    . LYS A 1 473 ? 12.424  14.213  -8.903  1.00 57.70  ? 730  LYS A CB    1 
ATOM   3454 C  CG    . LYS A 1 473 ? 11.339  14.097  -9.960  1.00 59.75  ? 730  LYS A CG    1 
ATOM   3455 C  CD    . LYS A 1 473 ? 11.734  14.866  -11.228 1.00 63.79  ? 730  LYS A CD    1 
ATOM   3456 C  CE    . LYS A 1 473 ? 10.527  15.358  -12.024 1.00 66.10  ? 730  LYS A CE    1 
ATOM   3457 N  NZ    . LYS A 1 473 ? 10.905  16.343  -13.069 1.00 69.70  ? 730  LYS A NZ    1 
ATOM   3458 N  N     . GLU A 1 474 ? 12.528  11.609  -7.397  1.00 50.03  ? 731  GLU A N     1 
ATOM   3459 C  CA    . GLU A 1 474 ? 12.275  10.177  -7.255  1.00 46.91  ? 731  GLU A CA    1 
ATOM   3460 C  C     . GLU A 1 474 ? 11.691  9.840   -5.897  1.00 42.92  ? 731  GLU A C     1 
ATOM   3461 O  O     . GLU A 1 474 ? 10.840  8.963   -5.806  1.00 40.43  ? 731  GLU A O     1 
ATOM   3462 C  CB    . GLU A 1 474 ? 13.556  9.373   -7.511  1.00 48.04  ? 731  GLU A CB    1 
ATOM   3463 C  CG    . GLU A 1 474 ? 13.947  9.413   -8.966  1.00 52.55  ? 731  GLU A CG    1 
ATOM   3464 C  CD    . GLU A 1 474 ? 15.258  8.717   -9.297  1.00 54.69  ? 731  GLU A CD    1 
ATOM   3465 O  OE1   . GLU A 1 474 ? 16.334  9.054   -8.719  1.00 56.20  ? 731  GLU A OE1   1 
ATOM   3466 O  OE2   . GLU A 1 474 ? 15.198  7.865   -10.202 1.00 56.01  ? 731  GLU A OE2   1 
ATOM   3467 N  N     . ALA A 1 475 ? 12.146  10.531  -4.850  1.00 41.02  ? 732  ALA A N     1 
ATOM   3468 C  CA    . ALA A 1 475 ? 11.628  10.296  -3.517  1.00 40.21  ? 732  ALA A CA    1 
ATOM   3469 C  C     . ALA A 1 475 ? 10.142  10.718  -3.441  1.00 39.86  ? 732  ALA A C     1 
ATOM   3470 O  O     . ALA A 1 475 ? 9.303   10.004  -2.844  1.00 36.28  ? 732  ALA A O     1 
ATOM   3471 C  CB    . ALA A 1 475 ? 12.487  11.005  -2.478  1.00 40.15  ? 732  ALA A CB    1 
ATOM   3472 N  N     . ALA A 1 476 ? 9.813   11.824  -4.107  1.00 42.26  ? 733  ALA A N     1 
ATOM   3473 C  CA    . ALA A 1 476 ? 8.416   12.313  -4.195  1.00 42.86  ? 733  ALA A CA    1 
ATOM   3474 C  C     . ALA A 1 476 ? 7.547   11.274  -4.913  1.00 42.72  ? 733  ALA A C     1 
ATOM   3475 O  O     . ALA A 1 476 ? 6.430   10.977  -4.472  1.00 40.11  ? 733  ALA A O     1 
ATOM   3476 C  CB    . ALA A 1 476 ? 8.343   13.670  -4.905  1.00 45.86  ? 733  ALA A CB    1 
ATOM   3477 N  N     . GLU A 1 477 ? 8.079   10.701  -5.998  1.00 43.78  ? 734  GLU A N     1 
ATOM   3478 C  CA    . GLU A 1 477 ? 7.442   9.569   -6.683  1.00 43.32  ? 734  GLU A CA    1 
ATOM   3479 C  C     . GLU A 1 477 ? 7.190   8.346   -5.763  1.00 40.06  ? 734  GLU A C     1 
ATOM   3480 O  O     . GLU A 1 477 ? 6.123   7.722   -5.813  1.00 40.20  ? 734  GLU A O     1 
ATOM   3481 C  CB    . GLU A 1 477 ? 8.313   9.129   -7.867  1.00 45.93  ? 734  GLU A CB    1 
ATOM   3482 C  CG    . GLU A 1 477 ? 8.262   10.071  -9.051  1.00 51.17  ? 734  GLU A CG    1 
ATOM   3483 C  CD    . GLU A 1 477 ? 9.200   9.657   -10.183 1.00 53.53  ? 734  GLU A CD    1 
ATOM   3484 O  OE1   . GLU A 1 477 ? 9.758   8.540   -10.165 1.00 55.33  ? 734  GLU A OE1   1 
ATOM   3485 O  OE2   . GLU A 1 477 ? 9.381   10.454  -11.110 1.00 57.37  ? 734  GLU A OE2   1 
ATOM   3486 N  N     . PHE A 1 478 ? 8.153   7.993   -4.925  1.00 44.63  ? 735  PHE A N     1 
ATOM   3487 C  CA    . PHE A 1 478 ? 7.945   6.883   -4.005  1.00 42.67  ? 735  PHE A CA    1 
ATOM   3488 C  C     . PHE A 1 478 ? 6.765   7.184   -3.085  1.00 40.49  ? 735  PHE A C     1 
ATOM   3489 O  O     . PHE A 1 478 ? 5.875   6.348   -2.902  1.00 37.67  ? 735  PHE A O     1 
ATOM   3490 C  CB    . PHE A 1 478 ? 9.183   6.636   -3.136  1.00 43.58  ? 735  PHE A CB    1 
ATOM   3491 C  CG    . PHE A 1 478 ? 10.096  5.596   -3.679  1.00 46.87  ? 735  PHE A CG    1 
ATOM   3492 C  CD1   . PHE A 1 478 ? 9.694   4.272   -3.707  1.00 47.90  ? 735  PHE A CD1   1 
ATOM   3493 C  CD2   . PHE A 1 478 ? 11.339  5.935   -4.192  1.00 49.61  ? 735  PHE A CD2   1 
ATOM   3494 C  CE1   . PHE A 1 478 ? 10.533  3.303   -4.231  1.00 50.51  ? 735  PHE A CE1   1 
ATOM   3495 C  CE2   . PHE A 1 478 ? 12.191  4.972   -4.715  1.00 52.08  ? 735  PHE A CE2   1 
ATOM   3496 C  CZ    . PHE A 1 478 ? 11.790  3.653   -4.734  1.00 52.55  ? 735  PHE A CZ    1 
ATOM   3497 N  N     . ILE A 1 479 ? 6.813   8.378   -2.488  1.00 39.43  ? 736  ILE A N     1 
ATOM   3498 C  CA    . ILE A 1 479 ? 5.850   8.831   -1.512  1.00 36.92  ? 736  ILE A CA    1 
ATOM   3499 C  C     . ILE A 1 479 ? 4.458   8.850   -2.145  1.00 36.47  ? 736  ILE A C     1 
ATOM   3500 O  O     . ILE A 1 479 ? 3.499   8.380   -1.552  1.00 34.17  ? 736  ILE A O     1 
ATOM   3501 C  CB    . ILE A 1 479 ? 6.263   10.194  -0.901  1.00 37.04  ? 736  ILE A CB    1 
ATOM   3502 C  CG1   . ILE A 1 479 ? 7.473   10.007  0.001   1.00 38.34  ? 736  ILE A CG1   1 
ATOM   3503 C  CG2   . ILE A 1 479 ? 5.163   10.756  -0.005  1.00 35.17  ? 736  ILE A CG2   1 
ATOM   3504 C  CD1   . ILE A 1 479 ? 8.133   11.285  0.493   1.00 38.81  ? 736  ILE A CD1   1 
ATOM   3505 N  N     . GLU A 1 480 ? 4.366   9.327   -3.373  1.00 38.83  ? 737  GLU A N     1 
ATOM   3506 C  CA    . GLU A 1 480 ? 3.107   9.369   -4.110  1.00 40.21  ? 737  GLU A CA    1 
ATOM   3507 C  C     . GLU A 1 480 ? 2.590   7.969   -4.414  1.00 39.74  ? 737  GLU A C     1 
ATOM   3508 O  O     . GLU A 1 480 ? 1.380   7.697   -4.411  1.00 37.99  ? 737  GLU A O     1 
ATOM   3509 C  CB    . GLU A 1 480 ? 3.303   10.163  -5.421  1.00 44.86  ? 737  GLU A CB    1 
ATOM   3510 C  CG    . GLU A 1 480 ? 2.280   9.895   -6.525  1.00 49.12  ? 737  GLU A CG    1 
ATOM   3511 C  CD    . GLU A 1 480 ? 2.633   10.604  -7.850  1.00 55.85  ? 737  GLU A CD    1 
ATOM   3512 O  OE1   . GLU A 1 480 ? 3.398   11.610  -7.822  1.00 62.34  ? 737  GLU A OE1   1 
ATOM   3513 O  OE2   . GLU A 1 480 ? 2.171   10.151  -8.934  1.00 58.39  ? 737  GLU A OE2   1 
ATOM   3514 N  N     . ARG A 1 481 ? 3.509   7.069   -4.694  1.00 38.97  ? 738  ARG A N     1 
ATOM   3515 C  CA    . ARG A 1 481 ? 3.130   5.701   -4.974  1.00 40.53  ? 738  ARG A CA    1 
ATOM   3516 C  C     . ARG A 1 481 ? 2.639   5.034   -3.654  1.00 35.91  ? 738  ARG A C     1 
ATOM   3517 O  O     . ARG A 1 481 ? 1.682   4.243   -3.658  1.00 34.44  ? 738  ARG A O     1 
ATOM   3518 C  CB    . ARG A 1 481 ? 4.332   4.991   -5.611  1.00 44.56  ? 738  ARG A CB    1 
ATOM   3519 C  CG    . ARG A 1 481 ? 4.047   3.736   -6.344  1.00 49.02  ? 738  ARG A CG    1 
ATOM   3520 C  CD    . ARG A 1 481 ? 3.083   3.911   -7.501  1.00 52.39  ? 738  ARG A CD    1 
ATOM   3521 N  NE    . ARG A 1 481 ? 2.386   2.650   -7.744  1.00 56.49  ? 738  ARG A NE    1 
ATOM   3522 C  CZ    . ARG A 1 481 ? 1.517   2.054   -6.906  1.00 57.77  ? 738  ARG A CZ    1 
ATOM   3523 N  NH1   . ARG A 1 481 ? 1.202   2.561   -5.720  1.00 56.08  ? 738  ARG A NH1   1 
ATOM   3524 N  NH2   . ARG A 1 481 ? 0.959   0.908   -7.261  1.00 61.52  ? 738  ARG A NH2   1 
ATOM   3525 N  N     . TYR A 1 482 ? 3.246   5.418   -2.538  1.00 33.51  ? 739  TYR A N     1 
ATOM   3526 C  CA    . TYR A 1 482 ? 2.827   4.921   -1.268  1.00 31.55  ? 739  TYR A CA    1 
ATOM   3527 C  C     . TYR A 1 482 ? 1.357   5.322   -0.957  1.00 31.47  ? 739  TYR A C     1 
ATOM   3528 O  O     . TYR A 1 482 ? 0.550   4.486   -0.536  1.00 30.24  ? 739  TYR A O     1 
ATOM   3529 C  CB    . TYR A 1 482 ? 3.778   5.370   -0.167  1.00 30.41  ? 739  TYR A CB    1 
ATOM   3530 C  CG    . TYR A 1 482 ? 3.359   4.879   1.179   1.00 28.95  ? 739  TYR A CG    1 
ATOM   3531 C  CD1   . TYR A 1 482 ? 2.441   5.588   1.944   1.00 28.01  ? 739  TYR A CD1   1 
ATOM   3532 C  CD2   . TYR A 1 482 ? 3.871   3.701   1.708   1.00 29.49  ? 739  TYR A CD2   1 
ATOM   3533 C  CE1   . TYR A 1 482 ? 2.026   5.135   3.178   1.00 26.95  ? 739  TYR A CE1   1 
ATOM   3534 C  CE2   . TYR A 1 482 ? 3.474   3.243   2.962   1.00 27.78  ? 739  TYR A CE2   1 
ATOM   3535 C  CZ    . TYR A 1 482 ? 2.554   3.971   3.686   1.00 27.41  ? 739  TYR A CZ    1 
ATOM   3536 O  OH    . TYR A 1 482 ? 2.139   3.532   4.909   1.00 27.35  ? 739  TYR A OH    1 
ATOM   3537 N  N     . PHE A 1 483 ? 1.027   6.599   -1.137  1.00 32.07  ? 740  PHE A N     1 
ATOM   3538 C  CA    . PHE A 1 483 ? -0.329  7.084   -0.864  1.00 31.15  ? 740  PHE A CA    1 
ATOM   3539 C  C     . PHE A 1 483 ? -1.383  6.469   -1.779  1.00 32.02  ? 740  PHE A C     1 
ATOM   3540 O  O     . PHE A 1 483 ? -2.531  6.340   -1.351  1.00 33.05  ? 740  PHE A O     1 
ATOM   3541 C  CB    . PHE A 1 483 ? -0.390  8.599   -0.923  1.00 30.74  ? 740  PHE A CB    1 
ATOM   3542 C  CG    . PHE A 1 483 ? 0.377   9.273   0.153   1.00 30.82  ? 740  PHE A CG    1 
ATOM   3543 C  CD1   . PHE A 1 483 ? 0.337   8.819   1.441   1.00 30.01  ? 740  PHE A CD1   1 
ATOM   3544 C  CD2   . PHE A 1 483 ? 1.120   10.396  -0.122  1.00 33.32  ? 740  PHE A CD2   1 
ATOM   3545 C  CE1   . PHE A 1 483 ? 1.030   9.444   2.441   1.00 30.76  ? 740  PHE A CE1   1 
ATOM   3546 C  CE2   . PHE A 1 483 ? 1.810   11.045  0.874   1.00 32.63  ? 740  PHE A CE2   1 
ATOM   3547 C  CZ    . PHE A 1 483 ? 1.772   10.572  2.157   1.00 31.89  ? 740  PHE A CZ    1 
ATOM   3548 N  N     . GLU A 1 484 ? -1.033  6.088   -3.003  1.00 33.78  ? 741  GLU A N     1 
ATOM   3549 C  CA    . GLU A 1 484 ? -1.967  5.373   -3.872  1.00 35.92  ? 741  GLU A CA    1 
ATOM   3550 C  C     . GLU A 1 484 ? -2.318  3.974   -3.304  1.00 34.60  ? 741  GLU A C     1 
ATOM   3551 O  O     . GLU A 1 484 ? -3.399  3.466   -3.536  1.00 32.99  ? 741  GLU A O     1 
ATOM   3552 C  CB    . GLU A 1 484 ? -1.396  5.181   -5.277  1.00 41.75  ? 741  GLU A CB    1 
ATOM   3553 C  CG    . GLU A 1 484 ? -1.341  6.421   -6.161  1.00 47.45  ? 741  GLU A CG    1 
ATOM   3554 C  CD    . GLU A 1 484 ? -0.690  6.138   -7.509  1.00 54.78  ? 741  GLU A CD    1 
ATOM   3555 O  OE1   . GLU A 1 484 ? -1.268  5.373   -8.315  1.00 62.69  ? 741  GLU A OE1   1 
ATOM   3556 O  OE2   . GLU A 1 484 ? 0.417   6.664   -7.777  1.00 61.80  ? 741  GLU A OE2   1 
ATOM   3557 N  N     . SER A 1 485 ? -1.380  3.344   -2.597  1.00 32.10  ? 742  SER A N     1 
ATOM   3558 C  CA    . SER A 1 485 ? -1.633  2.030   -1.997  1.00 30.94  ? 742  SER A CA    1 
ATOM   3559 C  C     . SER A 1 485 ? -2.284  2.110   -0.646  1.00 27.30  ? 742  SER A C     1 
ATOM   3560 O  O     . SER A 1 485 ? -2.936  1.163   -0.251  1.00 25.90  ? 742  SER A O     1 
ATOM   3561 C  CB    . SER A 1 485 ? -0.327  1.283   -1.794  1.00 32.08  ? 742  SER A CB    1 
ATOM   3562 O  OG    . SER A 1 485 ? 0.208   0.937   -3.026  1.00 35.56  ? 742  SER A OG    1 
ATOM   3563 N  N     . PHE A 1 486 ? -2.030  3.205   0.083   1.00 24.83  ? 743  PHE A N     1 
ATOM   3564 C  CA    . PHE A 1 486 ? -2.545  3.437   1.413   1.00 23.52  ? 743  PHE A CA    1 
ATOM   3565 C  C     . PHE A 1 486 ? -3.287  4.787   1.448   1.00 22.82  ? 743  PHE A C     1 
ATOM   3566 O  O     . PHE A 1 486 ? -2.840  5.737   2.094   1.00 21.80  ? 743  PHE A O     1 
ATOM   3567 C  CB    . PHE A 1 486 ? -1.395  3.403   2.431   1.00 23.02  ? 743  PHE A CB    1 
ATOM   3568 C  CG    . PHE A 1 486 ? -0.627  2.113   2.397   1.00 24.29  ? 743  PHE A CG    1 
ATOM   3569 C  CD1   . PHE A 1 486 ? -1.132  0.978   3.054   1.00 24.59  ? 743  PHE A CD1   1 
ATOM   3570 C  CD2   . PHE A 1 486 ? 0.545   1.990   1.663   1.00 25.40  ? 743  PHE A CD2   1 
ATOM   3571 C  CE1   . PHE A 1 486 ? -0.466  -0.233  3.019   1.00 25.91  ? 743  PHE A CE1   1 
ATOM   3572 C  CE2   . PHE A 1 486 ? 1.206   0.762   1.592   1.00 27.23  ? 743  PHE A CE2   1 
ATOM   3573 C  CZ    . PHE A 1 486 ? 0.714   -0.357  2.279   1.00 27.00  ? 743  PHE A CZ    1 
ATOM   3574 N  N     . PRO A 1 487 ? -4.413  4.880   0.728   1.00 22.68  ? 744  PRO A N     1 
ATOM   3575 C  CA    . PRO A 1 487 ? -5.138  6.155   0.660   1.00 22.56  ? 744  PRO A CA    1 
ATOM   3576 C  C     . PRO A 1 487 ? -5.669  6.671   1.995   1.00 21.07  ? 744  PRO A C     1 
ATOM   3577 O  O     . PRO A 1 487 ? -5.836  7.891   2.199   1.00 19.83  ? 744  PRO A O     1 
ATOM   3578 C  CB    . PRO A 1 487 ? -6.300  5.856   -0.345  1.00 23.90  ? 744  PRO A CB    1 
ATOM   3579 C  CG    . PRO A 1 487 ? -6.446  4.325   -0.336  1.00 23.88  ? 744  PRO A CG    1 
ATOM   3580 C  CD    . PRO A 1 487 ? -5.047  3.803   -0.064  1.00 23.41  ? 744  PRO A CD    1 
ATOM   3581 N  N     . GLY A 1 488 ? -5.890  5.764   2.947   1.00 20.14  ? 745  GLY A N     1 
ATOM   3582 C  CA    . GLY A 1 488 ? -6.329  6.152   4.260   1.00 19.44  ? 745  GLY A CA    1 
ATOM   3583 C  C     . GLY A 1 488 ? -5.216  6.858   5.030   1.00 18.92  ? 745  GLY A C     1 
ATOM   3584 O  O     . GLY A 1 488 ? -5.465  7.808   5.774   1.00 17.71  ? 745  GLY A O     1 
ATOM   3585 N  N     . VAL A 1 489 ? -3.992  6.420   4.822   1.00 19.35  ? 746  VAL A N     1 
ATOM   3586 C  CA    . VAL A 1 489 ? -2.836  7.118   5.436   1.00 19.34  ? 746  VAL A CA    1 
ATOM   3587 C  C     . VAL A 1 489 ? -2.710  8.536   4.782   1.00 19.87  ? 746  VAL A C     1 
ATOM   3588 O  O     . VAL A 1 489 ? -2.459  9.532   5.470   1.00 19.83  ? 746  VAL A O     1 
ATOM   3589 C  CB    . VAL A 1 489 ? -1.552  6.331   5.276   1.00 19.70  ? 746  VAL A CB    1 
ATOM   3590 C  CG1   . VAL A 1 489 ? -0.359  7.134   5.797   1.00 20.30  ? 746  VAL A CG1   1 
ATOM   3591 C  CG2   . VAL A 1 489 ? -1.625  4.947   5.983   1.00 19.30  ? 746  VAL A CG2   1 
ATOM   3592 N  N     . LYS A 1 490 ? -2.921  8.633   3.487   1.00 21.25  ? 747  LYS A N     1 
ATOM   3593 C  CA    . LYS A 1 490 ? -2.886  9.955   2.818   1.00 23.23  ? 747  LYS A CA    1 
ATOM   3594 C  C     . LYS A 1 490 ? -3.923  10.863  3.431   1.00 23.48  ? 747  LYS A C     1 
ATOM   3595 O  O     . LYS A 1 490 ? -3.640  11.997  3.789   1.00 22.11  ? 747  LYS A O     1 
ATOM   3596 C  CB    . LYS A 1 490 ? -3.153  9.849   1.310   1.00 26.03  ? 747  LYS A CB    1 
ATOM   3597 C  CG    . LYS A 1 490 ? -2.965  11.167  0.540   1.00 28.10  ? 747  LYS A CG    1 
ATOM   3598 C  CD    . LYS A 1 490 ? -3.495  11.083  -0.876  1.00 31.15  ? 747  LYS A CD    1 
ATOM   3599 C  CE    . LYS A 1 490 ? -3.029  12.272  -1.716  1.00 34.35  ? 747  LYS A CE    1 
ATOM   3600 N  NZ    . LYS A 1 490 ? -3.764  12.321  -3.012  1.00 36.85  ? 747  LYS A NZ    1 
ATOM   3601 N  N     . ARG A 1 491 ? -5.127  10.331  3.611   1.00 24.08  ? 748  ARG A N     1 
ATOM   3602 C  CA    . ARG A 1 491 ? -6.235  11.089  4.185   1.00 26.06  ? 748  ARG A CA    1 
ATOM   3603 C  C     . ARG A 1 491 ? -5.950  11.547  5.619   1.00 24.30  ? 748  ARG A C     1 
ATOM   3604 O  O     . ARG A 1 491 ? -6.241  12.684  5.983   1.00 23.20  ? 748  ARG A O     1 
ATOM   3605 C  CB    . ARG A 1 491 ? -7.504  10.237  4.147   1.00 29.32  ? 748  ARG A CB    1 
ATOM   3606 C  CG    . ARG A 1 491 ? -8.754  10.924  4.663   1.00 35.01  ? 748  ARG A CG    1 
ATOM   3607 C  CD    . ARG A 1 491 ? -9.964  10.019  4.498   1.00 42.86  ? 748  ARG A CD    1 
ATOM   3608 N  NE    . ARG A 1 491 ? -9.866  9.189   3.299   1.00 45.37  ? 748  ARG A NE    1 
ATOM   3609 C  CZ    . ARG A 1 491 ? -9.776  7.863   3.312   1.00 48.91  ? 748  ARG A CZ    1 
ATOM   3610 N  NH1   . ARG A 1 491 ? -9.770  7.207   4.464   1.00 52.64  ? 748  ARG A NH1   1 
ATOM   3611 N  NH2   . ARG A 1 491 ? -9.693  7.191   2.172   1.00 49.60  ? 748  ARG A NH2   1 
ATOM   3612 N  N     . TYR A 1 492 ? -5.366  10.660  6.418   1.00 22.78  ? 749  TYR A N     1 
ATOM   3613 C  CA    . TYR A 1 492 ? -4.926  10.984  7.768   1.00 22.54  ? 749  TYR A CA    1 
ATOM   3614 C  C     . TYR A 1 492 ? -3.878  12.124  7.765   1.00 22.40  ? 749  TYR A C     1 
ATOM   3615 O  O     . TYR A 1 492 ? -3.962  13.048  8.572   1.00 22.74  ? 749  TYR A O     1 
ATOM   3616 C  CB    . TYR A 1 492 ? -4.368  9.737   8.518   1.00 22.09  ? 749  TYR A CB    1 
ATOM   3617 C  CG    . TYR A 1 492 ? -3.454  10.115  9.648   1.00 22.01  ? 749  TYR A CG    1 
ATOM   3618 C  CD1   . TYR A 1 492 ? -3.974  10.565  10.844  1.00 22.83  ? 749  TYR A CD1   1 
ATOM   3619 C  CD2   . TYR A 1 492 ? -2.071  10.122  9.492   1.00 21.76  ? 749  TYR A CD2   1 
ATOM   3620 C  CE1   . TYR A 1 492 ? -3.163  10.982  11.877  1.00 22.53  ? 749  TYR A CE1   1 
ATOM   3621 C  CE2   . TYR A 1 492 ? -1.231  10.524  10.541  1.00 22.23  ? 749  TYR A CE2   1 
ATOM   3622 C  CZ    . TYR A 1 492 ? -1.808  10.952  11.735  1.00 22.32  ? 749  TYR A CZ    1 
ATOM   3623 O  OH    . TYR A 1 492 ? -1.062  11.424  12.806  1.00 22.04  ? 749  TYR A OH    1 
ATOM   3624 N  N     . MET A 1 493 ? -2.927  12.054  6.868   1.00 21.96  ? 750  MET A N     1 
ATOM   3625 C  CA    A MET A 1 493 ? -1.869  13.041  6.792   0.80 24.01  ? 750  MET A CA    1 
ATOM   3626 C  CA    B MET A 1 493 ? -1.892  13.053  6.820   0.20 22.30  ? 750  MET A CA    1 
ATOM   3627 C  C     . MET A 1 493 ? -2.445  14.413  6.419   1.00 23.33  ? 750  MET A C     1 
ATOM   3628 O  O     . MET A 1 493 ? -2.092  15.397  7.037   1.00 23.18  ? 750  MET A O     1 
ATOM   3629 C  CB    A MET A 1 493 ? -0.755  12.653  5.815   0.80 26.29  ? 750  MET A CB    1 
ATOM   3630 C  CB    B MET A 1 493 ? -0.763  12.602  5.921   0.20 22.43  ? 750  MET A CB    1 
ATOM   3631 C  CG    A MET A 1 493 ? 0.073   11.409  6.167   0.80 28.89  ? 750  MET A CG    1 
ATOM   3632 C  CG    B MET A 1 493 ? 0.014   11.473  6.566   0.20 21.78  ? 750  MET A CG    1 
ATOM   3633 S  SD    A MET A 1 493 ? 1.116   11.452  7.645   0.80 33.60  ? 750  MET A SD    1 
ATOM   3634 S  SD    B MET A 1 493 ? 1.450   11.067  5.584   0.20 22.15  ? 750  MET A SD    1 
ATOM   3635 C  CE    A MET A 1 493 ? 1.794   9.769   7.631   0.80 31.34  ? 750  MET A CE    1 
ATOM   3636 C  CE    B MET A 1 493 ? 1.658   12.648  4.758   0.20 23.81  ? 750  MET A CE    1 
ATOM   3637 N  N     . GLU A 1 494 ? -3.357  14.455  5.454   1.00 23.41  ? 751  GLU A N     1 
ATOM   3638 C  CA    . GLU A 1 494 ? -4.041  15.703  5.116   1.00 25.78  ? 751  GLU A CA    1 
ATOM   3639 C  C     . GLU A 1 494 ? -4.895  16.244  6.275   1.00 24.40  ? 751  GLU A C     1 
ATOM   3640 O  O     . GLU A 1 494 ? -4.842  17.422  6.620   1.00 23.33  ? 751  GLU A O     1 
ATOM   3641 C  CB    . GLU A 1 494 ? -4.943  15.486  3.897   1.00 27.97  ? 751  GLU A CB    1 
ATOM   3642 C  CG    . GLU A 1 494 ? -4.163  15.099  2.668   1.00 30.09  ? 751  GLU A CG    1 
ATOM   3643 C  CD    . GLU A 1 494 ? -5.050  14.570  1.525   1.00 33.93  ? 751  GLU A CD    1 
ATOM   3644 O  OE1   . GLU A 1 494 ? -6.192  14.086  1.765   1.00 34.43  ? 751  GLU A OE1   1 
ATOM   3645 O  OE2   . GLU A 1 494 ? -4.570  14.606  0.381   1.00 36.28  ? 751  GLU A OE2   1 
ATOM   3646 N  N     . ASN A 1 495 ? -5.649  15.352  6.906   1.00 23.73  ? 752  ASN A N     1 
ATOM   3647 C  CA    . ASN A 1 495 ? -6.623  15.754  7.932   1.00 24.13  ? 752  ASN A CA    1 
ATOM   3648 C  C     . ASN A 1 495 ? -5.930  16.242  9.181   1.00 23.31  ? 752  ASN A C     1 
ATOM   3649 O  O     . ASN A 1 495 ? -6.395  17.159  9.803   1.00 23.77  ? 752  ASN A O     1 
ATOM   3650 C  CB    . ASN A 1 495 ? -7.580  14.619  8.321   1.00 23.75  ? 752  ASN A CB    1 
ATOM   3651 C  CG    . ASN A 1 495 ? -8.626  14.334  7.251   1.00 27.42  ? 752  ASN A CG    1 
ATOM   3652 O  OD1   . ASN A 1 495 ? -8.737  15.058  6.284   1.00 27.95  ? 752  ASN A OD1   1 
ATOM   3653 N  ND2   . ASN A 1 495 ? -9.325  13.185  7.381   1.00 29.40  ? 752  ASN A ND2   1 
ATOM   3654 N  N     . ILE A 1 496 ? -4.830  15.609  9.570   1.00 21.88  ? 753  ILE A N     1 
ATOM   3655 C  CA    . ILE A 1 496 ? -4.180  15.973  10.784  1.00 21.16  ? 753  ILE A CA    1 
ATOM   3656 C  C     . ILE A 1 496 ? -3.424  17.318  10.661  1.00 21.59  ? 753  ILE A C     1 
ATOM   3657 O  O     . ILE A 1 496 ? -3.323  18.045  11.644  1.00 20.19  ? 753  ILE A O     1 
ATOM   3658 C  CB    . ILE A 1 496 ? -3.273  14.836  11.279  1.00 21.08  ? 753  ILE A CB    1 
ATOM   3659 C  CG1   . ILE A 1 496 ? -2.884  15.023  12.762  1.00 21.51  ? 753  ILE A CG1   1 
ATOM   3660 C  CG2   . ILE A 1 496 ? -2.003  14.766  10.460  1.00 21.27  ? 753  ILE A CG2   1 
ATOM   3661 C  CD1   . ILE A 1 496 ? -4.002  14.853  13.782  1.00 22.00  ? 753  ILE A CD1   1 
ATOM   3662 N  N     . VAL A 1 497 ? -2.880  17.642  9.480   1.00 21.36  ? 754  VAL A N     1 
ATOM   3663 C  CA    . VAL A 1 497 ? -2.294  18.953  9.262   1.00 22.71  ? 754  VAL A CA    1 
ATOM   3664 C  C     . VAL A 1 497 ? -3.360  20.055  9.354   1.00 23.76  ? 754  VAL A C     1 
ATOM   3665 O  O     . VAL A 1 497 ? -3.104  21.125  9.922   1.00 23.22  ? 754  VAL A O     1 
ATOM   3666 C  CB    . VAL A 1 497 ? -1.533  18.990  7.930   1.00 24.32  ? 754  VAL A CB    1 
ATOM   3667 C  CG1   . VAL A 1 497 ? -1.166  20.431  7.502   1.00 25.64  ? 754  VAL A CG1   1 
ATOM   3668 C  CG2   . VAL A 1 497 ? -0.310  18.071  8.040   1.00 24.34  ? 754  VAL A CG2   1 
ATOM   3669 N  N     . GLN A 1 498 ? -4.543  19.803  8.809   1.00 24.96  ? 755  GLN A N     1 
ATOM   3670 C  CA    . GLN A 1 498 ? -5.650  20.766  8.880   1.00 27.16  ? 755  GLN A CA    1 
ATOM   3671 C  C     . GLN A 1 498 ? -6.122  20.894  10.345  1.00 26.41  ? 755  GLN A C     1 
ATOM   3672 O  O     . GLN A 1 498 ? -6.417  21.982  10.839  1.00 23.80  ? 755  GLN A O     1 
ATOM   3673 C  CB    . GLN A 1 498 ? -6.820  20.335  7.972   1.00 30.49  ? 755  GLN A CB    1 
ATOM   3674 C  CG    . GLN A 1 498 ? -6.654  20.519  6.434   1.00 35.41  ? 755  GLN A CG    1 
ATOM   3675 C  CD    . GLN A 1 498 ? -5.214  20.742  5.847   1.00 40.61  ? 755  GLN A CD    1 
ATOM   3676 O  OE1   . GLN A 1 498 ? -4.749  21.908  5.750   1.00 42.69  ? 755  GLN A OE1   1 
ATOM   3677 N  NE2   . GLN A 1 498 ? -4.543  19.631  5.339   1.00 38.31  ? 755  GLN A NE2   1 
ATOM   3678 N  N     . GLU A 1 499 ? -6.174  19.771  11.055  1.00 25.42  ? 756  GLU A N     1 
ATOM   3679 C  CA    . GLU A 1 499 ? -6.534  19.819  12.453  1.00 26.51  ? 756  GLU A CA    1 
ATOM   3680 C  C     . GLU A 1 499 ? -5.538  20.647  13.288  1.00 24.29  ? 756  GLU A C     1 
ATOM   3681 O  O     . GLU A 1 499 ? -5.957  21.414  14.161  1.00 24.73  ? 756  GLU A O     1 
ATOM   3682 C  CB    . GLU A 1 499 ? -6.667  18.417  13.050  1.00 28.86  ? 756  GLU A CB    1 
ATOM   3683 C  CG    . GLU A 1 499 ? -6.898  18.492  14.549  1.00 34.12  ? 756  GLU A CG    1 
ATOM   3684 C  CD    . GLU A 1 499 ? -7.800  17.407  15.058  1.00 40.74  ? 756  GLU A CD    1 
ATOM   3685 O  OE1   . GLU A 1 499 ? -7.506  16.242  14.730  1.00 40.69  ? 756  GLU A OE1   1 
ATOM   3686 O  OE2   . GLU A 1 499 ? -8.790  17.737  15.776  1.00 48.10  ? 756  GLU A OE2   1 
ATOM   3687 N  N     . ALA A 1 500 ? -4.244  20.448  13.061  1.00 22.48  ? 757  ALA A N     1 
ATOM   3688 C  CA    . ALA A 1 500 ? -3.216  21.202  13.736  1.00 21.78  ? 757  ALA A CA    1 
ATOM   3689 C  C     . ALA A 1 500 ? -3.358  22.701  13.456  1.00 23.31  ? 757  ALA A C     1 
ATOM   3690 O  O     . ALA A 1 500 ? -3.116  23.539  14.336  1.00 20.58  ? 757  ALA A O     1 
ATOM   3691 C  CB    . ALA A 1 500 ? -1.862  20.748  13.269  1.00 20.96  ? 757  ALA A CB    1 
ATOM   3692 N  N     . LYS A 1 501 ? -3.655  23.010  12.191  1.00 24.20  ? 758  LYS A N     1 
ATOM   3693 C  CA    . LYS A 1 501 ? -3.885  24.397  11.772  1.00 27.32  ? 758  LYS A CA    1 
ATOM   3694 C  C     . LYS A 1 501 ? -5.069  25.008  12.490  1.00 25.82  ? 758  LYS A C     1 
ATOM   3695 O  O     . LYS A 1 501 ? -4.988  26.141  12.945  1.00 25.45  ? 758  LYS A O     1 
ATOM   3696 C  CB    . LYS A 1 501 ? -4.083  24.498  10.263  1.00 30.34  ? 758  LYS A CB    1 
ATOM   3697 C  CG    . LYS A 1 501 ? -4.069  25.935  9.781   1.00 37.65  ? 758  LYS A CG    1 
ATOM   3698 C  CD    . LYS A 1 501 ? -4.101  26.076  8.244   1.00 42.24  ? 758  LYS A CD    1 
ATOM   3699 C  CE    . LYS A 1 501 ? -3.262  27.272  7.799   1.00 46.58  ? 758  LYS A CE    1 
ATOM   3700 N  NZ    . LYS A 1 501 ? -3.385  27.542  6.319   1.00 50.54  ? 758  LYS A NZ    1 
ATOM   3701 N  N     . GLN A 1 502 ? -6.157  24.253  12.595  1.00 24.70  ? 759  GLN A N     1 
ATOM   3702 C  CA    . GLN A 1 502 ? -7.414  24.767  13.171  1.00 25.81  ? 759  GLN A CA    1 
ATOM   3703 C  C     . GLN A 1 502 ? -7.355  24.910  14.716  1.00 24.21  ? 759  GLN A C     1 
ATOM   3704 O  O     . GLN A 1 502 ? -7.792  25.914  15.244  1.00 23.10  ? 759  GLN A O     1 
ATOM   3705 C  CB    . GLN A 1 502 ? -8.558  23.840  12.794  1.00 26.54  ? 759  GLN A CB    1 
ATOM   3706 C  CG    . GLN A 1 502 ? -9.894  24.249  13.363  1.00 28.48  ? 759  GLN A CG    1 
ATOM   3707 C  CD    . GLN A 1 502 ? -10.296 23.486  14.631  1.00 28.65  ? 759  GLN A CD    1 
ATOM   3708 O  OE1   . GLN A 1 502 ? -10.398 22.256  14.590  1.00 29.30  ? 759  GLN A OE1   1 
ATOM   3709 N  NE2   . GLN A 1 502 ? -10.636 24.233  15.753  1.00 26.68  ? 759  GLN A NE2   1 
ATOM   3710 N  N     . LYS A 1 503 ? -6.891  23.859  15.391  1.00 22.43  ? 760  LYS A N     1 
ATOM   3711 C  CA    . LYS A 1 503 ? -6.832  23.783  16.843  1.00 23.25  ? 760  LYS A CA    1 
ATOM   3712 C  C     . LYS A 1 503 ? -5.552  24.418  17.419  1.00 22.08  ? 760  LYS A C     1 
ATOM   3713 O  O     . LYS A 1 503 ? -5.576  24.960  18.521  1.00 21.08  ? 760  LYS A O     1 
ATOM   3714 C  CB    . LYS A 1 503 ? -6.946  22.327  17.333  1.00 24.46  ? 760  LYS A CB    1 
ATOM   3715 C  CG    . LYS A 1 503 ? -8.330  21.732  17.194  1.00 29.33  ? 760  LYS A CG    1 
ATOM   3716 C  CD    . LYS A 1 503 ? -8.414  20.307  17.764  1.00 32.29  ? 760  LYS A CD    1 
ATOM   3717 C  CE    . LYS A 1 503 ? -9.859  19.804  17.896  1.00 36.47  ? 760  LYS A CE    1 
ATOM   3718 N  NZ    . LYS A 1 503 ? -10.736 20.089  16.717  1.00 39.08  ? 760  LYS A NZ    1 
ATOM   3719 N  N     . GLY A 1 504 ? -4.443  24.388  16.671  1.00 20.72  ? 761  GLY A N     1 
ATOM   3720 C  CA    . GLY A 1 504 ? -3.160  24.832  17.211  1.00 20.00  ? 761  GLY A CA    1 
ATOM   3721 C  C     . GLY A 1 504 ? -2.283  23.748  17.806  1.00 18.66  ? 761  GLY A C     1 
ATOM   3722 O  O     . GLY A 1 504 ? -1.107  24.023  18.221  1.00 17.62  ? 761  GLY A O     1 
ATOM   3723 N  N     . TYR A 1 505 ? -2.797  22.513  17.828  1.00 17.07  ? 762  TYR A N     1 
ATOM   3724 C  CA    . TYR A 1 505 ? -2.049  21.434  18.441  1.00 17.57  ? 762  TYR A CA    1 
ATOM   3725 C  C     . TYR A 1 505 ? -2.541  20.099  17.899  1.00 17.46  ? 762  TYR A C     1 
ATOM   3726 O  O     . TYR A 1 505 ? -3.639  20.038  17.346  1.00 18.63  ? 762  TYR A O     1 
ATOM   3727 C  CB    . TYR A 1 505 ? -2.238  21.502  19.956  1.00 16.86  ? 762  TYR A CB    1 
ATOM   3728 C  CG    . TYR A 1 505 ? -3.670  21.312  20.403  1.00 17.49  ? 762  TYR A CG    1 
ATOM   3729 C  CD1   . TYR A 1 505 ? -4.192  20.020  20.672  1.00 17.43  ? 762  TYR A CD1   1 
ATOM   3730 C  CD2   . TYR A 1 505 ? -4.487  22.415  20.629  1.00 18.51  ? 762  TYR A CD2   1 
ATOM   3731 C  CE1   . TYR A 1 505 ? -5.527  19.851  21.092  1.00 18.53  ? 762  TYR A CE1   1 
ATOM   3732 C  CE2   . TYR A 1 505 ? -5.797  22.254  21.038  1.00 19.48  ? 762  TYR A CE2   1 
ATOM   3733 C  CZ    . TYR A 1 505 ? -6.309  20.979  21.266  1.00 19.34  ? 762  TYR A CZ    1 
ATOM   3734 O  OH    . TYR A 1 505 ? -7.601  20.908  21.678  1.00 20.26  ? 762  TYR A OH    1 
ATOM   3735 N  N     . VAL A 1 506 ? -1.772  19.042  18.106  1.00 17.22  ? 763  VAL A N     1 
ATOM   3736 C  CA    . VAL A 1 506 ? -2.253  17.690  17.842  1.00 17.65  ? 763  VAL A CA    1 
ATOM   3737 C  C     . VAL A 1 506 ? -2.210  16.875  19.134  1.00 18.30  ? 763  VAL A C     1 
ATOM   3738 O  O     . VAL A 1 506 ? -1.537  17.269  20.096  1.00 16.77  ? 763  VAL A O     1 
ATOM   3739 C  CB    . VAL A 1 506 ? -1.427  17.014  16.704  1.00 18.16  ? 763  VAL A CB    1 
ATOM   3740 C  CG1   . VAL A 1 506 ? -1.547  17.786  15.385  1.00 17.77  ? 763  VAL A CG1   1 
ATOM   3741 C  CG2   . VAL A 1 506 ? 0.020   16.862  17.101  1.00 17.56  ? 763  VAL A CG2   1 
ATOM   3742 N  N     . THR A 1 507 ? -2.933  15.755  19.181  1.00 19.20  ? 764  THR A N     1 
ATOM   3743 C  CA    . THR A 1 507 ? -3.021  14.970  20.394  1.00 19.86  ? 764  THR A CA    1 
ATOM   3744 C  C     . THR A 1 507 ? -2.737  13.518  20.134  1.00 20.02  ? 764  THR A C     1 
ATOM   3745 O  O     . THR A 1 507 ? -2.833  13.021  19.006  1.00 20.80  ? 764  THR A O     1 
ATOM   3746 C  CB    . THR A 1 507 ? -4.411  15.109  21.085  1.00 22.39  ? 764  THR A CB    1 
ATOM   3747 O  OG1   . THR A 1 507 ? -5.374  14.555  20.204  1.00 27.15  ? 764  THR A OG1   1 
ATOM   3748 C  CG2   . THR A 1 507 ? -4.775  16.567  21.314  1.00 22.18  ? 764  THR A CG2   1 
ATOM   3749 N  N     . THR A 1 508 ? -2.335  12.824  21.180  1.00 20.01  ? 765  THR A N     1 
ATOM   3750 C  CA    . THR A 1 508 ? -2.128  11.400  21.090  1.00 19.65  ? 765  THR A CA    1 
ATOM   3751 C  C     . THR A 1 508 ? -3.344  10.633  21.613  1.00 22.08  ? 765  THR A C     1 
ATOM   3752 O  O     . THR A 1 508 ? -4.255  11.210  22.233  1.00 21.34  ? 765  THR A O     1 
ATOM   3753 C  CB    . THR A 1 508 ? -0.937  10.993  21.922  1.00 19.59  ? 765  THR A CB    1 
ATOM   3754 O  OG1   . THR A 1 508 ? -1.278  11.151  23.308  1.00 18.83  ? 765  THR A OG1   1 
ATOM   3755 C  CG2   . THR A 1 508 ? 0.352   11.843  21.512  1.00 17.94  ? 765  THR A CG2   1 
ATOM   3756 N  N     . LEU A 1 509 ? -3.281  9.317   21.482  1.00 21.32  ? 766  LEU A N     1 
ATOM   3757 C  CA    . LEU A 1 509 ? -4.306  8.435   21.979  1.00 24.06  ? 766  LEU A CA    1 
ATOM   3758 C  C     . LEU A 1 509 ? -4.709  8.672   23.434  1.00 23.82  ? 766  LEU A C     1 
ATOM   3759 O  O     . LEU A 1 509 ? -5.887  8.584   23.763  1.00 22.96  ? 766  LEU A O     1 
ATOM   3760 C  CB    . LEU A 1 509 ? -3.812  7.009   21.823  1.00 27.69  ? 766  LEU A CB    1 
ATOM   3761 C  CG    . LEU A 1 509 ? -4.838  5.911   21.898  1.00 33.58  ? 766  LEU A CG    1 
ATOM   3762 C  CD1   . LEU A 1 509 ? -5.418  5.718   20.499  1.00 34.83  ? 766  LEU A CD1   1 
ATOM   3763 C  CD2   . LEU A 1 509 ? -4.198  4.635   22.444  1.00 36.86  ? 766  LEU A CD2   1 
ATOM   3764 N  N     . LEU A 1 510 ? -3.747  8.937   24.325  1.00 21.97  ? 767  LEU A N     1 
ATOM   3765 C  CA    . LEU A 1 510 ? -4.054  9.193   25.720  1.00 22.55  ? 767  LEU A CA    1 
ATOM   3766 C  C     . LEU A 1 510 ? -4.040  10.693  26.116  1.00 21.26  ? 767  LEU A C     1 
ATOM   3767 O  O     . LEU A 1 510 ? -3.975  11.044  27.303  1.00 20.43  ? 767  LEU A O     1 
ATOM   3768 C  CB    . LEU A 1 510 ? -3.160  8.294   26.669  1.00 23.36  ? 767  LEU A CB    1 
ATOM   3769 C  CG    . LEU A 1 510 ? -3.251  6.749   26.513  1.00 24.88  ? 767  LEU A CG    1 
ATOM   3770 C  CD1   . LEU A 1 510 ? -2.484  5.998   27.626  1.00 25.96  ? 767  LEU A CD1   1 
ATOM   3771 C  CD2   . LEU A 1 510 ? -4.677  6.236   26.556  1.00 25.57  ? 767  LEU A CD2   1 
ATOM   3772 N  N     . HIS A 1 511 ? -4.125  11.577  25.117  1.00 20.48  ? 768  HIS A N     1 
ATOM   3773 C  CA    . HIS A 1 511 ? -4.475  12.991  25.275  1.00 20.93  ? 768  HIS A CA    1 
ATOM   3774 C  C     . HIS A 1 511 ? -3.257  13.838  25.564  1.00 19.93  ? 768  HIS A C     1 
ATOM   3775 O  O     . HIS A 1 511 ? -3.378  14.894  26.121  1.00 18.63  ? 768  HIS A O     1 
ATOM   3776 C  CB    . HIS A 1 511 ? -5.548  13.269  26.351  1.00 23.64  ? 768  HIS A CB    1 
ATOM   3777 C  CG    . HIS A 1 511 ? -6.873  12.578  26.115  1.00 26.49  ? 768  HIS A CG    1 
ATOM   3778 N  ND1   . HIS A 1 511 ? -7.325  12.292  24.878  1.00 30.06  ? 768  HIS A ND1   1 
ATOM   3779 C  CD2   . HIS A 1 511 ? -7.853  12.135  26.994  1.00 31.49  ? 768  HIS A CD2   1 
ATOM   3780 C  CE1   . HIS A 1 511 ? -8.507  11.639  24.955  1.00 29.90  ? 768  HIS A CE1   1 
ATOM   3781 N  NE2   . HIS A 1 511 ? -8.835  11.537  26.241  1.00 32.07  ? 768  HIS A NE2   1 
ATOM   3782 N  N     . ARG A 1 512 ? -2.066  13.335  25.252  1.00 19.41  ? 769  ARG A N     1 
ATOM   3783 C  CA    . ARG A 1 512 ? -0.874  14.172  25.278  1.00 19.84  ? 769  ARG A CA    1 
ATOM   3784 C  C     . ARG A 1 512 ? -1.032  15.151  24.099  1.00 19.42  ? 769  ARG A C     1 
ATOM   3785 O  O     . ARG A 1 512 ? -1.664  14.804  23.085  1.00 17.79  ? 769  ARG A O     1 
ATOM   3786 C  CB    . ARG A 1 512 ? 0.369   13.299  25.048  1.00 21.37  ? 769  ARG A CB    1 
ATOM   3787 C  CG    . ARG A 1 512 ? 1.692   13.914  25.423  1.00 23.11  ? 769  ARG A CG    1 
ATOM   3788 C  CD    . ARG A 1 512 ? 2.850   12.928  25.114  1.00 23.67  ? 769  ARG A CD    1 
ATOM   3789 N  NE    . ARG A 1 512 ? 2.648   11.685  25.848  1.00 24.25  ? 769  ARG A NE    1 
ATOM   3790 C  CZ    . ARG A 1 512 ? 2.912   11.505  27.140  1.00 23.87  ? 769  ARG A CZ    1 
ATOM   3791 N  NH1   . ARG A 1 512 ? 3.470   12.449  27.860  1.00 26.23  ? 769  ARG A NH1   1 
ATOM   3792 N  NH2   . ARG A 1 512 ? 2.639   10.342  27.707  1.00 25.78  ? 769  ARG A NH2   1 
ATOM   3793 N  N     . ARG A 1 513 ? -0.420  16.308  24.215  1.00 18.49  ? 770  ARG A N     1 
ATOM   3794 C  CA    . ARG A 1 513 ? -0.583  17.386  23.280  1.00 20.01  ? 770  ARG A CA    1 
ATOM   3795 C  C     . ARG A 1 513 ? 0.750   17.967  22.886  1.00 19.51  ? 770  ARG A C     1 
ATOM   3796 O  O     . ARG A 1 513 ? 1.690   18.018  23.700  1.00 20.10  ? 770  ARG A O     1 
ATOM   3797 C  CB    . ARG A 1 513 ? -1.458  18.400  24.031  1.00 21.83  ? 770  ARG A CB    1 
ATOM   3798 C  CG    . ARG A 1 513 ? -1.741  19.696  23.418  1.00 24.07  ? 770  ARG A CG    1 
ATOM   3799 C  CD    . ARG A 1 513 ? -2.627  20.512  24.387  1.00 24.43  ? 770  ARG A CD    1 
ATOM   3800 N  NE    . ARG A 1 513 ? -3.988  20.003  24.496  1.00 24.16  ? 770  ARG A NE    1 
ATOM   3801 C  CZ    . ARG A 1 513 ? -5.062  20.777  24.578  1.00 24.38  ? 770  ARG A CZ    1 
ATOM   3802 N  NH1   . ARG A 1 513 ? -4.924  22.099  24.563  1.00 24.87  ? 770  ARG A NH1   1 
ATOM   3803 N  NH2   . ARG A 1 513 ? -6.259  20.238  24.713  1.00 24.08  ? 770  ARG A NH2   1 
ATOM   3804 N  N     . ARG A 1 514 ? 0.826   18.422  21.634  1.00 18.30  ? 771  ARG A N     1 
ATOM   3805 C  CA    . ARG A 1 514 ? 1.959   19.164  21.120  1.00 18.02  ? 771  ARG A CA    1 
ATOM   3806 C  C     . ARG A 1 514 ? 1.408   20.365  20.336  1.00 17.96  ? 771  ARG A C     1 
ATOM   3807 O  O     . ARG A 1 514 ? 0.646   20.155  19.395  1.00 16.95  ? 771  ARG A O     1 
ATOM   3808 C  CB    . ARG A 1 514 ? 2.800   18.288  20.207  1.00 18.11  ? 771  ARG A CB    1 
ATOM   3809 C  CG    . ARG A 1 514 ? 4.109   18.951  19.733  1.00 19.30  ? 771  ARG A CG    1 
ATOM   3810 C  CD    . ARG A 1 514 ? 4.915   18.012  18.833  1.00 20.18  ? 771  ARG A CD    1 
ATOM   3811 N  NE    . ARG A 1 514 ? 6.208   18.631  18.499  1.00 20.48  ? 771  ARG A NE    1 
ATOM   3812 C  CZ    . ARG A 1 514 ? 7.255   17.986  18.033  1.00 21.59  ? 771  ARG A CZ    1 
ATOM   3813 N  NH1   . ARG A 1 514 ? 7.198   16.680  17.800  1.00 22.02  ? 771  ARG A NH1   1 
ATOM   3814 N  NH2   . ARG A 1 514 ? 8.381   18.646  17.814  1.00 21.87  ? 771  ARG A NH2   1 
ATOM   3815 N  N     . TYR A 1 515 ? 1.776   21.579  20.750  1.00 17.64  ? 772  TYR A N     1 
ATOM   3816 C  CA    . TYR A 1 515 ? 1.356   22.805  20.091  1.00 18.78  ? 772  TYR A CA    1 
ATOM   3817 C  C     . TYR A 1 515 ? 2.237   23.039  18.863  1.00 18.88  ? 772  TYR A C     1 
ATOM   3818 O  O     . TYR A 1 515 ? 3.438   22.830  18.909  1.00 17.50  ? 772  TYR A O     1 
ATOM   3819 C  CB    . TYR A 1 515 ? 1.433   24.027  21.039  1.00 19.81  ? 772  TYR A CB    1 
ATOM   3820 C  CG    . TYR A 1 515 ? 0.352   23.991  22.088  1.00 19.97  ? 772  TYR A CG    1 
ATOM   3821 C  CD1   . TYR A 1 515 ? -0.917  24.396  21.784  1.00 20.68  ? 772  TYR A CD1   1 
ATOM   3822 C  CD2   . TYR A 1 515 ? 0.596   23.460  23.346  1.00 19.53  ? 772  TYR A CD2   1 
ATOM   3823 C  CE1   . TYR A 1 515 ? -1.931  24.314  22.692  1.00 20.65  ? 772  TYR A CE1   1 
ATOM   3824 C  CE2   . TYR A 1 515 ? -0.406  23.349  24.285  1.00 20.68  ? 772  TYR A CE2   1 
ATOM   3825 C  CZ    . TYR A 1 515 ? -1.662  23.783  23.955  1.00 21.03  ? 772  TYR A CZ    1 
ATOM   3826 O  OH    . TYR A 1 515 ? -2.640  23.744  24.883  1.00 21.42  ? 772  TYR A OH    1 
ATOM   3827 N  N     . LEU A 1 516 ? 1.644   23.462  17.768  1.00 19.69  ? 773  LEU A N     1 
ATOM   3828 C  CA    . LEU A 1 516 ? 2.432   23.655  16.542  1.00 22.20  ? 773  LEU A CA    1 
ATOM   3829 C  C     . LEU A 1 516 ? 2.142   24.994  15.920  1.00 23.65  ? 773  LEU A C     1 
ATOM   3830 O  O     . LEU A 1 516 ? 1.556   25.060  14.833  1.00 22.96  ? 773  LEU A O     1 
ATOM   3831 C  CB    . LEU A 1 516 ? 2.181   22.535  15.528  1.00 23.11  ? 773  LEU A CB    1 
ATOM   3832 C  CG    . LEU A 1 516 ? 2.586   21.137  15.984  1.00 23.34  ? 773  LEU A CG    1 
ATOM   3833 C  CD1   . LEU A 1 516 ? 1.914   20.107  15.092  1.00 24.32  ? 773  LEU A CD1   1 
ATOM   3834 C  CD2   . LEU A 1 516 ? 4.103   20.974  15.979  1.00 22.92  ? 773  LEU A CD2   1 
ATOM   3835 N  N     . PRO A 1 517 ? 2.607   26.063  16.573  1.00 25.04  ? 774  PRO A N     1 
ATOM   3836 C  CA    . PRO A 1 517 ? 2.352   27.415  16.005  1.00 27.90  ? 774  PRO A CA    1 
ATOM   3837 C  C     . PRO A 1 517 ? 3.101   27.684  14.703  1.00 28.56  ? 774  PRO A C     1 
ATOM   3838 O  O     . PRO A 1 517 ? 2.686   28.548  13.971  1.00 28.26  ? 774  PRO A O     1 
ATOM   3839 C  CB    . PRO A 1 517 ? 2.773   28.351  17.139  1.00 27.73  ? 774  PRO A CB    1 
ATOM   3840 C  CG    . PRO A 1 517 ? 3.866   27.582  17.817  1.00 27.15  ? 774  PRO A CG    1 
ATOM   3841 C  CD    . PRO A 1 517 ? 3.398   26.143  17.812  1.00 24.97  ? 774  PRO A CD    1 
ATOM   3842 N  N     . ASP A 1 518 ? 4.130   26.895  14.416  1.00 28.49  ? 775  ASP A N     1 
ATOM   3843 C  CA    . ASP A 1 518 ? 4.935   27.038  13.204  1.00 30.46  ? 775  ASP A CA    1 
ATOM   3844 C  C     . ASP A 1 518 ? 4.190   26.643  11.927  1.00 29.58  ? 775  ASP A C     1 
ATOM   3845 O  O     . ASP A 1 518 ? 4.641   26.940  10.823  1.00 29.76  ? 775  ASP A O     1 
ATOM   3846 C  CB    . ASP A 1 518 ? 6.230   26.231  13.320  1.00 31.40  ? 775  ASP A CB    1 
ATOM   3847 C  CG    . ASP A 1 518 ? 7.311   26.974  14.077  1.00 34.74  ? 775  ASP A CG    1 
ATOM   3848 O  OD1   . ASP A 1 518 ? 7.048   28.106  14.531  1.00 37.93  ? 775  ASP A OD1   1 
ATOM   3849 O  OD2   . ASP A 1 518 ? 8.424   26.426  14.219  1.00 36.96  ? 775  ASP A OD2   1 
ATOM   3850 N  N     . ILE A 1 519 ? 3.063   25.959  12.080  1.00 28.30  ? 776  ILE A N     1 
ATOM   3851 C  CA    . ILE A 1 519 ? 2.355   25.380  10.944  1.00 30.84  ? 776  ILE A CA    1 
ATOM   3852 C  C     . ILE A 1 519 ? 1.909   26.432  9.922   1.00 33.03  ? 776  ILE A C     1 
ATOM   3853 O  O     . ILE A 1 519 ? 1.980   26.198  8.717   1.00 35.44  ? 776  ILE A O     1 
ATOM   3854 C  CB    . ILE A 1 519 ? 1.136   24.561  11.413  1.00 30.82  ? 776  ILE A CB    1 
ATOM   3855 C  CG1   . ILE A 1 519 ? 0.798   23.469  10.396  1.00 33.10  ? 776  ILE A CG1   1 
ATOM   3856 C  CG2   . ILE A 1 519 ? -0.059  25.468  11.659  1.00 29.77  ? 776  ILE A CG2   1 
ATOM   3857 C  CD1   . ILE A 1 519 ? 1.337   22.106  10.767  1.00 32.24  ? 776  ILE A CD1   1 
ATOM   3858 N  N     . THR A 1 520 ? 1.442   27.578  10.403  1.00 34.21  ? 777  THR A N     1 
ATOM   3859 C  CA    . THR A 1 520 ? 1.077   28.701  9.535   1.00 37.81  ? 777  THR A CA    1 
ATOM   3860 C  C     . THR A 1 520 ? 2.256   29.309  8.756   1.00 39.64  ? 777  THR A C     1 
ATOM   3861 O  O     . THR A 1 520 ? 2.108   29.722  7.607   1.00 43.41  ? 777  THR A O     1 
ATOM   3862 C  CB    . THR A 1 520 ? 0.360   29.815  10.322  1.00 37.93  ? 777  THR A CB    1 
ATOM   3863 O  OG1   . THR A 1 520 ? 1.196   30.262  11.397  1.00 41.72  ? 777  THR A OG1   1 
ATOM   3864 C  CG2   . THR A 1 520 ? -0.955  29.304  10.887  1.00 36.63  ? 777  THR A CG2   1 
ATOM   3865 N  N     . SER A 1 521 ? 3.409   29.383  9.412   1.00 37.98  ? 778  SER A N     1 
ATOM   3866 C  CA    . SER A 1 521 ? 4.580   30.137  8.946   1.00 39.13  ? 778  SER A CA    1 
ATOM   3867 C  C     . SER A 1 521 ? 4.654   30.344  7.410   1.00 41.12  ? 778  SER A C     1 
ATOM   3868 O  O     . SER A 1 521 ? 4.324   29.453  6.626   1.00 40.05  ? 778  SER A O     1 
ATOM   3869 C  CB    . SER A 1 521 ? 5.837   29.405  9.410   1.00 38.05  ? 778  SER A CB    1 
ATOM   3870 O  OG    . SER A 1 521 ? 7.015   30.021  8.967   1.00 39.78  ? 778  SER A OG    1 
ATOM   3871 N  N     . ARG A 1 522 ? 5.111   31.508  6.977   1.00 43.87  ? 779  ARG A N     1 
ATOM   3872 C  CA    . ARG A 1 522 ? 5.371   31.667  5.552   1.00 47.55  ? 779  ARG A CA    1 
ATOM   3873 C  C     . ARG A 1 522 ? 6.767   31.226  5.111   1.00 48.94  ? 779  ARG A C     1 
ATOM   3874 O  O     . ARG A 1 522 ? 7.057   31.263  3.917   1.00 50.56  ? 779  ARG A O     1 
ATOM   3875 C  CB    . ARG A 1 522 ? 5.052   33.067  5.062   1.00 50.70  ? 779  ARG A CB    1 
ATOM   3876 C  CG    . ARG A 1 522 ? 3.614   33.190  4.582   1.00 51.80  ? 779  ARG A CG    1 
ATOM   3877 C  CD    . ARG A 1 522 ? 2.676   33.196  5.775   1.00 52.16  ? 779  ARG A CD    1 
ATOM   3878 N  NE    . ARG A 1 522 ? 2.944   34.375  6.595   1.00 53.50  ? 779  ARG A NE    1 
ATOM   3879 C  CZ    . ARG A 1 522 ? 2.581   34.536  7.861   1.00 51.71  ? 779  ARG A CZ    1 
ATOM   3880 N  NH1   . ARG A 1 522 ? 1.906   33.595  8.512   1.00 48.71  ? 779  ARG A NH1   1 
ATOM   3881 N  NH2   . ARG A 1 522 ? 2.906   35.679  8.469   1.00 54.81  ? 779  ARG A NH2   1 
ATOM   3882 N  N     . ASN A 1 523 ? 7.616   30.803  6.051   1.00 47.93  ? 780  ASN A N     1 
ATOM   3883 C  CA    . ASN A 1 523 ? 8.868   30.141  5.686   1.00 47.82  ? 780  ASN A CA    1 
ATOM   3884 C  C     . ASN A 1 523 ? 8.548   28.668  5.361   1.00 45.02  ? 780  ASN A C     1 
ATOM   3885 O  O     . ASN A 1 523 ? 7.968   27.947  6.187   1.00 41.86  ? 780  ASN A O     1 
ATOM   3886 C  CB    . ASN A 1 523 ? 9.907   30.285  6.806   1.00 48.05  ? 780  ASN A CB    1 
ATOM   3887 C  CG    . ASN A 1 523 ? 11.217  29.554  6.494   1.00 50.54  ? 780  ASN A CG    1 
ATOM   3888 O  OD1   . ASN A 1 523 ? 11.263  28.327  6.358   1.00 50.57  ? 780  ASN A OD1   1 
ATOM   3889 N  ND2   . ASN A 1 523 ? 12.288  30.315  6.372   1.00 54.27  ? 780  ASN A ND2   1 
ATOM   3890 N  N     . PHE A 1 524 ? 8.888   28.234  4.154   1.00 46.17  ? 781  PHE A N     1 
ATOM   3891 C  CA    . PHE A 1 524 ? 8.547   26.900  3.692   1.00 45.79  ? 781  PHE A CA    1 
ATOM   3892 C  C     . PHE A 1 524 ? 9.178   25.829  4.590   1.00 43.67  ? 781  PHE A C     1 
ATOM   3893 O  O     . PHE A 1 524 ? 8.530   24.851  4.920   1.00 39.70  ? 781  PHE A O     1 
ATOM   3894 C  CB    . PHE A 1 524 ? 8.956   26.689  2.239   1.00 49.83  ? 781  PHE A CB    1 
ATOM   3895 C  CG    . PHE A 1 524 ? 8.771   25.269  1.752   1.00 51.03  ? 781  PHE A CG    1 
ATOM   3896 C  CD1   . PHE A 1 524 ? 7.506   24.793  1.394   1.00 51.54  ? 781  PHE A CD1   1 
ATOM   3897 C  CD2   . PHE A 1 524 ? 9.860   24.396  1.667   1.00 52.17  ? 781  PHE A CD2   1 
ATOM   3898 C  CE1   . PHE A 1 524 ? 7.330   23.473  0.974   1.00 52.25  ? 781  PHE A CE1   1 
ATOM   3899 C  CE2   . PHE A 1 524 ? 9.692   23.082  1.246   1.00 52.28  ? 781  PHE A CE2   1 
ATOM   3900 C  CZ    . PHE A 1 524 ? 8.427   22.619  0.890   1.00 52.19  ? 781  PHE A CZ    1 
ATOM   3901 N  N     . ASN A 1 525 ? 10.425  26.022  5.009   1.00 43.63  ? 782  ASN A N     1 
ATOM   3902 C  CA    . ASN A 1 525 ? 11.103  24.945  5.752   1.00 42.71  ? 782  ASN A CA    1 
ATOM   3903 C  C     . ASN A 1 525 ? 10.562  24.844  7.164   1.00 38.49  ? 782  ASN A C     1 
ATOM   3904 O  O     . ASN A 1 525 ? 10.289  23.764  7.632   1.00 35.35  ? 782  ASN A O     1 
ATOM   3905 C  CB    . ASN A 1 525 ? 12.615  25.133  5.751   1.00 46.22  ? 782  ASN A CB    1 
ATOM   3906 C  CG    . ASN A 1 525 ? 13.205  25.065  4.353   1.00 50.51  ? 782  ASN A CG    1 
ATOM   3907 O  OD1   . ASN A 1 525 ? 12.707  24.335  3.489   1.00 53.80  ? 782  ASN A OD1   1 
ATOM   3908 N  ND2   . ASN A 1 525 ? 14.263  25.829  4.116   1.00 54.32  ? 782  ASN A ND2   1 
ATOM   3909 N  N     . VAL A 1 526 ? 10.365  25.989  7.808   1.00 37.22  ? 783  VAL A N     1 
ATOM   3910 C  CA    . VAL A 1 526 ? 9.764   26.029  9.125   1.00 34.36  ? 783  VAL A CA    1 
ATOM   3911 C  C     . VAL A 1 526 ? 8.375   25.408  9.134   1.00 32.31  ? 783  VAL A C     1 
ATOM   3912 O  O     . VAL A 1 526 ? 8.083   24.526  9.977   1.00 29.91  ? 783  VAL A O     1 
ATOM   3913 C  CB    . VAL A 1 526 ? 9.703   27.457  9.668   1.00 35.50  ? 783  VAL A CB    1 
ATOM   3914 C  CG1   . VAL A 1 526 ? 8.810   27.507  10.889  1.00 32.51  ? 783  VAL A CG1   1 
ATOM   3915 C  CG2   . VAL A 1 526 ? 11.124  27.977  9.943   1.00 36.83  ? 783  VAL A CG2   1 
ATOM   3916 N  N     . ARG A 1 527 ? 7.541   25.823  8.195   1.00 31.79  ? 784  ARG A N     1 
ATOM   3917 C  CA    . ARG A 1 527 ? 6.204   25.285  8.076   1.00 31.32  ? 784  ARG A CA    1 
ATOM   3918 C  C     . ARG A 1 527 ? 6.166   23.770  7.793   1.00 29.77  ? 784  ARG A C     1 
ATOM   3919 O  O     . ARG A 1 527 ? 5.358   23.054  8.384   1.00 27.66  ? 784  ARG A O     1 
ATOM   3920 C  CB    . ARG A 1 527 ? 5.401   26.022  6.995   1.00 32.98  ? 784  ARG A CB    1 
ATOM   3921 C  CG    . ARG A 1 527 ? 4.002   25.476  6.850   1.00 33.56  ? 784  ARG A CG    1 
ATOM   3922 C  CD    . ARG A 1 527 ? 3.061   26.323  6.003   1.00 36.91  ? 784  ARG A CD    1 
ATOM   3923 N  NE    . ARG A 1 527 ? 3.335   26.162  4.583   1.00 40.12  ? 784  ARG A NE    1 
ATOM   3924 C  CZ    . ARG A 1 527 ? 3.813   27.097  3.777   1.00 43.36  ? 784  ARG A CZ    1 
ATOM   3925 N  NH1   . ARG A 1 527 ? 4.083   28.334  4.188   1.00 45.44  ? 784  ARG A NH1   1 
ATOM   3926 N  NH2   . ARG A 1 527 ? 4.058   26.764  2.525   1.00 47.45  ? 784  ARG A NH2   1 
ATOM   3927 N  N     . SER A 1 528 ? 6.988   23.311  6.864   1.00 31.54  ? 785  SER A N     1 
ATOM   3928 C  CA    . SER A 1 528 ? 7.046   21.885  6.496   1.00 31.82  ? 785  SER A CA    1 
ATOM   3929 C  C     . SER A 1 528 ? 7.414   21.006  7.676   1.00 29.79  ? 785  SER A C     1 
ATOM   3930 O  O     . SER A 1 528 ? 6.830   19.949  7.843   1.00 28.84  ? 785  SER A O     1 
ATOM   3931 C  CB    . SER A 1 528 ? 8.053   21.629  5.356   1.00 34.80  ? 785  SER A CB    1 
ATOM   3932 O  OG    . SER A 1 528 ? 7.738   22.405  4.204   1.00 39.78  ? 785  SER A OG    1 
ATOM   3933 N  N     . PHE A 1 529 ? 8.362   21.463  8.494   1.00 31.03  ? 786  PHE A N     1 
ATOM   3934 C  CA    . PHE A 1 529 ? 8.718   20.780  9.745   1.00 29.68  ? 786  PHE A CA    1 
ATOM   3935 C  C     . PHE A 1 529 ? 7.517   20.642  10.666  1.00 26.85  ? 786  PHE A C     1 
ATOM   3936 O  O     . PHE A 1 529 ? 7.219   19.542  11.166  1.00 23.82  ? 786  PHE A O     1 
ATOM   3937 C  CB    . PHE A 1 529 ? 9.917   21.433  10.467  1.00 32.24  ? 786  PHE A CB    1 
ATOM   3938 C  CG    . PHE A 1 529 ? 10.346  20.671  11.707  1.00 33.89  ? 786  PHE A CG    1 
ATOM   3939 C  CD1   . PHE A 1 529 ? 11.075  19.483  11.592  1.00 35.40  ? 786  PHE A CD1   1 
ATOM   3940 C  CD2   . PHE A 1 529 ? 9.927   21.072  12.987  1.00 33.57  ? 786  PHE A CD2   1 
ATOM   3941 C  CE1   . PHE A 1 529 ? 11.447  18.753  12.733  1.00 35.79  ? 786  PHE A CE1   1 
ATOM   3942 C  CE2   . PHE A 1 529 ? 10.287  20.338  14.136  1.00 33.25  ? 786  PHE A CE2   1 
ATOM   3943 C  CZ    . PHE A 1 529 ? 11.049  19.171  13.996  1.00 33.04  ? 786  PHE A CZ    1 
ATOM   3944 N  N     . ALA A 1 530 ? 6.795   21.750  10.874  1.00 25.42  ? 787  ALA A N     1 
ATOM   3945 C  CA    . ALA A 1 530 ? 5.595   21.723  11.705  1.00 22.97  ? 787  ALA A CA    1 
ATOM   3946 C  C     . ALA A 1 530 ? 4.580   20.715  11.160  1.00 21.84  ? 787  ALA A C     1 
ATOM   3947 O  O     . ALA A 1 530 ? 3.946   19.970  11.927  1.00 20.80  ? 787  ALA A O     1 
ATOM   3948 C  CB    . ALA A 1 530 ? 4.991   23.144  11.801  1.00 22.45  ? 787  ALA A CB    1 
ATOM   3949 N  N     . GLU A 1 531 ? 4.415   20.660  9.846   1.00 23.60  ? 788  GLU A N     1 
ATOM   3950 C  CA    . GLU A 1 531 ? 3.415   19.727  9.255   1.00 24.30  ? 788  GLU A CA    1 
ATOM   3951 C  C     . GLU A 1 531 ? 3.821   18.257  9.514   1.00 23.35  ? 788  GLU A C     1 
ATOM   3952 O  O     . GLU A 1 531 ? 2.970   17.421  9.814   1.00 22.25  ? 788  GLU A O     1 
ATOM   3953 C  CB    . GLU A 1 531 ? 3.251   19.958  7.747   1.00 26.98  ? 788  GLU A CB    1 
ATOM   3954 C  CG    . GLU A 1 531 ? 2.527   21.259  7.414   1.00 28.42  ? 788  GLU A CG    1 
ATOM   3955 C  CD    . GLU A 1 531 ? 2.585   21.624  5.931   1.00 32.52  ? 788  GLU A CD    1 
ATOM   3956 O  OE1   . GLU A 1 531 ? 3.299   20.932  5.149   1.00 34.67  ? 788  GLU A OE1   1 
ATOM   3957 O  OE2   . GLU A 1 531 ? 1.942   22.640  5.547   1.00 32.74  ? 788  GLU A OE2   1 
ATOM   3958 N  N     . ARG A 1 532 ? 5.112   17.985  9.401   1.00 24.98  ? 789  ARG A N     1 
ATOM   3959 C  CA    . ARG A 1 532 ? 5.652   16.638  9.646   1.00 26.53  ? 789  ARG A CA    1 
ATOM   3960 C  C     . ARG A 1 532 ? 5.469   16.268  11.109  1.00 25.08  ? 789  ARG A C     1 
ATOM   3961 O  O     . ARG A 1 532 ? 5.064   15.151  11.410  1.00 25.17  ? 789  ARG A O     1 
ATOM   3962 C  CB    . ARG A 1 532 ? 7.097   16.515  9.163   1.00 28.90  ? 789  ARG A CB    1 
ATOM   3963 C  CG    . ARG A 1 532 ? 7.154   16.527  7.627   1.00 32.29  ? 789  ARG A CG    1 
ATOM   3964 C  CD    . ARG A 1 532 ? 8.492   16.093  7.052   1.00 34.74  ? 789  ARG A CD    1 
ATOM   3965 N  NE    . ARG A 1 532 ? 9.599   16.780  7.689   1.00 36.58  ? 789  ARG A NE    1 
ATOM   3966 C  CZ    . ARG A 1 532 ? 10.070  17.963  7.346   1.00 39.82  ? 789  ARG A CZ    1 
ATOM   3967 N  NH1   . ARG A 1 532 ? 9.589   18.638  6.302   1.00 45.08  ? 789  ARG A NH1   1 
ATOM   3968 N  NH2   . ARG A 1 532 ? 11.072  18.464  8.022   1.00 41.13  ? 789  ARG A NH2   1 
ATOM   3969 N  N     . MET A 1 533 ? 5.649   17.231  12.010  1.00 24.72  ? 790  MET A N     1 
ATOM   3970 C  CA    . MET A 1 533 ? 5.432   16.994  13.437  1.00 22.97  ? 790  MET A CA    1 
ATOM   3971 C  C     . MET A 1 533 ? 3.957   16.749  13.737  1.00 20.78  ? 790  MET A C     1 
ATOM   3972 O  O     . MET A 1 533 ? 3.612   15.886  14.562  1.00 19.91  ? 790  MET A O     1 
ATOM   3973 C  CB    . MET A 1 533 ? 6.009   18.133  14.271  1.00 25.47  ? 790  MET A CB    1 
ATOM   3974 C  CG    . MET A 1 533 ? 7.521   18.234  14.176  1.00 29.78  ? 790  MET A CG    1 
ATOM   3975 S  SD    . MET A 1 533 ? 8.341   16.670  14.638  1.00 37.67  ? 790  MET A SD    1 
ATOM   3976 C  CE    . MET A 1 533 ? 8.433   15.724  13.097  1.00 35.96  ? 790  MET A CE    1 
ATOM   3977 N  N     . ALA A 1 534 ? 3.072   17.406  13.004  1.00 19.36  ? 791  ALA A N     1 
ATOM   3978 C  CA    . ALA A 1 534 ? 1.668   17.167  13.152  1.00 19.24  ? 791  ALA A CA    1 
ATOM   3979 C  C     . ALA A 1 534 ? 1.321   15.735  12.743  1.00 20.19  ? 791  ALA A C     1 
ATOM   3980 O  O     . ALA A 1 534 ? 0.482   15.072  13.386  1.00 18.92  ? 791  ALA A O     1 
ATOM   3981 C  CB    . ALA A 1 534 ? 0.842   18.155  12.348  1.00 19.00  ? 791  ALA A CB    1 
ATOM   3982 N  N     . MET A 1 535 ? 1.971   15.269  11.692  1.00 21.30  ? 792  MET A N     1 
ATOM   3983 C  CA    . MET A 1 535 ? 1.712   13.925  11.161  1.00 23.06  ? 792  MET A CA    1 
ATOM   3984 C  C     . MET A 1 535 ? 2.278   12.853  12.095  1.00 22.56  ? 792  MET A C     1 
ATOM   3985 O  O     . MET A 1 535 ? 1.642   11.862  12.382  1.00 25.35  ? 792  MET A O     1 
ATOM   3986 C  CB    . MET A 1 535 ? 2.399   13.789  9.787   1.00 24.01  ? 792  MET A CB    1 
ATOM   3987 C  CG    . MET A 1 535 ? 1.816   14.681  8.666   1.00 26.98  ? 792  MET A CG    1 
ATOM   3988 S  SD    . MET A 1 535 ? 2.674   14.511  7.056   1.00 30.98  ? 792  MET A SD    1 
ATOM   3989 C  CE    . MET A 1 535 ? 2.742   16.215  6.480   1.00 32.56  ? 792  MET A CE    1 
ATOM   3990 N  N     . ASN A 1 536 ? 3.493   13.073  12.542  1.00 21.59  ? 793  ASN A N     1 
ATOM   3991 C  CA    . ASN A 1 536 ? 4.254   12.093  13.261  1.00 22.04  ? 793  ASN A CA    1 
ATOM   3992 C  C     . ASN A 1 536 ? 3.970   12.006  14.786  1.00 20.74  ? 793  ASN A C     1 
ATOM   3993 O  O     . ASN A 1 536 ? 4.062   10.940  15.375  1.00 19.66  ? 793  ASN A O     1 
ATOM   3994 C  CB    . ASN A 1 536 ? 5.707   12.416  13.084  1.00 22.70  ? 793  ASN A CB    1 
ATOM   3995 C  CG    . ASN A 1 536 ? 6.575   11.368  13.668  1.00 25.45  ? 793  ASN A CG    1 
ATOM   3996 O  OD1   . ASN A 1 536 ? 7.243   11.606  14.678  1.00 25.51  ? 793  ASN A OD1   1 
ATOM   3997 N  ND2   . ASN A 1 536 ? 6.570   10.165  13.040  1.00 27.93  ? 793  ASN A ND2   1 
ATOM   3998 N  N     . THR A 1 537 ? 3.704   13.138  15.420  1.00 19.34  ? 794  THR A N     1 
ATOM   3999 C  CA    . THR A 1 537 ? 3.490   13.145  16.859  1.00 19.08  ? 794  THR A CA    1 
ATOM   4000 C  C     . THR A 1 537 ? 2.346   12.225  17.340  1.00 18.13  ? 794  THR A C     1 
ATOM   4001 O  O     . THR A 1 537 ? 2.558   11.494  18.294  1.00 19.43  ? 794  THR A O     1 
ATOM   4002 C  CB    . THR A 1 537 ? 3.404   14.594  17.423  1.00 19.96  ? 794  THR A CB    1 
ATOM   4003 O  OG1   . THR A 1 537 ? 4.669   15.232  17.192  1.00 21.22  ? 794  THR A OG1   1 
ATOM   4004 C  CG2   . THR A 1 537 ? 3.128   14.570  18.966  1.00 19.26  ? 794  THR A CG2   1 
ATOM   4005 N  N     . PRO A 1 538 ? 1.169   12.204  16.686  1.00 17.52  ? 795  PRO A N     1 
ATOM   4006 C  CA    . PRO A 1 538 ? 0.190   11.260  17.134  1.00 18.02  ? 795  PRO A CA    1 
ATOM   4007 C  C     . PRO A 1 538 ? 0.639   9.782   16.999  1.00 19.41  ? 795  PRO A C     1 
ATOM   4008 O  O     . PRO A 1 538 ? 0.143   8.915   17.739  1.00 20.53  ? 795  PRO A O     1 
ATOM   4009 C  CB    . PRO A 1 538 ? -1.041  11.587  16.278  1.00 17.95  ? 795  PRO A CB    1 
ATOM   4010 C  CG    . PRO A 1 538 ? -0.847  12.965  15.816  1.00 17.57  ? 795  PRO A CG    1 
ATOM   4011 C  CD    . PRO A 1 538 ? 0.631   13.082  15.642  1.00 17.72  ? 795  PRO A CD    1 
ATOM   4012 N  N     . ILE A 1 539 ? 1.586   9.499   16.091  1.00 18.82  ? 796  ILE A N     1 
ATOM   4013 C  CA    . ILE A 1 539 ? 2.064   8.133   15.896  1.00 19.50  ? 796  ILE A CA    1 
ATOM   4014 C  C     . ILE A 1 539 ? 3.067   7.809   17.000  1.00 19.75  ? 796  ILE A C     1 
ATOM   4015 O  O     . ILE A 1 539 ? 2.845   6.893   17.816  1.00 18.71  ? 796  ILE A O     1 
ATOM   4016 C  CB    . ILE A 1 539 ? 2.709   7.950   14.498  1.00 20.02  ? 796  ILE A CB    1 
ATOM   4017 C  CG1   . ILE A 1 539 ? 1.647   8.245   13.407  1.00 20.53  ? 796  ILE A CG1   1 
ATOM   4018 C  CG2   . ILE A 1 539 ? 3.295   6.558   14.426  1.00 20.82  ? 796  ILE A CG2   1 
ATOM   4019 C  CD1   . ILE A 1 539 ? 2.177   8.284   11.974  1.00 22.68  ? 796  ILE A CD1   1 
ATOM   4020 N  N     . GLN A 1 540 ? 4.158   8.567   17.024  1.00 19.64  ? 797  GLN A N     1 
ATOM   4021 C  CA    . GLN A 1 540 ? 5.209   8.346   17.975  1.00 21.30  ? 797  GLN A CA    1 
ATOM   4022 C  C     . GLN A 1 540 ? 4.725   8.535   19.420  1.00 20.33  ? 797  GLN A C     1 
ATOM   4023 O  O     . GLN A 1 540 ? 5.068   7.744   20.287  1.00 18.64  ? 797  GLN A O     1 
ATOM   4024 C  CB    . GLN A 1 540 ? 6.387   9.268   17.687  1.00 25.94  ? 797  GLN A CB    1 
ATOM   4025 C  CG    . GLN A 1 540 ? 7.088   8.914   16.378  1.00 31.64  ? 797  GLN A CG    1 
ATOM   4026 C  CD    . GLN A 1 540 ? 8.429   8.230   16.578  1.00 40.33  ? 797  GLN A CD    1 
ATOM   4027 O  OE1   . GLN A 1 540 ? 9.269   8.665   17.422  1.00 45.83  ? 797  GLN A OE1   1 
ATOM   4028 N  NE2   . GLN A 1 540 ? 8.663   7.157   15.796  1.00 42.36  ? 797  GLN A NE2   1 
ATOM   4029 N  N     . GLY A 1 541 ? 3.915   9.559   19.663  1.00 19.07  ? 798  GLY A N     1 
ATOM   4030 C  CA    . GLY A 1 541 ? 3.409   9.840   21.001  1.00 18.36  ? 798  GLY A CA    1 
ATOM   4031 C  C     . GLY A 1 541 ? 2.410   8.822   21.484  1.00 18.00  ? 798  GLY A C     1 
ATOM   4032 O  O     . GLY A 1 541 ? 2.394   8.488   22.670  1.00 17.77  ? 798  GLY A O     1 
ATOM   4033 N  N     . SER A 1 542 ? 1.568   8.299   20.590  1.00 17.46  ? 799  SER A N     1 
ATOM   4034 C  CA    . SER A 1 542 ? 0.641   7.227   20.996  1.00 16.36  ? 799  SER A CA    1 
ATOM   4035 C  C     . SER A 1 542 ? 1.373   5.922   21.352  1.00 16.30  ? 799  SER A C     1 
ATOM   4036 O  O     . SER A 1 542 ? 1.007   5.246   22.331  1.00 15.64  ? 799  SER A O     1 
ATOM   4037 C  CB    . SER A 1 542 ? -0.440  6.987   19.948  1.00 16.77  ? 799  SER A CB    1 
ATOM   4038 O  OG    . SER A 1 542 ? -1.235  8.142   19.739  1.00 16.10  ? 799  SER A OG    1 
ATOM   4039 N  N     . ALA A 1 543 ? 2.413   5.610   20.595  1.00 15.52  ? 800  ALA A N     1 
ATOM   4040 C  CA    . ALA A 1 543 ? 3.273   4.489   20.873  1.00 15.90  ? 800  ALA A CA    1 
ATOM   4041 C  C     . ALA A 1 543 ? 3.957   4.669   22.259  1.00 16.03  ? 800  ALA A C     1 
ATOM   4042 O  O     . ALA A 1 543 ? 4.023   3.718   23.026  1.00 14.49  ? 800  ALA A O     1 
ATOM   4043 C  CB    . ALA A 1 543 ? 4.332   4.310   19.765  1.00 15.40  ? 800  ALA A CB    1 
ATOM   4044 N  N     . ALA A 1 544 ? 4.382   5.888   22.575  1.00 15.80  ? 801  ALA A N     1 
ATOM   4045 C  CA    . ALA A 1 544 ? 4.907   6.193   23.878  1.00 16.72  ? 801  ALA A CA    1 
ATOM   4046 C  C     . ALA A 1 544 ? 3.853   5.991   24.943  1.00 16.61  ? 801  ALA A C     1 
ATOM   4047 O  O     . ALA A 1 544 ? 4.156   5.326   25.986  1.00 16.84  ? 801  ALA A O     1 
ATOM   4048 C  CB    . ALA A 1 544 ? 5.529   7.612   23.937  1.00 17.29  ? 801  ALA A CB    1 
ATOM   4049 N  N     . ASP A 1 545 ? 2.640   6.496   24.709  1.00 16.80  ? 802  ASP A N     1 
ATOM   4050 C  CA    . ASP A 1 545 ? 1.542   6.339   25.677  1.00 17.27  ? 802  ASP A CA    1 
ATOM   4051 C  C     . ASP A 1 545 ? 1.313   4.830   26.029  1.00 16.82  ? 802  ASP A C     1 
ATOM   4052 O  O     . ASP A 1 545 ? 1.177   4.444   27.222  1.00 15.19  ? 802  ASP A O     1 
ATOM   4053 C  CB    . ASP A 1 545 ? 0.241   6.854   25.115  1.00 19.10  ? 802  ASP A CB    1 
ATOM   4054 C  CG    . ASP A 1 545 ? 0.175   8.380   24.993  1.00 21.25  ? 802  ASP A CG    1 
ATOM   4055 O  OD1   . ASP A 1 545 ? 0.988   9.115   25.610  1.00 20.67  ? 802  ASP A OD1   1 
ATOM   4056 O  OD2   . ASP A 1 545 ? -0.767  8.831   24.285  1.00 22.43  ? 802  ASP A OD2   1 
ATOM   4057 N  N     . ILE A 1 546 ? 1.282   4.004   24.984  1.00 15.92  ? 803  ILE A N     1 
ATOM   4058 C  CA    . ILE A 1 546 ? 1.011   2.590   25.112  1.00 15.85  ? 803  ILE A CA    1 
ATOM   4059 C  C     . ILE A 1 546 ? 2.053   1.882   25.927  1.00 16.14  ? 803  ILE A C     1 
ATOM   4060 O  O     . ILE A 1 546 ? 1.705   1.103   26.839  1.00 14.99  ? 803  ILE A O     1 
ATOM   4061 C  CB    . ILE A 1 546 ? 0.865   1.879   23.759  1.00 16.11  ? 803  ILE A CB    1 
ATOM   4062 C  CG1   . ILE A 1 546 ? -0.397  2.396   23.039  1.00 17.10  ? 803  ILE A CG1   1 
ATOM   4063 C  CG2   . ILE A 1 546 ? 0.826   0.341   23.946  1.00 15.99  ? 803  ILE A CG2   1 
ATOM   4064 C  CD1   . ILE A 1 546 ? -0.401  2.016   21.555  1.00 17.81  ? 803  ILE A CD1   1 
ATOM   4065 N  N     . ILE A 1 547 ? 3.319   2.113   25.601  1.00 16.49  ? 804  ILE A N     1 
ATOM   4066 C  CA    . ILE A 1 547 ? 4.358   1.413   26.362  1.00 17.85  ? 804  ILE A CA    1 
ATOM   4067 C  C     . ILE A 1 547 ? 4.422   1.904   27.805  1.00 16.60  ? 804  ILE A C     1 
ATOM   4068 O  O     . ILE A 1 547 ? 4.703   1.102   28.703  1.00 15.60  ? 804  ILE A O     1 
ATOM   4069 C  CB    . ILE A 1 547 ? 5.742   1.449   25.691  1.00 20.05  ? 804  ILE A CB    1 
ATOM   4070 C  CG1   . ILE A 1 547 ? 6.734   0.547   26.462  1.00 22.28  ? 804  ILE A CG1   1 
ATOM   4071 C  CG2   . ILE A 1 547 ? 6.298   2.842   25.632  1.00 20.22  ? 804  ILE A CG2   1 
ATOM   4072 C  CD1   . ILE A 1 547 ? 7.863   0.007   25.607  1.00 21.74  ? 804  ILE A CD1   1 
ATOM   4073 N  N     . LYS A 1 548 ? 4.101   3.177   28.044  1.00 15.69  ? 805  LYS A N     1 
ATOM   4074 C  CA    . LYS A 1 548 ? 3.998   3.678   29.434  1.00 15.80  ? 805  LYS A CA    1 
ATOM   4075 C  C     . LYS A 1 548 ? 2.897   2.969   30.210  1.00 16.10  ? 805  LYS A C     1 
ATOM   4076 O  O     . LYS A 1 548 ? 3.089   2.558   31.345  1.00 14.97  ? 805  LYS A O     1 
ATOM   4077 C  CB    . LYS A 1 548 ? 3.823   5.186   29.473  1.00 16.38  ? 805  LYS A CB    1 
ATOM   4078 C  CG    . LYS A 1 548 ? 5.065   5.958   29.022  1.00 16.74  ? 805  LYS A CG    1 
ATOM   4079 C  CD    . LYS A 1 548 ? 4.807   7.470   29.012  1.00 18.94  ? 805  LYS A CD    1 
ATOM   4080 C  CE    . LYS A 1 548 ? 6.120   8.276   29.003  1.00 21.42  ? 805  LYS A CE    1 
ATOM   4081 N  NZ    . LYS A 1 548 ? 5.856   9.742   28.971  1.00 24.14  ? 805  LYS A NZ    1 
ATOM   4082 N  N     . LYS A 1 549 ? 1.742   2.817   29.583  1.00 16.64  ? 806  LYS A N     1 
ATOM   4083 C  CA    . LYS A 1 549 ? 0.673   2.071   30.167  1.00 17.70  ? 806  LYS A CA    1 
ATOM   4084 C  C     . LYS A 1 549 ? 1.068   0.608   30.434  1.00 17.70  ? 806  LYS A C     1 
ATOM   4085 O  O     . LYS A 1 549 ? 0.741   0.077   31.498  1.00 17.15  ? 806  LYS A O     1 
ATOM   4086 C  CB    . LYS A 1 549 ? -0.601  2.129   29.299  1.00 19.42  ? 806  LYS A CB    1 
ATOM   4087 C  CG    . LYS A 1 549 ? -1.788  1.633   30.128  1.00 22.64  ? 806  LYS A CG    1 
ATOM   4088 C  CD    . LYS A 1 549 ? -3.112  1.723   29.388  1.00 26.37  ? 806  LYS A CD    1 
ATOM   4089 C  CE    . LYS A 1 549 ? -4.226  0.979   30.148  1.00 28.15  ? 806  LYS A CE    1 
ATOM   4090 N  NZ    . LYS A 1 549 ? -3.991  -0.505  30.312  1.00 24.44  ? 806  LYS A NZ    1 
ATOM   4091 N  N     . ALA A 1 550 ? 1.780   -0.012  29.478  1.00 15.76  ? 807  ALA A N     1 
ATOM   4092 C  CA    . ALA A 1 550 ? 2.248   -1.388  29.605  1.00 16.72  ? 807  ALA A CA    1 
ATOM   4093 C  C     . ALA A 1 550 ? 3.115   -1.514  30.833  1.00 17.17  ? 807  ALA A C     1 
ATOM   4094 O  O     . ALA A 1 550 ? 3.018   -2.539  31.574  1.00 17.07  ? 807  ALA A O     1 
ATOM   4095 C  CB    . ALA A 1 550 ? 3.055   -1.850  28.348  1.00 14.96  ? 807  ALA A CB    1 
ATOM   4096 N  N     . MET A 1 551 ? 3.954   -0.497  31.070  1.00 15.92  ? 808  MET A N     1 
ATOM   4097 C  CA    . MET A 1 551 ? 4.876   -0.515  32.220  1.00 16.14  ? 808  MET A CA    1 
ATOM   4098 C  C     . MET A 1 551 ? 4.154   -0.522  33.543  1.00 16.89  ? 808  MET A C     1 
ATOM   4099 O  O     . MET A 1 551 ? 4.470   -1.297  34.463  1.00 17.29  ? 808  MET A O     1 
ATOM   4100 C  CB    . MET A 1 551 ? 5.853   0.669   32.146  1.00 17.41  ? 808  MET A CB    1 
ATOM   4101 C  CG    . MET A 1 551 ? 6.835   0.535   31.007  1.00 17.83  ? 808  MET A CG    1 
ATOM   4102 S  SD    . MET A 1 551 ? 7.888   1.980   30.725  1.00 20.05  ? 808  MET A SD    1 
ATOM   4103 C  CE    . MET A 1 551 ? 9.025   1.839   32.107  1.00 17.70  ? 808  MET A CE    1 
ATOM   4104 N  N     . ILE A 1 552 ? 3.147   0.325   33.641  1.00 17.31  ? 809  ILE A N     1 
ATOM   4105 C  CA    . ILE A 1 552 ? 2.305   0.391   34.808  1.00 17.59  ? 809  ILE A CA    1 
ATOM   4106 C  C     . ILE A 1 552 ? 1.557   -0.933  35.063  1.00 17.98  ? 809  ILE A C     1 
ATOM   4107 O  O     . ILE A 1 552 ? 1.570   -1.469  36.180  1.00 18.08  ? 809  ILE A O     1 
ATOM   4108 C  CB    . ILE A 1 552 ? 1.354   1.596   34.718  1.00 18.39  ? 809  ILE A CB    1 
ATOM   4109 C  CG1   . ILE A 1 552 ? 2.175   2.909   34.720  1.00 19.56  ? 809  ILE A CG1   1 
ATOM   4110 C  CG2   . ILE A 1 552 ? 0.357   1.593   35.875  1.00 19.94  ? 809  ILE A CG2   1 
ATOM   4111 C  CD1   . ILE A 1 552 ? 1.381   4.086   34.225  1.00 20.22  ? 809  ILE A CD1   1 
ATOM   4112 N  N     . ASP A 1 553 ? 0.967   -1.462  34.018  1.00 17.62  ? 810  ASP A N     1 
ATOM   4113 C  CA    . ASP A 1 553 ? 0.260   -2.718  34.063  1.00 18.59  ? 810  ASP A CA    1 
ATOM   4114 C  C     . ASP A 1 553 ? 1.193   -3.850  34.436  1.00 18.07  ? 810  ASP A C     1 
ATOM   4115 O  O     . ASP A 1 553 ? 0.862   -4.697  35.249  1.00 16.98  ? 810  ASP A O     1 
ATOM   4116 C  CB    . ASP A 1 553 ? -0.376  -3.020  32.685  1.00 18.46  ? 810  ASP A CB    1 
ATOM   4117 C  CG    . ASP A 1 553 ? -1.575  -2.132  32.349  1.00 21.93  ? 810  ASP A CG    1 
ATOM   4118 O  OD1   . ASP A 1 553 ? -2.120  -1.372  33.220  1.00 24.37  ? 810  ASP A OD1   1 
ATOM   4119 O  OD2   . ASP A 1 553 ? -2.014  -2.208  31.172  1.00 25.23  ? 810  ASP A OD2   1 
ATOM   4120 N  N     . LEU A 1 554 ? 2.386   -3.865  33.857  1.00 17.51  ? 811  LEU A N     1 
ATOM   4121 C  CA    . LEU A 1 554 ? 3.333   -4.896  34.165  1.00 17.57  ? 811  LEU A CA    1 
ATOM   4122 C  C     . LEU A 1 554 ? 3.813   -4.904  35.625  1.00 19.35  ? 811  LEU A C     1 
ATOM   4123 O  O     . LEU A 1 554 ? 3.859   -5.967  36.261  1.00 18.13  ? 811  LEU A O     1 
ATOM   4124 C  CB    . LEU A 1 554 ? 4.548   -4.765  33.246  1.00 18.13  ? 811  LEU A CB    1 
ATOM   4125 C  CG    . LEU A 1 554 ? 5.606   -5.852  33.415  1.00 18.25  ? 811  LEU A CG    1 
ATOM   4126 C  CD1   . LEU A 1 554 ? 4.987   -7.244  33.255  1.00 17.28  ? 811  LEU A CD1   1 
ATOM   4127 C  CD2   . LEU A 1 554 ? 6.705   -5.552  32.395  1.00 18.83  ? 811  LEU A CD2   1 
ATOM   4128 N  N     . ASN A 1 555 ? 4.174   -3.734  36.169  1.00 18.69  ? 812  ASN A N     1 
ATOM   4129 C  CA    . ASN A 1 555 ? 4.562   -3.609  37.556  1.00 19.23  ? 812  ASN A CA    1 
ATOM   4130 C  C     . ASN A 1 555 ? 3.475   -4.158  38.494  1.00 19.55  ? 812  ASN A C     1 
ATOM   4131 O  O     . ASN A 1 555 ? 3.786   -4.877  39.445  1.00 17.73  ? 812  ASN A O     1 
ATOM   4132 C  CB    . ASN A 1 555 ? 4.812   -2.129  37.870  1.00 21.39  ? 812  ASN A CB    1 
ATOM   4133 C  CG    . ASN A 1 555 ? 5.167   -1.882  39.300  1.00 25.76  ? 812  ASN A CG    1 
ATOM   4134 O  OD1   . ASN A 1 555 ? 6.313   -2.008  39.680  1.00 29.60  ? 812  ASN A OD1   1 
ATOM   4135 N  ND2   . ASN A 1 555 ? 4.200   -1.453  40.081  1.00 28.11  ? 812  ASN A ND2   1 
ATOM   4136 N  N     . ALA A 1 556 ? 2.211   -3.853  38.201  1.00 19.07  ? 813  ALA A N     1 
ATOM   4137 C  CA    . ALA A 1 556 ? 1.108   -4.326  39.028  1.00 21.10  ? 813  ALA A CA    1 
ATOM   4138 C  C     . ALA A 1 556 ? 1.002   -5.877  38.924  1.00 20.78  ? 813  ALA A C     1 
ATOM   4139 O  O     . ALA A 1 556 ? 0.870   -6.573  39.932  1.00 20.91  ? 813  ALA A O     1 
ATOM   4140 C  CB    . ALA A 1 556 ? -0.220  -3.663  38.620  1.00 21.44  ? 813  ALA A CB    1 
ATOM   4141 N  N     . ARG A 1 557 ? 1.083   -6.385  37.698  1.00 20.68  ? 814  ARG A N     1 
ATOM   4142 C  CA    . ARG A 1 557 ? 0.981   -7.819  37.443  1.00 21.77  ? 814  ARG A CA    1 
ATOM   4143 C  C     . ARG A 1 557 ? 2.103   -8.629  38.090  1.00 19.88  ? 814  ARG A C     1 
ATOM   4144 O  O     . ARG A 1 557 ? 1.857   -9.696  38.647  1.00 18.89  ? 814  ARG A O     1 
ATOM   4145 C  CB    . ARG A 1 557 ? 0.944   -8.093  35.939  1.00 24.21  ? 814  ARG A CB    1 
ATOM   4146 C  CG    . ARG A 1 557 ? -0.440  -7.981  35.322  1.00 30.25  ? 814  ARG A CG    1 
ATOM   4147 C  CD    . ARG A 1 557 ? -1.448  -8.838  36.070  1.00 34.38  ? 814  ARG A CD    1 
ATOM   4148 N  NE    . ARG A 1 557 ? -1.144  -10.261 35.962  1.00 38.00  ? 814  ARG A NE    1 
ATOM   4149 C  CZ    . ARG A 1 557 ? -1.451  -11.013 34.910  1.00 41.64  ? 814  ARG A CZ    1 
ATOM   4150 N  NH1   . ARG A 1 557 ? -2.071  -10.477 33.868  1.00 40.26  ? 814  ARG A NH1   1 
ATOM   4151 N  NH2   . ARG A 1 557 ? -1.137  -12.300 34.899  1.00 41.96  ? 814  ARG A NH2   1 
ATOM   4152 N  N     . LEU A 1 558 ? 3.331   -8.124  38.023  1.00 18.35  ? 815  LEU A N     1 
ATOM   4153 C  CA    . LEU A 1 558 ? 4.457   -8.813  38.655  1.00 19.43  ? 815  LEU A CA    1 
ATOM   4154 C  C     . LEU A 1 558 ? 4.259   -8.978  40.157  1.00 20.53  ? 815  LEU A C     1 
ATOM   4155 O  O     . LEU A 1 558 ? 4.580   -10.025 40.713  1.00 21.04  ? 815  LEU A O     1 
ATOM   4156 C  CB    . LEU A 1 558 ? 5.795   -8.089  38.373  1.00 18.75  ? 815  LEU A CB    1 
ATOM   4157 C  CG    . LEU A 1 558 ? 6.265   -8.093  36.932  1.00 18.65  ? 815  LEU A CG    1 
ATOM   4158 C  CD1   . LEU A 1 558 ? 7.456   -7.144  36.779  1.00 18.90  ? 815  LEU A CD1   1 
ATOM   4159 C  CD2   . LEU A 1 558 ? 6.592   -9.536  36.473  1.00 18.23  ? 815  LEU A CD2   1 
ATOM   4160 N  N     . LYS A 1 559 ? 3.722   -7.957  40.807  1.00 22.47  ? 816  LYS A N     1 
ATOM   4161 C  CA    . LYS A 1 559 ? 3.413   -8.013  42.240  1.00 26.28  ? 816  LYS A CA    1 
ATOM   4162 C  C     . LYS A 1 559 ? 2.256   -8.962  42.540  1.00 26.02  ? 816  LYS A C     1 
ATOM   4163 O  O     . LYS A 1 559 ? 2.351   -9.760  43.468  1.00 24.89  ? 816  LYS A O     1 
ATOM   4164 C  CB    . LYS A 1 559 ? 3.072   -6.622  42.823  1.00 29.84  ? 816  LYS A CB    1 
ATOM   4165 C  CG    . LYS A 1 559 ? 4.244   -5.668  42.836  1.00 34.85  ? 816  LYS A CG    1 
ATOM   4166 C  CD    . LYS A 1 559 ? 3.895   -4.278  43.394  1.00 42.30  ? 816  LYS A CD    1 
ATOM   4167 C  CE    . LYS A 1 559 ? 5.137   -3.360  43.404  1.00 45.42  ? 816  LYS A CE    1 
ATOM   4168 N  NZ    . LYS A 1 559 ? 4.886   -1.956  43.917  1.00 50.18  ? 816  LYS A NZ    1 
ATOM   4169 N  N     . GLU A 1 560 ? 1.169   -8.862  41.785  1.00 25.86  ? 817  GLU A N     1 
ATOM   4170 C  CA    . GLU A 1 560 ? 0.060   -9.818  41.917  1.00 29.49  ? 817  GLU A CA    1 
ATOM   4171 C  C     . GLU A 1 560 ? 0.512   -11.277 41.803  1.00 28.93  ? 817  GLU A C     1 
ATOM   4172 O  O     . GLU A 1 560 ? 0.044   -12.129 42.567  1.00 29.07  ? 817  GLU A O     1 
ATOM   4173 C  CB    . GLU A 1 560 ? -0.993  -9.610  40.835  1.00 33.99  ? 817  GLU A CB    1 
ATOM   4174 C  CG    . GLU A 1 560 ? -1.950  -8.457  40.994  1.00 40.08  ? 817  GLU A CG    1 
ATOM   4175 C  CD    . GLU A 1 560 ? -2.625  -8.155  39.641  1.00 46.59  ? 817  GLU A CD    1 
ATOM   4176 O  OE1   . GLU A 1 560 ? -3.176  -9.119  39.037  1.00 50.90  ? 817  GLU A OE1   1 
ATOM   4177 O  OE2   . GLU A 1 560 ? -2.531  -6.989  39.125  1.00 54.13  ? 817  GLU A OE2   1 
ATOM   4178 N  N     . GLU A 1 561 ? 1.444   -11.549 40.884  1.00 26.41  ? 818  GLU A N     1 
ATOM   4179 C  CA    . GLU A 1 561 ? 1.925   -12.906 40.605  1.00 28.10  ? 818  GLU A CA    1 
ATOM   4180 C  C     . GLU A 1 561 ? 3.068   -13.364 41.529  1.00 27.91  ? 818  GLU A C     1 
ATOM   4181 O  O     . GLU A 1 561 ? 3.577   -14.499 41.405  1.00 26.88  ? 818  GLU A O     1 
ATOM   4182 C  CB    . GLU A 1 561 ? 2.446   -12.989 39.168  1.00 28.67  ? 818  GLU A CB    1 
ATOM   4183 C  CG    . GLU A 1 561 ? 1.426   -12.739 38.087  1.00 30.43  ? 818  GLU A CG    1 
ATOM   4184 C  CD    . GLU A 1 561 ? 0.425   -13.855 37.978  1.00 37.59  ? 818  GLU A CD    1 
ATOM   4185 O  OE1   . GLU A 1 561 ? 0.755   -14.960 38.457  1.00 44.84  ? 818  GLU A OE1   1 
ATOM   4186 O  OE2   . GLU A 1 561 ? -0.703  -13.618 37.472  1.00 39.98  ? 818  GLU A OE2   1 
ATOM   4187 N  N     . ARG A 1 562 ? 3.477   -12.459 42.418  1.00 26.84  ? 819  ARG A N     1 
ATOM   4188 C  CA    . ARG A 1 562 ? 4.500   -12.698 43.391  1.00 26.07  ? 819  ARG A CA    1 
ATOM   4189 C  C     . ARG A 1 562 ? 5.836   -13.086 42.749  1.00 25.34  ? 819  ARG A C     1 
ATOM   4190 O  O     . ARG A 1 562 ? 6.563   -13.913 43.292  1.00 26.53  ? 819  ARG A O     1 
ATOM   4191 C  CB    . ARG A 1 562 ? 4.052   -13.806 44.338  1.00 27.19  ? 819  ARG A CB    1 
ATOM   4192 C  CG    . ARG A 1 562 ? 2.646   -13.653 44.882  1.00 28.19  ? 819  ARG A CG    1 
ATOM   4193 C  CD    . ARG A 1 562 ? 2.559   -12.343 45.600  1.00 27.63  ? 819  ARG A CD    1 
ATOM   4194 N  NE    . ARG A 1 562 ? 1.467   -12.255 46.562  1.00 28.20  ? 819  ARG A NE    1 
ATOM   4195 C  CZ    . ARG A 1 562 ? 0.637   -11.213 46.669  1.00 28.12  ? 819  ARG A CZ    1 
ATOM   4196 N  NH1   . ARG A 1 562 ? 0.726   -10.179 45.846  1.00 27.29  ? 819  ARG A NH1   1 
ATOM   4197 N  NH2   . ARG A 1 562 ? -0.282  -11.198 47.621  1.00 30.14  ? 819  ARG A NH2   1 
ATOM   4198 N  N     . LEU A 1 563 ? 6.162   -12.492 41.621  1.00 23.27  ? 820  LEU A N     1 
ATOM   4199 C  CA    . LEU A 1 563 ? 7.431   -12.758 40.955  1.00 23.70  ? 820  LEU A CA    1 
ATOM   4200 C  C     . LEU A 1 563 ? 8.515   -11.810 41.496  1.00 23.69  ? 820  LEU A C     1 
ATOM   4201 O  O     . LEU A 1 563 ? 8.203   -10.711 41.935  1.00 23.09  ? 820  LEU A O     1 
ATOM   4202 C  CB    . LEU A 1 563 ? 7.257   -12.565 39.460  1.00 22.82  ? 820  LEU A CB    1 
ATOM   4203 C  CG    . LEU A 1 563 ? 6.420   -13.620 38.771  1.00 23.67  ? 820  LEU A CG    1 
ATOM   4204 C  CD1   . LEU A 1 563 ? 5.909   -13.093 37.436  1.00 24.07  ? 820  LEU A CD1   1 
ATOM   4205 C  CD2   . LEU A 1 563 ? 7.180   -14.929 38.590  1.00 24.82  ? 820  LEU A CD2   1 
ATOM   4206 N  N     . GLN A 1 564 ? 9.761   -12.276 41.505  1.00 24.55  ? 821  GLN A N     1 
ATOM   4207 C  CA    . GLN A 1 564 ? 10.898  -11.450 41.836  1.00 24.39  ? 821  GLN A CA    1 
ATOM   4208 C  C     . GLN A 1 564 ? 11.417  -10.642 40.651  1.00 24.49  ? 821  GLN A C     1 
ATOM   4209 O  O     . GLN A 1 564 ? 12.266  -9.778  40.819  1.00 26.41  ? 821  GLN A O     1 
ATOM   4210 C  CB    . GLN A 1 564 ? 12.012  -12.310 42.421  1.00 26.40  ? 821  GLN A CB    1 
ATOM   4211 C  CG    . GLN A 1 564 ? 11.581  -13.079 43.669  1.00 27.75  ? 821  GLN A CG    1 
ATOM   4212 C  CD    . GLN A 1 564 ? 12.717  -13.859 44.292  1.00 30.12  ? 821  GLN A CD    1 
ATOM   4213 O  OE1   . GLN A 1 564 ? 12.622  -15.069 44.454  1.00 33.42  ? 821  GLN A OE1   1 
ATOM   4214 N  NE2   . GLN A 1 564 ? 13.774  -13.183 44.653  1.00 28.71  ? 821  GLN A NE2   1 
ATOM   4215 N  N     . ALA A 1 565 ? 10.943  -10.949 39.449  1.00 22.30  ? 822  ALA A N     1 
ATOM   4216 C  CA    . ALA A 1 565 ? 11.342  -10.266 38.258  1.00 21.20  ? 822  ALA A CA    1 
ATOM   4217 C  C     . ALA A 1 565 ? 11.313  -8.757  38.423  1.00 22.22  ? 822  ALA A C     1 
ATOM   4218 O  O     . ALA A 1 565 ? 10.371  -8.226  38.948  1.00 21.84  ? 822  ALA A O     1 
ATOM   4219 C  CB    . ALA A 1 565 ? 10.439  -10.669 37.084  1.00 19.23  ? 822  ALA A CB    1 
ATOM   4220 N  N     . ARG A 1 566 ? 12.330  -8.047  37.951  1.00 22.82  ? 823  ARG A N     1 
ATOM   4221 C  CA    . ARG A 1 566 ? 12.196  -6.608  37.968  1.00 24.49  ? 823  ARG A CA    1 
ATOM   4222 C  C     . ARG A 1 566 ? 12.556  -5.897  36.665  1.00 23.05  ? 823  ARG A C     1 
ATOM   4223 O  O     . ARG A 1 566 ? 13.501  -6.304  35.952  1.00 20.62  ? 823  ARG A O     1 
ATOM   4224 C  CB    . ARG A 1 566 ? 12.966  -6.002  39.116  1.00 28.78  ? 823  ARG A CB    1 
ATOM   4225 C  CG    . ARG A 1 566 ? 14.453  -6.138  39.013  1.00 32.29  ? 823  ARG A CG    1 
ATOM   4226 C  CD    . ARG A 1 566 ? 15.098  -5.479  40.243  1.00 37.48  ? 823  ARG A CD    1 
ATOM   4227 N  NE    . ARG A 1 566 ? 16.297  -6.212  40.550  1.00 41.36  ? 823  ARG A NE    1 
ATOM   4228 C  CZ    . ARG A 1 566 ? 16.513  -7.023  41.567  1.00 44.65  ? 823  ARG A CZ    1 
ATOM   4229 N  NH1   . ARG A 1 566 ? 15.640  -7.188  42.553  1.00 48.31  ? 823  ARG A NH1   1 
ATOM   4230 N  NH2   . ARG A 1 566 ? 17.688  -7.628  41.628  1.00 46.05  ? 823  ARG A NH2   1 
ATOM   4231 N  N     . LEU A 1 567 ? 11.784  -4.835  36.413  1.00 19.98  ? 824  LEU A N     1 
ATOM   4232 C  CA    . LEU A 1 567 ? 11.997  -3.919  35.309  1.00 21.02  ? 824  LEU A CA    1 
ATOM   4233 C  C     . LEU A 1 567 ? 13.286  -3.147  35.493  1.00 18.08  ? 824  LEU A C     1 
ATOM   4234 O  O     . LEU A 1 567 ? 13.507  -2.584  36.553  1.00 17.79  ? 824  LEU A O     1 
ATOM   4235 C  CB    . LEU A 1 567 ? 10.861  -2.912  35.233  1.00 22.86  ? 824  LEU A CB    1 
ATOM   4236 C  CG    . LEU A 1 567 ? 9.803   -3.036  34.178  1.00 26.74  ? 824  LEU A CG    1 
ATOM   4237 C  CD1   . LEU A 1 567 ? 8.809   -1.868  34.364  1.00 24.77  ? 824  LEU A CD1   1 
ATOM   4238 C  CD2   . LEU A 1 567 ? 10.471  -3.038  32.789  1.00 25.69  ? 824  LEU A CD2   1 
ATOM   4239 N  N     . LEU A 1 568 ? 14.129  -3.143  34.464  1.00 17.06  ? 825  LEU A N     1 
ATOM   4240 C  CA    . LEU A 1 568 ? 15.397  -2.432  34.517  1.00 18.28  ? 825  LEU A CA    1 
ATOM   4241 C  C     . LEU A 1 568 ? 15.466  -1.240  33.576  1.00 18.63  ? 825  LEU A C     1 
ATOM   4242 O  O     . LEU A 1 568 ? 15.990  -0.204  33.963  1.00 19.03  ? 825  LEU A O     1 
ATOM   4243 C  CB    . LEU A 1 568 ? 16.570  -3.379  34.200  1.00 18.80  ? 825  LEU A CB    1 
ATOM   4244 C  CG    . LEU A 1 568 ? 16.852  -4.508  35.182  1.00 20.82  ? 825  LEU A CG    1 
ATOM   4245 C  CD1   . LEU A 1 568 ? 18.016  -5.337  34.671  1.00 23.16  ? 825  LEU A CD1   1 
ATOM   4246 C  CD2   . LEU A 1 568 ? 17.101  -4.050  36.596  1.00 21.90  ? 825  LEU A CD2   1 
ATOM   4247 N  N     . LEU A 1 569 ? 14.995  -1.410  32.333  1.00 17.99  ? 826  LEU A N     1 
ATOM   4248 C  CA    . LEU A 1 569 ? 15.099  -0.396  31.319  1.00 18.68  ? 826  LEU A CA    1 
ATOM   4249 C  C     . LEU A 1 569 ? 13.929  -0.429  30.362  1.00 17.97  ? 826  LEU A C     1 
ATOM   4250 O  O     . LEU A 1 569 ? 13.250  -1.451  30.183  1.00 16.27  ? 826  LEU A O     1 
ATOM   4251 C  CB    . LEU A 1 569 ? 16.355  -0.600  30.456  1.00 20.69  ? 826  LEU A CB    1 
ATOM   4252 C  CG    . LEU A 1 569 ? 17.720  -0.579  31.103  1.00 25.01  ? 826  LEU A CG    1 
ATOM   4253 C  CD1   . LEU A 1 569 ? 18.800  -0.958  30.059  1.00 25.94  ? 826  LEU A CD1   1 
ATOM   4254 C  CD2   . LEU A 1 569 ? 17.967  0.814   31.750  1.00 24.46  ? 826  LEU A CD2   1 
ATOM   4255 N  N     . GLN A 1 570 ? 13.698  0.728   29.760  1.00 17.79  ? 827  GLN A N     1 
ATOM   4256 C  CA    . GLN A 1 570 ? 12.790  0.892   28.649  1.00 17.95  ? 827  GLN A CA    1 
ATOM   4257 C  C     . GLN A 1 570 ? 13.609  1.560   27.553  1.00 19.60  ? 827  GLN A C     1 
ATOM   4258 O  O     . GLN A 1 570 ? 14.370  2.516   27.838  1.00 19.41  ? 827  GLN A O     1 
ATOM   4259 C  CB    . GLN A 1 570 ? 11.612  1.791   29.026  1.00 18.97  ? 827  GLN A CB    1 
ATOM   4260 C  CG    . GLN A 1 570 ? 10.518  1.924   27.954  1.00 19.83  ? 827  GLN A CG    1 
ATOM   4261 C  CD    . GLN A 1 570 ? 10.542  3.272   27.249  1.00 21.40  ? 827  GLN A CD    1 
ATOM   4262 O  OE1   . GLN A 1 570 ? 11.586  3.797   26.870  1.00 23.99  ? 827  GLN A OE1   1 
ATOM   4263 N  NE2   . GLN A 1 570 ? 9.414   3.883   27.195  1.00 23.46  ? 827  GLN A NE2   1 
ATOM   4264 N  N     . VAL A 1 571 ? 13.479  1.051   26.324  1.00 19.62  ? 828  VAL A N     1 
ATOM   4265 C  CA    . VAL A 1 571 ? 14.142  1.599   25.134  1.00 22.33  ? 828  VAL A CA    1 
ATOM   4266 C  C     . VAL A 1 571 ? 13.095  1.801   24.014  1.00 24.44  ? 828  VAL A C     1 
ATOM   4267 O  O     . VAL A 1 571 ? 13.054  1.089   23.043  1.00 29.28  ? 828  VAL A O     1 
ATOM   4268 C  CB    . VAL A 1 571 ? 15.307  0.701   24.620  1.00 23.77  ? 828  VAL A CB    1 
ATOM   4269 C  CG1   . VAL A 1 571 ? 16.124  1.458   23.574  1.00 24.63  ? 828  VAL A CG1   1 
ATOM   4270 C  CG2   . VAL A 1 571 ? 16.208  0.252   25.738  1.00 22.77  ? 828  VAL A CG2   1 
ATOM   4271 N  N     . HIS A 1 572 ? 12.172  2.729   24.249  1.00 24.05  ? 829  HIS A N     1 
ATOM   4272 C  CA    . HIS A 1 572 ? 11.106  3.146   23.350  1.00 23.99  ? 829  HIS A CA    1 
ATOM   4273 C  C     . HIS A 1 572 ? 10.037  2.175   23.030  1.00 24.00  ? 829  HIS A C     1 
ATOM   4274 O  O     . HIS A 1 572 ? 8.811   2.497   23.219  1.00 25.62  ? 829  HIS A O     1 
ATOM   4275 C  CB    . HIS A 1 572 ? 11.685  3.808   22.090  1.00 25.36  ? 829  HIS A CB    1 
ATOM   4276 C  CG    . HIS A 1 572 ? 12.686  4.876   22.411  1.00 27.05  ? 829  HIS A CG    1 
ATOM   4277 N  ND1   . HIS A 1 572 ? 12.433  5.857   23.320  1.00 26.28  ? 829  HIS A ND1   1 
ATOM   4278 C  CD2   . HIS A 1 572 ? 14.010  5.020   22.038  1.00 28.54  ? 829  HIS A CD2   1 
ATOM   4279 C  CE1   . HIS A 1 572 ? 13.510  6.637   23.426  1.00 28.07  ? 829  HIS A CE1   1 
ATOM   4280 N  NE2   . HIS A 1 572 ? 14.481  6.119   22.653  1.00 29.22  ? 829  HIS A NE2   1 
ATOM   4281 N  N     . ASP A 1 573 ? 10.414  1.041   22.447  1.00 23.23  ? 830  ASP A N     1 
ATOM   4282 C  CA    . ASP A 1 573 ? 9.428   0.022   22.160  1.00 22.23  ? 830  ASP A CA    1 
ATOM   4283 C  C     . ASP A 1 573 ? 9.757   -1.315  22.789  1.00 22.11  ? 830  ASP A C     1 
ATOM   4284 O  O     . ASP A 1 573 ? 9.121   -2.314  22.467  1.00 18.07  ? 830  ASP A O     1 
ATOM   4285 C  CB    . ASP A 1 573 ? 9.211   -0.143  20.649  1.00 25.07  ? 830  ASP A CB    1 
ATOM   4286 C  CG    . ASP A 1 573 ? 10.400  -0.756  19.940  1.00 30.23  ? 830  ASP A CG    1 
ATOM   4287 O  OD1   . ASP A 1 573 ? 11.483  -0.851  20.575  1.00 31.39  ? 830  ASP A OD1   1 
ATOM   4288 O  OD2   . ASP A 1 573 ? 10.260  -1.159  18.731  1.00 35.97  ? 830  ASP A OD2   1 
ATOM   4289 N  N     . GLU A 1 574 ? 10.744  -1.329  23.675  1.00 21.85  ? 831  GLU A N     1 
ATOM   4290 C  CA    . GLU A 1 574 ? 11.050  -2.535  24.396  1.00 23.16  ? 831  GLU A CA    1 
ATOM   4291 C  C     . GLU A 1 574 ? 11.276  -2.340  25.876  1.00 20.60  ? 831  GLU A C     1 
ATOM   4292 O  O     . GLU A 1 574 ? 11.652  -1.253  26.312  1.00 17.77  ? 831  GLU A O     1 
ATOM   4293 C  CB    . GLU A 1 574 ? 12.247  -3.211  23.798  1.00 28.80  ? 831  GLU A CB    1 
ATOM   4294 C  CG    . GLU A 1 574 ? 13.561  -2.568  24.040  1.00 35.01  ? 831  GLU A CG    1 
ATOM   4295 C  CD    . GLU A 1 574 ? 14.684  -3.423  23.461  1.00 44.65  ? 831  GLU A CD    1 
ATOM   4296 O  OE1   . GLU A 1 574 ? 14.728  -4.650  23.787  1.00 49.04  ? 831  GLU A OE1   1 
ATOM   4297 O  OE2   . GLU A 1 574 ? 15.482  -2.860  22.669  1.00 45.45  ? 831  GLU A OE2   1 
ATOM   4298 N  N     . LEU A 1 575 ? 11.030  -3.416  26.616  1.00 19.14  ? 832  LEU A N     1 
ATOM   4299 C  CA    . LEU A 1 575 ? 11.191  -3.467  28.049  1.00 18.71  ? 832  LEU A CA    1 
ATOM   4300 C  C     . LEU A 1 575 ? 12.192  -4.573  28.392  1.00 19.15  ? 832  LEU A C     1 
ATOM   4301 O  O     . LEU A 1 575 ? 12.137  -5.689  27.847  1.00 18.58  ? 832  LEU A O     1 
ATOM   4302 C  CB    . LEU A 1 575 ? 9.865   -3.744  28.736  1.00 17.93  ? 832  LEU A CB    1 
ATOM   4303 C  CG    . LEU A 1 575 ? 8.731   -2.758  28.545  1.00 17.60  ? 832  LEU A CG    1 
ATOM   4304 C  CD1   . LEU A 1 575 ? 7.515   -3.238  29.315  1.00 17.80  ? 832  LEU A CD1   1 
ATOM   4305 C  CD2   . LEU A 1 575 ? 9.159   -1.383  29.056  1.00 18.62  ? 832  LEU A CD2   1 
ATOM   4306 N  N     . ILE A 1 576 ? 13.145  -4.216  29.265  1.00 18.47  ? 833  ILE A N     1 
ATOM   4307 C  CA    A ILE A 1 576 ? 14.231  -5.121  29.683  0.70 17.83  ? 833  ILE A CA    1 
ATOM   4308 C  CA    B ILE A 1 576 ? 14.205  -5.132  29.691  0.30 17.84  ? 833  ILE A CA    1 
ATOM   4309 C  C     . ILE A 1 576 ? 14.084  -5.353  31.182  1.00 17.66  ? 833  ILE A C     1 
ATOM   4310 O  O     . ILE A 1 576 ? 14.010  -4.379  31.974  1.00 17.11  ? 833  ILE A O     1 
ATOM   4311 C  CB    A ILE A 1 576 ? 15.607  -4.524  29.398  0.70 18.46  ? 833  ILE A CB    1 
ATOM   4312 C  CB    B ILE A 1 576 ? 15.596  -4.584  29.383  0.30 18.02  ? 833  ILE A CB    1 
ATOM   4313 C  CG1   A ILE A 1 576 ? 15.713  -3.876  27.985  0.70 18.91  ? 833  ILE A CG1   1 
ATOM   4314 C  CG1   B ILE A 1 576 ? 15.837  -4.539  27.870  0.30 18.14  ? 833  ILE A CG1   1 
ATOM   4315 C  CG2   A ILE A 1 576 ? 16.718  -5.562  29.637  0.70 18.73  ? 833  ILE A CG2   1 
ATOM   4316 C  CG2   B ILE A 1 576 ? 16.677  -5.410  30.085  0.30 18.32  ? 833  ILE A CG2   1 
ATOM   4317 C  CD1   A ILE A 1 576 ? 15.656  -4.852  26.840  0.70 19.53  ? 833  ILE A CD1   1 
ATOM   4318 C  CD1   B ILE A 1 576 ? 15.838  -3.142  27.296  0.30 17.79  ? 833  ILE A CD1   1 
ATOM   4319 N  N     . LEU A 1 577 ? 14.028  -6.625  31.562  1.00 17.80  ? 834  LEU A N     1 
ATOM   4320 C  CA    . LEU A 1 577 ? 13.895  -7.088  32.927  1.00 18.46  ? 834  LEU A CA    1 
ATOM   4321 C  C     . LEU A 1 577 ? 15.022  -8.064  33.282  1.00 18.09  ? 834  LEU A C     1 
ATOM   4322 O  O     . LEU A 1 577 ? 15.694  -8.562  32.396  1.00 17.52  ? 834  LEU A O     1 
ATOM   4323 C  CB    . LEU A 1 577 ? 12.576  -7.839  33.100  1.00 19.31  ? 834  LEU A CB    1 
ATOM   4324 C  CG    . LEU A 1 577 ? 11.308  -7.058  32.760  1.00 20.09  ? 834  LEU A CG    1 
ATOM   4325 C  CD1   . LEU A 1 577 ? 10.816  -7.238  31.298  1.00 21.35  ? 834  LEU A CD1   1 
ATOM   4326 C  CD2   . LEU A 1 577 ? 10.208  -7.466  33.712  1.00 23.54  ? 834  LEU A CD2   1 
ATOM   4327 N  N     . GLU A 1 578 ? 15.248  -8.289  34.577  1.00 18.53  ? 835  GLU A N     1 
ATOM   4328 C  CA    . GLU A 1 578 ? 16.067  -9.425  35.029  1.00 18.62  ? 835  GLU A CA    1 
ATOM   4329 C  C     . GLU A 1 578 ? 15.196  -10.211 36.018  1.00 18.67  ? 835  GLU A C     1 
ATOM   4330 O  O     . GLU A 1 578 ? 14.356  -9.648  36.670  1.00 18.60  ? 835  GLU A O     1 
ATOM   4331 C  CB    . GLU A 1 578 ? 17.377  -8.981  35.654  1.00 18.70  ? 835  GLU A CB    1 
ATOM   4332 C  CG    . GLU A 1 578 ? 17.217  -8.178  36.927  1.00 19.69  ? 835  GLU A CG    1 
ATOM   4333 C  CD    . GLU A 1 578 ? 18.544  -7.714  37.536  1.00 22.42  ? 835  GLU A CD    1 
ATOM   4334 O  OE1   . GLU A 1 578 ? 19.616  -8.075  36.985  1.00 23.47  ? 835  GLU A OE1   1 
ATOM   4335 O  OE2   . GLU A 1 578 ? 18.523  -7.051  38.645  1.00 22.20  ? 835  GLU A OE2   1 
ATOM   4336 N  N     . ALA A 1 579 ? 15.386  -11.520 36.082  1.00 19.59  ? 836  ALA A N     1 
ATOM   4337 C  CA    . ALA A 1 579 ? 14.589  -12.377 36.929  1.00 19.21  ? 836  ALA A CA    1 
ATOM   4338 C  C     . ALA A 1 579 ? 15.352  -13.664 37.189  1.00 19.44  ? 836  ALA A C     1 
ATOM   4339 O  O     . ALA A 1 579 ? 16.215  -14.014 36.382  1.00 18.34  ? 836  ALA A O     1 
ATOM   4340 C  CB    . ALA A 1 579 ? 13.260  -12.719 36.201  1.00 19.29  ? 836  ALA A CB    1 
ATOM   4341 N  N     . PRO A 1 580 ? 15.013  -14.386 38.294  1.00 20.01  ? 837  PRO A N     1 
ATOM   4342 C  CA    . PRO A 1 580 ? 15.539  -15.720 38.515  1.00 21.35  ? 837  PRO A CA    1 
ATOM   4343 C  C     . PRO A 1 580 ? 15.310  -16.584 37.298  1.00 21.59  ? 837  PRO A C     1 
ATOM   4344 O  O     . PRO A 1 580 ? 14.280  -16.452 36.622  1.00 22.11  ? 837  PRO A O     1 
ATOM   4345 C  CB    . PRO A 1 580 ? 14.733  -16.253 39.709  1.00 22.19  ? 837  PRO A CB    1 
ATOM   4346 C  CG    . PRO A 1 580 ? 14.239  -15.037 40.419  1.00 21.60  ? 837  PRO A CG    1 
ATOM   4347 C  CD    . PRO A 1 580 ? 14.025  -14.004 39.321  1.00 20.55  ? 837  PRO A CD    1 
ATOM   4348 N  N     . LYS A 1 581 ? 16.257  -17.436 36.995  1.00 22.34  ? 838  LYS A N     1 
ATOM   4349 C  CA    . LYS A 1 581 ? 16.078  -18.353 35.870  1.00 24.85  ? 838  LYS A CA    1 
ATOM   4350 C  C     . LYS A 1 581 ? 14.778  -19.154 35.969  1.00 25.04  ? 838  LYS A C     1 
ATOM   4351 O  O     . LYS A 1 581 ? 14.162  -19.436 34.950  1.00 24.49  ? 838  LYS A O     1 
ATOM   4352 C  CB    . LYS A 1 581 ? 17.283  -19.261 35.665  1.00 26.11  ? 838  LYS A CB    1 
ATOM   4353 C  CG    . LYS A 1 581 ? 17.495  -20.321 36.703  1.00 29.74  ? 838  LYS A CG    1 
ATOM   4354 C  CD    . LYS A 1 581 ? 18.850  -21.023 36.539  1.00 32.13  ? 838  LYS A CD    1 
ATOM   4355 C  CE    . LYS A 1 581 ? 18.978  -22.145 37.576  1.00 36.17  ? 838  LYS A CE    1 
ATOM   4356 N  NZ    . LYS A 1 581 ? 20.353  -22.756 37.587  1.00 38.76  ? 838  LYS A NZ    1 
ATOM   4357 N  N     . GLU A 1 582 ? 14.357  -19.490 37.187  1.00 25.33  ? 839  GLU A N     1 
ATOM   4358 C  CA    . GLU A 1 582 ? 13.095  -20.233 37.397  1.00 26.73  ? 839  GLU A CA    1 
ATOM   4359 C  C     . GLU A 1 582 ? 11.841  -19.461 37.032  1.00 25.35  ? 839  GLU A C     1 
ATOM   4360 O  O     . GLU A 1 582 ? 10.764  -20.036 37.123  1.00 24.73  ? 839  GLU A O     1 
ATOM   4361 C  CB    . GLU A 1 582 ? 12.898  -20.667 38.855  1.00 30.84  ? 839  GLU A CB    1 
ATOM   4362 C  CG    . GLU A 1 582 ? 14.123  -21.225 39.534  1.00 35.40  ? 839  GLU A CG    1 
ATOM   4363 C  CD    . GLU A 1 582 ? 14.928  -20.047 40.144  1.00 38.90  ? 839  GLU A CD    1 
ATOM   4364 O  OE1   . GLU A 1 582 ? 14.467  -19.444 41.172  1.00 46.81  ? 839  GLU A OE1   1 
ATOM   4365 O  OE2   . GLU A 1 582 ? 15.931  -19.649 39.541  1.00 32.70  ? 839  GLU A OE2   1 
ATOM   4366 N  N     . GLU A 1 583 ? 11.949  -18.165 36.726  1.00 22.16  ? 840  GLU A N     1 
ATOM   4367 C  CA    . GLU A 1 583 ? 10.793  -17.376 36.360  1.00 22.00  ? 840  GLU A CA    1 
ATOM   4368 C  C     . GLU A 1 583 ? 10.663  -17.158 34.863  1.00 20.91  ? 840  GLU A C     1 
ATOM   4369 O  O     . GLU A 1 583 ? 9.649   -16.596 34.431  1.00 19.85  ? 840  GLU A O     1 
ATOM   4370 C  CB    . GLU A 1 583 ? 10.771  -16.010 37.096  1.00 21.57  ? 840  GLU A CB    1 
ATOM   4371 C  CG    . GLU A 1 583 ? 10.636  -16.136 38.617  1.00 23.74  ? 840  GLU A CG    1 
ATOM   4372 C  CD    . GLU A 1 583 ? 10.503  -14.772 39.297  1.00 24.32  ? 840  GLU A CD    1 
ATOM   4373 O  OE1   . GLU A 1 583 ? 10.490  -13.722 38.571  1.00 24.00  ? 840  GLU A OE1   1 
ATOM   4374 O  OE2   . GLU A 1 583 ? 10.417  -14.739 40.554  1.00 25.43  ? 840  GLU A OE2   1 
ATOM   4375 N  N     . MET A 1 584 ? 11.642  -17.611 34.067  1.00 21.11  ? 841  MET A N     1 
ATOM   4376 C  CA    . MET A 1 584 ? 11.641  -17.290 32.611  1.00 21.34  ? 841  MET A CA    1 
ATOM   4377 C  C     . MET A 1 584 ? 10.382  -17.818 31.926  1.00 20.73  ? 841  MET A C     1 
ATOM   4378 O  O     . MET A 1 584 ? 9.814   -17.107 31.132  1.00 18.98  ? 841  MET A O     1 
ATOM   4379 C  CB    . MET A 1 584 ? 12.875  -17.903 31.894  1.00 23.11  ? 841  MET A CB    1 
ATOM   4380 C  CG    . MET A 1 584 ? 14.176  -17.242 32.297  1.00 23.69  ? 841  MET A CG    1 
ATOM   4381 S  SD    . MET A 1 584 ? 14.251  -15.482 31.832  1.00 25.60  ? 841  MET A SD    1 
ATOM   4382 C  CE    . MET A 1 584 ? 13.944  -14.656 33.369  1.00 22.41  ? 841  MET A CE    1 
ATOM   4383 N  N     . GLU A 1 585 ? 9.960   -19.049 32.249  1.00 21.03  ? 842  GLU A N     1 
ATOM   4384 C  CA    . GLU A 1 585 ? 8.861   -19.701 31.515  1.00 22.11  ? 842  GLU A CA    1 
ATOM   4385 C  C     . GLU A 1 585 ? 7.563   -18.908 31.767  1.00 22.32  ? 842  GLU A C     1 
ATOM   4386 O  O     . GLU A 1 585 ? 6.756   -18.674 30.844  1.00 20.91  ? 842  GLU A O     1 
ATOM   4387 C  CB    . GLU A 1 585 ? 8.718   -21.168 31.862  1.00 23.98  ? 842  GLU A CB    1 
ATOM   4388 C  CG    . GLU A 1 585 ? 9.884   -22.020 31.361  1.00 25.03  ? 842  GLU A CG    1 
ATOM   4389 C  CD    . GLU A 1 585 ? 9.600   -23.487 31.386  1.00 27.47  ? 842  GLU A CD    1 
ATOM   4390 O  OE1   . GLU A 1 585 ? 8.787   -24.020 30.592  1.00 29.53  ? 842  GLU A OE1   1 
ATOM   4391 O  OE2   . GLU A 1 585 ? 10.198  -24.160 32.248  1.00 30.03  ? 842  GLU A OE2   1 
ATOM   4392 N  N     . ARG A 1 586 ? 7.377   -18.474 33.013  1.00 21.59  ? 843  ARG A N     1 
ATOM   4393 C  CA    . ARG A 1 586 ? 6.213   -17.655 33.343  1.00 21.94  ? 843  ARG A CA    1 
ATOM   4394 C  C     . ARG A 1 586 ? 6.285   -16.285 32.693  1.00 19.89  ? 843  ARG A C     1 
ATOM   4395 O  O     . ARG A 1 586 ? 5.298   -15.798 32.225  1.00 19.22  ? 843  ARG A O     1 
ATOM   4396 C  CB    . ARG A 1 586 ? 6.060   -17.504 34.825  1.00 23.69  ? 843  ARG A CB    1 
ATOM   4397 C  CG    . ARG A 1 586 ? 5.769   -18.850 35.487  1.00 27.93  ? 843  ARG A CG    1 
ATOM   4398 C  CD    . ARG A 1 586 ? 4.721   -18.612 36.509  1.00 32.57  ? 843  ARG A CD    1 
ATOM   4399 N  NE    . ARG A 1 586 ? 5.309   -18.299 37.774  1.00 36.64  ? 843  ARG A NE    1 
ATOM   4400 C  CZ    . ARG A 1 586 ? 4.745   -17.561 38.739  1.00 38.41  ? 843  ARG A CZ    1 
ATOM   4401 N  NH1   . ARG A 1 586 ? 3.575   -16.946 38.612  1.00 39.51  ? 843  ARG A NH1   1 
ATOM   4402 N  NH2   . ARG A 1 586 ? 5.407   -17.436 39.857  1.00 40.21  ? 843  ARG A NH2   1 
ATOM   4403 N  N     . LEU A 1 587 ? 7.444   -15.678 32.665  1.00 18.48  ? 844  LEU A N     1 
ATOM   4404 C  CA    . LEU A 1 587 ? 7.588   -14.353 32.030  1.00 19.57  ? 844  LEU A CA    1 
ATOM   4405 C  C     . LEU A 1 587 ? 7.362   -14.388 30.542  1.00 19.32  ? 844  LEU A C     1 
ATOM   4406 O  O     . LEU A 1 587 ? 6.831   -13.414 29.992  1.00 19.56  ? 844  LEU A O     1 
ATOM   4407 C  CB    . LEU A 1 587 ? 8.977   -13.768 32.332  1.00 19.69  ? 844  LEU A CB    1 
ATOM   4408 C  CG    . LEU A 1 587 ? 9.198   -13.357 33.765  1.00 19.48  ? 844  LEU A CG    1 
ATOM   4409 C  CD1   . LEU A 1 587 ? 10.615  -12.890 33.927  1.00 21.19  ? 844  LEU A CD1   1 
ATOM   4410 C  CD2   . LEU A 1 587 ? 8.290   -12.205 34.148  1.00 18.86  ? 844  LEU A CD2   1 
ATOM   4411 N  N     . CYS A 1 588 ? 7.749   -15.493 29.887  1.00 20.67  ? 845  CYS A N     1 
ATOM   4412 C  CA    . CYS A 1 588 ? 7.486   -15.684 28.445  1.00 22.61  ? 845  CYS A CA    1 
ATOM   4413 C  C     . CYS A 1 588 ? 5.995   -15.558 28.105  1.00 23.19  ? 845  CYS A C     1 
ATOM   4414 O  O     . CYS A 1 588 ? 5.631   -15.084 27.017  1.00 24.24  ? 845  CYS A O     1 
ATOM   4415 C  CB    . CYS A 1 588 ? 7.978   -17.066 27.946  1.00 25.38  ? 845  CYS A CB    1 
ATOM   4416 S  SG    . CYS A 1 588 ? 9.783   -17.086 27.807  1.00 28.82  ? 845  CYS A SG    1 
ATOM   4417 N  N     . ARG A 1 589 ? 5.143   -16.019 28.997  1.00 22.25  ? 846  ARG A N     1 
ATOM   4418 C  CA    . ARG A 1 589 ? 3.701   -15.849 28.825  1.00 24.43  ? 846  ARG A CA    1 
ATOM   4419 C  C     . ARG A 1 589 ? 3.185   -14.533 29.345  1.00 23.46  ? 846  ARG A C     1 
ATOM   4420 O  O     . ARG A 1 589 ? 2.420   -13.848 28.657  1.00 25.68  ? 846  ARG A O     1 
ATOM   4421 C  CB    . ARG A 1 589 ? 2.938   -16.991 29.502  1.00 26.32  ? 846  ARG A CB    1 
ATOM   4422 C  CG    . ARG A 1 589 ? 2.996   -18.213 28.621  1.00 30.10  ? 846  ARG A CG    1 
ATOM   4423 C  CD    . ARG A 1 589 ? 2.402   -19.416 29.294  1.00 31.86  ? 846  ARG A CD    1 
ATOM   4424 N  NE    . ARG A 1 589 ? 0.961   -19.385 29.517  1.00 34.01  ? 846  ARG A NE    1 
ATOM   4425 C  CZ    . ARG A 1 589 ? 0.043   -19.749 28.608  1.00 37.62  ? 846  ARG A CZ    1 
ATOM   4426 N  NH1   . ARG A 1 589 ? 0.418   -20.058 27.368  1.00 37.77  ? 846  ARG A NH1   1 
ATOM   4427 N  NH2   . ARG A 1 589 ? -1.253  -19.777 28.928  1.00 37.76  ? 846  ARG A NH2   1 
ATOM   4428 N  N     . LEU A 1 590 ? 3.650   -14.125 30.510  1.00 22.31  ? 847  LEU A N     1 
ATOM   4429 C  CA    . LEU A 1 590 ? 3.096   -12.951 31.170  1.00 21.67  ? 847  LEU A CA    1 
ATOM   4430 C  C     . LEU A 1 590 ? 3.448   -11.638 30.500  1.00 20.20  ? 847  LEU A C     1 
ATOM   4431 O  O     . LEU A 1 590 ? 2.575   -10.832 30.279  1.00 20.83  ? 847  LEU A O     1 
ATOM   4432 C  CB    . LEU A 1 590 ? 3.540   -12.954 32.636  1.00 23.12  ? 847  LEU A CB    1 
ATOM   4433 C  CG    . LEU A 1 590 ? 3.086   -11.820 33.561  1.00 26.23  ? 847  LEU A CG    1 
ATOM   4434 C  CD1   . LEU A 1 590 ? 1.548   -11.710 33.518  1.00 27.57  ? 847  LEU A CD1   1 
ATOM   4435 C  CD2   . LEU A 1 590 ? 3.572   -12.138 34.984  1.00 27.20  ? 847  LEU A CD2   1 
ATOM   4436 N  N     . VAL A 1 591 ? 4.726   -11.396 30.192  1.00 19.25  ? 848  VAL A N     1 
ATOM   4437 C  CA    . VAL A 1 591 ? 5.153   -10.112 29.710  1.00 17.93  ? 848  VAL A CA    1 
ATOM   4438 C  C     . VAL A 1 591 ? 4.529   -9.723  28.367  1.00 17.99  ? 848  VAL A C     1 
ATOM   4439 O  O     . VAL A 1 591 ? 4.008   -8.659  28.261  1.00 16.73  ? 848  VAL A O     1 
ATOM   4440 C  CB    . VAL A 1 591 ? 6.695   -9.961  29.728  1.00 18.43  ? 848  VAL A CB    1 
ATOM   4441 C  CG1   . VAL A 1 591 ? 7.104   -8.610  29.157  1.00 17.69  ? 848  VAL A CG1   1 
ATOM   4442 C  CG2   . VAL A 1 591 ? 7.246   -10.088 31.177  1.00 18.16  ? 848  VAL A CG2   1 
ATOM   4443 N  N     . PRO A 1 592 ? 4.561   -10.617 27.351  1.00 19.72  ? 849  PRO A N     1 
ATOM   4444 C  CA    . PRO A 1 592 ? 3.974   -10.274 26.061  1.00 20.21  ? 849  PRO A CA    1 
ATOM   4445 C  C     . PRO A 1 592 ? 2.480   -10.002 26.193  1.00 21.40  ? 849  PRO A C     1 
ATOM   4446 O  O     . PRO A 1 592 ? 1.994   -9.066  25.558  1.00 20.97  ? 849  PRO A O     1 
ATOM   4447 C  CB    . PRO A 1 592 ? 4.283   -11.498 25.186  1.00 21.04  ? 849  PRO A CB    1 
ATOM   4448 C  CG    . PRO A 1 592 ? 5.531   -12.048 25.812  1.00 21.74  ? 849  PRO A CG    1 
ATOM   4449 C  CD    . PRO A 1 592 ? 5.307   -11.888 27.285  1.00 20.25  ? 849  PRO A CD    1 
ATOM   4450 N  N     . GLU A 1 593 ? 1.776   -10.781 27.008  1.00 21.50  ? 850  GLU A N     1 
ATOM   4451 C  CA    . GLU A 1 593 ? 0.353   -10.616 27.178  1.00 23.60  ? 850  GLU A CA    1 
ATOM   4452 C  C     . GLU A 1 593 ? 0.000   -9.259  27.783  1.00 22.54  ? 850  GLU A C     1 
ATOM   4453 O  O     . GLU A 1 593 ? -0.912  -8.564  27.287  1.00 21.61  ? 850  GLU A O     1 
ATOM   4454 C  CB    . GLU A 1 593 ? -0.232  -11.746 28.041  1.00 29.35  ? 850  GLU A CB    1 
ATOM   4455 C  CG    . GLU A 1 593 ? -1.739  -11.667 28.320  1.00 34.73  ? 850  GLU A CG    1 
ATOM   4456 C  CD    . GLU A 1 593 ? -2.631  -11.927 27.099  1.00 43.08  ? 850  GLU A CD    1 
ATOM   4457 O  OE1   . GLU A 1 593 ? -2.218  -12.634 26.149  1.00 52.20  ? 850  GLU A OE1   1 
ATOM   4458 O  OE2   . GLU A 1 593 ? -3.791  -11.441 27.081  1.00 52.11  ? 850  GLU A OE2   1 
ATOM   4459 N  N     . VAL A 1 594 ? 0.723   -8.865  28.832  1.00 20.38  ? 851  VAL A N     1 
ATOM   4460 C  CA    . VAL A 1 594 ? 0.518   -7.568  29.430  1.00 19.98  ? 851  VAL A CA    1 
ATOM   4461 C  C     . VAL A 1 594 ? 0.784   -6.429  28.429  1.00 18.71  ? 851  VAL A C     1 
ATOM   4462 O  O     . VAL A 1 594 ? -0.020  -5.498  28.309  1.00 20.53  ? 851  VAL A O     1 
ATOM   4463 C  CB    . VAL A 1 594 ? 1.365   -7.388  30.693  1.00 20.07  ? 851  VAL A CB    1 
ATOM   4464 C  CG1   . VAL A 1 594 ? 1.256   -5.966  31.235  1.00 19.63  ? 851  VAL A CG1   1 
ATOM   4465 C  CG2   . VAL A 1 594 ? 0.925   -8.411  31.762  1.00 20.29  ? 851  VAL A CG2   1 
ATOM   4466 N  N     . MET A 1 595 ? 1.884   -6.505  27.703  1.00 17.86  ? 852  MET A N     1 
ATOM   4467 C  CA    . MET A 1 595 ? 2.198   -5.506  26.720  1.00 17.09  ? 852  MET A CA    1 
ATOM   4468 C  C     . MET A 1 595 ? 1.168   -5.490  25.584  1.00 18.15  ? 852  MET A C     1 
ATOM   4469 O  O     . MET A 1 595 ? 0.821   -4.420  25.060  1.00 19.68  ? 852  MET A O     1 
ATOM   4470 C  CB    . MET A 1 595 ? 3.592   -5.792  26.188  1.00 17.87  ? 852  MET A CB    1 
ATOM   4471 C  CG    . MET A 1 595 ? 4.653   -5.522  27.234  1.00 17.71  ? 852  MET A CG    1 
ATOM   4472 S  SD    . MET A 1 595 ? 6.332   -5.916  26.712  1.00 18.87  ? 852  MET A SD    1 
ATOM   4473 C  CE    . MET A 1 595 ? 6.554   -4.690  25.407  1.00 18.73  ? 852  MET A CE    1 
ATOM   4474 N  N     . GLU A 1 596 ? 0.748   -6.663  25.156  1.00 18.46  ? 853  GLU A N     1 
ATOM   4475 C  CA    . GLU A 1 596 ? -0.148  -6.760  24.026  1.00 20.41  ? 853  GLU A CA    1 
ATOM   4476 C  C     . GLU A 1 596 ? -1.535  -6.227  24.385  1.00 22.45  ? 853  GLU A C     1 
ATOM   4477 O  O     . GLU A 1 596 ? -2.243  -5.726  23.517  1.00 23.17  ? 853  GLU A O     1 
ATOM   4478 C  CB    . GLU A 1 596 ? -0.241  -8.197  23.487  1.00 22.41  ? 853  GLU A CB    1 
ATOM   4479 C  CG    . GLU A 1 596 ? 0.964   -8.573  22.615  1.00 24.10  ? 853  GLU A CG    1 
ATOM   4480 C  CD    . GLU A 1 596 ? 1.032   -10.054 22.280  1.00 28.30  ? 853  GLU A CD    1 
ATOM   4481 O  OE1   . GLU A 1 596 ? 0.175   -10.806 22.798  1.00 29.07  ? 853  GLU A OE1   1 
ATOM   4482 O  OE2   . GLU A 1 596 ? 1.920   -10.473 21.472  1.00 30.83  ? 853  GLU A OE2   1 
ATOM   4483 N  N     . GLN A 1 597 ? -1.926  -6.356  25.644  1.00 21.12  ? 854  GLN A N     1 
ATOM   4484 C  CA    . GLN A 1 597 ? -3.275  -5.993  26.067  1.00 22.53  ? 854  GLN A CA    1 
ATOM   4485 C  C     . GLN A 1 597 ? -3.350  -4.612  26.696  1.00 21.67  ? 854  GLN A C     1 
ATOM   4486 O  O     . GLN A 1 597 ? -4.395  -4.222  27.194  1.00 20.54  ? 854  GLN A O     1 
ATOM   4487 C  CB    . GLN A 1 597 ? -3.798  -7.053  27.056  1.00 24.65  ? 854  GLN A CB    1 
ATOM   4488 C  CG    . GLN A 1 597 ? -4.002  -8.421  26.402  1.00 27.84  ? 854  GLN A CG    1 
ATOM   4489 C  CD    . GLN A 1 597 ? -4.924  -8.359  25.202  1.00 31.94  ? 854  GLN A CD    1 
ATOM   4490 O  OE1   . GLN A 1 597 ? -5.996  -7.763  25.273  1.00 36.86  ? 854  GLN A OE1   1 
ATOM   4491 N  NE2   . GLN A 1 597 ? -4.521  -8.956  24.097  1.00 34.16  ? 854  GLN A NE2   1 
ATOM   4492 N  N     . ALA A 1 598 ? -2.241  -3.874  26.676  1.00 20.13  ? 855  ALA A N     1 
ATOM   4493 C  CA    . ALA A 1 598 ? -2.178  -2.549  27.331  1.00 20.75  ? 855  ALA A CA    1 
ATOM   4494 C  C     . ALA A 1 598 ? -3.269  -1.565  26.795  1.00 21.97  ? 855  ALA A C     1 
ATOM   4495 O  O     . ALA A 1 598 ? -3.902  -0.850  27.574  1.00 20.42  ? 855  ALA A O     1 
ATOM   4496 C  CB    . ALA A 1 598 ? -0.807  -1.959  27.163  1.00 18.66  ? 855  ALA A CB    1 
ATOM   4497 N  N     . VAL A 1 599 ? -3.508  -1.605  25.489  1.00 21.64  ? 856  VAL A N     1 
ATOM   4498 C  CA    . VAL A 1 599 ? -4.680  -0.925  24.880  1.00 24.20  ? 856  VAL A CA    1 
ATOM   4499 C  C     . VAL A 1 599 ? -5.313  -1.857  23.834  1.00 25.30  ? 856  VAL A C     1 
ATOM   4500 O  O     . VAL A 1 599 ? -4.721  -2.850  23.448  1.00 28.64  ? 856  VAL A O     1 
ATOM   4501 C  CB    . VAL A 1 599 ? -4.266  0.378   24.199  1.00 25.01  ? 856  VAL A CB    1 
ATOM   4502 C  CG1   . VAL A 1 599 ? -3.602  1.318   25.199  1.00 23.27  ? 856  VAL A CG1   1 
ATOM   4503 C  CG2   . VAL A 1 599 ? -3.321  0.059   23.036  1.00 25.25  ? 856  VAL A CG2   1 
ATOM   4504 N  N     . THR A 1 600 ? -6.522  -1.561  23.405  1.00 25.03  ? 857  THR A N     1 
ATOM   4505 C  CA    . THR A 1 600 ? -7.127  -2.279  22.327  1.00 24.51  ? 857  THR A CA    1 
ATOM   4506 C  C     . THR A 1 600 ? -7.223  -1.361  21.139  1.00 23.50  ? 857  THR A C     1 
ATOM   4507 O  O     . THR A 1 600 ? -7.788  -0.287  21.217  1.00 23.10  ? 857  THR A O     1 
ATOM   4508 C  CB    . THR A 1 600 ? -8.536  -2.758  22.728  1.00 27.64  ? 857  THR A CB    1 
ATOM   4509 O  OG1   . THR A 1 600 ? -8.413  -3.498  23.943  1.00 30.31  ? 857  THR A OG1   1 
ATOM   4510 C  CG2   . THR A 1 600 ? -9.128  -3.712  21.657  1.00 28.98  ? 857  THR A CG2   1 
ATOM   4511 N  N     . LEU A 1 601 ? -6.668  -1.785  20.031  1.00 22.86  ? 858  LEU A N     1 
ATOM   4512 C  CA    . LEU A 1 601 ? -6.632  -1.006  18.805  1.00 22.58  ? 858  LEU A CA    1 
ATOM   4513 C  C     . LEU A 1 601 ? -7.420  -1.784  17.772  1.00 23.25  ? 858  LEU A C     1 
ATOM   4514 O  O     . LEU A 1 601 ? -7.777  -2.949  17.998  1.00 26.12  ? 858  LEU A O     1 
ATOM   4515 C  CB    . LEU A 1 601 ? -5.163  -0.853  18.336  1.00 21.83  ? 858  LEU A CB    1 
ATOM   4516 C  CG    . LEU A 1 601 ? -4.153  -0.091  19.194  1.00 21.24  ? 858  LEU A CG    1 
ATOM   4517 C  CD1   . LEU A 1 601 ? -2.815  0.009   18.464  1.00 22.24  ? 858  LEU A CD1   1 
ATOM   4518 C  CD2   . LEU A 1 601 ? -4.652  1.267   19.592  1.00 20.87  ? 858  LEU A CD2   1 
ATOM   4519 N  N     . ARG A 1 602 ? -7.635  -1.202  16.609  1.00 23.42  ? 859  ARG A N     1 
ATOM   4520 C  CA    . ARG A 1 602 ? -8.275  -1.903  15.500  1.00 24.80  ? 859  ARG A CA    1 
ATOM   4521 C  C     . ARG A 1 602 ? -7.426  -3.004  14.883  1.00 24.06  ? 859  ARG A C     1 
ATOM   4522 O  O     . ARG A 1 602 ? -7.913  -3.742  14.057  1.00 26.08  ? 859  ARG A O     1 
ATOM   4523 C  CB    . ARG A 1 602 ? -8.627  -0.906  14.389  1.00 27.36  ? 859  ARG A CB    1 
ATOM   4524 C  CG    . ARG A 1 602 ? -9.736  0.031   14.815  1.00 29.43  ? 859  ARG A CG    1 
ATOM   4525 C  CD    . ARG A 1 602 ? -9.844  1.233   13.888  1.00 31.70  ? 859  ARG A CD    1 
ATOM   4526 N  NE    . ARG A 1 602 ? -10.880 2.041   14.467  1.00 33.98  ? 859  ARG A NE    1 
ATOM   4527 C  CZ    . ARG A 1 602 ? -10.757 3.249   15.008  1.00 35.86  ? 859  ARG A CZ    1 
ATOM   4528 N  NH1   . ARG A 1 602 ? -9.635  3.972   14.953  1.00 32.77  ? 859  ARG A NH1   1 
ATOM   4529 N  NH2   . ARG A 1 602 ? -11.859 3.784   15.540  1.00 40.66  ? 859  ARG A NH2   1 
ATOM   4530 N  N     . VAL A 1 603 ? -6.153  -3.047  15.235  1.00 21.99  ? 860  VAL A N     1 
ATOM   4531 C  CA    . VAL A 1 603 ? -5.270  -4.103  14.814  1.00 22.05  ? 860  VAL A CA    1 
ATOM   4532 C  C     . VAL A 1 603 ? -4.691  -4.717  16.077  1.00 20.95  ? 860  VAL A C     1 
ATOM   4533 O  O     . VAL A 1 603 ? -4.636  -4.051  17.115  1.00 19.93  ? 860  VAL A O     1 
ATOM   4534 C  CB    . VAL A 1 603 ? -4.190  -3.580  13.847  1.00 21.48  ? 860  VAL A CB    1 
ATOM   4535 C  CG1   . VAL A 1 603 ? -4.886  -3.046  12.580  1.00 22.27  ? 860  VAL A CG1   1 
ATOM   4536 C  CG2   . VAL A 1 603 ? -3.343  -2.479  14.500  1.00 20.47  ? 860  VAL A CG2   1 
ATOM   4537 N  N     . PRO A 1 604 ? -4.240  -5.971  16.000  1.00 21.59  ? 861  PRO A N     1 
ATOM   4538 C  CA    . PRO A 1 604 ? -3.524  -6.538  17.147  1.00 21.21  ? 861  PRO A CA    1 
ATOM   4539 C  C     . PRO A 1 604 ? -2.219  -5.835  17.411  1.00 21.13  ? 861  PRO A C     1 
ATOM   4540 O  O     . PRO A 1 604 ? -1.628  -5.244  16.504  1.00 22.16  ? 861  PRO A O     1 
ATOM   4541 C  CB    . PRO A 1 604 ? -3.226  -7.983  16.696  1.00 22.46  ? 861  PRO A CB    1 
ATOM   4542 C  CG    . PRO A 1 604 ? -4.010  -8.201  15.483  1.00 23.42  ? 861  PRO A CG    1 
ATOM   4543 C  CD    . PRO A 1 604 ? -4.305  -6.905  14.872  1.00 22.92  ? 861  PRO A CD    1 
ATOM   4544 N  N     . LEU A 1 605 ? -1.772  -5.888  18.641  1.00 20.39  ? 862  LEU A N     1 
ATOM   4545 C  CA    . LEU A 1 605 ? -0.417  -5.587  18.982  1.00 20.23  ? 862  LEU A CA    1 
ATOM   4546 C  C     . LEU A 1 605 ? 0.282   -6.929  19.137  1.00 21.53  ? 862  LEU A C     1 
ATOM   4547 O  O     . LEU A 1 605 ? -0.356  -7.917  19.488  1.00 22.92  ? 862  LEU A O     1 
ATOM   4548 C  CB    . LEU A 1 605 ? -0.337  -4.775  20.271  1.00 19.42  ? 862  LEU A CB    1 
ATOM   4549 C  CG    . LEU A 1 605 ? -0.819  -3.330  20.187  1.00 21.01  ? 862  LEU A CG    1 
ATOM   4550 C  CD1   . LEU A 1 605 ? -0.881  -2.731  21.564  1.00 20.88  ? 862  LEU A CD1   1 
ATOM   4551 C  CD2   . LEU A 1 605 ? 0.085   -2.510  19.249  1.00 21.43  ? 862  LEU A CD2   1 
ATOM   4552 N  N     . LYS A 1 606 ? 1.559   -6.962  18.776  1.00 21.54  ? 863  LYS A N     1 
ATOM   4553 C  CA    . LYS A 1 606 ? 2.376   -8.161  18.754  1.00 22.21  ? 863  LYS A CA    1 
ATOM   4554 C  C     . LYS A 1 606 ? 3.679   -7.853  19.486  1.00 21.42  ? 863  LYS A C     1 
ATOM   4555 O  O     . LYS A 1 606 ? 4.327   -6.817  19.211  1.00 19.87  ? 863  LYS A O     1 
ATOM   4556 C  CB    . LYS A 1 606 ? 2.696   -8.626  17.331  1.00 24.91  ? 863  LYS A CB    1 
ATOM   4557 C  CG    . LYS A 1 606 ? 3.347   -10.023 17.285  1.00 27.65  ? 863  LYS A CG    1 
ATOM   4558 C  CD    . LYS A 1 606 ? 3.602   -10.427 15.856  1.00 31.29  ? 863  LYS A CD    1 
ATOM   4559 C  CE    . LYS A 1 606 ? 4.518   -11.628 15.712  1.00 34.27  ? 863  LYS A CE    1 
ATOM   4560 N  NZ    . LYS A 1 606 ? 4.896   -11.784 14.273  1.00 38.02  ? 863  LYS A NZ    1 
ATOM   4561 N  N     . VAL A 1 607 ? 4.055   -8.724  20.431  1.00 20.51  ? 864  VAL A N     1 
ATOM   4562 C  CA    . VAL A 1 607 ? 5.295   -8.534  21.227  1.00 19.39  ? 864  VAL A CA    1 
ATOM   4563 C  C     . VAL A 1 607 ? 6.203   -9.739  21.047  1.00 21.94  ? 864  VAL A C     1 
ATOM   4564 O  O     . VAL A 1 607 ? 5.748   -10.897 21.163  1.00 24.12  ? 864  VAL A O     1 
ATOM   4565 C  CB    . VAL A 1 607 ? 4.921   -8.297  22.702  1.00 18.26  ? 864  VAL A CB    1 
ATOM   4566 C  CG1   . VAL A 1 607 ? 6.123   -8.294  23.652  1.00 16.74  ? 864  VAL A CG1   1 
ATOM   4567 C  CG2   . VAL A 1 607 ? 4.220   -6.953  22.841  1.00 16.63  ? 864  VAL A CG2   1 
ATOM   4568 N  N     . ASP A 1 608 ? 7.463   -9.513  20.693  1.00 22.01  ? 865  ASP A N     1 
ATOM   4569 C  CA    . ASP A 1 608 ? 8.431   -10.591 20.592  1.00 23.54  ? 865  ASP A CA    1 
ATOM   4570 C  C     . ASP A 1 608 ? 9.289   -10.576 21.866  1.00 22.81  ? 865  ASP A C     1 
ATOM   4571 O  O     . ASP A 1 608 ? 9.399   -9.548  22.515  1.00 21.38  ? 865  ASP A O     1 
ATOM   4572 C  CB    . ASP A 1 608 ? 9.314   -10.410 19.386  1.00 26.83  ? 865  ASP A CB    1 
ATOM   4573 C  CG    . ASP A 1 608 ? 8.530   -10.551 18.047  1.00 31.65  ? 865  ASP A CG    1 
ATOM   4574 O  OD1   . ASP A 1 608 ? 7.769   -11.525 17.848  1.00 36.87  ? 865  ASP A OD1   1 
ATOM   4575 O  OD2   . ASP A 1 608 ? 8.708   -9.689  17.184  1.00 35.38  ? 865  ASP A OD2   1 
ATOM   4576 N  N     . TYR A 1 609 ? 9.886   -11.706 22.225  1.00 22.33  ? 866  TYR A N     1 
ATOM   4577 C  CA    . TYR A 1 609 ? 10.672  -11.774 23.463  1.00 22.48  ? 866  TYR A CA    1 
ATOM   4578 C  C     . TYR A 1 609 ? 11.791  -12.770 23.386  1.00 22.08  ? 866  TYR A C     1 
ATOM   4579 O  O     . TYR A 1 609 ? 11.772  -13.735 22.584  1.00 20.25  ? 866  TYR A O     1 
ATOM   4580 C  CB    . TYR A 1 609 ? 9.792   -12.149 24.669  1.00 24.10  ? 866  TYR A CB    1 
ATOM   4581 C  CG    . TYR A 1 609 ? 9.070   -13.426 24.418  1.00 27.92  ? 866  TYR A CG    1 
ATOM   4582 C  CD1   . TYR A 1 609 ? 7.883   -13.420 23.712  1.00 32.01  ? 866  TYR A CD1   1 
ATOM   4583 C  CD2   . TYR A 1 609 ? 9.577   -14.626 24.843  1.00 31.06  ? 866  TYR A CD2   1 
ATOM   4584 C  CE1   . TYR A 1 609 ? 7.211   -14.578 23.453  1.00 34.70  ? 866  TYR A CE1   1 
ATOM   4585 C  CE2   . TYR A 1 609 ? 8.921   -15.811 24.581  1.00 34.68  ? 866  TYR A CE2   1 
ATOM   4586 C  CZ    . TYR A 1 609 ? 7.734   -15.769 23.890  1.00 36.79  ? 866  TYR A CZ    1 
ATOM   4587 O  OH    . TYR A 1 609 ? 7.050   -16.920 23.615  1.00 42.69  ? 866  TYR A OH    1 
ATOM   4588 N  N     . HIS A 1 610 ? 12.777  -12.541 24.240  1.00 20.55  ? 867  HIS A N     1 
ATOM   4589 C  CA    . HIS A 1 610 ? 13.982  -13.340 24.256  1.00 22.15  ? 867  HIS A CA    1 
ATOM   4590 C  C     . HIS A 1 610 ? 14.575  -13.235 25.636  1.00 21.07  ? 867  HIS A C     1 
ATOM   4591 O  O     . HIS A 1 610 ? 14.330  -12.274 26.353  1.00 19.35  ? 867  HIS A O     1 
ATOM   4592 C  CB    . HIS A 1 610 ? 15.020  -12.854 23.233  1.00 24.45  ? 867  HIS A CB    1 
ATOM   4593 C  CG    . HIS A 1 610 ? 14.500  -12.716 21.817  1.00 26.37  ? 867  HIS A CG    1 
ATOM   4594 N  ND1   . HIS A 1 610 ? 14.573  -13.720 20.915  1.00 30.29  ? 867  HIS A ND1   1 
ATOM   4595 C  CD2   . HIS A 1 610 ? 13.915  -11.635 21.165  1.00 26.21  ? 867  HIS A CD2   1 
ATOM   4596 C  CE1   . HIS A 1 610 ? 14.034  -13.299 19.742  1.00 30.69  ? 867  HIS A CE1   1 
ATOM   4597 N  NE2   . HIS A 1 610 ? 13.639  -12.023 19.906  1.00 29.05  ? 867  HIS A NE2   1 
ATOM   4598 N  N     . TYR A 1 611 ? 15.410  -14.191 25.995  1.00 21.03  ? 868  TYR A N     1 
ATOM   4599 C  CA    . TYR A 1 611 ? 16.123  -14.105 27.266  1.00 20.10  ? 868  TYR A CA    1 
ATOM   4600 C  C     . TYR A 1 611 ? 17.446  -14.796 27.165  1.00 19.87  ? 868  TYR A C     1 
ATOM   4601 O  O     . TYR A 1 611 ? 17.645  -15.629 26.307  1.00 19.49  ? 868  TYR A O     1 
ATOM   4602 C  CB    . TYR A 1 611 ? 15.259  -14.633 28.422  1.00 21.85  ? 868  TYR A CB    1 
ATOM   4603 C  CG    . TYR A 1 611 ? 14.946  -16.108 28.348  1.00 24.30  ? 868  TYR A CG    1 
ATOM   4604 C  CD1   . TYR A 1 611 ? 15.829  -17.057 28.842  1.00 26.30  ? 868  TYR A CD1   1 
ATOM   4605 C  CD2   . TYR A 1 611 ? 13.797  -16.538 27.766  1.00 26.19  ? 868  TYR A CD2   1 
ATOM   4606 C  CE1   . TYR A 1 611 ? 15.541  -18.421 28.757  1.00 29.18  ? 868  TYR A CE1   1 
ATOM   4607 C  CE2   . TYR A 1 611 ? 13.497  -17.876 27.665  1.00 27.94  ? 868  TYR A CE2   1 
ATOM   4608 C  CZ    . TYR A 1 611 ? 14.354  -18.808 28.167  1.00 30.81  ? 868  TYR A CZ    1 
ATOM   4609 O  OH    . TYR A 1 611 ? 14.032  -20.129 28.028  1.00 33.63  ? 868  TYR A OH    1 
ATOM   4610 N  N     . GLY A 1 612 ? 18.369  -14.433 28.034  1.00 18.97  ? 869  GLY A N     1 
ATOM   4611 C  CA    . GLY A 1 612 ? 19.638  -15.098 28.093  1.00 19.68  ? 869  GLY A CA    1 
ATOM   4612 C  C     . GLY A 1 612 ? 20.540  -14.537 29.182  1.00 19.58  ? 869  GLY A C     1 
ATOM   4613 O  O     . GLY A 1 612 ? 20.078  -13.801 30.024  1.00 18.79  ? 869  GLY A O     1 
ATOM   4614 N  N     . SER A 1 613 ? 21.823  -14.910 29.163  1.00 20.96  ? 870  SER A N     1 
ATOM   4615 C  CA    . SER A 1 613 ? 22.740  -14.608 30.277  1.00 22.28  ? 870  SER A CA    1 
ATOM   4616 C  C     . SER A 1 613 ? 23.215  -13.176 30.293  1.00 22.04  ? 870  SER A C     1 
ATOM   4617 O  O     . SER A 1 613 ? 23.799  -12.743 31.282  1.00 22.00  ? 870  SER A O     1 
ATOM   4618 C  CB    . SER A 1 613 ? 24.027  -15.408 30.141  1.00 24.55  ? 870  SER A CB    1 
ATOM   4619 O  OG    . SER A 1 613 ? 23.749  -16.742 30.281  1.00 28.13  ? 870  SER A OG    1 
ATOM   4620 N  N     . THR A 1 614 ? 23.105  -12.497 29.163  1.00 21.05  ? 871  THR A N     1 
ATOM   4621 C  CA    . THR A 1 614 ? 23.520  -11.120 29.048  1.00 21.73  ? 871  THR A CA    1 
ATOM   4622 C  C     . THR A 1 614 ? 22.504  -10.425 28.127  1.00 21.14  ? 871  THR A C     1 
ATOM   4623 O  O     . THR A 1 614 ? 21.684  -11.076 27.461  1.00 20.54  ? 871  THR A O     1 
ATOM   4624 C  CB    . THR A 1 614 ? 24.939  -10.999 28.385  1.00 23.48  ? 871  THR A CB    1 
ATOM   4625 O  OG1   . THR A 1 614 ? 24.806  -11.236 26.980  1.00 25.01  ? 871  THR A OG1   1 
ATOM   4626 C  CG2   . THR A 1 614 ? 25.973  -11.936 28.946  1.00 23.63  ? 871  THR A CG2   1 
ATOM   4627 N  N     . TRP A 1 615 ? 22.529  -9.098  28.078  1.00 20.51  ? 872  TRP A N     1 
ATOM   4628 C  CA    . TRP A 1 615 ? 21.595  -8.392  27.221  1.00 21.40  ? 872  TRP A CA    1 
ATOM   4629 C  C     . TRP A 1 615 ? 21.829  -8.789  25.769  1.00 21.70  ? 872  TRP A C     1 
ATOM   4630 O  O     . TRP A 1 615 ? 20.898  -8.867  24.996  1.00 21.11  ? 872  TRP A O     1 
ATOM   4631 C  CB    . TRP A 1 615 ? 21.827  -6.896  27.424  1.00 22.32  ? 872  TRP A CB    1 
ATOM   4632 C  CG    . TRP A 1 615 ? 20.853  -5.988  26.818  1.00 21.73  ? 872  TRP A CG    1 
ATOM   4633 C  CD1   . TRP A 1 615 ? 19.613  -6.282  26.261  1.00 21.24  ? 872  TRP A CD1   1 
ATOM   4634 C  CD2   . TRP A 1 615 ? 20.961  -4.549  26.771  1.00 22.35  ? 872  TRP A CD2   1 
ATOM   4635 N  NE1   . TRP A 1 615 ? 18.997  -5.148  25.820  1.00 21.38  ? 872  TRP A NE1   1 
ATOM   4636 C  CE2   . TRP A 1 615 ? 19.731  -4.067  26.148  1.00 21.70  ? 872  TRP A CE2   1 
ATOM   4637 C  CE3   . TRP A 1 615 ? 21.920  -3.635  27.186  1.00 23.39  ? 872  TRP A CE3   1 
ATOM   4638 C  CZ2   . TRP A 1 615 ? 19.508  -2.721  25.911  1.00 22.87  ? 872  TRP A CZ2   1 
ATOM   4639 C  CZ3   . TRP A 1 615 ? 21.674  -2.268  26.965  1.00 23.76  ? 872  TRP A CZ3   1 
ATOM   4640 C  CH2   . TRP A 1 615 ? 20.492  -1.831  26.336  1.00 23.29  ? 872  TRP A CH2   1 
ATOM   4641 N  N     . TYR A 1 616 ? 23.082  -9.015  25.397  1.00 23.18  ? 873  TYR A N     1 
ATOM   4642 C  CA    . TYR A 1 616 ? 23.431  -9.471  24.049  1.00 26.52  ? 873  TYR A CA    1 
ATOM   4643 C  C     . TYR A 1 616 ? 22.655  -10.733 23.662  1.00 28.21  ? 873  TYR A C     1 
ATOM   4644 O  O     . TYR A 1 616 ? 22.100  -10.822 22.574  1.00 27.41  ? 873  TYR A O     1 
ATOM   4645 C  CB    . TYR A 1 616 ? 24.909  -9.783  23.978  1.00 29.19  ? 873  TYR A CB    1 
ATOM   4646 C  CG    . TYR A 1 616 ? 25.414  -10.413 22.678  1.00 31.71  ? 873  TYR A CG    1 
ATOM   4647 C  CD1   . TYR A 1 616 ? 25.783  -9.615  21.625  1.00 33.41  ? 873  TYR A CD1   1 
ATOM   4648 C  CD2   . TYR A 1 616 ? 25.561  -11.801 22.540  1.00 33.09  ? 873  TYR A CD2   1 
ATOM   4649 C  CE1   . TYR A 1 616 ? 26.271  -10.148 20.449  1.00 36.18  ? 873  TYR A CE1   1 
ATOM   4650 C  CE2   . TYR A 1 616 ? 26.045  -12.353 21.359  1.00 35.44  ? 873  TYR A CE2   1 
ATOM   4651 C  CZ    . TYR A 1 616 ? 26.391  -11.516 20.307  1.00 36.44  ? 873  TYR A CZ    1 
ATOM   4652 O  OH    . TYR A 1 616 ? 26.895  -12.003 19.118  1.00 39.73  ? 873  TYR A OH    1 
ATOM   4653 N  N     . ASP A 1 617 ? 22.591  -11.689 24.590  1.00 29.38  ? 874  ASP A N     1 
ATOM   4654 C  CA    . ASP A 1 617 ? 21.957  -12.967 24.319  1.00 31.34  ? 874  ASP A CA    1 
ATOM   4655 C  C     . ASP A 1 617 ? 20.502  -12.863 24.409  1.00 31.58  ? 874  ASP A C     1 
ATOM   4656 O  O     . ASP A 1 617 ? 19.837  -13.789 23.971  1.00 34.45  ? 874  ASP A O     1 
ATOM   4657 C  CB    . ASP A 1 617 ? 22.372  -14.030 25.323  1.00 33.46  ? 874  ASP A CB    1 
ATOM   4658 C  CG    . ASP A 1 617 ? 23.820  -14.186 25.388  1.00 36.25  ? 874  ASP A CG    1 
ATOM   4659 O  OD1   . ASP A 1 617 ? 24.426  -14.580 24.356  1.00 39.55  ? 874  ASP A OD1   1 
ATOM   4660 O  OD2   . ASP A 1 617 ? 24.356  -13.874 26.465  1.00 38.50  ? 874  ASP A OD2   1 
ATOM   4661 N  N     . ALA A 1 618 ? 19.963  -11.788 24.983  1.00 28.79  ? 875  ALA A N     1 
ATOM   4662 C  CA    . ALA A 1 618 ? 18.528  -11.675 25.038  1.00 30.58  ? 875  ALA A CA    1 
ATOM   4663 C  C     . ALA A 1 618 ? 18.066  -11.210 23.662  1.00 34.63  ? 875  ALA A C     1 
ATOM   4664 O  O     . ALA A 1 618 ? 17.434  -10.175 23.537  1.00 31.91  ? 875  ALA A O     1 
ATOM   4665 C  CB    . ALA A 1 618 ? 18.056  -10.751 26.178  1.00 27.38  ? 875  ALA A CB    1 
ATOM   4666 N  N     . LYS A 1 619 ? 18.373  -12.043 22.651  1.00 41.88  ? 876  LYS A N     1 
ATOM   4667 C  CA    . LYS A 1 619 ? 18.182  -11.737 21.210  1.00 45.77  ? 876  LYS A CA    1 
ATOM   4668 C  C     . LYS A 1 619 ? 17.722  -12.988 20.473  1.00 47.85  ? 876  LYS A C     1 
ATOM   4669 O  O     . LYS A 1 619 ? 17.336  -12.928 19.308  1.00 53.35  ? 876  LYS A O     1 
ATOM   4670 C  CB    . LYS A 1 619 ? 19.513  -11.352 20.551  1.00 48.54  ? 876  LYS A CB    1 
ATOM   4671 C  CG    . LYS A 1 619 ? 20.496  -12.536 20.466  1.00 48.49  ? 876  LYS A CG    1 
ATOM   4672 C  CD    . LYS A 1 619 ? 21.781  -12.276 19.680  1.00 47.88  ? 876  LYS A CD    1 
ATOM   4673 C  CE    . LYS A 1 619 ? 22.753  -13.410 19.951  1.00 50.07  ? 876  LYS A CE    1 
ATOM   4674 N  NZ    . LYS A 1 619 ? 23.489  -13.865 18.739  1.00 53.89  ? 876  LYS A NZ    1 
ATOM   4675 O  OXT   . LYS A 1 619 ? 17.763  -14.103 20.989  1.00 48.86  ? 876  LYS A OXT   1 
ATOM   4676 P  P     . DC  B 2 1   ? 39.298  24.717  34.058  1.00 118.14 ? 1    DC  B P     1 
ATOM   4677 O  OP1   . DC  B 2 1   ? 40.031  24.666  32.760  1.00 111.54 ? 1    DC  B OP1   1 
ATOM   4678 O  OP2   . DC  B 2 1   ? 39.321  23.539  34.966  1.00 113.40 ? 1    DC  B OP2   1 
ATOM   4679 O  "O5'" . DC  B 2 1   ? 37.777  25.147  33.822  1.00 108.49 ? 1    DC  B "O5'" 1 
ATOM   4680 C  "C5'" . DC  B 2 1   ? 37.184  26.250  34.543  1.00 94.04  ? 1    DC  B "C5'" 1 
ATOM   4681 C  "C4'" . DC  B 2 1   ? 36.248  27.038  33.652  1.00 87.20  ? 1    DC  B "C4'" 1 
ATOM   4682 O  "O4'" . DC  B 2 1   ? 36.933  27.479  32.451  1.00 86.82  ? 1    DC  B "O4'" 1 
ATOM   4683 C  "C3'" . DC  B 2 1   ? 34.999  26.288  33.177  1.00 82.49  ? 1    DC  B "C3'" 1 
ATOM   4684 O  "O3'" . DC  B 2 1   ? 33.829  27.093  33.377  1.00 74.44  ? 1    DC  B "O3'" 1 
ATOM   4685 C  "C2'" . DC  B 2 1   ? 35.246  26.065  31.691  1.00 82.19  ? 1    DC  B "C2'" 1 
ATOM   4686 C  "C1'" . DC  B 2 1   ? 36.098  27.263  31.320  1.00 81.75  ? 1    DC  B "C1'" 1 
ATOM   4687 N  N1    . DC  B 2 1   ? 36.967  27.074  30.134  1.00 75.35  ? 1    DC  B N1    1 
ATOM   4688 C  C2    . DC  B 2 1   ? 36.758  27.866  28.998  1.00 71.43  ? 1    DC  B C2    1 
ATOM   4689 O  O2    . DC  B 2 1   ? 35.844  28.704  29.008  1.00 71.81  ? 1    DC  B O2    1 
ATOM   4690 N  N3    . DC  B 2 1   ? 37.553  27.693  27.916  1.00 69.43  ? 1    DC  B N3    1 
ATOM   4691 C  C4    . DC  B 2 1   ? 38.520  26.772  27.939  1.00 72.88  ? 1    DC  B C4    1 
ATOM   4692 N  N4    . DC  B 2 1   ? 39.282  26.634  26.851  1.00 71.12  ? 1    DC  B N4    1 
ATOM   4693 C  C5    . DC  B 2 1   ? 38.751  25.950  29.081  1.00 73.22  ? 1    DC  B C5    1 
ATOM   4694 C  C6    . DC  B 2 1   ? 37.959  26.132  30.146  1.00 74.50  ? 1    DC  B C6    1 
ATOM   4695 P  P     . DC  B 2 2   ? 32.380  26.450  33.154  1.00 69.99  ? 2    DC  B P     1 
ATOM   4696 O  OP1   . DC  B 2 2   ? 31.477  26.983  34.204  1.00 71.66  ? 2    DC  B OP1   1 
ATOM   4697 O  OP2   . DC  B 2 2   ? 32.537  24.983  32.997  1.00 64.89  ? 2    DC  B OP2   1 
ATOM   4698 O  "O5'" . DC  B 2 2   ? 31.924  27.055  31.754  1.00 63.10  ? 2    DC  B "O5'" 1 
ATOM   4699 C  "C5'" . DC  B 2 2   ? 32.095  28.454  31.469  1.00 61.56  ? 2    DC  B "C5'" 1 
ATOM   4700 C  "C4'" . DC  B 2 2   ? 31.567  28.780  30.091  1.00 63.48  ? 2    DC  B "C4'" 1 
ATOM   4701 O  "O4'" . DC  B 2 2   ? 32.616  28.591  29.111  1.00 62.79  ? 2    DC  B "O4'" 1 
ATOM   4702 C  "C3'" . DC  B 2 2   ? 30.385  27.925  29.627  1.00 65.76  ? 2    DC  B "C3'" 1 
ATOM   4703 O  "O3'" . DC  B 2 2   ? 29.421  28.775  29.000  1.00 66.09  ? 2    DC  B "O3'" 1 
ATOM   4704 C  "C2'" . DC  B 2 2   ? 31.006  26.965  28.628  1.00 63.80  ? 2    DC  B "C2'" 1 
ATOM   4705 C  "C1'" . DC  B 2 2   ? 32.142  27.785  28.046  1.00 62.60  ? 2    DC  B "C1'" 1 
ATOM   4706 N  N1    . DC  B 2 2   ? 33.275  26.992  27.546  1.00 59.02  ? 2    DC  B N1    1 
ATOM   4707 C  C2    . DC  B 2 2   ? 33.818  27.305  26.297  1.00 57.51  ? 2    DC  B C2    1 
ATOM   4708 O  O2    . DC  B 2 2   ? 33.323  28.236  25.646  1.00 61.00  ? 2    DC  B O2    1 
ATOM   4709 N  N3    . DC  B 2 2   ? 34.863  26.584  25.831  1.00 53.35  ? 2    DC  B N3    1 
ATOM   4710 C  C4    . DC  B 2 2   ? 35.366  25.588  26.564  1.00 55.01  ? 2    DC  B C4    1 
ATOM   4711 N  N4    . DC  B 2 2   ? 36.398  24.903  26.065  1.00 53.18  ? 2    DC  B N4    1 
ATOM   4712 C  C5    . DC  B 2 2   ? 34.833  25.250  27.842  1.00 57.52  ? 2    DC  B C5    1 
ATOM   4713 C  C6    . DC  B 2 2   ? 33.799  25.972  28.291  1.00 54.96  ? 2    DC  B C6    1 
ATOM   4714 P  P     . DT  B 2 3   ? 27.948  28.306  28.586  1.00 73.17  ? 3    DT  B P     1 
ATOM   4715 O  OP1   . DT  B 2 3   ? 27.054  29.450  28.876  1.00 75.59  ? 3    DT  B OP1   1 
ATOM   4716 O  OP2   . DT  B 2 3   ? 27.648  26.957  29.129  1.00 68.04  ? 3    DT  B OP2   1 
ATOM   4717 O  "O5'" . DT  B 2 3   ? 28.096  28.207  27.003  1.00 74.67  ? 3    DT  B "O5'" 1 
ATOM   4718 C  "C5'" . DT  B 2 3   ? 28.732  29.266  26.261  1.00 73.00  ? 3    DT  B "C5'" 1 
ATOM   4719 C  "C4'" . DT  B 2 3   ? 28.807  28.896  24.799  1.00 70.82  ? 3    DT  B "C4'" 1 
ATOM   4720 O  "O4'" . DT  B 2 3   ? 30.006  28.125  24.547  1.00 63.60  ? 3    DT  B "O4'" 1 
ATOM   4721 C  "C3'" . DT  B 2 3   ? 27.640  28.047  24.287  1.00 68.94  ? 3    DT  B "C3'" 1 
ATOM   4722 O  "O3'" . DT  B 2 3   ? 27.217  28.610  23.046  1.00 73.96  ? 3    DT  B "O3'" 1 
ATOM   4723 C  "C2'" . DT  B 2 3   ? 28.230  26.647  24.179  1.00 64.30  ? 3    DT  B "C2'" 1 
ATOM   4724 C  "C1'" . DT  B 2 3   ? 29.677  26.945  23.828  1.00 60.03  ? 3    DT  B "C1'" 1 
ATOM   4725 N  N1    . DT  B 2 3   ? 30.702  25.920  24.152  1.00 57.77  ? 3    DT  B N1    1 
ATOM   4726 C  C2    . DT  B 2 3   ? 31.741  25.773  23.257  1.00 55.16  ? 3    DT  B C2    1 
ATOM   4727 O  O2    . DT  B 2 3   ? 31.817  26.401  22.216  1.00 58.02  ? 3    DT  B O2    1 
ATOM   4728 N  N3    . DT  B 2 3   ? 32.677  24.835  23.613  1.00 52.77  ? 3    DT  B N3    1 
ATOM   4729 C  C4    . DT  B 2 3   ? 32.694  24.067  24.761  1.00 54.58  ? 3    DT  B C4    1 
ATOM   4730 O  O4    . DT  B 2 3   ? 33.613  23.273  24.953  1.00 56.00  ? 3    DT  B O4    1 
ATOM   4731 C  C5    . DT  B 2 3   ? 31.591  24.292  25.670  1.00 56.72  ? 3    DT  B C5    1 
ATOM   4732 C  C7    . DT  B 2 3   ? 31.528  23.505  26.940  1.00 57.60  ? 3    DT  B C7    1 
ATOM   4733 C  C6    . DT  B 2 3   ? 30.660  25.193  25.323  1.00 56.58  ? 3    DT  B C6    1 
ATOM   4734 P  P     . DG  B 2 4   ? 25.871  28.182  22.301  1.00 77.08  ? 4    DG  B P     1 
ATOM   4735 O  OP1   . DG  B 2 4   ? 25.078  29.409  22.051  1.00 74.31  ? 4    DG  B OP1   1 
ATOM   4736 O  OP2   . DG  B 2 4   ? 25.269  27.020  23.005  1.00 76.53  ? 4    DG  B OP2   1 
ATOM   4737 O  "O5'" . DG  B 2 4   ? 26.474  27.761  20.890  1.00 73.31  ? 4    DG  B "O5'" 1 
ATOM   4738 C  "C5'" . DG  B 2 4   ? 27.331  28.677  20.184  1.00 73.89  ? 4    DG  B "C5'" 1 
ATOM   4739 C  "C4'" . DG  B 2 4   ? 27.986  27.996  19.005  1.00 75.68  ? 4    DG  B "C4'" 1 
ATOM   4740 O  "O4'" . DG  B 2 4   ? 29.021  27.084  19.444  1.00 73.85  ? 4    DG  B "O4'" 1 
ATOM   4741 C  "C3'" . DG  B 2 4   ? 27.039  27.166  18.141  1.00 73.82  ? 4    DG  B "C3'" 1 
ATOM   4742 O  "O3'" . DG  B 2 4   ? 27.463  27.383  16.797  1.00 79.11  ? 4    DG  B "O3'" 1 
ATOM   4743 C  "C2'" . DG  B 2 4   ? 27.267  25.749  18.636  1.00 71.67  ? 4    DG  B "C2'" 1 
ATOM   4744 C  "C1'" . DG  B 2 4   ? 28.752  25.773  18.969  1.00 65.91  ? 4    DG  B "C1'" 1 
ATOM   4745 N  N9    . DG  B 2 4   ? 29.178  24.833  20.000  1.00 63.27  ? 4    DG  B N9    1 
ATOM   4746 C  C8    . DG  B 2 4   ? 28.536  24.551  21.182  1.00 63.32  ? 4    DG  B C8    1 
ATOM   4747 N  N7    . DG  B 2 4   ? 29.171  23.677  21.914  1.00 59.84  ? 4    DG  B N7    1 
ATOM   4748 C  C5    . DG  B 2 4   ? 30.302  23.362  21.172  1.00 57.69  ? 4    DG  B C5    1 
ATOM   4749 C  C6    . DG  B 2 4   ? 31.369  22.471  21.456  1.00 57.22  ? 4    DG  B C6    1 
ATOM   4750 O  O6    . DG  B 2 4   ? 31.530  21.753  22.449  1.00 56.76  ? 4    DG  B O6    1 
ATOM   4751 N  N1    . DG  B 2 4   ? 32.313  22.461  20.434  1.00 60.36  ? 4    DG  B N1    1 
ATOM   4752 C  C2    . DG  B 2 4   ? 32.237  23.207  19.284  1.00 61.63  ? 4    DG  B C2    1 
ATOM   4753 N  N2    . DG  B 2 4   ? 33.249  23.060  18.418  1.00 63.22  ? 4    DG  B N2    1 
ATOM   4754 N  N3    . DG  B 2 4   ? 31.255  24.051  19.013  1.00 60.08  ? 4    DG  B N3    1 
ATOM   4755 C  C4    . DG  B 2 4   ? 30.329  24.079  19.995  1.00 60.39  ? 4    DG  B C4    1 
ATOM   4756 P  P     . DA  B 2 5   ? 26.667  26.699  15.591  1.00 84.04  ? 5    DA  B P     1 
ATOM   4757 O  OP1   . DA  B 2 5   ? 26.442  27.730  14.547  1.00 74.55  ? 5    DA  B OP1   1 
ATOM   4758 O  OP2   . DA  B 2 5   ? 25.509  25.966  16.162  1.00 74.42  ? 5    DA  B OP2   1 
ATOM   4759 O  "O5'" . DA  B 2 5   ? 27.700  25.630  15.021  1.00 72.61  ? 5    DA  B "O5'" 1 
ATOM   4760 C  "C5'" . DA  B 2 5   ? 29.098  25.947  14.894  1.00 66.62  ? 5    DA  B "C5'" 1 
ATOM   4761 C  "C4'" . DA  B 2 5   ? 29.851  24.767  14.325  1.00 63.02  ? 5    DA  B "C4'" 1 
ATOM   4762 O  "O4'" . DA  B 2 5   ? 30.324  23.930  15.406  1.00 60.29  ? 5    DA  B "O4'" 1 
ATOM   4763 C  "C3'" . DA  B 2 5   ? 29.023  23.858  13.416  1.00 61.61  ? 5    DA  B "C3'" 1 
ATOM   4764 O  "O3'" . DA  B 2 5   ? 29.825  23.393  12.326  1.00 55.74  ? 5    DA  B "O3'" 1 
ATOM   4765 C  "C2'" . DA  B 2 5   ? 28.633  22.710  14.329  1.00 59.70  ? 5    DA  B "C2'" 1 
ATOM   4766 C  "C1'" . DA  B 2 5   ? 29.833  22.607  15.254  1.00 55.13  ? 5    DA  B "C1'" 1 
ATOM   4767 N  N9    . DA  B 2 5   ? 29.521  22.092  16.586  1.00 53.96  ? 5    DA  B N9    1 
ATOM   4768 C  C8    . DA  B 2 5   ? 28.439  22.398  17.374  1.00 52.64  ? 5    DA  B C8    1 
ATOM   4769 N  N7    . DA  B 2 5   ? 28.431  21.774  18.527  1.00 50.83  ? 5    DA  B N7    1 
ATOM   4770 C  C5    . DA  B 2 5   ? 29.585  21.004  18.497  1.00 48.79  ? 5    DA  B C5    1 
ATOM   4771 C  C6    . DA  B 2 5   ? 30.151  20.112  19.423  1.00 45.61  ? 5    DA  B C6    1 
ATOM   4772 N  N6    . DA  B 2 5   ? 29.608  19.833  20.610  1.00 48.34  ? 5    DA  B N6    1 
ATOM   4773 N  N1    . DA  B 2 5   ? 31.311  19.507  19.085  1.00 43.75  ? 5    DA  B N1    1 
ATOM   4774 C  C2    . DA  B 2 5   ? 31.855  19.787  17.894  1.00 45.91  ? 5    DA  B C2    1 
ATOM   4775 N  N3    . DA  B 2 5   ? 31.419  20.606  16.939  1.00 48.80  ? 5    DA  B N3    1 
ATOM   4776 C  C4    . DA  B 2 5   ? 30.266  21.191  17.307  1.00 49.70  ? 5    DA  B C4    1 
ATOM   4777 P  P     . DC  B 2 6   ? 29.185  22.498  11.166  1.00 53.72  ? 6    DC  B P     1 
ATOM   4778 O  OP1   . DC  B 2 6   ? 29.756  22.957  9.876   1.00 54.75  ? 6    DC  B OP1   1 
ATOM   4779 O  OP2   . DC  B 2 6   ? 27.713  22.466  11.347  1.00 48.71  ? 6    DC  B OP2   1 
ATOM   4780 O  "O5'" . DC  B 2 6   ? 29.770  21.051  11.482  1.00 49.27  ? 6    DC  B "O5'" 1 
ATOM   4781 C  "C5'" . DC  B 2 6   ? 31.142  20.888  11.885  1.00 46.96  ? 6    DC  B "C5'" 1 
ATOM   4782 C  "C4'" . DC  B 2 6   ? 31.472  19.424  12.061  1.00 46.88  ? 6    DC  B "C4'" 1 
ATOM   4783 O  "O4'" . DC  B 2 6   ? 31.298  19.051  13.449  1.00 45.17  ? 6    DC  B "O4'" 1 
ATOM   4784 C  "C3'" . DC  B 2 6   ? 30.606  18.460  11.247  1.00 46.53  ? 6    DC  B "C3'" 1 
ATOM   4785 O  "O3'" . DC  B 2 6   ? 31.429  17.430  10.690  1.00 46.28  ? 6    DC  B "O3'" 1 
ATOM   4786 C  "C2'" . DC  B 2 6   ? 29.646  17.887  12.274  1.00 45.56  ? 6    DC  B "C2'" 1 
ATOM   4787 C  "C1'" . DC  B 2 6   ? 30.484  17.894  13.537  1.00 45.31  ? 6    DC  B "C1'" 1 
ATOM   4788 N  N1    . DC  B 2 6   ? 29.710  17.984  14.783  1.00 45.38  ? 6    DC  B N1    1 
ATOM   4789 C  C2    . DC  B 2 6   ? 30.131  17.247  15.893  1.00 45.19  ? 6    DC  B C2    1 
ATOM   4790 O  O2    . DC  B 2 6   ? 31.142  16.537  15.791  1.00 44.13  ? 6    DC  B O2    1 
ATOM   4791 N  N3    . DC  B 2 6   ? 29.427  17.325  17.045  1.00 44.08  ? 6    DC  B N3    1 
ATOM   4792 C  C4    . DC  B 2 6   ? 28.343  18.101  17.113  1.00 44.46  ? 6    DC  B C4    1 
ATOM   4793 N  N4    . DC  B 2 6   ? 27.679  18.149  18.270  1.00 48.69  ? 6    DC  B N4    1 
ATOM   4794 C  C5    . DC  B 2 6   ? 27.893  18.865  15.997  1.00 44.78  ? 6    DC  B C5    1 
ATOM   4795 C  C6    . DC  B 2 6   ? 28.600  18.778  14.863  1.00 44.07  ? 6    DC  B C6    1 
ATOM   4796 P  P     . DT  B 2 7   ? 30.850  16.366  9.647   1.00 44.97  ? 7    DT  B P     1 
ATOM   4797 O  OP1   . DT  B 2 7   ? 31.865  16.182  8.581   1.00 43.80  ? 7    DT  B OP1   1 
ATOM   4798 O  OP2   . DT  B 2 7   ? 29.465  16.751  9.283   1.00 41.41  ? 7    DT  B OP2   1 
ATOM   4799 O  "O5'" . DT  B 2 7   ? 30.797  15.027  10.508  1.00 42.46  ? 7    DT  B "O5'" 1 
ATOM   4800 C  "C5'" . DT  B 2 7   ? 31.928  14.618  11.297  1.00 42.08  ? 7    DT  B "C5'" 1 
ATOM   4801 C  "C4'" . DT  B 2 7   ? 31.541  13.493  12.228  1.00 40.74  ? 7    DT  B "C4'" 1 
ATOM   4802 O  "O4'" . DT  B 2 7   ? 30.849  14.028  13.379  1.00 41.73  ? 7    DT  B "O4'" 1 
ATOM   4803 C  "C3'" . DT  B 2 7   ? 30.612  12.439  11.616  1.00 39.74  ? 7    DT  B "C3'" 1 
ATOM   4804 O  "O3'" . DT  B 2 7   ? 31.229  11.150  11.677  1.00 38.00  ? 7    DT  B "O3'" 1 
ATOM   4805 C  "C2'" . DT  B 2 7   ? 29.361  12.484  12.481  1.00 39.63  ? 7    DT  B "C2'" 1 
ATOM   4806 C  "C1'" . DT  B 2 7   ? 29.851  13.111  13.771  1.00 41.31  ? 7    DT  B "C1'" 1 
ATOM   4807 N  N1    . DT  B 2 7   ? 28.819  13.856  14.512  1.00 40.88  ? 7    DT  B N1    1 
ATOM   4808 C  C2    . DT  B 2 7   ? 28.681  13.616  15.860  1.00 40.62  ? 7    DT  B C2    1 
ATOM   4809 O  O2    . DT  B 2 7   ? 29.376  12.820  16.469  1.00 38.24  ? 7    DT  B O2    1 
ATOM   4810 N  N3    . DT  B 2 7   ? 27.695  14.348  16.473  1.00 39.55  ? 7    DT  B N3    1 
ATOM   4811 C  C4    . DT  B 2 7   ? 26.852  15.272  15.885  1.00 42.01  ? 7    DT  B C4    1 
ATOM   4812 O  O4    . DT  B 2 7   ? 26.011  15.854  16.565  1.00 44.99  ? 7    DT  B O4    1 
ATOM   4813 C  C5    . DT  B 2 7   ? 27.052  15.473  14.468  1.00 43.62  ? 7    DT  B C5    1 
ATOM   4814 C  C7    . DT  B 2 7   ? 26.186  16.455  13.745  1.00 49.47  ? 7    DT  B C7    1 
ATOM   4815 C  C6    . DT  B 2 7   ? 28.012  14.764  13.861  1.00 42.12  ? 7    DT  B C6    1 
ATOM   4816 P  P     . DC  B 2 8   ? 30.506  9.866   11.061  1.00 38.18  ? 8    DC  B P     1 
ATOM   4817 O  OP1   . DC  B 2 8   ? 31.562  8.935   10.594  1.00 33.84  ? 8    DC  B OP1   1 
ATOM   4818 O  OP2   . DC  B 2 8   ? 29.460  10.323  10.114  1.00 37.97  ? 8    DC  B OP2   1 
ATOM   4819 O  "O5'" . DC  B 2 8   ? 29.797  9.216   12.330  1.00 40.05  ? 8    DC  B "O5'" 1 
ATOM   4820 C  "C5'" . DC  B 2 8   ? 30.497  9.107   13.583  1.00 39.71  ? 8    DC  B "C5'" 1 
ATOM   4821 C  "C4'" . DC  B 2 8   ? 29.675  8.326   14.581  1.00 39.45  ? 8    DC  B "C4'" 1 
ATOM   4822 O  "O4'" . DC  B 2 8   ? 28.860  9.236   15.359  1.00 39.11  ? 8    DC  B "O4'" 1 
ATOM   4823 C  "C3'" . DC  B 2 8   ? 28.709  7.308   13.972  1.00 39.62  ? 8    DC  B "C3'" 1 
ATOM   4824 O  "O3'" . DC  B 2 8   ? 28.699  6.126   14.776  1.00 42.02  ? 8    DC  B "O3'" 1 
ATOM   4825 C  "C2'" . DC  B 2 8   ? 27.363  8.003   14.058  1.00 39.73  ? 8    DC  B "C2'" 1 
ATOM   4826 C  "C1'" . DC  B 2 8   ? 27.511  8.803   15.337  1.00 38.47  ? 8    DC  B "C1'" 1 
ATOM   4827 N  N1    . DC  B 2 8   ? 26.654  9.993   15.420  1.00 38.03  ? 8    DC  B N1    1 
ATOM   4828 C  C2    . DC  B 2 8   ? 26.156  10.376  16.668  1.00 36.74  ? 8    DC  B C2    1 
ATOM   4829 O  O2    . DC  B 2 8   ? 26.453  9.700   17.663  1.00 38.42  ? 8    DC  B O2    1 
ATOM   4830 N  N3    . DC  B 2 8   ? 25.366  11.470  16.757  1.00 37.41  ? 8    DC  B N3    1 
ATOM   4831 C  C4    . DC  B 2 8   ? 25.070  12.170  15.660  1.00 36.07  ? 8    DC  B C4    1 
ATOM   4832 N  N4    . DC  B 2 8   ? 24.287  13.243  15.794  1.00 36.74  ? 8    DC  B N4    1 
ATOM   4833 C  C5    . DC  B 2 8   ? 25.564  11.801  14.375  1.00 36.09  ? 8    DC  B C5    1 
ATOM   4834 C  C6    . DC  B 2 8   ? 26.345  10.717  14.302  1.00 36.03  ? 8    DC  B C6    1 
ATOM   4835 P  P     . DT  B 2 9   ? 28.278  4.711   14.168  1.00 46.50  ? 9    DT  B P     1 
ATOM   4836 O  OP1   . DT  B 2 9   ? 29.409  3.779   14.392  1.00 44.06  ? 9    DT  B OP1   1 
ATOM   4837 O  OP2   . DT  B 2 9   ? 27.759  4.919   12.795  1.00 46.03  ? 9    DT  B OP2   1 
ATOM   4838 O  "O5'" . DT  B 2 9   ? 27.066  4.270   15.104  1.00 49.91  ? 9    DT  B "O5'" 1 
ATOM   4839 C  "C5'" . DT  B 2 9   ? 27.299  3.856   16.462  1.00 45.53  ? 9    DT  B "C5'" 1 
ATOM   4840 C  "C4'" . DT  B 2 9   ? 26.041  4.003   17.286  1.00 42.00  ? 9    DT  B "C4'" 1 
ATOM   4841 O  "O4'" . DT  B 2 9   ? 25.793  5.395   17.566  1.00 39.67  ? 9    DT  B "O4'" 1 
ATOM   4842 C  "C3'" . DT  B 2 9   ? 24.762  3.516   16.617  1.00 39.28  ? 9    DT  B "C3'" 1 
ATOM   4843 O  "O3'" . DT  B 2 9   ? 24.563  2.118   16.840  1.00 37.53  ? 9    DT  B "O3'" 1 
ATOM   4844 C  "C2'" . DT  B 2 9   ? 23.686  4.315   17.332  1.00 39.17  ? 9    DT  B "C2'" 1 
ATOM   4845 C  "C1'" . DT  B 2 9   ? 24.405  5.573   17.825  1.00 40.72  ? 9    DT  B "C1'" 1 
ATOM   4846 N  N1    . DT  B 2 9   ? 23.971  6.810   17.154  1.00 36.36  ? 9    DT  B N1    1 
ATOM   4847 C  C2    . DT  B 2 9   ? 23.282  7.742   17.895  1.00 35.87  ? 9    DT  B C2    1 
ATOM   4848 O  O2    . DT  B 2 9   ? 23.027  7.596   19.079  1.00 32.98  ? 9    DT  B O2    1 
ATOM   4849 N  N3    . DT  B 2 9   ? 22.902  8.860   17.195  1.00 36.58  ? 9    DT  B N3    1 
ATOM   4850 C  C4    . DT  B 2 9   ? 23.135  9.129   15.860  1.00 39.54  ? 9    DT  B C4    1 
ATOM   4851 O  O4    . DT  B 2 9   ? 22.733  10.180  15.369  1.00 36.95  ? 9    DT  B O4    1 
ATOM   4852 C  C5    . DT  B 2 9   ? 23.859  8.105   15.143  1.00 38.55  ? 9    DT  B C5    1 
ATOM   4853 C  C7    . DT  B 2 9   ? 24.157  8.308   13.691  1.00 42.34  ? 9    DT  B C7    1 
ATOM   4854 C  C6    . DT  B 2 9   ? 24.233  7.010   15.816  1.00 39.13  ? 9    DT  B C6    1 
ATOM   4855 P  P     . DA  B 2 10  ? 23.275  1.405   16.217  1.00 39.15  ? 10   DA  B P     1 
ATOM   4856 O  OP1   . DA  B 2 10  ? 23.447  -0.060  16.363  1.00 38.88  ? 10   DA  B OP1   1 
ATOM   4857 O  OP2   . DA  B 2 10  ? 23.027  1.984   14.875  1.00 39.42  ? 10   DA  B OP2   1 
ATOM   4858 O  "O5'" . DA  B 2 10  ? 22.095  1.871   17.180  1.00 38.54  ? 10   DA  B "O5'" 1 
ATOM   4859 C  "C5'" . DA  B 2 10  ? 21.872  1.223   18.446  1.00 37.09  ? 10   DA  B "C5'" 1 
ATOM   4860 C  "C4'" . DA  B 2 10  ? 20.703  1.860   19.161  1.00 40.64  ? 10   DA  B "C4'" 1 
ATOM   4861 O  "O4'" . DA  B 2 10  ? 20.903  3.290   19.230  1.00 38.69  ? 10   DA  B "O4'" 1 
ATOM   4862 C  "C3'" . DA  B 2 10  ? 19.353  1.665   18.476  1.00 40.55  ? 10   DA  B "C3'" 1 
ATOM   4863 O  "O3'" . DA  B 2 10  ? 18.690  0.524   19.028  1.00 40.28  ? 10   DA  B "O3'" 1 
ATOM   4864 C  "C2'" . DA  B 2 10  ? 18.597  2.929   18.839  1.00 42.64  ? 10   DA  B "C2'" 1 
ATOM   4865 C  "C1'" . DA  B 2 10  ? 19.694  3.980   18.938  1.00 43.87  ? 10   DA  B "C1'" 1 
ATOM   4866 N  N9    . DA  B 2 10  ? 19.906  4.757   17.718  1.00 46.68  ? 10   DA  B N9    1 
ATOM   4867 C  C8    . DA  B 2 10  ? 20.528  4.358   16.561  1.00 49.69  ? 10   DA  B C8    1 
ATOM   4868 N  N7    . DA  B 2 10  ? 20.573  5.287   15.637  1.00 48.89  ? 10   DA  B N7    1 
ATOM   4869 C  C5    . DA  B 2 10  ? 19.940  6.373   16.226  1.00 46.53  ? 10   DA  B C5    1 
ATOM   4870 C  C6    . DA  B 2 10  ? 19.663  7.671   15.764  1.00 47.40  ? 10   DA  B C6    1 
ATOM   4871 N  N6    . DA  B 2 10  ? 20.001  8.113   14.551  1.00 46.87  ? 10   DA  B N6    1 
ATOM   4872 N  N1    . DA  B 2 10  ? 19.017  8.511   16.602  1.00 48.24  ? 10   DA  B N1    1 
ATOM   4873 C  C2    . DA  B 2 10  ? 18.677  8.066   17.818  1.00 49.67  ? 10   DA  B C2    1 
ATOM   4874 N  N3    . DA  B 2 10  ? 18.882  6.871   18.367  1.00 45.73  ? 10   DA  B N3    1 
ATOM   4875 C  C4    . DA  B 2 10  ? 19.526  6.061   17.509  1.00 46.94  ? 10   DA  B C4    1 
ATOM   4876 P  P     . DA  B 2 11  ? 17.521  -0.193  18.211  1.00 49.28  ? 11   DA  B P     1 
ATOM   4877 O  OP1   . DA  B 2 11  ? 17.409  -1.557  18.789  1.00 55.39  ? 11   DA  B OP1   1 
ATOM   4878 O  OP2   . DA  B 2 11  ? 17.880  -0.024  16.782  1.00 50.82  ? 11   DA  B OP2   1 
ATOM   4879 O  "O5'" . DA  B 2 11  ? 16.299  0.786   18.487  1.00 49.57  ? 11   DA  B "O5'" 1 
ATOM   4880 C  "C5'" . DA  B 2 11  ? 15.553  0.788   19.715  1.00 55.49  ? 11   DA  B "C5'" 1 
ATOM   4881 C  "C4'" . DA  B 2 11  ? 14.565  1.934   19.689  1.00 55.81  ? 11   DA  B "C4'" 1 
ATOM   4882 O  "O4'" . DA  B 2 11  ? 15.278  3.131   19.286  1.00 57.96  ? 11   DA  B "O4'" 1 
ATOM   4883 C  "C3'" . DA  B 2 11  ? 13.404  1.769   18.698  1.00 59.46  ? 11   DA  B "C3'" 1 
ATOM   4884 O  "O3'" . DA  B 2 11  ? 12.149  1.545   19.348  1.00 52.61  ? 11   DA  B "O3'" 1 
ATOM   4885 C  "C2'" . DA  B 2 11  ? 13.230  3.144   18.079  1.00 59.84  ? 11   DA  B "C2'" 1 
ATOM   4886 C  "C1'" . DA  B 2 11  ? 14.550  3.859   18.295  1.00 58.74  ? 11   DA  B "C1'" 1 
ATOM   4887 N  N9    . DA  B 2 11  ? 15.364  3.920   17.086  1.00 59.64  ? 11   DA  B N9    1 
ATOM   4888 C  C8    . DA  B 2 11  ? 15.895  2.874   16.367  1.00 59.79  ? 11   DA  B C8    1 
ATOM   4889 N  N7    . DA  B 2 11  ? 16.548  3.249   15.295  1.00 57.54  ? 11   DA  B N7    1 
ATOM   4890 C  C5    . DA  B 2 11  ? 16.443  4.632   15.309  1.00 57.20  ? 11   DA  B C5    1 
ATOM   4891 C  C6    . DA  B 2 11  ? 16.924  5.624   14.437  1.00 62.98  ? 11   DA  B C6    1 
ATOM   4892 N  N6    . DA  B 2 11  ? 17.660  5.361   13.350  1.00 63.42  ? 11   DA  B N6    1 
ATOM   4893 N  N1    . DA  B 2 11  ? 16.624  6.911   14.725  1.00 58.26  ? 11   DA  B N1    1 
ATOM   4894 C  C2    . DA  B 2 11  ? 15.888  7.170   15.815  1.00 60.11  ? 11   DA  B C2    1 
ATOM   4895 N  N3    . DA  B 2 11  ? 15.375  6.323   16.706  1.00 62.97  ? 11   DA  B N3    1 
ATOM   4896 C  C4    . DA  B 2 11  ? 15.705  5.057   16.398  1.00 58.77  ? 11   DA  B C4    1 
ATOM   4897 P  P     . DT  C 3 3   ? 14.514  15.454  8.285   1.00 81.49  ? 4    DT  C P     1 
ATOM   4898 O  OP1   . DT  C 3 3   ? 13.547  15.219  7.184   1.00 84.14  ? 4    DT  C OP1   1 
ATOM   4899 O  OP2   . DT  C 3 3   ? 15.695  14.566  8.426   1.00 80.32  ? 4    DT  C OP2   1 
ATOM   4900 O  "O5'" . DT  C 3 3   ? 13.714  15.436  9.662   1.00 77.16  ? 4    DT  C "O5'" 1 
ATOM   4901 C  "C5'" . DT  C 3 3   ? 14.316  14.904  10.855  1.00 72.90  ? 4    DT  C "C5'" 1 
ATOM   4902 C  "C4'" . DT  C 3 3   ? 13.260  14.639  11.902  1.00 71.44  ? 4    DT  C "C4'" 1 
ATOM   4903 O  "O4'" . DT  C 3 3   ? 12.796  13.274  11.779  1.00 72.58  ? 4    DT  C "O4'" 1 
ATOM   4904 C  "C3'" . DT  C 3 3   ? 13.744  14.791  13.344  1.00 67.55  ? 4    DT  C "C3'" 1 
ATOM   4905 O  "O3'" . DT  C 3 3   ? 13.387  16.083  13.845  1.00 66.47  ? 4    DT  C "O3'" 1 
ATOM   4906 C  "C2'" . DT  C 3 3   ? 12.983  13.708  14.085  1.00 67.08  ? 4    DT  C "C2'" 1 
ATOM   4907 C  "C1'" . DT  C 3 3   ? 12.847  12.615  13.037  1.00 69.75  ? 4    DT  C "C1'" 1 
ATOM   4908 N  N1    . DT  C 3 3   ? 13.967  11.658  12.999  1.00 68.36  ? 4    DT  C N1    1 
ATOM   4909 C  C2    . DT  C 3 3   ? 14.019  10.676  13.962  1.00 66.65  ? 4    DT  C C2    1 
ATOM   4910 O  O2    . DT  C 3 3   ? 13.186  10.565  14.847  1.00 66.18  ? 4    DT  C O2    1 
ATOM   4911 N  N3    . DT  C 3 3   ? 15.089  9.823   13.851  1.00 65.93  ? 4    DT  C N3    1 
ATOM   4912 C  C4    . DT  C 3 3   ? 16.087  9.854   12.895  1.00 66.89  ? 4    DT  C C4    1 
ATOM   4913 O  O4    . DT  C 3 3   ? 16.987  9.020   12.923  1.00 66.66  ? 4    DT  C O4    1 
ATOM   4914 C  C5    . DT  C 3 3   ? 15.967  10.909  11.915  1.00 68.62  ? 4    DT  C C5    1 
ATOM   4915 C  C7    . DT  C 3 3   ? 17.002  11.022  10.840  1.00 70.08  ? 4    DT  C C7    1 
ATOM   4916 C  C6    . DT  C 3 3   ? 14.927  11.746  12.015  1.00 68.94  ? 4    DT  C C6    1 
HETATM 4917 O  O1P   . FOX C 3 4   ? 13.644  18.105  15.315  1.00 66.38  ? 5    FOX C O1P   1 
HETATM 4918 P  P     . FOX C 3 4   ? 14.377  16.890  14.807  1.00 64.38  ? 5    FOX C P     1 
HETATM 4919 O  O2P   . FOX C 3 4   ? 15.704  17.047  14.108  1.00 64.31  ? 5    FOX C O2P   1 
HETATM 4920 O  "O5'" . FOX C 3 4   ? 14.580  15.896  16.051  1.00 62.40  ? 5    FOX C "O5'" 1 
HETATM 4921 C  "C5'" . FOX C 3 4   ? 14.371  16.390  17.369  1.00 62.72  ? 5    FOX C "C5'" 1 
HETATM 4922 C  "C4'" . FOX C 3 4   ? 13.318  15.531  18.050  1.00 62.81  ? 5    FOX C "C4'" 1 
HETATM 4923 C  "C6'" . FOX C 3 4   ? 12.781  14.527  17.040  1.00 65.14  ? 5    FOX C "C6'" 1 
HETATM 4924 C  "C3'" . FOX C 3 4   ? 13.969  14.728  19.163  1.00 59.04  ? 5    FOX C "C3'" 1 
HETATM 4925 O  "O3'" . FOX C 3 4   ? 13.186  14.869  20.350  1.00 55.53  ? 5    FOX C "O3'" 1 
HETATM 4926 C  "C2'" . FOX C 3 4   ? 14.020  13.273  18.714  1.00 61.64  ? 5    FOX C "C2'" 1 
HETATM 4927 C  "C1'" . FOX C 3 4   ? 13.536  13.225  17.270  1.00 64.50  ? 5    FOX C "C1'" 1 
HETATM 4928 N  N9    . FOX C 3 4   ? 14.682  13.216  16.386  1.00 67.26  ? 5    FOX C N9    1 
HETATM 4929 C  C4    . FOX C 3 4   ? 15.652  12.290  16.511  1.00 67.41  ? 5    FOX C C4    1 
HETATM 4930 N  N3    . FOX C 3 4   ? 15.591  11.335  17.462  1.00 67.34  ? 5    FOX C N3    1 
HETATM 4931 C  C2    . FOX C 3 4   ? 16.565  10.400  17.588  1.00 67.84  ? 5    FOX C C2    1 
HETATM 4932 N  N2    . FOX C 3 4   ? 16.446  9.468   18.563  1.00 67.49  ? 5    FOX C N2    1 
HETATM 4933 N  N1    . FOX C 3 4   ? 17.642  10.361  16.785  1.00 68.09  ? 5    FOX C N1    1 
HETATM 4934 C  C6    . FOX C 3 4   ? 17.830  11.246  15.801  1.00 67.79  ? 5    FOX C C6    1 
HETATM 4935 O  O6    . FOX C 3 4   ? 18.841  11.186  15.069  1.00 66.76  ? 5    FOX C O6    1 
HETATM 4936 C  C5    . FOX C 3 4   ? 16.813  12.299  15.597  1.00 69.01  ? 5    FOX C C5    1 
HETATM 4937 N  N7    . FOX C 3 4   ? 16.937  13.225  14.623  1.00 71.05  ? 5    FOX C N7    1 
HETATM 4938 C  C8    . FOX C 3 4   ? 18.099  13.376  13.996  1.00 71.20  ? 5    FOX C C8    1 
HETATM 4939 O  O8    . FOX C 3 4   ? 18.199  14.177  13.082  1.00 74.43  ? 5    FOX C O8    1 
ATOM   4940 P  P     . DA  C 3 5   ? 13.659  15.931  21.444  1.00 51.01  ? 6    DA  C P     1 
ATOM   4941 O  OP1   . DA  C 3 5   ? 12.471  16.384  22.207  1.00 50.84  ? 6    DA  C OP1   1 
ATOM   4942 O  OP2   . DA  C 3 5   ? 14.521  16.926  20.762  1.00 51.96  ? 6    DA  C OP2   1 
ATOM   4943 O  "O5'" . DA  C 3 5   ? 14.581  15.039  22.387  1.00 50.28  ? 6    DA  C "O5'" 1 
ATOM   4944 C  "C5'" . DA  C 3 5   ? 15.463  14.055  21.817  1.00 48.47  ? 6    DA  C "C5'" 1 
ATOM   4945 C  "C4'" . DA  C 3 5   ? 16.178  13.292  22.906  1.00 46.02  ? 6    DA  C "C4'" 1 
ATOM   4946 O  "O4'" . DA  C 3 5   ? 17.005  12.277  22.299  1.00 46.43  ? 6    DA  C "O4'" 1 
ATOM   4947 C  "C3'" . DA  C 3 5   ? 17.129  14.132  23.751  1.00 44.08  ? 6    DA  C "C3'" 1 
ATOM   4948 O  "O3'" . DA  C 3 5   ? 17.278  13.578  25.061  1.00 41.42  ? 6    DA  C "O3'" 1 
ATOM   4949 C  "C2'" . DA  C 3 5   ? 18.434  14.049  22.980  1.00 44.35  ? 6    DA  C "C2'" 1 
ATOM   4950 C  "C1'" . DA  C 3 5   ? 18.363  12.699  22.270  1.00 45.09  ? 6    DA  C "C1'" 1 
ATOM   4951 N  N9    . DA  C 3 5   ? 18.787  12.749  20.872  1.00 45.92  ? 6    DA  C N9    1 
ATOM   4952 C  C8    . DA  C 3 5   ? 18.511  13.724  19.946  1.00 46.53  ? 6    DA  C C8    1 
ATOM   4953 N  N7    . DA  C 3 5   ? 19.037  13.498  18.767  1.00 46.86  ? 6    DA  C N7    1 
ATOM   4954 C  C5    . DA  C 3 5   ? 19.709  12.294  18.928  1.00 46.61  ? 6    DA  C C5    1 
ATOM   4955 C  C6    . DA  C 3 5   ? 20.473  11.512  18.045  1.00 47.31  ? 6    DA  C C6    1 
ATOM   4956 N  N6    . DA  C 3 5   ? 20.698  11.840  16.770  1.00 48.10  ? 6    DA  C N6    1 
ATOM   4957 N  N1    . DA  C 3 5   ? 21.005  10.366  18.521  1.00 47.13  ? 6    DA  C N1    1 
ATOM   4958 C  C2    . DA  C 3 5   ? 20.779  10.037  19.799  1.00 46.65  ? 6    DA  C C2    1 
ATOM   4959 N  N3    . DA  C 3 5   ? 20.079  10.688  20.725  1.00 45.43  ? 6    DA  C N3    1 
ATOM   4960 C  C4    . DA  C 3 5   ? 19.564  11.822  20.220  1.00 45.92  ? 6    DA  C C4    1 
ATOM   4961 P  P     . DG  C 3 6   ? 18.426  14.129  26.028  1.00 39.82  ? 7    DG  C P     1 
ATOM   4962 O  OP1   . DG  C 3 6   ? 18.033  13.829  27.426  1.00 40.13  ? 7    DG  C OP1   1 
ATOM   4963 O  OP2   . DG  C 3 6   ? 18.745  15.523  25.636  1.00 39.46  ? 7    DG  C OP2   1 
ATOM   4964 O  "O5'" . DG  C 3 6   ? 19.665  13.205  25.643  1.00 38.67  ? 7    DG  C "O5'" 1 
ATOM   4965 C  "C5'" . DG  C 3 6   ? 19.678  11.810  25.993  1.00 38.67  ? 7    DG  C "C5'" 1 
ATOM   4966 C  "C4'" . DG  C 3 6   ? 21.088  11.271  25.939  1.00 38.24  ? 7    DG  C "C4'" 1 
ATOM   4967 O  "O4'" . DG  C 3 6   ? 21.526  11.200  24.562  1.00 38.29  ? 7    DG  C "O4'" 1 
ATOM   4968 C  "C3'" . DG  C 3 6   ? 22.129  12.119  26.671  1.00 37.08  ? 7    DG  C "C3'" 1 
ATOM   4969 O  "O3'" . DG  C 3 6   ? 23.075  11.263  27.319  1.00 37.06  ? 7    DG  C "O3'" 1 
ATOM   4970 C  "C2'" . DG  C 3 6   ? 22.778  12.920  25.557  1.00 36.84  ? 7    DG  C "C2'" 1 
ATOM   4971 C  "C1'" . DG  C 3 6   ? 22.708  11.963  24.379  1.00 37.58  ? 7    DG  C "C1'" 1 
ATOM   4972 N  N9    . DG  C 3 6   ? 22.619  12.616  23.077  1.00 37.87  ? 7    DG  C N9    1 
ATOM   4973 C  C8    . DG  C 3 6   ? 21.921  13.759  22.769  1.00 38.15  ? 7    DG  C C8    1 
ATOM   4974 N  N7    . DG  C 3 6   ? 22.025  14.101  21.514  1.00 38.70  ? 7    DG  C N7    1 
ATOM   4975 C  C5    . DG  C 3 6   ? 22.838  13.124  20.958  1.00 38.75  ? 7    DG  C C5    1 
ATOM   4976 C  C6    . DG  C 3 6   ? 23.304  12.963  19.627  1.00 39.72  ? 7    DG  C C6    1 
ATOM   4977 O  O6    . DG  C 3 6   ? 23.082  13.676  18.641  1.00 40.41  ? 7    DG  C O6    1 
ATOM   4978 N  N1    . DG  C 3 6   ? 24.106  11.834  19.499  1.00 39.67  ? 7    DG  C N1    1 
ATOM   4979 C  C2    . DG  C 3 6   ? 24.420  10.969  20.518  1.00 39.26  ? 7    DG  C C2    1 
ATOM   4980 N  N2    . DG  C 3 6   ? 25.210  9.936   20.194  1.00 39.65  ? 7    DG  C N2    1 
ATOM   4981 N  N3    . DG  C 3 6   ? 23.994  11.108  21.762  1.00 38.51  ? 7    DG  C N3    1 
ATOM   4982 C  C4    . DG  C 3 6   ? 23.212  12.198  21.909  1.00 38.36  ? 7    DG  C C4    1 
ATOM   4983 P  P     . DA  C 3 7   ? 24.248  11.843  28.236  1.00 34.50  ? 8    DA  C P     1 
ATOM   4984 O  OP1   . DA  C 3 7   ? 24.402  10.939  29.401  1.00 35.27  ? 8    DA  C OP1   1 
ATOM   4985 O  OP2   . DA  C 3 7   ? 24.027  13.293  28.452  1.00 33.93  ? 8    DA  C OP2   1 
ATOM   4986 O  "O5'" . DA  C 3 7   ? 25.521  11.649  27.300  1.00 33.99  ? 8    DA  C "O5'" 1 
ATOM   4987 C  "C5'" . DA  C 3 7   ? 25.719  10.413  26.593  1.00 35.35  ? 8    DA  C "C5'" 1 
ATOM   4988 C  "C4'" . DA  C 3 7   ? 26.977  10.482  25.761  1.00 35.32  ? 8    DA  C "C4'" 1 
ATOM   4989 O  "O4'" . DA  C 3 7   ? 26.671  11.049  24.466  1.00 35.15  ? 8    DA  C "O4'" 1 
ATOM   4990 C  "C3'" . DA  C 3 7   ? 28.095  11.343  26.356  1.00 35.42  ? 8    DA  C "C3'" 1 
ATOM   4991 O  "O3'" . DA  C 3 7   ? 29.332  10.632  26.273  1.00 36.74  ? 8    DA  C "O3'" 1 
ATOM   4992 C  "C2'" . DA  C 3 7   ? 28.109  12.582  25.477  1.00 34.72  ? 8    DA  C "C2'" 1 
ATOM   4993 C  "C1'" . DA  C 3 7   ? 27.622  12.046  24.146  1.00 34.61  ? 8    DA  C "C1'" 1 
ATOM   4994 N  N9    . DA  C 3 7   ? 26.962  13.036  23.296  1.00 34.52  ? 8    DA  C N9    1 
ATOM   4995 C  C8    . DA  C 3 7   ? 26.049  13.991  23.667  1.00 34.94  ? 8    DA  C C8    1 
ATOM   4996 N  N7    . DA  C 3 7   ? 25.632  14.738  22.674  1.00 35.36  ? 8    DA  C N7    1 
ATOM   4997 C  C5    . DA  C 3 7   ? 26.315  14.240  21.574  1.00 35.22  ? 8    DA  C C5    1 
ATOM   4998 C  C6    . DA  C 3 7   ? 26.314  14.604  20.215  1.00 35.95  ? 8    DA  C C6    1 
ATOM   4999 N  N6    . DA  C 3 7   ? 25.573  15.594  19.714  1.00 37.07  ? 8    DA  C N6    1 
ATOM   5000 N  N1    . DA  C 3 7   ? 27.111  13.905  19.378  1.00 35.94  ? 8    DA  C N1    1 
ATOM   5001 C  C2    . DA  C 3 7   ? 27.854  12.912  19.881  1.00 35.21  ? 8    DA  C C2    1 
ATOM   5002 N  N3    . DA  C 3 7   ? 27.942  12.477  21.136  1.00 34.30  ? 8    DA  C N3    1 
ATOM   5003 C  C4    . DA  C 3 7   ? 27.138  13.191  21.942  1.00 34.59  ? 8    DA  C C4    1 
ATOM   5004 P  P     . DG  C 3 8   ? 30.579  10.991  27.203  1.00 37.74  ? 9    DG  C P     1 
ATOM   5005 O  OP1   . DG  C 3 8   ? 30.803  9.865   28.141  1.00 40.53  ? 9    DG  C OP1   1 
ATOM   5006 O  OP2   . DG  C 3 8   ? 30.419  12.368  27.729  1.00 37.57  ? 9    DG  C OP2   1 
ATOM   5007 O  "O5'" . DG  C 3 8   ? 31.752  10.976  26.128  1.00 37.02  ? 9    DG  C "O5'" 1 
ATOM   5008 C  "C5'" . DG  C 3 8   ? 31.685  10.090  24.997  1.00 36.72  ? 9    DG  C "C5'" 1 
ATOM   5009 C  "C4'" . DG  C 3 8   ? 32.547  10.613  23.872  1.00 35.85  ? 9    DG  C "C4'" 1 
ATOM   5010 O  "O4'" . DG  C 3 8   ? 31.748  11.428  22.983  1.00 35.60  ? 9    DG  C "O4'" 1 
ATOM   5011 C  "C3'" . DG  C 3 8   ? 33.724  11.484  24.320  1.00 35.99  ? 9    DG  C "C3'" 1 
ATOM   5012 O  "O3'" . DG  C 3 8   ? 34.907  11.050  23.648  1.00 35.65  ? 9    DG  C "O3'" 1 
ATOM   5013 C  "C2'" . DG  C 3 8   ? 33.328  12.886  23.892  1.00 35.95  ? 9    DG  C "C2'" 1 
ATOM   5014 C  "C1'" . DG  C 3 8   ? 32.433  12.632  22.695  1.00 36.16  ? 9    DG  C "C1'" 1 
ATOM   5015 N  N9    . DG  C 3 8   ? 31.433  13.669  22.466  1.00 37.02  ? 9    DG  C N9    1 
ATOM   5016 C  C8    . DG  C 3 8   ? 30.578  14.212  23.394  1.00 37.93  ? 9    DG  C C8    1 
ATOM   5017 N  N7    . DG  C 3 8   ? 29.792  15.126  22.893  1.00 38.94  ? 9    DG  C N7    1 
ATOM   5018 C  C5    . DG  C 3 8   ? 30.151  15.191  21.554  1.00 38.78  ? 9    DG  C C5    1 
ATOM   5019 C  C6    . DG  C 3 8   ? 29.646  16.003  20.505  1.00 40.53  ? 9    DG  C C6    1 
ATOM   5020 O  O6    . DG  C 3 8   ? 28.750  16.855  20.553  1.00 42.24  ? 9    DG  C O6    1 
ATOM   5021 N  N1    . DG  C 3 8   ? 30.294  15.745  19.302  1.00 40.96  ? 9    DG  C N1    1 
ATOM   5022 C  C2    . DG  C 3 8   ? 31.299  14.826  19.127  1.00 40.36  ? 9    DG  C C2    1 
ATOM   5023 N  N2    . DG  C 3 8   ? 31.798  14.725  17.887  1.00 41.42  ? 9    DG  C N2    1 
ATOM   5024 N  N3    . DG  C 3 8   ? 31.778  14.063  20.096  1.00 37.72  ? 9    DG  C N3    1 
ATOM   5025 C  C4    . DG  C 3 8   ? 31.162  14.297  21.274  1.00 37.69  ? 9    DG  C C4    1 
ATOM   5026 P  P     . DT  C 3 9   ? 36.352  11.633  23.990  1.00 36.38  ? 10   DT  C P     1 
ATOM   5027 O  OP1   . DT  C 3 9   ? 37.302  10.543  23.682  1.00 36.73  ? 10   DT  C OP1   1 
ATOM   5028 O  OP2   . DT  C 3 9   ? 36.352  12.303  25.284  1.00 35.70  ? 10   DT  C OP2   1 
ATOM   5029 O  "O5'" . DT  C 3 9   ? 36.541  12.710  22.832  1.00 34.96  ? 10   DT  C "O5'" 1 
ATOM   5030 C  "C5'" . DT  C 3 9   ? 36.638  12.281  21.469  1.00 35.14  ? 10   DT  C "C5'" 1 
ATOM   5031 C  "C4'" . DT  C 3 9   ? 36.712  13.506  20.591  1.00 35.89  ? 10   DT  C "C4'" 1 
ATOM   5032 O  "O4'" . DT  C 3 9   ? 35.457  14.210  20.689  1.00 37.01  ? 10   DT  C "O4'" 1 
ATOM   5033 C  "C3'" . DT  C 3 9   ? 37.791  14.513  21.016  1.00 36.67  ? 10   DT  C "C3'" 1 
ATOM   5034 O  "O3'" . DT  C 3 9   ? 38.853  14.490  20.058  1.00 36.80  ? 10   DT  C "O3'" 1 
ATOM   5035 C  "C2'" . DT  C 3 9   ? 37.056  15.843  21.147  1.00 37.51  ? 10   DT  C "C2'" 1 
ATOM   5036 C  "C1'" . DT  C 3 9   ? 35.702  15.589  20.504  1.00 37.91  ? 10   DT  C "C1'" 1 
ATOM   5037 N  N1    . DT  C 3 9   ? 34.547  16.332  21.064  1.00 39.17  ? 10   DT  C N1    1 
ATOM   5038 C  C2    . DT  C 3 9   ? 33.770  17.085  20.204  1.00 40.62  ? 10   DT  C C2    1 
ATOM   5039 O  O2    . DT  C 3 9   ? 33.998  17.186  19.007  1.00 40.98  ? 10   DT  C O2    1 
ATOM   5040 N  N3    . DT  C 3 9   ? 32.712  17.723  20.800  1.00 40.46  ? 10   DT  C N3    1 
ATOM   5041 C  C4    . DT  C 3 9   ? 32.343  17.664  22.125  1.00 40.93  ? 10   DT  C C4    1 
ATOM   5042 O  O4    . DT  C 3 9   ? 31.366  18.294  22.510  1.00 42.29  ? 10   DT  C O4    1 
ATOM   5043 C  C5    . DT  C 3 9   ? 33.197  16.856  22.972  1.00 40.26  ? 10   DT  C C5    1 
ATOM   5044 C  C7    . DT  C 3 9   ? 32.886  16.755  24.432  1.00 41.15  ? 10   DT  C C7    1 
ATOM   5045 C  C6    . DT  C 3 9   ? 34.240  16.235  22.405  1.00 39.55  ? 10   DT  C C6    1 
ATOM   5046 P  P     . DC  C 3 10  ? 40.159  15.398  20.187  1.00 37.91  ? 11   DC  C P     1 
ATOM   5047 O  OP1   . DC  C 3 10  ? 41.253  14.786  19.375  1.00 38.30  ? 11   DC  C OP1   1 
ATOM   5048 O  OP2   . DC  C 3 10  ? 40.426  15.775  21.588  1.00 37.59  ? 11   DC  C OP2   1 
ATOM   5049 O  "O5'" . DC  C 3 10  ? 39.664  16.700  19.426  1.00 37.40  ? 11   DC  C "O5'" 1 
ATOM   5050 C  "C5'" . DC  C 3 10  ? 39.235  16.628  18.065  1.00 37.57  ? 11   DC  C "C5'" 1 
ATOM   5051 C  "C4'" . DC  C 3 10  ? 38.812  17.998  17.595  1.00 39.19  ? 11   DC  C "C4'" 1 
ATOM   5052 O  "O4'" . DC  C 3 10  ? 37.613  18.415  18.279  1.00 39.03  ? 11   DC  C "O4'" 1 
ATOM   5053 C  "C3'" . DC  C 3 10  ? 39.845  19.110  17.810  1.00 40.69  ? 11   DC  C "C3'" 1 
ATOM   5054 O  "O3'" . DC  C 3 10  ? 40.078  19.648  16.505  1.00 42.09  ? 11   DC  C "O3'" 1 
ATOM   5055 C  "C2'" . DC  C 3 10  ? 39.186  20.057  18.806  1.00 41.76  ? 11   DC  C "C2'" 1 
ATOM   5056 C  "C1'" . DC  C 3 10  ? 37.701  19.787  18.617  1.00 41.77  ? 11   DC  C "C1'" 1 
ATOM   5057 N  N1    . DC  C 3 10  ? 36.805  20.007  19.778  1.00 42.34  ? 11   DC  C N1    1 
ATOM   5058 C  C2    . DC  C 3 10  ? 35.606  20.706  19.584  1.00 44.27  ? 11   DC  C C2    1 
ATOM   5059 O  O2    . DC  C 3 10  ? 35.367  21.187  18.473  1.00 45.54  ? 11   DC  C O2    1 
ATOM   5060 N  N3    . DC  C 3 10  ? 34.747  20.851  20.618  1.00 44.00  ? 11   DC  C N3    1 
ATOM   5061 C  C4    . DC  C 3 10  ? 35.018  20.280  21.790  1.00 42.94  ? 11   DC  C C4    1 
ATOM   5062 N  N4    . DC  C 3 10  ? 34.140  20.448  22.781  1.00 43.77  ? 11   DC  C N4    1 
ATOM   5063 C  C5    . DC  C 3 10  ? 36.224  19.553  22.014  1.00 42.13  ? 11   DC  C C5    1 
ATOM   5064 C  C6    . DC  C 3 10  ? 37.069  19.418  20.981  1.00 41.54  ? 11   DC  C C6    1 
ATOM   5065 P  P     . DA  C 3 11  ? 41.190  20.747  16.182  1.00 44.97  ? 12   DA  C P     1 
ATOM   5066 O  OP1   . DA  C 3 11  ? 41.464  20.569  14.731  1.00 44.45  ? 12   DA  C OP1   1 
ATOM   5067 O  OP2   . DA  C 3 11  ? 42.268  20.670  17.182  1.00 42.91  ? 12   DA  C OP2   1 
ATOM   5068 O  "O5'" . DA  C 3 11  ? 40.374  22.087  16.399  1.00 47.76  ? 12   DA  C "O5'" 1 
ATOM   5069 C  "C5'" . DA  C 3 11  ? 39.271  22.388  15.553  1.00 50.47  ? 12   DA  C "C5'" 1 
ATOM   5070 C  "C4'" . DA  C 3 11  ? 38.752  23.747  15.945  1.00 55.16  ? 12   DA  C "C4'" 1 
ATOM   5071 O  "O4'" . DA  C 3 11  ? 37.975  23.613  17.159  1.00 54.69  ? 12   DA  C "O4'" 1 
ATOM   5072 C  "C3'" . DA  C 3 11  ? 39.844  24.772  16.260  1.00 58.94  ? 12   DA  C "C3'" 1 
ATOM   5073 O  "O3'" . DA  C 3 11  ? 39.391  26.008  15.739  1.00 64.75  ? 12   DA  C "O3'" 1 
ATOM   5074 C  "C2'" . DA  C 3 11  ? 39.871  24.817  17.780  1.00 58.10  ? 12   DA  C "C2'" 1 
ATOM   5075 C  "C1'" . DA  C 3 11  ? 38.408  24.564  18.109  1.00 55.98  ? 12   DA  C "C1'" 1 
ATOM   5076 N  N9    . DA  C 3 11  ? 38.115  24.027  19.434  1.00 53.48  ? 12   DA  C N9    1 
ATOM   5077 C  C8    . DA  C 3 11  ? 38.886  23.222  20.240  1.00 51.41  ? 12   DA  C C8    1 
ATOM   5078 N  N7    . DA  C 3 11  ? 38.317  22.917  21.380  1.00 49.97  ? 12   DA  C N7    1 
ATOM   5079 C  C5    . DA  C 3 11  ? 37.082  23.546  21.314  1.00 51.29  ? 12   DA  C C5    1 
ATOM   5080 C  C6    . DA  C 3 11  ? 36.002  23.604  22.209  1.00 51.12  ? 12   DA  C C6    1 
ATOM   5081 N  N6    . DA  C 3 11  ? 35.993  22.990  23.392  1.00 50.14  ? 12   DA  C N6    1 
ATOM   5082 N  N1    . DA  C 3 11  ? 34.916  24.319  21.839  1.00 52.04  ? 12   DA  C N1    1 
ATOM   5083 C  C2    . DA  C 3 11  ? 34.926  24.934  20.650  1.00 53.90  ? 12   DA  C C2    1 
ATOM   5084 N  N3    . DA  C 3 11  ? 35.879  24.948  19.720  1.00 54.37  ? 12   DA  C N3    1 
ATOM   5085 C  C4    . DA  C 3 11  ? 36.941  24.226  20.118  1.00 52.89  ? 12   DA  C C4    1 
ATOM   5086 P  P     . DG  C 3 12  ? 40.342  27.170  15.208  1.00 71.47  ? 13   DG  C P     1 
ATOM   5087 O  OP1   . DG  C 3 12  ? 40.373  26.912  13.746  1.00 70.89  ? 13   DG  C OP1   1 
ATOM   5088 O  OP2   . DG  C 3 12  ? 41.602  27.247  16.010  1.00 71.06  ? 13   DG  C OP2   1 
ATOM   5089 O  "O5'" . DG  C 3 12  ? 39.397  28.404  15.554  1.00 73.92  ? 13   DG  C "O5'" 1 
ATOM   5090 C  "C5'" . DG  C 3 12  ? 37.957  28.268  15.512  1.00 73.54  ? 13   DG  C "C5'" 1 
ATOM   5091 C  "C4'" . DG  C 3 12  ? 37.311  29.275  16.435  1.00 76.40  ? 13   DG  C "C4'" 1 
ATOM   5092 O  "O4'" . DG  C 3 12  ? 36.991  28.652  17.699  1.00 72.62  ? 13   DG  C "O4'" 1 
ATOM   5093 C  "C3'" . DG  C 3 12  ? 38.173  30.498  16.758  1.00 80.98  ? 13   DG  C "C3'" 1 
ATOM   5094 O  "O3'" . DG  C 3 12  ? 37.379  31.666  16.527  1.00 86.87  ? 13   DG  C "O3'" 1 
ATOM   5095 C  "C2'" . DG  C 3 12  ? 38.638  30.248  18.183  1.00 78.96  ? 13   DG  C "C2'" 1 
ATOM   5096 C  "C1'" . DG  C 3 12  ? 37.521  29.403  18.773  1.00 74.93  ? 13   DG  C "C1'" 1 
ATOM   5097 N  N9    . DG  C 3 12  ? 37.939  28.467  19.815  1.00 71.27  ? 13   DG  C N9    1 
ATOM   5098 C  C8    . DG  C 3 12  ? 39.114  27.755  19.868  1.00 69.34  ? 13   DG  C C8    1 
ATOM   5099 N  N7    . DG  C 3 12  ? 39.210  27.004  20.931  1.00 66.98  ? 13   DG  C N7    1 
ATOM   5100 C  C5    . DG  C 3 12  ? 38.032  27.238  21.627  1.00 67.10  ? 13   DG  C C5    1 
ATOM   5101 C  C6    . DG  C 3 12  ? 37.572  26.709  22.863  1.00 65.53  ? 13   DG  C C6    1 
ATOM   5102 O  O6    . DG  C 3 12  ? 38.133  25.900  23.612  1.00 62.46  ? 13   DG  C O6    1 
ATOM   5103 N  N1    . DG  C 3 12  ? 36.326  27.223  23.208  1.00 66.14  ? 13   DG  C N1    1 
ATOM   5104 C  C2    . DG  C 3 12  ? 35.608  28.123  22.456  1.00 68.45  ? 13   DG  C C2    1 
ATOM   5105 N  N2    . DG  C 3 12  ? 34.420  28.495  22.952  1.00 69.02  ? 13   DG  C N2    1 
ATOM   5106 N  N3    . DG  C 3 12  ? 36.024  28.620  21.301  1.00 70.39  ? 13   DG  C N3    1 
ATOM   5107 C  C4    . DG  C 3 12  ? 37.236  28.140  20.952  1.00 69.63  ? 13   DG  C C4    1 
ATOM   5108 P  P     . DG  C 3 13  ? 37.652  33.094  17.168  1.00 93.74  ? 14   DG  C P     1 
ATOM   5109 O  OP1   . DG  C 3 13  ? 36.937  34.073  16.319  1.00 98.00  ? 14   DG  C OP1   1 
ATOM   5110 O  OP2   . DG  C 3 13  ? 39.096  33.269  17.482  1.00 93.84  ? 14   DG  C OP2   1 
ATOM   5111 O  "O5'" . DG  C 3 13  ? 36.866  32.907  18.538  1.00 95.67  ? 14   DG  C "O5'" 1 
ATOM   5112 C  "C5'" . DG  C 3 13  ? 35.592  33.524  18.784  1.00 100.96 ? 14   DG  C "C5'" 1 
ATOM   5113 C  "C4'" . DG  C 3 13  ? 35.441  33.708  20.274  1.00 104.21 ? 14   DG  C "C4'" 1 
ATOM   5114 O  "O4'" . DG  C 3 13  ? 35.903  32.506  20.947  1.00 97.75  ? 14   DG  C "O4'" 1 
ATOM   5115 C  "C3'" . DG  C 3 13  ? 36.284  34.856  20.838  1.00 113.40 ? 14   DG  C "C3'" 1 
ATOM   5116 O  "O3'" . DG  C 3 13  ? 35.543  35.595  21.805  1.00 129.42 ? 14   DG  C "O3'" 1 
ATOM   5117 C  "C2'" . DG  C 3 13  ? 37.433  34.146  21.526  1.00 108.15 ? 14   DG  C "C2'" 1 
ATOM   5118 C  "C1'" . DG  C 3 13  ? 36.727  32.907  22.021  1.00 98.92  ? 14   DG  C "C1'" 1 
ATOM   5119 N  N9    . DG  C 3 13  ? 37.610  31.804  22.382  1.00 91.32  ? 14   DG  C N9    1 
ATOM   5120 C  C8    . DG  C 3 13  ? 38.774  31.417  21.761  1.00 89.11  ? 14   DG  C C8    1 
ATOM   5121 N  N7    . DG  C 3 13  ? 39.382  30.440  22.376  1.00 84.70  ? 14   DG  C N7    1 
ATOM   5122 C  C5    . DG  C 3 13  ? 38.587  30.186  23.486  1.00 83.45  ? 14   DG  C C5    1 
ATOM   5123 C  C6    . DG  C 3 13  ? 38.743  29.239  24.532  1.00 80.25  ? 14   DG  C C6    1 
ATOM   5124 O  O6    . DG  C 3 13  ? 39.640  28.406  24.690  1.00 77.69  ? 14   DG  C O6    1 
ATOM   5125 N  N1    . DG  C 3 13  ? 37.705  29.321  25.454  1.00 80.30  ? 14   DG  C N1    1 
ATOM   5126 C  C2    . DG  C 3 13  ? 36.657  30.205  25.387  1.00 82.81  ? 14   DG  C C2    1 
ATOM   5127 N  N2    . DG  C 3 13  ? 35.758  30.133  26.380  1.00 82.71  ? 14   DG  C N2    1 
ATOM   5128 N  N3    . DG  C 3 13  ? 36.505  31.098  24.422  1.00 85.24  ? 14   DG  C N3    1 
ATOM   5129 C  C4    . DG  C 3 13  ? 37.499  31.031  23.512  1.00 86.44  ? 14   DG  C C4    1 
ATOM   5130 P  P     . DC  C 3 14  ? 36.209  36.881  22.478  1.00 77.21  ? 15   DC  C P     1 
ATOM   5131 O  OP1   . DC  C 3 14  ? 35.189  37.951  22.312  1.00 75.09  ? 15   DC  C OP1   1 
ATOM   5132 O  OP2   . DC  C 3 14  ? 37.572  37.068  21.912  1.00 73.88  ? 15   DC  C OP2   1 
ATOM   5133 O  "O5'" . DC  C 3 14  ? 36.388  36.505  24.020  1.00 77.35  ? 15   DC  C "O5'" 1 
ATOM   5134 C  "C5'" . DC  C 3 14  ? 35.407  35.721  24.734  1.00 79.66  ? 15   DC  C "C5'" 1 
ATOM   5135 C  "C4'" . DC  C 3 14  ? 35.984  35.163  26.016  1.00 81.55  ? 15   DC  C "C4'" 1 
ATOM   5136 O  "O4'" . DC  C 3 14  ? 36.800  34.005  25.749  1.00 82.13  ? 15   DC  C "O4'" 1 
ATOM   5137 C  "C3'" . DC  C 3 14  ? 36.892  36.099  26.816  1.00 86.20  ? 15   DC  C "C3'" 1 
ATOM   5138 O  "O3'" . DC  C 3 14  ? 36.153  36.831  27.801  1.00 92.40  ? 15   DC  C "O3'" 1 
ATOM   5139 C  "C2'" . DC  C 3 14  ? 37.899  35.161  27.473  1.00 84.75  ? 15   DC  C "C2'" 1 
ATOM   5140 C  "C1'" . DC  C 3 14  ? 37.563  33.777  26.922  1.00 80.45  ? 15   DC  C "C1'" 1 
ATOM   5141 N  N1    . DC  C 3 14  ? 38.735  32.958  26.559  1.00 79.68  ? 15   DC  C N1    1 
ATOM   5142 C  C2    . DC  C 3 14  ? 39.121  31.908  27.408  1.00 78.26  ? 15   DC  C C2    1 
ATOM   5143 O  O2    . DC  C 3 14  ? 38.461  31.690  28.435  1.00 73.66  ? 15   DC  C O2    1 
ATOM   5144 N  N3    . DC  C 3 14  ? 40.200  31.158  27.082  1.00 75.10  ? 15   DC  C N3    1 
ATOM   5145 C  C4    . DC  C 3 14  ? 40.887  31.426  25.967  1.00 72.19  ? 15   DC  C C4    1 
ATOM   5146 N  N4    . DC  C 3 14  ? 41.941  30.659  25.684  1.00 76.54  ? 15   DC  C N4    1 
ATOM   5147 C  C5    . DC  C 3 14  ? 40.518  32.489  25.090  1.00 71.82  ? 15   DC  C C5    1 
ATOM   5148 C  C6    . DC  C 3 14  ? 39.447  33.224  25.422  1.00 76.14  ? 15   DC  C C6    1 
HETATM 5149 S  S     . SO4 D 4 .   ? 13.719  -6.102  9.286   1.00 48.05  ? 1877 SO4 A S     1 
HETATM 5150 O  O1    . SO4 D 4 .   ? 13.649  -5.143  10.423  1.00 52.14  ? 1877 SO4 A O1    1 
HETATM 5151 O  O2    . SO4 D 4 .   ? 14.273  -5.358  8.125   1.00 49.23  ? 1877 SO4 A O2    1 
HETATM 5152 O  O3    . SO4 D 4 .   ? 12.367  -6.562  8.935   1.00 49.29  ? 1877 SO4 A O3    1 
HETATM 5153 O  O4    . SO4 D 4 .   ? 14.597  -7.240  9.599   1.00 49.35  ? 1877 SO4 A O4    1 
HETATM 5154 S  S     . SO4 E 4 .   ? -4.294  -10.229 -1.373  1.00 40.65  ? 1878 SO4 A S     1 
HETATM 5155 O  O1    . SO4 E 4 .   ? -3.670  -9.363  -0.379  1.00 50.58  ? 1878 SO4 A O1    1 
HETATM 5156 O  O2    . SO4 E 4 .   ? -3.208  -11.139 -1.760  1.00 46.31  ? 1878 SO4 A O2    1 
HETATM 5157 O  O3    . SO4 E 4 .   ? -4.692  -9.334  -2.473  1.00 44.23  ? 1878 SO4 A O3    1 
HETATM 5158 O  O4    . SO4 E 4 .   ? -5.572  -10.788 -0.883  1.00 38.98  ? 1878 SO4 A O4    1 
HETATM 5159 S  S     . SO4 F 4 .   ? 17.468  21.480  41.335  1.00 66.65  ? 1879 SO4 A S     1 
HETATM 5160 O  O1    . SO4 F 4 .   ? 18.099  22.517  42.208  1.00 56.21  ? 1879 SO4 A O1    1 
HETATM 5161 O  O2    . SO4 F 4 .   ? 18.419  20.427  40.795  1.00 49.37  ? 1879 SO4 A O2    1 
HETATM 5162 O  O3    . SO4 F 4 .   ? 16.892  22.226  40.180  1.00 52.22  ? 1879 SO4 A O3    1 
HETATM 5163 O  O4    . SO4 F 4 .   ? 16.441  20.815  42.193  1.00 51.89  ? 1879 SO4 A O4    1 
HETATM 5164 S  S     . SO4 G 4 .   ? -8.981  3.195   3.284   0.50 36.41  ? 1880 SO4 A S     1 
HETATM 5165 O  O1    . SO4 G 4 .   ? -9.457  4.548   3.644   0.50 41.75  ? 1880 SO4 A O1    1 
HETATM 5166 O  O2    . SO4 G 4 .   ? -7.551  3.138   3.602   0.50 34.99  ? 1880 SO4 A O2    1 
HETATM 5167 O  O3    . SO4 G 4 .   ? -9.257  2.957   1.849   0.50 38.54  ? 1880 SO4 A O3    1 
HETATM 5168 O  O4    . SO4 G 4 .   ? -9.661  2.191   4.115   0.50 38.63  ? 1880 SO4 A O4    1 
HETATM 5169 S  S     . SO4 H 4 .   ? 3.039   37.905  5.962   0.50 41.37  ? 1881 SO4 A S     1 
HETATM 5170 O  O1    . SO4 H 4 .   ? 2.816   37.977  7.415   0.50 36.22  ? 1881 SO4 A O1    1 
HETATM 5171 O  O2    . SO4 H 4 .   ? 4.039   38.888  5.526   0.50 37.91  ? 1881 SO4 A O2    1 
HETATM 5172 O  O3    . SO4 H 4 .   ? 1.738   38.127  5.290   0.50 38.63  ? 1881 SO4 A O3    1 
HETATM 5173 O  O4    . SO4 H 4 .   ? 3.547   36.578  5.588   0.50 38.45  ? 1881 SO4 A O4    1 
HETATM 5174 S  S     . SO4 I 4 .   ? 9.993   -5.334  14.257  0.50 34.50  ? 1882 SO4 A S     1 
HETATM 5175 O  O1    . SO4 I 4 .   ? 9.355   -4.079  14.852  0.50 25.22  ? 1882 SO4 A O1    1 
HETATM 5176 O  O2    . SO4 I 4 .   ? 11.374  -5.431  14.792  0.50 31.78  ? 1882 SO4 A O2    1 
HETATM 5177 O  O3    . SO4 I 4 .   ? 9.990   -5.238  12.792  0.50 30.11  ? 1882 SO4 A O3    1 
HETATM 5178 O  O4    . SO4 I 4 .   ? 9.283   -6.583  14.568  0.50 29.02  ? 1882 SO4 A O4    1 
HETATM 5179 MG MG    . MG  J 5 .   ? 10.832  -3.819  17.617  1.00 43.80  ? 1883 MG  A MG    1 
HETATM 5180 O  O     . HOH K 6 .   ? 5.640   29.284  59.799  1.00 40.12  ? 2001 HOH A O     1 
HETATM 5181 O  O     . HOH K 6 .   ? 2.861   21.458  66.273  1.00 37.67  ? 2002 HOH A O     1 
HETATM 5182 O  O     . HOH K 6 .   ? 2.697   18.803  56.291  1.00 26.69  ? 2003 HOH A O     1 
HETATM 5183 O  O     . HOH K 6 .   ? 1.115   15.445  53.714  1.00 35.65  ? 2004 HOH A O     1 
HETATM 5184 O  O     . HOH K 6 .   ? -2.280  21.521  54.998  1.00 23.09  ? 2005 HOH A O     1 
HETATM 5185 O  O     . HOH K 6 .   ? -0.706  17.146  47.737  1.00 34.39  ? 2006 HOH A O     1 
HETATM 5186 O  O     . HOH K 6 .   ? -3.228  16.968  44.508  1.00 38.21  ? 2007 HOH A O     1 
HETATM 5187 O  O     . HOH K 6 .   ? 9.394   19.634  45.318  1.00 17.62  ? 2008 HOH A O     1 
HETATM 5188 O  O     . HOH K 6 .   ? 11.812  18.589  45.929  1.00 19.24  ? 2009 HOH A O     1 
HETATM 5189 O  O     . HOH K 6 .   ? 15.289  17.724  44.640  1.00 22.98  ? 2010 HOH A O     1 
HETATM 5190 O  O     . HOH K 6 .   ? 13.758  20.272  44.773  1.00 26.98  ? 2011 HOH A O     1 
HETATM 5191 O  O     . HOH K 6 .   ? 22.747  17.829  46.259  1.00 21.95  ? 2012 HOH A O     1 
HETATM 5192 O  O     . HOH K 6 .   ? 25.971  15.527  39.335  1.00 32.79  ? 2013 HOH A O     1 
HETATM 5193 O  O     . HOH K 6 .   ? 20.277  14.382  35.733  1.00 37.40  ? 2014 HOH A O     1 
HETATM 5194 O  O     . HOH K 6 .   ? 13.825  13.044  37.809  1.00 28.21  ? 2015 HOH A O     1 
HETATM 5195 O  O     . HOH K 6 .   ? 25.865  12.172  48.835  1.00 30.36  ? 2016 HOH A O     1 
HETATM 5196 O  O     . HOH K 6 .   ? 27.408  11.001  45.867  1.00 39.56  ? 2017 HOH A O     1 
HETATM 5197 O  O     . HOH K 6 .   ? 22.979  9.019   49.924  1.00 21.48  ? 2018 HOH A O     1 
HETATM 5198 O  O     . HOH K 6 .   ? 21.041  10.169  48.405  1.00 23.67  ? 2019 HOH A O     1 
HETATM 5199 O  O     . HOH K 6 .   ? 22.156  14.478  52.619  1.00 31.05  ? 2020 HOH A O     1 
HETATM 5200 O  O     . HOH K 6 .   ? -0.193  28.681  54.826  1.00 44.81  ? 2021 HOH A O     1 
HETATM 5201 O  O     . HOH K 6 .   ? 2.513   30.104  51.108  1.00 26.87  ? 2022 HOH A O     1 
HETATM 5202 O  O     . HOH K 6 .   ? 9.949   6.445   61.149  1.00 34.41  ? 2023 HOH A O     1 
HETATM 5203 O  O     . HOH K 6 .   ? 4.541   11.129  61.823  1.00 38.03  ? 2024 HOH A O     1 
HETATM 5204 O  O     . HOH K 6 .   ? 9.636   7.103   54.880  1.00 31.68  ? 2025 HOH A O     1 
HETATM 5205 O  O     . HOH K 6 .   ? 13.137  19.309  42.383  1.00 32.39  ? 2026 HOH A O     1 
HETATM 5206 O  O     . HOH K 6 .   ? 12.677  16.733  44.066  1.00 28.15  ? 2027 HOH A O     1 
HETATM 5207 O  O     . HOH K 6 .   ? 15.755  15.152  37.700  1.00 28.59  ? 2028 HOH A O     1 
HETATM 5208 O  O     . HOH K 6 .   ? 8.909   12.982  38.973  1.00 22.42  ? 2029 HOH A O     1 
HETATM 5209 O  O     . HOH K 6 .   ? 12.150  13.125  34.839  1.00 23.82  ? 2030 HOH A O     1 
HETATM 5210 O  O     . HOH K 6 .   ? 12.001  7.249   48.577  1.00 18.48  ? 2031 HOH A O     1 
HETATM 5211 O  O     . HOH K 6 .   ? 16.272  2.018   50.034  1.00 32.27  ? 2032 HOH A O     1 
HETATM 5212 O  O     . HOH K 6 .   ? 9.275   3.954   43.727  1.00 35.33  ? 2033 HOH A O     1 
HETATM 5213 O  O     . HOH K 6 .   ? 12.763  0.712   44.576  1.00 40.08  ? 2034 HOH A O     1 
HETATM 5214 O  O     . HOH K 6 .   ? 11.049  4.858   55.040  1.00 33.26  ? 2035 HOH A O     1 
HETATM 5215 O  O     . HOH K 6 .   ? 4.199   8.890   45.949  1.00 30.21  ? 2036 HOH A O     1 
HETATM 5216 O  O     . HOH K 6 .   ? 3.711   15.609  27.028  1.00 28.70  ? 2037 HOH A O     1 
HETATM 5217 O  O     . HOH K 6 .   ? 7.984   11.385  28.919  1.00 24.48  ? 2038 HOH A O     1 
HETATM 5218 O  O     . HOH K 6 .   ? 1.364   16.910  26.413  1.00 22.44  ? 2039 HOH A O     1 
HETATM 5219 O  O     . HOH K 6 .   ? -1.981  23.211  27.408  1.00 17.77  ? 2040 HOH A O     1 
HETATM 5220 O  O     . HOH K 6 .   ? 7.628   22.176  29.592  1.00 26.20  ? 2041 HOH A O     1 
HETATM 5221 O  O     . HOH K 6 .   ? 3.946   21.787  22.634  1.00 20.68  ? 2042 HOH A O     1 
HETATM 5222 O  O     . HOH K 6 .   ? 2.717   27.121  27.067  1.00 35.18  ? 2043 HOH A O     1 
HETATM 5223 O  O     . HOH K 6 .   ? 12.166  19.207  32.046  1.00 30.10  ? 2044 HOH A O     1 
HETATM 5224 O  O     . HOH K 6 .   ? 13.648  29.253  35.340  1.00 32.07  ? 2045 HOH A O     1 
HETATM 5225 O  O     . HOH K 6 .   ? 17.207  27.614  36.614  1.00 29.09  ? 2046 HOH A O     1 
HETATM 5226 O  O     . HOH K 6 .   ? 13.000  27.737  40.531  1.00 19.03  ? 2047 HOH A O     1 
HETATM 5227 O  O     . HOH K 6 .   ? 13.188  23.716  40.623  1.00 24.13  ? 2048 HOH A O     1 
HETATM 5228 O  O     . HOH K 6 .   ? 8.409   32.504  37.838  1.00 21.74  ? 2049 HOH A O     1 
HETATM 5229 O  O     . HOH K 6 .   ? 8.222   29.542  31.726  1.00 31.19  ? 2050 HOH A O     1 
HETATM 5230 O  O     . HOH K 6 .   ? 24.999  19.013  47.203  1.00 27.35  ? 2051 HOH A O     1 
HETATM 5231 O  O     . HOH K 6 .   ? -5.545  27.424  35.056  1.00 35.45  ? 2052 HOH A O     1 
HETATM 5232 O  O     . HOH K 6 .   ? 2.404   32.413  47.247  1.00 24.54  ? 2053 HOH A O     1 
HETATM 5233 O  O     . HOH K 6 .   ? 6.857   31.702  46.135  1.00 17.23  ? 2054 HOH A O     1 
HETATM 5234 O  O     . HOH K 6 .   ? 10.949  36.729  38.338  1.00 38.99  ? 2055 HOH A O     1 
HETATM 5235 O  O     . HOH K 6 .   ? 7.894   40.182  38.129  1.00 33.39  ? 2056 HOH A O     1 
HETATM 5236 O  O     . HOH K 6 .   ? 11.380  35.694  44.729  1.00 32.63  ? 2057 HOH A O     1 
HETATM 5237 O  O     . HOH K 6 .   ? 10.660  33.935  38.523  1.00 27.59  ? 2058 HOH A O     1 
HETATM 5238 O  O     . HOH K 6 .   ? 13.397  31.698  45.153  1.00 21.67  ? 2059 HOH A O     1 
HETATM 5239 O  O     . HOH K 6 .   ? 16.956  33.055  48.235  1.00 24.14  ? 2060 HOH A O     1 
HETATM 5240 O  O     . HOH K 6 .   ? 25.120  29.687  44.608  1.00 36.09  ? 2061 HOH A O     1 
HETATM 5241 O  O     . HOH K 6 .   ? 28.298  24.198  47.442  1.00 36.78  ? 2062 HOH A O     1 
HETATM 5242 O  O     . HOH K 6 .   ? 14.756  33.567  46.860  1.00 29.32  ? 2063 HOH A O     1 
HETATM 5243 O  O     . HOH K 6 .   ? 13.742  36.102  46.471  1.00 33.42  ? 2064 HOH A O     1 
HETATM 5244 O  O     . HOH K 6 .   ? 10.662  30.854  32.200  1.00 39.53  ? 2065 HOH A O     1 
HETATM 5245 O  O     . HOH K 6 .   ? 9.659   37.695  45.020  1.00 37.02  ? 2066 HOH A O     1 
HETATM 5246 O  O     . HOH K 6 .   ? 1.662   29.843  48.479  1.00 20.59  ? 2067 HOH A O     1 
HETATM 5247 O  O     . HOH K 6 .   ? -3.300  25.538  44.744  1.00 22.99  ? 2068 HOH A O     1 
HETATM 5248 O  O     . HOH K 6 .   ? -1.112  29.824  48.319  1.00 34.24  ? 2069 HOH A O     1 
HETATM 5249 O  O     . HOH K 6 .   ? -5.216  24.735  27.920  1.00 31.70  ? 2070 HOH A O     1 
HETATM 5250 O  O     . HOH K 6 .   ? -8.289  22.807  26.568  1.00 44.43  ? 2071 HOH A O     1 
HETATM 5251 O  O     . HOH K 6 .   ? -4.936  17.104  25.416  1.00 25.28  ? 2072 HOH A O     1 
HETATM 5252 O  O     . HOH K 6 .   ? -6.535  12.286  30.869  1.00 25.09  ? 2073 HOH A O     1 
HETATM 5253 O  O     . HOH K 6 .   ? 13.199  -2.833  41.253  1.00 26.07  ? 2074 HOH A O     1 
HETATM 5254 O  O     . HOH K 6 .   ? -0.964  9.871   40.908  1.00 21.98  ? 2075 HOH A O     1 
HETATM 5255 O  O     . HOH K 6 .   ? -2.566  3.960   37.045  1.00 27.81  ? 2076 HOH A O     1 
HETATM 5256 O  O     . HOH K 6 .   ? 1.003   8.115   41.602  1.00 32.58  ? 2077 HOH A O     1 
HETATM 5257 O  O     . HOH K 6 .   ? 3.468   3.356   40.448  1.00 24.05  ? 2078 HOH A O     1 
HETATM 5258 O  O     . HOH K 6 .   ? 9.847   12.417  36.463  1.00 26.19  ? 2079 HOH A O     1 
HETATM 5259 O  O     . HOH K 6 .   ? 10.087  -0.483  38.837  1.00 24.99  ? 2080 HOH A O     1 
HETATM 5260 O  O     . HOH K 6 .   ? 14.331  -0.613  42.912  1.00 24.03  ? 2081 HOH A O     1 
HETATM 5261 O  O     . HOH K 6 .   ? 4.935   1.593   41.813  1.00 46.41  ? 2082 HOH A O     1 
HETATM 5262 O  O     . HOH K 6 .   ? 18.065  0.731   35.549  1.00 18.24  ? 2083 HOH A O     1 
HETATM 5263 O  O     . HOH K 6 .   ? 19.604  -4.504  39.397  1.00 29.67  ? 2084 HOH A O     1 
HETATM 5264 O  O     . HOH K 6 .   ? 18.574  -4.568  42.035  1.00 38.58  ? 2085 HOH A O     1 
HETATM 5265 O  O     . HOH K 6 .   ? 21.403  -6.076  36.022  1.00 16.58  ? 2086 HOH A O     1 
HETATM 5266 O  O     . HOH K 6 .   ? 33.507  -7.787  35.731  1.00 34.81  ? 2087 HOH A O     1 
HETATM 5267 O  O     . HOH K 6 .   ? 29.519  -10.798 30.274  1.00 31.26  ? 2088 HOH A O     1 
HETATM 5268 O  O     . HOH K 6 .   ? 28.539  -0.525  16.168  1.00 39.23  ? 2089 HOH A O     1 
HETATM 5269 O  O     . HOH K 6 .   ? 39.599  17.207  -6.908  1.00 38.47  ? 2090 HOH A O     1 
HETATM 5270 O  O     . HOH K 6 .   ? 33.331  14.934  -0.632  1.00 33.31  ? 2091 HOH A O     1 
HETATM 5271 O  O     . HOH K 6 .   ? 33.135  16.769  1.464   1.00 31.60  ? 2092 HOH A O     1 
HETATM 5272 O  O     . HOH K 6 .   ? 28.336  16.260  6.643   1.00 38.20  ? 2093 HOH A O     1 
HETATM 5273 O  O     . HOH K 6 .   ? 39.451  3.356   0.591   1.00 30.72  ? 2094 HOH A O     1 
HETATM 5274 O  O     . HOH K 6 .   ? -1.230  27.888  16.223  1.00 35.15  ? 2095 HOH A O     1 
HETATM 5275 O  O     . HOH K 6 .   ? 45.375  4.827   -2.229  1.00 36.77  ? 2096 HOH A O     1 
HETATM 5276 O  O     . HOH K 6 .   ? 7.042   22.819  14.419  1.00 26.91  ? 2097 HOH A O     1 
HETATM 5277 O  O     . HOH K 6 .   ? 32.048  5.764   13.690  1.00 36.33  ? 2098 HOH A O     1 
HETATM 5278 O  O     . HOH K 6 .   ? 26.557  7.559   20.606  1.00 37.34  ? 2099 HOH A O     1 
HETATM 5279 O  O     . HOH K 6 .   ? 30.498  8.953   30.510  1.00 35.47  ? 2100 HOH A O     1 
HETATM 5280 O  O     . HOH K 6 .   ? 25.513  5.241   36.347  1.00 27.68  ? 2101 HOH A O     1 
HETATM 5281 O  O     . HOH K 6 .   ? 20.453  2.019   34.942  1.00 17.04  ? 2102 HOH A O     1 
HETATM 5282 O  O     . HOH K 6 .   ? 10.987  13.044  28.077  1.00 17.59  ? 2103 HOH A O     1 
HETATM 5283 O  O     . HOH K 6 .   ? 7.782   6.200   20.636  1.00 50.00  ? 2104 HOH A O     1 
HETATM 5284 O  O     . HOH K 6 .   ? 10.525  6.191   25.330  1.00 30.16  ? 2105 HOH A O     1 
HETATM 5285 O  O     . HOH K 6 .   ? 14.520  9.904   23.928  1.00 27.85  ? 2106 HOH A O     1 
HETATM 5286 O  O     . HOH K 6 .   ? 17.914  8.565   25.523  1.00 31.12  ? 2107 HOH A O     1 
HETATM 5287 O  O     . HOH K 6 .   ? 26.141  7.242   27.915  1.00 25.68  ? 2108 HOH A O     1 
HETATM 5288 O  O     . HOH K 6 .   ? 25.195  5.172   25.316  1.00 30.18  ? 2109 HOH A O     1 
HETATM 5289 O  O     . HOH K 6 .   ? 19.284  8.420   22.682  1.00 25.56  ? 2110 HOH A O     1 
HETATM 5290 O  O     . HOH K 6 .   ? 24.496  9.245   23.688  1.00 30.95  ? 2111 HOH A O     1 
HETATM 5291 O  O     . HOH K 6 .   ? 20.176  0.673   23.654  1.00 23.14  ? 2112 HOH A O     1 
HETATM 5292 O  O     . HOH K 6 .   ? 25.955  -0.883  15.076  1.00 32.44  ? 2113 HOH A O     1 
HETATM 5293 O  O     . HOH K 6 .   ? 21.895  -8.593  21.029  1.00 30.25  ? 2114 HOH A O     1 
HETATM 5294 O  O     . HOH K 6 .   ? 20.217  -7.066  22.933  1.00 25.89  ? 2115 HOH A O     1 
HETATM 5295 O  O     . HOH K 6 .   ? 26.031  -11.548 36.720  1.00 39.95  ? 2116 HOH A O     1 
HETATM 5296 O  O     . HOH K 6 .   ? 24.629  -17.046 37.636  1.00 45.27  ? 2117 HOH A O     1 
HETATM 5297 O  O     . HOH K 6 .   ? 10.237  -7.661  17.220  1.00 44.95  ? 2118 HOH A O     1 
HETATM 5298 O  O     . HOH K 6 .   ? 8.060   -1.431  17.216  1.00 23.50  ? 2119 HOH A O     1 
HETATM 5299 O  O     . HOH K 6 .   ? 3.231   -4.503  18.155  1.00 16.98  ? 2120 HOH A O     1 
HETATM 5300 O  O     . HOH K 6 .   ? 4.596   -6.309  12.994  1.00 23.03  ? 2121 HOH A O     1 
HETATM 5301 O  O     . HOH K 6 .   ? 6.362   0.555   13.216  1.00 17.77  ? 2122 HOH A O     1 
HETATM 5302 O  O     . HOH K 6 .   ? 11.834  -3.648  10.782  1.00 42.75  ? 2123 HOH A O     1 
HETATM 5303 O  O     . HOH K 6 .   ? 7.712   3.544   19.924  1.00 33.17  ? 2124 HOH A O     1 
HETATM 5304 O  O     . HOH K 6 .   ? -0.549  -9.037  13.929  1.00 18.07  ? 2125 HOH A O     1 
HETATM 5305 O  O     . HOH K 6 .   ? 2.886   -7.952  11.081  1.00 32.94  ? 2126 HOH A O     1 
HETATM 5306 O  O     . HOH K 6 .   ? -7.597  8.264   7.242   1.00 26.16  ? 2127 HOH A O     1 
HETATM 5307 O  O     . HOH K 6 .   ? -6.125  1.470   2.379   1.00 30.16  ? 2128 HOH A O     1 
HETATM 5308 O  O     . HOH K 6 .   ? -9.062  -5.976  7.512   1.00 28.88  ? 2129 HOH A O     1 
HETATM 5309 O  O     . HOH K 6 .   ? -0.004  -14.042 6.657   1.00 28.10  ? 2130 HOH A O     1 
HETATM 5310 O  O     . HOH K 6 .   ? -2.000  -13.137 2.722   1.00 30.95  ? 2131 HOH A O     1 
HETATM 5311 O  O     . HOH K 6 .   ? 4.737   -11.544 5.043   1.00 37.50  ? 2132 HOH A O     1 
HETATM 5312 O  O     . HOH K 6 .   ? 3.437   0.833   5.376   1.00 25.82  ? 2133 HOH A O     1 
HETATM 5313 O  O     . HOH K 6 .   ? 17.130  -5.350  -7.462  1.00 20.37  ? 2134 HOH A O     1 
HETATM 5314 O  O     . HOH K 6 .   ? 16.373  -6.249  1.662   1.00 28.22  ? 2135 HOH A O     1 
HETATM 5315 O  O     . HOH K 6 .   ? 20.248  -5.227  -2.519  1.00 21.55  ? 2136 HOH A O     1 
HETATM 5316 O  O     . HOH K 6 .   ? 19.502  -3.550  -0.599  1.00 29.11  ? 2137 HOH A O     1 
HETATM 5317 O  O     . HOH K 6 .   ? 15.096  -4.779  3.648   1.00 33.13  ? 2138 HOH A O     1 
HETATM 5318 O  O     . HOH K 6 .   ? 16.034  0.585   4.425   1.00 26.83  ? 2139 HOH A O     1 
HETATM 5319 O  O     . HOH K 6 .   ? 6.901   12.405  5.833   1.00 40.27  ? 2140 HOH A O     1 
HETATM 5320 O  O     . HOH K 6 .   ? -8.588  28.154  13.648  1.00 34.17  ? 2141 HOH A O     1 
HETATM 5321 O  O     . HOH K 6 .   ? -4.430  26.095  20.615  1.00 20.98  ? 2142 HOH A O     1 
HETATM 5322 O  O     . HOH K 6 .   ? -0.495  26.654  18.397  1.00 23.19  ? 2143 HOH A O     1 
HETATM 5323 O  O     . HOH K 6 .   ? -5.902  18.219  18.013  1.00 34.46  ? 2144 HOH A O     1 
HETATM 5324 O  O     . HOH K 6 .   ? -4.739  15.358  17.179  1.00 29.92  ? 2145 HOH A O     1 
HETATM 5325 O  O     . HOH K 6 .   ? 5.787   21.613  18.798  1.00 35.39  ? 2146 HOH A O     1 
HETATM 5326 O  O     . HOH K 6 .   ? 9.925   15.261  17.611  1.00 36.74  ? 2147 HOH A O     1 
HETATM 5327 O  O     . HOH K 6 .   ? 5.452   24.869  15.724  1.00 23.31  ? 2148 HOH A O     1 
HETATM 5328 O  O     . HOH K 6 .   ? 8.721   24.386  12.686  1.00 29.88  ? 2149 HOH A O     1 
HETATM 5329 O  O     . HOH K 6 .   ? 0.558   24.063  7.047   1.00 33.64  ? 2150 HOH A O     1 
HETATM 5330 O  O     . HOH K 6 .   ? 6.410   2.002   22.049  1.00 29.13  ? 2151 HOH A O     1 
HETATM 5331 O  O     . HOH K 6 .   ? 1.650   -0.478  38.537  1.00 24.24  ? 2152 HOH A O     1 
HETATM 5332 O  O     . HOH K 6 .   ? -1.887  -5.088  35.542  1.00 25.74  ? 2153 HOH A O     1 
HETATM 5333 O  O     . HOH K 6 .   ? -1.933  -4.679  29.973  1.00 20.74  ? 2154 HOH A O     1 
HETATM 5334 O  O     . HOH K 6 .   ? -0.689  -5.460  41.968  1.00 29.05  ? 2155 HOH A O     1 
HETATM 5335 O  O     . HOH K 6 .   ? 9.911   -4.188  38.496  1.00 27.40  ? 2156 HOH A O     1 
HETATM 5336 O  O     . HOH K 6 .   ? 12.488  -1.993  38.974  1.00 23.60  ? 2157 HOH A O     1 
HETATM 5337 O  O     . HOH K 6 .   ? 8.140   5.235   23.536  1.00 27.46  ? 2158 HOH A O     1 
HETATM 5338 O  O     . HOH K 6 .   ? 12.787  -2.523  19.796  1.00 42.41  ? 2159 HOH A O     1 
HETATM 5339 O  O     . HOH K 6 .   ? 11.750  -20.767 34.100  1.00 25.46  ? 2160 HOH A O     1 
HETATM 5340 O  O     . HOH K 6 .   ? 8.769   -19.905 35.194  1.00 19.26  ? 2161 HOH A O     1 
HETATM 5341 O  O     . HOH K 6 .   ? 5.629   -20.819 29.531  1.00 25.70  ? 2162 HOH A O     1 
HETATM 5342 O  O     . HOH K 6 .   ? 7.164   -22.961 28.678  1.00 25.90  ? 2163 HOH A O     1 
HETATM 5343 O  O     . HOH K 6 .   ? 11.531  -23.440 34.310  1.00 26.84  ? 2164 HOH A O     1 
HETATM 5344 O  O     . HOH K 6 .   ? 3.044   -16.798 33.089  1.00 22.19  ? 2165 HOH A O     1 
HETATM 5345 O  O     . HOH K 6 .   ? 2.504   -19.397 32.727  1.00 33.54  ? 2166 HOH A O     1 
HETATM 5346 O  O     . HOH K 6 .   ? -7.667  0.567   24.967  1.00 36.94  ? 2167 HOH A O     1 
HETATM 5347 O  O     . HOH K 6 .   ? -5.134  -4.185  19.681  1.00 22.25  ? 2168 HOH A O     1 
HETATM 5348 O  O     . HOH K 6 .   ? -7.880  -5.599  16.907  1.00 36.76  ? 2169 HOH A O     1 
HETATM 5349 O  O     . HOH K 6 .   ? -3.350  -7.480  20.482  1.00 39.26  ? 2170 HOH A O     1 
HETATM 5350 O  O     . HOH K 6 .   ? 9.614   -13.821 20.243  1.00 31.82  ? 2171 HOH A O     1 
HETATM 5351 O  O     . HOH K 6 .   ? 15.484  -16.386 24.016  1.00 27.07  ? 2172 HOH A O     1 
HETATM 5352 O  O     . HOH K 6 .   ? 22.393  -17.097 27.134  1.00 30.21  ? 2173 HOH A O     1 
HETATM 5353 O  O     . HOH L 6 .   ? 31.582  6.381   11.085  1.00 30.28  ? 2001 HOH B O     1 
HETATM 5354 O  O     . HOH M 6 .   ? 31.592  14.092  26.523  1.00 35.62  ? 2001 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 41  ? 0.7469 0.3433 0.9123 -0.0132 0.0938  -0.1565 298 LYS A N     
2    C CA    . LYS A 41  ? 0.7219 0.3732 0.8860 -0.0203 0.0735  -0.1774 298 LYS A CA    
3    C C     . LYS A 41  ? 0.6752 0.3623 0.7918 -0.0030 0.0553  -0.1750 298 LYS A C     
4    O O     . LYS A 41  ? 0.7262 0.4255 0.8413 0.0067  0.0442  -0.1983 298 LYS A O     
5    C CB    . LYS A 41  ? 0.7246 0.3861 0.9384 -0.0309 0.0648  -0.2220 298 LYS A CB    
6    N N     . MET A 42  ? 0.6154 0.3192 0.6972 0.0008  0.0538  -0.1483 299 MET A N     
7    C CA    . MET A 42  ? 0.5633 0.2949 0.6056 0.0162  0.0426  -0.1402 299 MET A CA    
8    C C     . MET A 42  ? 0.5434 0.3174 0.5793 0.0173  0.0263  -0.1642 299 MET A C     
9    O O     . MET A 42  ? 0.5493 0.3432 0.5948 0.0070  0.0197  -0.1739 299 MET A O     
10   C CB    . MET A 42  ? 0.5203 0.2607 0.5362 0.0170  0.0447  -0.1099 299 MET A CB    
11   C CG    . MET A 42  ? 0.4760 0.2490 0.4620 0.0282  0.0345  -0.1030 299 MET A CG    
12   S SD    . MET A 42  ? 0.4498 0.2234 0.4139 0.0314  0.0376  -0.0714 299 MET A SD    
13   C CE    . MET A 42  ? 0.4585 0.1914 0.4147 0.0488  0.0467  -0.0568 299 MET A CE    
14   N N     . ALA A 43  ? 0.5226 0.3116 0.5399 0.0317  0.0204  -0.1723 300 ALA A N     
15   C CA    . ALA A 43  ? 0.5120 0.3392 0.5153 0.0370  0.0080  -0.1927 300 ALA A CA    
16   C C     . ALA A 43  ? 0.4795 0.3368 0.4570 0.0355  0.0037  -0.1757 300 ALA A C     
17   O O     . ALA A 43  ? 0.4543 0.3132 0.4160 0.0373  0.0091  -0.1501 300 ALA A O     
18   C CB    . ALA A 43  ? 0.5248 0.3596 0.5151 0.0537  0.0071  -0.2049 300 ALA A CB    
19   N N     . PHE A 44  ? 0.4637 0.3445 0.4387 0.0331  -0.0069 -0.1910 301 PHE A N     
20   C CA    . PHE A 44  ? 0.4469 0.3543 0.3945 0.0348  -0.0107 -0.1752 301 PHE A CA    
21   C C     . PHE A 44  ? 0.4577 0.3922 0.3936 0.0420  -0.0247 -0.1985 301 PHE A C     
22   O O     . PHE A 44  ? 0.4776 0.4118 0.4340 0.0424  -0.0334 -0.2291 301 PHE A O     
23   C CB    . PHE A 44  ? 0.4247 0.3241 0.3814 0.0219  -0.0075 -0.1534 301 PHE A CB    
24   C CG    . PHE A 44  ? 0.4295 0.3234 0.4166 0.0098  -0.0120 -0.1684 301 PHE A CG    
25   C CD1   . PHE A 44  ? 0.4566 0.3207 0.4760 0.0001  -0.0026 -0.1718 301 PHE A CD1   
26   C CD2   . PHE A 44  ? 0.4280 0.3464 0.4131 0.0091  -0.0243 -0.1780 301 PHE A CD2   
27   C CE1   . PHE A 44  ? 0.4728 0.3330 0.5293 -0.0133 -0.0030 -0.1866 301 PHE A CE1   
28   C CE2   . PHE A 44  ? 0.4441 0.3625 0.4647 -0.0020 -0.0289 -0.1954 301 PHE A CE2   
29   C CZ    . PHE A 44  ? 0.4529 0.3430 0.5125 -0.0149 -0.0170 -0.1999 301 PHE A CZ    
30   N N     . THR A 45  ? 0.4475 0.4044 0.3517 0.0490  -0.0270 -0.1849 302 THR A N     
31   C CA    . THR A 45  ? 0.4813 0.4638 0.3649 0.0609  -0.0412 -0.2032 302 THR A CA    
32   C C     . THR A 45  ? 0.4776 0.4670 0.3677 0.0537  -0.0501 -0.1969 302 THR A C     
33   O O     . THR A 45  ? 0.4423 0.4293 0.3232 0.0486  -0.0432 -0.1684 302 THR A O     
34   C CB    . THR A 45  ? 0.5015 0.5027 0.3388 0.0781  -0.0352 -0.1905 302 THR A CB    
35   O OG1   . THR A 45  ? 0.5226 0.5217 0.3558 0.0863  -0.0266 -0.1994 302 THR A OG1   
36   C CG2   . THR A 45  ? 0.5398 0.5655 0.3460 0.0954  -0.0500 -0.2061 302 THR A CG2   
37   N N     . LEU A 46  ? 0.4962 0.4960 0.4064 0.0539  -0.0662 -0.2267 303 LEU A N     
38   C CA    . LEU A 46  ? 0.5210 0.5328 0.4401 0.0500  -0.0773 -0.2263 303 LEU A CA    
39   C C     . LEU A 46  ? 0.5496 0.5871 0.4215 0.0722  -0.0894 -0.2254 303 LEU A C     
40   O O     . LEU A 46  ? 0.5545 0.6136 0.4229 0.0859  -0.1092 -0.2556 303 LEU A O     
41   C CB    . LEU A 46  ? 0.5412 0.5560 0.5109 0.0404  -0.0891 -0.2615 303 LEU A CB    
42   C CG    . LEU A 46  ? 0.5393 0.5554 0.5410 0.0259  -0.0906 -0.2561 303 LEU A CG    
43   C CD1   . LEU A 46  ? 0.5420 0.5355 0.6017 0.0039  -0.0787 -0.2657 303 LEU A CD1   
44   C CD2   . LEU A 46  ? 0.5840 0.6331 0.5858 0.0385  -0.1152 -0.2816 303 LEU A CD2   
45   N N     . ALA A 47  ? 0.5700 0.6043 0.4063 0.0771  -0.0771 -0.1911 304 ALA A N     
46   C CA    . ALA A 47  ? 0.6303 0.6818 0.4156 0.0996  -0.0818 -0.1820 304 ALA A CA    
47   C C     . ALA A 47  ? 0.6607 0.7266 0.4434 0.1069  -0.1006 -0.1872 304 ALA A C     
48   O O     . ALA A 47  ? 0.6442 0.7035 0.4582 0.0912  -0.1014 -0.1794 304 ALA A O     
49   C CB    . ALA A 47  ? 0.6215 0.6623 0.3810 0.0991  -0.0599 -0.1428 304 ALA A CB    
50   N N     . ASP A 48  ? 0.7316 0.8182 0.4742 0.1335  -0.1158 -0.2009 305 ASP A N     
51   C CA    . ASP A 48  ? 0.7682 0.8702 0.4968 0.1482  -0.1351 -0.2029 305 ASP A CA    
52   C C     . ASP A 48  ? 0.7714 0.8703 0.4378 0.1699  -0.1262 -0.1676 305 ASP A C     
53   O O     . ASP A 48  ? 0.8050 0.9143 0.4487 0.1884  -0.1419 -0.1660 305 ASP A O     
54   C CB    . ASP A 48  ? 0.8427 0.9728 0.5785 0.1651  -0.1648 -0.2506 305 ASP A CB    
55   C CG    . ASP A 48  ? 0.9153 1.0561 0.6163 0.1855  -0.1673 -0.2703 305 ASP A CG    
56   O OD1   . ASP A 48  ? 1.0183 1.1536 0.6622 0.2018  -0.1515 -0.2429 305 ASP A OD1   
57   O OD2   . ASP A 48  ? 0.9841 1.1383 0.7173 0.1849  -0.1833 -0.3140 305 ASP A OD2   
58   N N     . ARG A 49  ? 0.7435 0.8278 0.3848 0.1686  -0.1002 -0.1401 306 ARG A N     
59   C CA    . ARG A 49  ? 0.7433 0.8149 0.3436 0.1783  -0.0815 -0.0982 306 ARG A CA    
60   C C     . ARG A 49  ? 0.6786 0.7306 0.2967 0.1569  -0.0512 -0.0709 306 ARG A C     
61   O O     . ARG A 49  ? 0.6349 0.6860 0.2784 0.1439  -0.0451 -0.0845 306 ARG A O     
62   C CB    . ARG A 49  ? 0.8217 0.9045 0.3522 0.2143  -0.0819 -0.0951 306 ARG A CB    
63   C CG    . ARG A 49  ? 0.8770 0.9654 0.3850 0.2222  -0.0674 -0.1032 306 ARG A CG    
64   C CD    . ARG A 49  ? 0.9803 1.0775 0.4097 0.2607  -0.0621 -0.0927 306 ARG A CD    
65   N NE    . ARG A 49  ? 1.0291 1.1277 0.4366 0.2656  -0.0372 -0.0887 306 ARG A NE    
66   C CZ    . ARG A 49  ? 1.0420 1.1244 0.4576 0.2504  -0.0021 -0.0556 306 ARG A CZ    
67   N NH1   . ARG A 49  ? 1.0619 1.1238 0.5065 0.2291  0.0116  -0.0240 306 ARG A NH1   
68   N NH2   . ARG A 49  ? 1.0753 1.1638 0.4747 0.2564  0.0189  -0.0569 306 ARG A NH2   
69   N N     . VAL A 50  ? 0.6537 0.6903 0.2631 0.1538  -0.0336 -0.0347 307 VAL A N     
70   C CA    . VAL A 50  ? 0.6247 0.6468 0.2532 0.1362  -0.0059 -0.0108 307 VAL A CA    
71   C C     . VAL A 50  ? 0.6449 0.6705 0.2366 0.1506  0.0167  -0.0002 307 VAL A C     
72   O O     . VAL A 50  ? 0.6881 0.7166 0.2280 0.1754  0.0204  0.0105  307 VAL A O     
73   C CB    . VAL A 50  ? 0.6276 0.6323 0.2673 0.1272  0.0046  0.0206  307 VAL A CB    
74   C CG1   . VAL A 50  ? 0.6079 0.6018 0.2731 0.1102  0.0319  0.0408  307 VAL A CG1   
75   C CG2   . VAL A 50  ? 0.5786 0.5816 0.2564 0.1128  -0.0152 0.0098  307 VAL A CG2   
76   N N     . THR A 51  ? 0.6050 0.6304 0.2228 0.1366  0.0323  -0.0030 308 THR A N     
77   C CA    . THR A 51  ? 0.6483 0.6795 0.2421 0.1470  0.0570  0.0052  308 THR A CA    
78   C C     . THR A 51  ? 0.6292 0.6512 0.2586 0.1278  0.0843  0.0285  308 THR A C     
79   O O     . THR A 51  ? 0.5854 0.5991 0.2611 0.1064  0.0797  0.0299  308 THR A O     
80   C CB    . THR A 51  ? 0.6442 0.6896 0.2413 0.1512  0.0485  -0.0281 308 THR A CB    
81   O OG1   . THR A 51  ? 0.6201 0.6594 0.2720 0.1276  0.0435  -0.0400 308 THR A OG1   
82   C CG2   . THR A 51  ? 0.6761 0.7333 0.2493 0.1683  0.0194  -0.0579 308 THR A CG2   
83   N N     . GLU A 52  ? 0.6787 0.7042 0.2880 0.1367  0.1129  0.0447  309 GLU A N     
84   C CA    . GLU A 52  ? 0.6914 0.7120 0.3391 0.1198  0.1411  0.0649  309 GLU A CA    
85   C C     . GLU A 52  ? 0.6278 0.6541 0.3322 0.0998  0.1342  0.0457  309 GLU A C     
86   O O     . GLU A 52  ? 0.5877 0.6084 0.3369 0.0817  0.1409  0.0550  309 GLU A O     
87   C CB    . GLU A 52  ? 0.7721 0.7995 0.3911 0.1337  0.1761  0.0813  309 GLU A CB    
88   C CG    . GLU A 52  ? 0.8226 0.8422 0.4776 0.1188  0.2111  0.1096  309 GLU A CG    
89   C CD    . GLU A 52  ? 0.8608 0.8585 0.5375 0.1060  0.2082  0.1304  309 GLU A CD    
90   O OE1   . GLU A 52  ? 0.9383 0.9203 0.5718 0.1207  0.2097  0.1512  309 GLU A OE1   
91   O OE2   . GLU A 52  ? 0.8541 0.8506 0.5910 0.0832  0.2032  0.1247  309 GLU A OE2   
92   N N     . GLU A 53  ? 0.6219 0.6580 0.3244 0.1045  0.1192  0.0179  310 GLU A N     
93   C CA    . GLU A 53  ? 0.5960 0.6347 0.3463 0.0901  0.1142  0.0020  310 GLU A CA    
94   C C     . GLU A 53  ? 0.5349 0.5608 0.3174 0.0741  0.0935  -0.0015 310 GLU A C     
95   O O     . GLU A 53  ? 0.5082 0.5331 0.3290 0.0631  0.0913  -0.0075 310 GLU A O     
96   C CB    . GLU A 53  ? 0.6368 0.6854 0.3775 0.1009  0.1069  -0.0253 310 GLU A CB    
97   C CG    . GLU A 53  ? 0.6602 0.7037 0.3891 0.1052  0.0788  -0.0492 310 GLU A CG    
98   C CD    . GLU A 53  ? 0.7116 0.7639 0.4350 0.1167  0.0750  -0.0773 310 GLU A CD    
99   O OE1   . GLU A 53  ? 0.7413 0.8050 0.4655 0.1226  0.0947  -0.0761 310 GLU A OE1   
100  O OE2   . GLU A 53  ? 0.7264 0.7748 0.4488 0.1196  0.0534  -0.1020 310 GLU A OE2   
101  N N     . MET A 54  ? 0.5197 0.5369 0.2858 0.0748  0.0786  0.0024  311 MET A N     
102  C CA    . MET A 54  ? 0.4828 0.4888 0.2774 0.0604  0.0631  0.0024  311 MET A CA    
103  C C     . MET A 54  ? 0.4469 0.4469 0.2666 0.0490  0.0742  0.0235  311 MET A C     
104  O O     . MET A 54  ? 0.4420 0.4349 0.2872 0.0380  0.0634  0.0225  311 MET A O     
105  C CB    . MET A 54  ? 0.5017 0.5038 0.2759 0.0654  0.0433  -0.0035 311 MET A CB    
106  C CG    . MET A 54  ? 0.5179 0.5269 0.2766 0.0751  0.0285  -0.0300 311 MET A CG    
107  S SD    . MET A 54  ? 0.5372 0.5491 0.2761 0.0838  0.0054  -0.0394 311 MET A SD    
108  C CE    . MET A 54  ? 0.5594 0.5851 0.2808 0.0989  -0.0072 -0.0739 311 MET A CE    
109  N N     . LEU A 55  ? 0.4617 0.4643 0.2762 0.0520  0.0972  0.0416  312 LEU A N     
110  C CA    . LEU A 55  ? 0.4470 0.4424 0.2895 0.0412  0.1100  0.0609  312 LEU A CA    
111  C C     . LEU A 55  ? 0.4305 0.4365 0.3144 0.0324  0.1300  0.0612  312 LEU A C     
112  O O     . LEU A 55  ? 0.4298 0.4334 0.3318 0.0272  0.1521  0.0785  312 LEU A O     
113  C CB    . LEU A 55  ? 0.4909 0.4762 0.2984 0.0515  0.1238  0.0849  312 LEU A CB    
114  C CG    . LEU A 55  ? 0.5068 0.4872 0.2688 0.0662  0.1037  0.0824  312 LEU A CG    
115  C CD1   . LEU A 55  ? 0.5628 0.5331 0.2825 0.0826  0.1195  0.1081  312 LEU A CD1   
116  C CD2   . LEU A 55  ? 0.4777 0.4513 0.2623 0.0559  0.0799  0.0743  312 LEU A CD2   
117  N N     . ALA A 56  ? 0.4141 0.4311 0.3178 0.0308  0.1218  0.0411  313 ALA A N     
118  C CA    . ALA A 56  ? 0.3947 0.4269 0.3435 0.0246  0.1351  0.0349  313 ALA A CA    
119  C C     . ALA A 56  ? 0.3581 0.3883 0.3532 0.0111  0.1313  0.0369  313 ALA A C     
120  O O     . ALA A 56  ? 0.3455 0.3630 0.3362 0.0075  0.1144  0.0386  313 ALA A O     
121  C CB    . ALA A 56  ? 0.3894 0.4299 0.3440 0.0297  0.1210  0.0123  313 ALA A CB    
122  N N     . ASP A 57  ? 0.3522 0.3977 0.3957 0.0044  0.1451  0.0327  314 ASP A N     
123  C CA    . ASP A 57  ? 0.3479 0.3935 0.4390 -0.0076 0.1415  0.0315  314 ASP A CA    
124  C C     . ASP A 57  ? 0.3008 0.3526 0.4129 -0.0067 0.1136  0.0102  314 ASP A C     
125  O O     . ASP A 57  ? 0.2720 0.3286 0.4245 -0.0134 0.1066  0.0028  314 ASP A O     
126  C CB    . ASP A 57  ? 0.3806 0.4400 0.5231 -0.0166 0.1694  0.0352  314 ASP A CB    
127  C CG    . ASP A 57  ? 0.3987 0.4839 0.5681 -0.0129 0.1765  0.0183  314 ASP A CG    
128  O OD1   . ASP A 57  ? 0.4278 0.5170 0.5758 -0.0027 0.1565  0.0037  314 ASP A OD1   
129  O OD2   . ASP A 57  ? 0.4424 0.5429 0.6549 -0.0198 0.2040  0.0202  314 ASP A OD2   
130  N N     . LYS A 58  ? 0.2975 0.3474 0.3800 0.0033  0.0985  0.0005  315 LYS A N     
131  C CA    . LYS A 58  ? 0.2832 0.3316 0.3709 0.0080  0.0735  -0.0142 315 LYS A CA    
132  C C     . LYS A 58  ? 0.2695 0.3000 0.3109 0.0148  0.0609  -0.0136 315 LYS A C     
133  O O     . LYS A 58  ? 0.2760 0.3062 0.2958 0.0213  0.0656  -0.0164 315 LYS A O     
134  C CB    . LYS A 58  ? 0.2915 0.3606 0.4111 0.0151  0.0716  -0.0321 315 LYS A CB    
135  C CG    . LYS A 58  ? 0.2972 0.3614 0.4091 0.0264  0.0474  -0.0447 315 LYS A CG    
136  C CD    . LYS A 58  ? 0.2792 0.3441 0.4100 0.0248  0.0320  -0.0496 315 LYS A CD    
137  C CE    . LYS A 58  ? 0.2938 0.3689 0.4365 0.0412  0.0129  -0.0677 315 LYS A CE    
138  N NZ    . LYS A 58  ? 0.2824 0.3586 0.4356 0.0429  -0.0037 -0.0738 315 LYS A NZ    
139  N N     . ALA A 59  ? 0.2502 0.2667 0.2800 0.0134  0.0455  -0.0121 316 ALA A N     
140  C CA    . ALA A 59  ? 0.2570 0.2566 0.2514 0.0172  0.0365  -0.0121 316 ALA A CA    
141  C C     . ALA A 59  ? 0.2489 0.2369 0.2411 0.0183  0.0212  -0.0144 316 ALA A C     
142  O O     . ALA A 59  ? 0.2458 0.2373 0.2550 0.0148  0.0163  -0.0132 316 ALA A O     
143  C CB    . ALA A 59  ? 0.2589 0.2514 0.2287 0.0130  0.0413  -0.0014 316 ALA A CB    
144  N N     . ALA A 60  ? 0.2470 0.2199 0.2180 0.0228  0.0156  -0.0173 317 ALA A N     
145  C CA    . ALA A 60  ? 0.2458 0.2037 0.2071 0.0226  0.0070  -0.0151 317 ALA A CA    
146  C C     . ALA A 60  ? 0.2480 0.1993 0.1958 0.0143  0.0078  -0.0104 317 ALA A C     
147  O O     . ALA A 60  ? 0.2673 0.2165 0.2034 0.0140  0.0107  -0.0137 317 ALA A O     
148  C CB    . ALA A 60  ? 0.2382 0.1802 0.1884 0.0319  0.0044  -0.0191 317 ALA A CB    
149  N N     . LEU A 61  ? 0.2404 0.1907 0.1913 0.0095  0.0036  -0.0054 318 LEU A N     
150  C CA    . LEU A 61  ? 0.2473 0.1955 0.1905 0.0035  0.0022  -0.0021 318 LEU A CA    
151  C C     . LEU A 61  ? 0.2559 0.1939 0.1973 0.0013  -0.0023 -0.0027 318 LEU A C     
152  O O     . LEU A 61  ? 0.2455 0.1820 0.1916 0.0040  -0.0048 -0.0011 318 LEU A O     
153  C CB    . LEU A 61  ? 0.2411 0.1981 0.1936 0.0002  0.0039  0.0055  318 LEU A CB    
154  C CG    . LEU A 61  ? 0.2546 0.2095 0.2006 -0.0029 0.0000  0.0101  318 LEU A CG    
155  C CD1   . LEU A 61  ? 0.2677 0.2240 0.1939 0.0003  0.0008  0.0079  318 LEU A CD1   
156  C CD2   . LEU A 61  ? 0.2451 0.2025 0.2047 -0.0051 0.0025  0.0191  318 LEU A CD2   
157  N N     . VAL A 62  ? 0.2675 0.2009 0.2036 -0.0025 -0.0027 -0.0067 319 VAL A N     
158  C CA    . VAL A 62  ? 0.2830 0.2095 0.2230 -0.0066 -0.0032 -0.0079 319 VAL A CA    
159  C C     . VAL A 62  ? 0.2713 0.2081 0.2146 -0.0105 -0.0089 -0.0102 319 VAL A C     
160  O O     . VAL A 62  ? 0.2729 0.2156 0.2111 -0.0095 -0.0119 -0.0163 319 VAL A O     
161  C CB    . VAL A 62  ? 0.3086 0.2206 0.2498 -0.0082 0.0026  -0.0141 319 VAL A CB    
162  C CG1   . VAL A 62  ? 0.2958 0.2025 0.2479 -0.0150 0.0064  -0.0161 319 VAL A CG1   
163  C CG2   . VAL A 62  ? 0.3097 0.2077 0.2439 -0.0006 0.0078  -0.0094 319 VAL A CG2   
164  N N     . VAL A 63  ? 0.2488 0.1888 0.1986 -0.0119 -0.0115 -0.0064 320 VAL A N     
165  C CA    . VAL A 63  ? 0.2618 0.2110 0.2163 -0.0132 -0.0183 -0.0087 320 VAL A CA    
166  C C     . VAL A 63  ? 0.2663 0.2141 0.2338 -0.0177 -0.0158 -0.0134 320 VAL A C     
167  O O     . VAL A 63  ? 0.2655 0.2120 0.2358 -0.0167 -0.0141 -0.0089 320 VAL A O     
168  C CB    . VAL A 63  ? 0.2600 0.2132 0.2147 -0.0101 -0.0218 0.0003  320 VAL A CB    
169  C CG1   . VAL A 63  ? 0.2655 0.2257 0.2241 -0.0083 -0.0299 -0.0014 320 VAL A CG1   
170  C CG2   . VAL A 63  ? 0.2618 0.2153 0.2065 -0.0067 -0.0185 0.0072  320 VAL A CG2   
171  N N     . GLU A 64  ? 0.2579 0.2068 0.2357 -0.0223 -0.0144 -0.0241 321 GLU A N     
172  C CA    . GLU A 64  ? 0.2776 0.2205 0.2706 -0.0284 -0.0041 -0.0270 321 GLU A CA    
173  C C     . GLU A 64  ? 0.2679 0.2247 0.2791 -0.0309 -0.0075 -0.0332 321 GLU A C     
174  O O     . GLU A 64  ? 0.2643 0.2355 0.2888 -0.0316 -0.0172 -0.0456 321 GLU A O     
175  C CB    . GLU A 64  ? 0.2953 0.2301 0.3008 -0.0345 0.0028  -0.0372 321 GLU A CB    
176  C CG    . GLU A 64  ? 0.3234 0.2451 0.3462 -0.0418 0.0204  -0.0365 321 GLU A CG    
177  C CD    . GLU A 64  ? 0.3523 0.2492 0.3547 -0.0366 0.0342  -0.0208 321 GLU A CD    
178  O OE1   . GLU A 64  ? 0.3781 0.2741 0.3567 -0.0271 0.0277  -0.0119 321 GLU A OE1   
179  O OE2   . GLU A 64  ? 0.3632 0.2413 0.3744 -0.0407 0.0522  -0.0173 321 GLU A OE2   
180  N N     . VAL A 65  ? 0.2475 0.2018 0.2591 -0.0301 -0.0004 -0.0265 322 VAL A N     
181  C CA    . VAL A 65  ? 0.2528 0.2202 0.2833 -0.0318 -0.0002 -0.0324 322 VAL A CA    
182  C C     . VAL A 65  ? 0.2561 0.2147 0.2960 -0.0369 0.0202  -0.0306 322 VAL A C     
183  O O     . VAL A 65  ? 0.2460 0.1926 0.2660 -0.0312 0.0294  -0.0192 322 VAL A O     
184  C CB    . VAL A 65  ? 0.2503 0.2220 0.2710 -0.0239 -0.0079 -0.0260 322 VAL A CB    
185  C CG1   . VAL A 65  ? 0.2391 0.2249 0.2800 -0.0239 -0.0072 -0.0334 322 VAL A CG1   
186  C CG2   . VAL A 65  ? 0.2441 0.2178 0.2548 -0.0189 -0.0223 -0.0226 322 VAL A CG2   
187  N N     . VAL A 66  ? 0.2570 0.2218 0.3275 -0.0465 0.0279  -0.0425 323 VAL A N     
188  C CA    . VAL A 66  ? 0.2836 0.2356 0.3671 -0.0535 0.0529  -0.0389 323 VAL A CA    
189  C C     . VAL A 66  ? 0.3042 0.2662 0.3970 -0.0525 0.0642  -0.0375 323 VAL A C     
190  O O     . VAL A 66  ? 0.3175 0.2643 0.4022 -0.0519 0.0879  -0.0258 323 VAL A O     
191  C CB    . VAL A 66  ? 0.2876 0.2419 0.4106 -0.0667 0.0587  -0.0554 323 VAL A CB    
192  C CG1   . VAL A 66  ? 0.3170 0.2553 0.4613 -0.0762 0.0902  -0.0502 323 VAL A CG1   
193  C CG2   . VAL A 66  ? 0.2964 0.2390 0.4070 -0.0659 0.0492  -0.0579 323 VAL A CG2   
194  N N     . GLU A 67  ? 0.2895 0.2763 0.3989 -0.0506 0.0492  -0.0491 324 GLU A N     
195  C CA    . GLU A 67  ? 0.3170 0.3165 0.4367 -0.0479 0.0584  -0.0503 324 GLU A CA    
196  C C     . GLU A 67  ? 0.3129 0.2988 0.3916 -0.0353 0.0631  -0.0342 324 GLU A C     
197  O O     . GLU A 67  ? 0.2838 0.2642 0.3371 -0.0274 0.0465  -0.0292 324 GLU A O     
198  C CB    . GLU A 67  ? 0.3397 0.3650 0.4769 -0.0433 0.0366  -0.0640 324 GLU A CB    
199  C CG    . GLU A 67  ? 0.3870 0.4350 0.5685 -0.0506 0.0290  -0.0853 324 GLU A CG    
200  C CD    . GLU A 67  ? 0.4407 0.5003 0.6646 -0.0613 0.0530  -0.0950 324 GLU A CD    
201  O OE1   . GLU A 67  ? 0.5083 0.5637 0.7247 -0.0593 0.0734  -0.0853 324 GLU A OE1   
202  O OE2   . GLU A 67  ? 0.5403 0.6148 0.8074 -0.0712 0.0525  -0.1141 324 GLU A OE2   
203  N N     . GLU A 68  ? 0.3260 0.3086 0.4002 -0.0325 0.0858  -0.0280 325 GLU A N     
204  C CA    . GLU A 68  ? 0.3642 0.3353 0.3964 -0.0171 0.0906  -0.0154 325 GLU A CA    
205  C C     . GLU A 68  ? 0.3144 0.3003 0.3388 -0.0065 0.0663  -0.0231 325 GLU A C     
206  O O     . GLU A 68  ? 0.3018 0.2798 0.2994 0.0032  0.0538  -0.0187 325 GLU A O     
207  C CB    . GLU A 68  ? 0.4469 0.4146 0.4752 -0.0140 0.1219  -0.0081 325 GLU A CB    
208  C CG    . GLU A 68  ? 0.5499 0.5119 0.5316 0.0071  0.1237  0.0006  325 GLU A CG    
209  C CD    . GLU A 68  ? 0.6704 0.6140 0.6261 0.0149  0.1587  0.0180  325 GLU A CD    
210  O OE1   . GLU A 68  ? 0.7486 0.7020 0.7227 0.0113  0.1822  0.0167  325 GLU A OE1   
211  O OE2   . GLU A 68  ? 0.8074 0.7264 0.7232 0.0265  0.1635  0.0336  325 GLU A OE2   
212  N N     . ASN A 69  ? 0.2709 0.2784 0.3245 -0.0089 0.0595  -0.0362 326 ASN A N     
213  C CA    . ASN A 69  ? 0.2539 0.2725 0.3084 -0.0003 0.0364  -0.0443 326 ASN A CA    
214  C C     . ASN A 69  ? 0.2258 0.2443 0.2910 -0.0057 0.0155  -0.0464 326 ASN A C     
215  O O     . ASN A 69  ? 0.2053 0.2354 0.2972 -0.0127 0.0115  -0.0546 326 ASN A O     
216  C CB    . ASN A 69  ? 0.2515 0.2918 0.3317 0.0024  0.0396  -0.0570 326 ASN A CB    
217  C CG    . ASN A 69  ? 0.2558 0.3031 0.3374 0.0130  0.0181  -0.0651 326 ASN A CG    
218  O OD1   . ASN A 69  ? 0.2411 0.2823 0.3232 0.0127  -0.0014 -0.0638 326 ASN A OD1   
219  N ND2   . ASN A 69  ? 0.2595 0.3185 0.3431 0.0228  0.0233  -0.0735 326 ASN A ND2   
220  N N     . TYR A 70  ? 0.1982 0.2050 0.2434 -0.0014 0.0030  -0.0400 327 TYR A N     
221  C CA    . TYR A 70  ? 0.2002 0.2039 0.2485 -0.0050 -0.0116 -0.0382 327 TYR A CA    
222  C C     . TYR A 70  ? 0.1928 0.2033 0.2539 0.0001  -0.0291 -0.0424 327 TYR A C     
223  O O     . TYR A 70  ? 0.1877 0.1937 0.2458 -0.0003 -0.0390 -0.0380 327 TYR A O     
224  C CB    . TYR A 70  ? 0.2097 0.1979 0.2349 -0.0038 -0.0136 -0.0286 327 TYR A CB    
225  C CG    . TYR A 70  ? 0.2312 0.2160 0.2436 0.0059  -0.0164 -0.0285 327 TYR A CG    
226  C CD1   . TYR A 70  ? 0.2278 0.2160 0.2510 0.0107  -0.0294 -0.0335 327 TYR A CD1   
227  C CD2   . TYR A 70  ? 0.2493 0.2267 0.2394 0.0118  -0.0071 -0.0246 327 TYR A CD2   
228  C CE1   . TYR A 70  ? 0.2412 0.2291 0.2596 0.0195  -0.0344 -0.0389 327 TYR A CE1   
229  C CE2   . TYR A 70  ? 0.2514 0.2298 0.2299 0.0239  -0.0137 -0.0291 327 TYR A CE2   
230  C CZ    . TYR A 70  ? 0.2504 0.2356 0.2458 0.0267  -0.0279 -0.0382 327 TYR A CZ    
231  O OH    . TYR A 70  ? 0.2555 0.2446 0.2464 0.0384  -0.0363 -0.0480 327 TYR A OH    
232  N N     . HIS A 71  ? 0.1874 0.2071 0.2608 0.0064  -0.0315 -0.0500 328 HIS A N     
233  C CA    . HIS A 71  ? 0.1886 0.2103 0.2745 0.0127  -0.0472 -0.0525 328 HIS A CA    
234  C C     . HIS A 71  ? 0.1773 0.2104 0.2773 0.0120  -0.0543 -0.0571 328 HIS A C     
235  O O     . HIS A 71  ? 0.1668 0.2170 0.2857 0.0084  -0.0479 -0.0680 328 HIS A O     
236  C CB    . HIS A 71  ? 0.1960 0.2250 0.2944 0.0210  -0.0489 -0.0623 328 HIS A CB    
237  C CG    . HIS A 71  ? 0.2083 0.2281 0.2944 0.0256  -0.0482 -0.0624 328 HIS A CG    
238  N ND1   . HIS A 71  ? 0.2089 0.2151 0.2956 0.0274  -0.0582 -0.0585 328 HIS A ND1   
239  C CD2   . HIS A 71  ? 0.2194 0.2435 0.2929 0.0304  -0.0385 -0.0679 328 HIS A CD2   
240  C CE1   . HIS A 71  ? 0.2147 0.2197 0.2954 0.0323  -0.0578 -0.0652 328 HIS A CE1   
241  N NE2   . HIS A 71  ? 0.2203 0.2364 0.2885 0.0360  -0.0469 -0.0707 328 HIS A NE2   
242  N N     . ASP A 72  ? 0.1815 0.2063 0.2736 0.0169  -0.0670 -0.0498 329 ASP A N     
243  C CA    . ASP A 72  ? 0.1893 0.2253 0.2880 0.0226  -0.0792 -0.0549 329 ASP A CA    
244  C C     . ASP A 72  ? 0.1904 0.2401 0.2971 0.0137  -0.0738 -0.0649 329 ASP A C     
245  O O     . ASP A 72  ? 0.1974 0.2660 0.3229 0.0172  -0.0827 -0.0787 329 ASP A O     
246  C CB    . ASP A 72  ? 0.1985 0.2475 0.3192 0.0335  -0.0895 -0.0651 329 ASP A CB    
247  C CG    . ASP A 72  ? 0.2215 0.2705 0.3360 0.0488  -0.1083 -0.0626 329 ASP A CG    
248  O OD1   . ASP A 72  ? 0.2364 0.2727 0.3250 0.0514  -0.1116 -0.0503 329 ASP A OD1   
249  O OD2   . ASP A 72  ? 0.2186 0.2819 0.3529 0.0602  -0.1194 -0.0736 329 ASP A OD2   
250  N N     . ALA A 73  ? 0.1927 0.2320 0.2873 0.0031  -0.0601 -0.0591 330 ALA A N     
251  C CA    . ALA A 73  ? 0.2028 0.2490 0.3086 -0.0072 -0.0508 -0.0678 330 ALA A CA    
252  C C     . ALA A 73  ? 0.2155 0.2573 0.3058 -0.0064 -0.0591 -0.0665 330 ALA A C     
253  O O     . ALA A 73  ? 0.2204 0.2487 0.2845 -0.0003 -0.0646 -0.0532 330 ALA A O     
254  C CB    . ALA A 73  ? 0.1904 0.2239 0.2886 -0.0159 -0.0300 -0.0605 330 ALA A CB    
255  N N     . PRO A 74  ? 0.2266 0.2797 0.3356 -0.0129 -0.0578 -0.0813 331 PRO A N     
256  C CA    . PRO A 74  ? 0.2379 0.2896 0.3326 -0.0104 -0.0667 -0.0849 331 PRO A CA    
257  C C     . PRO A 74  ? 0.2535 0.2828 0.3227 -0.0160 -0.0549 -0.0706 331 PRO A C     
258  O O     . PRO A 74  ? 0.2385 0.2560 0.3103 -0.0247 -0.0382 -0.0641 331 PRO A O     
259  C CB    . PRO A 74  ? 0.2463 0.3174 0.3793 -0.0179 -0.0668 -0.1098 331 PRO A CB    
260  C CG    . PRO A 74  ? 0.2415 0.3297 0.4095 -0.0204 -0.0632 -0.1196 331 PRO A CG    
261  C CD    . PRO A 74  ? 0.2300 0.3014 0.3804 -0.0214 -0.0495 -0.0994 331 PRO A CD    
262  N N     . ILE A 75  ? 0.2625 0.2861 0.3045 -0.0083 -0.0633 -0.0646 332 ILE A N     
263  C CA    . ILE A 75  ? 0.2556 0.2635 0.2791 -0.0126 -0.0541 -0.0569 332 ILE A CA    
264  C C     . ILE A 75  ? 0.2805 0.2970 0.3162 -0.0152 -0.0579 -0.0765 332 ILE A C     
265  O O     . ILE A 75  ? 0.2760 0.3085 0.3095 -0.0053 -0.0741 -0.0894 332 ILE A O     
266  C CB    . ILE A 75  ? 0.2708 0.2697 0.2625 -0.0032 -0.0579 -0.0406 332 ILE A CB    
267  C CG1   . ILE A 75  ? 0.2656 0.2556 0.2559 -0.0028 -0.0537 -0.0257 332 ILE A CG1   
268  C CG2   . ILE A 75  ? 0.2685 0.2574 0.2439 -0.0053 -0.0506 -0.0375 332 ILE A CG2   
269  C CD1   . ILE A 75  ? 0.2669 0.2483 0.2374 0.0059  -0.0561 -0.0098 332 ILE A CD1   
270  N N     . VAL A 76  ? 0.2596 0.2659 0.3098 -0.0268 -0.0439 -0.0808 333 VAL A N     
271  C CA    . VAL A 76  ? 0.2788 0.2929 0.3529 -0.0316 -0.0464 -0.1035 333 VAL A CA    
272  C C     . VAL A 76  ? 0.2834 0.2900 0.3362 -0.0271 -0.0494 -0.1060 333 VAL A C     
273  O O     . VAL A 76  ? 0.2858 0.3015 0.3551 -0.0275 -0.0562 -0.1281 333 VAL A O     
274  C CB    . VAL A 76  ? 0.2987 0.3049 0.4105 -0.0474 -0.0273 -0.1100 333 VAL A CB    
275  C CG1   . VAL A 76  ? 0.2786 0.2961 0.4130 -0.0510 -0.0223 -0.1095 333 VAL A CG1   
276  C CG2   . VAL A 76  ? 0.2869 0.2638 0.3802 -0.0517 -0.0083 -0.0907 333 VAL A CG2   
277  N N     . GLY A 77  ? 0.2752 0.2674 0.2949 -0.0223 -0.0445 -0.0860 334 GLY A N     
278  C CA    . GLY A 77  ? 0.2806 0.2661 0.2815 -0.0180 -0.0443 -0.0881 334 GLY A CA    
279  C C     . GLY A 77  ? 0.2697 0.2417 0.2435 -0.0146 -0.0360 -0.0650 334 GLY A C     
280  O O     . GLY A 77  ? 0.2653 0.2297 0.2402 -0.0181 -0.0290 -0.0504 334 GLY A O     
281  N N     . ILE A 78  ? 0.2859 0.2576 0.2378 -0.0071 -0.0371 -0.0641 335 ILE A N     
282  C CA    . ILE A 78  ? 0.2840 0.2480 0.2164 -0.0036 -0.0293 -0.0462 335 ILE A CA    
283  C C     . ILE A 78  ? 0.2997 0.2565 0.2269 -0.0021 -0.0235 -0.0524 335 ILE A C     
284  O O     . ILE A 78  ? 0.3294 0.2922 0.2547 0.0020  -0.0289 -0.0693 335 ILE A O     
285  C CB    . ILE A 78  ? 0.3103 0.2834 0.2190 0.0071  -0.0337 -0.0355 335 ILE A CB    
286  C CG1   . ILE A 78  ? 0.3178 0.2937 0.2326 0.0069  -0.0388 -0.0271 335 ILE A CG1   
287  C CG2   . ILE A 78  ? 0.3157 0.2831 0.2120 0.0092  -0.0224 -0.0199 335 ILE A CG2   
288  C CD1   . ILE A 78  ? 0.3561 0.3381 0.2476 0.0202  -0.0449 -0.0190 335 ILE A CD1   
289  N N     . ALA A 79  ? 0.2855 0.2307 0.2128 -0.0038 -0.0140 -0.0416 336 ALA A N     
290  C CA    . ALA A 79  ? 0.2903 0.2298 0.2119 0.0003  -0.0087 -0.0458 336 ALA A CA    
291  C C     . ALA A 79  ? 0.2839 0.2266 0.1968 0.0048  -0.0027 -0.0321 336 ALA A C     
292  O O     . ALA A 79  ? 0.2718 0.2135 0.1906 0.0024  -0.0012 -0.0206 336 ALA A O     
293  C CB    . ALA A 79  ? 0.2951 0.2154 0.2315 -0.0041 -0.0028 -0.0505 336 ALA A CB    
294  N N     . VAL A 80  ? 0.2959 0.2445 0.1982 0.0116  0.0009  -0.0361 337 VAL A N     
295  C CA    . VAL A 80  ? 0.3007 0.2552 0.2020 0.0154  0.0092  -0.0271 337 VAL A CA    
296  C C     . VAL A 80  ? 0.3070 0.2575 0.2108 0.0208  0.0131  -0.0367 337 VAL A C     
297  O O     . VAL A 80  ? 0.3319 0.2826 0.2276 0.0252  0.0117  -0.0501 337 VAL A O     
298  C CB    . VAL A 80  ? 0.3246 0.2926 0.2085 0.0210  0.0146  -0.0206 337 VAL A CB    
299  C CG1   . VAL A 80  ? 0.3270 0.3025 0.2189 0.0228  0.0277  -0.0128 337 VAL A CG1   
300  C CG2   . VAL A 80  ? 0.3165 0.2856 0.1957 0.0187  0.0108  -0.0096 337 VAL A CG2   
301  N N     . VAL A 81  ? 0.2954 0.2442 0.2114 0.0225  0.0165  -0.0322 338 VAL A N     
302  C CA    . VAL A 81  ? 0.2954 0.2428 0.2148 0.0306  0.0200  -0.0407 338 VAL A CA    
303  C C     . VAL A 81  ? 0.2907 0.2565 0.2212 0.0339  0.0275  -0.0362 338 VAL A C     
304  O O     . VAL A 81  ? 0.2743 0.2456 0.2195 0.0306  0.0268  -0.0286 338 VAL A O     
305  C CB    . VAL A 81  ? 0.3045 0.2312 0.2303 0.0338  0.0164  -0.0422 338 VAL A CB    
306  C CG1   . VAL A 81  ? 0.3003 0.2281 0.2321 0.0455  0.0189  -0.0488 338 VAL A CG1   
307  C CG2   . VAL A 81  ? 0.3040 0.2112 0.2270 0.0296  0.0145  -0.0494 338 VAL A CG2   
308  N N     . ASN A 82  ? 0.3001 0.2774 0.2268 0.0401  0.0357  -0.0427 339 ASN A N     
309  C CA    . ASN A 82  ? 0.3027 0.2991 0.2466 0.0420  0.0465  -0.0398 339 ASN A CA    
310  C C     . ASN A 82  ? 0.3311 0.3358 0.2770 0.0525  0.0527  -0.0526 339 ASN A C     
311  O O     . ASN A 82  ? 0.3393 0.3308 0.2751 0.0586  0.0463  -0.0636 339 ASN A O     
312  C CB    . ASN A 82  ? 0.3020 0.3094 0.2404 0.0364  0.0582  -0.0268 339 ASN A CB    
313  C CG    . ASN A 82  ? 0.3279 0.3368 0.2335 0.0423  0.0634  -0.0280 339 ASN A CG    
314  O OD1   . ASN A 82  ? 0.3352 0.3457 0.2301 0.0508  0.0631  -0.0418 339 ASN A OD1   
315  N ND2   . ASN A 82  ? 0.3307 0.3387 0.2185 0.0402  0.0667  -0.0151 339 ASN A ND2   
316  N N     . GLU A 83  ? 0.3482 0.3745 0.3108 0.0544  0.0668  -0.0520 340 GLU A N     
317  C CA    . GLU A 83  ? 0.3851 0.4235 0.3549 0.0654  0.0740  -0.0655 340 GLU A CA    
318  C C     . GLU A 83  ? 0.4034 0.4391 0.3410 0.0726  0.0778  -0.0736 340 GLU A C     
319  O O     . GLU A 83  ? 0.4024 0.4409 0.3411 0.0832  0.0786  -0.0888 340 GLU A O     
320  C CB    . GLU A 83  ? 0.4259 0.4917 0.4258 0.0639  0.0923  -0.0630 340 GLU A CB    
321  C CG    . GLU A 83  ? 0.4832 0.5573 0.4670 0.0588  0.1131  -0.0486 340 GLU A CG    
322  C CD    . GLU A 83  ? 0.5375 0.6297 0.5597 0.0495  0.1321  -0.0386 340 GLU A CD    
323  O OE1   . GLU A 83  ? 0.5689 0.6826 0.6132 0.0533  0.1502  -0.0447 340 GLU A OE1   
324  O OE2   . GLU A 83  ? 0.5945 0.6795 0.6285 0.0381  0.1303  -0.0261 340 GLU A OE2   
325  N N     . HIS A 84  ? 0.3936 0.4255 0.3031 0.0692  0.0788  -0.0659 341 HIS A N     
326  C CA    . HIS A 84  ? 0.4249 0.4584 0.3017 0.0790  0.0795  -0.0769 341 HIS A CA    
327  C C     . HIS A 84  ? 0.4228 0.4369 0.2897 0.0792  0.0605  -0.0912 341 HIS A C     
328  O O     . HIS A 84  ? 0.4582 0.4743 0.3063 0.0886  0.0572  -0.1080 341 HIS A O     
329  C CB    . HIS A 84  ? 0.4438 0.4857 0.2911 0.0802  0.0899  -0.0624 341 HIS A CB    
330  C CG    . HIS A 84  ? 0.4568 0.5145 0.3150 0.0785  0.1144  -0.0455 341 HIS A CG    
331  N ND1   . HIS A 84  ? 0.4602 0.5148 0.3313 0.0672  0.1210  -0.0247 341 HIS A ND1   
332  C CD2   . HIS A 84  ? 0.4682 0.5450 0.3327 0.0857  0.1360  -0.0478 341 HIS A CD2   
333  C CE1   . HIS A 84  ? 0.4684 0.5381 0.3553 0.0664  0.1470  -0.0141 341 HIS A CE1   
334  N NE2   . HIS A 84  ? 0.4791 0.5635 0.3615 0.0776  0.1568  -0.0278 341 HIS A NE2   
335  N N     . GLY A 85  ? 0.3966 0.3927 0.2779 0.0694  0.0488  -0.0863 342 GLY A N     
336  C CA    . GLY A 85  ? 0.3918 0.3680 0.2728 0.0675  0.0351  -0.0997 342 GLY A CA    
337  C C     . GLY A 85  ? 0.3613 0.3231 0.2494 0.0554  0.0268  -0.0888 342 GLY A C     
338  O O     . GLY A 85  ? 0.3372 0.3008 0.2330 0.0494  0.0291  -0.0722 342 GLY A O     
339  N N     . ARG A 86  ? 0.3651 0.3145 0.2537 0.0520  0.0175  -0.1010 343 ARG A N     
340  C CA    . ARG A 86  ? 0.3569 0.2938 0.2550 0.0406  0.0115  -0.0938 343 ARG A CA    
341  C C     . ARG A 86  ? 0.3691 0.3167 0.2566 0.0397  0.0028  -0.1037 343 ARG A C     
342  O O     . ARG A 86  ? 0.3723 0.3247 0.2557 0.0461  -0.0028 -0.1256 343 ARG A O     
343  C CB    . ARG A 86  ? 0.3628 0.2723 0.2806 0.0367  0.0105  -0.1002 343 ARG A CB    
344  C CG    . ARG A 86  ? 0.3677 0.2640 0.2917 0.0446  0.0163  -0.0958 343 ARG A CG    
345  C CD    . ARG A 86  ? 0.3783 0.2423 0.3151 0.0416  0.0183  -0.0909 343 ARG A CD    
346  N NE    . ARG A 86  ? 0.3956 0.2446 0.3347 0.0540  0.0217  -0.0897 343 ARG A NE    
347  C CZ    . ARG A 86  ? 0.4191 0.2521 0.3658 0.0610  0.0233  -0.1042 343 ARG A CZ    
348  N NH1   . ARG A 86  ? 0.4288 0.2581 0.3849 0.0563  0.0217  -0.1247 343 ARG A NH1   
349  N NH2   . ARG A 86  ? 0.4314 0.2528 0.3785 0.0749  0.0251  -0.1005 343 ARG A NH2   
350  N N     . PHE A 87  ? 0.3550 0.3063 0.2411 0.0330  -0.0002 -0.0905 344 PHE A N     
351  C CA    . PHE A 87  ? 0.3666 0.3315 0.2399 0.0357  -0.0100 -0.0975 344 PHE A CA    
352  C C     . PHE A 87  ? 0.3476 0.3065 0.2390 0.0245  -0.0163 -0.0946 344 PHE A C     
353  O O     . PHE A 87  ? 0.3314 0.2811 0.2323 0.0166  -0.0110 -0.0770 344 PHE A O     
354  C CB    . PHE A 87  ? 0.3787 0.3596 0.2228 0.0448  -0.0048 -0.0816 344 PHE A CB    
355  C CG    . PHE A 87  ? 0.3952 0.3837 0.2242 0.0547  0.0074  -0.0801 344 PHE A CG    
356  C CD1   . PHE A 87  ? 0.4321 0.4329 0.2371 0.0693  0.0054  -0.0966 344 PHE A CD1   
357  C CD2   . PHE A 87  ? 0.3891 0.3755 0.2299 0.0506  0.0206  -0.0643 344 PHE A CD2   
358  C CE1   . PHE A 87  ? 0.4472 0.4567 0.2387 0.0790  0.0192  -0.0954 344 PHE A CE1   
359  C CE2   . PHE A 87  ? 0.4072 0.4037 0.2408 0.0589  0.0335  -0.0646 344 PHE A CE2   
360  C CZ    . PHE A 87  ? 0.4357 0.4432 0.2440 0.0728  0.0343  -0.0790 344 PHE A CZ    
361  N N     . PHE A 88  ? 0.3500 0.3162 0.2486 0.0248  -0.0282 -0.1145 345 PHE A N     
362  C CA    . PHE A 88  ? 0.3488 0.3174 0.2637 0.0168  -0.0349 -0.1138 345 PHE A CA    
363  C C     . PHE A 88  ? 0.3651 0.3553 0.2572 0.0289  -0.0478 -0.1174 345 PHE A C     
364  O O     . PHE A 88  ? 0.3799 0.3841 0.2555 0.0422  -0.0573 -0.1364 345 PHE A O     
365  C CB    . PHE A 88  ? 0.3638 0.3251 0.3152 0.0069  -0.0381 -0.1366 345 PHE A CB    
366  C CG    . PHE A 88  ? 0.3644 0.3332 0.3382 -0.0009 -0.0444 -0.1407 345 PHE A CG    
367  C CD1   . PHE A 88  ? 0.3505 0.3064 0.3384 -0.0123 -0.0339 -0.1224 345 PHE A CD1   
368  C CD2   . PHE A 88  ? 0.3923 0.3842 0.3725 0.0055  -0.0619 -0.1647 345 PHE A CD2   
369  C CE1   . PHE A 88  ? 0.3437 0.3086 0.3550 -0.0193 -0.0378 -0.1272 345 PHE A CE1   
370  C CE2   . PHE A 88  ? 0.3745 0.3768 0.3804 -0.0010 -0.0682 -0.1707 345 PHE A CE2   
371  C CZ    . PHE A 88  ? 0.3622 0.3509 0.3846 -0.0142 -0.0549 -0.1512 345 PHE A CZ    
372  N N     . LEU A 89  ? 0.3601 0.3525 0.2493 0.0269  -0.0488 -0.1001 346 LEU A N     
373  C CA    . LEU A 89  ? 0.3911 0.3997 0.2589 0.0401  -0.0613 -0.0999 346 LEU A CA    
374  C C     . LEU A 89  ? 0.3862 0.4002 0.2808 0.0332  -0.0710 -0.1064 346 LEU A C     
375  O O     . LEU A 89  ? 0.3536 0.3564 0.2710 0.0191  -0.0625 -0.0948 346 LEU A O     
376  C CB    . LEU A 89  ? 0.4039 0.4081 0.2436 0.0463  -0.0513 -0.0702 346 LEU A CB    
377  C CG    . LEU A 89  ? 0.4290 0.4339 0.2369 0.0575  -0.0404 -0.0622 346 LEU A CG    
378  C CD1   . LEU A 89  ? 0.4379 0.4328 0.2410 0.0536  -0.0233 -0.0322 346 LEU A CD1   
379  C CD2   . LEU A 89  ? 0.4809 0.5014 0.2514 0.0799  -0.0514 -0.0719 346 LEU A CD2   
380  N N     . ARG A 90  ? 0.4189 0.4525 0.3092 0.0456  -0.0892 -0.1254 347 ARG A N     
381  C CA    . ARG A 90  ? 0.4207 0.4659 0.3351 0.0437  -0.1013 -0.1339 347 ARG A CA    
382  C C     . ARG A 90  ? 0.4241 0.4642 0.3143 0.0507  -0.0988 -0.1050 347 ARG A C     
383  O O     . ARG A 90  ? 0.4423 0.4799 0.2916 0.0661  -0.0972 -0.0887 347 ARG A O     
384  C CB    . ARG A 90  ? 0.4730 0.5445 0.3889 0.0594  -0.1251 -0.1667 347 ARG A CB    
385  C CG    . ARG A 90  ? 0.4972 0.5753 0.4508 0.0506  -0.1294 -0.2016 347 ARG A CG    
386  C CD    . ARG A 90  ? 0.5543 0.6629 0.5081 0.0698  -0.1565 -0.2387 347 ARG A CD    
387  N NE    . ARG A 90  ? 0.6005 0.7116 0.5861 0.0627  -0.1586 -0.2721 347 ARG A NE    
388  C CZ    . ARG A 90  ? 0.6573 0.7697 0.6145 0.0757  -0.1616 -0.2838 347 ARG A CZ    
389  N NH1   . ARG A 90  ? 0.6992 0.8127 0.5923 0.0978  -0.1618 -0.2643 347 ARG A NH1   
390  N NH2   . ARG A 90  ? 0.6894 0.8014 0.6848 0.0670  -0.1631 -0.3160 347 ARG A NH2   
391  N N     . PRO A 91  ? 0.4157 0.4523 0.3320 0.0397  -0.0962 -0.0977 348 PRO A N     
392  C CA    . PRO A 91  ? 0.4213 0.4496 0.3223 0.0442  -0.0928 -0.0719 348 PRO A CA    
393  C C     . PRO A 91  ? 0.4609 0.4999 0.3339 0.0671  -0.1086 -0.0700 348 PRO A C     
394  O O     . PRO A 91  ? 0.4751 0.5015 0.3200 0.0764  -0.1024 -0.0447 348 PRO A O     
395  C CB    . PRO A 91  ? 0.4073 0.4353 0.3473 0.0293  -0.0901 -0.0744 348 PRO A CB    
396  C CG    . PRO A 91  ? 0.4033 0.4338 0.3756 0.0150  -0.0858 -0.0949 348 PRO A CG    
397  C CD    . PRO A 91  ? 0.4158 0.4579 0.3797 0.0241  -0.0965 -0.1162 348 PRO A CD    
398  N N     . GLU A 92  ? 0.5280 0.5625 0.3376 0.0426  -0.1049 -0.0707 349 GLU A N     
399  C CA    . GLU A 92  ? 0.5857 0.6407 0.3776 0.0611  -0.1061 -0.0678 349 GLU A CA    
400  C C     . GLU A 92  ? 0.6052 0.6658 0.3667 0.0841  -0.1012 -0.0662 349 GLU A C     
401  O O     . GLU A 92  ? 0.6494 0.7257 0.3943 0.1004  -0.0954 -0.0548 349 GLU A O     
402  C CB    . GLU A 92  ? 0.6049 0.6742 0.4030 0.0608  -0.1250 -0.0849 349 GLU A CB    
403  C CG    . GLU A 92  ? 0.6716 0.7373 0.4632 0.0660  -0.1435 -0.1094 349 GLU A CG    
404  C CD    . GLU A 92  ? 0.6887 0.7336 0.5052 0.0438  -0.1521 -0.1194 349 GLU A CD    
405  O OE1   . GLU A 92  ? 0.6264 0.6614 0.4635 0.0246  -0.1415 -0.1060 349 GLU A OE1   
406  O OE2   . GLU A 92  ? 0.7437 0.7824 0.5587 0.0472  -0.1708 -0.1413 349 GLU A OE2   
407  N N     . THR A 93  ? 0.6089 0.6583 0.3631 0.0866  -0.1034 -0.0765 350 THR A N     
408  C CA    . THR A 93  ? 0.6258 0.6853 0.3514 0.1098  -0.0976 -0.0749 350 THR A CA    
409  C C     . THR A 93  ? 0.5936 0.6500 0.3213 0.1073  -0.0753 -0.0499 350 THR A C     
410  O O     . THR A 93  ? 0.5943 0.6665 0.3092 0.1203  -0.0630 -0.0308 350 THR A O     
411  C CB    . THR A 93  ? 0.6463 0.6951 0.3643 0.1153  -0.1111 -0.0990 350 THR A CB    
412  O OG1   . THR A 93  ? 0.6644 0.7137 0.3869 0.1147  -0.1343 -0.1229 350 THR A OG1   
413  C CG2   . THR A 93  ? 0.6893 0.7545 0.3757 0.1429  -0.1054 -0.0991 350 THR A CG2   
414  N N     . ALA A 94  ? 0.5413 0.5776 0.2874 0.0898  -0.0710 -0.0492 351 ALA A N     
415  C CA    . ALA A 94  ? 0.5085 0.5408 0.2598 0.0864  -0.0526 -0.0299 351 ALA A CA    
416  C C     . ALA A 94  ? 0.4829 0.5202 0.2451 0.0817  -0.0406 -0.0064 351 ALA A C     
417  O O     . ALA A 94  ? 0.4859 0.5320 0.2428 0.0895  -0.0270 0.0124  351 ALA A O     
418  C CB    . ALA A 94  ? 0.4804 0.4906 0.2506 0.0685  -0.0530 -0.0356 351 ALA A CB    
419  N N     . LEU A 95  ? 0.4624 0.4951 0.2405 0.0698  -0.0464 -0.0075 352 LEU A N     
420  C CA    . LEU A 95  ? 0.4570 0.4893 0.2482 0.0650  -0.0373 0.0118  352 LEU A CA    
421  C C     . LEU A 95  ? 0.4793 0.5272 0.2559 0.0811  -0.0354 0.0246  352 LEU A C     
422  O O     . LEU A 95  ? 0.5020 0.5465 0.2891 0.0790  -0.0281 0.0425  352 LEU A O     
423  C CB    . LEU A 95  ? 0.4281 0.4519 0.2422 0.0482  -0.0431 0.0064  352 LEU A CB    
424  C CG    . LEU A 95  ? 0.4160 0.4250 0.2460 0.0321  -0.0429 -0.0012 352 LEU A CG    
425  C CD1   . LEU A 95  ? 0.4004 0.4076 0.2518 0.0180  -0.0465 -0.0032 352 LEU A CD1   
426  C CD2   . LEU A 95  ? 0.3984 0.3985 0.2328 0.0306  -0.0298 0.0108  352 LEU A CD2   
427  N N     . ALA A 96  ? 0.4946 0.5586 0.2477 0.0980  -0.0429 0.0155  353 ALA A N     
428  C CA    . ALA A 96  ? 0.5187 0.6011 0.2524 0.1175  -0.0403 0.0291  353 ALA A CA    
429  C C     . ALA A 96  ? 0.5311 0.6275 0.2444 0.1339  -0.0285 0.0421  353 ALA A C     
430  O O     . ALA A 96  ? 0.5455 0.6607 0.2399 0.1522  -0.0243 0.0563  353 ALA A O     
431  C CB    . ALA A 96  ? 0.5397 0.6366 0.2587 0.1289  -0.0573 0.0096  353 ALA A CB    
432  N N     . ASP A 97  ? 0.5239 0.6143 0.2403 0.1289  -0.0231 0.0378  354 ASP A N     
433  C CA    . ASP A 97  ? 0.5431 0.6525 0.2404 0.1459  -0.0120 0.0483  354 ASP A CA    
434  C C     . ASP A 97  ? 0.5253 0.6321 0.2406 0.1371  0.0067  0.0786  354 ASP A C     
435  O O     . ASP A 97  ? 0.4784 0.5654 0.2183 0.1179  0.0097  0.0783  354 ASP A O     
436  C CB    . ASP A 97  ? 0.5591 0.6644 0.2505 0.1471  -0.0173 0.0258  354 ASP A CB    
437  C CG    . ASP A 97  ? 0.5934 0.7231 0.2643 0.1672  -0.0061 0.0345  354 ASP A CG    
438  O OD1   . ASP A 97  ? 0.6232 0.7547 0.3071 0.1606  0.0100  0.0543  354 ASP A OD1   
439  O OD2   . ASP A 97  ? 0.6123 0.7618 0.2549 0.1903  -0.0141 0.0205  354 ASP A OD2   
440  N N     . PRO A 98  ? 0.5326 0.6603 0.2369 0.1513  0.0187  0.1053  355 PRO A N     
441  C CA    . PRO A 98  ? 0.5285 0.6519 0.2565 0.1402  0.0350  0.1363  355 PRO A CA    
442  C C     . PRO A 98  ? 0.5123 0.6367 0.2535 0.1322  0.0454  0.1388  355 PRO A C     
443  O O     . PRO A 98  ? 0.4928 0.6012 0.2635 0.1142  0.0513  0.1505  355 PRO A O     
444  C CB    . PRO A 98  ? 0.5556 0.7059 0.2661 0.1595  0.0457  0.1657  355 PRO A CB    
445  C CG    . PRO A 98  ? 0.5792 0.7442 0.2581 0.1799  0.0334  0.1492  355 PRO A CG    
446  C CD    . PRO A 98  ? 0.5677 0.7209 0.2421 0.1759  0.0162  0.1100  355 PRO A CD    
447  N N     . GLN A 99  ? 0.5291 0.6730 0.2487 0.1470  0.0462  0.1264  356 GLN A N     
448  C CA    . GLN A 99  ? 0.5229 0.6715 0.2532 0.1424  0.0559  0.1279  356 GLN A CA    
449  C C     . GLN A 99  ? 0.4845 0.6007 0.2360 0.1213  0.0466  0.1058  356 GLN A C     
450  O O     . GLN A 99  ? 0.4674 0.5763 0.2432 0.1074  0.0547  0.1139  356 GLN A O     
451  C CB    . GLN A 99  ? 0.5626 0.7420 0.2617 0.1676  0.0574  0.1177  356 GLN A CB    
452  C CG    . GLN A 99  ? 0.6118 0.8318 0.2908 0.1901  0.0712  0.1449  356 GLN A CG    
453  C CD    . GLN A 99  ? 0.6703 0.8970 0.3263 0.2047  0.0628  0.1449  356 GLN A CD    
454  O OE1   . GLN A 99  ? 0.7593 1.0083 0.4084 0.2152  0.0742  0.1754  356 GLN A OE1   
455  N NE2   . GLN A 99  ? 0.6861 0.8955 0.3305 0.2062  0.0426  0.1119  356 GLN A NE2   
456  N N     . PHE A 100 ? 0.4666 0.5652 0.2110 0.1186  0.0299  0.0797  357 PHE A N     
457  C CA    . PHE A 100 ? 0.4402 0.5107 0.2039 0.0993  0.0216  0.0621  357 PHE A CA    
458  C C     . PHE A 100 ? 0.4184 0.4716 0.2119 0.0798  0.0253  0.0757  357 PHE A C     
459  O O     . PHE A 100 ? 0.3830 0.4232 0.1972 0.0661  0.0283  0.0749  357 PHE A O     
460  C CB    . PHE A 100 ? 0.4407 0.4982 0.1950 0.0985  0.0030  0.0346  357 PHE A CB    
461  C CG    . PHE A 100 ? 0.4227 0.4555 0.1941 0.0811  -0.0038 0.0189  357 PHE A CG    
462  C CD1   . PHE A 100 ? 0.4341 0.4625 0.2003 0.0844  -0.0054 0.0061  357 PHE A CD1   
463  C CD2   . PHE A 100 ? 0.4035 0.4197 0.1960 0.0631  -0.0078 0.0188  357 PHE A CD2   
464  C CE1   . PHE A 100 ? 0.4210 0.4266 0.2023 0.0692  -0.0112 -0.0052 357 PHE A CE1   
465  C CE2   . PHE A 100 ? 0.3923 0.3898 0.1995 0.0485  -0.0126 0.0077  357 PHE A CE2   
466  C CZ    . PHE A 100 ? 0.3905 0.3815 0.1922 0.0510  -0.0142 -0.0035 357 PHE A CZ    
467  N N     . VAL A 101 ? 0.4299 0.4838 0.2249 0.0808  0.0242  0.0876  358 VAL A N     
468  C CA    . VAL A 101 ? 0.4096 0.4467 0.2321 0.0655  0.0255  0.0989  358 VAL A CA    
469  C C     . VAL A 101 ? 0.3939 0.4334 0.2369 0.0599  0.0392  0.1217  358 VAL A C     
470  O O     . VAL A 101 ? 0.3728 0.3961 0.2416 0.0452  0.0388  0.1211  358 VAL A O     
471  C CB    . VAL A 101 ? 0.4321 0.4689 0.2510 0.0703  0.0200  0.1061  358 VAL A CB    
472  C CG1   . VAL A 101 ? 0.4190 0.4380 0.2664 0.0578  0.0206  0.1183  358 VAL A CG1   
473  C CG2   . VAL A 101 ? 0.4315 0.4664 0.2380 0.0719  0.0051  0.0816  358 VAL A CG2   
474  N N     . ALA A 102 ? 0.4111 0.4732 0.2444 0.0717  0.0508  0.1417  359 ALA A N     
475  C CA    . ALA A 102 ? 0.4073 0.4762 0.2642 0.0649  0.0644  0.1653  359 ALA A CA    
476  C C     . ALA A 102 ? 0.3906 0.4561 0.2589 0.0565  0.0657  0.1510  359 ALA A C     
477  O O     . ALA A 102 ? 0.3810 0.4376 0.2793 0.0426  0.0693  0.1584  359 ALA A O     
478  C CB    . ALA A 102 ? 0.4378 0.5390 0.2801 0.0807  0.0780  0.1905  359 ALA A CB    
479  N N     . TRP A 103 ? 0.3886 0.4601 0.2333 0.0659  0.0612  0.1291  360 TRP A N     
480  C CA    . TRP A 103 ? 0.3763 0.4420 0.2288 0.0599  0.0607  0.1140  360 TRP A CA    
481  C C     . TRP A 103 ? 0.3467 0.3844 0.2212 0.0420  0.0522  0.1020  360 TRP A C     
482  O O     . TRP A 103 ? 0.3449 0.3781 0.2405 0.0326  0.0555  0.1032  360 TRP A O     
483  C CB    . TRP A 103 ? 0.3783 0.4517 0.2004 0.0751  0.0545  0.0920  360 TRP A CB    
484  C CG    . TRP A 103 ? 0.3664 0.4314 0.1936 0.0712  0.0524  0.0758  360 TRP A CG    
485  C CD1   . TRP A 103 ? 0.3674 0.4503 0.1976 0.0771  0.0620  0.0801  360 TRP A CD1   
486  C CD2   . TRP A 103 ? 0.3471 0.3852 0.1764 0.0617  0.0395  0.0531  360 TRP A CD2   
487  N NE1   . TRP A 103 ? 0.3514 0.4177 0.1841 0.0728  0.0550  0.0607  360 TRP A NE1   
488  C CE2   . TRP A 103 ? 0.3453 0.3838 0.1777 0.0631  0.0417  0.0452  360 TRP A CE2   
489  C CE3   . TRP A 103 ? 0.3453 0.3622 0.1752 0.0526  0.0270  0.0406  360 TRP A CE3   
490  C CZ2   . TRP A 103 ? 0.3381 0.3533 0.1729 0.0558  0.0316  0.0267  360 TRP A CZ2   
491  C CZ3   . TRP A 103 ? 0.3357 0.3322 0.1699 0.0441  0.0180  0.0234  360 TRP A CZ3   
492  C CH2   . TRP A 103 ? 0.3349 0.3291 0.1707 0.0458  0.0200  0.0171  360 TRP A CH2   
493  N N     . LEU A 104 ? 0.3479 0.3698 0.2182 0.0383  0.0411  0.0911  361 LEU A N     
494  C CA    . LEU A 104 ? 0.3388 0.3395 0.2278 0.0240  0.0336  0.0802  361 LEU A CA    
495  C C     . LEU A 104 ? 0.3325 0.3270 0.2522 0.0138  0.0380  0.0954  361 LEU A C     
496  O O     . LEU A 104 ? 0.3092 0.2932 0.2471 0.0044  0.0355  0.0879  361 LEU A O     
497  C CB    . LEU A 104 ? 0.3400 0.3319 0.2210 0.0230  0.0222  0.0693  361 LEU A CB    
498  C CG    . LEU A 104 ? 0.3571 0.3472 0.2186 0.0263  0.0124  0.0492  361 LEU A CG    
499  C CD1   . LEU A 104 ? 0.3639 0.3520 0.2231 0.0252  0.0029  0.0445  361 LEU A CD1   
500  C CD2   . LEU A 104 ? 0.3274 0.3049 0.1960 0.0173  0.0088  0.0350  361 LEU A CD2   
501  N N     . GLY A 105 ? 0.3443 0.3448 0.2694 0.0168  0.0430  0.1163  362 GLY A N     
502  C CA    . GLY A 105 ? 0.3523 0.3434 0.3093 0.0072  0.0446  0.1317  362 GLY A CA    
503  C C     . GLY A 105 ? 0.3723 0.3751 0.3508 0.0027  0.0558  0.1490  362 GLY A C     
504  O O     . GLY A 105 ? 0.3633 0.3575 0.3730 -0.0066 0.0558  0.1624  362 GLY A O     
505  N N     . ASP A 106 ? 0.3714 0.3946 0.3355 0.0097  0.0642  0.1484  363 ASP A N     
506  C CA    . ASP A 106 ? 0.3861 0.4275 0.3710 0.0064  0.0759  0.1651  363 ASP A CA    
507  C C     . ASP A 106 ? 0.3739 0.4076 0.3773 -0.0027 0.0723  0.1487  363 ASP A C     
508  O O     . ASP A 106 ? 0.3434 0.3777 0.3282 0.0025  0.0695  0.1283  363 ASP A O     
509  C CB    . ASP A 106 ? 0.3962 0.4686 0.3552 0.0220  0.0870  0.1725  363 ASP A CB    
510  C CG    . ASP A 106 ? 0.4004 0.5001 0.3807 0.0203  0.1013  0.1951  363 ASP A CG    
511  O OD1   . ASP A 106 ? 0.3901 0.4856 0.4054 0.0064  0.1020  0.1988  363 ASP A OD1   
512  O OD2   . ASP A 106 ? 0.4125 0.5418 0.3731 0.0347  0.1117  0.2080  363 ASP A OD2   
513  N N     . GLU A 107 ? 0.3767 0.4017 0.4175 -0.0157 0.0706  0.1570  364 GLU A N     
514  C CA    . GLU A 107 ? 0.3891 0.4079 0.4508 -0.0237 0.0659  0.1420  364 GLU A CA    
515  C C     . GLU A 107 ? 0.3729 0.4169 0.4319 -0.0190 0.0757  0.1420  364 GLU A C     
516  O O     . GLU A 107 ? 0.3809 0.4215 0.4429 -0.0202 0.0714  0.1244  364 GLU A O     
517  C CB    . GLU A 107 ? 0.4377 0.4446 0.5424 -0.0371 0.0610  0.1518  364 GLU A CB    
518  C CG    . GLU A 107 ? 0.4909 0.4939 0.6238 -0.0452 0.0547  0.1378  364 GLU A CG    
519  C CD    . GLU A 107 ? 0.5383 0.5254 0.6562 -0.0423 0.0432  0.1087  364 GLU A CD    
520  O OE1   . GLU A 107 ? 0.6175 0.5906 0.7127 -0.0378 0.0368  0.0990  364 GLU A OE1   
521  O OE2   . GLU A 107 ? 0.5830 0.5742 0.7132 -0.0443 0.0408  0.0965  364 GLU A OE2   
522  N N     . THR A 108 ? 0.3694 0.4408 0.4211 -0.0115 0.0887  0.1614  365 THR A N     
523  C CA    . THR A 108 ? 0.3680 0.4676 0.4178 -0.0048 0.0981  0.1613  365 THR A CA    
524  C C     . THR A 108 ? 0.3678 0.4695 0.3754 0.0116  0.0956  0.1396  365 THR A C     
525  O O     . THR A 108 ? 0.3594 0.4808 0.3606 0.0202  0.1006  0.1339  365 THR A O     
526  C CB    . THR A 108 ? 0.3868 0.5230 0.4466 -0.0012 0.1144  0.1921  365 THR A CB    
527  O OG1   . THR A 108 ? 0.4146 0.5619 0.4381 0.0143  0.1191  0.1988  365 THR A OG1   
528  C CG2   . THR A 108 ? 0.4017 0.5349 0.5070 -0.0186 0.1166  0.2184  365 THR A CG2   
529  N N     . LYS A 109 ? 0.3709 0.4529 0.3514 0.0162  0.0870  0.1276  366 LYS A N     
530  C CA    . LYS A 109 ? 0.3674 0.4442 0.3124 0.0290  0.0806  0.1052  366 LYS A CA    
531  C C     . LYS A 109 ? 0.3487 0.3963 0.2974 0.0202  0.0683  0.0840  366 LYS A C     
532  O O     . LYS A 109 ? 0.3493 0.3760 0.3007 0.0122  0.0601  0.0799  366 LYS A O     
533  C CB    . LYS A 109 ? 0.3849 0.4616 0.3008 0.0393  0.0779  0.1058  366 LYS A CB    
534  C CG    . LYS A 109 ? 0.4103 0.5169 0.3208 0.0493  0.0903  0.1307  366 LYS A CG    
535  C CD    . LYS A 109 ? 0.4336 0.5747 0.3269 0.0674  0.0999  0.1324  366 LYS A CD    
536  C CE    . LYS A 109 ? 0.4671 0.6422 0.3552 0.0778  0.1135  0.1607  366 LYS A CE    
537  N NZ    . LYS A 109 ? 0.4813 0.6835 0.4002 0.0715  0.1280  0.1834  366 LYS A NZ    
538  N N     . LYS A 110 ? 0.3393 0.3875 0.2877 0.0229  0.0669  0.0710  367 LYS A N     
539  C CA    . LYS A 110 ? 0.3225 0.3479 0.2793 0.0144  0.0574  0.0557  367 LYS A CA    
540  C C     . LYS A 110 ? 0.3179 0.3224 0.2484 0.0181  0.0467  0.0377  367 LYS A C     
541  O O     . LYS A 110 ? 0.3332 0.3407 0.2398 0.0303  0.0452  0.0295  367 LYS A O     
542  C CB    . LYS A 110 ? 0.3399 0.3763 0.3105 0.0159  0.0606  0.0517  367 LYS A CB    
543  C CG    . LYS A 110 ? 0.3482 0.4068 0.3514 0.0095  0.0701  0.0698  367 LYS A CG    
544  C CD    . LYS A 110 ? 0.3604 0.4052 0.3917 -0.0056 0.0659  0.0774  367 LYS A CD    
545  C CE    . LYS A 110 ? 0.3892 0.4544 0.4587 -0.0138 0.0737  0.0965  367 LYS A CE    
546  N NZ    . LYS A 110 ? 0.4199 0.4692 0.5148 -0.0263 0.0684  0.1057  367 LYS A NZ    
547  N N     . LYS A 111 ? 0.2904 0.2752 0.2267 0.0083  0.0387  0.0317  368 LYS A N     
548  C CA    . LYS A 111 ? 0.2968 0.2635 0.2150 0.0084  0.0288  0.0181  368 LYS A CA    
549  C C     . LYS A 111 ? 0.2826 0.2358 0.2087 0.0026  0.0233  0.0091  368 LYS A C     
550  O O     . LYS A 111 ? 0.2757 0.2300 0.2223 -0.0040 0.0240  0.0119  368 LYS A O     
551  C CB    . LYS A 111 ? 0.2964 0.2568 0.2113 0.0034  0.0242  0.0205  368 LYS A CB    
552  C CG    . LYS A 111 ? 0.3118 0.2849 0.2151 0.0109  0.0282  0.0292  368 LYS A CG    
553  C CD    . LYS A 111 ? 0.3109 0.2924 0.2331 0.0063  0.0347  0.0463  368 LYS A CD    
554  C CE    . LYS A 111 ? 0.3355 0.3318 0.2447 0.0153  0.0399  0.0584  368 LYS A CE    
555  N NZ    . LYS A 111 ? 0.3389 0.3460 0.2700 0.0117  0.0490  0.0800  368 LYS A NZ    
556  N N     . SER A 112 ? 0.2810 0.2209 0.1910 0.0058  0.0165  -0.0017 369 SER A N     
557  C CA    . SER A 112 ? 0.2770 0.2030 0.1906 0.0006  0.0107  -0.0078 369 SER A CA    
558  C C     . SER A 112 ? 0.2766 0.1900 0.1828 -0.0062 0.0027  -0.0103 369 SER A C     
559  O O     . SER A 112 ? 0.2867 0.1942 0.1783 -0.0033 -0.0022 -0.0146 369 SER A O     
560  C CB    . SER A 112 ? 0.2934 0.2129 0.1969 0.0092  0.0086  -0.0157 369 SER A CB    
561  O OG    . SER A 112 ? 0.3075 0.2444 0.2210 0.0152  0.0165  -0.0127 369 SER A OG    
562  N N     . MET A 113 ? 0.2619 0.1742 0.1791 -0.0141 0.0010  -0.0082 370 MET A N     
563  C CA    . MET A 113 ? 0.2686 0.1761 0.1838 -0.0216 -0.0050 -0.0080 370 MET A CA    
564  C C     . MET A 113 ? 0.2597 0.1642 0.1807 -0.0266 -0.0075 -0.0071 370 MET A C     
565  O O     . MET A 113 ? 0.2823 0.1888 0.2086 -0.0234 -0.0051 -0.0075 370 MET A O     
566  C CB    . MET A 113 ? 0.2622 0.1811 0.1855 -0.0244 -0.0031 -0.0031 370 MET A CB    
567  C CG    . MET A 113 ? 0.2760 0.2011 0.1942 -0.0186 0.0010  0.0002  370 MET A CG    
568  S SD    . MET A 113 ? 0.2828 0.2172 0.2079 -0.0207 0.0011  0.0070  370 MET A SD    
569  C CE    . MET A 113 ? 0.2642 0.1961 0.1796 -0.0253 -0.0079 0.0015  370 MET A CE    
570  N N     . PHE A 114 ? 0.2703 0.1742 0.1915 -0.0341 -0.0122 -0.0050 371 PHE A N     
571  C CA    . PHE A 114 ? 0.2655 0.1751 0.1936 -0.0388 -0.0129 -0.0005 371 PHE A CA    
572  C C     . PHE A 114 ? 0.2737 0.2005 0.2102 -0.0422 -0.0126 0.0023  371 PHE A C     
573  O O     . PHE A 114 ? 0.2939 0.2223 0.2292 -0.0469 -0.0160 0.0026  371 PHE A O     
574  C CB    . PHE A 114 ? 0.2750 0.1708 0.1986 -0.0451 -0.0187 0.0022  371 PHE A CB    
575  C CG    . PHE A 114 ? 0.2761 0.1805 0.2062 -0.0499 -0.0181 0.0112  371 PHE A CG    
576  C CD1   . PHE A 114 ? 0.2646 0.1873 0.2034 -0.0570 -0.0182 0.0176  371 PHE A CD1   
577  C CD2   . PHE A 114 ? 0.2732 0.1704 0.2003 -0.0461 -0.0174 0.0145  371 PHE A CD2   
578  C CE1   . PHE A 114 ? 0.2686 0.2045 0.2127 -0.0599 -0.0163 0.0282  371 PHE A CE1   
579  C CE2   . PHE A 114 ? 0.2649 0.1734 0.1964 -0.0488 -0.0159 0.0254  371 PHE A CE2   
580  C CZ    . PHE A 114 ? 0.2617 0.1912 0.2015 -0.0552 -0.0147 0.0326  371 PHE A CZ    
581  N N     . ASP A 115 ? 0.2789 0.2194 0.2239 -0.0383 -0.0101 0.0025  372 ASP A N     
582  C CA    . ASP A 115 ? 0.2879 0.2463 0.2407 -0.0380 -0.0109 0.0031  372 ASP A CA    
583  C C     . ASP A 115 ? 0.2689 0.2253 0.2227 -0.0366 -0.0111 0.0012  372 ASP A C     
584  O O     . ASP A 115 ? 0.2830 0.2443 0.2353 -0.0397 -0.0136 0.0024  372 ASP A O     
585  C CB    . ASP A 115 ? 0.2907 0.2606 0.2443 -0.0450 -0.0130 0.0088  372 ASP A CB    
586  C CG    . ASP A 115 ? 0.3218 0.3169 0.2835 -0.0408 -0.0134 0.0084  372 ASP A CG    
587  O OD1   . ASP A 115 ? 0.2990 0.2982 0.2657 -0.0318 -0.0138 0.0021  372 ASP A OD1   
588  O OD2   . ASP A 115 ? 0.3385 0.3501 0.3033 -0.0460 -0.0142 0.0142  372 ASP A OD2   
589  N N     . SER A 116 ? 0.2766 0.2272 0.2342 -0.0318 -0.0085 -0.0006 373 SER A N     
590  C CA    . SER A 116 ? 0.2775 0.2258 0.2365 -0.0301 -0.0075 0.0014  373 SER A CA    
591  C C     . SER A 116 ? 0.2648 0.2225 0.2331 -0.0277 -0.0107 0.0013  373 SER A C     
592  O O     . SER A 116 ? 0.2580 0.2149 0.2239 -0.0269 -0.0111 0.0047  373 SER A O     
593  C CB    . SER A 116 ? 0.2856 0.2284 0.2502 -0.0270 -0.0031 0.0027  373 SER A CB    
594  O OG    . SER A 116 ? 0.2771 0.2238 0.2573 -0.0246 -0.0044 -0.0008 373 SER A OG    
595  N N     . LYS A 117 ? 0.2359 0.2034 0.2128 -0.0244 -0.0136 -0.0031 374 LYS A N     
596  C CA    . LYS A 117 ? 0.2394 0.2167 0.2235 -0.0195 -0.0184 -0.0055 374 LYS A CA    
597  C C     . LYS A 117 ? 0.2266 0.2133 0.2029 -0.0222 -0.0199 -0.0029 374 LYS A C     
598  O O     . LYS A 117 ? 0.2249 0.2141 0.2033 -0.0185 -0.0230 -0.0026 374 LYS A O     
599  C CB    . LYS A 117 ? 0.2262 0.2171 0.2178 -0.0125 -0.0222 -0.0129 374 LYS A CB    
600  C CG    . LYS A 117 ? 0.2071 0.2097 0.2056 -0.0038 -0.0288 -0.0185 374 LYS A CG    
601  C CD    . LYS A 117 ? 0.2030 0.2137 0.2116 0.0072  -0.0347 -0.0295 374 LYS A CD    
602  C CE    . LYS A 117 ? 0.1954 0.2268 0.1972 0.0110  -0.0327 -0.0315 374 LYS A CE    
603  N NZ    . LYS A 117 ? 0.1840 0.2413 0.1783 0.0117  -0.0309 -0.0272 374 LYS A NZ    
604  N N     . ARG A 118 ? 0.2256 0.2181 0.1949 -0.0287 -0.0187 -0.0009 375 ARG A N     
605  C CA    . ARG A 118 ? 0.2225 0.2257 0.1882 -0.0334 -0.0213 0.0013  375 ARG A CA    
606  C C     . ARG A 118 ? 0.2521 0.2445 0.2106 -0.0335 -0.0224 0.0023  375 ARG A C     
607  O O     . ARG A 118 ? 0.2342 0.2355 0.1927 -0.0307 -0.0258 0.0021  375 ARG A O     
608  C CB    . ARG A 118 ? 0.2234 0.2293 0.1868 -0.0429 -0.0207 0.0050  375 ARG A CB    
609  C CG    . ARG A 118 ? 0.2326 0.2420 0.1948 -0.0517 -0.0248 0.0070  375 ARG A CG    
610  C CD    . ARG A 118 ? 0.2453 0.2537 0.2106 -0.0629 -0.0255 0.0127  375 ARG A CD    
611  N NE    . ARG A 118 ? 0.2388 0.2720 0.2128 -0.0625 -0.0224 0.0186  375 ARG A NE    
612  C CZ    . ARG A 118 ? 0.2418 0.3029 0.2252 -0.0653 -0.0234 0.0227  375 ARG A CZ    
613  N NH1   . ARG A 118 ? 0.2541 0.3211 0.2418 -0.0713 -0.0286 0.0216  375 ARG A NH1   
614  N NH2   . ARG A 118 ? 0.2508 0.3379 0.2394 -0.0606 -0.0194 0.0276  375 ARG A NH2   
615  N N     . ALA A 119 ? 0.2548 0.2303 0.2059 -0.0348 -0.0195 0.0033  376 ALA A N     
616  C CA    . ALA A 119 ? 0.2661 0.2352 0.2077 -0.0322 -0.0198 0.0048  376 ALA A CA    
617  C C     . ALA A 119 ? 0.2484 0.2173 0.1947 -0.0248 -0.0183 0.0092  376 ALA A C     
618  O O     . ALA A 119 ? 0.2565 0.2291 0.1974 -0.0209 -0.0205 0.0115  376 ALA A O     
619  C CB    . ALA A 119 ? 0.2748 0.2303 0.2071 -0.0322 -0.0166 0.0044  376 ALA A CB    
620  N N     . ALA A 120 ? 0.2450 0.2089 0.2028 -0.0228 -0.0158 0.0105  377 ALA A N     
621  C CA    . ALA A 120 ? 0.2494 0.2091 0.2164 -0.0174 -0.0160 0.0160  377 ALA A CA    
622  C C     . ALA A 120 ? 0.2418 0.2095 0.2118 -0.0124 -0.0224 0.0141  377 ALA A C     
623  O O     . ALA A 120 ? 0.2532 0.2178 0.2217 -0.0075 -0.0236 0.0206  377 ALA A O     
624  C CB    . ALA A 120 ? 0.2466 0.1994 0.2306 -0.0172 -0.0152 0.0151  377 ALA A CB    
625  N N     . VAL A 121 ? 0.2225 0.2026 0.1962 -0.0121 -0.0264 0.0062  378 VAL A N     
626  C CA    . VAL A 121 ? 0.2263 0.2188 0.2029 -0.0053 -0.0328 0.0028  378 VAL A CA    
627  C C     . VAL A 121 ? 0.2354 0.2372 0.2007 -0.0061 -0.0343 0.0050  378 VAL A C     
628  O O     . VAL A 121 ? 0.2343 0.2374 0.1986 0.0013  -0.0384 0.0070  378 VAL A O     
629  C CB    . VAL A 121 ? 0.2102 0.2206 0.1936 -0.0027 -0.0357 -0.0056 378 VAL A CB    
630  C CG1   . VAL A 121 ? 0.2042 0.2339 0.1884 0.0050  -0.0417 -0.0093 378 VAL A CG1   
631  C CG2   . VAL A 121 ? 0.2040 0.2060 0.1991 0.0024  -0.0376 -0.0108 378 VAL A CG2   
632  N N     . ALA A 122 ? 0.2371 0.2438 0.1944 -0.0144 -0.0326 0.0043  379 ALA A N     
633  C CA    . ALA A 122 ? 0.2429 0.2586 0.1917 -0.0150 -0.0363 0.0039  379 ALA A CA    
634  C C     . ALA A 122 ? 0.2550 0.2599 0.1933 -0.0080 -0.0357 0.0096  379 ALA A C     
635  O O     . ALA A 122 ? 0.2644 0.2781 0.1971 -0.0021 -0.0403 0.0097  379 ALA A O     
636  C CB    . ALA A 122 ? 0.2480 0.2656 0.1929 -0.0256 -0.0370 0.0011  379 ALA A CB    
637  N N     . LEU A 123 ? 0.2584 0.2475 0.1943 -0.0080 -0.0296 0.0152  380 LEU A N     
638  C CA    . LEU A 123 ? 0.2699 0.2523 0.1970 -0.0010 -0.0266 0.0245  380 LEU A CA    
639  C C     . LEU A 123 ? 0.2764 0.2545 0.2125 0.0066  -0.0283 0.0323  380 LEU A C     
640  O O     . LEU A 123 ? 0.2836 0.2631 0.2108 0.0144  -0.0293 0.0398  380 LEU A O     
641  C CB    . LEU A 123 ? 0.2773 0.2493 0.2019 -0.0033 -0.0187 0.0296  380 LEU A CB    
642  C CG    . LEU A 123 ? 0.2797 0.2529 0.1902 -0.0059 -0.0187 0.0227  380 LEU A CG    
643  C CD1   . LEU A 123 ? 0.2866 0.2515 0.1974 -0.0072 -0.0111 0.0258  380 LEU A CD1   
644  C CD2   . LEU A 123 ? 0.2852 0.2660 0.1770 0.0019  -0.0221 0.0216  380 LEU A CD2   
645  N N     . LYS A 124 ? 0.2659 0.2384 0.2188 0.0057  -0.0302 0.0297  381 LYS A N     
646  C CA    . LYS A 124 ? 0.2851 0.2503 0.2491 0.0132  -0.0351 0.0337  381 LYS A CA    
647  C C     . LYS A 124 ? 0.2810 0.2589 0.2373 0.0217  -0.0423 0.0307  381 LYS A C     
648  O O     . LYS A 124 ? 0.2751 0.2466 0.2299 0.0301  -0.0449 0.0394  381 LYS A O     
649  C CB    . LYS A 124 ? 0.3046 0.2651 0.2872 0.0131  -0.0395 0.0253  381 LYS A CB    
650  C CG    . LYS A 124 ? 0.3417 0.2849 0.3397 0.0085  -0.0361 0.0309  381 LYS A CG    
651  C CD    . LYS A 124 ? 0.3523 0.2941 0.3672 0.0105  -0.0430 0.0178  381 LYS A CD    
652  C CE    . LYS A 124 ? 0.3739 0.3036 0.4049 0.0043  -0.0403 0.0194  381 LYS A CE    
653  N NZ    . LYS A 124 ? 0.4228 0.3339 0.4704 0.0032  -0.0411 0.0333  381 LYS A NZ    
654  N N     . TRP A 125 ? 0.2665 0.2637 0.2191 0.0194  -0.0452 0.0197  382 TRP A N     
655  C CA    . TRP A 125 ? 0.2679 0.2822 0.2154 0.0269  -0.0521 0.0158  382 TRP A CA    
656  C C     . TRP A 125 ? 0.2859 0.3019 0.2171 0.0309  -0.0520 0.0222  382 TRP A C     
657  O O     . TRP A 125 ? 0.2927 0.3190 0.2196 0.0402  -0.0582 0.0215  382 TRP A O     
658  C CB    . TRP A 125 ? 0.2481 0.2872 0.1991 0.0213  -0.0545 0.0049  382 TRP A CB    
659  C CG    . TRP A 125 ? 0.2357 0.2841 0.2001 0.0249  -0.0570 -0.0023 382 TRP A CG    
660  C CD1   . TRP A 125 ? 0.2186 0.2648 0.1904 0.0192  -0.0532 -0.0053 382 TRP A CD1   
661  C CD2   . TRP A 125 ? 0.2270 0.2920 0.1975 0.0379  -0.0648 -0.0090 382 TRP A CD2   
662  N NE1   . TRP A 125 ? 0.2154 0.2773 0.1961 0.0278  -0.0577 -0.0133 382 TRP A NE1   
663  C CE2   . TRP A 125 ? 0.2233 0.2972 0.2040 0.0397  -0.0648 -0.0164 382 TRP A CE2   
664  C CE3   . TRP A 125 ? 0.2415 0.3157 0.2091 0.0500  -0.0720 -0.0101 382 TRP A CE3   
665  C CZ2   . TRP A 125 ? 0.2181 0.3105 0.2053 0.0540  -0.0720 -0.0257 382 TRP A CZ2   
666  C CZ3   . TRP A 125 ? 0.2394 0.3312 0.2148 0.0636  -0.0793 -0.0194 382 TRP A CZ3   
667  C CH2   . TRP A 125 ? 0.2287 0.3300 0.2132 0.0659  -0.0793 -0.0274 382 TRP A CH2   
668  N N     . LYS A 126 ? 0.3074 0.3155 0.2286 0.0263  -0.0456 0.0276  383 LYS A N     
669  C CA    . LYS A 126 ? 0.3357 0.3472 0.2389 0.0335  -0.0454 0.0335  383 LYS A CA    
670  C C     . LYS A 126 ? 0.3616 0.3583 0.2615 0.0406  -0.0393 0.0515  383 LYS A C     
671  O O     . LYS A 126 ? 0.3618 0.3630 0.2449 0.0479  -0.0368 0.0591  383 LYS A O     
672  C CB    . LYS A 126 ? 0.3523 0.3681 0.2445 0.0270  -0.0437 0.0268  383 LYS A CB    
673  C CG    . LYS A 126 ? 0.3491 0.3786 0.2475 0.0179  -0.0503 0.0123  383 LYS A CG    
674  C CD    . LYS A 126 ? 0.3796 0.4090 0.2681 0.0129  -0.0520 0.0049  383 LYS A CD    
675  C CE    . LYS A 126 ? 0.3804 0.4229 0.2793 0.0022  -0.0601 -0.0068 383 LYS A CE    
676  N NZ    . LYS A 126 ? 0.4346 0.4950 0.3283 0.0088  -0.0698 -0.0129 383 LYS A NZ    
677  N N     . GLY A 127 ? 0.3441 0.3247 0.2612 0.0384  -0.0372 0.0586  384 GLY A N     
678  C CA    . GLY A 127 ? 0.3609 0.3274 0.2812 0.0427  -0.0320 0.0787  384 GLY A CA    
679  C C     . GLY A 127 ? 0.3676 0.3320 0.2851 0.0372  -0.0206 0.0887  384 GLY A C     
680  O O     . GLY A 127 ? 0.3638 0.3258 0.2783 0.0421  -0.0144 0.1080  384 GLY A O     
681  N N     . ILE A 128 ? 0.3458 0.3121 0.2654 0.0278  -0.0179 0.0769  385 ILE A N     
682  C CA    . ILE A 128 ? 0.3613 0.3291 0.2761 0.0243  -0.0083 0.0825  385 ILE A CA    
683  C C     . ILE A 128 ? 0.3579 0.3149 0.2945 0.0137  -0.0059 0.0793  385 ILE A C     
684  O O     . ILE A 128 ? 0.3320 0.2871 0.2762 0.0084  -0.0117 0.0641  385 ILE A O     
685  C CB    . ILE A 128 ? 0.3697 0.3497 0.2639 0.0252  -0.0096 0.0684  385 ILE A CB    
686  C CG1   . ILE A 128 ? 0.3913 0.3844 0.2636 0.0377  -0.0129 0.0702  385 ILE A CG1   
687  C CG2   . ILE A 128 ? 0.3658 0.3464 0.2566 0.0225  -0.0013 0.0694  385 ILE A CG2   
688  C CD1   . ILE A 128 ? 0.3829 0.3855 0.2398 0.0380  -0.0193 0.0520  385 ILE A CD1   
689  N N     . GLU A 129 ? 0.3683 0.3209 0.3162 0.0113  0.0023  0.0944  386 GLU A N     
690  C CA    . GLU A 129 ? 0.3905 0.3348 0.3604 0.0019  0.0039  0.0912  386 GLU A CA    
691  C C     . GLU A 129 ? 0.3721 0.3247 0.3326 -0.0011 0.0105  0.0845  386 GLU A C     
692  O O     . GLU A 129 ? 0.3682 0.3319 0.3130 0.0041  0.0178  0.0916  386 GLU A O     
693  C CB    . GLU A 129 ? 0.4684 0.4033 0.4637 -0.0013 0.0072  0.1102  386 GLU A CB    
694  C CG    . GLU A 129 ? 0.5580 0.4781 0.5672 0.0016  -0.0021 0.1152  386 GLU A CG    
695  C CD    . GLU A 129 ? 0.6342 0.5455 0.6540 0.0011  -0.0146 0.0939  386 GLU A CD    
696  O OE1   . GLU A 129 ? 0.6927 0.6031 0.7238 -0.0048 -0.0158 0.0815  386 GLU A OE1   
697  O OE2   . GLU A 129 ? 0.6910 0.5986 0.7075 0.0084  -0.0234 0.0897  386 GLU A OE2   
698  N N     . LEU A 130 ? 0.3433 0.2914 0.3122 -0.0073 0.0071  0.0701  387 LEU A N     
699  C CA    . LEU A 130 ? 0.3418 0.2940 0.3047 -0.0098 0.0117  0.0632  387 LEU A CA    
700  C C     . LEU A 130 ? 0.3415 0.2903 0.3287 -0.0152 0.0152  0.0680  387 LEU A C     
701  O O     . LEU A 130 ? 0.3265 0.2672 0.3321 -0.0190 0.0090  0.0620  387 LEU A O     
702  C CB    . LEU A 130 ? 0.3314 0.2819 0.2868 -0.0127 0.0051  0.0455  387 LEU A CB    
703  C CG    . LEU A 130 ? 0.3303 0.2802 0.2812 -0.0153 0.0074  0.0371  387 LEU A CG    
704  C CD1   . LEU A 130 ? 0.3346 0.2902 0.2658 -0.0093 0.0119  0.0389  387 LEU A CD1   
705  C CD2   . LEU A 130 ? 0.3258 0.2734 0.2740 -0.0195 0.0007  0.0243  387 LEU A CD2   
706  N N     . CYS A 131 ? 0.3408 0.2984 0.3290 -0.0144 0.0245  0.0782  388 CYS A N     
707  C CA    . CYS A 131 ? 0.3351 0.2937 0.3492 -0.0203 0.0281  0.0831  388 CYS A CA    
708  C C     . CYS A 131 ? 0.3154 0.2853 0.3193 -0.0179 0.0346  0.0780  388 CYS A C     
709  O O     . CYS A 131 ? 0.2960 0.2711 0.2734 -0.0109 0.0362  0.0725  388 CYS A O     
710  C CB    . CYS A 131 ? 0.3562 0.3197 0.3891 -0.0222 0.0347  0.1068  388 CYS A CB    
711  S SG    . CYS A 131 ? 0.4229 0.3698 0.4705 -0.0236 0.0266  0.1165  388 CYS A SG    
712  N N     . GLY A 132 ? 0.2976 0.2710 0.3242 -0.0227 0.0370  0.0791  389 GLY A N     
713  C CA    . GLY A 132 ? 0.3138 0.3000 0.3345 -0.0192 0.0432  0.0756  389 GLY A CA    
714  C C     . GLY A 132 ? 0.2893 0.2674 0.2943 -0.0168 0.0373  0.0553  389 GLY A C     
715  O O     . GLY A 132 ? 0.3011 0.2869 0.2941 -0.0110 0.0409  0.0508  389 GLY A O     
716  N N     . VAL A 133 ? 0.2829 0.2471 0.2885 -0.0203 0.0282  0.0443  390 VAL A N     
717  C CA    . VAL A 133 ? 0.2747 0.2322 0.2673 -0.0188 0.0232  0.0291  390 VAL A CA    
718  C C     . VAL A 133 ? 0.2851 0.2462 0.2955 -0.0198 0.0231  0.0240  390 VAL A C     
719  O O     . VAL A 133 ? 0.2865 0.2460 0.3183 -0.0235 0.0184  0.0216  390 VAL A O     
720  C CB    . VAL A 133 ? 0.2794 0.2273 0.2667 -0.0214 0.0150  0.0215  390 VAL A CB    
721  C CG1   . VAL A 133 ? 0.2582 0.2010 0.2335 -0.0206 0.0113  0.0107  390 VAL A CG1   
722  C CG2   . VAL A 133 ? 0.2646 0.2114 0.2358 -0.0202 0.0140  0.0254  390 VAL A CG2   
723  N N     . SER A 134 ? 0.2640 0.2316 0.2668 -0.0148 0.0273  0.0216  391 SER A N     
724  C CA    . SER A 134 ? 0.2579 0.2329 0.2793 -0.0147 0.0275  0.0177  391 SER A CA    
725  C C     . SER A 134 ? 0.2477 0.2140 0.2570 -0.0110 0.0216  0.0044  391 SER A C     
726  O O     . SER A 134 ? 0.2371 0.2085 0.2595 -0.0095 0.0195  -0.0014 391 SER A O     
727  C CB    . SER A 134 ? 0.2713 0.2644 0.2955 -0.0101 0.0368  0.0253  391 SER A CB    
728  O OG    . SER A 134 ? 0.2966 0.2877 0.2907 -0.0010 0.0383  0.0208  391 SER A OG    
729  N N     . PHE A 135 ? 0.2465 0.2004 0.2324 -0.0096 0.0181  0.0002  392 PHE A N     
730  C CA    . PHE A 135 ? 0.2457 0.1908 0.2213 -0.0070 0.0128  -0.0084 392 PHE A CA    
731  C C     . PHE A 135 ? 0.2478 0.1823 0.2106 -0.0112 0.0081  -0.0087 392 PHE A C     
732  O O     . PHE A 135 ? 0.2396 0.1685 0.1892 -0.0123 0.0080  -0.0065 392 PHE A O     
733  C CB    . PHE A 135 ? 0.2656 0.2068 0.2250 0.0006  0.0139  -0.0121 392 PHE A CB    
734  C CG    . PHE A 135 ? 0.2620 0.1908 0.2103 0.0033  0.0081  -0.0180 392 PHE A CG    
735  C CD1   . PHE A 135 ? 0.2663 0.2006 0.2242 0.0066  0.0064  -0.0218 392 PHE A CD1   
736  C CD2   . PHE A 135 ? 0.2781 0.1899 0.2077 0.0024  0.0035  -0.0187 392 PHE A CD2   
737  C CE1   . PHE A 135 ? 0.2628 0.1868 0.2090 0.0104  0.0018  -0.0242 392 PHE A CE1   
738  C CE2   . PHE A 135 ? 0.2896 0.1891 0.2114 0.0038  -0.0016 -0.0202 392 PHE A CE2   
739  C CZ    . PHE A 135 ? 0.2771 0.1832 0.2059 0.0082  -0.0017 -0.0218 392 PHE A CZ    
740  N N     . ASP A 136 ? 0.2327 0.1683 0.2010 -0.0125 0.0040  -0.0115 393 ASP A N     
741  C CA    . ASP A 136 ? 0.2405 0.1722 0.1998 -0.0164 0.0003  -0.0102 393 ASP A CA    
742  C C     . ASP A 136 ? 0.2337 0.1611 0.1845 -0.0139 -0.0022 -0.0114 393 ASP A C     
743  O O     . ASP A 136 ? 0.2350 0.1710 0.1924 -0.0092 -0.0035 -0.0144 393 ASP A O     
744  C CB    . ASP A 136 ? 0.2338 0.1755 0.2058 -0.0178 -0.0020 -0.0107 393 ASP A CB    
745  C CG    . ASP A 136 ? 0.2595 0.2033 0.2237 -0.0218 -0.0046 -0.0079 393 ASP A CG    
746  O OD1   . ASP A 136 ? 0.2765 0.2160 0.2299 -0.0240 -0.0055 -0.0053 393 ASP A OD1   
747  O OD2   . ASP A 136 ? 0.2642 0.2139 0.2344 -0.0230 -0.0060 -0.0073 393 ASP A OD2   
748  N N     . LEU A 137 ? 0.2439 0.1581 0.1808 -0.0167 -0.0041 -0.0089 394 LEU A N     
749  C CA    . LEU A 137 ? 0.2525 0.1573 0.1809 -0.0153 -0.0069 -0.0067 394 LEU A CA    
750  C C     . LEU A 137 ? 0.2432 0.1590 0.1747 -0.0175 -0.0076 -0.0009 394 LEU A C     
751  O O     . LEU A 137 ? 0.2488 0.1653 0.1769 -0.0130 -0.0082 0.0020  394 LEU A O     
752  C CB    . LEU A 137 ? 0.2693 0.1536 0.1855 -0.0193 -0.0114 -0.0054 394 LEU A CB    
753  C CG    . LEU A 137 ? 0.2877 0.1556 0.1966 -0.0194 -0.0161 -0.0011 394 LEU A CG    
754  C CD1   . LEU A 137 ? 0.2979 0.1641 0.2034 -0.0075 -0.0148 -0.0056 394 LEU A CD1   
755  C CD2   . LEU A 137 ? 0.2967 0.1407 0.1978 -0.0244 -0.0240 -0.0019 394 LEU A CD2   
756  N N     . LEU A 138 ? 0.2458 0.1730 0.1830 -0.0229 -0.0075 0.0015  395 LEU A N     
757  C CA    . LEU A 138 ? 0.2367 0.1821 0.1772 -0.0224 -0.0073 0.0066  395 LEU A CA    
758  C C     . LEU A 138 ? 0.2230 0.1837 0.1690 -0.0110 -0.0071 0.0002  395 LEU A C     
759  O O     . LEU A 138 ? 0.2253 0.1962 0.1674 -0.0052 -0.0070 0.0039  395 LEU A O     
760  C CB    . LEU A 138 ? 0.2444 0.2020 0.1904 -0.0280 -0.0077 0.0083  395 LEU A CB    
761  C CG    . LEU A 138 ? 0.2506 0.2349 0.2007 -0.0240 -0.0070 0.0121  395 LEU A CG    
762  C CD1   . LEU A 138 ? 0.2635 0.2525 0.2087 -0.0275 -0.0055 0.0252  395 LEU A CD1   
763  C CD2   . LEU A 138 ? 0.2597 0.2578 0.2159 -0.0271 -0.0081 0.0114  395 LEU A CD2   
764  N N     . LEU A 139 ? 0.2106 0.1733 0.1666 -0.0074 -0.0078 -0.0091 396 LEU A N     
765  C CA    . LEU A 139 ? 0.2009 0.1768 0.1663 0.0029  -0.0104 -0.0181 396 LEU A CA    
766  C C     . LEU A 139 ? 0.2046 0.1761 0.1665 0.0094  -0.0105 -0.0207 396 LEU A C     
767  O O     . LEU A 139 ? 0.1977 0.1826 0.1605 0.0196  -0.0132 -0.0255 396 LEU A O     
768  C CB    . LEU A 139 ? 0.2012 0.1767 0.1828 0.0022  -0.0125 -0.0255 396 LEU A CB    
769  C CG    . LEU A 139 ? 0.1992 0.1799 0.1840 -0.0012 -0.0138 -0.0240 396 LEU A CG    
770  C CD1   . LEU A 139 ? 0.1988 0.1741 0.2008 -0.0026 -0.0162 -0.0284 396 LEU A CD1   
771  C CD2   . LEU A 139 ? 0.2046 0.2064 0.1887 0.0077  -0.0176 -0.0278 396 LEU A CD2   
772  N N     . ALA A 140 ? 0.2159 0.1704 0.1722 0.0055  -0.0081 -0.0183 397 ALA A N     
773  C CA    . ALA A 140 ? 0.2204 0.1700 0.1712 0.0130  -0.0084 -0.0205 397 ALA A CA    
774  C C     . ALA A 140 ? 0.2353 0.1854 0.1727 0.0173  -0.0093 -0.0130 397 ALA A C     
775  O O     . ALA A 140 ? 0.2444 0.2030 0.1803 0.0281  -0.0112 -0.0162 397 ALA A O     
776  C CB    . ALA A 140 ? 0.2150 0.1472 0.1595 0.0104  -0.0064 -0.0198 397 ALA A CB    
777  N N     . ALA A 141 ? 0.2455 0.1863 0.1742 0.0089  -0.0084 -0.0017 398 ALA A N     
778  C CA    . ALA A 141 ? 0.2641 0.2050 0.1826 0.0105  -0.0085 0.0105  398 ALA A CA    
779  C C     . ALA A 141 ? 0.2615 0.2311 0.1820 0.0188  -0.0077 0.0117  398 ALA A C     
780  O O     . ALA A 141 ? 0.2588 0.2371 0.1715 0.0289  -0.0078 0.0166  398 ALA A O     
781  C CB    . ALA A 141 ? 0.2682 0.1948 0.1835 -0.0032 -0.0087 0.0228  398 ALA A CB    
782  N N     . TYR A 142 ? 0.2511 0.2370 0.1807 0.0171  -0.0076 0.0065  399 TYR A N     
783  C CA    . TYR A 142 ? 0.2501 0.2664 0.1813 0.0288  -0.0086 0.0034  399 TYR A CA    
784  C C     . TYR A 142 ? 0.2524 0.2792 0.1852 0.0448  -0.0129 -0.0098 399 TYR A C     
785  O O     . TYR A 142 ? 0.2582 0.3065 0.1833 0.0583  -0.0136 -0.0079 399 TYR A O     
786  C CB    . TYR A 142 ? 0.2504 0.2776 0.1925 0.0262  -0.0102 -0.0042 399 TYR A CB    
787  C CG    . TYR A 142 ? 0.2594 0.3169 0.2043 0.0408  -0.0137 -0.0127 399 TYR A CG    
788  C CD1   . TYR A 142 ? 0.2674 0.3514 0.2030 0.0472  -0.0105 -0.0017 399 TYR A CD1   
789  C CD2   . TYR A 142 ? 0.2586 0.3199 0.2168 0.0483  -0.0208 -0.0311 399 TYR A CD2   
790  C CE1   . TYR A 142 ? 0.2847 0.4008 0.2205 0.0642  -0.0142 -0.0110 399 TYR A CE1   
791  C CE2   . TYR A 142 ? 0.2658 0.3543 0.2263 0.0644  -0.0267 -0.0423 399 TYR A CE2   
792  C CZ    . TYR A 142 ? 0.2751 0.3923 0.2228 0.0736  -0.0233 -0.0332 399 TYR A CZ    
793  O OH    . TYR A 142 ? 0.2782 0.4262 0.2259 0.0924  -0.0294 -0.0454 399 TYR A OH    
794  N N     . LEU A 143 ? 0.2374 0.2518 0.1808 0.0442  -0.0159 -0.0224 400 LEU A N     
795  C CA    . LEU A 143 ? 0.2439 0.2686 0.1932 0.0582  -0.0214 -0.0362 400 LEU A CA    
796  C C     . LEU A 143 ? 0.2615 0.2835 0.1966 0.0669  -0.0206 -0.0305 400 LEU A C     
797  O O     . LEU A 143 ? 0.2678 0.3083 0.2000 0.0829  -0.0249 -0.0374 400 LEU A O     
798  C CB    . LEU A 143 ? 0.2329 0.2480 0.2019 0.0532  -0.0242 -0.0484 400 LEU A CB    
799  C CG    . LEU A 143 ? 0.2229 0.2421 0.2097 0.0487  -0.0279 -0.0563 400 LEU A CG    
800  C CD1   . LEU A 143 ? 0.2120 0.2214 0.2202 0.0421  -0.0292 -0.0629 400 LEU A CD1   
801  C CD2   . LEU A 143 ? 0.2194 0.2616 0.2115 0.0633  -0.0364 -0.0690 400 LEU A CD2   
802  N N     . LEU A 144 ? 0.2736 0.2721 0.1994 0.0579  -0.0164 -0.0189 401 LEU A N     
803  C CA    . LEU A 144 ? 0.2973 0.2871 0.2089 0.0656  -0.0165 -0.0118 401 LEU A CA    
804  C C     . LEU A 144 ? 0.3205 0.3244 0.2177 0.0732  -0.0147 0.0031  401 LEU A C     
805  O O     . LEU A 144 ? 0.3359 0.3461 0.2231 0.0874  -0.0166 0.0046  401 LEU A O     
806  C CB    . LEU A 144 ? 0.3118 0.2704 0.2175 0.0550  -0.0146 -0.0044 401 LEU A CB    
807  C CG    . LEU A 144 ? 0.3042 0.2533 0.2194 0.0535  -0.0154 -0.0172 401 LEU A CG    
808  C CD1   . LEU A 144 ? 0.3243 0.2448 0.2292 0.0478  -0.0152 -0.0111 401 LEU A CD1   
809  C CD2   . LEU A 144 ? 0.2962 0.2584 0.2173 0.0678  -0.0189 -0.0298 401 LEU A CD2   
810  N N     . ASP A 145 ? 0.3151 0.3264 0.2112 0.0645  -0.0108 0.0154  402 ASP A N     
811  C CA    . ASP A 145 ? 0.3403 0.3744 0.2252 0.0722  -0.0075 0.0320  402 ASP A CA    
812  C C     . ASP A 145 ? 0.3277 0.3787 0.2176 0.0629  -0.0034 0.0408  402 ASP A C     
813  O O     . ASP A 145 ? 0.3414 0.3774 0.2327 0.0462  0.0001  0.0569  402 ASP A O     
814  C CB    . ASP A 145 ? 0.3718 0.3848 0.2445 0.0693  -0.0056 0.0526  402 ASP A CB    
815  C CG    . ASP A 145 ? 0.3924 0.4302 0.2537 0.0782  -0.0011 0.0737  402 ASP A CG    
816  O OD1   . ASP A 145 ? 0.4034 0.4793 0.2633 0.0899  0.0006  0.0710  402 ASP A OD1   
817  O OD2   . ASP A 145 ? 0.4219 0.4413 0.2755 0.0746  0.0002  0.0937  402 ASP A OD2   
818  N N     . PRO A 146 ? 0.3101 0.3930 0.2037 0.0745  -0.0051 0.0290  403 PRO A N     
819  C CA    . PRO A 146 ? 0.3053 0.4087 0.2036 0.0690  -0.0018 0.0349  403 PRO A CA    
820  C C     . PRO A 146 ? 0.3231 0.4451 0.2131 0.0664  0.0059  0.0623  403 PRO A C     
821  O O     . PRO A 146 ? 0.3249 0.4575 0.2214 0.0553  0.0098  0.0724  403 PRO A O     
822  C CB    . PRO A 146 ? 0.2995 0.4336 0.2014 0.0878  -0.0077 0.0139  403 PRO A CB    
823  C CG    . PRO A 146 ? 0.3042 0.4361 0.2039 0.1027  -0.0142 -0.0014 403 PRO A CG    
824  C CD    . PRO A 146 ? 0.3066 0.4090 0.2003 0.0954  -0.0118 0.0087  403 PRO A CD    
825  N N     . ALA A 147 ? 0.3333 0.4612 0.2106 0.0765  0.0081  0.0755  404 ALA A N     
826  C CA    . ALA A 147 ? 0.3793 0.5264 0.2509 0.0731  0.0164  0.1067  404 ALA A CA    
827  C C     . ALA A 147 ? 0.4074 0.5201 0.2876 0.0466  0.0188  0.1279  404 ALA A C     
828  O O     . ALA A 147 ? 0.4003 0.5280 0.2837 0.0378  0.0252  0.1550  404 ALA A O     
829  C CB    . ALA A 147 ? 0.3758 0.5400 0.2305 0.0928  0.0182  0.1179  404 ALA A CB    
830  N N     . GLN A 148 ? 0.4158 0.4853 0.3010 0.0352  0.0129  0.1153  405 GLN A N     
831  C CA    . GLN A 148 ? 0.4571 0.4911 0.3503 0.0128  0.0116  0.1294  405 GLN A CA    
832  C C     . GLN A 148 ? 0.4379 0.4821 0.3459 -0.0044 0.0136  0.1347  405 GLN A C     
833  O O     . GLN A 148 ? 0.4483 0.4764 0.3655 -0.0221 0.0132  0.1524  405 GLN A O     
834  C CB    . GLN A 148 ? 0.4817 0.4713 0.3741 0.0089  0.0042  0.1119  405 GLN A CB    
835  C CG    . GLN A 148 ? 0.5425 0.5130 0.4224 0.0206  0.0013  0.1142  405 GLN A CG    
836  C CD    . GLN A 148 ? 0.6107 0.5637 0.4892 0.0121  0.0015  0.1428  405 GLN A CD    
837  O OE1   . GLN A 148 ? 0.6974 0.6172 0.5841 -0.0047 -0.0033 0.1486  405 GLN A OE1   
838  N NE2   . GLN A 148 ? 0.6254 0.6014 0.4948 0.0239  0.0064  0.1613  405 GLN A NE2   
839  N N     . GLY A 149 ? 0.4136 0.4836 0.3256 0.0009  0.0145  0.1190  406 GLY A N     
840  C CA    . GLY A 149 ? 0.3982 0.4815 0.3236 -0.0133 0.0162  0.1240  406 GLY A CA    
841  C C     . GLY A 149 ? 0.4048 0.4497 0.3387 -0.0307 0.0100  0.1147  406 GLY A C     
842  O O     . GLY A 149 ? 0.3960 0.4409 0.3422 -0.0471 0.0095  0.1242  406 GLY A O     
843  N N     . VAL A 150 ? 0.3700 0.3869 0.2983 -0.0259 0.0051  0.0952  407 VAL A N     
844  C CA    . VAL A 150 ? 0.3782 0.3612 0.3108 -0.0386 -0.0006 0.0864  407 VAL A CA    
845  C C     . VAL A 150 ? 0.3801 0.3777 0.3216 -0.0442 -0.0007 0.0781  407 VAL A C     
846  O O     . VAL A 150 ? 0.3655 0.3811 0.3066 -0.0336 0.0005  0.0652  407 VAL A O     
847  C CB    . VAL A 150 ? 0.3724 0.3304 0.2966 -0.0295 -0.0041 0.0685  407 VAL A CB    
848  C CG1   . VAL A 150 ? 0.3595 0.2925 0.2866 -0.0386 -0.0089 0.0577  407 VAL A CG1   
849  C CG2   . VAL A 150 ? 0.3820 0.3216 0.2970 -0.0238 -0.0056 0.0764  407 VAL A CG2   
850  N N     . ASP A 151 ? 0.3689 0.3597 0.3200 -0.0602 -0.0033 0.0861  408 ASP A N     
851  C CA    . ASP A 151 ? 0.3968 0.4007 0.3561 -0.0657 -0.0044 0.0791  408 ASP A CA    
852  C C     . ASP A 151 ? 0.3756 0.3514 0.3393 -0.0790 -0.0118 0.0743  408 ASP A C     
853  O O     . ASP A 151 ? 0.3395 0.3257 0.3106 -0.0847 -0.0137 0.0704  408 ASP A O     
854  C CB    . ASP A 151 ? 0.4311 0.4717 0.4012 -0.0710 -0.0001 0.0949  408 ASP A CB    
855  C CG    . ASP A 151 ? 0.5076 0.5405 0.4878 -0.0871 -0.0011 0.1167  408 ASP A CG    
856  O OD1   . ASP A 151 ? 0.5921 0.5933 0.5672 -0.0893 -0.0043 0.1213  408 ASP A OD1   
857  O OD2   . ASP A 151 ? 0.5923 0.6516 0.5871 -0.0973 0.0009  0.1299  408 ASP A OD2   
858  N N     . ASP A 152 ? 0.2866 0.2529 0.2954 -0.0156 0.0204  0.0154  409 ASP A N     
859  C CA    . ASP A 152 ? 0.2840 0.2541 0.3013 -0.0180 0.0147  0.0093  409 ASP A CA    
860  C C     . ASP A 152 ? 0.2633 0.2266 0.2719 -0.0144 0.0110  0.0084  409 ASP A C     
861  O O     . ASP A 152 ? 0.2516 0.2074 0.2502 -0.0105 0.0124  0.0122  409 ASP A O     
862  C CB    . ASP A 152 ? 0.3104 0.2806 0.3443 -0.0243 0.0171  0.0067  409 ASP A CB    
863  C CG    . ASP A 152 ? 0.3605 0.3167 0.3951 -0.0267 0.0233  0.0103  409 ASP A CG    
864  O OD1   . ASP A 152 ? 0.3821 0.3275 0.4019 -0.0223 0.0252  0.0152  409 ASP A OD1   
865  O OD2   . ASP A 152 ? 0.3844 0.3397 0.4354 -0.0329 0.0260  0.0077  409 ASP A OD2   
866  N N     . VAL A 153 ? 0.2500 0.2165 0.2616 -0.0146 0.0057  0.0027  410 VAL A N     
867  C CA    . VAL A 153 ? 0.2318 0.1936 0.2368 -0.0109 0.0029  0.0010  410 VAL A CA    
868  C C     . VAL A 153 ? 0.2312 0.1800 0.2340 -0.0103 0.0052  0.0034  410 VAL A C     
869  O O     . VAL A 153 ? 0.2365 0.1808 0.2316 -0.0052 0.0042  0.0046  410 VAL A O     
870  C CB    . VAL A 153 ? 0.2321 0.1968 0.2389 -0.0107 -0.0019 -0.0056 410 VAL A CB    
871  C CG1   . VAL A 153 ? 0.2262 0.1846 0.2277 -0.0070 -0.0033 -0.0077 410 VAL A CG1   
872  C CG2   . VAL A 153 ? 0.2164 0.1904 0.2200 -0.0091 -0.0036 -0.0068 410 VAL A CG2   
873  N N     . ALA A 154 ? 0.2420 0.1846 0.2529 -0.0152 0.0081  0.0034  411 ALA A N     
874  C CA    . ALA A 154 ? 0.2492 0.1765 0.2576 -0.0151 0.0113  0.0062  411 ALA A CA    
875  C C     . ALA A 154 ? 0.2704 0.1890 0.2657 -0.0103 0.0159  0.0139  411 ALA A C     
876  O O     . ALA A 154 ? 0.2755 0.1820 0.2615 -0.0053 0.0154  0.0158  411 ALA A O     
877  C CB    . ALA A 154 ? 0.2460 0.1685 0.2686 -0.0226 0.0152  0.0050  411 ALA A CB    
878  N N     . ALA A 155 ? 0.2753 0.1984 0.2687 -0.0108 0.0201  0.0182  412 ALA A N     
879  C CA    . ALA A 155 ? 0.2949 0.2096 0.2725 -0.0045 0.0232  0.0247  412 ALA A CA    
880  C C     . ALA A 155 ? 0.2777 0.1963 0.2460 0.0034  0.0152  0.0224  412 ALA A C     
881  O O     . ALA A 155 ? 0.3212 0.2287 0.2767 0.0106  0.0142  0.0252  412 ALA A O     
882  C CB    . ALA A 155 ? 0.2780 0.1977 0.2545 -0.0057 0.0287  0.0285  412 ALA A CB    
883  N N     . ALA A 156 ? 0.2610 0.1944 0.2360 0.0026  0.0100  0.0171  413 ALA A N     
884  C CA    . ALA A 156 ? 0.2536 0.1922 0.2256 0.0086  0.0037  0.0138  413 ALA A CA    
885  C C     . ALA A 156 ? 0.2637 0.1957 0.2353 0.0121  0.0011  0.0114  413 ALA A C     
886  O O     . ALA A 156 ? 0.2697 0.1984 0.2352 0.0195  -0.0028 0.0111  413 ALA A O     
887  C CB    . ALA A 156 ? 0.2358 0.1895 0.2159 0.0060  0.0013  0.0093  413 ALA A CB    
888  N N     . ALA A 157 ? 0.2479 0.1781 0.2261 0.0076  0.0021  0.0088  414 ALA A N     
889  C CA    . ALA A 157 ? 0.2605 0.1842 0.2387 0.0107  -0.0001 0.0058  414 ALA A CA    
890  C C     . ALA A 157 ? 0.2899 0.1961 0.2583 0.0155  0.0011  0.0102  414 ALA A C     
891  O O     . ALA A 157 ? 0.2845 0.1866 0.2488 0.0226  -0.0026 0.0085  414 ALA A O     
892  C CB    . ALA A 157 ? 0.2600 0.1835 0.2459 0.0048  0.0003  0.0016  414 ALA A CB    
893  N N     . LYS A 158 ? 0.3164 0.2120 0.2801 0.0127  0.0068  0.0163  415 LYS A N     
894  C CA    . LYS A 158 ? 0.3623 0.2375 0.3128 0.0179  0.0097  0.0221  415 LYS A CA    
895  C C     . LYS A 158 ? 0.3812 0.2543 0.3175 0.0294  0.0044  0.0236  415 LYS A C     
896  O O     . LYS A 158 ? 0.3897 0.2482 0.3151 0.0374  0.0024  0.0253  415 LYS A O     
897  C CB    . LYS A 158 ? 0.4038 0.2687 0.3528 0.0120  0.0194  0.0288  415 LYS A CB    
898  C CG    . LYS A 158 ? 0.4926 0.3328 0.4324 0.0134  0.0258  0.0347  415 LYS A CG    
899  C CD    . LYS A 158 ? 0.5480 0.3812 0.4944 0.0043  0.0376  0.0400  415 LYS A CD    
900  C CE    . LYS A 158 ? 0.6113 0.4183 0.5522 0.0035  0.0457  0.0454  415 LYS A CE    
901  N NZ    . LYS A 158 ? 0.6754 0.4724 0.6168 -0.0024 0.0601  0.0534  415 LYS A NZ    
902  N N     . MET A 159 ? 0.3866 0.2747 0.3244 0.0309  0.0007  0.0216  416 MET A N     
903  C CA    . MET A 159 ? 0.4085 0.2974 0.3369 0.0416  -0.0064 0.0205  416 MET A CA    
904  C C     . MET A 159 ? 0.3937 0.2860 0.3273 0.0482  -0.0138 0.0144  416 MET A C     
905  O O     . MET A 159 ? 0.3970 0.2854 0.3222 0.0589  -0.0205 0.0133  416 MET A O     
906  C CB    . MET A 159 ? 0.4062 0.3122 0.3400 0.0406  -0.0097 0.0174  416 MET A CB    
907  C CG    . MET A 159 ? 0.4424 0.3470 0.3701 0.0366  -0.0038 0.0225  416 MET A CG    
908  S SD    . MET A 159 ? 0.4785 0.4041 0.4161 0.0343  -0.0083 0.0171  416 MET A SD    
909  C CE    . MET A 159 ? 0.5051 0.4301 0.4328 0.0466  -0.0186 0.0137  416 MET A CE    
910  N N     . LYS A 160 ? 0.3608 0.2609 0.3081 0.0429  -0.0130 0.0098  417 LYS A N     
911  C CA    . LYS A 160 ? 0.3496 0.2527 0.3028 0.0490  -0.0179 0.0040  417 LYS A CA    
912  C C     . LYS A 160 ? 0.3469 0.2354 0.2979 0.0479  -0.0149 0.0046  417 LYS A C     
913  O O     . LYS A 160 ? 0.3345 0.2283 0.2937 0.0489  -0.0164 -0.0010 417 LYS A O     
914  C CB    . LYS A 160 ? 0.3514 0.2760 0.3216 0.0452  -0.0187 -0.0027 417 LYS A CB    
915  C CG    . LYS A 160 ? 0.3669 0.3059 0.3424 0.0451  -0.0215 -0.0042 417 LYS A CG    
916  C CD    . LYS A 160 ? 0.3896 0.3306 0.3646 0.0557  -0.0297 -0.0075 417 LYS A CD    
917  C CE    . LYS A 160 ? 0.4015 0.3541 0.3808 0.0558  -0.0336 -0.0096 417 LYS A CE    
918  N NZ    . LYS A 160 ? 0.4202 0.3748 0.4004 0.0673  -0.0438 -0.0147 417 LYS A NZ    
919  N N     . GLN A 161 ? 0.3612 0.2309 0.3017 0.0456  -0.0100 0.0110  418 GLN A N     
920  C CA    . GLN A 161 ? 0.3703 0.2226 0.3085 0.0447  -0.0073 0.0116  418 GLN A CA    
921  C C     . GLN A 161 ? 0.3478 0.2082 0.3001 0.0370  -0.0064 0.0052  418 GLN A C     
922  O O     . GLN A 161 ? 0.3647 0.2164 0.3174 0.0392  -0.0077 0.0018  418 GLN A O     
923  C CB    . GLN A 161 ? 0.4252 0.2656 0.3538 0.0573  -0.0126 0.0109  418 GLN A CB    
924  C CG    . GLN A 161 ? 0.4541 0.2841 0.3652 0.0680  -0.0157 0.0161  418 GLN A CG    
925  C CD    . GLN A 161 ? 0.5188 0.3298 0.4147 0.0648  -0.0074 0.0261  418 GLN A CD    
926  O OE1   . GLN A 161 ? 0.5742 0.3608 0.4599 0.0647  -0.0014 0.0318  418 GLN A OE1   
927  N NE2   . GLN A 161 ? 0.5171 0.3375 0.4108 0.0627  -0.0062 0.0285  418 GLN A NE2   
928  N N     . TYR A 162 ? 0.3250 0.2010 0.2866 0.0291  -0.0050 0.0034  419 TYR A N     
929  C CA    . TYR A 162 ? 0.3075 0.1908 0.2791 0.0225  -0.0048 -0.0025 419 TYR A CA    
930  C C     . TYR A 162 ? 0.3111 0.1891 0.2871 0.0131  -0.0004 0.0002  419 TYR A C     
931  O O     . TYR A 162 ? 0.2953 0.1801 0.2727 0.0090  0.0025  0.0042  419 TYR A O     
932  C CB    . TYR A 162 ? 0.2874 0.1913 0.2649 0.0221  -0.0064 -0.0061 419 TYR A CB    
933  C CG    . TYR A 162 ? 0.2728 0.1830 0.2556 0.0184  -0.0068 -0.0122 419 TYR A CG    
934  C CD1   . TYR A 162 ? 0.2618 0.1718 0.2487 0.0108  -0.0061 -0.0131 419 TYR A CD1   
935  C CD2   . TYR A 162 ? 0.2669 0.1826 0.2502 0.0235  -0.0079 -0.0177 419 TYR A CD2   
936  C CE1   . TYR A 162 ? 0.2648 0.1785 0.2534 0.0095  -0.0083 -0.0197 419 TYR A CE1   
937  C CE2   . TYR A 162 ? 0.2667 0.1851 0.2501 0.0219  -0.0080 -0.0231 419 TYR A CE2   
938  C CZ    . TYR A 162 ? 0.2665 0.1834 0.2511 0.0155  -0.0091 -0.0243 419 TYR A CZ    
939  O OH    . TYR A 162 ? 0.2908 0.2090 0.2724 0.0161  -0.0109 -0.0305 419 TYR A OH    
940  N N     . GLU A 163 ? 0.3158 0.1816 0.2954 0.0097  0.0001  -0.0025 420 GLU A N     
941  C CA    . GLU A 163 ? 0.3425 0.2024 0.3309 0.0003  0.0043  -0.0014 420 GLU A CA    
942  C C     . GLU A 163 ? 0.3370 0.2012 0.3372 -0.0052 0.0002  -0.0106 420 GLU A C     
943  O O     . GLU A 163 ? 0.3399 0.1979 0.3514 -0.0130 0.0024  -0.0119 420 GLU A O     
944  C CB    . GLU A 163 ? 0.3904 0.2270 0.3734 0.0003  0.0100  0.0047  420 GLU A CB    
945  C CG    . GLU A 163 ? 0.4345 0.2663 0.4040 0.0055  0.0143  0.0140  420 GLU A CG    
946  C CD    . GLU A 163 ? 0.5040 0.3108 0.4646 0.0057  0.0224  0.0222  420 GLU A CD    
947  O OE1   . GLU A 163 ? 0.5763 0.3679 0.5437 0.0003  0.0259  0.0211  420 GLU A OE1   
948  O OE2   . GLU A 163 ? 0.5430 0.3438 0.4881 0.0122  0.0253  0.0297  420 GLU A OE2   
949  N N     . ALA A 164 ? 0.3151 0.1897 0.3132 -0.0010 -0.0054 -0.0172 421 ALA A N     
950  C CA    . ALA A 164 ? 0.3234 0.2000 0.3280 -0.0038 -0.0107 -0.0267 421 ALA A CA    
951  C C     . ALA A 164 ? 0.3107 0.2031 0.3221 -0.0082 -0.0126 -0.0290 421 ALA A C     
952  O O     . ALA A 164 ? 0.3008 0.2010 0.3088 -0.0053 -0.0177 -0.0354 421 ALA A O     
953  C CB    . ALA A 164 ? 0.3103 0.1864 0.3056 0.0045  -0.0147 -0.0327 421 ALA A CB    
954  N N     . VAL A 165 ? 0.3096 0.2058 0.3284 -0.0139 -0.0081 -0.0233 422 VAL A N     
955  C CA    . VAL A 165 ? 0.2911 0.2024 0.3170 -0.0176 -0.0092 -0.0242 422 VAL A CA    
956  C C     . VAL A 165 ? 0.2994 0.2084 0.3386 -0.0255 -0.0029 -0.0198 422 VAL A C     
957  O O     . VAL A 165 ? 0.3028 0.2017 0.3379 -0.0257 0.0042  -0.0121 422 VAL A O     
958  C CB    . VAL A 165 ? 0.2792 0.2030 0.2951 -0.0129 -0.0084 -0.0202 422 VAL A CB    
959  C CG1   . VAL A 165 ? 0.2648 0.1862 0.2748 -0.0111 -0.0026 -0.0114 422 VAL A CG1   
960  C CG2   . VAL A 165 ? 0.2670 0.2040 0.2886 -0.0155 -0.0105 -0.0222 422 VAL A CG2   
961  N N     . ARG A 166 ? 0.2963 0.2133 0.3515 -0.0314 -0.0053 -0.0250 423 ARG A N     
962  C CA    . ARG A 166 ? 0.3106 0.2273 0.3817 -0.0391 0.0020  -0.0216 423 ARG A CA    
963  C C     . ARG A 166 ? 0.2840 0.2129 0.3532 -0.0387 0.0067  -0.0153 423 ARG A C     
964  O O     . ARG A 166 ? 0.2646 0.2055 0.3270 -0.0344 0.0015  -0.0171 423 ARG A O     
965  C CB    . ARG A 166 ? 0.3311 0.2527 0.4254 -0.0457 -0.0032 -0.0318 423 ARG A CB    
966  C CG    . ARG A 166 ? 0.3822 0.2903 0.4805 -0.0469 -0.0083 -0.0393 423 ARG A CG    
967  C CD    . ARG A 166 ? 0.4169 0.3341 0.5341 -0.0500 -0.0189 -0.0527 423 ARG A CD    
968  N NE    . ARG A 166 ? 0.4648 0.3843 0.6108 -0.0604 -0.0138 -0.0545 423 ARG A NE    
969  C CZ    . ARG A 166 ? 0.5129 0.4452 0.6832 -0.0646 -0.0215 -0.0655 423 ARG A CZ    
970  N NH1   . ARG A 166 ? 0.5023 0.4456 0.6681 -0.0581 -0.0358 -0.0757 423 ARG A NH1   
971  N NH2   . ARG A 166 ? 0.5104 0.4440 0.7101 -0.0751 -0.0140 -0.0663 423 ARG A NH2   
972  N N     . PRO A 167 ? 0.2904 0.2148 0.3650 -0.0429 0.0172  -0.0079 424 PRO A N     
973  C CA    . PRO A 167 ? 0.2785 0.2149 0.3543 -0.0430 0.0217  -0.0036 424 PRO A CA    
974  C C     . PRO A 167 ? 0.2780 0.2310 0.3734 -0.0466 0.0159  -0.0120 424 PRO A C     
975  O O     . PRO A 167 ? 0.2737 0.2274 0.3897 -0.0526 0.0135  -0.0194 424 PRO A O     
976  C CB    . PRO A 167 ? 0.2997 0.2250 0.3786 -0.0470 0.0355  0.0050  424 PRO A CB    
977  C CG    . PRO A 167 ? 0.3273 0.2321 0.4006 -0.0474 0.0383  0.0072  424 PRO A CG    
978  C CD    . PRO A 167 ? 0.3184 0.2244 0.3956 -0.0468 0.0265  -0.0028 424 PRO A CD    
979  N N     . ASP A 168 ? 0.2710 0.2369 0.3608 -0.0427 0.0132  -0.0116 425 ASP A N     
980  C CA    . ASP A 168 ? 0.2837 0.2653 0.3893 -0.0441 0.0076  -0.0186 425 ASP A CA    
981  C C     . ASP A 168 ? 0.3031 0.2895 0.4369 -0.0524 0.0141  -0.0208 425 ASP A C     
982  O O     . ASP A 168 ? 0.2956 0.2914 0.4505 -0.0554 0.0067  -0.0309 425 ASP A O     
983  C CB    . ASP A 168 ? 0.2838 0.2748 0.3778 -0.0388 0.0076  -0.0149 425 ASP A CB    
984  C CG    . ASP A 168 ? 0.2972 0.2876 0.3708 -0.0317 -0.0002 -0.0159 425 ASP A CG    
985  O OD1   . ASP A 168 ? 0.3059 0.2918 0.3759 -0.0302 -0.0067 -0.0211 425 ASP A OD1   
986  O OD2   . ASP A 168 ? 0.3326 0.3261 0.3938 -0.0276 0.0011  -0.0114 425 ASP A OD2   
987  N N     . GLU A 169 ? 0.3364 0.3156 0.4708 -0.0557 0.0280  -0.0117 426 GLU A N     
988  C CA    . GLU A 169 ? 0.3619 0.3441 0.5239 -0.0642 0.0379  -0.0123 426 GLU A CA    
989  C C     . GLU A 169 ? 0.3618 0.3379 0.5458 -0.0719 0.0359  -0.0198 426 GLU A C     
990  O O     . GLU A 169 ? 0.3367 0.3228 0.5526 -0.0792 0.0372  -0.0268 426 GLU A O     
991  C CB    . GLU A 169 ? 0.4334 0.4038 0.5851 -0.0649 0.0550  0.0004  426 GLU A CB    
992  C CG    . GLU A 169 ? 0.4883 0.4625 0.6682 -0.0735 0.0690  0.0013  426 GLU A CG    
993  C CD    . GLU A 169 ? 0.5412 0.5024 0.7049 -0.0718 0.0871  0.0148  426 GLU A CD    
994  O OE1   . GLU A 169 ? 0.6013 0.5625 0.7393 -0.0632 0.0863  0.0205  426 GLU A OE1   
995  O OE2   . GLU A 169 ? 0.5874 0.5373 0.7636 -0.0787 0.1021  0.0195  426 GLU A OE2   
996  N N     . ALA A 170 ? 0.3463 0.3063 0.5152 -0.0702 0.0326  -0.0191 427 ALA A N     
997  C CA    . ALA A 170 ? 0.3418 0.2943 0.5291 -0.0765 0.0289  -0.0273 427 ALA A CA    
998  C C     . ALA A 170 ? 0.3279 0.2949 0.5302 -0.0757 0.0118  -0.0425 427 ALA A C     
999  O O     . ALA A 170 ? 0.3367 0.3042 0.5645 -0.0823 0.0083  -0.0518 427 ALA A O     
1000 C CB    . ALA A 170 ? 0.3526 0.2836 0.5185 -0.0735 0.0290  -0.0232 427 ALA A CB    
1001 N N     . VAL A 171 ? 0.3056 0.2827 0.4910 -0.0670 0.0010  -0.0451 428 VAL A N     
1002 C CA    . VAL A 171 ? 0.2993 0.2861 0.4910 -0.0635 -0.0159 -0.0588 428 VAL A CA    
1003 C C     . VAL A 171 ? 0.2923 0.2993 0.5077 -0.0649 -0.0194 -0.0652 428 VAL A C     
1004 O O     . VAL A 171 ? 0.2711 0.2866 0.5099 -0.0669 -0.0301 -0.0784 428 VAL A O     
1005 C CB    . VAL A 171 ? 0.2920 0.2771 0.4502 -0.0522 -0.0241 -0.0573 428 VAL A CB    
1006 C CG1   . VAL A 171 ? 0.2874 0.2809 0.4451 -0.0459 -0.0406 -0.0700 428 VAL A CG1   
1007 C CG2   . VAL A 171 ? 0.2897 0.2570 0.4268 -0.0498 -0.0215 -0.0526 428 VAL A CG2   
1008 N N     . TYR A 172 ? 0.2732 0.2882 0.4824 -0.0628 -0.0116 -0.0567 429 TYR A N     
1009 C CA    . TYR A 172 ? 0.2889 0.3236 0.5180 -0.0623 -0.0148 -0.0621 429 TYR A CA    
1010 C C     . TYR A 172 ? 0.3027 0.3453 0.5666 -0.0723 -0.0022 -0.0616 429 TYR A C     
1011 O O     . TYR A 172 ? 0.2966 0.3574 0.5860 -0.0730 -0.0062 -0.0694 429 TYR A O     
1012 C CB    . TYR A 172 ? 0.2776 0.3170 0.4822 -0.0540 -0.0138 -0.0544 429 TYR A CB    
1013 C CG    . TYR A 172 ? 0.2859 0.3189 0.4595 -0.0445 -0.0248 -0.0553 429 TYR A CG    
1014 C CD1   . TYR A 172 ? 0.2990 0.3356 0.4730 -0.0393 -0.0407 -0.0672 429 TYR A CD1   
1015 C CD2   . TYR A 172 ? 0.2846 0.3070 0.4287 -0.0405 -0.0192 -0.0449 429 TYR A CD2   
1016 C CE1   . TYR A 172 ? 0.3094 0.3383 0.4536 -0.0303 -0.0486 -0.0674 429 TYR A CE1   
1017 C CE2   . TYR A 172 ? 0.2775 0.2947 0.3966 -0.0326 -0.0272 -0.0457 429 TYR A CE2   
1018 C CZ    . TYR A 172 ? 0.2935 0.3130 0.4117 -0.0276 -0.0407 -0.0563 429 TYR A CZ    
1019 O OH    . TYR A 172 ? 0.2832 0.2957 0.3752 -0.0194 -0.0467 -0.0568 429 TYR A OH    
1020 N N     . GLY A 173 ? 0.3160 0.3446 0.5818 -0.0795 0.0133  -0.0528 430 GLY A N     
1021 C CA    . GLY A 173 ? 0.3302 0.3639 0.6272 -0.0891 0.0292  -0.0503 430 GLY A CA    
1022 C C     . GLY A 173 ? 0.3500 0.3886 0.6341 -0.0852 0.0412  -0.0393 430 GLY A C     
1023 O O     . GLY A 173 ? 0.3004 0.3385 0.5546 -0.0760 0.0358  -0.0348 430 GLY A O     
1024 N N     . LYS A 174 ? 0.4221 0.4644 0.7287 -0.0921 0.0582  -0.0350 431 LYS A N     
1025 C CA    . LYS A 174 ? 0.4636 0.5094 0.7577 -0.0878 0.0709  -0.0249 431 LYS A CA    
1026 C C     . LYS A 174 ? 0.4560 0.5242 0.7872 -0.0914 0.0759  -0.0312 431 LYS A C     
1027 O O     . LYS A 174 ? 0.4197 0.4961 0.7902 -0.1006 0.0781  -0.0396 431 LYS A O     
1028 C CB    . LYS A 174 ? 0.5325 0.5566 0.8093 -0.0902 0.0915  -0.0101 431 LYS A CB    
1029 C CG    . LYS A 174 ? 0.6025 0.6263 0.8569 -0.0832 0.1025  0.0005  431 LYS A CG    
1030 C CD    . LYS A 174 ? 0.6804 0.6782 0.9019 -0.0805 0.1167  0.0151  431 LYS A CD    
1031 C CE    . LYS A 174 ? 0.7320 0.7154 0.9711 -0.0903 0.1355  0.0201  431 LYS A CE    
1032 N NZ    . LYS A 174 ? 0.8067 0.7616 1.0093 -0.0857 0.1480  0.0344  431 LYS A NZ    
1033 N N     . GLY A 175 ? 0.4651 0.5432 0.7845 -0.0838 0.0773  -0.0277 432 GLY A N     
1034 C CA    . GLY A 175 ? 0.4891 0.5879 0.8394 -0.0852 0.0845  -0.0318 432 GLY A CA    
1035 C C     . GLY A 175 ? 0.4943 0.6167 0.8836 -0.0869 0.0688  -0.0489 432 GLY A C     
1036 O O     . GLY A 175 ? 0.4799 0.6070 0.8588 -0.0800 0.0480  -0.0571 432 GLY A O     
1037 N N     . ALA A 176 ? 0.4898 0.6268 0.9243 -0.0954 0.0793  -0.0546 433 ALA A N     
1038 C CA    . ALA A 176 ? 0.4877 0.6484 0.9656 -0.0976 0.0641  -0.0727 433 ALA A CA    
1039 C C     . ALA A 176 ? 0.4842 0.6384 0.9624 -0.0992 0.0444  -0.0832 433 ALA A C     
1040 O O     . ALA A 176 ? 0.5262 0.6945 1.0146 -0.0934 0.0230  -0.0972 433 ALA A O     
1041 C CB    . ALA A 176 ? 0.4453 0.6206 0.9766 -0.1093 0.0814  -0.0769 433 ALA A CB    
1042 N N     . LYS A 177 ? 0.4762 0.6076 0.9398 -0.1054 0.0511  -0.0763 434 LYS A N     
1043 C CA    . LYS A 177 ? 0.4567 0.5798 0.9209 -0.1073 0.0344  -0.0861 434 LYS A CA    
1044 C C     . LYS A 177 ? 0.4416 0.5544 0.8600 -0.0952 0.0162  -0.0854 434 LYS A C     
1045 O O     . LYS A 177 ? 0.4170 0.5225 0.8312 -0.0947 0.0019  -0.0936 434 LYS A O     
1046 C CB    . LYS A 177 ? 0.4825 0.5845 0.9519 -0.1188 0.0500  -0.0794 434 LYS A CB    
1047 C CG    . LYS A 177 ? 0.5210 0.6341 1.0454 -0.1324 0.0639  -0.0853 434 LYS A CG    
1048 C CD    . LYS A 177 ? 0.5672 0.6573 1.0923 -0.1432 0.0889  -0.0724 434 LYS A CD    
1049 C CE    . LYS A 177 ? 0.5874 0.6909 1.1623 -0.1547 0.1096  -0.0736 434 LYS A CE    
1050 N NZ    . LYS A 177 ? 0.6555 0.7343 1.2355 -0.1664 0.1343  -0.0624 434 LYS A NZ    
1051 N N     . ARG A 178 ? 0.4111 0.5233 0.7965 -0.0856 0.0176  -0.0761 435 ARG A N     
1052 C CA    . ARG A 178 ? 0.4170 0.5192 0.7596 -0.0748 0.0042  -0.0736 435 ARG A CA    
1053 C C     . ARG A 178 ? 0.4022 0.5154 0.7517 -0.0681 -0.0193 -0.0894 435 ARG A C     
1054 O O     . ARG A 178 ? 0.3929 0.5260 0.7686 -0.0659 -0.0266 -0.0994 435 ARG A O     
1055 C CB    . ARG A 178 ? 0.4315 0.5346 0.7472 -0.0670 0.0108  -0.0626 435 ARG A CB    
1056 C CG    . ARG A 178 ? 0.4606 0.5488 0.7312 -0.0587 0.0055  -0.0550 435 ARG A CG    
1057 C CD    . ARG A 178 ? 0.4791 0.5694 0.7298 -0.0522 0.0124  -0.0459 435 ARG A CD    
1058 N NE    . ARG A 178 ? 0.4757 0.5565 0.6891 -0.0434 0.0039  -0.0420 435 ARG A NE    
1059 C CZ    . ARG A 178 ? 0.4689 0.5330 0.6570 -0.0433 0.0069  -0.0345 435 ARG A CZ    
1060 N NH1   . ARG A 178 ? 0.5593 0.6128 0.7518 -0.0503 0.0174  -0.0296 435 ARG A NH1   
1061 N NH2   . ARG A 178 ? 0.4859 0.5434 0.6452 -0.0360 0.0000  -0.0320 435 ARG A NH2   
1062 N N     . ALA A 179 ? 0.3629 0.4629 0.6897 -0.0642 -0.0312 -0.0924 436 ALA A N     
1063 C CA    . ALA A 179 ? 0.3429 0.4492 0.6706 -0.0564 -0.0538 -0.1074 436 ALA A CA    
1064 C C     . ALA A 179 ? 0.3393 0.4271 0.6270 -0.0492 -0.0622 -0.1053 436 ALA A C     
1065 O O     . ALA A 179 ? 0.3185 0.3900 0.5913 -0.0536 -0.0529 -0.0968 436 ALA A O     
1066 C CB    . ALA A 179 ? 0.3264 0.4426 0.6982 -0.0641 -0.0613 -0.1232 436 ALA A CB    
1067 N N     . VAL A 180 ? 0.3481 0.4379 0.6173 -0.0373 -0.0791 -0.1125 437 VAL A N     
1068 C CA    . VAL A 180 ? 0.3609 0.4339 0.5933 -0.0293 -0.0875 -0.1122 437 VAL A CA    
1069 C C     . VAL A 180 ? 0.3524 0.4212 0.6018 -0.0329 -0.0978 -0.1255 437 VAL A C     
1070 O O     . VAL A 180 ? 0.3389 0.4206 0.6176 -0.0334 -0.1093 -0.1395 437 VAL A O     
1071 C CB    . VAL A 180 ? 0.3735 0.4480 0.5802 -0.0145 -0.1015 -0.1161 437 VAL A CB    
1072 C CG1   . VAL A 180 ? 0.3672 0.4232 0.5348 -0.0063 -0.1067 -0.1143 437 VAL A CG1   
1073 C CG2   . VAL A 180 ? 0.3438 0.4238 0.5396 -0.0114 -0.0925 -0.1050 437 VAL A CG2   
1074 N N     . PRO A 181 ? 0.3423 0.3935 0.5753 -0.0353 -0.0941 -0.1218 438 PRO A N     
1075 C CA    . PRO A 181 ? 0.3559 0.4017 0.6043 -0.0382 -0.1048 -0.1355 438 PRO A CA    
1076 C C     . PRO A 181 ? 0.3723 0.4128 0.5968 -0.0246 -0.1249 -0.1471 438 PRO A C     
1077 O O     . PRO A 181 ? 0.3744 0.4141 0.5693 -0.0132 -0.1288 -0.1433 438 PRO A O     
1078 C CB    . PRO A 181 ? 0.3574 0.3853 0.5964 -0.0454 -0.0914 -0.1258 438 PRO A CB    
1079 C CG    . PRO A 181 ? 0.3446 0.3659 0.5480 -0.0400 -0.0809 -0.1098 438 PRO A CG    
1080 C CD    . PRO A 181 ? 0.3307 0.3674 0.5369 -0.0369 -0.0790 -0.1059 438 PRO A CD    
1081 N N     . ASP A 182 ? 0.4117 0.4471 0.6488 -0.0257 -0.1368 -0.1612 439 ASP A N     
1082 C CA    . ASP A 182 ? 0.4447 0.4723 0.6584 -0.0122 -0.1565 -0.1740 439 ASP A CA    
1083 C C     . ASP A 182 ? 0.4303 0.4402 0.5949 -0.0026 -0.1514 -0.1632 439 ASP A C     
1084 O O     . ASP A 182 ? 0.3805 0.3818 0.5354 -0.0086 -0.1352 -0.1497 439 ASP A O     
1085 C CB    . ASP A 182 ? 0.4914 0.5126 0.7260 -0.0168 -0.1671 -0.1895 439 ASP A CB    
1086 C CG    . ASP A 182 ? 0.5381 0.5774 0.8218 -0.0231 -0.1786 -0.2062 439 ASP A CG    
1087 O OD1   . ASP A 182 ? 0.5575 0.6151 0.8553 -0.0202 -0.1824 -0.2082 439 ASP A OD1   
1088 O OD2   . ASP A 182 ? 0.5975 0.6326 0.9071 -0.0307 -0.1842 -0.2182 439 ASP A OD2   
1089 N N     . GLU A 183 ? 0.4488 0.4529 0.5831 0.0128  -0.1655 -0.1699 440 GLU A N     
1090 C CA    . GLU A 183 ? 0.4697 0.4579 0.5572 0.0230  -0.1596 -0.1597 440 GLU A CA    
1091 C C     . GLU A 183 ? 0.4511 0.4239 0.5272 0.0184  -0.1490 -0.1536 440 GLU A C     
1092 O O     . GLU A 183 ? 0.4344 0.4012 0.4893 0.0187  -0.1347 -0.1393 440 GLU A O     
1093 C CB    . GLU A 183 ? 0.5170 0.4973 0.5737 0.0408  -0.1772 -0.1704 440 GLU A CB    
1094 C CG    . GLU A 183 ? 0.5391 0.5015 0.5476 0.0517  -0.1697 -0.1604 440 GLU A CG    
1095 C CD    . GLU A 183 ? 0.5809 0.5345 0.5546 0.0706  -0.1842 -0.1678 440 GLU A CD    
1096 O OE1   . GLU A 183 ? 0.5632 0.5214 0.5265 0.0765  -0.1834 -0.1620 440 GLU A OE1   
1097 O OE2   . GLU A 183 ? 0.6015 0.5419 0.5569 0.0803  -0.1961 -0.1793 440 GLU A OE2   
1098 N N     . PRO A 184 ? 0.4572 0.4234 0.5484 0.0144  -0.1562 -0.1651 441 PRO A N     
1099 C CA    . PRO A 184 ? 0.4541 0.4047 0.5317 0.0117  -0.1458 -0.1586 441 PRO A CA    
1100 C C     . PRO A 184 ? 0.4136 0.3665 0.5043 -0.0008 -0.1261 -0.1427 441 PRO A C     
1101 O O     . PRO A 184 ? 0.3988 0.3417 0.4681 0.0008  -0.1150 -0.1321 441 PRO A O     
1102 C CB    . PRO A 184 ? 0.4729 0.4169 0.5699 0.0084  -0.1578 -0.1746 441 PRO A CB    
1103 C CG    . PRO A 184 ? 0.5035 0.4552 0.6068 0.0166  -0.1788 -0.1917 441 PRO A CG    
1104 C CD    . PRO A 184 ? 0.4881 0.4580 0.6024 0.0153  -0.1756 -0.1852 441 PRO A CD    
1105 N N     . VAL A 185 ? 0.3841 0.3499 0.5094 -0.0122 -0.1218 -0.1415 442 VAL A N     
1106 C CA    . VAL A 185 ? 0.3531 0.3189 0.4893 -0.0229 -0.1036 -0.1272 442 VAL A CA    
1107 C C     . VAL A 185 ? 0.3339 0.3050 0.4486 -0.0185 -0.0939 -0.1131 442 VAL A C     
1108 O O     . VAL A 185 ? 0.3252 0.2894 0.4256 -0.0197 -0.0812 -0.1006 442 VAL A O     
1109 C CB    . VAL A 185 ? 0.3509 0.3272 0.5300 -0.0362 -0.0999 -0.1302 442 VAL A CB    
1110 C CG1   . VAL A 185 ? 0.3261 0.3021 0.5101 -0.0449 -0.0799 -0.1135 442 VAL A CG1   
1111 C CG2   . VAL A 185 ? 0.3638 0.3318 0.5658 -0.0425 -0.1069 -0.1431 442 VAL A CG2   
1112 N N     . LEU A 186 ? 0.3112 0.2938 0.4231 -0.0125 -0.1010 -0.1159 443 LEU A N     
1113 C CA    . LEU A 186 ? 0.2962 0.2828 0.3884 -0.0081 -0.0930 -0.1039 443 LEU A CA    
1114 C C     . LEU A 186 ? 0.3031 0.2766 0.3596 0.0004  -0.0895 -0.0980 443 LEU A C     
1115 O O     . LEU A 186 ? 0.2754 0.2470 0.3205 -0.0010 -0.0769 -0.0853 443 LEU A O     
1116 C CB    . LEU A 186 ? 0.3004 0.2988 0.3935 -0.0012 -0.1030 -0.1094 443 LEU A CB    
1117 C CG    . LEU A 186 ? 0.2881 0.2880 0.3577 0.0053  -0.0972 -0.0989 443 LEU A CG    
1118 C CD1   . LEU A 186 ? 0.2733 0.2796 0.3554 -0.0040 -0.0817 -0.0864 443 LEU A CD1   
1119 C CD2   . LEU A 186 ? 0.2988 0.3069 0.3668 0.0143  -0.1101 -0.1067 443 LEU A CD2   
1120 N N     . ALA A 187 ? 0.3233 0.2876 0.3629 0.0093  -0.1005 -0.1076 444 ALA A N     
1121 C CA    . ALA A 187 ? 0.3373 0.2895 0.3419 0.0188  -0.0965 -0.1027 444 ALA A CA    
1122 C C     . ALA A 187 ? 0.3397 0.2841 0.3426 0.0137  -0.0846 -0.0950 444 ALA A C     
1123 O O     . ALA A 187 ? 0.3202 0.2622 0.3066 0.0161  -0.0742 -0.0849 444 ALA A O     
1124 C CB    . ALA A 187 ? 0.3709 0.3130 0.3548 0.0308  -0.1101 -0.1150 444 ALA A CB    
1125 N N     . GLU A 188 ? 0.3548 0.2951 0.3763 0.0069  -0.0861 -0.1000 445 GLU A N     
1126 C CA    . GLU A 188 ? 0.3818 0.3135 0.4016 0.0031  -0.0757 -0.0929 445 GLU A CA    
1127 C C     . GLU A 188 ? 0.3350 0.2728 0.3612 -0.0034 -0.0624 -0.0791 445 GLU A C     
1128 O O     . GLU A 188 ? 0.3326 0.2658 0.3461 -0.0013 -0.0541 -0.0713 445 GLU A O     
1129 C CB    . GLU A 188 ? 0.4341 0.3574 0.4724 -0.0030 -0.0798 -0.1008 445 GLU A CB    
1130 C CG    . GLU A 188 ? 0.5061 0.4151 0.5310 -0.0005 -0.0739 -0.0977 445 GLU A CG    
1131 C CD    . GLU A 188 ? 0.5554 0.4579 0.5982 -0.0101 -0.0661 -0.0926 445 GLU A CD    
1132 O OE1   . GLU A 188 ? 0.6291 0.5392 0.6887 -0.0182 -0.0597 -0.0860 445 GLU A OE1   
1133 O OE2   . GLU A 188 ? 0.6199 0.5083 0.6574 -0.0085 -0.0653 -0.0945 445 GLU A OE2   
1134 N N     . HIS A 189 ? 0.3083 0.2567 0.3546 -0.0105 -0.0609 -0.0770 446 HIS A N     
1135 C CA    . HIS A 189 ? 0.2793 0.2337 0.3286 -0.0149 -0.0495 -0.0648 446 HIS A CA    
1136 C C     . HIS A 189 ? 0.2700 0.2274 0.2980 -0.0081 -0.0459 -0.0580 446 HIS A C     
1137 O O     . HIS A 189 ? 0.2692 0.2236 0.2888 -0.0079 -0.0375 -0.0497 446 HIS A O     
1138 C CB    . HIS A 189 ? 0.2690 0.2350 0.3420 -0.0219 -0.0488 -0.0649 446 HIS A CB    
1139 C CG    . HIS A 189 ? 0.2571 0.2266 0.3322 -0.0261 -0.0366 -0.0529 446 HIS A CG    
1140 N ND1   . HIS A 189 ? 0.2526 0.2127 0.3226 -0.0282 -0.0276 -0.0449 446 HIS A ND1   
1141 C CD2   . HIS A 189 ? 0.2485 0.2292 0.3274 -0.0268 -0.0329 -0.0480 446 HIS A CD2   
1142 C CE1   . HIS A 189 ? 0.2505 0.2152 0.3205 -0.0301 -0.0191 -0.0357 446 HIS A CE1   
1143 N NE2   . HIS A 189 ? 0.2444 0.2217 0.3203 -0.0296 -0.0219 -0.0376 446 HIS A NE2   
1144 N N     . LEU A 190 ? 0.2540 0.2158 0.2718 -0.0018 -0.0524 -0.0620 447 LEU A N     
1145 C CA    . LEU A 190 ? 0.2510 0.2139 0.2496 0.0037  -0.0472 -0.0549 447 LEU A CA    
1146 C C     . LEU A 190 ? 0.2450 0.1988 0.2255 0.0087  -0.0423 -0.0524 447 LEU A C     
1147 O O     . LEU A 190 ? 0.2305 0.1859 0.2045 0.0090  -0.0337 -0.0443 447 LEU A O     
1148 C CB    . LEU A 190 ? 0.2628 0.2291 0.2511 0.0105  -0.0541 -0.0585 447 LEU A CB    
1149 C CG    . LEU A 190 ? 0.2522 0.2297 0.2595 0.0071  -0.0597 -0.0619 447 LEU A CG    
1150 C CD1   . LEU A 190 ? 0.2720 0.2513 0.2647 0.0157  -0.0657 -0.0637 447 LEU A CD1   
1151 C CD2   . LEU A 190 ? 0.2387 0.2242 0.2627 -0.0014 -0.0504 -0.0537 447 LEU A CD2   
1152 N N     . VAL A 191 ? 0.2526 0.1975 0.2263 0.0127  -0.0476 -0.0600 448 VAL A N     
1153 C CA    . VAL A 191 ? 0.2662 0.2029 0.2246 0.0179  -0.0423 -0.0585 448 VAL A CA    
1154 C C     . VAL A 191 ? 0.2534 0.1895 0.2219 0.0127  -0.0346 -0.0524 448 VAL A C     
1155 O O     . VAL A 191 ? 0.2481 0.1845 0.2093 0.0153  -0.0271 -0.0470 448 VAL A O     
1156 C CB    . VAL A 191 ? 0.2955 0.2216 0.2430 0.0245  -0.0503 -0.0689 448 VAL A CB    
1157 C CG1   . VAL A 191 ? 0.2977 0.2154 0.2333 0.0292  -0.0438 -0.0678 448 VAL A CG1   
1158 C CG2   . VAL A 191 ? 0.3179 0.2420 0.2474 0.0332  -0.0576 -0.0743 448 VAL A CG2   
1159 N N     . ARG A 192 ? 0.2522 0.1872 0.2380 0.0057  -0.0362 -0.0532 449 ARG A N     
1160 C CA    . ARG A 192 ? 0.2468 0.1790 0.2395 0.0019  -0.0294 -0.0467 449 ARG A CA    
1161 C C     . ARG A 192 ? 0.2305 0.1710 0.2234 0.0004  -0.0224 -0.0373 449 ARG A C     
1162 O O     . ARG A 192 ? 0.2149 0.1543 0.2042 0.0024  -0.0174 -0.0327 449 ARG A O     
1163 C CB    . ARG A 192 ? 0.2508 0.1773 0.2603 -0.0053 -0.0308 -0.0484 449 ARG A CB    
1164 C CG    . ARG A 192 ? 0.2798 0.1942 0.2888 -0.0037 -0.0362 -0.0569 449 ARG A CG    
1165 C CD    . ARG A 192 ? 0.2917 0.1982 0.3191 -0.0117 -0.0364 -0.0587 449 ARG A CD    
1166 N NE    . ARG A 192 ? 0.3109 0.2037 0.3364 -0.0094 -0.0416 -0.0670 449 ARG A NE    
1167 C CZ    . ARG A 192 ? 0.3154 0.1966 0.3314 -0.0052 -0.0384 -0.0650 449 ARG A CZ    
1168 N NH1   . ARG A 192 ? 0.3061 0.1884 0.3145 -0.0025 -0.0307 -0.0554 449 ARG A NH1   
1169 N NH2   . ARG A 192 ? 0.3262 0.1946 0.3406 -0.0028 -0.0441 -0.0740 449 ARG A NH2   
1170 N N     . LYS A 193 ? 0.2318 0.1811 0.2287 -0.0021 -0.0230 -0.0356 450 LYS A N     
1171 C CA    . LYS A 193 ? 0.2193 0.1757 0.2151 -0.0028 -0.0172 -0.0278 450 LYS A CA    
1172 C C     . LYS A 193 ? 0.2317 0.1897 0.2151 0.0027  -0.0139 -0.0260 450 LYS A C     
1173 O O     . LYS A 193 ? 0.2266 0.1870 0.2101 0.0032  -0.0089 -0.0211 450 LYS A O     
1174 C CB    . LYS A 193 ? 0.2252 0.1899 0.2278 -0.0060 -0.0187 -0.0270 450 LYS A CB    
1175 C CG    . LYS A 193 ? 0.2306 0.1957 0.2493 -0.0125 -0.0179 -0.0265 450 LYS A CG    
1176 C CD    . LYS A 193 ? 0.2410 0.2155 0.2675 -0.0155 -0.0157 -0.0231 450 LYS A CD    
1177 C CE    . LYS A 193 ? 0.2577 0.2400 0.2829 -0.0128 -0.0212 -0.0272 450 LYS A CE    
1178 N NZ    . LYS A 193 ? 0.2520 0.2433 0.2899 -0.0163 -0.0191 -0.0252 450 LYS A NZ    
1179 N N     . ALA A 194 ? 0.2448 0.2011 0.2176 0.0073  -0.0164 -0.0304 451 ALA A N     
1180 C CA    . ALA A 194 ? 0.2472 0.2032 0.2082 0.0123  -0.0109 -0.0285 451 ALA A CA    
1181 C C     . ALA A 194 ? 0.2429 0.1956 0.2040 0.0148  -0.0069 -0.0287 451 ALA A C     
1182 O O     . ALA A 194 ? 0.2425 0.1994 0.2048 0.0159  -0.0004 -0.0252 451 ALA A O     
1183 C CB    . ALA A 194 ? 0.2526 0.2036 0.1980 0.0183  -0.0138 -0.0329 451 ALA A CB    
1184 N N     . ALA A 195 ? 0.2463 0.1918 0.2082 0.0157  -0.0109 -0.0335 452 ALA A N     
1185 C CA    . ALA A 195 ? 0.2500 0.1913 0.2119 0.0190  -0.0079 -0.0344 452 ALA A CA    
1186 C C     . ALA A 195 ? 0.2341 0.1795 0.2066 0.0164  -0.0052 -0.0290 452 ALA A C     
1187 O O     . ALA A 195 ? 0.2160 0.1639 0.1901 0.0200  -0.0013 -0.0283 452 ALA A O     
1188 C CB    . ALA A 195 ? 0.2467 0.1775 0.2072 0.0205  -0.0134 -0.0408 452 ALA A CB    
1189 N N     . ALA A 196 ? 0.2364 0.1826 0.2162 0.0110  -0.0074 -0.0258 453 ALA A N     
1190 C CA    . ALA A 196 ? 0.2333 0.1811 0.2190 0.0098  -0.0055 -0.0204 453 ALA A CA    
1191 C C     . ALA A 196 ? 0.2350 0.1930 0.2218 0.0108  -0.0021 -0.0175 453 ALA A C     
1192 O O     . ALA A 196 ? 0.2436 0.2045 0.2338 0.0139  -0.0009 -0.0165 453 ALA A O     
1193 C CB    . ALA A 196 ? 0.2116 0.1568 0.2025 0.0041  -0.0066 -0.0171 453 ALA A CB    
1194 N N     . ILE A 197 ? 0.2255 0.1890 0.2103 0.0087  -0.0012 -0.0169 454 ILE A N     
1195 C CA    . ILE A 197 ? 0.2205 0.1921 0.2070 0.0088  0.0025  -0.0145 454 ILE A CA    
1196 C C     . ILE A 197 ? 0.2210 0.1951 0.2086 0.0129  0.0071  -0.0166 454 ILE A C     
1197 O O     . ILE A 197 ? 0.2252 0.2056 0.2212 0.0137  0.0089  -0.0160 454 ILE A O     
1198 C CB    . ILE A 197 ? 0.2184 0.1924 0.2001 0.0069  0.0030  -0.0136 454 ILE A CB    
1199 C CG1   . ILE A 197 ? 0.2204 0.1954 0.2053 0.0029  -0.0004 -0.0114 454 ILE A CG1   
1200 C CG2   . ILE A 197 ? 0.2173 0.1968 0.2002 0.0071  0.0083  -0.0116 454 ILE A CG2   
1201 C CD1   . ILE A 197 ? 0.2113 0.1869 0.1916 0.0023  -0.0025 -0.0126 454 ILE A CD1   
1202 N N     . TRP A 198 ? 0.2333 0.2024 0.2131 0.0161  0.0087  -0.0200 455 TRP A N     
1203 C CA    . TRP A 198 ? 0.2424 0.2128 0.2226 0.0206  0.0149  -0.0222 455 TRP A CA    
1204 C C     . TRP A 198 ? 0.2520 0.2251 0.2426 0.0232  0.0138  -0.0236 455 TRP A C     
1205 O O     . TRP A 198 ? 0.2570 0.2380 0.2575 0.0252  0.0186  -0.0246 455 TRP A O     
1206 C CB    . TRP A 198 ? 0.2669 0.2283 0.2334 0.0249  0.0151  -0.0261 455 TRP A CB    
1207 C CG    . TRP A 198 ? 0.2862 0.2470 0.2485 0.0305  0.0236  -0.0283 455 TRP A CG    
1208 C CD1   . TRP A 198 ? 0.3328 0.2890 0.2927 0.0361  0.0245  -0.0327 455 TRP A CD1   
1209 C CD2   . TRP A 198 ? 0.2986 0.2618 0.2573 0.0316  0.0342  -0.0260 455 TRP A CD2   
1210 N NE1   . TRP A 198 ? 0.3387 0.2955 0.2940 0.0408  0.0351  -0.0335 455 TRP A NE1   
1211 C CE2   . TRP A 198 ? 0.3293 0.2898 0.2840 0.0379  0.0420  -0.0292 455 TRP A CE2   
1212 C CE3   . TRP A 198 ? 0.3002 0.2660 0.2585 0.0281  0.0387  -0.0217 455 TRP A CE3   
1213 C CZ2   . TRP A 198 ? 0.3358 0.2966 0.2869 0.0403  0.0552  -0.0275 455 TRP A CZ2   
1214 C CZ3   . TRP A 198 ? 0.3173 0.2818 0.2713 0.0302  0.0514  -0.0199 455 TRP A CZ3   
1215 C CH2   . TRP A 198 ? 0.3205 0.2829 0.2718 0.0358  0.0602  -0.0224 455 TRP A CH2   
1216 N N     . ALA A 199 ? 0.2517 0.2179 0.2412 0.0235  0.0077  -0.0242 456 ALA A N     
1217 C CA    . ALA A 199 ? 0.2559 0.2216 0.2522 0.0278  0.0057  -0.0254 456 ALA A CA    
1218 C C     . ALA A 199 ? 0.2544 0.2269 0.2594 0.0272  0.0033  -0.0226 456 ALA A C     
1219 O O     . ALA A 199 ? 0.2570 0.2332 0.2697 0.0321  0.0019  -0.0245 456 ALA A O     
1220 C CB    . ALA A 199 ? 0.2603 0.2129 0.2508 0.0287  0.0007  -0.0261 456 ALA A CB    
1221 N N     . LEU A 200 ? 0.2428 0.2162 0.2461 0.0223  0.0017  -0.0187 457 LEU A N     
1222 C CA    . LEU A 200 ? 0.2450 0.2210 0.2521 0.0230  -0.0021 -0.0163 457 LEU A CA    
1223 C C     . LEU A 200 ? 0.2352 0.2237 0.2524 0.0221  -0.0007 -0.0173 457 LEU A C     
1224 O O     . LEU A 200 ? 0.2322 0.2241 0.2538 0.0244  -0.0052 -0.0174 457 LEU A O     
1225 C CB    . LEU A 200 ? 0.2460 0.2151 0.2455 0.0187  -0.0038 -0.0116 457 LEU A CB    
1226 C CG    . LEU A 200 ? 0.2642 0.2199 0.2573 0.0188  -0.0051 -0.0104 457 LEU A CG    
1227 C CD1   . LEU A 200 ? 0.2736 0.2256 0.2638 0.0128  -0.0042 -0.0067 457 LEU A CD1   
1228 C CD2   . LEU A 200 ? 0.2650 0.2134 0.2554 0.0250  -0.0081 -0.0091 457 LEU A CD2   
1229 N N     . GLU A 201 ? 0.2337 0.2278 0.2540 0.0192  0.0053  -0.0183 458 GLU A N     
1230 C CA    . GLU A 201 ? 0.2392 0.2436 0.2709 0.0171  0.0080  -0.0192 458 GLU A CA    
1231 C C     . GLU A 201 ? 0.2424 0.2557 0.2901 0.0215  0.0052  -0.0239 458 GLU A C     
1232 O O     . GLU A 201 ? 0.2083 0.2270 0.2634 0.0216  0.0004  -0.0250 458 GLU A O     
1233 C CB    . GLU A 201 ? 0.2601 0.2661 0.2917 0.0148  0.0173  -0.0194 458 GLU A CB    
1234 C CG    . GLU A 201 ? 0.2822 0.2966 0.3265 0.0113  0.0218  -0.0199 458 GLU A CG    
1235 C CD    . GLU A 201 ? 0.3348 0.3472 0.3760 0.0093  0.0332  -0.0185 458 GLU A CD    
1236 O OE1   . GLU A 201 ? 0.3735 0.3771 0.3980 0.0107  0.0357  -0.0166 458 GLU A OE1   
1237 O OE2   . GLU A 201 ? 0.3549 0.3738 0.4103 0.0066  0.0399  -0.0196 458 GLU A OE2   
1238 N N     . ARG A 202 ? 0.2523 0.2674 0.3055 0.0258  0.0077  -0.0274 459 ARG A N     
1239 C CA    . ARG A 202 ? 0.2831 0.3089 0.3550 0.0308  0.0050  -0.0331 459 ARG A CA    
1240 C C     . ARG A 202 ? 0.2737 0.2969 0.3434 0.0365  -0.0069 -0.0339 459 ARG A C     
1241 O O     . ARG A 202 ? 0.2488 0.2812 0.3318 0.0382  -0.0122 -0.0379 459 ARG A O     
1242 C CB    . ARG A 202 ? 0.3458 0.3734 0.4231 0.0354  0.0103  -0.0368 459 ARG A CB    
1243 C CG    . ARG A 202 ? 0.4266 0.4662 0.5250 0.0420  0.0063  -0.0437 459 ARG A CG    
1244 C CD    . ARG A 202 ? 0.5467 0.5892 0.6515 0.0464  0.0137  -0.0475 459 ARG A CD    
1245 N NE    . ARG A 202 ? 0.6783 0.7341 0.8063 0.0533  0.0095  -0.0550 459 ARG A NE    
1246 C CZ    . ARG A 202 ? 0.7675 0.8295 0.9072 0.0590  0.0149  -0.0600 459 ARG A CZ    
1247 N NH1   . ARG A 202 ? 0.8341 0.8887 0.9619 0.0589  0.0253  -0.0581 459 ARG A NH1   
1248 N NH2   . ARG A 202 ? 0.7961 0.8721 0.9595 0.0657  0.0092  -0.0678 459 ARG A NH2   
1249 N N     . PRO A 203 ? 0.2805 0.2902 0.3334 0.0398  -0.0109 -0.0305 460 PRO A N     
1250 C CA    . PRO A 203 ? 0.2783 0.2825 0.3252 0.0462  -0.0210 -0.0302 460 PRO A CA    
1251 C C     . PRO A 203 ? 0.2581 0.2624 0.3002 0.0435  -0.0247 -0.0276 460 PRO A C     
1252 O O     . PRO A 203 ? 0.2629 0.2687 0.3062 0.0497  -0.0332 -0.0303 460 PRO A O     
1253 C CB    . PRO A 203 ? 0.2983 0.2848 0.3267 0.0487  -0.0215 -0.0255 460 PRO A CB    
1254 C CG    . PRO A 203 ? 0.3061 0.2901 0.3318 0.0425  -0.0135 -0.0243 460 PRO A CG    
1255 C CD    . PRO A 203 ? 0.3026 0.3010 0.3434 0.0401  -0.0074 -0.0286 460 PRO A CD    
1256 N N     . PHE A 204 ? 0.2287 0.2311 0.2647 0.0355  -0.0192 -0.0232 461 PHE A N     
1257 C CA    . PHE A 204 ? 0.2191 0.2222 0.2514 0.0334  -0.0221 -0.0215 461 PHE A CA    
1258 C C     . PHE A 204 ? 0.2128 0.2304 0.2644 0.0328  -0.0245 -0.0279 461 PHE A C     
1259 O O     . PHE A 204 ? 0.1900 0.2093 0.2427 0.0370  -0.0326 -0.0309 461 PHE A O     
1260 C CB    . PHE A 204 ? 0.2061 0.2042 0.2285 0.0258  -0.0161 -0.0158 461 PHE A CB    
1261 C CG    . PHE A 204 ? 0.2183 0.2029 0.2241 0.0264  -0.0164 -0.0101 461 PHE A CG    
1262 C CD1   . PHE A 204 ? 0.2328 0.2088 0.2333 0.0267  -0.0142 -0.0085 461 PHE A CD1   
1263 C CD2   . PHE A 204 ? 0.2243 0.2043 0.2203 0.0262  -0.0177 -0.0064 461 PHE A CD2   
1264 C CE1   . PHE A 204 ? 0.2430 0.2061 0.2314 0.0262  -0.0131 -0.0034 461 PHE A CE1   
1265 C CE2   . PHE A 204 ? 0.2507 0.2179 0.2331 0.0264  -0.0157 -0.0007 461 PHE A CE2   
1266 C CZ    . PHE A 204 ? 0.2510 0.2100 0.2309 0.0259  -0.0132 0.0008  461 PHE A CZ    
1267 N N     . LEU A 205 ? 0.2167 0.2436 0.2837 0.0282  -0.0172 -0.0307 462 LEU A N     
1268 C CA    . LEU A 205 ? 0.2282 0.2687 0.3176 0.0262  -0.0173 -0.0370 462 LEU A CA    
1269 C C     . LEU A 205 ? 0.2348 0.2839 0.3398 0.0343  -0.0271 -0.0452 462 LEU A C     
1270 O O     . LEU A 205 ? 0.2215 0.2787 0.3401 0.0353  -0.0341 -0.0513 462 LEU A O     
1271 C CB    . LEU A 205 ? 0.2295 0.2762 0.3316 0.0202  -0.0050 -0.0375 462 LEU A CB    
1272 C CG    . LEU A 205 ? 0.2278 0.2679 0.3182 0.0128  0.0034  -0.0313 462 LEU A CG    
1273 C CD1   . LEU A 205 ? 0.2387 0.2815 0.3367 0.0092  0.0164  -0.0311 462 LEU A CD1   
1274 C CD2   . LEU A 205 ? 0.2165 0.2584 0.3111 0.0088  0.0005  -0.0319 462 LEU A CD2   
1275 N N     . ASP A 206 ? 0.2537 0.3010 0.3573 0.0408  -0.0285 -0.0462 463 ASP A N     
1276 C CA    . ASP A 206 ? 0.2697 0.3240 0.3856 0.0508  -0.0395 -0.0541 463 ASP A CA    
1277 C C     . ASP A 206 ? 0.2528 0.2987 0.3529 0.0580  -0.0528 -0.0540 463 ASP A C     
1278 O O     . ASP A 206 ? 0.2266 0.2814 0.3403 0.0631  -0.0629 -0.0621 463 ASP A O     
1279 C CB    . ASP A 206 ? 0.3108 0.3605 0.4224 0.0576  -0.0389 -0.0539 463 ASP A CB    
1280 C CG    . ASP A 206 ? 0.3658 0.4261 0.4962 0.0539  -0.0273 -0.0568 463 ASP A CG    
1281 O OD1   . ASP A 206 ? 0.4275 0.5013 0.5797 0.0475  -0.0207 -0.0605 463 ASP A OD1   
1282 O OD2   . ASP A 206 ? 0.4480 0.5019 0.5705 0.0575  -0.0238 -0.0552 463 ASP A OD2   
1283 N N     . GLU A 207 ? 0.2443 0.2729 0.3159 0.0583  -0.0522 -0.0453 464 GLU A N     
1284 C CA    . GLU A 207 ? 0.2635 0.2821 0.3171 0.0661  -0.0627 -0.0445 464 GLU A CA    
1285 C C     . GLU A 207 ? 0.2357 0.2608 0.2952 0.0623  -0.0660 -0.0478 464 GLU A C     
1286 O O     . GLU A 207 ? 0.2403 0.2665 0.2995 0.0704  -0.0781 -0.0539 464 GLU A O     
1287 C CB    . GLU A 207 ? 0.2935 0.2914 0.3166 0.0669  -0.0589 -0.0339 464 GLU A CB    
1288 C CG    . GLU A 207 ? 0.3419 0.3267 0.3435 0.0785  -0.0691 -0.0330 464 GLU A CG    
1289 C CD    . GLU A 207 ? 0.3955 0.3584 0.3680 0.0796  -0.0634 -0.0221 464 GLU A CD    
1290 O OE1   . GLU A 207 ? 0.4037 0.3624 0.3755 0.0716  -0.0530 -0.0163 464 GLU A OE1   
1291 O OE2   . GLU A 207 ? 0.4604 0.4099 0.4110 0.0889  -0.0691 -0.0198 464 GLU A OE2   
1292 N N     . LEU A 208 ? 0.2169 0.2448 0.2801 0.0510  -0.0561 -0.0441 465 LEU A N     
1293 C CA    . LEU A 208 ? 0.2097 0.2435 0.2809 0.0464  -0.0579 -0.0475 465 LEU A CA    
1294 C C     . LEU A 208 ? 0.2063 0.2559 0.3062 0.0487  -0.0660 -0.0596 465 LEU A C     
1295 O O     . LEU A 208 ? 0.1993 0.2509 0.3019 0.0525  -0.0765 -0.0660 465 LEU A O     
1296 C CB    . LEU A 208 ? 0.1897 0.2250 0.2645 0.0344  -0.0450 -0.0425 465 LEU A CB    
1297 C CG    . LEU A 208 ? 0.1978 0.2194 0.2470 0.0323  -0.0398 -0.0326 465 LEU A CG    
1298 C CD1   . LEU A 208 ? 0.1923 0.2151 0.2444 0.0228  -0.0281 -0.0282 465 LEU A CD1   
1299 C CD2   . LEU A 208 ? 0.2082 0.2237 0.2440 0.0349  -0.0455 -0.0320 465 LEU A CD2   
1300 N N     . ARG A 209 ? 0.2137 0.2748 0.3362 0.0468  -0.0614 -0.0636 466 ARG A N     
1301 C CA    . ARG A 209 ? 0.2286 0.3075 0.3848 0.0480  -0.0677 -0.0761 466 ARG A CA    
1302 C C     . ARG A 209 ? 0.2279 0.3079 0.3831 0.0622  -0.0860 -0.0845 466 ARG A C     
1303 O O     . ARG A 209 ? 0.2091 0.2991 0.3831 0.0649  -0.0972 -0.0954 466 ARG A O     
1304 C CB    . ARG A 209 ? 0.2723 0.3628 0.4521 0.0432  -0.0561 -0.0775 466 ARG A CB    
1305 C CG    . ARG A 209 ? 0.3459 0.4566 0.5649 0.0444  -0.0603 -0.0905 466 ARG A CG    
1306 C CD    . ARG A 209 ? 0.4443 0.5643 0.6881 0.0346  -0.0573 -0.0960 466 ARG A CD    
1307 N NE    . ARG A 209 ? 0.5158 0.6546 0.8002 0.0297  -0.0488 -0.1038 466 ARG A NE    
1308 C CZ    . ARG A 209 ? 0.5590 0.7121 0.8795 0.0235  -0.0489 -0.1137 466 ARG A CZ    
1309 N NH1   . ARG A 209 ? 0.5772 0.7281 0.8985 0.0217  -0.0588 -0.1183 466 ARG A NH1   
1310 N NH2   . ARG A 209 ? 0.5715 0.7412 0.9287 0.0192  -0.0385 -0.1197 466 ARG A NH2   
1311 N N     . ARG A 210 ? 0.2344 0.3030 0.3675 0.0719  -0.0898 -0.0799 467 ARG A N     
1312 C CA    . ARG A 210 ? 0.2771 0.3420 0.4017 0.0878  -0.1075 -0.0865 467 ARG A CA    
1313 C C     . ARG A 210 ? 0.2753 0.3294 0.3782 0.0926  -0.1175 -0.0866 467 ARG A C     
1314 O O     . ARG A 210 ? 0.2779 0.3356 0.3853 0.1029  -0.1337 -0.0969 467 ARG A O     
1315 C CB    . ARG A 210 ? 0.3140 0.3634 0.4137 0.0969  -0.1072 -0.0792 467 ARG A CB    
1316 C CG    . ARG A 210 ? 0.3431 0.4034 0.4642 0.0969  -0.1019 -0.0823 467 ARG A CG    
1317 C CD    . ARG A 210 ? 0.3915 0.4363 0.4903 0.1091  -0.1060 -0.0782 467 ARG A CD    
1318 N NE    . ARG A 210 ? 0.4353 0.4574 0.5001 0.1056  -0.0970 -0.0644 467 ARG A NE    
1319 C CZ    . ARG A 210 ? 0.4418 0.4596 0.5035 0.0962  -0.0828 -0.0569 467 ARG A CZ    
1320 N NH1   . ARG A 210 ? 0.4568 0.4892 0.5428 0.0898  -0.0746 -0.0605 467 ARG A NH1   
1321 N NH2   . ARG A 210 ? 0.4585 0.4566 0.4925 0.0937  -0.0766 -0.0461 467 ARG A NH2   
1322 N N     . ASN A 211 ? 0.2571 0.2988 0.3379 0.0852  -0.1078 -0.0761 468 ASN A N     
1323 C CA    . ASN A 211 ? 0.2733 0.3051 0.3340 0.0887  -0.1145 -0.0758 468 ASN A CA    
1324 C C     . ASN A 211 ? 0.2648 0.3095 0.3491 0.0812  -0.1174 -0.0847 468 ASN A C     
1325 O O     . ASN A 211 ? 0.2586 0.2948 0.3263 0.0837  -0.1224 -0.0848 468 ASN A O     
1326 C CB    . ASN A 211 ? 0.2672 0.2824 0.2989 0.0830  -0.1016 -0.0615 468 ASN A CB    
1327 C CG    . ASN A 211 ? 0.2815 0.2778 0.2829 0.0914  -0.0998 -0.0522 468 ASN A CG    
1328 O OD1   . ASN A 211 ? 0.2957 0.2895 0.2949 0.1018  -0.1076 -0.0553 468 ASN A OD1   
1329 N ND2   . ASN A 211 ? 0.2832 0.2663 0.2633 0.0859  -0.0882 -0.0406 468 ASN A ND2   
1330 N N     . GLU A 212 ? 0.2579 0.3212 0.3798 0.0720  -0.1129 -0.0915 469 GLU A N     
1331 C CA    . GLU A 212 ? 0.2618 0.3347 0.4068 0.0620  -0.1115 -0.0979 469 GLU A CA    
1332 C C     . GLU A 212 ? 0.2397 0.3012 0.3653 0.0531  -0.1004 -0.0878 469 GLU A C     
1333 O O     . GLU A 212 ? 0.2440 0.3041 0.3707 0.0511  -0.1047 -0.0919 469 GLU A O     
1334 C CB    . GLU A 212 ? 0.2947 0.3732 0.4506 0.0709  -0.1311 -0.1126 469 GLU A CB    
1335 C CG    . GLU A 212 ? 0.3484 0.4417 0.5300 0.0792  -0.1422 -0.1242 469 GLU A CG    
1336 C CD    . GLU A 212 ? 0.3951 0.4968 0.5933 0.0886  -0.1639 -0.1415 469 GLU A CD    
1337 O OE1   . GLU A 212 ? 0.4619 0.5580 0.6529 0.0879  -0.1703 -0.1454 469 GLU A OE1   
1338 O OE2   . GLU A 212 ? 0.4730 0.5870 0.6916 0.0972  -0.1751 -0.1520 469 GLU A OE2   
1339 N N     . GLN A 213 ? 0.2190 0.2725 0.3280 0.0486  -0.0871 -0.0754 470 GLN A N     
1340 C CA    . GLN A 213 ? 0.2182 0.2620 0.3098 0.0410  -0.0764 -0.0657 470 GLN A CA    
1341 C C     . GLN A 213 ? 0.2120 0.2607 0.3171 0.0288  -0.0605 -0.0605 470 GLN A C     
1342 O O     . GLN A 213 ? 0.1901 0.2315 0.2818 0.0231  -0.0516 -0.0525 470 GLN A O     
1343 C CB    . GLN A 213 ? 0.2272 0.2554 0.2848 0.0468  -0.0745 -0.0554 470 GLN A CB    
1344 C CG    . GLN A 213 ? 0.2451 0.2627 0.2798 0.0591  -0.0867 -0.0572 470 GLN A CG    
1345 C CD    . GLN A 213 ? 0.2635 0.2648 0.2671 0.0629  -0.0806 -0.0456 470 GLN A CD    
1346 O OE1   . GLN A 213 ? 0.2730 0.2716 0.2740 0.0632  -0.0759 -0.0408 470 GLN A OE1   
1347 N NE2   . GLN A 213 ? 0.2591 0.2490 0.2398 0.0655  -0.0799 -0.0413 470 GLN A NE2   
1348 N N     . ASP A 214 ? 0.2272 0.2882 0.3585 0.0257  -0.0568 -0.0654 471 ASP A N     
1349 C CA    . ASP A 214 ? 0.2509 0.3135 0.3897 0.0158  -0.0404 -0.0595 471 ASP A CA    
1350 C C     . ASP A 214 ? 0.2221 0.2840 0.3692 0.0065  -0.0335 -0.0592 471 ASP A C     
1351 O O     . ASP A 214 ? 0.1990 0.2536 0.3345 0.0009  -0.0223 -0.0510 471 ASP A O     
1352 C CB    . ASP A 214 ? 0.2797 0.3547 0.4434 0.0154  -0.0361 -0.0644 471 ASP A CB    
1353 C CG    . ASP A 214 ? 0.3212 0.4109 0.5171 0.0167  -0.0445 -0.0773 471 ASP A CG    
1354 O OD1   . ASP A 214 ? 0.3643 0.4546 0.5573 0.0255  -0.0607 -0.0840 471 ASP A OD1   
1355 O OD2   . ASP A 214 ? 0.4014 0.5013 0.6257 0.0091  -0.0351 -0.0811 471 ASP A OD2   
1356 N N     . ARG A 215 ? 0.2191 0.2871 0.3852 0.0057  -0.0410 -0.0685 472 ARG A N     
1357 C CA    . ARG A 215 ? 0.2362 0.3005 0.4079 -0.0023 -0.0360 -0.0686 472 ARG A CA    
1358 C C     . ARG A 215 ? 0.2244 0.2750 0.3660 -0.0002 -0.0386 -0.0622 472 ARG A C     
1359 O O     . ARG A 215 ? 0.2146 0.2580 0.3501 -0.0064 -0.0297 -0.0567 472 ARG A O     
1360 C CB    . ARG A 215 ? 0.2673 0.3414 0.4689 -0.0036 -0.0447 -0.0817 472 ARG A CB    
1361 C CG    . ARG A 215 ? 0.2866 0.3765 0.5244 -0.0070 -0.0403 -0.0889 472 ARG A CG    
1362 C CD    . ARG A 215 ? 0.3317 0.4324 0.6032 -0.0089 -0.0501 -0.1035 472 ARG A CD    
1363 N NE    . ARG A 215 ? 0.3595 0.4527 0.6365 -0.0187 -0.0423 -0.1024 472 ARG A NE    
1364 C CZ    . ARG A 215 ? 0.4028 0.5002 0.7047 -0.0222 -0.0499 -0.1139 472 ARG A CZ    
1365 N NH1   . ARG A 215 ? 0.4372 0.5478 0.7622 -0.0163 -0.0668 -0.1287 472 ARG A NH1   
1366 N NH2   . ARG A 215 ? 0.4007 0.4882 0.7049 -0.0313 -0.0410 -0.1113 472 ARG A NH2   
1367 N N     . LEU A 216 ? 0.2076 0.2537 0.3295 0.0092  -0.0500 -0.0625 473 LEU A N     
1368 C CA    . LEU A 216 ? 0.2027 0.2363 0.2953 0.0117  -0.0499 -0.0553 473 LEU A CA    
1369 C C     . LEU A 216 ? 0.1887 0.2164 0.2671 0.0069  -0.0370 -0.0439 473 LEU A C     
1370 O O     . LEU A 216 ? 0.1912 0.2116 0.2576 0.0041  -0.0325 -0.0391 473 LEU A O     
1371 C CB    . LEU A 216 ? 0.2046 0.2326 0.2762 0.0232  -0.0612 -0.0558 473 LEU A CB    
1372 C CG    . LEU A 216 ? 0.2119 0.2271 0.2535 0.0276  -0.0613 -0.0493 473 LEU A CG    
1373 C CD1   . LEU A 216 ? 0.2158 0.2280 0.2580 0.0259  -0.0641 -0.0535 473 LEU A CD1   
1374 C CD2   . LEU A 216 ? 0.2209 0.2290 0.2417 0.0401  -0.0709 -0.0496 473 LEU A CD2   
1375 N N     . LEU A 217 ? 0.1883 0.2184 0.2670 0.0069  -0.0319 -0.0402 474 LEU A N     
1376 C CA    . LEU A 217 ? 0.1877 0.2125 0.2543 0.0030  -0.0214 -0.0314 474 LEU A CA    
1377 C C     . LEU A 217 ? 0.1888 0.2139 0.2658 -0.0048 -0.0113 -0.0302 474 LEU A C     
1378 O O     . LEU A 217 ? 0.2037 0.2216 0.2684 -0.0073 -0.0063 -0.0248 474 LEU A O     
1379 C CB    . LEU A 217 ? 0.1911 0.2174 0.2557 0.0053  -0.0190 -0.0289 474 LEU A CB    
1380 C CG    . LEU A 217 ? 0.1940 0.2154 0.2479 0.0021  -0.0099 -0.0218 474 LEU A CG    
1381 C CD1   . LEU A 217 ? 0.1847 0.1979 0.2185 0.0033  -0.0108 -0.0160 474 LEU A CD1   
1382 C CD2   . LEU A 217 ? 0.2022 0.2257 0.2587 0.0044  -0.0081 -0.0219 474 LEU A CD2   
1383 N N     . VAL A 218 ? 0.1979 0.2307 0.2975 -0.0081 -0.0076 -0.0351 475 VAL A N     
1384 C CA    . VAL A 218 ? 0.2181 0.2493 0.3267 -0.0151 0.0053  -0.0327 475 VAL A CA    
1385 C C     . VAL A 218 ? 0.2131 0.2395 0.3277 -0.0201 0.0074  -0.0341 475 VAL A C     
1386 O O     . VAL A 218 ? 0.2069 0.2245 0.3132 -0.0238 0.0174  -0.0282 475 VAL A O     
1387 C CB    . VAL A 218 ? 0.2241 0.2652 0.3549 -0.0165 0.0111  -0.0368 475 VAL A CB    
1388 C CG1   . VAL A 218 ? 0.2637 0.3019 0.4043 -0.0234 0.0264  -0.0343 475 VAL A CG1   
1389 C CG2   . VAL A 218 ? 0.2453 0.2864 0.3635 -0.0116 0.0117  -0.0332 475 VAL A CG2   
1390 N N     . GLU A 219 ? 0.1963 0.2266 0.3224 -0.0192 -0.0027 -0.0419 476 GLU A N     
1391 C CA    . GLU A 219 ? 0.2183 0.2438 0.3529 -0.0239 -0.0020 -0.0450 476 GLU A CA    
1392 C C     . GLU A 219 ? 0.2307 0.2475 0.3443 -0.0200 -0.0094 -0.0433 476 GLU A C     
1393 O O     . GLU A 219 ? 0.2312 0.2409 0.3468 -0.0235 -0.0077 -0.0443 476 GLU A O     
1394 C CB    . GLU A 219 ? 0.2307 0.2666 0.3972 -0.0263 -0.0081 -0.0569 476 GLU A CB    
1395 C CG    . GLU A 219 ? 0.2540 0.3000 0.4457 -0.0307 0.0015  -0.0590 476 GLU A CG    
1396 C CD    . GLU A 219 ? 0.2834 0.3430 0.5127 -0.0333 -0.0043 -0.0720 476 GLU A CD    
1397 O OE1   . GLU A 219 ? 0.3539 0.4119 0.5968 -0.0369 -0.0089 -0.0788 476 GLU A OE1   
1398 O OE2   . GLU A 219 ? 0.3298 0.4021 0.5775 -0.0318 -0.0042 -0.0764 476 GLU A OE2   
1399 N N     . LEU A 220 ? 0.2181 0.2342 0.3114 -0.0128 -0.0166 -0.0406 477 LEU A N     
1400 C CA    . LEU A 220 ? 0.2309 0.2392 0.3050 -0.0088 -0.0220 -0.0391 477 LEU A CA    
1401 C C     . LEU A 220 ? 0.2215 0.2243 0.2725 -0.0065 -0.0173 -0.0296 477 LEU A C     
1402 O O     . LEU A 220 ? 0.2107 0.2064 0.2525 -0.0081 -0.0126 -0.0254 477 LEU A O     
1403 C CB    . LEU A 220 ? 0.2588 0.2692 0.3304 -0.0014 -0.0358 -0.0464 477 LEU A CB    
1404 C CG    . LEU A 220 ? 0.3005 0.3023 0.3528 0.0039  -0.0415 -0.0465 477 LEU A CG    
1405 C CD1   . LEU A 220 ? 0.3403 0.3400 0.4069 0.0010  -0.0458 -0.0550 477 LEU A CD1   
1406 C CD2   . LEU A 220 ? 0.3488 0.3494 0.3857 0.0142  -0.0522 -0.0492 477 LEU A CD2   
1407 N N     . GLU A 221 ? 0.2141 0.2197 0.2565 -0.0024 -0.0191 -0.0268 478 GLU A N     
1408 C CA    . GLU A 221 ? 0.2115 0.2125 0.2349 -0.0004 -0.0158 -0.0193 478 GLU A CA    
1409 C C     . GLU A 221 ? 0.1964 0.1955 0.2185 -0.0049 -0.0065 -0.0139 478 GLU A C     
1410 O O     . GLU A 221 ? 0.1824 0.1770 0.1932 -0.0045 -0.0040 -0.0097 478 GLU A O     
1411 C CB    . GLU A 221 ? 0.2327 0.2348 0.2474 0.0046  -0.0190 -0.0174 478 GLU A CB    
1412 C CG    . GLU A 221 ? 0.2548 0.2551 0.2627 0.0117  -0.0281 -0.0213 478 GLU A CG    
1413 C CD    . GLU A 221 ? 0.2795 0.2732 0.2716 0.0156  -0.0296 -0.0199 478 GLU A CD    
1414 O OE1   . GLU A 221 ? 0.3123 0.3038 0.2999 0.0128  -0.0239 -0.0158 478 GLU A OE1   
1415 O OE2   . GLU A 221 ? 0.3004 0.2905 0.2837 0.0227  -0.0369 -0.0234 478 GLU A OE2   
1416 N N     . GLN A 222 ? 0.1935 0.1956 0.2263 -0.0081 -0.0015 -0.0143 479 GLN A N     
1417 C CA    . GLN A 222 ? 0.2094 0.2072 0.2362 -0.0104 0.0069  -0.0093 479 GLN A CA    
1418 C C     . GLN A 222 ? 0.2129 0.2028 0.2374 -0.0130 0.0116  -0.0078 479 GLN A C     
1419 O O     . GLN A 222 ? 0.2086 0.1924 0.2193 -0.0115 0.0137  -0.0034 479 GLN A O     
1420 C CB    . GLN A 222 ? 0.2196 0.2209 0.2547 -0.0119 0.0123  -0.0097 479 GLN A CB    
1421 C CG    . GLN A 222 ? 0.2101 0.2155 0.2416 -0.0084 0.0081  -0.0096 479 GLN A CG    
1422 C CD    . GLN A 222 ? 0.2073 0.2163 0.2465 -0.0086 0.0125  -0.0108 479 GLN A CD    
1423 O OE1   . GLN A 222 ? 0.2207 0.2306 0.2553 -0.0057 0.0096  -0.0103 479 GLN A OE1   
1424 N NE2   . GLN A 222 ? 0.2028 0.2134 0.2546 -0.0118 0.0201  -0.0124 479 GLN A NE2   
1425 N N     . PRO A 223 ? 0.2206 0.2099 0.2588 -0.0163 0.0125  -0.0119 480 PRO A N     
1426 C CA    . PRO A 223 ? 0.2297 0.2085 0.2640 -0.0185 0.0175  -0.0098 480 PRO A CA    
1427 C C     . PRO A 223 ? 0.2229 0.1977 0.2429 -0.0144 0.0113  -0.0087 480 PRO A C     
1428 O O     . PRO A 223 ? 0.2074 0.1733 0.2156 -0.0132 0.0146  -0.0047 480 PRO A O     
1429 C CB    . PRO A 223 ? 0.2413 0.2217 0.2972 -0.0234 0.0178  -0.0162 480 PRO A CB    
1430 C CG    . PRO A 223 ? 0.2380 0.2296 0.3098 -0.0245 0.0177  -0.0199 480 PRO A CG    
1431 C CD    . PRO A 223 ? 0.2250 0.2223 0.2849 -0.0188 0.0108  -0.0185 480 PRO A CD    
1432 N N     . LEU A 224 ? 0.2222 0.2030 0.2414 -0.0110 0.0028  -0.0119 481 LEU A N     
1433 C CA    . LEU A 224 ? 0.2207 0.1981 0.2270 -0.0066 -0.0015 -0.0111 481 LEU A CA    
1434 C C     . LEU A 224 ? 0.2253 0.2022 0.2185 -0.0041 0.0013  -0.0052 481 LEU A C     
1435 O O     . LEU A 224 ? 0.2210 0.1939 0.2053 -0.0014 0.0012  -0.0033 481 LEU A O     
1436 C CB    . LEU A 224 ? 0.2123 0.1943 0.2171 -0.0023 -0.0097 -0.0151 481 LEU A CB    
1437 C CG    . LEU A 224 ? 0.2194 0.1983 0.2100 0.0031  -0.0125 -0.0141 481 LEU A CG    
1438 C CD1   . LEU A 224 ? 0.2469 0.2181 0.2374 0.0032  -0.0139 -0.0174 481 LEU A CD1   
1439 C CD2   . LEU A 224 ? 0.2411 0.2223 0.2251 0.0087  -0.0185 -0.0163 481 LEU A CD2   
1440 N N     . SER A 225 ? 0.2460 0.2278 0.2397 -0.0047 0.0030  -0.0031 482 SER A N     
1441 C CA    . SER A 225 ? 0.2409 0.2236 0.2255 -0.0025 0.0038  0.0006  482 SER A CA    
1442 C C     . SER A 225 ? 0.2394 0.2143 0.2163 -0.0018 0.0076  0.0034  482 SER A C     
1443 O O     . SER A 225 ? 0.2517 0.2261 0.2211 0.0016  0.0061  0.0049  482 SER A O     
1444 C CB    . SER A 225 ? 0.2512 0.2386 0.2392 -0.0037 0.0048  0.0011  482 SER A CB    
1445 O OG    . SER A 225 ? 0.2991 0.2881 0.2812 -0.0020 0.0043  0.0032  482 SER A OG    
1446 N N     . SER A 226 ? 0.2558 0.2244 0.2348 -0.0044 0.0130  0.0040  483 SER A N     
1447 C CA    . SER A 226 ? 0.2747 0.2314 0.2429 -0.0027 0.0177  0.0073  483 SER A CA    
1448 C C     . SER A 226 ? 0.2670 0.2173 0.2302 -0.0003 0.0155  0.0072  483 SER A C     
1449 O O     . SER A 226 ? 0.2606 0.2046 0.2115 0.0046  0.0150  0.0097  483 SER A O     
1450 C CB    . SER A 226 ? 0.2846 0.2340 0.2570 -0.0066 0.0264  0.0085  483 SER A CB    
1451 O OG    . SER A 226 ? 0.3073 0.2631 0.2842 -0.0079 0.0284  0.0082  483 SER A OG    
1452 N N     . ILE A 227 ? 0.2412 0.1930 0.2135 -0.0025 0.0131  0.0036  484 ILE A N     
1453 C CA    . ILE A 227 ? 0.2333 0.1789 0.2017 0.0000  0.0104  0.0022  484 ILE A CA    
1454 C C     . ILE A 227 ? 0.2267 0.1785 0.1878 0.0057  0.0053  0.0024  484 ILE A C     
1455 O O     . ILE A 227 ? 0.2141 0.1602 0.1663 0.0104  0.0046  0.0036  484 ILE A O     
1456 C CB    . ILE A 227 ? 0.2348 0.1809 0.2156 -0.0036 0.0078  -0.0034 484 ILE A CB    
1457 C CG1   . ILE A 227 ? 0.2365 0.1760 0.2284 -0.0100 0.0146  -0.0038 484 ILE A CG1   
1458 C CG2   . ILE A 227 ? 0.2417 0.1825 0.2172 0.0003  0.0033  -0.0061 484 ILE A CG2   
1459 C CD1   . ILE A 227 ? 0.2512 0.1936 0.2608 -0.0141 0.0110  -0.0112 484 ILE A CD1   
1460 N N     . LEU A 228 ? 0.2132 0.1763 0.1782 0.0057  0.0026  0.0015  485 LEU A N     
1461 C CA    . LEU A 228 ? 0.2124 0.1819 0.1733 0.0102  0.0000  0.0019  485 LEU A CA    
1462 C C     . LEU A 228 ? 0.2106 0.1808 0.1667 0.0130  0.0005  0.0044  485 LEU A C     
1463 O O     . LEU A 228 ? 0.2125 0.1850 0.1661 0.0175  -0.0013 0.0041  485 LEU A O     
1464 C CB    . LEU A 228 ? 0.2086 0.1873 0.1740 0.0093  -0.0012 0.0013  485 LEU A CB    
1465 C CG    . LEU A 228 ? 0.2254 0.2033 0.1923 0.0094  -0.0039 -0.0020 485 LEU A CG    
1466 C CD1   . LEU A 228 ? 0.2149 0.1991 0.1831 0.0094  -0.0045 -0.0013 485 LEU A CD1   
1467 C CD2   . LEU A 228 ? 0.2088 0.1834 0.1691 0.0143  -0.0056 -0.0038 485 LEU A CD2   
1468 N N     . ALA A 229 ? 0.2210 0.1893 0.1760 0.0110  0.0024  0.0060  486 ALA A N     
1469 C CA    . ALA A 229 ? 0.2309 0.1987 0.1796 0.0149  0.0011  0.0071  486 ALA A CA    
1470 C C     . ALA A 229 ? 0.2623 0.2192 0.2003 0.0203  0.0007  0.0081  486 ALA A C     
1471 O O     . ALA A 229 ? 0.2615 0.2209 0.1961 0.0261  -0.0034 0.0073  486 ALA A O     
1472 C CB    . ALA A 229 ? 0.2050 0.1691 0.1505 0.0129  0.0038  0.0084  486 ALA A CB    
1473 N N     . GLU A 230 ? 0.2710 0.2156 0.2052 0.0184  0.0049  0.0096  487 GLU A N     
1474 C CA    . GLU A 230 ? 0.3228 0.2535 0.2454 0.0236  0.0055  0.0113  487 GLU A CA    
1475 C C     . GLU A 230 ? 0.2989 0.2342 0.2235 0.0279  0.0008  0.0087  487 GLU A C     
1476 O O     . GLU A 230 ? 0.2817 0.2124 0.1978 0.0352  -0.0020 0.0089  487 GLU A O     
1477 C CB    . GLU A 230 ? 0.3981 0.3138 0.3195 0.0191  0.0123  0.0132  487 GLU A CB    
1478 C CG    . GLU A 230 ? 0.4611 0.3698 0.3799 0.0154  0.0197  0.0164  487 GLU A CG    
1479 C CD    . GLU A 230 ? 0.5933 0.4936 0.5219 0.0077  0.0276  0.0165  487 GLU A CD    
1480 O OE1   . GLU A 230 ? 0.6480 0.5434 0.5822 0.0059  0.0268  0.0142  487 GLU A OE1   
1481 O OE2   . GLU A 230 ? 0.6653 0.5643 0.5978 0.0034  0.0347  0.0181  487 GLU A OE2   
1482 N N     . MET A 231 ? 0.2600 0.2039 0.1946 0.0245  0.0000  0.0059  488 MET A N     
1483 C CA    . MET A 231 ? 0.2710 0.2186 0.2062 0.0291  -0.0029 0.0033  488 MET A CA    
1484 C C     . MET A 231 ? 0.2640 0.2244 0.2024 0.0340  -0.0057 0.0026  488 MET A C     
1485 O O     . MET A 231 ? 0.2758 0.2366 0.2119 0.0407  -0.0079 0.0012  488 MET A O     
1486 C CB    . MET A 231 ? 0.2609 0.2139 0.2028 0.0258  -0.0031 0.0005  488 MET A CB    
1487 C CG    . MET A 231 ? 0.2796 0.2220 0.2230 0.0213  -0.0022 -0.0012 488 MET A CG    
1488 S SD    . MET A 231 ? 0.2668 0.2164 0.2180 0.0180  -0.0049 -0.0055 488 MET A SD    
1489 C CE    . MET A 231 ? 0.2398 0.1926 0.1839 0.0258  -0.0074 -0.0078 488 MET A CE    
1490 N N     . GLU A 232 ? 0.2401 0.2110 0.1856 0.0305  -0.0056 0.0028  489 GLU A N     
1491 C CA    . GLU A 232 ? 0.2456 0.2297 0.1989 0.0336  -0.0079 0.0011  489 GLU A CA    
1492 C C     . GLU A 232 ? 0.2454 0.2262 0.1930 0.0401  -0.0125 0.0004  489 GLU A C     
1493 O O     . GLU A 232 ? 0.2517 0.2399 0.2042 0.0460  -0.0159 -0.0024 489 GLU A O     
1494 C CB    . GLU A 232 ? 0.2339 0.2270 0.1959 0.0280  -0.0069 0.0013  489 GLU A CB    
1495 C CG    . GLU A 232 ? 0.2424 0.2382 0.2082 0.0233  -0.0032 0.0021  489 GLU A CG    
1496 C CD    . GLU A 232 ? 0.2404 0.2414 0.2124 0.0181  -0.0022 0.0028  489 GLU A CD    
1497 O OE1   . GLU A 232 ? 0.2526 0.2552 0.2263 0.0179  -0.0045 0.0022  489 GLU A OE1   
1498 O OE2   . GLU A 232 ? 0.2466 0.2486 0.2200 0.0153  0.0002  0.0037  489 GLU A OE2   
1499 N N     . PHE A 233 ? 0.2657 0.2350 0.2024 0.0398  -0.0125 0.0026  490 PHE A N     
1500 C CA    . PHE A 233 ? 0.2737 0.2359 0.1992 0.0478  -0.0172 0.0024  490 PHE A CA    
1501 C C     . PHE A 233 ? 0.2920 0.2446 0.2084 0.0555  -0.0188 0.0025  490 PHE A C     
1502 O O     . PHE A 233 ? 0.2677 0.2229 0.1823 0.0644  -0.0253 -0.0002 490 PHE A O     
1503 C CB    . PHE A 233 ? 0.2826 0.2310 0.1943 0.0465  -0.0144 0.0058  490 PHE A CB    
1504 C CG    . PHE A 233 ? 0.3022 0.2408 0.1976 0.0563  -0.0196 0.0057  490 PHE A CG    
1505 C CD1   . PHE A 233 ? 0.2956 0.2457 0.1961 0.0611  -0.0281 0.0007  490 PHE A CD1   
1506 C CD2   . PHE A 233 ? 0.3304 0.2473 0.2050 0.0615  -0.0164 0.0102  490 PHE A CD2   
1507 C CE1   . PHE A 233 ? 0.3234 0.2639 0.2070 0.0717  -0.0348 -0.0005 490 PHE A CE1   
1508 C CE2   . PHE A 233 ? 0.3696 0.2744 0.2243 0.0725  -0.0214 0.0105  490 PHE A CE2   
1509 C CZ    . PHE A 233 ? 0.3598 0.2768 0.2182 0.0783  -0.0316 0.0047  490 PHE A CZ    
1510 N N     . ALA A 234 ? 0.2949 0.2367 0.2069 0.0529  -0.0140 0.0048  491 ALA A N     
1511 C CA    . ALA A 234 ? 0.2997 0.2301 0.2027 0.0603  -0.0153 0.0047  491 ALA A CA    
1512 C C     . ALA A 234 ? 0.2985 0.2437 0.2122 0.0658  -0.0194 0.0002  491 ALA A C     
1513 O O     . ALA A 234 ? 0.3039 0.2464 0.2124 0.0757  -0.0242 -0.0015 491 ALA A O     
1514 C CB    . ALA A 234 ? 0.2988 0.2160 0.1989 0.0549  -0.0097 0.0065  491 ALA A CB    
1515 N N     . GLY A 235 ? 0.2722 0.2328 0.2007 0.0602  -0.0170 -0.0017 492 GLY A N     
1516 C CA    . GLY A 235 ? 0.2765 0.2522 0.2170 0.0646  -0.0180 -0.0055 492 GLY A CA    
1517 C C     . GLY A 235 ? 0.2912 0.2582 0.2251 0.0696  -0.0168 -0.0065 492 GLY A C     
1518 O O     . GLY A 235 ? 0.3156 0.2647 0.2370 0.0691  -0.0160 -0.0045 492 GLY A O     
1519 N N     . VAL A 236 ? 0.2894 0.2690 0.2330 0.0738  -0.0158 -0.0097 493 VAL A N     
1520 C CA    . VAL A 236 ? 0.2968 0.2695 0.2343 0.0805  -0.0150 -0.0117 493 VAL A CA    
1521 C C     . VAL A 236 ? 0.3051 0.2883 0.2504 0.0909  -0.0187 -0.0155 493 VAL A C     
1522 O O     . VAL A 236 ? 0.2919 0.2950 0.2549 0.0910  -0.0180 -0.0180 493 VAL A O     
1523 C CB    . VAL A 236 ? 0.2990 0.2772 0.2398 0.0776  -0.0092 -0.0127 493 VAL A CB    
1524 C CG1   . VAL A 236 ? 0.3002 0.2698 0.2327 0.0855  -0.0089 -0.0156 493 VAL A CG1   
1525 C CG2   . VAL A 236 ? 0.2863 0.2577 0.2226 0.0682  -0.0072 -0.0103 493 VAL A CG2   
1526 N N     . LYS A 237 ? 0.3106 0.2803 0.2443 0.0998  -0.0223 -0.0164 494 LYS A N     
1527 C CA    . LYS A 237 ? 0.3052 0.2826 0.2446 0.1116  -0.0273 -0.0205 494 LYS A CA    
1528 C C     . LYS A 237 ? 0.2935 0.2850 0.2451 0.1151  -0.0222 -0.0244 494 LYS A C     
1529 O O     . LYS A 237 ? 0.2904 0.2739 0.2342 0.1136  -0.0172 -0.0238 494 LYS A O     
1530 C CB    . LYS A 237 ? 0.3403 0.2941 0.2593 0.1206  -0.0322 -0.0194 494 LYS A CB    
1531 C CG    . LYS A 237 ? 0.3578 0.3149 0.2780 0.1347  -0.0398 -0.0234 494 LYS A CG    
1532 C CD    . LYS A 237 ? 0.3966 0.3558 0.3157 0.1370  -0.0472 -0.0231 494 LYS A CD    
1533 C CE    . LYS A 237 ? 0.4417 0.3908 0.3489 0.1525  -0.0569 -0.0252 494 LYS A CE    
1534 N NZ    . LYS A 237 ? 0.4573 0.4055 0.3588 0.1548  -0.0646 -0.0250 494 LYS A NZ    
1535 N N     . VAL A 238 ? 0.2860 0.2985 0.2572 0.1207  -0.0236 -0.0290 495 VAL A N     
1536 C CA    . VAL A 238 ? 0.2802 0.3083 0.2660 0.1252  -0.0173 -0.0329 495 VAL A CA    
1537 C C     . VAL A 238 ? 0.2954 0.3288 0.2872 0.1391  -0.0231 -0.0384 495 VAL A C     
1538 O O     . VAL A 238 ? 0.2949 0.3340 0.2935 0.1440  -0.0323 -0.0412 495 VAL A O     
1539 C CB    . VAL A 238 ? 0.2746 0.3274 0.2861 0.1181  -0.0108 -0.0340 495 VAL A CB    
1540 C CG1   . VAL A 238 ? 0.2667 0.3349 0.2934 0.1235  -0.0017 -0.0376 495 VAL A CG1   
1541 C CG2   . VAL A 238 ? 0.2684 0.3155 0.2731 0.1055  -0.0050 -0.0285 495 VAL A CG2   
1542 N N     . ASP A 239 ? 0.3045 0.3354 0.2926 0.1465  -0.0186 -0.0406 496 ASP A N     
1543 C CA    . ASP A 239 ? 0.3298 0.3677 0.3257 0.1609  -0.0224 -0.0466 496 ASP A CA    
1544 C C     . ASP A 239 ? 0.3225 0.3922 0.3517 0.1606  -0.0157 -0.0514 496 ASP A C     
1545 O O     . ASP A 239 ? 0.3132 0.3913 0.3494 0.1611  -0.0044 -0.0522 496 ASP A O     
1546 C CB    . ASP A 239 ? 0.3520 0.3719 0.3287 0.1680  -0.0193 -0.0468 496 ASP A CB    
1547 C CG    . ASP A 239 ? 0.3761 0.4013 0.3588 0.1839  -0.0227 -0.0531 496 ASP A CG    
1548 O OD1   . ASP A 239 ? 0.3877 0.4339 0.3929 0.1900  -0.0270 -0.0581 496 ASP A OD1   
1549 O OD2   . ASP A 239 ? 0.4104 0.4186 0.3760 0.1908  -0.0216 -0.0538 496 ASP A OD2   
1550 N N     . THR A 240 ? 0.3246 0.4110 0.3744 0.1596  -0.0224 -0.0547 497 THR A N     
1551 C CA    . THR A 240 ? 0.3211 0.4381 0.4072 0.1569  -0.0157 -0.0597 497 THR A CA    
1552 C C     . THR A 240 ? 0.3369 0.4685 0.4397 0.1693  -0.0125 -0.0664 497 THR A C     
1553 O O     . THR A 240 ? 0.3344 0.4862 0.4614 0.1667  0.0003  -0.0684 497 THR A O     
1554 C CB    . THR A 240 ? 0.3041 0.4359 0.4107 0.1544  -0.0261 -0.0640 497 THR A CB    
1555 O OG1   . THR A 240 ? 0.3319 0.4554 0.4282 0.1674  -0.0421 -0.0680 497 THR A OG1   
1556 C CG2   . THR A 240 ? 0.2871 0.4095 0.3831 0.1411  -0.0257 -0.0579 497 THR A CG2   
1557 N N     . LYS A 241 ? 0.3710 0.4914 0.4604 0.1833  -0.0230 -0.0695 498 LYS A N     
1558 C CA    . LYS A 241 ? 0.4110 0.5454 0.5165 0.1970  -0.0212 -0.0768 498 LYS A CA    
1559 C C     . LYS A 241 ? 0.3799 0.5111 0.4784 0.1964  -0.0047 -0.0741 498 LYS A C     
1560 O O     . LYS A 241 ? 0.3669 0.5197 0.4903 0.2003  0.0057  -0.0788 498 LYS A O     
1561 C CB    . LYS A 241 ? 0.4747 0.5917 0.5606 0.2129  -0.0359 -0.0795 498 LYS A CB    
1562 C CG    . LYS A 241 ? 0.5286 0.6625 0.6358 0.2231  -0.0510 -0.0880 498 LYS A CG    
1563 C CD    . LYS A 241 ? 0.5970 0.7030 0.6720 0.2332  -0.0671 -0.0861 498 LYS A CD    
1564 C CE    . LYS A 241 ? 0.6138 0.7346 0.7058 0.2430  -0.0841 -0.0944 498 LYS A CE    
1565 N NZ    . LYS A 241 ? 0.6397 0.8001 0.7798 0.2459  -0.0823 -0.1055 498 LYS A NZ    
1566 N N     . ARG A 242 ? 0.6467 0.4722 0.4067 0.0768  0.0791  0.0799  499 ARG A N     
1567 C CA    . ARG A 242 ? 0.6721 0.4654 0.4113 0.0661  0.0860  0.0742  499 ARG A CA    
1568 C C     . ARG A 242 ? 0.6023 0.4533 0.3946 0.0566  0.0700  0.0705  499 ARG A C     
1569 O O     . ARG A 242 ? 0.5900 0.4376 0.3785 0.0658  0.0751  0.0733  499 ARG A O     
1570 C CB    . ARG A 242 ? 0.7314 0.4738 0.4333 0.0308  0.0905  0.0613  499 ARG A CB    
1571 C CG    . ARG A 242 ? 0.7772 0.5052 0.4692 0.0081  0.0909  0.0533  499 ARG A CG    
1572 C CD    . ARG A 242 ? 0.9147 0.5601 0.5326 0.0158  0.1149  0.0557  499 ARG A CD    
1573 N NE    . ARG A 242 ? 1.0254 0.6038 0.5801 -0.0149 0.1267  0.0473  499 ARG A NE    
1574 C CZ    . ARG A 242 ? 1.1695 0.6596 0.6431 -0.0223 0.1494  0.0454  499 ARG A CZ    
1575 N NH1   . ARG A 242 ? 1.2319 0.6903 0.6804 0.0041  0.1634  0.0524  499 ARG A NH1   
1576 N NH2   . ARG A 242 ? 1.2467 0.6775 0.6593 -0.0578 0.1594  0.0368  499 ARG A NH2   
1577 N N     . LEU A 243 ? 0.5393 0.4375 0.3757 0.0395  0.0529  0.0647  500 LEU A N     
1578 C CA    . LEU A 243 ? 0.4892 0.4338 0.3683 0.0303  0.0397  0.0611  500 LEU A CA    
1579 C C     . LEU A 243 ? 0.4681 0.4505 0.3672 0.0525  0.0383  0.0713  500 LEU A C     
1580 O O     . LEU A 243 ? 0.4300 0.4279 0.3428 0.0518  0.0362  0.0707  500 LEU A O     
1581 C CB    . LEU A 243 ? 0.4541 0.4316 0.3648 0.0133  0.0262  0.0551  500 LEU A CB    
1582 C CG    . LEU A 243 ? 0.4507 0.4231 0.3627 -0.0113 0.0227  0.0460  500 LEU A CG    
1583 C CD1   . LEU A 243 ? 0.4102 0.4176 0.3531 -0.0183 0.0125  0.0438  500 LEU A CD1   
1584 C CD2   . LEU A 243 ? 0.4371 0.4061 0.3476 -0.0193 0.0231  0.0430  500 LEU A CD2   
1585 N N     . GLU A 244 ? 0.4763 0.4782 0.3764 0.0710  0.0395  0.0815  501 GLU A N     
1586 C CA    . GLU A 244 ? 0.4844 0.5386 0.4050 0.0899  0.0372  0.0941  501 GLU A CA    
1587 C C     . GLU A 244 ? 0.5091 0.5481 0.4084 0.1154  0.0520  0.1039  501 GLU A C     
1588 O O     . GLU A 244 ? 0.4892 0.5683 0.4098 0.1202  0.0492  0.1089  501 GLU A O     
1589 C CB    . GLU A 244 ? 0.5024 0.5883 0.4265 0.1034  0.0349  0.1051  501 GLU A CB    
1590 C CG    . GLU A 244 ? 0.4873 0.6071 0.4395 0.0778  0.0186  0.0975  501 GLU A CG    
1591 C CD    . GLU A 244 ? 0.5288 0.6622 0.4761 0.0840  0.0166  0.1044  501 GLU A CD    
1592 O OE1   . GLU A 244 ? 0.5597 0.6815 0.4837 0.1116  0.0276  0.1167  501 GLU A OE1   
1593 O OE2   . GLU A 244 ? 0.5514 0.7001 0.5126 0.0624  0.0057  0.0974  501 GLU A OE2   
1594 N N     . GLN A 245 ? 0.5663 0.5428 0.4181 0.1309  0.0696  0.1068  502 GLN A N     
1595 C CA    . GLN A 245 ? 0.6255 0.5779 0.4471 0.1600  0.0880  0.1179  502 GLN A CA    
1596 C C     . GLN A 245 ? 0.6083 0.5388 0.4291 0.1412  0.0877  0.1068  502 GLN A C     
1597 O O     . GLN A 245 ? 0.5844 0.5295 0.4075 0.1584  0.0942  0.1147  502 GLN A O     
1598 C CB    . GLN A 245 ? 0.7214 0.6007 0.4790 0.1842  0.1112  0.1253  502 GLN A CB    
1599 C CG    . GLN A 245 ? 0.7670 0.6725 0.5226 0.2128  0.1144  0.1412  502 GLN A CG    
1600 C CD    . GLN A 245 ? 0.8813 0.7007 0.5636 0.2371  0.1402  0.1480  502 GLN A CD    
1601 O OE1   . GLN A 245 ? 0.9715 0.7081 0.6055 0.2168  0.1511  0.1349  502 GLN A OE1   
1602 N NE2   . GLN A 245 ? 0.9262 0.7640 0.5943 0.2802  0.1515  0.1696  502 GLN A NE2   
1603 N N     . MET A 246 ? 0.5964 0.5000 0.4162 0.1064  0.0796  0.0900  503 MET A N     
1604 C CA    . MET A 246 ? 0.5884 0.4863 0.4157 0.0850  0.0749  0.0797  503 MET A CA    
1605 C C     . MET A 246 ? 0.5181 0.4834 0.3966 0.0847  0.0612  0.0816  503 MET A C     
1606 O O     . MET A 246 ? 0.4972 0.4641 0.3765 0.0886  0.0647  0.0827  503 MET A O     
1607 C CB    . MET A 246 ? 0.6047 0.4893 0.4344 0.0486  0.0648  0.0649  503 MET A CB    
1608 C CG    . MET A 246 ? 0.6867 0.5008 0.4589 0.0339  0.0781  0.0591  503 MET A CG    
1609 S SD    . MET A 246 ? 0.7325 0.5574 0.5159 -0.0091 0.0643  0.0457  503 MET A SD    
1610 C CE    . MET A 246 ? 0.7905 0.5274 0.4915 -0.0283 0.0841  0.0410  503 MET A CE    
1611 N N     . GLY A 247 ? 0.4699 0.4847 0.3845 0.0777  0.0471  0.0816  504 GLY A N     
1612 C CA    . GLY A 247 ? 0.4387 0.5116 0.3921 0.0719  0.0354  0.0829  504 GLY A CA    
1613 C C     . GLY A 247 ? 0.4532 0.5614 0.4107 0.0969  0.0425  0.0977  504 GLY A C     
1614 O O     . GLY A 247 ? 0.4216 0.5558 0.3960 0.0918  0.0395  0.0973  504 GLY A O     
1615 N N     . GLU A 248 ? 0.4884 0.5983 0.4282 0.1258  0.0536  0.1121  505 GLU A N     
1616 C CA    . GLU A 248 ? 0.5269 0.6756 0.4673 0.1575  0.0639  0.1308  505 GLU A CA    
1617 C C     . GLU A 248 ? 0.5667 0.6759 0.4842 0.1688  0.0781  0.1308  505 GLU A C     
1618 O O     . GLU A 248 ? 0.5530 0.7054 0.4882 0.1770  0.0792  0.1385  505 GLU A O     
1619 C CB    . GLU A 248 ? 0.5678 0.7179 0.4852 0.1932  0.0766  0.1487  505 GLU A CB    
1620 C CG    . GLU A 248 ? 0.5560 0.7567 0.4980 0.1829  0.0620  0.1512  505 GLU A CG    
1621 C CD    . GLU A 248 ? 0.6225 0.8224 0.5400 0.2180  0.0738  0.1689  505 GLU A CD    
1622 O OE1   . GLU A 248 ? 0.6508 0.8839 0.5603 0.2571  0.0871  0.1910  505 GLU A OE1   
1623 O OE2   . GLU A 248 ? 0.6624 0.8318 0.5681 0.2086  0.0704  0.1621  505 GLU A OE2   
1624 N N     . GLU A 249 ? 0.6267 0.6540 0.5014 0.1662  0.0895  0.1220  506 GLU A N     
1625 C CA    . GLU A 249 ? 0.6790 0.6581 0.5228 0.1722  0.1038  0.1204  506 GLU A CA    
1626 C C     . GLU A 249 ? 0.6266 0.6290 0.5026 0.1436  0.0894  0.1082  506 GLU A C     
1627 O O     . GLU A 249 ? 0.6318 0.6430 0.5082 0.1542  0.0961  0.1131  506 GLU A O     
1628 C CB    . GLU A 249 ? 0.7791 0.6635 0.5633 0.1646  0.1178  0.1116  506 GLU A CB    
1629 C CG    . GLU A 249 ? 0.8863 0.7284 0.6218 0.1987  0.1391  0.1254  506 GLU A CG    
1630 C CD    . GLU A 249 ? 1.0019 0.7462 0.6720 0.1818  0.1521  0.1145  506 GLU A CD    
1631 O OE1   . GLU A 249 ? 1.0877 0.7668 0.7112 0.1728  0.1657  0.1083  506 GLU A OE1   
1632 O OE2   . GLU A 249 ? 1.0347 0.7671 0.6968 0.1743  0.1491  0.1118  506 GLU A OE2   
1633 N N     . LEU A 250 ? 0.5516 0.5651 0.4528 0.1106  0.0712  0.0939  507 LEU A N     
1634 C CA    . LEU A 250 ? 0.5230 0.5556 0.4505 0.0865  0.0588  0.0836  507 LEU A CA    
1635 C C     . LEU A 250 ? 0.4867 0.5851 0.4487 0.0910  0.0529  0.0910  507 LEU A C     
1636 O O     . LEU A 250 ? 0.4490 0.5536 0.4176 0.0858  0.0529  0.0887  507 LEU A O     
1637 C CB    . LEU A 250 ? 0.4864 0.5204 0.4303 0.0578  0.0435  0.0707  507 LEU A CB    
1638 C CG    . LEU A 250 ? 0.5076 0.4919 0.4260 0.0396  0.0448  0.0603  507 LEU A CG    
1639 C CD1   . LEU A 250 ? 0.4800 0.4814 0.4195 0.0184  0.0310  0.0523  507 LEU A CD1   
1640 C CD2   . LEU A 250 ? 0.5144 0.4790 0.4215 0.0320  0.0479  0.0560  507 LEU A CD2   
1641 N N     . ALA A 251 ? 0.4672 0.6164 0.4486 0.0977  0.0479  0.1001  508 ALA A N     
1642 C CA    . ALA A 251 ? 0.4524 0.6723 0.4634 0.0937  0.0411  0.1074  508 ALA A CA    
1643 C C     . ALA A 251 ? 0.4724 0.7105 0.4778 0.1202  0.0549  0.1212  508 ALA A C     
1644 O O     . ALA A 251 ? 0.4760 0.7468 0.4978 0.1103  0.0518  0.1211  508 ALA A O     
1645 C CB    . ALA A 251 ? 0.4365 0.7095 0.4627 0.0944  0.0340  0.1163  508 ALA A CB    
1646 N N     . GLU A 252 ? 0.5247 0.7343 0.5013 0.1546  0.0723  0.1331  509 GLU A N     
1647 C CA    . GLU A 252 ? 0.5618 0.7779 0.5242 0.1871  0.0903  0.1483  509 GLU A CA    
1648 C C     . GLU A 252 ? 0.5594 0.7273 0.5080 0.1751  0.0946  0.1365  509 GLU A C     
1649 O O     . GLU A 252 ? 0.5293 0.7312 0.4888 0.1830  0.0992  0.1437  509 GLU A O     
1650 C CB    . GLU A 252 ? 0.6419 0.8177 0.5620 0.2293  0.1124  0.1634  509 GLU A CB    
1651 C CG    . GLU A 252 ? 0.7178 0.8768 0.6083 0.2682  0.1371  0.1791  509 GLU A CG    
1652 C CD    . GLU A 252 ? 0.8176 0.9464 0.6629 0.3183  0.1624  0.1997  509 GLU A CD    
1653 O OE1   . GLU A 252 ? 0.8506 0.9966 0.6988 0.3253  0.1582  0.2056  509 GLU A OE1   
1654 O OE2   . GLU A 252 ? 0.9222 1.0047 0.7234 0.3532  0.1885  0.2110  509 GLU A OE2   
1655 N N     . GLN A 253 ? 0.5587 0.6542 0.4833 0.1554  0.0929  0.1196  510 GLN A N     
1656 C CA    . GLN A 253 ? 0.5751 0.6282 0.4860 0.1395  0.0945  0.1080  510 GLN A CA    
1657 C C     . GLN A 253 ? 0.5145 0.6132 0.4646 0.1130  0.0777  0.0997  510 GLN A C     
1658 O O     . GLN A 253 ? 0.5243 0.6214 0.4732 0.1124  0.0818  0.0991  510 GLN A O     
1659 C CB    . GLN A 253 ? 0.6134 0.5931 0.4911 0.1194  0.0943  0.0934  510 GLN A CB    
1660 C CG    . GLN A 253 ? 0.7032 0.6054 0.5187 0.1378  0.1180  0.0974  510 GLN A CG    
1661 C CD    . GLN A 253 ? 0.7503 0.5896 0.5290 0.1148  0.1180  0.0854  510 GLN A CD    
1662 O OE1   . GLN A 253 ? 0.7775 0.5858 0.5424 0.0854  0.1129  0.0726  510 GLN A OE1   
1663 N NE2   . GLN A 253 ? 0.7761 0.6009 0.5380 0.1266  0.1237  0.0905  510 GLN A NE2   
1664 N N     . LEU A 254 ? 0.4667 0.5993 0.4452 0.0914  0.0608  0.0936  511 LEU A N     
1665 C CA    . LEU A 254 ? 0.4278 0.5941 0.4328 0.0660  0.0476  0.0861  511 LEU A CA    
1666 C C     . LEU A 254 ? 0.4184 0.6445 0.4407 0.0725  0.0506  0.0974  511 LEU A C     
1667 O O     . LEU A 254 ? 0.4082 0.6383 0.4354 0.0593  0.0489  0.0924  511 LEU A O     
1668 C CB    . LEU A 254 ? 0.4012 0.5846 0.4220 0.0449  0.0334  0.0795  511 LEU A CB    
1669 C CG    . LEU A 254 ? 0.4014 0.5370 0.4123 0.0299  0.0276  0.0662  511 LEU A CG    
1670 C CD1   . LEU A 254 ? 0.3799 0.5291 0.4014 0.0168  0.0177  0.0626  511 LEU A CD1   
1671 C CD2   . LEU A 254 ? 0.3850 0.5024 0.3944 0.0154  0.0247  0.0573  511 LEU A CD2   
1672 N N     . ARG A 255 ? 0.4255 0.7023 0.4563 0.0924  0.0551  0.1135  512 ARG A N     
1673 C CA    . ARG A 255 ? 0.4252 0.7768 0.4748 0.0991  0.0581  0.1281  512 ARG A CA    
1674 C C     . ARG A 255 ? 0.4347 0.7677 0.4709 0.1194  0.0732  0.1333  512 ARG A C     
1675 O O     . ARG A 255 ? 0.4343 0.8030 0.4839 0.1073  0.0718  0.1340  512 ARG A O     
1676 C CB    . ARG A 255 ? 0.4502 0.8638 0.5085 0.1246  0.0623  0.1488  512 ARG A CB    
1677 C CG    . ARG A 255 ? 0.4501 0.9044 0.5254 0.0995  0.0461  0.1463  512 ARG A CG    
1678 C CD    . ARG A 255 ? 0.4715 1.0151 0.5616 0.1201  0.0482  0.1702  512 ARG A CD    
1679 N NE    . ARG A 255 ? 0.5199 1.0336 0.5908 0.1605  0.0603  0.1813  512 ARG A NE    
1680 C CZ    . ARG A 255 ? 0.5236 1.0025 0.5855 0.1560  0.0546  0.1744  512 ARG A CZ    
1681 N NH1   . ARG A 255 ? 0.5046 0.9769 0.5766 0.1154  0.0374  0.1574  512 ARG A NH1   
1682 N NH2   . ARG A 255 ? 0.5514 0.9974 0.5890 0.1932  0.0683  0.1851  512 ARG A NH2   
1683 N N     . THR A 256 ? 0.4570 0.7294 0.4609 0.1483  0.0891  0.1367  513 THR A N     
1684 C CA    . THR A 256 ? 0.4881 0.7281 0.4695 0.1670  0.1060  0.1405  513 THR A CA    
1685 C C     . THR A 256 ? 0.4617 0.6703 0.4447 0.1353  0.0973  0.1224  513 THR A C     
1686 O O     . THR A 256 ? 0.4437 0.6811 0.4364 0.1342  0.1004  0.1259  513 THR A O     
1687 C CB    . THR A 256 ? 0.5447 0.7041 0.4754 0.1975  0.1269  0.1446  513 THR A CB    
1688 O OG1   . THR A 256 ? 0.5708 0.7577 0.4963 0.2314  0.1369  0.1634  513 THR A OG1   
1689 C CG2   . THR A 256 ? 0.5744 0.6992 0.4753 0.2191  0.1474  0.1507  513 THR A CG2   
1690 N N     . VAL A 257 ? 0.4439 0.6008 0.4184 0.1104  0.0864  0.1047  514 VAL A N     
1691 C CA    A VAL A 257 ? 0.4393 0.5665 0.4116 0.0854  0.0794  0.0902  514 VAL A CA    
1692 C CA    B VAL A 257 ? 0.4396 0.5672 0.4120 0.0856  0.0795  0.0903  514 VAL A CA    
1693 C C     . VAL A 257 ? 0.4083 0.5889 0.4113 0.0620  0.0670  0.0869  514 VAL A C     
1694 O O     . VAL A 257 ? 0.3898 0.5663 0.3920 0.0521  0.0677  0.0826  514 VAL A O     
1695 C CB    A VAL A 257 ? 0.4394 0.5124 0.3971 0.0659  0.0707  0.0754  514 VAL A CB    
1696 C CB    B VAL A 257 ? 0.4413 0.5131 0.3980 0.0663  0.0712  0.0755  514 VAL A CB    
1697 C CG1   A VAL A 257 ? 0.4353 0.4769 0.3834 0.0482  0.0674  0.0647  514 VAL A CG1   
1698 C CG1   B VAL A 257 ? 0.4861 0.5010 0.4037 0.0816  0.0845  0.0776  514 VAL A CG1   
1699 C CG2   A VAL A 257 ? 0.4808 0.5027 0.4030 0.0812  0.0825  0.0780  514 VAL A CG2   
1700 C CG2   B VAL A 257 ? 0.4048 0.5013 0.3845 0.0485  0.0554  0.0699  514 VAL A CG2   
1701 N N     . GLU A 258 ? 0.3974 0.6228 0.4210 0.0507  0.0570  0.0886  515 GLU A N     
1702 C CA    . GLU A 258 ? 0.4036 0.6700 0.4437 0.0232  0.0475  0.0849  515 GLU A CA    
1703 C C     . GLU A 258 ? 0.4179 0.7336 0.4666 0.0282  0.0553  0.0955  515 GLU A C     
1704 O O     . GLU A 258 ? 0.4073 0.7253 0.4554 0.0068  0.0530  0.0889  515 GLU A O     
1705 C CB    . GLU A 258 ? 0.4258 0.7335 0.4791 0.0109  0.0382  0.0875  515 GLU A CB    
1706 C CG    . GLU A 258 ? 0.4555 0.7937 0.5129 -0.0246 0.0296  0.0820  515 GLU A CG    
1707 C CD    . GLU A 258 ? 0.4976 0.8779 0.5623 -0.0386 0.0217  0.0858  515 GLU A CD    
1708 O OE1   . GLU A 258 ? 0.5171 0.8692 0.5788 -0.0320 0.0180  0.0824  515 GLU A OE1   
1709 O OE2   . GLU A 258 ? 0.5134 0.9575 0.5851 -0.0584 0.0192  0.0926  515 GLU A OE2   
1710 N N     . GLN A 259 ? 0.4352 0.7902 0.4889 0.0588  0.0662  0.1133  516 GLN A N     
1711 C CA    . GLN A 259 ? 0.4524 0.8665 0.5163 0.0700  0.0759  0.1278  516 GLN A CA    
1712 C C     . GLN A 259 ? 0.4519 0.8153 0.4981 0.0762  0.0856  0.1220  516 GLN A C     
1713 O O     . GLN A 259 ? 0.4419 0.8360 0.4956 0.0630  0.0866  0.1228  516 GLN A O     
1714 C CB    . GLN A 259 ? 0.4776 0.9442 0.5468 0.1110  0.0889  0.1520  516 GLN A CB    
1715 C CG    . GLN A 259 ? 0.4849 1.0359 0.5783 0.1014  0.0786  0.1628  516 GLN A CG    
1716 C CD    . GLN A 259 ? 0.4887 1.1103 0.6017 0.0587  0.0668  0.1606  516 GLN A CD    
1717 O OE1   . GLN A 259 ? 0.5194 1.1862 0.6398 0.0581  0.0733  0.1688  516 GLN A OE1   
1718 N NE2   . GLN A 259 ? 0.4798 1.1047 0.5949 0.0207  0.0509  0.1489  516 GLN A NE2   
1719 N N     . ARG A 260 ? 0.4747 0.7600 0.4943 0.0917  0.0924  0.1157  517 ARG A N     
1720 C CA    . ARG A 260 ? 0.4974 0.7278 0.4936 0.0962  0.1020  0.1099  517 ARG A CA    
1721 C C     . ARG A 260 ? 0.4597 0.6763 0.4611 0.0605  0.0891  0.0937  517 ARG A C     
1722 O O     . ARG A 260 ? 0.4467 0.6626 0.4442 0.0570  0.0944  0.0930  517 ARG A O     
1723 C CB    . ARG A 260 ? 0.5512 0.6996 0.5106 0.1111  0.1105  0.1053  517 ARG A CB    
1724 C CG    . ARG A 260 ? 0.6118 0.6959 0.5375 0.1134  0.1215  0.0994  517 ARG A CG    
1725 C CD    . ARG A 260 ? 0.6627 0.7708 0.5846 0.1368  0.1392  0.1130  517 ARG A CD    
1726 N NE    . ARG A 260 ? 0.7097 0.7496 0.5935 0.1386  0.1511  0.1072  517 ARG A NE    
1727 C CZ    . ARG A 260 ? 0.7564 0.8053 0.6331 0.1539  0.1659  0.1156  517 ARG A CZ    
1728 N NH1   . ARG A 260 ? 0.7458 0.8764 0.6533 0.1686  0.1705  0.1311  517 ARG A NH1   
1729 N NH2   . ARG A 260 ? 0.8074 0.7871 0.6445 0.1528  0.1765  0.1091  517 ARG A NH2   
1730 N N     . ILE A 261 ? 0.4152 0.6220 0.4231 0.0363  0.0739  0.0822  518 ILE A N     
1731 C CA    . ILE A 261 ? 0.3939 0.5826 0.4001 0.0073  0.0641  0.0688  518 ILE A CA    
1732 C C     . ILE A 261 ? 0.3948 0.6342 0.4121 -0.0116 0.0636  0.0714  518 ILE A C     
1733 O O     . ILE A 261 ? 0.3806 0.5996 0.3877 -0.0256 0.0643  0.0644  518 ILE A O     
1734 C CB    . ILE A 261 ? 0.3718 0.5384 0.3776 -0.0088 0.0514  0.0588  518 ILE A CB    
1735 C CG1   . ILE A 261 ? 0.3779 0.4920 0.3688 0.0016  0.0511  0.0541  518 ILE A CG1   
1736 C CG2   . ILE A 261 ? 0.3713 0.5228 0.3698 -0.0347 0.0447  0.0484  518 ILE A CG2   
1737 C CD1   . ILE A 261 ? 0.3603 0.4641 0.3541 -0.0069 0.0408  0.0485  518 ILE A CD1   
1738 N N     . TYR A 262 ? 0.3966 0.7034 0.4320 -0.0146 0.0624  0.0817  519 TYR A N     
1739 C CA    . TYR A 262 ? 0.4092 0.7737 0.4522 -0.0400 0.0616  0.0849  519 TYR A CA    
1740 C C     . TYR A 262 ? 0.4281 0.8164 0.4738 -0.0252 0.0740  0.0942  519 TYR A C     
1741 O O     . TYR A 262 ? 0.4387 0.8355 0.4787 -0.0490 0.0746  0.0897  519 TYR A O     
1742 C CB    . TYR A 262 ? 0.3994 0.8433 0.4607 -0.0495 0.0567  0.0961  519 TYR A CB    
1743 C CG    . TYR A 262 ? 0.3994 0.8227 0.4553 -0.0673 0.0453  0.0873  519 TYR A CG    
1744 C CD1   . TYR A 262 ? 0.4047 0.7538 0.4386 -0.0844 0.0399  0.0699  519 TYR A CD1   
1745 C CD2   . TYR A 262 ? 0.3918 0.8716 0.4626 -0.0650 0.0409  0.0979  519 TYR A CD2   
1746 C CE1   . TYR A 262 ? 0.4101 0.7391 0.4362 -0.0975 0.0320  0.0631  519 TYR A CE1   
1747 C CE2   . TYR A 262 ? 0.3960 0.8535 0.4592 -0.0819 0.0313  0.0894  519 TYR A CE2   
1748 C CZ    . TYR A 262 ? 0.3953 0.7757 0.4355 -0.0978 0.0277  0.0719  519 TYR A CZ    
1749 O OH    . TYR A 262 ? 0.3877 0.7442 0.4179 -0.1104 0.0207  0.0651  519 TYR A OH    
1750 N N     . GLU A 263 ? 0.4561 0.8503 0.5050 0.0145  0.0858  0.1076  520 GLU A N     
1751 C CA    . GLU A 263 ? 0.5000 0.9054 0.5453 0.0368  0.1016  0.1179  520 GLU A CA    
1752 C C     . GLU A 263 ? 0.5008 0.8342 0.5244 0.0242  0.1021  0.1023  520 GLU A C     
1753 O O     . GLU A 263 ? 0.5034 0.8549 0.5267 0.0120  0.1062  0.1023  520 GLU A O     
1754 C CB    . GLU A 263 ? 0.5548 0.9434 0.5895 0.0850  0.1179  0.1322  520 GLU A CB    
1755 C CG    . GLU A 263 ? 0.5879 1.0536 0.6410 0.1113  0.1234  0.1543  520 GLU A CG    
1756 C CD    . GLU A 263 ? 0.6511 1.0674 0.6793 0.1568  0.1392  0.1638  520 GLU A CD    
1757 O OE1   . GLU A 263 ? 0.6995 1.0584 0.6971 0.1820  0.1573  0.1660  520 GLU A OE1   
1758 O OE2   . GLU A 263 ? 0.6640 1.0901 0.6962 0.1656  0.1349  0.1682  520 GLU A OE2   
1759 N N     . LEU A 264 ? 0.4849 0.7416 0.4897 0.0257  0.0976  0.0897  521 LEU A N     
1760 C CA    . LEU A 264 ? 0.4976 0.6905 0.4806 0.0162  0.0976  0.0771  521 LEU A CA    
1761 C C     . LEU A 264 ? 0.4808 0.6733 0.4636 -0.0187 0.0873  0.0656  521 LEU A C     
1762 O O     . LEU A 264 ? 0.4860 0.6532 0.4552 -0.0263 0.0908  0.0603  521 LEU A O     
1763 C CB    . LEU A 264 ? 0.5145 0.6380 0.4771 0.0230  0.0944  0.0686  521 LEU A CB    
1764 C CG    . LEU A 264 ? 0.5426 0.6330 0.4826 0.0536  0.1103  0.0767  521 LEU A CG    
1765 C CD1   . LEU A 264 ? 0.5222 0.5630 0.4447 0.0535  0.1054  0.0701  521 LEU A CD1   
1766 C CD2   . LEU A 264 ? 0.5650 0.6176 0.4804 0.0578  0.1217  0.0752  521 LEU A CD2   
1767 N N     . ALA A 265 ? 0.4567 0.6708 0.4479 -0.0397 0.0768  0.0619  522 ALA A N     
1768 C CA    . ALA A 265 ? 0.4658 0.6714 0.4446 -0.0734 0.0713  0.0519  522 ALA A CA    
1769 C C     . ALA A 265 ? 0.4873 0.7518 0.4713 -0.0928 0.0768  0.0580  522 ALA A C     
1770 O O     . ALA A 265 ? 0.5001 0.7480 0.4637 -0.1226 0.0763  0.0494  522 ALA A O     
1771 C CB    . ALA A 265 ? 0.4480 0.6466 0.4233 -0.0907 0.0614  0.0458  522 ALA A CB    
1772 N N     . GLY A 266 ? 0.4821 0.8154 0.4893 -0.0759 0.0831  0.0737  523 GLY A N     
1773 C CA    . GLY A 266 ? 0.4915 0.9036 0.5094 -0.0955 0.0871  0.0831  523 GLY A CA    
1774 C C     . GLY A 266 ? 0.5075 0.9543 0.5221 -0.1356 0.0772  0.0795  523 GLY A C     
1775 O O     . GLY A 266 ? 0.5283 1.0182 0.5364 -0.1698 0.0783  0.0802  523 GLY A O     
1776 N N     . GLN A 267 ? 0.5180 0.9461 0.5331 -0.1345 0.0685  0.0756  524 GLN A N     
1777 C CA    . GLN A 267 ? 0.5418 0.9762 0.5402 -0.1762 0.0603  0.0682  524 GLN A CA    
1778 C C     . GLN A 267 ? 0.5199 0.9344 0.5221 -0.1667 0.0519  0.0660  524 GLN A C     
1779 O O     . GLN A 267 ? 0.4800 0.8419 0.4847 -0.1370 0.0513  0.0625  524 GLN A O     
1780 C CB    . GLN A 267 ? 0.5908 0.9472 0.5480 -0.2040 0.0622  0.0511  524 GLN A CB    
1781 C CG    . GLN A 267 ? 0.6400 0.9710 0.5606 -0.2474 0.0587  0.0407  524 GLN A CG    
1782 C CD    . GLN A 267 ? 0.7000 0.9376 0.5733 -0.2612 0.0646  0.0259  524 GLN A CD    
1783 O OE1   . GLN A 267 ? 0.7169 0.9306 0.5869 -0.2502 0.0704  0.0243  524 GLN A OE1   
1784 N NE2   . GLN A 267 ? 0.7656 0.9466 0.5980 -0.2831 0.0647  0.0160  524 GLN A NE2   
1785 N N     . GLU A 268 ? 0.5216 0.9801 0.5216 -0.1952 0.0456  0.0681  525 GLU A N     
1786 C CA    . GLU A 268 ? 0.5271 0.9591 0.5236 -0.1930 0.0381  0.0638  525 GLU A CA    
1787 C C     . GLU A 268 ? 0.5413 0.8859 0.4941 -0.2185 0.0377  0.0460  525 GLU A C     
1788 O O     . GLU A 268 ? 0.5648 0.8884 0.4837 -0.2531 0.0421  0.0384  525 GLU A O     
1789 C CB    . GLU A 268 ? 0.5516 1.0683 0.5625 -0.2101 0.0319  0.0751  525 GLU A CB    
1790 C CG    . GLU A 268 ? 0.5511 1.1529 0.6041 -0.1724 0.0339  0.0966  525 GLU A CG    
1791 C CD    . GLU A 268 ? 0.5654 1.2462 0.6343 -0.1795 0.0265  0.1094  525 GLU A CD    
1792 O OE1   . GLU A 268 ? 0.6000 1.2553 0.6497 -0.2068 0.0187  0.0998  525 GLU A OE1   
1793 O OE2   . GLU A 268 ? 0.5668 1.3361 0.6656 -0.1545 0.0296  0.1307  525 GLU A OE2   
1794 N N     . PHE A 269 ? 0.5072 0.7977 0.4571 -0.1984 0.0344  0.0405  526 PHE A N     
1795 C CA    . PHE A 269 ? 0.5329 0.7417 0.4408 -0.2125 0.0365  0.0273  526 PHE A CA    
1796 C C     . PHE A 269 ? 0.5204 0.7079 0.4379 -0.1910 0.0312  0.0270  526 PHE A C     
1797 O O     . PHE A 269 ? 0.4698 0.6966 0.4235 -0.1656 0.0265  0.0355  526 PHE A O     
1798 C CB    . PHE A 269 ? 0.5462 0.6931 0.4356 -0.2009 0.0431  0.0206  526 PHE A CB    
1799 C CG    . PHE A 269 ? 0.5098 0.6453 0.4276 -0.1599 0.0411  0.0239  526 PHE A CG    
1800 C CD1   . PHE A 269 ? 0.4947 0.6726 0.4429 -0.1412 0.0422  0.0322  526 PHE A CD1   
1801 C CD2   . PHE A 269 ? 0.5089 0.5902 0.4172 -0.1413 0.0399  0.0195  526 PHE A CD2   
1802 C CE1   . PHE A 269 ? 0.4685 0.6248 0.4304 -0.1095 0.0423  0.0338  526 PHE A CE1   
1803 C CE2   . PHE A 269 ? 0.4868 0.5608 0.4157 -0.1117 0.0376  0.0221  526 PHE A CE2   
1804 C CZ    . PHE A 269 ? 0.4682 0.5747 0.4205 -0.0981 0.0390  0.0283  526 PHE A CZ    
1805 N N     . ASN A 270 ? 0.5431 0.6672 0.4244 -0.1998 0.0337  0.0183  527 ASN A N     
1806 C CA    . ASN A 270 ? 0.5241 0.6305 0.4145 -0.1794 0.0295  0.0186  527 ASN A CA    
1807 C C     . ASN A 270 ? 0.5111 0.5834 0.4140 -0.1446 0.0298  0.0184  527 ASN A C     
1808 O O     . ASN A 270 ? 0.5260 0.5445 0.4010 -0.1407 0.0357  0.0137  527 ASN A O     
1809 C CB    . ASN A 270 ? 0.5657 0.6223 0.4100 -0.2010 0.0340  0.0116  527 ASN A CB    
1810 C CG    . ASN A 270 ? 0.5451 0.5949 0.4017 -0.1821 0.0296  0.0132  527 ASN A CG    
1811 O OD1   . ASN A 270 ? 0.5007 0.5727 0.3963 -0.1526 0.0236  0.0182  527 ASN A OD1   
1812 N ND2   . ASN A 270 ? 0.5805 0.5947 0.3985 -0.2008 0.0339  0.0087  527 ASN A ND2   
1813 N N     . ILE A 271 ? 0.4683 0.5727 0.4086 -0.1203 0.0245  0.0246  528 ILE A N     
1814 C CA    . ILE A 271 ? 0.4638 0.5449 0.4142 -0.0945 0.0241  0.0248  528 ILE A CA    
1815 C C     . ILE A 271 ? 0.4969 0.5402 0.4347 -0.0856 0.0232  0.0220  528 ILE A C     
1816 O O     . ILE A 271 ? 0.5150 0.5344 0.4495 -0.0711 0.0238  0.0218  528 ILE A O     
1817 C CB    . ILE A 271 ? 0.4256 0.5401 0.4066 -0.0744 0.0216  0.0318  528 ILE A CB    
1818 C CG1   . ILE A 271 ? 0.4084 0.5680 0.4019 -0.0767 0.0251  0.0384  528 ILE A CG1   
1819 C CG2   . ILE A 271 ? 0.4283 0.5143 0.4102 -0.0561 0.0219  0.0309  528 ILE A CG2   
1820 C CD1   . ILE A 271 ? 0.3836 0.5714 0.3974 -0.0528 0.0271  0.0480  528 ILE A CD1   
1821 N N     . ASN A 272 ? 0.5120 0.5550 0.4422 -0.0942 0.0221  0.0212  529 ASN A N     
1822 C CA    . ASN A 272 ? 0.5288 0.5385 0.4447 -0.0844 0.0234  0.0201  529 ASN A CA    
1823 C C     . ASN A 272 ? 0.5617 0.5180 0.4339 -0.0878 0.0334  0.0170  529 ASN A C     
1824 O O     . ASN A 272 ? 0.5607 0.4894 0.4178 -0.0737 0.0374  0.0188  529 ASN A O     
1825 C CB    . ASN A 272 ? 0.5400 0.5636 0.4588 -0.0920 0.0203  0.0206  529 ASN A CB    
1826 C CG    . ASN A 272 ? 0.5246 0.5891 0.4802 -0.0796 0.0128  0.0255  529 ASN A CG    
1827 O OD1   . ASN A 272 ? 0.6147 0.7033 0.5776 -0.0861 0.0095  0.0275  529 ASN A OD1   
1828 N ND2   . ASN A 272 ? 0.5115 0.5791 0.4839 -0.0625 0.0112  0.0276  529 ASN A ND2   
1829 N N     . SER A 273 ? 0.5588 0.4996 0.4076 -0.1043 0.0392  0.0136  530 SER A N     
1830 C CA    . SER A 273 ? 0.6198 0.4998 0.4167 -0.1074 0.0519  0.0109  530 SER A CA    
1831 C C     . SER A 273 ? 0.6327 0.5003 0.4313 -0.0875 0.0539  0.0137  530 SER A C     
1832 O O     . SER A 273 ? 0.6192 0.5003 0.4255 -0.0967 0.0526  0.0119  530 SER A O     
1833 C CB    . SER A 273 ? 0.6469 0.5107 0.4059 -0.1445 0.0588  0.0047  530 SER A CB    
1834 O OG    . SER A 273 ? 0.7074 0.5027 0.4091 -0.1466 0.0737  0.0019  530 SER A OG    
1835 N N     . PRO A 274 ? 0.6546 0.5007 0.4449 -0.0600 0.0574  0.0193  531 PRO A N     
1836 C CA    . PRO A 274 ? 0.6526 0.4909 0.4406 -0.0421 0.0591  0.0235  531 PRO A CA    
1837 C C     . PRO A 274 ? 0.7042 0.4977 0.4483 -0.0551 0.0706  0.0194  531 PRO A C     
1838 O O     . PRO A 274 ? 0.6973 0.4962 0.4483 -0.0499 0.0690  0.0205  531 PRO A O     
1839 C CB    . PRO A 274 ? 0.6657 0.4909 0.4421 -0.0115 0.0640  0.0330  531 PRO A CB    
1840 C CG    . PRO A 274 ? 0.6539 0.4982 0.4479 -0.0118 0.0596  0.0334  531 PRO A CG    
1841 C CD    . PRO A 274 ? 0.6479 0.4865 0.4345 -0.0429 0.0594  0.0241  531 PRO A CD    
1842 N N     . LYS A 275 ? 0.7283 0.4758 0.4236 -0.0755 0.0826  0.0141  532 LYS A N     
1843 C CA    . LYS A 275 ? 0.7829 0.4795 0.4261 -0.0933 0.0957  0.0092  532 LYS A CA    
1844 C C     . LYS A 275 ? 0.7508 0.4866 0.4177 -0.1229 0.0883  0.0032  532 LYS A C     
1845 O O     . LYS A 275 ? 0.7558 0.4749 0.4071 -0.1264 0.0931  0.0018  532 LYS A O     
1846 C CB    . LYS A 275 ? 0.8679 0.4970 0.4413 -0.1131 0.1124  0.0045  532 LYS A CB    
1847 C CG    . LYS A 275 ? 0.9481 0.5079 0.4509 -0.1340 0.1300  -0.0011 532 LYS A CG    
1848 C CD    . LYS A 275 ? 1.0462 0.5427 0.4755 -0.1703 0.1454  -0.0090 532 LYS A CD    
1849 C CE    . LYS A 275 ? 1.1216 0.5514 0.4780 -0.2009 0.1625  -0.0162 532 LYS A CE    
1850 N NZ    . LYS A 275 ? 1.2368 0.5807 0.4991 -0.2360 0.1830  -0.0238 532 LYS A NZ    
1851 N N     . GLN A 276 ? 0.7082 0.4977 0.4103 -0.1424 0.0779  0.0011  533 GLN A N     
1852 C CA    . GLN A 276 ? 0.6728 0.5140 0.4020 -0.1657 0.0716  -0.0008 533 GLN A CA    
1853 C C     . GLN A 276 ? 0.6128 0.4946 0.3923 -0.1410 0.0626  0.0040  533 GLN A C     
1854 O O     . GLN A 276 ? 0.6022 0.4978 0.3871 -0.1483 0.0637  0.0034  533 GLN A O     
1855 C CB    . GLN A 276 ? 0.6559 0.5495 0.4080 -0.1868 0.0639  -0.0006 533 GLN A CB    
1856 C CG    . GLN A 276 ? 0.7257 0.5826 0.4221 -0.2225 0.0726  -0.0065 533 GLN A CG    
1857 C CD    . GLN A 276 ? 0.7071 0.6283 0.4292 -0.2453 0.0631  -0.0046 533 GLN A CD    
1858 O OE1   . GLN A 276 ? 0.6676 0.6618 0.4308 -0.2520 0.0550  0.0002  533 GLN A OE1   
1859 N NE2   . GLN A 276 ? 0.7500 0.6477 0.4492 -0.2525 0.0646  -0.0064 533 GLN A NE2   
1860 N N     . LEU A 277 ? 0.5764 0.4726 0.3865 -0.1136 0.0551  0.0087  534 LEU A N     
1861 C CA    . LEU A 277 ? 0.5387 0.4615 0.3844 -0.0936 0.0482  0.0125  534 LEU A CA    
1862 C C     . LEU A 277 ? 0.5591 0.4478 0.3827 -0.0845 0.0535  0.0126  534 LEU A C     
1863 O O     . LEU A 277 ? 0.5385 0.4413 0.3758 -0.0831 0.0520  0.0129  534 LEU A O     
1864 C CB    . LEU A 277 ? 0.5177 0.4552 0.3886 -0.0726 0.0405  0.0167  534 LEU A CB    
1865 C CG    . LEU A 277 ? 0.4916 0.4506 0.3900 -0.0581 0.0342  0.0199  534 LEU A CG    
1866 C CD1   . LEU A 277 ? 0.4697 0.4619 0.3906 -0.0639 0.0333  0.0204  534 LEU A CD1   
1867 C CD2   . LEU A 277 ? 0.4838 0.4526 0.3969 -0.0440 0.0278  0.0235  534 LEU A CD2   
1868 N N     . GLY A 278 ? 0.5870 0.4288 0.3726 -0.0760 0.0613  0.0135  535 GLY A N     
1869 C CA    . GLY A 278 ? 0.6122 0.4168 0.3677 -0.0660 0.0687  0.0152  535 GLY A CA    
1870 C C     . GLY A 278 ? 0.6288 0.4187 0.3639 -0.0886 0.0754  0.0093  535 GLY A C     
1871 O O     . GLY A 278 ? 0.6158 0.4042 0.3532 -0.0819 0.0752  0.0104  535 GLY A O     
1872 N N     . VAL A 279 ? 0.6469 0.4287 0.3602 -0.1183 0.0812  0.0034  536 VAL A N     
1873 C CA    . VAL A 279 ? 0.6682 0.4471 0.3641 -0.1452 0.0872  -0.0017 536 VAL A CA    
1874 C C     . VAL A 279 ? 0.6153 0.4565 0.3638 -0.1429 0.0778  0.0006  536 VAL A C     
1875 O O     . VAL A 279 ? 0.6169 0.4533 0.3599 -0.1459 0.0816  -0.0003 536 VAL A O     
1876 C CB    . VAL A 279 ? 0.7065 0.4793 0.3706 -0.1848 0.0936  -0.0077 536 VAL A CB    
1877 C CG1   . VAL A 279 ? 0.7167 0.5019 0.3682 -0.2162 0.0985  -0.0117 536 VAL A CG1   
1878 C CG2   . VAL A 279 ? 0.7777 0.4700 0.3732 -0.1883 0.1078  -0.0107 536 VAL A CG2   
1879 N N     . ILE A 280 ? 0.5586 0.4523 0.3523 -0.1358 0.0680  0.0043  537 ILE A N     
1880 C CA    . ILE A 280 ? 0.5164 0.4610 0.3509 -0.1291 0.0634  0.0083  537 ILE A CA    
1881 C C     . ILE A 280 ? 0.4978 0.4234 0.3373 -0.1060 0.0620  0.0099  537 ILE A C     
1882 O O     . ILE A 280 ? 0.4965 0.4254 0.3366 -0.1071 0.0656  0.0101  537 ILE A O     
1883 C CB    . ILE A 280 ? 0.4811 0.4752 0.3545 -0.1204 0.0558  0.0134  537 ILE A CB    
1884 C CG1   . ILE A 280 ? 0.4921 0.5181 0.3636 -0.1456 0.0558  0.0134  537 ILE A CG1   
1885 C CG2   . ILE A 280 ? 0.4574 0.4879 0.3611 -0.1053 0.0557  0.0193  537 ILE A CG2   
1886 C CD1   . ILE A 280 ? 0.4992 0.5574 0.3641 -0.1725 0.0613  0.0139  537 ILE A CD1   
1887 N N     . LEU A 281 ? 0.4830 0.3902 0.3224 -0.0876 0.0571  0.0117  538 LEU A N     
1888 C CA    . LEU A 281 ? 0.4779 0.3788 0.3235 -0.0702 0.0534  0.0144  538 LEU A CA    
1889 C C     . LEU A 281 ? 0.5077 0.3725 0.3224 -0.0699 0.0594  0.0133  538 LEU A C     
1890 O O     . LEU A 281 ? 0.4983 0.3643 0.3161 -0.0682 0.0598  0.0134  538 LEU A O     
1891 C CB    . LEU A 281 ? 0.4603 0.3631 0.3141 -0.0543 0.0459  0.0182  538 LEU A CB    
1892 C CG    . LEU A 281 ? 0.4392 0.3736 0.3219 -0.0529 0.0400  0.0194  538 LEU A CG    
1893 C CD1   . LEU A 281 ? 0.4281 0.3664 0.3167 -0.0403 0.0329  0.0233  538 LEU A CD1   
1894 C CD2   . LEU A 281 ? 0.4133 0.3704 0.3153 -0.0532 0.0407  0.0200  538 LEU A CD2   
1895 N N     . PHE A 282 ? 0.5377 0.3656 0.3178 -0.0706 0.0657  0.0128  539 PHE A N     
1896 C CA    . PHE A 282 ? 0.5852 0.3731 0.3305 -0.0616 0.0721  0.0146  539 PHE A CA    
1897 C C     . PHE A 282 ? 0.6355 0.3908 0.3463 -0.0809 0.0836  0.0090  539 PHE A C     
1898 O O     . PHE A 282 ? 0.6743 0.4012 0.3610 -0.0746 0.0886  0.0101  539 PHE A O     
1899 C CB    . PHE A 282 ? 0.6004 0.3630 0.3221 -0.0412 0.0749  0.0210  539 PHE A CB    
1900 C CG    . PHE A 282 ? 0.5644 0.3662 0.3204 -0.0253 0.0632  0.0272  539 PHE A CG    
1901 C CD1   . PHE A 282 ? 0.5351 0.3670 0.3151 -0.0190 0.0533  0.0307  539 PHE A CD1   
1902 C CD2   . PHE A 282 ? 0.5578 0.3659 0.3189 -0.0203 0.0624  0.0291  539 PHE A CD2   
1903 C CE1   . PHE A 282 ? 0.5066 0.3747 0.3134 -0.0115 0.0429  0.0354  539 PHE A CE1   
1904 C CE2   . PHE A 282 ? 0.5215 0.3687 0.3143 -0.0092 0.0517  0.0344  539 PHE A CE2   
1905 C CZ    . PHE A 282 ? 0.5011 0.3787 0.3161 -0.0066 0.0419  0.0373  539 PHE A CZ    
1906 N N     . GLU A 283 ? 0.6604 0.4245 0.3685 -0.1067 0.0875  0.0035  540 GLU A N     
1907 C CA    . GLU A 283 ? 0.7095 0.4519 0.3849 -0.1338 0.0983  -0.0023 540 GLU A CA    
1908 C C     . GLU A 283 ? 0.6811 0.4790 0.3930 -0.1485 0.0949  -0.0030 540 GLU A C     
1909 O O     . GLU A 283 ? 0.6957 0.4884 0.4014 -0.1517 0.0993  -0.0039 540 GLU A O     
1910 C CB    . GLU A 283 ? 0.7746 0.4850 0.4076 -0.1586 0.1075  -0.0072 540 GLU A CB    
1911 C CG    . GLU A 283 ? 0.8399 0.4810 0.4226 -0.1387 0.1170  -0.0047 540 GLU A CG    
1912 C CD    . GLU A 283 ? 0.9181 0.5077 0.4432 -0.1617 0.1301  -0.0097 540 GLU A CD    
1913 O OE1   . GLU A 283 ? 0.9535 0.5517 0.4637 -0.2031 0.1336  -0.0170 540 GLU A OE1   
1914 O OE2   . GLU A 283 ? 0.9606 0.5027 0.4527 -0.1380 0.1377  -0.0052 540 GLU A OE2   
1915 N N     . LYS A 284 ? 0.6434 0.4960 0.3922 -0.1544 0.0884  -0.0010 541 LYS A N     
1916 C CA    . LYS A 284 ? 0.6203 0.5306 0.4002 -0.1637 0.0884  0.0018  541 LYS A CA    
1917 C C     . LYS A 284 ? 0.5862 0.5058 0.3921 -0.1369 0.0857  0.0061  541 LYS A C     
1918 O O     . LYS A 284 ? 0.5748 0.5018 0.3801 -0.1401 0.0916  0.0068  541 LYS A O     
1919 C CB    . LYS A 284 ? 0.6087 0.5784 0.4186 -0.1722 0.0834  0.0058  541 LYS A CB    
1920 C CG    . LYS A 284 ? 0.6029 0.6433 0.4424 -0.1794 0.0857  0.0127  541 LYS A CG    
1921 C CD    . LYS A 284 ? 0.5971 0.6977 0.4604 -0.1884 0.0805  0.0183  541 LYS A CD    
1922 C CE    . LYS A 284 ? 0.5964 0.7814 0.4843 -0.2003 0.0840  0.0283  541 LYS A CE    
1923 N NZ    . LYS A 284 ? 0.5877 0.7966 0.5038 -0.1665 0.0886  0.0374  541 LYS A NZ    
1924 N N     . LEU A 285 ? 0.5386 0.4537 0.3611 -0.1135 0.0780  0.0086  542 LEU A N     
1925 C CA    . LEU A 285 ? 0.5204 0.4385 0.3584 -0.0939 0.0764  0.0120  542 LEU A CA    
1926 C C     . LEU A 285 ? 0.5390 0.4131 0.3531 -0.0857 0.0755  0.0102  542 LEU A C     
1927 O O     . LEU A 285 ? 0.5258 0.3957 0.3429 -0.0762 0.0752  0.0117  542 LEU A O     
1928 C CB    . LEU A 285 ? 0.4902 0.4286 0.3534 -0.0787 0.0694  0.0158  542 LEU A CB    
1929 C CG    . LEU A 285 ? 0.4725 0.4607 0.3612 -0.0805 0.0711  0.0206  542 LEU A CG    
1930 C CD1   . LEU A 285 ? 0.4486 0.4452 0.3545 -0.0638 0.0658  0.0241  542 LEU A CD1   
1931 C CD2   . LEU A 285 ? 0.4678 0.4867 0.3647 -0.0793 0.0810  0.0259  542 LEU A CD2   
1932 N N     . GLN A 286 ? 0.5724 0.4126 0.3585 -0.0886 0.0763  0.0081  543 GLN A N     
1933 C CA    . GLN A 286 ? 0.6051 0.4081 0.3643 -0.0793 0.0773  0.0089  543 GLN A CA    
1934 C C     . GLN A 286 ? 0.5885 0.3991 0.3597 -0.0616 0.0674  0.0138  543 GLN A C     
1935 O O     . GLN A 286 ? 0.5833 0.3798 0.3410 -0.0561 0.0665  0.0157  543 GLN A O     
1936 C CB    . GLN A 286 ? 0.6523 0.4438 0.3983 -0.0885 0.0851  0.0063  543 GLN A CB    
1937 C CG    . GLN A 286 ? 0.6812 0.4657 0.4078 -0.1117 0.0953  0.0017  543 GLN A CG    
1938 C CD    . GLN A 286 ? 0.7500 0.4788 0.4275 -0.1149 0.1027  -0.0005 543 GLN A CD    
1939 O OE1   . GLN A 286 ? 0.7942 0.4905 0.4479 -0.1055 0.1057  0.0007  543 GLN A OE1   
1940 N NE2   . GLN A 286 ? 0.7726 0.4847 0.4279 -0.1279 0.1074  -0.0031 543 GLN A NE2   
1941 N N     . LEU A 287 ? 0.5523 0.3867 0.3459 -0.0558 0.0599  0.0161  544 LEU A N     
1942 C CA    . LEU A 287 ? 0.5384 0.3838 0.3389 -0.0453 0.0505  0.0209  544 LEU A CA    
1943 C C     . LEU A 287 ? 0.5621 0.3934 0.3400 -0.0325 0.0492  0.0271  544 LEU A C     
1944 O O     . LEU A 287 ? 0.5740 0.3838 0.3331 -0.0283 0.0561  0.0276  544 LEU A O     
1945 C CB    . LEU A 287 ? 0.5068 0.3782 0.3318 -0.0436 0.0443  0.0218  544 LEU A CB    
1946 C CG    . LEU A 287 ? 0.4926 0.3795 0.3369 -0.0499 0.0476  0.0188  544 LEU A CG    
1947 C CD1   . LEU A 287 ? 0.4652 0.3723 0.3284 -0.0464 0.0416  0.0205  544 LEU A CD1   
1948 C CD2   . LEU A 287 ? 0.4893 0.3676 0.3276 -0.0517 0.0526  0.0178  544 LEU A CD2   
1949 N N     . PRO A 288 ? 0.5619 0.4048 0.3364 -0.0263 0.0420  0.0331  545 PRO A N     
1950 C CA    . PRO A 288 ? 0.5896 0.4321 0.3447 -0.0081 0.0411  0.0435  545 PRO A CA    
1951 C C     . PRO A 288 ? 0.5866 0.4435 0.3478 0.0061  0.0402  0.0498  545 PRO A C     
1952 O O     . PRO A 288 ? 0.5504 0.4352 0.3374 0.0007  0.0332  0.0487  545 PRO A O     
1953 C CB    . PRO A 288 ? 0.5900 0.4627 0.3484 -0.0100 0.0301  0.0499  545 PRO A CB    
1954 C CG    . PRO A 288 ? 0.5760 0.4477 0.3456 -0.0308 0.0280  0.0407  545 PRO A CG    
1955 C CD    . PRO A 288 ? 0.5610 0.4201 0.3451 -0.0361 0.0351  0.0321  545 PRO A CD    
1956 N N     . VAL A 289 ? 0.6342 0.4671 0.3662 0.0258  0.0493  0.0572  546 VAL A N     
1957 C CA    . VAL A 289 ? 0.6456 0.4860 0.3735 0.0460  0.0521  0.0663  546 VAL A CA    
1958 C C     . VAL A 289 ? 0.6492 0.5396 0.3849 0.0651  0.0432  0.0827  546 VAL A C     
1959 O O     . VAL A 289 ? 0.6697 0.5557 0.3803 0.0847  0.0476  0.0939  546 VAL A O     
1960 C CB    . VAL A 289 ? 0.7032 0.4824 0.3824 0.0604  0.0708  0.0679  546 VAL A CB    
1961 C CG1   . VAL A 289 ? 0.7094 0.4876 0.3765 0.0853  0.0775  0.0785  546 VAL A CG1   
1962 C CG2   . VAL A 289 ? 0.7101 0.4495 0.3797 0.0324  0.0781  0.0518  546 VAL A CG2   
1963 N N     . LEU A 290 ? 0.6251 0.5664 0.3938 0.0580  0.0309  0.0848  547 LEU A N     
1964 C CA    . LEU A 290 ? 0.6297 0.6341 0.4095 0.0677  0.0202  0.1005  547 LEU A CA    
1965 C C     . LEU A 290 ? 0.6570 0.6852 0.4334 0.0992  0.0256  0.1168  547 LEU A C     
1966 O O     . LEU A 290 ? 0.6546 0.7405 0.4348 0.1154  0.0200  0.1349  547 LEU A O     
1967 C CB    . LEU A 290 ? 0.5926 0.6380 0.4031 0.0389  0.0057  0.0943  547 LEU A CB    
1968 C CG    . LEU A 290 ? 0.5914 0.6143 0.4023 0.0092  0.0021  0.0798  547 LEU A CG    
1969 C CD1   . LEU A 290 ? 0.5599 0.6127 0.3887 -0.0155 -0.0081 0.0756  547 LEU A CD1   
1970 C CD2   . LEU A 290 ? 0.6073 0.6289 0.3977 0.0085  0.0006  0.0845  547 LEU A CD2   
1971 N N     . LYS A 291 ? 0.6765 0.6647 0.4444 0.1069  0.0368  0.1114  548 LYS A N     
1972 C CA    . LYS A 291 ? 0.7206 0.7240 0.4825 0.1367  0.0443  0.1257  548 LYS A CA    
1973 C C     . LYS A 291 ? 0.7582 0.6874 0.4885 0.1433  0.0621  0.1176  548 LYS A C     
1974 O O     . LYS A 291 ? 0.7109 0.6084 0.4480 0.1152  0.0612  0.0995  548 LYS A O     
1975 C CB    . LYS A 291 ? 0.7073 0.7750 0.5105 0.1236  0.0301  0.1272  548 LYS A CB    
1976 C CG    . LYS A 291 ? 0.7430 0.8438 0.5467 0.1545  0.0360  0.1445  548 LYS A CG    
1977 C CD    . LYS A 291 ? 0.7248 0.9013 0.5692 0.1361  0.0196  0.1472  548 LYS A CD    
1978 C CE    . LYS A 291 ? 0.7497 0.9459 0.5995 0.1584  0.0264  0.1575  548 LYS A CE    
1979 N NZ    . LYS A 291 ? 0.7363 1.0142 0.6220 0.1405  0.0108  0.1630  548 LYS A NZ    
1980 N N     . LYS A 292 ? 0.8272 0.7296 0.5182 0.1806  0.0797  0.1325  549 LYS A N     
1981 C CA    . LYS A 292 ? 0.8917 0.7158 0.5389 0.1861  0.0996  0.1262  549 LYS A CA    
1982 C C     . LYS A 292 ? 0.9022 0.7445 0.5519 0.2091  0.1054  0.1372  549 LYS A C     
1983 O O     . LYS A 292 ? 0.8697 0.7846 0.5463 0.2311  0.0981  0.1548  549 LYS A O     
1984 C CB    . LYS A 292 ? 0.9911 0.7409 0.5703 0.2104  0.1222  0.1328  549 LYS A CB    
1985 C CG    . LYS A 292 ? 1.0090 0.7402 0.5826 0.1896  0.1179  0.1231  549 LYS A CG    
1986 C CD    . LYS A 292 ? 1.1021 0.7339 0.6008 0.1952  0.1423  0.1197  549 LYS A CD    
1987 C CE    . LYS A 292 ? 1.1976 0.7917 0.6361 0.2485  0.1659  0.1423  549 LYS A CE    
1988 N NZ    . LYS A 292 ? 1.2136 0.8765 0.6713 0.2831  0.1582  0.1648  549 LYS A NZ    
1989 N N     . SER A 293 ? 0.9257 0.7065 0.5479 0.1992  0.1176  0.1262  550 SER A N     
1990 C CA    A SER A 293 ? 0.9445 0.7193 0.5532 0.2225  0.1289  0.1354  550 SER A CA    
1991 C CA    B SER A 293 ? 0.9435 0.7184 0.5522 0.2225  0.1289  0.1355  550 SER A CA    
1992 C C     . SER A 293 ? 1.0417 0.7218 0.5661 0.2527  0.1602  0.1432  550 SER A C     
1993 O O     . SER A 293 ? 1.0683 0.6883 0.5491 0.2474  0.1706  0.1379  550 SER A O     
1994 C CB    A SER A 293 ? 0.9095 0.6773 0.5407 0.1867  0.1212  0.1171  550 SER A CB    
1995 C CB    B SER A 293 ? 0.9076 0.6767 0.5395 0.1871  0.1210  0.1173  550 SER A CB    
1996 O OG    A SER A 293 ? 0.9354 0.6313 0.5313 0.1559  0.1289  0.0990  550 SER A OG    
1997 O OG    B SER A 293 ? 0.8282 0.6603 0.5233 0.1551  0.0962  0.1068  550 SER A OG    
1998 N N     . LYS A 294 ? 1.0890 0.7499 0.5848 0.2837  0.1770  0.1555  551 LYS A N     
1999 C CA    . LYS A 294 ? 1.1978 0.7515 0.6000 0.3123  0.2116  0.1621  551 LYS A CA    
2000 C C     . LYS A 294 ? 1.2322 0.6875 0.5813 0.2693  0.2212  0.1385  551 LYS A C     
2001 O O     . LYS A 294 ? 1.2893 0.6666 0.5687 0.2807  0.2422  0.1408  551 LYS A O     
2002 C CB    . LYS A 294 ? 1.2394 0.7783 0.6230 0.3343  0.2259  0.1703  551 LYS A CB    
2003 C CG    . LYS A 294 ? 1.3769 0.8039 0.6550 0.3753  0.2665  0.1828  551 LYS A CG    
2004 C CD    . LYS A 294 ? 1.4140 0.8171 0.6715 0.3882  0.2804  0.1864  551 LYS A CD    
2005 C CE    . LYS A 294 ? 1.5514 0.8237 0.6892 0.4263  0.3252  0.1971  551 LYS A CE    
2006 N NZ    . LYS A 294 ? 1.5963 0.8898 0.7094 0.5047  0.3470  0.2328  551 LYS A NZ    
2007 N N     . THR A 295 ? 1.1927 0.6569 0.5742 0.2190  0.2057  0.1169  552 THR A N     
2008 C CA    . THR A 295 ? 1.2324 0.6149 0.5635 0.1736  0.2149  0.0959  552 THR A CA    
2009 C C     . THR A 295 ? 1.1865 0.5998 0.5566 0.1313  0.1954  0.0801  552 THR A C     
2010 O O     . THR A 295 ? 1.2442 0.5991 0.5721 0.0931  0.2032  0.0648  552 THR A O     
2011 C CB    . THR A 295 ? 1.2339 0.6004 0.5621 0.1441  0.2145  0.0837  552 THR A CB    
2012 O OG1   . THR A 295 ? 1.1168 0.5850 0.5386 0.1309  0.1853  0.0805  552 THR A OG1   
2013 C CG2   . THR A 295 ? 1.3105 0.6143 0.5737 0.1825  0.2420  0.0972  552 THR A CG2   
2014 N N     . GLY A 296 ? 1.0860 0.5884 0.5306 0.1359  0.1718  0.0841  553 GLY A N     
2015 C CA    . GLY A 296 ? 1.0354 0.5648 0.5152 0.0989  0.1555  0.0700  553 GLY A CA    
2016 C C     . GLY A 296 ? 0.9501 0.5684 0.5024 0.1047  0.1320  0.0750  553 GLY A C     
2017 O O     . GLY A 296 ? 0.9522 0.6003 0.5107 0.1397  0.1315  0.0915  553 GLY A O     
2018 N N     . TYR A 297 ? 0.8786 0.5386 0.4804 0.0701  0.1141  0.0618  554 TYR A N     
2019 C CA    . TYR A 297 ? 0.8111 0.5427 0.4714 0.0699  0.0940  0.0643  554 TYR A CA    
2020 C C     . TYR A 297 ? 0.7296 0.5220 0.4407 0.0702  0.0794  0.0665  554 TYR A C     
2021 O O     . TYR A 297 ? 0.7095 0.4986 0.4294 0.0533  0.0782  0.0583  554 TYR A O     
2022 C CB    . TYR A 297 ? 0.8047 0.5453 0.4868 0.0364  0.0853  0.0504  554 TYR A CB    
2023 C CG    . TYR A 297 ? 0.8785 0.5621 0.5157 0.0199  0.0983  0.0426  554 TYR A CG    
2024 C CD1   . TYR A 297 ? 0.9090 0.5699 0.5202 0.0328  0.1042  0.0476  554 TYR A CD1   
2025 C CD2   . TYR A 297 ? 0.9047 0.5641 0.5268 -0.0129 0.1034  0.0302  554 TYR A CD2   
2026 C CE1   . TYR A 297 ? 0.9714 0.5790 0.5397 0.0146  0.1164  0.0397  554 TYR A CE1   
2027 C CE2   . TYR A 297 ? 0.9522 0.5648 0.5317 -0.0345 0.1151  0.0227  554 TYR A CE2   
2028 C CZ    . TYR A 297 ? 1.0050 0.5890 0.5572 -0.0206 0.1219  0.0269  554 TYR A CZ    
2029 O OH    . TYR A 297 ? 1.0853 0.6202 0.5920 -0.0438 0.1344  0.0191  554 TYR A OH    
2030 N N     . SER A 298 ? 0.6794 0.5289 0.4221 0.0847  0.0678  0.0771  555 SER A N     
2031 C CA    . SER A 298 ? 0.6286 0.5347 0.4155 0.0796  0.0540  0.0783  555 SER A CA    
2032 C C     . SER A 298 ? 0.5726 0.4953 0.3930 0.0478  0.0419  0.0641  555 SER A C     
2033 O O     . SER A 298 ? 0.5545 0.4752 0.3783 0.0349  0.0382  0.0588  555 SER A O     
2034 C CB    . SER A 298 ? 0.6275 0.5947 0.4337 0.0967  0.0449  0.0937  555 SER A CB    
2035 O OG    . SER A 298 ? 0.6112 0.6292 0.4550 0.0853  0.0323  0.0933  555 SER A OG    
2036 N N     . THR A 299 ? 0.5165 0.4546 0.3586 0.0384  0.0372  0.0597  556 THR A N     
2037 C CA    . THR A 299 ? 0.4816 0.4386 0.3531 0.0158  0.0277  0.0500  556 THR A CA    
2038 C C     . THR A 299 ? 0.4543 0.4536 0.3527 0.0156  0.0179  0.0539  556 THR A C     
2039 O O     . THR A 299 ? 0.4303 0.4377 0.3468 0.0021  0.0134  0.0474  556 THR A O     
2040 C CB    . THR A 299 ? 0.4736 0.4070 0.3419 -0.0003 0.0324  0.0399  556 THR A CB    
2041 O OG1   . THR A 299 ? 0.4652 0.3951 0.3310 0.0034  0.0351  0.0409  556 THR A OG1   
2042 C CG2   . THR A 299 ? 0.4951 0.3867 0.3304 -0.0070 0.0431  0.0356  556 THR A CG2   
2043 N N     . SER A 300 ? 0.4662 0.4949 0.3650 0.0307  0.0155  0.0657  557 SER A N     
2044 C CA    . SER A 300 ? 0.4533 0.5269 0.3742 0.0262  0.0065  0.0701  557 SER A CA    
2045 C C     . SER A 300 ? 0.4370 0.5242 0.3691 0.0018  -0.0028 0.0636  557 SER A C     
2046 O O     . SER A 300 ? 0.4273 0.4989 0.3505 -0.0058 -0.0028 0.0597  557 SER A O     
2047 C CB    . SER A 300 ? 0.4711 0.5857 0.3897 0.0473  0.0063  0.0871  557 SER A CB    
2048 O OG    . SER A 300 ? 0.5168 0.6558 0.4310 0.0465  0.0013  0.0939  557 SER A OG    
2049 N N     . ALA A 301 ? 0.4242 0.5332 0.3693 -0.0107 -0.0086 0.0622  558 ALA A N     
2050 C CA    . ALA A 301 ? 0.4305 0.5358 0.3732 -0.0344 -0.0131 0.0553  558 ALA A CA    
2051 C C     . ALA A 301 ? 0.4592 0.5818 0.3894 -0.0453 -0.0181 0.0595  558 ALA A C     
2052 O O     . ALA A 301 ? 0.4641 0.5595 0.3805 -0.0592 -0.0167 0.0524  558 ALA A O     
2053 C CB    . ALA A 301 ? 0.4188 0.5399 0.3682 -0.0472 -0.0166 0.0541  558 ALA A CB    
2054 N N     . ASP A 302 ? 0.4696 0.6384 0.4024 -0.0375 -0.0229 0.0722  559 ASP A N     
2055 C CA    . ASP A 302 ? 0.5228 0.7205 0.4440 -0.0509 -0.0297 0.0782  559 ASP A CA    
2056 C C     . ASP A 302 ? 0.5249 0.6898 0.4322 -0.0431 -0.0255 0.0758  559 ASP A C     
2057 O O     . ASP A 302 ? 0.5540 0.7143 0.4455 -0.0627 -0.0289 0.0730  559 ASP A O     
2058 C CB    . ASP A 302 ? 0.5685 0.8389 0.4987 -0.0408 -0.0358 0.0965  559 ASP A CB    
2059 C CG    . ASP A 302 ? 0.6165 0.8908 0.5484 -0.0003 -0.0281 0.1088  559 ASP A CG    
2060 O OD1   . ASP A 302 ? 0.6757 0.9155 0.6102 0.0186  -0.0190 0.1053  559 ASP A OD1   
2061 O OD2   . ASP A 302 ? 0.7154 1.0250 0.6404 0.0122  -0.0300 0.1226  559 ASP A OD2   
2062 N N     . VAL A 303 ? 0.4965 0.6332 0.4043 -0.0179 -0.0169 0.0760  560 VAL A N     
2063 C CA    . VAL A 303 ? 0.4935 0.5931 0.3863 -0.0119 -0.0110 0.0723  560 VAL A CA    
2064 C C     . VAL A 303 ? 0.4862 0.5444 0.3761 -0.0301 -0.0079 0.0576  560 VAL A C     
2065 O O     . VAL A 303 ? 0.4858 0.5276 0.3620 -0.0404 -0.0075 0.0540  560 VAL A O     
2066 C CB    . VAL A 303 ? 0.5063 0.5784 0.3909 0.0144  -0.0003 0.0752  560 VAL A CB    
2067 C CG1   . VAL A 303 ? 0.5185 0.5467 0.3835 0.0154  0.0070  0.0694  560 VAL A CG1   
2068 C CG2   . VAL A 303 ? 0.5154 0.6245 0.3962 0.0404  0.0008  0.0929  560 VAL A CG2   
2069 N N     . LEU A 304 ? 0.4584 0.5028 0.3597 -0.0327 -0.0050 0.0507  561 LEU A N     
2070 C CA    . LEU A 304 ? 0.4694 0.4819 0.3679 -0.0432 0.0001  0.0406  561 LEU A CA    
2071 C C     . LEU A 304 ? 0.4790 0.4852 0.3617 -0.0629 -0.0019 0.0378  561 LEU A C     
2072 O O     . LEU A 304 ? 0.4824 0.4591 0.3509 -0.0675 0.0042  0.0329  561 LEU A O     
2073 C CB    . LEU A 304 ? 0.4590 0.4664 0.3719 -0.0408 0.0032  0.0365  561 LEU A CB    
2074 C CG    . LEU A 304 ? 0.4578 0.4585 0.3770 -0.0288 0.0078  0.0363  561 LEU A CG    
2075 C CD1   . LEU A 304 ? 0.4422 0.4452 0.3751 -0.0307 0.0089  0.0329  561 LEU A CD1   
2076 C CD2   . LEU A 304 ? 0.4819 0.4595 0.3901 -0.0282 0.0145  0.0331  561 LEU A CD2   
2077 N N     . GLU A 305 ? 0.4975 0.5284 0.3772 -0.0761 -0.0088 0.0410  562 GLU A N     
2078 C CA    . GLU A 305 ? 0.5472 0.5659 0.3991 -0.1018 -0.0097 0.0380  562 GLU A CA    
2079 C C     . GLU A 305 ? 0.5560 0.5646 0.3887 -0.1077 -0.0098 0.0385  562 GLU A C     
2080 O O     . GLU A 305 ? 0.5916 0.5618 0.3963 -0.1219 -0.0035 0.0324  562 GLU A O     
2081 C CB    . GLU A 305 ? 0.5817 0.6416 0.4308 -0.1207 -0.0191 0.0434  562 GLU A CB    
2082 C CG    . GLU A 305 ? 0.6210 0.6715 0.4725 -0.1259 -0.0164 0.0394  562 GLU A CG    
2083 C CD    . GLU A 305 ? 0.6587 0.7615 0.5165 -0.1402 -0.0259 0.0464  562 GLU A CD    
2084 O OE1   . GLU A 305 ? 0.7115 0.8463 0.5527 -0.1646 -0.0333 0.0511  562 GLU A OE1   
2085 O OE2   . GLU A 305 ? 0.7112 0.8271 0.5900 -0.1286 -0.0258 0.0477  562 GLU A OE2   
2086 N N     . LYS A 306 ? 0.5415 0.5806 0.3847 -0.0948 -0.0152 0.0466  563 LYS A N     
2087 C CA    . LYS A 306 ? 0.5557 0.5898 0.3808 -0.0988 -0.0162 0.0486  563 LYS A CA    
2088 C C     . LYS A 306 ? 0.5402 0.5264 0.3603 -0.0881 -0.0054 0.0412  563 LYS A C     
2089 O O     . LYS A 306 ? 0.5469 0.5132 0.3461 -0.0964 -0.0033 0.0392  563 LYS A O     
2090 C CB    . LYS A 306 ? 0.5696 0.6523 0.4041 -0.0830 -0.0235 0.0623  563 LYS A CB    
2091 C CG    . LYS A 306 ? 0.5922 0.7390 0.4298 -0.0968 -0.0351 0.0732  563 LYS A CG    
2092 C CD    . LYS A 306 ? 0.6162 0.8172 0.4574 -0.0784 -0.0409 0.0906  563 LYS A CD    
2093 C CE    . LYS A 306 ? 0.6184 0.9004 0.4723 -0.0828 -0.0511 0.1058  563 LYS A CE    
2094 N NZ    . LYS A 306 ? 0.6229 0.9158 0.5005 -0.0602 -0.0471 0.1092  563 LYS A NZ    
2095 N N     . LEU A 307 ? 0.5034 0.4742 0.3411 -0.0724 0.0015  0.0374  564 LEU A N     
2096 C CA    . LEU A 307 ? 0.5013 0.4374 0.3360 -0.0658 0.0120  0.0314  564 LEU A CA    
2097 C C     . LEU A 307 ? 0.5112 0.4171 0.3364 -0.0720 0.0215  0.0250  564 LEU A C     
2098 O O     . LEU A 307 ? 0.5126 0.3969 0.3336 -0.0665 0.0313  0.0222  564 LEU A O     
2099 C CB    . LEU A 307 ? 0.4815 0.4204 0.3346 -0.0500 0.0155  0.0315  564 LEU A CB    
2100 C CG    . LEU A 307 ? 0.4851 0.4375 0.3371 -0.0368 0.0125  0.0386  564 LEU A CG    
2101 C CD1   . LEU A 307 ? 0.4731 0.4145 0.3317 -0.0271 0.0189  0.0367  564 LEU A CD1   
2102 C CD2   . LEU A 307 ? 0.4932 0.4340 0.3253 -0.0345 0.0138  0.0413  564 LEU A CD2   
2103 N N     . ALA A 308 ? 0.5163 0.4208 0.3357 -0.0809 0.0208  0.0241  565 ALA A N     
2104 C CA    . ALA A 308 ? 0.5358 0.4055 0.3386 -0.0807 0.0333  0.0206  565 ALA A CA    
2105 C C     . ALA A 308 ? 0.5782 0.4085 0.3503 -0.0831 0.0448  0.0182  565 ALA A C     
2106 O O     . ALA A 308 ? 0.5976 0.4098 0.3684 -0.0686 0.0581  0.0185  565 ALA A O     
2107 C CB    . ALA A 308 ? 0.5507 0.4124 0.3359 -0.0947 0.0323  0.0197  565 ALA A CB    
2108 N N     . PRO A 309 ? 0.5996 0.4214 0.3471 -0.1000 0.0401  0.0175  566 PRO A N     
2109 C CA    . PRO A 309 ? 0.6321 0.4109 0.3462 -0.1027 0.0524  0.0149  566 PRO A CA    
2110 C C     . PRO A 309 ? 0.6153 0.3961 0.3475 -0.0842 0.0591  0.0156  566 PRO A C     
2111 O O     . PRO A 309 ? 0.6493 0.3953 0.3579 -0.0797 0.0735  0.0147  566 PRO A O     
2112 C CB    . PRO A 309 ? 0.6594 0.4416 0.3487 -0.1270 0.0421  0.0149  566 PRO A CB    
2113 C CG    . PRO A 309 ? 0.6495 0.4675 0.3461 -0.1421 0.0286  0.0174  566 PRO A CG    
2114 C CD    . PRO A 309 ? 0.6034 0.4541 0.3458 -0.1196 0.0253  0.0200  566 PRO A CD    
2115 N N     . TYR A 310 ? 0.5581 0.3751 0.3253 -0.0749 0.0509  0.0175  567 TYR A N     
2116 C CA    . TYR A 310 ? 0.5472 0.3656 0.3263 -0.0636 0.0579  0.0174  567 TYR A CA    
2117 C C     . TYR A 310 ? 0.5304 0.3568 0.3265 -0.0495 0.0692  0.0191  567 TYR A C     
2118 O O     . TYR A 310 ? 0.5194 0.3446 0.3163 -0.0439 0.0784  0.0198  567 TYR A O     
2119 C CB    . TYR A 310 ? 0.5246 0.3663 0.3212 -0.0612 0.0488  0.0186  567 TYR A CB    
2120 C CG    . TYR A 310 ? 0.5422 0.3844 0.3226 -0.0684 0.0396  0.0208  567 TYR A CG    
2121 C CD1   . TYR A 310 ? 0.5706 0.3925 0.3299 -0.0719 0.0431  0.0200  567 TYR A CD1   
2122 C CD2   . TYR A 310 ? 0.5397 0.4082 0.3251 -0.0714 0.0276  0.0253  567 TYR A CD2   
2123 C CE1   . TYR A 310 ? 0.5837 0.4126 0.3272 -0.0777 0.0341  0.0241  567 TYR A CE1   
2124 C CE2   . TYR A 310 ? 0.5607 0.4434 0.3322 -0.0767 0.0188  0.0307  567 TYR A CE2   
2125 C CZ    . TYR A 310 ? 0.5746 0.4378 0.3252 -0.0794 0.0217  0.0303  567 TYR A CZ    
2126 O OH    . TYR A 310 ? 0.5906 0.4741 0.3278 -0.0830 0.0127  0.0376  567 TYR A OH    
2127 N N     . HIS A 311 ? 0.5175 0.3590 0.3284 -0.0442 0.0680  0.0208  568 HIS A N     
2128 C CA    . HIS A 311 ? 0.5073 0.3717 0.3391 -0.0304 0.0763  0.0249  568 HIS A CA    
2129 C C     . HIS A 311 ? 0.5110 0.3787 0.3462 -0.0233 0.0775  0.0276  568 HIS A C     
2130 O O     . HIS A 311 ? 0.5017 0.3717 0.3396 -0.0316 0.0668  0.0253  568 HIS A O     
2131 C CB    . HIS A 311 ? 0.4778 0.3759 0.3362 -0.0337 0.0697  0.0243  568 HIS A CB    
2132 C CG    . HIS A 311 ? 0.4733 0.4025 0.3484 -0.0267 0.0791  0.0291  568 HIS A CG    
2133 N ND1   . HIS A 311 ? 0.4604 0.4189 0.3527 -0.0169 0.0819  0.0349  568 HIS A ND1   
2134 C CD2   . HIS A 311 ? 0.4750 0.4167 0.3510 -0.0293 0.0865  0.0303  568 HIS A CD2   
2135 C CE1   . HIS A 311 ? 0.4560 0.4520 0.3618 -0.0135 0.0898  0.0409  568 HIS A CE1   
2136 N NE2   . HIS A 311 ? 0.4693 0.4551 0.3652 -0.0227 0.0927  0.0376  568 HIS A NE2   
2137 N N     . GLU A 312 ? 0.5274 0.3980 0.3613 -0.0058 0.0917  0.0341  569 GLU A N     
2138 C CA    . GLU A 312 ? 0.5530 0.4197 0.3825 0.0063  0.0973  0.0387  569 GLU A CA    
2139 C C     . GLU A 312 ? 0.5110 0.4211 0.3758 0.0044  0.0850  0.0392  569 GLU A C     
2140 O O     . GLU A 312 ? 0.5189 0.4227 0.3802 0.0074  0.0838  0.0401  569 GLU A O     
2141 C CB    . GLU A 312 ? 0.5938 0.4604 0.4134 0.0328  0.1180  0.0494  569 GLU A CB    
2142 C CG    . GLU A 312 ? 0.6336 0.4958 0.4447 0.0526  0.1275  0.0572  569 GLU A CG    
2143 C CD    . GLU A 312 ? 0.6903 0.5354 0.4748 0.0844  0.1530  0.0699  569 GLU A CD    
2144 O OE1   . GLU A 312 ? 0.7270 0.5760 0.5086 0.0904  0.1619  0.0729  569 GLU A OE1   
2145 O OE2   . GLU A 312 ? 0.7253 0.5502 0.4882 0.1051  0.1658  0.0776  569 GLU A OE2   
2146 N N     . ILE A 313 ? 0.4693 0.4176 0.3618 -0.0025 0.0773  0.0383  570 ILE A N     
2147 C CA    . ILE A 313 ? 0.4394 0.4221 0.3580 -0.0078 0.0668  0.0380  570 ILE A CA    
2148 C C     . ILE A 313 ? 0.4331 0.3983 0.3475 -0.0167 0.0556  0.0327  570 ILE A C     
2149 O O     . ILE A 313 ? 0.4241 0.4035 0.3502 -0.0148 0.0512  0.0339  570 ILE A O     
2150 C CB    . ILE A 313 ? 0.4164 0.4262 0.3496 -0.0210 0.0620  0.0358  570 ILE A CB    
2151 C CG1   . ILE A 313 ? 0.3957 0.4448 0.3496 -0.0250 0.0574  0.0384  570 ILE A CG1   
2152 C CG2   . ILE A 313 ? 0.4120 0.3956 0.3336 -0.0336 0.0540  0.0284  570 ILE A CG2   
2153 C CD1   . ILE A 313 ? 0.3902 0.4562 0.3461 -0.0446 0.0544  0.0351  570 ILE A CD1   
2154 N N     . VAL A 314 ? 0.4455 0.3856 0.3433 -0.0261 0.0511  0.0282  571 VAL A N     
2155 C CA    . VAL A 314 ? 0.4490 0.3881 0.3464 -0.0347 0.0399  0.0257  571 VAL A CA    
2156 C C     . VAL A 314 ? 0.4636 0.3956 0.3544 -0.0350 0.0397  0.0265  571 VAL A C     
2157 O O     . VAL A 314 ? 0.4412 0.3912 0.3467 -0.0361 0.0324  0.0268  571 VAL A O     
2158 C CB    . VAL A 314 ? 0.4691 0.3932 0.3485 -0.0445 0.0353  0.0238  571 VAL A CB    
2159 C CG1   . VAL A 314 ? 0.4644 0.4028 0.3461 -0.0515 0.0241  0.0249  571 VAL A CG1   
2160 C CG2   . VAL A 314 ? 0.4619 0.3885 0.3441 -0.0435 0.0356  0.0231  571 VAL A CG2   
2161 N N     . GLU A 315 ? 0.5078 0.4075 0.3704 -0.0344 0.0496  0.0267  572 GLU A N     
2162 C CA    . GLU A 315 ? 0.5325 0.4145 0.3783 -0.0362 0.0526  0.0270  572 GLU A CA    
2163 C C     . GLU A 315 ? 0.4896 0.3950 0.3588 -0.0203 0.0546  0.0315  572 GLU A C     
2164 O O     . GLU A 315 ? 0.4792 0.3880 0.3507 -0.0239 0.0501  0.0311  572 GLU A O     
2165 C CB    . GLU A 315 ? 0.6284 0.4564 0.4260 -0.0376 0.0679  0.0268  572 GLU A CB    
2166 C CG    . GLU A 315 ? 0.7030 0.5161 0.4916 -0.0139 0.0856  0.0326  572 GLU A CG    
2167 C CD    . GLU A 315 ? 0.8275 0.5736 0.5565 -0.0140 0.1042  0.0325  572 GLU A CD    
2168 O OE1   . GLU A 315 ? 0.9159 0.6221 0.6076 -0.0220 0.1103  0.0308  572 GLU A OE1   
2169 O OE2   . GLU A 315 ? 0.9167 0.6449 0.6306 -0.0075 0.1142  0.0338  572 GLU A OE2   
2170 N N     . ASN A 316 ? 0.4590 0.3863 0.3458 -0.0051 0.0604  0.0363  573 ASN A N     
2171 C CA    . ASN A 316 ? 0.4355 0.3952 0.3447 0.0077  0.0612  0.0422  573 ASN A CA    
2172 C C     . ASN A 316 ? 0.3948 0.3844 0.3308 -0.0035 0.0466  0.0387  573 ASN A C     
2173 O O     . ASN A 316 ? 0.3858 0.3855 0.3294 -0.0005 0.0440  0.0404  573 ASN A O     
2174 C CB    . ASN A 316 ? 0.4330 0.4218 0.3544 0.0226  0.0703  0.0500  573 ASN A CB    
2175 C CG    . ASN A 316 ? 0.4797 0.4418 0.3727 0.0454  0.0898  0.0584  573 ASN A CG    
2176 O OD1   . ASN A 316 ? 0.4922 0.4525 0.3769 0.0640  0.0986  0.0663  573 ASN A OD1   
2177 N ND2   . ASN A 316 ? 0.4866 0.4251 0.3609 0.0467  0.0985  0.0578  573 ASN A ND2   
2178 N N     . ILE A 317 ? 0.3746 0.3718 0.3188 -0.0149 0.0390  0.0343  574 ILE A N     
2179 C CA    . ILE A 317 ? 0.3574 0.3689 0.3149 -0.0231 0.0287  0.0315  574 ILE A CA    
2180 C C     . ILE A 317 ? 0.3556 0.3592 0.3091 -0.0268 0.0225  0.0301  574 ILE A C     
2181 O O     . ILE A 317 ? 0.3353 0.3522 0.2998 -0.0264 0.0183  0.0306  574 ILE A O     
2182 C CB    . ILE A 317 ? 0.3583 0.3671 0.3132 -0.0305 0.0261  0.0285  574 ILE A CB    
2183 C CG1   . ILE A 317 ? 0.3614 0.3861 0.3215 -0.0328 0.0316  0.0296  574 ILE A CG1   
2184 C CG2   . ILE A 317 ? 0.3422 0.3522 0.2984 -0.0336 0.0198  0.0273  574 ILE A CG2   
2185 C CD1   . ILE A 317 ? 0.3928 0.4025 0.3403 -0.0389 0.0338  0.0268  574 ILE A CD1   
2186 N N     . LEU A 318 ? 0.3786 0.3629 0.3139 -0.0327 0.0225  0.0288  575 LEU A N     
2187 C CA    . LEU A 318 ? 0.3858 0.3691 0.3139 -0.0415 0.0171  0.0284  575 LEU A CA    
2188 C C     . LEU A 318 ? 0.3956 0.3720 0.3207 -0.0377 0.0213  0.0293  575 LEU A C     
2189 O O     . LEU A 318 ? 0.3845 0.3738 0.3177 -0.0410 0.0158  0.0295  575 LEU A O     
2190 C CB    . LEU A 318 ? 0.4070 0.3724 0.3092 -0.0553 0.0170  0.0269  575 LEU A CB    
2191 C CG    . LEU A 318 ? 0.4011 0.3791 0.3044 -0.0596 0.0109  0.0279  575 LEU A CG    
2192 C CD1   . LEU A 318 ? 0.4303 0.3862 0.3030 -0.0748 0.0130  0.0262  575 LEU A CD1   
2193 C CD2   . LEU A 318 ? 0.3918 0.4041 0.3096 -0.0603 0.0012  0.0321  575 LEU A CD2   
2194 N N     . HIS A 319 ? 0.4289 0.3847 0.3401 -0.0278 0.0326  0.0311  576 HIS A N     
2195 C CA    . HIS A 319 ? 0.4549 0.3996 0.3573 -0.0188 0.0395  0.0341  576 HIS A CA    
2196 C C     . HIS A 319 ? 0.4211 0.4024 0.3550 -0.0104 0.0339  0.0370  576 HIS A C     
2197 O O     . HIS A 319 ? 0.4017 0.3853 0.3374 -0.0107 0.0317  0.0374  576 HIS A O     
2198 C CB    . HIS A 319 ? 0.5146 0.4288 0.3905 -0.0029 0.0564  0.0388  576 HIS A CB    
2199 C CG    . HIS A 319 ? 0.5602 0.4475 0.4112 0.0097  0.0681  0.0433  576 HIS A CG    
2200 N ND1   . HIS A 319 ? 0.6120 0.4770 0.4436 -0.0042 0.0662  0.0394  576 HIS A ND1   
2201 C CD2   . HIS A 319 ? 0.5986 0.4776 0.4371 0.0376  0.0840  0.0533  576 HIS A CD2   
2202 C CE1   . HIS A 319 ? 0.6445 0.4800 0.4492 0.0133  0.0806  0.0452  576 HIS A CE1   
2203 N NE2   . HIS A 319 ? 0.6579 0.5032 0.4671 0.0416  0.0919  0.0548  576 HIS A NE2   
2204 N N     . TYR A 320 ? 0.4020 0.4106 0.3570 -0.0065 0.0318  0.0385  577 TYR A N     
2205 C CA    . TYR A 320 ? 0.3891 0.4307 0.3672 -0.0058 0.0263  0.0403  577 TYR A CA    
2206 C C     . TYR A 320 ? 0.3815 0.4254 0.3662 -0.0159 0.0168  0.0361  577 TYR A C     
2207 O O     . TYR A 320 ? 0.3688 0.4226 0.3604 -0.0144 0.0145  0.0373  577 TYR A O     
2208 C CB    . TYR A 320 ? 0.3925 0.4578 0.3822 -0.0085 0.0265  0.0413  577 TYR A CB    
2209 C CG    . TYR A 320 ? 0.4051 0.4990 0.4089 -0.0158 0.0212  0.0418  577 TYR A CG    
2210 C CD1   . TYR A 320 ? 0.4165 0.5014 0.4179 -0.0279 0.0153  0.0362  577 TYR A CD1   
2211 C CD2   . TYR A 320 ? 0.4192 0.5486 0.4338 -0.0101 0.0233  0.0493  577 TYR A CD2   
2212 C CE1   . TYR A 320 ? 0.4365 0.5362 0.4402 -0.0378 0.0126  0.0357  577 TYR A CE1   
2213 C CE2   . TYR A 320 ? 0.4283 0.5845 0.4507 -0.0230 0.0178  0.0493  577 TYR A CE2   
2214 C CZ    . TYR A 320 ? 0.4352 0.5704 0.4492 -0.0386 0.0129  0.0413  577 TYR A CZ    
2215 O OH    . TYR A 320 ? 0.4845 0.6334 0.4955 -0.0543 0.0096  0.0401  577 TYR A OH    
2216 N N     . ARG A 321 ? 0.3838 0.4198 0.3643 -0.0234 0.0127  0.0327  578 ARG A N     
2217 C CA    . ARG A 321 ? 0.3825 0.4244 0.3670 -0.0272 0.0064  0.0320  578 ARG A CA    
2218 C C     . ARG A 321 ? 0.3869 0.4281 0.3686 -0.0297 0.0046  0.0325  578 ARG A C     
2219 O O     . ARG A 321 ? 0.3674 0.4193 0.3570 -0.0290 0.0015  0.0333  578 ARG A O     
2220 C CB    . ARG A 321 ? 0.3904 0.4299 0.3681 -0.0301 0.0039  0.0320  578 ARG A CB    
2221 C CG    . ARG A 321 ? 0.3957 0.4304 0.3708 -0.0279 0.0062  0.0314  578 ARG A CG    
2222 C CD    . ARG A 321 ? 0.3922 0.4271 0.3635 -0.0228 0.0058  0.0336  578 ARG A CD    
2223 N NE    . ARG A 321 ? 0.3961 0.4134 0.3527 -0.0223 0.0110  0.0325  578 ARG A NE    
2224 C CZ    . ARG A 321 ? 0.3988 0.4064 0.3421 -0.0166 0.0130  0.0351  578 ARG A CZ    
2225 N NH1   . ARG A 321 ? 0.3844 0.4073 0.3307 -0.0119 0.0085  0.0399  578 ARG A NH1   
2226 N NH2   . ARG A 321 ? 0.4105 0.3933 0.3337 -0.0178 0.0199  0.0333  578 ARG A NH2   
2227 N N     . GLN A 322 ? 0.4242 0.4478 0.3886 -0.0347 0.0080  0.0319  579 GLN A N     
2228 C CA    . GLN A 322 ? 0.4474 0.4628 0.3990 -0.0430 0.0081  0.0314  579 GLN A CA    
2229 C C     . GLN A 322 ? 0.4217 0.4346 0.3775 -0.0332 0.0117  0.0330  579 GLN A C     
2230 O O     . GLN A 322 ? 0.4054 0.4291 0.3684 -0.0357 0.0079  0.0332  579 GLN A O     
2231 C CB    . GLN A 322 ? 0.5351 0.5184 0.4534 -0.0543 0.0144  0.0294  579 GLN A CB    
2232 C CG    . GLN A 322 ? 0.6128 0.5835 0.5077 -0.0720 0.0149  0.0278  579 GLN A CG    
2233 C CD    . GLN A 322 ? 0.7277 0.6433 0.5757 -0.0774 0.0287  0.0258  579 GLN A CD    
2234 O OE1   . GLN A 322 ? 0.8624 0.7542 0.6844 -0.0871 0.0338  0.0245  579 GLN A OE1   
2235 N NE2   . GLN A 322 ? 0.7997 0.6889 0.6307 -0.0703 0.0370  0.0258  579 GLN A NE2   
2236 N N     . LEU A 323 ? 0.4093 0.4141 0.3622 -0.0200 0.0192  0.0358  580 LEU A N     
2237 C CA    . LEU A 323 ? 0.4087 0.4205 0.3667 -0.0072 0.0227  0.0403  580 LEU A CA    
2238 C C     . LEU A 323 ? 0.3715 0.4156 0.3557 -0.0085 0.0141  0.0403  580 LEU A C     
2239 O O     . LEU A 323 ? 0.3636 0.4125 0.3506 -0.0068 0.0128  0.0416  580 LEU A O     
2240 C CB    . LEU A 323 ? 0.4312 0.4433 0.3843 0.0108  0.0327  0.0470  580 LEU A CB    
2241 C CG    . LEU A 323 ? 0.4888 0.4546 0.4034 0.0169  0.0466  0.0483  580 LEU A CG    
2242 C CD1   . LEU A 323 ? 0.5098 0.4810 0.4202 0.0407  0.0590  0.0578  580 LEU A CD1   
2243 C CD2   . LEU A 323 ? 0.5242 0.4527 0.4075 0.0161  0.0536  0.0481  580 LEU A CD2   
2244 N N     . GLY A 324 ? 0.3419 0.4018 0.3388 -0.0128 0.0100  0.0388  581 GLY A N     
2245 C CA    . GLY A 324 ? 0.3234 0.4024 0.3326 -0.0169 0.0052  0.0384  581 GLY A CA    
2246 C C     . GLY A 324 ? 0.3190 0.3930 0.3281 -0.0215 0.0011  0.0359  581 GLY A C     
2247 O O     . GLY A 324 ? 0.3052 0.3860 0.3175 -0.0232 -0.0007 0.0360  581 GLY A O     
2248 N N     . LYS A 325 ? 0.3223 0.3883 0.3263 -0.0239 0.0001  0.0348  582 LYS A N     
2249 C CA    . LYS A 325 ? 0.3200 0.3918 0.3253 -0.0255 -0.0028 0.0355  582 LYS A CA    
2250 C C     . LYS A 325 ? 0.3240 0.3954 0.3287 -0.0270 -0.0029 0.0359  582 LYS A C     
2251 O O     . LYS A 325 ? 0.3184 0.3963 0.3276 -0.0256 -0.0040 0.0367  582 LYS A O     
2252 C CB    . LYS A 325 ? 0.3397 0.4169 0.3405 -0.0298 -0.0046 0.0369  582 LYS A CB    
2253 C CG    . LYS A 325 ? 0.3510 0.4489 0.3553 -0.0302 -0.0072 0.0410  582 LYS A CG    
2254 C CD    . LYS A 325 ? 0.3595 0.4602 0.3664 -0.0173 -0.0046 0.0443  582 LYS A CD    
2255 C CE    . LYS A 325 ? 0.3757 0.5048 0.3847 -0.0106 -0.0049 0.0527  582 LYS A CE    
2256 N NZ    . LYS A 325 ? 0.3991 0.5222 0.4004 0.0081  0.0022  0.0584  582 LYS A NZ    
2257 N N     . LEU A 326 ? 0.3343 0.3914 0.3274 -0.0291 0.0004  0.0354  583 LEU A N     
2258 C CA    . LEU A 326 ? 0.3560 0.4034 0.3403 -0.0295 0.0028  0.0359  583 LEU A CA    
2259 C C     . LEU A 326 ? 0.3517 0.4085 0.3464 -0.0200 0.0026  0.0382  583 LEU A C     
2260 O O     . LEU A 326 ? 0.3561 0.4166 0.3531 -0.0211 0.0010  0.0384  583 LEU A O     
2261 C CB    . LEU A 326 ? 0.3798 0.3958 0.3368 -0.0305 0.0110  0.0358  583 LEU A CB    
2262 C CG    . LEU A 326 ? 0.4060 0.4113 0.3448 -0.0482 0.0108  0.0327  583 LEU A CG    
2263 C CD1   . LEU A 326 ? 0.4538 0.4139 0.3538 -0.0504 0.0223  0.0318  583 LEU A CD1   
2264 C CD2   . LEU A 326 ? 0.4129 0.4323 0.3506 -0.0641 0.0064  0.0320  583 LEU A CD2   
2265 N N     . GLN A 327 ? 0.3496 0.4149 0.3499 -0.0125 0.0041  0.0406  584 GLN A N     
2266 C CA    . GLN A 327 ? 0.3543 0.4388 0.3628 -0.0069 0.0032  0.0447  584 GLN A CA    
2267 C C     . GLN A 327 ? 0.3511 0.4462 0.3672 -0.0160 -0.0023 0.0419  584 GLN A C     
2268 O O     . GLN A 327 ? 0.3530 0.4532 0.3695 -0.0162 -0.0038 0.0432  584 GLN A O     
2269 C CB    . GLN A 327 ? 0.3668 0.4707 0.3805 -0.0005 0.0056  0.0495  584 GLN A CB    
2270 C CG    . GLN A 327 ? 0.3685 0.5074 0.3911 0.0033  0.0041  0.0566  584 GLN A CG    
2271 C CD    . GLN A 327 ? 0.4061 0.5442 0.4205 0.0219  0.0101  0.0650  584 GLN A CD    
2272 O OE1   . GLN A 327 ? 0.4264 0.5364 0.4287 0.0235  0.0119  0.0625  584 GLN A OE1   
2273 N NE2   . GLN A 327 ? 0.3890 0.5596 0.4071 0.0375  0.0147  0.0765  584 GLN A NE2   
2274 N N     . SER A 328 ? 0.3491 0.4412 0.3652 -0.0225 -0.0035 0.0386  585 SER A N     
2275 C CA    . SER A 328 ? 0.3600 0.4494 0.3707 -0.0298 -0.0042 0.0365  585 SER A CA    
2276 C C     . SER A 328 ? 0.3589 0.4371 0.3660 -0.0268 -0.0034 0.0360  585 SER A C     
2277 O O     . SER A 328 ? 0.3545 0.4285 0.3554 -0.0293 -0.0028 0.0357  585 SER A O     
2278 C CB    . SER A 328 ? 0.3940 0.4749 0.3960 -0.0356 -0.0021 0.0342  585 SER A CB    
2279 O OG    . SER A 328 ? 0.4520 0.5219 0.4527 -0.0289 -0.0006 0.0340  585 SER A OG    
2280 N N     . THR A 329 ? 0.3450 0.4227 0.3548 -0.0226 -0.0032 0.0367  586 THR A N     
2281 C CA    . THR A 329 ? 0.3530 0.4335 0.3619 -0.0187 -0.0019 0.0390  586 THR A CA    
2282 C C     . THR A 329 ? 0.3546 0.4410 0.3674 -0.0217 -0.0036 0.0393  586 THR A C     
2283 O O     . THR A 329 ? 0.3864 0.4742 0.3982 -0.0200 -0.0023 0.0405  586 THR A O     
2284 C CB    . THR A 329 ? 0.3546 0.4449 0.3644 -0.0145 -0.0013 0.0424  586 THR A CB    
2285 O OG1   . THR A 329 ? 0.3524 0.4292 0.3521 -0.0091 0.0027  0.0426  586 THR A OG1   
2286 C CG2   . THR A 329 ? 0.3340 0.4428 0.3461 -0.0085 0.0004  0.0483  586 THR A CG2   
2287 N N     . TYR A 330 ? 0.3448 0.4301 0.3561 -0.0265 -0.0046 0.0385  587 TYR A N     
2288 C CA    . TYR A 330 ? 0.3548 0.4351 0.3591 -0.0322 -0.0037 0.0382  587 TYR A CA    
2289 C C     . TYR A 330 ? 0.3782 0.4470 0.3778 -0.0279 -0.0021 0.0383  587 TYR A C     
2290 O O     . TYR A 330 ? 0.4518 0.5182 0.4473 -0.0305 -0.0013 0.0384  587 TYR A O     
2291 C CB    . TYR A 330 ? 0.3479 0.4216 0.3392 -0.0432 -0.0026 0.0371  587 TYR A CB    
2292 C CG    . TYR A 330 ? 0.3268 0.4263 0.3249 -0.0488 -0.0058 0.0396  587 TYR A CG    
2293 C CD1   . TYR A 330 ? 0.3140 0.4411 0.3198 -0.0502 -0.0070 0.0438  587 TYR A CD1   
2294 C CD2   . TYR A 330 ? 0.3200 0.4215 0.3173 -0.0497 -0.0069 0.0397  587 TYR A CD2   
2295 C CE1   . TYR A 330 ? 0.3056 0.4675 0.3187 -0.0504 -0.0091 0.0500  587 TYR A CE1   
2296 C CE2   . TYR A 330 ? 0.3123 0.4437 0.3156 -0.0519 -0.0098 0.0444  587 TYR A CE2   
2297 C CZ    . TYR A 330 ? 0.2998 0.4645 0.3116 -0.0510 -0.0109 0.0505  587 TYR A CZ    
2298 O OH    . TYR A 330 ? 0.2959 0.5008 0.3143 -0.0487 -0.0130 0.0589  587 TYR A OH    
2299 N N     . ILE A 331 ? 0.3667 0.4333 0.3668 -0.0206 -0.0012 0.0397  588 ILE A N     
2300 C CA    . ILE A 331 ? 0.3732 0.4377 0.3684 -0.0131 0.0007  0.0431  588 ILE A CA    
2301 C C     . ILE A 331 ? 0.3878 0.4712 0.3928 -0.0133 -0.0035 0.0445  588 ILE A C     
2302 O O     . ILE A 331 ? 0.3820 0.4651 0.3841 -0.0129 -0.0040 0.0456  588 ILE A O     
2303 C CB    . ILE A 331 ? 0.3914 0.4497 0.3774 -0.0013 0.0063  0.0478  588 ILE A CB    
2304 C CG1   . ILE A 331 ? 0.4302 0.4527 0.3895 -0.0025 0.0145  0.0465  588 ILE A CG1   
2305 C CG2   . ILE A 331 ? 0.3872 0.4610 0.3740 0.0116  0.0076  0.0554  588 ILE A CG2   
2306 C CD1   . ILE A 331 ? 0.4537 0.4621 0.4007 0.0046  0.0211  0.0484  588 ILE A CD1   
2307 N N     . GLU A 332 ? 0.3883 0.4850 0.4000 -0.0171 -0.0060 0.0441  589 GLU A N     
2308 C CA    . GLU A 332 ? 0.4068 0.5155 0.4178 -0.0255 -0.0090 0.0440  589 GLU A CA    
2309 C C     . GLU A 332 ? 0.3951 0.4861 0.3987 -0.0304 -0.0079 0.0400  589 GLU A C     
2310 O O     . GLU A 332 ? 0.3925 0.4821 0.3890 -0.0352 -0.0085 0.0401  589 GLU A O     
2311 C CB    . GLU A 332 ? 0.4470 0.5667 0.4578 -0.0341 -0.0099 0.0432  589 GLU A CB    
2312 C CG    . GLU A 332 ? 0.5026 0.6557 0.5214 -0.0308 -0.0112 0.0502  589 GLU A CG    
2313 C CD    . GLU A 332 ? 0.5812 0.7466 0.5999 -0.0413 -0.0114 0.0491  589 GLU A CD    
2314 O OE1   . GLU A 332 ? 0.6280 0.7708 0.6342 -0.0541 -0.0103 0.0425  589 GLU A OE1   
2315 O OE2   . GLU A 332 ? 0.6281 0.8240 0.6558 -0.0353 -0.0109 0.0560  589 GLU A OE2   
2316 N N     . GLY A 333 ? 0.3924 0.4725 0.3962 -0.0275 -0.0053 0.0382  590 GLY A N     
2317 C CA    . GLY A 333 ? 0.3993 0.4685 0.3964 -0.0254 -0.0016 0.0379  590 GLY A CA    
2318 C C     . GLY A 333 ? 0.3925 0.4632 0.3911 -0.0236 -0.0012 0.0390  590 GLY A C     
2319 O O     . GLY A 333 ? 0.4148 0.4765 0.4041 -0.0227 0.0023  0.0394  590 GLY A O     
2320 N N     . LEU A 334 ? 0.3718 0.4479 0.3760 -0.0238 -0.0030 0.0395  591 LEU A N     
2321 C CA    . LEU A 334 ? 0.3667 0.4410 0.3679 -0.0253 -0.0018 0.0400  591 LEU A CA    
2322 C C     . LEU A 334 ? 0.3551 0.4243 0.3510 -0.0247 -0.0029 0.0405  591 LEU A C     
2323 O O     . LEU A 334 ? 0.3498 0.4151 0.3412 -0.0257 -0.0015 0.0405  591 LEU A O     
2324 C CB    . LEU A 334 ? 0.3845 0.4539 0.3800 -0.0299 -0.0009 0.0397  591 LEU A CB    
2325 C CG    . LEU A 334 ? 0.3976 0.4810 0.3954 -0.0376 -0.0004 0.0402  591 LEU A CG    
2326 C CD1   . LEU A 334 ? 0.4089 0.4805 0.3911 -0.0496 0.0013  0.0384  591 LEU A CD1   
2327 C CD2   . LEU A 334 ? 0.3837 0.4793 0.3835 -0.0390 0.0014  0.0424  591 LEU A CD2   
2328 N N     . LEU A 335 ? 0.3388 0.4126 0.3350 -0.0221 -0.0051 0.0423  592 LEU A N     
2329 C CA    . LEU A 335 ? 0.3346 0.4151 0.3267 -0.0204 -0.0070 0.0456  592 LEU A CA    
2330 C C     . LEU A 335 ? 0.3434 0.4248 0.3301 -0.0297 -0.0088 0.0438  592 LEU A C     
2331 O O     . LEU A 335 ? 0.3472 0.4283 0.3272 -0.0314 -0.0096 0.0452  592 LEU A O     
2332 C CB    . LEU A 335 ? 0.3208 0.4203 0.3164 -0.0132 -0.0084 0.0514  592 LEU A CB    
2333 C CG    . LEU A 335 ? 0.3291 0.4159 0.3165 0.0009  -0.0024 0.0556  592 LEU A CG    
2334 C CD1   . LEU A 335 ? 0.3314 0.4394 0.3213 0.0142  -0.0006 0.0640  592 LEU A CD1   
2335 C CD2   . LEU A 335 ? 0.3527 0.4244 0.3253 0.0076  0.0013  0.0586  592 LEU A CD2   
2336 N N     . LYS A 336 ? 0.3526 0.4287 0.3357 -0.0361 -0.0076 0.0408  593 LYS A N     
2337 C CA    . LYS A 336 ? 0.3830 0.4447 0.3470 -0.0472 -0.0054 0.0383  593 LYS A CA    
2338 C C     . LYS A 336 ? 0.3674 0.4079 0.3209 -0.0431 0.0007  0.0374  593 LYS A C     
2339 O O     . LYS A 336 ? 0.3841 0.4076 0.3163 -0.0513 0.0036  0.0360  593 LYS A O     
2340 C CB    . LYS A 336 ? 0.4400 0.4895 0.3949 -0.0513 -0.0017 0.0357  593 LYS A CB    
2341 C CG    . LYS A 336 ? 0.5180 0.5429 0.4406 -0.0674 0.0030  0.0325  593 LYS A CG    
2342 C CD    . LYS A 336 ? 0.5623 0.5731 0.4739 -0.0705 0.0074  0.0303  593 LYS A CD    
2343 C CE    . LYS A 336 ? 0.5738 0.6185 0.5120 -0.0692 0.0000  0.0321  593 LYS A CE    
2344 N NZ    . LYS A 336 ? 0.6192 0.6547 0.5420 -0.0810 0.0027  0.0295  593 LYS A NZ    
2345 N N     . VAL A 337 ? 0.3393 0.3824 0.3047 -0.0323 0.0031  0.0387  594 VAL A N     
2346 C CA    . VAL A 337 ? 0.3397 0.3727 0.2982 -0.0267 0.0098  0.0399  594 VAL A CA    
2347 C C     . VAL A 337 ? 0.3278 0.3699 0.2946 -0.0263 0.0078  0.0409  594 VAL A C     
2348 O O     . VAL A 337 ? 0.3311 0.3724 0.2955 -0.0225 0.0132  0.0427  594 VAL A O     
2349 C CB    . VAL A 337 ? 0.3422 0.3781 0.3030 -0.0155 0.0166  0.0431  594 VAL A CB    
2350 C CG1   . VAL A 337 ? 0.3577 0.3732 0.3010 -0.0147 0.0212  0.0422  594 VAL A CG1   
2351 C CG2   . VAL A 337 ? 0.3143 0.3765 0.2967 -0.0148 0.0118  0.0446  594 VAL A CG2   
2352 N N     . VAL A 338 ? 0.3151 0.3636 0.2871 -0.0289 0.0021  0.0408  595 VAL A N     
2353 C CA    . VAL A 338 ? 0.3157 0.3607 0.2841 -0.0289 0.0023  0.0417  595 VAL A CA    
2354 C C     . VAL A 338 ? 0.3339 0.3717 0.2906 -0.0316 0.0017  0.0420  595 VAL A C     
2355 O O     . VAL A 338 ? 0.3293 0.3720 0.2813 -0.0359 -0.0024 0.0427  595 VAL A O     
2356 C CB    . VAL A 338 ? 0.3182 0.3632 0.2854 -0.0251 0.0002  0.0437  595 VAL A CB    
2357 C CG1   . VAL A 338 ? 0.3395 0.3699 0.2928 -0.0234 0.0033  0.0451  595 VAL A CG1   
2358 C CG2   . VAL A 338 ? 0.3159 0.3612 0.2874 -0.0258 0.0017  0.0425  595 VAL A CG2   
2359 N N     . ARG A 339 ? 0.3488 0.3777 0.2990 -0.0319 0.0056  0.0418  596 ARG A N     
2360 C CA    . ARG A 339 ? 0.3745 0.3939 0.3105 -0.0356 0.0051  0.0421  596 ARG A CA    
2361 C C     . ARG A 339 ? 0.3864 0.4114 0.3200 -0.0330 0.0004  0.0455  596 ARG A C     
2362 O O     . ARG A 339 ? 0.3956 0.4134 0.3273 -0.0284 0.0032  0.0463  596 ARG A O     
2363 C CB    . ARG A 339 ? 0.3920 0.3999 0.3209 -0.0349 0.0123  0.0416  596 ARG A CB    
2364 C CG    . ARG A 339 ? 0.4024 0.4120 0.3347 -0.0294 0.0197  0.0423  596 ARG A CG    
2365 C CD    . ARG A 339 ? 0.4385 0.4318 0.3541 -0.0254 0.0294  0.0437  596 ARG A CD    
2366 N NE    . ARG A 339 ? 0.4471 0.4338 0.3558 -0.0160 0.0377  0.0461  596 ARG A NE    
2367 C CZ    . ARG A 339 ? 0.4681 0.4213 0.3465 -0.0131 0.0475  0.0462  596 ARG A CZ    
2368 N NH1   . ARG A 339 ? 0.4874 0.4145 0.3417 -0.0222 0.0492  0.0434  596 ARG A NH1   
2369 N NH2   . ARG A 339 ? 0.4789 0.4207 0.3458 -0.0010 0.0573  0.0496  596 ARG A NH2   
2370 N N     . PRO A 340 ? 0.4043 0.4420 0.3329 -0.0365 -0.0054 0.0485  597 PRO A N     
2371 C CA    . PRO A 340 ? 0.4307 0.4852 0.3580 -0.0278 -0.0093 0.0560  597 PRO A CA    
2372 C C     . PRO A 340 ? 0.4634 0.5031 0.3771 -0.0222 -0.0065 0.0584  597 PRO A C     
2373 O O     . PRO A 340 ? 0.4929 0.5369 0.4002 -0.0086 -0.0057 0.0658  597 PRO A O     
2374 C CB    . PRO A 340 ? 0.4300 0.5137 0.3549 -0.0385 -0.0171 0.0597  597 PRO A CB    
2375 C CG    . PRO A 340 ? 0.4344 0.5013 0.3494 -0.0562 -0.0155 0.0521  597 PRO A CG    
2376 C CD    . PRO A 340 ? 0.4213 0.4600 0.3404 -0.0501 -0.0073 0.0462  597 PRO A CD    
2377 N N     . ASP A 341 ? 0.4094 0.4256 0.4813 -0.0159 -0.1769 0.0110  598 ASP A N     
2378 C CA    . ASP A 341 ? 0.4744 0.4802 0.5164 -0.0116 -0.1896 0.0152  598 ASP A CA    
2379 C C     . ASP A 341 ? 0.4941 0.4923 0.5148 -0.0070 -0.1760 0.0227  598 ASP A C     
2380 O O     . ASP A 341 ? 0.5716 0.5645 0.5805 -0.0023 -0.1844 0.0302  598 ASP A O     
2381 C CB    . ASP A 341 ? 0.5078 0.5009 0.5148 -0.0147 -0.2000 0.0085  598 ASP A CB    
2382 C CG    . ASP A 341 ? 0.4830 0.4692 0.4733 -0.0185 -0.1840 0.0023  598 ASP A CG    
2383 O OD1   . ASP A 341 ? 0.4752 0.4691 0.4912 -0.0216 -0.1718 0.0002  598 ASP A OD1   
2384 O OD2   . ASP A 341 ? 0.5508 0.5242 0.5025 -0.0181 -0.1841 -0.0004 598 ASP A OD2   
2385 N N     . THR A 342 ? 0.4641 0.4615 0.4824 -0.0084 -0.1561 0.0212  599 THR A N     
2386 C CA    . THR A 342 ? 0.4572 0.4485 0.4613 -0.0047 -0.1426 0.0273  599 THR A CA    
2387 C C     . THR A 342 ? 0.3967 0.3971 0.4279 -0.0028 -0.1276 0.0279  599 THR A C     
2388 O O     . THR A 342 ? 0.3728 0.3683 0.3962 0.0002  -0.1177 0.0318  599 THR A O     
2389 C CB    . THR A 342 ? 0.4502 0.4306 0.4220 -0.0075 -0.1316 0.0243  599 THR A CB    
2390 O OG1   . THR A 342 ? 0.4764 0.4615 0.4609 -0.0115 -0.1223 0.0173  599 THR A OG1   
2391 C CG2   . THR A 342 ? 0.5195 0.4894 0.4575 -0.0088 -0.1436 0.0222  599 THR A CG2   
2392 N N     . LYS A 343 ? 0.3487 0.3620 0.4112 -0.0048 -0.1258 0.0242  600 LYS A N     
2393 C CA    . LYS A 343 ? 0.3231 0.3458 0.4088 -0.0028 -0.1104 0.0242  600 LYS A CA    
2394 C C     . LYS A 343 ? 0.2865 0.3014 0.3522 -0.0035 -0.0940 0.0232  600 LYS A C     
2395 O O     . LYS A 343 ? 0.2694 0.2858 0.3410 0.0005  -0.0836 0.0245  600 LYS A O     
2396 C CB    . LYS A 343 ? 0.3540 0.3823 0.4594 0.0045  -0.1123 0.0286  600 LYS A CB    
2397 C CG    . LYS A 343 ? 0.3914 0.4304 0.5248 0.0058  -0.1287 0.0295  600 LYS A CG    
2398 C CD    . LYS A 343 ? 0.4483 0.4952 0.6087 0.0138  -0.1277 0.0324  600 LYS A CD    
2399 C CE    . LYS A 343 ? 0.4847 0.5450 0.6798 0.0158  -0.1439 0.0331  600 LYS A CE    
2400 N NZ    . LYS A 343 ? 0.5329 0.6030 0.7599 0.0244  -0.1403 0.0344  600 LYS A NZ    
2401 N N     . LYS A 344 ? 0.2638 0.2704 0.3073 -0.0081 -0.0924 0.0200  601 LYS A N     
2402 C CA    . LYS A 344 ? 0.2739 0.2748 0.3035 -0.0089 -0.0784 0.0185  601 LYS A CA    
2403 C C     . LYS A 344 ? 0.2523 0.2561 0.2898 -0.0141 -0.0729 0.0143  601 LYS A C     
2404 O O     . LYS A 344 ? 0.2539 0.2602 0.3005 -0.0181 -0.0813 0.0116  601 LYS A O     
2405 C CB    . LYS A 344 ? 0.3068 0.2949 0.3045 -0.0093 -0.0787 0.0188  601 LYS A CB    
2406 C CG    . LYS A 344 ? 0.3360 0.3186 0.3230 -0.0052 -0.0814 0.0249  601 LYS A CG    
2407 C CD    . LYS A 344 ? 0.3674 0.3390 0.3233 -0.0066 -0.0818 0.0258  601 LYS A CD    
2408 C CE    . LYS A 344 ? 0.4025 0.3674 0.3474 -0.0036 -0.0830 0.0339  601 LYS A CE    
2409 N NZ    . LYS A 344 ? 0.4088 0.3663 0.3339 -0.0050 -0.0722 0.0348  601 LYS A NZ    
2410 N N     . VAL A 345 ? 0.2402 0.2423 0.2739 -0.0138 -0.0598 0.0142  602 VAL A N     
2411 C CA    . VAL A 345 ? 0.2387 0.2388 0.2726 -0.0184 -0.0539 0.0116  602 VAL A CA    
2412 C C     . VAL A 345 ? 0.2398 0.2278 0.2475 -0.0185 -0.0517 0.0090  602 VAL A C     
2413 O O     . VAL A 345 ? 0.2531 0.2372 0.2480 -0.0150 -0.0475 0.0106  602 VAL A O     
2414 C CB    . VAL A 345 ? 0.2233 0.2299 0.2705 -0.0177 -0.0410 0.0141  602 VAL A CB    
2415 C CG1   . VAL A 345 ? 0.2208 0.2415 0.2973 -0.0180 -0.0411 0.0162  602 VAL A CG1   
2416 C CG2   . VAL A 345 ? 0.2356 0.2390 0.2711 -0.0125 -0.0330 0.0151  602 VAL A CG2   
2417 N N     . HIS A 346 ? 0.2315 0.2140 0.2345 -0.0225 -0.0545 0.0048  603 HIS A N     
2418 C CA    . HIS A 346 ? 0.2437 0.2157 0.2251 -0.0222 -0.0517 0.0010  603 HIS A CA    
2419 C C     . HIS A 346 ? 0.2276 0.1966 0.2154 -0.0247 -0.0456 -0.0003 603 HIS A C     
2420 O O     . HIS A 346 ? 0.2298 0.1960 0.2243 -0.0286 -0.0503 -0.0037 603 HIS A O     
2421 C CB    . HIS A 346 ? 0.2499 0.2161 0.2172 -0.0234 -0.0621 -0.0045 603 HIS A CB    
2422 C CG    . HIS A 346 ? 0.2695 0.2372 0.2277 -0.0210 -0.0697 -0.0015 603 HIS A CG    
2423 N ND1   . HIS A 346 ? 0.2731 0.2357 0.2098 -0.0181 -0.0668 0.0006  603 HIS A ND1   
2424 C CD2   . HIS A 346 ? 0.2804 0.2544 0.2509 -0.0210 -0.0802 0.0009  603 HIS A CD2   
2425 C CE1   . HIS A 346 ? 0.2889 0.2526 0.2216 -0.0166 -0.0757 0.0047  603 HIS A CE1   
2426 N NE2   . HIS A 346 ? 0.2940 0.2649 0.2480 -0.0179 -0.0845 0.0046  603 HIS A NE2   
2427 N N     . THR A 347 ? 0.2307 0.2000 0.2181 -0.0226 -0.0362 0.0030  604 THR A N     
2428 C CA    . THR A 347 ? 0.2362 0.2012 0.2268 -0.0242 -0.0309 0.0034  604 THR A CA    
2429 C C     . THR A 347 ? 0.2518 0.2068 0.2316 -0.0247 -0.0332 -0.0026 604 THR A C     
2430 O O     . THR A 347 ? 0.2523 0.2042 0.2182 -0.0229 -0.0359 -0.0071 604 THR A O     
2431 C CB    . THR A 347 ? 0.2355 0.2017 0.2229 -0.0208 -0.0221 0.0076  604 THR A CB    
2432 O OG1   . THR A 347 ? 0.2471 0.2103 0.2393 -0.0226 -0.0176 0.0107  604 THR A OG1   
2433 C CG2   . THR A 347 ? 0.2249 0.1861 0.1974 -0.0171 -0.0205 0.0053  604 THR A CG2   
2434 N N     . ILE A 348 ? 0.2606 0.2100 0.2467 -0.0268 -0.0315 -0.0024 605 ILE A N     
2435 C CA    . ILE A 348 ? 0.2698 0.2092 0.2476 -0.0255 -0.0318 -0.0081 605 ILE A CA    
2436 C C     . ILE A 348 ? 0.2706 0.2072 0.2481 -0.0231 -0.0253 -0.0036 605 ILE A C     
2437 O O     . ILE A 348 ? 0.2494 0.1856 0.2356 -0.0252 -0.0230 0.0025  605 ILE A O     
2438 C CB    . ILE A 348 ? 0.2871 0.2194 0.2734 -0.0296 -0.0384 -0.0131 605 ILE A CB    
2439 C CG1   . ILE A 348 ? 0.2929 0.2275 0.2769 -0.0315 -0.0474 -0.0187 605 ILE A CG1   
2440 C CG2   . ILE A 348 ? 0.2989 0.2199 0.2808 -0.0275 -0.0376 -0.0187 605 ILE A CG2   
2441 C CD1   . ILE A 348 ? 0.2995 0.2257 0.2915 -0.0357 -0.0562 -0.0260 605 ILE A CD1   
2442 N N     . PHE A 349 ? 0.2636 0.1984 0.2314 -0.0188 -0.0225 -0.0063 606 PHE A N     
2443 C CA    . PHE A 349 ? 0.2835 0.2148 0.2515 -0.0161 -0.0191 -0.0034 606 PHE A CA    
2444 C C     . PHE A 349 ? 0.3003 0.2216 0.2728 -0.0159 -0.0213 -0.0069 606 PHE A C     
2445 O O     . PHE A 349 ? 0.3359 0.2534 0.3059 -0.0147 -0.0229 -0.0151 606 PHE A O     
2446 C CB    . PHE A 349 ? 0.2889 0.2234 0.2499 -0.0120 -0.0160 -0.0046 606 PHE A CB    
2447 C CG    . PHE A 349 ? 0.2947 0.2367 0.2530 -0.0115 -0.0143 -0.0009 606 PHE A CG    
2448 C CD1   . PHE A 349 ? 0.3046 0.2486 0.2640 -0.0106 -0.0124 0.0043  606 PHE A CD1   
2449 C CD2   . PHE A 349 ? 0.2997 0.2456 0.2530 -0.0115 -0.0145 -0.0027 606 PHE A CD2   
2450 C CE1   . PHE A 349 ? 0.3180 0.2679 0.2759 -0.0094 -0.0110 0.0061  606 PHE A CE1   
2451 C CE2   . PHE A 349 ? 0.3001 0.2514 0.2530 -0.0106 -0.0137 0.0008  606 PHE A CE2   
2452 C CZ    . PHE A 349 ? 0.3007 0.2540 0.2570 -0.0094 -0.0120 0.0044  606 PHE A CZ    
2453 N N     . ASN A 350 ? 0.2904 0.2063 0.2687 -0.0167 -0.0214 -0.0008 607 ASN A N     
2454 C CA    . ASN A 350 ? 0.2942 0.1988 0.2785 -0.0156 -0.0243 -0.0032 607 ASN A CA    
2455 C C     . ASN A 350 ? 0.2987 0.2024 0.2801 -0.0099 -0.0231 -0.0029 607 ASN A C     
2456 O O     . ASN A 350 ? 0.3095 0.2144 0.2876 -0.0086 -0.0223 0.0044  607 ASN A O     
2457 C CB    . ASN A 350 ? 0.3054 0.2030 0.2987 -0.0201 -0.0260 0.0044  607 ASN A CB    
2458 C CG    . ASN A 350 ? 0.3202 0.2038 0.3225 -0.0197 -0.0307 0.0009  607 ASN A CG    
2459 O OD1   . ASN A 350 ? 0.3077 0.1873 0.3093 -0.0144 -0.0318 -0.0057 607 ASN A OD1   
2460 N ND2   . ASN A 350 ? 0.2911 0.1678 0.3045 -0.0254 -0.0334 0.0051  607 ASN A ND2   
2461 N N     . GLN A 351 ? 0.2810 0.1839 0.2633 -0.0062 -0.0229 -0.0116 608 GLN A N     
2462 C CA    . GLN A 351 ? 0.2860 0.1900 0.2708 -0.0007 -0.0221 -0.0129 608 GLN A CA    
2463 C C     . GLN A 351 ? 0.2849 0.1780 0.2799 0.0024  -0.0264 -0.0127 608 GLN A C     
2464 O O     . GLN A 351 ? 0.2999 0.1935 0.3006 0.0074  -0.0275 -0.0132 608 GLN A O     
2465 C CB    . GLN A 351 ? 0.2951 0.2049 0.2779 0.0016  -0.0176 -0.0225 608 GLN A CB    
2466 C CG    . GLN A 351 ? 0.3018 0.2171 0.2905 0.0063  -0.0150 -0.0240 608 GLN A CG    
2467 C CD    . GLN A 351 ? 0.2835 0.2053 0.2699 0.0079  -0.0080 -0.0320 608 GLN A CD    
2468 O OE1   . GLN A 351 ? 0.2882 0.2095 0.2642 0.0056  -0.0063 -0.0360 608 GLN A OE1   
2469 N NE2   . GLN A 351 ? 0.2644 0.1926 0.2605 0.0116  -0.0042 -0.0339 608 GLN A NE2   
2470 N N     . ALA A 352 ? 0.2919 0.1747 0.2918 -0.0004 -0.0297 -0.0119 609 ALA A N     
2471 C CA    . ALA A 352 ? 0.3014 0.1716 0.3128 0.0028  -0.0345 -0.0129 609 ALA A CA    
2472 C C     . ALA A 352 ? 0.3124 0.1720 0.3265 -0.0013 -0.0385 -0.0015 609 ALA A C     
2473 O O     . ALA A 352 ? 0.3203 0.1670 0.3449 -0.0021 -0.0428 -0.0028 609 ALA A O     
2474 C CB    . ALA A 352 ? 0.2965 0.1612 0.3140 0.0045  -0.0346 -0.0263 609 ALA A CB    
2475 N N     . LEU A 353 ? 0.2987 0.1629 0.3037 -0.0039 -0.0368 0.0096  610 LEU A N     
2476 C CA    . LEU A 353 ? 0.3227 0.1788 0.3281 -0.0088 -0.0378 0.0221  610 LEU A CA    
2477 C C     . LEU A 353 ? 0.3281 0.1802 0.3251 -0.0057 -0.0399 0.0335  610 LEU A C     
2478 O O     . LEU A 353 ? 0.3415 0.1805 0.3427 -0.0056 -0.0443 0.0413  610 LEU A O     
2479 C CB    . LEU A 353 ? 0.3246 0.1901 0.3254 -0.0154 -0.0323 0.0258  610 LEU A CB    
2480 C CG    . LEU A 353 ? 0.3562 0.2155 0.3586 -0.0209 -0.0307 0.0399  610 LEU A CG    
2481 C CD1   . LEU A 353 ? 0.3850 0.2302 0.4042 -0.0249 -0.0355 0.0396  610 LEU A CD1   
2482 C CD2   . LEU A 353 ? 0.3655 0.2374 0.3641 -0.0259 -0.0234 0.0446  610 LEU A CD2   
2483 N N     . THR A 354 ? 0.3260 0.1880 0.3104 -0.0030 -0.0378 0.0345  611 THR A N     
2484 C CA    . THR A 354 ? 0.3549 0.2121 0.3265 -0.0004 -0.0407 0.0458  611 THR A CA    
2485 C C     . THR A 354 ? 0.3712 0.2199 0.3480 0.0064  -0.0500 0.0456  611 THR A C     
2486 O O     . THR A 354 ? 0.3444 0.1959 0.3338 0.0108  -0.0527 0.0350  611 THR A O     
2487 C CB    . THR A 354 ? 0.3392 0.2082 0.2950 0.0011  -0.0373 0.0454  611 THR A CB    
2488 O OG1   . THR A 354 ? 0.3357 0.2119 0.2968 0.0057  -0.0400 0.0349  611 THR A OG1   
2489 C CG2   . THR A 354 ? 0.3296 0.2086 0.2828 -0.0041 -0.0287 0.0446  611 THR A CG2   
2490 N N     . GLN A 355 ? 0.3971 0.2359 0.3635 0.0077  -0.0548 0.0579  612 GLN A N     
2491 C CA    . GLN A 355 ? 0.4299 0.2592 0.4009 0.0145  -0.0659 0.0601  612 GLN A CA    
2492 C C     . GLN A 355 ? 0.4280 0.2661 0.3924 0.0203  -0.0709 0.0555  612 GLN A C     
2493 O O     . GLN A 355 ? 0.4733 0.3069 0.4456 0.0266  -0.0812 0.0550  612 GLN A O     
2494 C CB    . GLN A 355 ? 0.4935 0.3075 0.4525 0.0135  -0.0701 0.0771  612 GLN A CB    
2495 C CG    . GLN A 355 ? 0.5411 0.3479 0.5056 0.0056  -0.0633 0.0841  612 GLN A CG    
2496 C CD    . GLN A 355 ? 0.5832 0.3822 0.5734 0.0059  -0.0668 0.0758  612 GLN A CD    
2497 O OE1   . GLN A 355 ? 0.6390 0.4259 0.6396 0.0112  -0.0763 0.0770  612 GLN A OE1   
2498 N NE2   . GLN A 355 ? 0.6392 0.4446 0.6397 0.0006  -0.0600 0.0666  612 GLN A NE2   
2499 N N     . THR A 356 ? 0.3985 0.2489 0.3506 0.0183  -0.0646 0.0520  613 THR A N     
2500 C CA    . THR A 356 ? 0.3981 0.2559 0.3444 0.0229  -0.0699 0.0474  613 THR A CA    
2501 C C     . THR A 356 ? 0.3767 0.2477 0.3398 0.0235  -0.0666 0.0339  613 THR A C     
2502 O O     . THR A 356 ? 0.4048 0.2814 0.3720 0.0274  -0.0724 0.0292  613 THR A O     
2503 C CB    . THR A 356 ? 0.4044 0.2660 0.3254 0.0210  -0.0656 0.0516  613 THR A CB    
2504 O OG1   . THR A 356 ? 0.3875 0.2575 0.3095 0.0153  -0.0534 0.0485  613 THR A OG1   
2505 C CG2   . THR A 356 ? 0.4295 0.2784 0.3286 0.0214  -0.0689 0.0659  613 THR A CG2   
2506 N N     . GLY A 357 ? 0.3394 0.2143 0.3126 0.0198  -0.0581 0.0284  614 GLY A N     
2507 C CA    . GLY A 357 ? 0.3213 0.2083 0.3054 0.0195  -0.0526 0.0174  614 GLY A CA    
2508 C C     . GLY A 357 ? 0.3045 0.2006 0.2770 0.0153  -0.0451 0.0161  614 GLY A C     
2509 O O     . GLY A 357 ? 0.3215 0.2269 0.3002 0.0146  -0.0405 0.0089  614 GLY A O     
2510 N N     . ARG A 358 ? 0.3058 0.1991 0.2618 0.0127  -0.0433 0.0237  615 ARG A N     
2511 C CA    . ARG A 358 ? 0.2999 0.2012 0.2471 0.0093  -0.0360 0.0229  615 ARG A CA    
2512 C C     . ARG A 358 ? 0.2883 0.1928 0.2429 0.0046  -0.0295 0.0200  615 ARG A C     
2513 O O     . ARG A 358 ? 0.3097 0.2074 0.2708 0.0027  -0.0299 0.0217  615 ARG A O     
2514 C CB    . ARG A 358 ? 0.3090 0.2070 0.2379 0.0085  -0.0344 0.0315  615 ARG A CB    
2515 C CG    . ARG A 358 ? 0.3199 0.2195 0.2350 0.0124  -0.0383 0.0305  615 ARG A CG    
2516 C CD    . ARG A 358 ? 0.3309 0.2275 0.2248 0.0121  -0.0342 0.0383  615 ARG A CD    
2517 N NE    . ARG A 358 ? 0.3368 0.2345 0.2148 0.0162  -0.0377 0.0350  615 ARG A NE    
2518 C CZ    . ARG A 358 ? 0.3645 0.2628 0.2228 0.0170  -0.0319 0.0378  615 ARG A CZ    
2519 N NH1   . ARG A 358 ? 0.3654 0.2649 0.2202 0.0133  -0.0215 0.0452  615 ARG A NH1   
2520 N NH2   . ARG A 358 ? 0.3865 0.2844 0.2299 0.0215  -0.0365 0.0326  615 ARG A NH2   
2521 N N     . LEU A 359 ? 0.2800 0.1936 0.2338 0.0029  -0.0248 0.0157  616 LEU A N     
2522 C CA    . LEU A 359 ? 0.2740 0.1911 0.2319 -0.0014 -0.0203 0.0135  616 LEU A CA    
2523 C C     . LEU A 359 ? 0.3045 0.2213 0.2586 -0.0053 -0.0169 0.0205  616 LEU A C     
2524 O O     . LEU A 359 ? 0.3668 0.2837 0.3114 -0.0043 -0.0153 0.0262  616 LEU A O     
2525 C CB    . LEU A 359 ? 0.2585 0.1847 0.2162 -0.0016 -0.0175 0.0082  616 LEU A CB    
2526 C CG    . LEU A 359 ? 0.2649 0.1935 0.2286 0.0007  -0.0178 0.0017  616 LEU A CG    
2527 C CD1   . LEU A 359 ? 0.2732 0.2093 0.2350 -0.0006 -0.0144 -0.0007 616 LEU A CD1   
2528 C CD2   . LEU A 359 ? 0.2537 0.1778 0.2244 0.0009  -0.0181 -0.0027 616 LEU A CD2   
2529 N N     . SER A 360 ? 0.3037 0.2205 0.2656 -0.0097 -0.0157 0.0196  617 SER A N     
2530 C CA    . SER A 360 ? 0.3101 0.2295 0.2745 -0.0143 -0.0119 0.0257  617 SER A CA    
2531 C C     . SER A 360 ? 0.3145 0.2421 0.2853 -0.0170 -0.0113 0.0205  617 SER A C     
2532 O O     . SER A 360 ? 0.2867 0.2141 0.2585 -0.0162 -0.0143 0.0131  617 SER A O     
2533 C CB    . SER A 360 ? 0.3229 0.2325 0.2948 -0.0179 -0.0134 0.0313  617 SER A CB    
2534 O OG    . SER A 360 ? 0.3379 0.2468 0.3222 -0.0222 -0.0158 0.0265  617 SER A OG    
2535 N N     . SER A 361 ? 0.2996 0.2347 0.2744 -0.0197 -0.0073 0.0246  618 SER A N     
2536 C CA    . SER A 361 ? 0.2932 0.2371 0.2743 -0.0213 -0.0083 0.0203  618 SER A CA    
2537 C C     . SER A 361 ? 0.2856 0.2331 0.2818 -0.0271 -0.0072 0.0245  618 SER A C     
2538 O O     . SER A 361 ? 0.2742 0.2230 0.2731 -0.0287 -0.0011 0.0324  618 SER A O     
2539 C CB    . SER A 361 ? 0.3060 0.2577 0.2804 -0.0172 -0.0048 0.0201  618 SER A CB    
2540 O OG    . SER A 361 ? 0.3127 0.2736 0.2953 -0.0182 -0.0047 0.0191  618 SER A OG    
2541 N N     . THR A 362 ? 0.2731 0.2216 0.2788 -0.0304 -0.0133 0.0194  619 THR A N     
2542 C CA    . THR A 362 ? 0.3020 0.2547 0.3266 -0.0365 -0.0145 0.0223  619 THR A CA    
2543 C C     . THR A 362 ? 0.3037 0.2656 0.3366 -0.0375 -0.0203 0.0175  619 THR A C     
2544 O O     . THR A 362 ? 0.2694 0.2304 0.2911 -0.0343 -0.0254 0.0111  619 THR A O     
2545 C CB    . THR A 362 ? 0.3336 0.2748 0.3660 -0.0411 -0.0200 0.0207  619 THR A CB    
2546 O OG1   . THR A 362 ? 0.3289 0.2642 0.3532 -0.0390 -0.0277 0.0103  619 THR A OG1   
2547 C CG2   . THR A 362 ? 0.3565 0.2870 0.3835 -0.0404 -0.0160 0.0270  619 THR A CG2   
2548 N N     . GLU A 363 ? 0.3127 0.2840 0.3658 -0.0418 -0.0192 0.0216  620 GLU A N     
2549 C CA    . GLU A 363 ? 0.3592 0.3386 0.4265 -0.0439 -0.0275 0.0177  620 GLU A CA    
2550 C C     . GLU A 363 ? 0.3274 0.3124 0.3841 -0.0381 -0.0304 0.0143  620 GLU A C     
2551 O O     . GLU A 363 ? 0.3406 0.3233 0.3922 -0.0378 -0.0403 0.0086  620 GLU A O     
2552 C CB    . GLU A 363 ? 0.4049 0.3748 0.4750 -0.0481 -0.0392 0.0106  620 GLU A CB    
2553 C CG    . GLU A 363 ? 0.4754 0.4399 0.5639 -0.0553 -0.0391 0.0141  620 GLU A CG    
2554 C CD    . GLU A 363 ? 0.5445 0.5016 0.6421 -0.0601 -0.0534 0.0051  620 GLU A CD    
2555 O OE1   . GLU A 363 ? 0.5376 0.5025 0.6463 -0.0618 -0.0626 0.0013  620 GLU A OE1   
2556 O OE2   . GLU A 363 ? 0.6245 0.5671 0.7178 -0.0614 -0.0566 0.0010  620 GLU A OE2   
2557 N N     . PRO A 364 ? 0.3026 0.2944 0.3564 -0.0336 -0.0220 0.0181  621 PRO A N     
2558 C CA    . PRO A 364 ? 0.2991 0.2951 0.3573 -0.0333 -0.0097 0.0248  621 PRO A CA    
2559 C C     . PRO A 364 ? 0.2813 0.2675 0.3173 -0.0298 -0.0043 0.0257  621 PRO A C     
2560 O O     . PRO A 364 ? 0.2611 0.2401 0.2814 -0.0266 -0.0087 0.0210  621 PRO A O     
2561 C CB    . PRO A 364 ? 0.2886 0.2972 0.3548 -0.0289 -0.0058 0.0255  621 PRO A CB    
2562 C CG    . PRO A 364 ? 0.3000 0.3045 0.3526 -0.0245 -0.0140 0.0202  621 PRO A CG    
2563 C CD    . PRO A 364 ? 0.2982 0.2947 0.3462 -0.0283 -0.0247 0.0160  621 PRO A CD    
2564 N N     . ASN A 365 ? 0.2664 0.2530 0.3016 -0.0302 0.0053  0.0321  622 ASN A N     
2565 C CA    . ASN A 365 ? 0.2693 0.2481 0.2836 -0.0259 0.0095  0.0333  622 ASN A CA    
2566 C C     . ASN A 365 ? 0.2787 0.2636 0.2853 -0.0194 0.0129  0.0304  622 ASN A C     
2567 O O     . ASN A 365 ? 0.2675 0.2623 0.2822 -0.0180 0.0199  0.0324  622 ASN A O     
2568 C CB    . ASN A 365 ? 0.2710 0.2472 0.2842 -0.0283 0.0177  0.0420  622 ASN A CB    
2569 C CG    . ASN A 365 ? 0.2865 0.2545 0.2764 -0.0233 0.0205  0.0436  622 ASN A CG    
2570 O OD1   . ASN A 365 ? 0.2734 0.2379 0.2510 -0.0185 0.0159  0.0376  622 ASN A OD1   
2571 N ND2   . ASN A 365 ? 0.2811 0.2460 0.2651 -0.0247 0.0278  0.0524  622 ASN A ND2   
2572 N N     . LEU A 366 ? 0.2766 0.2557 0.2697 -0.0154 0.0080  0.0252  623 LEU A N     
2573 C CA    . LEU A 366 ? 0.2953 0.2783 0.2838 -0.0098 0.0097  0.0221  623 LEU A CA    
2574 C C     . LEU A 366 ? 0.3300 0.3067 0.3007 -0.0055 0.0127  0.0217  623 LEU A C     
2575 O O     . LEU A 366 ? 0.3211 0.2976 0.2859 -0.0007 0.0122  0.0176  623 LEU A O     
2576 C CB    . LEU A 366 ? 0.3042 0.2862 0.2932 -0.0088 0.0018  0.0176  623 LEU A CB    
2577 C CG    . LEU A 366 ? 0.3061 0.2952 0.3108 -0.0115 -0.0030 0.0175  623 LEU A CG    
2578 C CD1   . LEU A 366 ? 0.3135 0.2992 0.3128 -0.0104 -0.0109 0.0144  623 LEU A CD1   
2579 C CD2   . LEU A 366 ? 0.3249 0.3255 0.3449 -0.0092 0.0019  0.0190  623 LEU A CD2   
2580 N N     . GLN A 367 ? 0.3389 0.3099 0.3018 -0.0071 0.0152  0.0262  624 GLN A N     
2581 C CA    . GLN A 367 ? 0.3488 0.3127 0.2932 -0.0030 0.0157  0.0262  624 GLN A CA    
2582 C C     . GLN A 367 ? 0.3588 0.3254 0.2947 -0.0013 0.0251  0.0308  624 GLN A C     
2583 O O     . GLN A 367 ? 0.3803 0.3403 0.2973 0.0022  0.0255  0.0316  624 GLN A O     
2584 C CB    . GLN A 367 ? 0.3442 0.2977 0.2836 -0.0049 0.0099  0.0281  624 GLN A CB    
2585 C CG    . GLN A 367 ? 0.3431 0.2943 0.2874 -0.0050 0.0024  0.0221  624 GLN A CG    
2586 C CD    . GLN A 367 ? 0.3584 0.3006 0.3014 -0.0057 -0.0027 0.0224  624 GLN A CD    
2587 O OE1   . GLN A 367 ? 0.3517 0.2890 0.2960 -0.0082 -0.0022 0.0277  624 GLN A OE1   
2588 N NE2   . GLN A 367 ? 0.3486 0.2890 0.2917 -0.0036 -0.0073 0.0170  624 GLN A NE2   
2589 N N     . ASN A 368 ? 0.3422 0.3188 0.2917 -0.0037 0.0330  0.0341  625 ASN A N     
2590 C CA    . ASN A 368 ? 0.3456 0.3267 0.2874 -0.0020 0.0449  0.0388  625 ASN A CA    
2591 C C     . ASN A 368 ? 0.3272 0.3223 0.2833 0.0007  0.0530  0.0355  625 ASN A C     
2592 O O     . ASN A 368 ? 0.3361 0.3398 0.2979 -0.0003 0.0650  0.0408  625 ASN A O     
2593 C CB    . ASN A 368 ? 0.3558 0.3339 0.2988 -0.0081 0.0500  0.0502  625 ASN A CB    
2594 C CG    . ASN A 368 ? 0.3429 0.3293 0.3143 -0.0153 0.0513  0.0537  625 ASN A CG    
2595 O OD1   . ASN A 368 ? 0.3236 0.3162 0.3120 -0.0158 0.0454  0.0475  625 ASN A OD1   
2596 N ND2   . ASN A 368 ? 0.3453 0.3319 0.3227 -0.0210 0.0588  0.0642  625 ASN A ND2   
2597 N N     . ILE A 369 ? 0.3096 0.3069 0.2730 0.0042  0.0466  0.0274  626 ILE A N     
2598 C CA    . ILE A 369 ? 0.3079 0.3173 0.2873 0.0079  0.0521  0.0234  626 ILE A CA    
2599 C C     . ILE A 369 ? 0.3252 0.3349 0.2870 0.0154  0.0617  0.0195  626 ILE A C     
2600 O O     . ILE A 369 ? 0.3238 0.3225 0.2628 0.0193  0.0573  0.0153  626 ILE A O     
2601 C CB    . ILE A 369 ? 0.2909 0.3001 0.2814 0.0098  0.0413  0.0171  626 ILE A CB    
2602 C CG1   . ILE A 369 ? 0.2827 0.2911 0.2857 0.0031  0.0320  0.0201  626 ILE A CG1   
2603 C CG2   . ILE A 369 ? 0.2932 0.3143 0.3026 0.0145  0.0459  0.0136  626 ILE A CG2   
2604 C CD1   . ILE A 369 ? 0.2730 0.2917 0.2982 -0.0026 0.0350  0.0253  626 ILE A CD1   
2605 N N     . PRO A 370 ? 0.3400 0.3624 0.3125 0.0177  0.0750  0.0204  627 PRO A N     
2606 C CA    . PRO A 370 ? 0.3647 0.3861 0.3155 0.0249  0.0855  0.0164  627 PRO A CA    
2607 C C     . PRO A 370 ? 0.3788 0.3925 0.3177 0.0331  0.0785  0.0043  627 PRO A C     
2608 O O     . PRO A 370 ? 0.3566 0.3708 0.3124 0.0344  0.0697  -0.0009 627 PRO A O     
2609 C CB    . PRO A 370 ? 0.3723 0.4116 0.3433 0.0262  0.1019  0.0185  627 PRO A CB    
2610 C CG    . PRO A 370 ? 0.3522 0.3995 0.3508 0.0167  0.1004  0.0278  627 PRO A CG    
2611 C CD    . PRO A 370 ? 0.3304 0.3685 0.3338 0.0137  0.0817  0.0252  627 PRO A CD    
2612 N N     . ILE A 371 ? 0.4197 0.4252 0.3287 0.0384  0.0818  0.0004  628 ILE A N     
2613 C CA    . ILE A 371 ? 0.4418 0.4379 0.3373 0.0461  0.0747  -0.0122 628 ILE A CA    
2614 C C     . ILE A 371 ? 0.4754 0.4688 0.3423 0.0541  0.0848  -0.0185 628 ILE A C     
2615 O O     . ILE A 371 ? 0.4541 0.4449 0.3177 0.0622  0.0841  -0.0310 628 ILE A O     
2616 C CB    . ILE A 371 ? 0.4488 0.4304 0.3346 0.0435  0.0575  -0.0136 628 ILE A CB    
2617 C CG1   . ILE A 371 ? 0.4909 0.4647 0.3753 0.0499  0.0486  -0.0264 628 ILE A CG1   
2618 C CG2   . ILE A 371 ? 0.4634 0.4358 0.3206 0.0420  0.0560  -0.0085 628 ILE A CG2   
2619 C CD1   . ILE A 371 ? 0.4982 0.4626 0.3885 0.0460  0.0328  -0.0271 628 ILE A CD1   
2620 N N     . ARG A 372 ? 0.5142 0.5073 0.3594 0.0520  0.0938  -0.0099 629 ARG A N     
2621 C CA    . ARG A 372 ? 0.5497 0.5376 0.3594 0.0594  0.1021  -0.0148 629 ARG A CA    
2622 C C     . ARG A 372 ? 0.5386 0.5387 0.3532 0.0673  0.1197  -0.0225 629 ARG A C     
2623 O O     . ARG A 372 ? 0.5494 0.5434 0.3425 0.0766  0.1208  -0.0354 629 ARG A O     
2624 C CB    . ARG A 372 ? 0.6076 0.5917 0.3928 0.0546  0.1080  -0.0008 629 ARG A CB    
2625 C CG    . ARG A 372 ? 0.7182 0.6935 0.4585 0.0620  0.1135  -0.0046 629 ARG A CG    
2626 C CD    . ARG A 372 ? 0.7778 0.7488 0.4927 0.0574  0.1201  0.0117  629 ARG A CD    
2627 N NE    . ARG A 372 ? 0.8263 0.8125 0.5529 0.0539  0.1427  0.0230  629 ARG A NE    
2628 C CZ    . ARG A 372 ? 0.8926 0.8866 0.6017 0.0600  0.1630  0.0212  629 ARG A CZ    
2629 N NH1   . ARG A 372 ? 0.9776 0.9641 0.6531 0.0706  0.1630  0.0072  629 ARG A NH1   
2630 N NH2   . ARG A 372 ? 0.9042 0.9138 0.6303 0.0555  0.1838  0.0328  629 ARG A NH2   
2631 N N     . LEU A 373 ? 0.5089 0.5263 0.3518 0.0640  0.1335  -0.0153 630 LEU A N     
2632 C CA    . LEU A 373 ? 0.5175 0.5491 0.3714 0.0718  0.1512  -0.0226 630 LEU A CA    
2633 C C     . LEU A 373 ? 0.4850 0.5248 0.3806 0.0734  0.1445  -0.0293 630 LEU A C     
2634 O O     . LEU A 373 ? 0.4328 0.4757 0.3551 0.0654  0.1347  -0.0217 630 LEU A O     
2635 C CB    . LEU A 373 ? 0.5398 0.5868 0.3991 0.0674  0.1727  -0.0094 630 LEU A CB    
2636 C CG    . LEU A 373 ? 0.5894 0.6270 0.4026 0.0673  0.1811  -0.0022 630 LEU A CG    
2637 C CD1   . LEU A 373 ? 0.6152 0.6669 0.4372 0.0604  0.2016  0.0146  630 LEU A CD1   
2638 C CD2   . LEU A 373 ? 0.6216 0.6528 0.3986 0.0800  0.1875  -0.0170 630 LEU A CD2   
2639 N N     . GLU A 374 ? 0.4859 0.5280 0.3851 0.0842  0.1493  -0.0438 631 GLU A N     
2640 C CA    . GLU A 374 ? 0.4848 0.5310 0.4198 0.0879  0.1411  -0.0516 631 GLU A CA    
2641 C C     . GLU A 374 ? 0.4589 0.5245 0.4380 0.0823  0.1455  -0.0420 631 GLU A C     
2642 O O     . GLU A 374 ? 0.4177 0.4819 0.4214 0.0785  0.1303  -0.0401 631 GLU A O     
2643 C CB    . GLU A 374 ? 0.5248 0.5696 0.4550 0.1018  0.1477  -0.0695 631 GLU A CB    
2644 C CG    . GLU A 374 ? 0.5293 0.5772 0.4970 0.1074  0.1399  -0.0779 631 GLU A CG    
2645 C CD    . GLU A 374 ? 0.5342 0.5690 0.5128 0.1013  0.1163  -0.0749 631 GLU A CD    
2646 O OE1   . GLU A 374 ? 0.5988 0.6175 0.5510 0.0970  0.1044  -0.0741 631 GLU A OE1   
2647 O OE2   . GLU A 374 ? 0.5478 0.5890 0.5617 0.1007  0.1095  -0.0727 631 GLU A OE2   
2648 N N     . GLU A 375 ? 0.4879 0.5709 0.4762 0.0811  0.1655  -0.0353 632 GLU A N     
2649 C CA    . GLU A 375 ? 0.4966 0.5995 0.5290 0.0749  0.1701  -0.0257 632 GLU A CA    
2650 C C     . GLU A 375 ? 0.4479 0.5444 0.4888 0.0630  0.1523  -0.0150 632 GLU A C     
2651 O O     . GLU A 375 ? 0.4411 0.5426 0.5140 0.0606  0.1405  -0.0142 632 GLU A O     
2652 C CB    . GLU A 375 ? 0.5614 0.6819 0.5978 0.0721  0.1945  -0.0166 632 GLU A CB    
2653 C CG    . GLU A 375 ? 0.6474 0.7804 0.6833 0.0840  0.2167  -0.0266 632 GLU A CG    
2654 C CD    . GLU A 375 ? 0.7253 0.8822 0.7832 0.0802  0.2418  -0.0161 632 GLU A CD    
2655 O OE1   . GLU A 375 ? 0.7339 0.9057 0.8348 0.0720  0.2396  -0.0066 632 GLU A OE1   
2656 O OE2   . GLU A 375 ? 0.8109 0.9722 0.8438 0.0853  0.2641  -0.0170 632 GLU A OE2   
2657 N N     . GLY A 376 ? 0.4118 0.4962 0.4228 0.0563  0.1496  -0.0074 633 GLY A N     
2658 C CA    . GLY A 376 ? 0.3840 0.4613 0.4000 0.0457  0.1342  0.0017  633 GLY A CA    
2659 C C     . GLY A 376 ? 0.3690 0.4325 0.3831 0.0467  0.1132  -0.0047 633 GLY A C     
2660 O O     . GLY A 376 ? 0.3279 0.3911 0.3603 0.0404  0.1007  -0.0003 633 GLY A O     
2661 N N     . ARG A 377 ? 0.3781 0.4291 0.3682 0.0544  0.1096  -0.0149 634 ARG A N     
2662 C CA    . ARG A 377 ? 0.3729 0.4097 0.3593 0.0549  0.0912  -0.0203 634 ARG A CA    
2663 C C     . ARG A 377 ? 0.3428 0.3858 0.3627 0.0562  0.0831  -0.0224 634 ARG A C     
2664 O O     . ARG A 377 ? 0.3048 0.3395 0.3284 0.0526  0.0683  -0.0208 634 ARG A O     
2665 C CB    . ARG A 377 ? 0.4249 0.4497 0.3857 0.0638  0.0906  -0.0325 634 ARG A CB    
2666 C CG    . ARG A 377 ? 0.4563 0.4647 0.4096 0.0636  0.0728  -0.0375 634 ARG A CG    
2667 C CD    . ARG A 377 ? 0.5380 0.5346 0.4653 0.0721  0.0726  -0.0502 634 ARG A CD    
2668 N NE    . ARG A 377 ? 0.5976 0.5785 0.5162 0.0697  0.0558  -0.0529 634 ARG A NE    
2669 C CZ    . ARG A 377 ? 0.6806 0.6481 0.5772 0.0745  0.0496  -0.0630 634 ARG A CZ    
2670 N NH1   . ARG A 377 ? 0.7198 0.6861 0.5960 0.0829  0.0586  -0.0727 634 ARG A NH1   
2671 N NH2   . ARG A 377 ? 0.6949 0.6504 0.5906 0.0708  0.0342  -0.0638 634 ARG A NH2   
2672 N N     . LYS A 378 ? 0.3410 0.3987 0.3850 0.0618  0.0931  -0.0255 635 LYS A N     
2673 C CA    . LYS A 378 ? 0.3622 0.4261 0.4396 0.0640  0.0844  -0.0268 635 LYS A CA    
2674 C C     . LYS A 378 ? 0.3466 0.4135 0.4400 0.0540  0.0730  -0.0164 635 LYS A C     
2675 O O     . LYS A 378 ? 0.3325 0.3981 0.4434 0.0543  0.0603  -0.0161 635 LYS A O     
2676 C CB    . LYS A 378 ? 0.3883 0.4703 0.4926 0.0716  0.0985  -0.0312 635 LYS A CB    
2677 C CG    . LYS A 378 ? 0.4242 0.5018 0.5160 0.0839  0.1072  -0.0449 635 LYS A CG    
2678 C CD    . LYS A 378 ? 0.4636 0.5621 0.5793 0.0908  0.1265  -0.0484 635 LYS A CD    
2679 C CE    . LYS A 378 ? 0.5028 0.5998 0.6239 0.1052  0.1314  -0.0640 635 LYS A CE    
2680 N NZ    . LYS A 378 ? 0.5390 0.6136 0.6234 0.1102  0.1250  -0.0747 635 LYS A NZ    
2681 N N     . ILE A 379 ? 0.3486 0.4175 0.4338 0.0453  0.0768  -0.0079 636 ILE A N     
2682 C CA    . ILE A 379 ? 0.3334 0.4024 0.4295 0.0358  0.0653  0.0001  636 ILE A CA    
2683 C C     . ILE A 379 ? 0.3023 0.3557 0.3861 0.0350  0.0486  -0.0015 636 ILE A C     
2684 O O     . ILE A 379 ? 0.2606 0.3148 0.3584 0.0314  0.0369  0.0018  636 ILE A O     
2685 C CB    . ILE A 379 ? 0.3482 0.4163 0.4321 0.0271  0.0706  0.0082  636 ILE A CB    
2686 C CG1   . ILE A 379 ? 0.3753 0.4608 0.4784 0.0252  0.0869  0.0131  636 ILE A CG1   
2687 C CG2   . ILE A 379 ? 0.3411 0.4034 0.4281 0.0184  0.0565  0.0135  636 ILE A CG2   
2688 C CD1   . ILE A 379 ? 0.4021 0.5059 0.5458 0.0273  0.0878  0.0122  636 ILE A CD1   
2689 N N     . ARG A 380 ? 0.3093 0.3489 0.3673 0.0383  0.0474  -0.0064 637 ARG A N     
2690 C CA    . ARG A 380 ? 0.2916 0.3170 0.3389 0.0366  0.0334  -0.0069 637 ARG A CA    
2691 C C     . ARG A 380 ? 0.2806 0.3045 0.3444 0.0413  0.0246  -0.0096 637 ARG A C     
2692 O O     . ARG A 380 ? 0.2782 0.2918 0.3363 0.0389  0.0134  -0.0078 637 ARG A O     
2693 C CB    . ARG A 380 ? 0.3126 0.3246 0.3324 0.0384  0.0335  -0.0114 637 ARG A CB    
2694 C CG    . ARG A 380 ? 0.3299 0.3401 0.3310 0.0333  0.0388  -0.0069 637 ARG A CG    
2695 C CD    . ARG A 380 ? 0.3436 0.3418 0.3186 0.0367  0.0384  -0.0123 637 ARG A CD    
2696 N NE    . ARG A 380 ? 0.3545 0.3492 0.3118 0.0321  0.0407  -0.0069 637 ARG A NE    
2697 C CZ    . ARG A 380 ? 0.3587 0.3424 0.3012 0.0295  0.0325  -0.0064 637 ARG A CZ    
2698 N NH1   . ARG A 380 ? 0.3506 0.3263 0.2932 0.0304  0.0226  -0.0109 637 ARG A NH1   
2699 N NH2   . ARG A 380 ? 0.3757 0.3566 0.3046 0.0261  0.0347  -0.0008 637 ARG A NH2   
2700 N N     . GLN A 381 ? 0.2862 0.3201 0.3708 0.0481  0.0297  -0.0134 638 GLN A N     
2701 C CA    . GLN A 381 ? 0.3030 0.3355 0.4070 0.0528  0.0197  -0.0145 638 GLN A CA    
2702 C C     . GLN A 381 ? 0.2950 0.3317 0.4133 0.0469  0.0082  -0.0061 638 GLN A C     
2703 O O     . GLN A 381 ? 0.3010 0.3340 0.4308 0.0495  -0.0028 -0.0045 638 GLN A O     
2704 C CB    . GLN A 381 ? 0.3222 0.3657 0.4491 0.0625  0.0281  -0.0211 638 GLN A CB    
2705 C CG    . GLN A 381 ? 0.3473 0.3842 0.4591 0.0705  0.0373  -0.0318 638 GLN A CG    
2706 C CD    . GLN A 381 ? 0.3753 0.4251 0.5085 0.0802  0.0488  -0.0392 638 GLN A CD    
2707 O OE1   . GLN A 381 ? 0.3976 0.4641 0.5582 0.0800  0.0522  -0.0353 638 GLN A OE1   
2708 N NE2   . GLN A 381 ? 0.4075 0.4500 0.5297 0.0891  0.0548  -0.0507 638 GLN A NE2   
2709 N N     . ALA A 382 ? 0.2765 0.3207 0.3949 0.0394  0.0103  -0.0010 639 ALA A N     
2710 C CA    . ALA A 382 ? 0.2810 0.3296 0.4122 0.0340  -0.0009 0.0051  639 ALA A CA    
2711 C C     . ALA A 382 ? 0.2575 0.2920 0.3654 0.0279  -0.0110 0.0087  639 ALA A C     
2712 O O     . ALA A 382 ? 0.2564 0.2911 0.3682 0.0240  -0.0219 0.0128  639 ALA A O     
2713 C CB    . ALA A 382 ? 0.2675 0.3305 0.4133 0.0285  0.0056  0.0079  639 ALA A CB    
2714 N N     . PHE A 383 ? 0.2599 0.2828 0.3440 0.0274  -0.0075 0.0067  640 PHE A N     
2715 C CA    . PHE A 383 ? 0.2442 0.2552 0.3084 0.0223  -0.0148 0.0096  640 PHE A CA    
2716 C C     . PHE A 383 ? 0.2484 0.2484 0.3080 0.0260  -0.0212 0.0096  640 PHE A C     
2717 O O     . PHE A 383 ? 0.2320 0.2262 0.2876 0.0304  -0.0171 0.0050  640 PHE A O     
2718 C CB    . PHE A 383 ? 0.2557 0.2612 0.3001 0.0190  -0.0080 0.0082  640 PHE A CB    
2719 C CG    . PHE A 383 ? 0.2705 0.2836 0.3175 0.0141  -0.0028 0.0102  640 PHE A CG    
2720 C CD1   . PHE A 383 ? 0.2766 0.2991 0.3326 0.0160  0.0079  0.0092  640 PHE A CD1   
2721 C CD2   . PHE A 383 ? 0.2688 0.2792 0.3104 0.0076  -0.0082 0.0131  640 PHE A CD2   
2722 C CE1   . PHE A 383 ? 0.2992 0.3279 0.3597 0.0105  0.0129  0.0128  640 PHE A CE1   
2723 C CE2   . PHE A 383 ? 0.2814 0.2970 0.3281 0.0026  -0.0046 0.0150  640 PHE A CE2   
2724 C CZ    . PHE A 383 ? 0.2867 0.3111 0.3433 0.0036  0.0059  0.0157  640 PHE A CZ    
2725 N N     . VAL A 384 ? 0.2356 0.2321 0.2957 0.0240  -0.0319 0.0150  641 VAL A N     
2726 C CA    . VAL A 384 ? 0.2438 0.2310 0.3057 0.0277  -0.0389 0.0175  641 VAL A CA    
2727 C C     . VAL A 384 ? 0.2427 0.2195 0.2855 0.0224  -0.0447 0.0235  641 VAL A C     
2728 O O     . VAL A 384 ? 0.2692 0.2478 0.3004 0.0169  -0.0450 0.0248  641 VAL A O     
2729 C CB    . VAL A 384 ? 0.2372 0.2309 0.3217 0.0325  -0.0467 0.0199  641 VAL A CB    
2730 C CG1   . VAL A 384 ? 0.2515 0.2576 0.3583 0.0386  -0.0385 0.0133  641 VAL A CG1   
2731 C CG2   . VAL A 384 ? 0.2325 0.2312 0.3172 0.0279  -0.0561 0.0252  641 VAL A CG2   
2732 N N     . PRO A 385 ? 0.2545 0.2204 0.2946 0.0239  -0.0488 0.0272  642 PRO A N     
2733 C CA    . PRO A 385 ? 0.2625 0.2195 0.2846 0.0187  -0.0525 0.0343  642 PRO A CA    
2734 C C     . PRO A 385 ? 0.2825 0.2418 0.3008 0.0172  -0.0621 0.0406  642 PRO A C     
2735 O O     . PRO A 385 ? 0.2793 0.2447 0.3142 0.0211  -0.0688 0.0411  642 PRO A O     
2736 C CB    . PRO A 385 ? 0.2776 0.2230 0.3033 0.0210  -0.0549 0.0380  642 PRO A CB    
2737 C CG    . PRO A 385 ? 0.2687 0.2154 0.3107 0.0272  -0.0513 0.0298  642 PRO A CG    
2738 C CD    . PRO A 385 ? 0.2668 0.2271 0.3206 0.0303  -0.0499 0.0253  642 PRO A CD    
2739 N N     . SER A 386 ? 0.2874 0.2424 0.2847 0.0119  -0.0630 0.0446  643 SER A N     
2740 C CA    . SER A 386 ? 0.3076 0.2639 0.2957 0.0102  -0.0727 0.0487  643 SER A CA    
2741 C C     . SER A 386 ? 0.3348 0.2819 0.3169 0.0120  -0.0824 0.0591  643 SER A C     
2742 O O     . SER A 386 ? 0.3294 0.2764 0.3031 0.0117  -0.0932 0.0633  643 SER A O     
2743 C CB    . SER A 386 ? 0.3187 0.2741 0.2843 0.0047  -0.0690 0.0466  643 SER A CB    
2744 O OG    . SER A 386 ? 0.3351 0.2819 0.2845 0.0022  -0.0624 0.0506  643 SER A OG    
2745 N N     . GLU A 387 ? 0.3426 0.2811 0.3295 0.0138  -0.0802 0.0637  644 GLU A N     
2746 C CA    . GLU A 387 ? 0.3966 0.3243 0.3776 0.0151  -0.0894 0.0757  644 GLU A CA    
2747 C C     . GLU A 387 ? 0.3810 0.3037 0.3856 0.0206  -0.0916 0.0769  644 GLU A C     
2748 O O     . GLU A 387 ? 0.3202 0.2449 0.3382 0.0222  -0.0834 0.0687  644 GLU A O     
2749 C CB    . GLU A 387 ? 0.4720 0.3899 0.4285 0.0095  -0.0831 0.0833  644 GLU A CB    
2750 C CG    . GLU A 387 ? 0.5480 0.4693 0.4791 0.0051  -0.0812 0.0817  644 GLU A CG    
2751 C CD    . GLU A 387 ? 0.6564 0.5696 0.5634 0.0004  -0.0736 0.0894  644 GLU A CD    
2752 O OE1   . GLU A 387 ? 0.7651 0.6680 0.6646 0.0002  -0.0774 0.1022  644 GLU A OE1   
2753 O OE2   . GLU A 387 ? 0.7643 0.6816 0.6611 -0.0031 -0.0635 0.0832  644 GLU A OE2   
2754 N N     . SER A 388 ? 0.3947 0.3094 0.4035 0.0240  -0.1032 0.0869  645 SER A N     
2755 C CA    . SER A 388 ? 0.4104 0.3201 0.4448 0.0304  -0.1059 0.0864  645 SER A CA    
2756 C C     . SER A 388 ? 0.3982 0.2950 0.4293 0.0273  -0.0984 0.0895  645 SER A C     
2757 O O     . SER A 388 ? 0.3830 0.2727 0.3926 0.0208  -0.0949 0.0981  645 SER A O     
2758 C CB    . SER A 388 ? 0.4621 0.3661 0.5063 0.0359  -0.1218 0.0962  645 SER A CB    
2759 O OG    . SER A 388 ? 0.5329 0.4229 0.5541 0.0319  -0.1270 0.1114  645 SER A OG    
2760 N N     . ASP A 389 ? 0.3954 0.2895 0.4484 0.0319  -0.0957 0.0819  646 ASP A N     
2761 C CA    . ASP A 389 ? 0.4209 0.3019 0.4759 0.0289  -0.0907 0.0838  646 ASP A CA    
2762 C C     . ASP A 389 ? 0.3752 0.2609 0.4164 0.0222  -0.0786 0.0777  646 ASP A C     
2763 O O     . ASP A 389 ? 0.3721 0.2489 0.4136 0.0180  -0.0745 0.0802  646 ASP A O     
2764 C CB    . ASP A 389 ? 0.4628 0.3277 0.5109 0.0259  -0.0974 0.1014  646 ASP A CB    
2765 C CG    . ASP A 389 ? 0.5411 0.3992 0.6049 0.0334  -0.1114 0.1082  646 ASP A CG    
2766 O OD1   . ASP A 389 ? 0.5988 0.4551 0.6882 0.0407  -0.1136 0.0995  646 ASP A OD1   
2767 O OD2   . ASP A 389 ? 0.6009 0.4553 0.6517 0.0329  -0.1206 0.1214  646 ASP A OD2   
2768 N N     . TRP A 390 ? 0.3472 0.2470 0.3799 0.0214  -0.0738 0.0698  647 TRP A N     
2769 C CA    . TRP A 390 ? 0.3228 0.2283 0.3470 0.0171  -0.0634 0.0616  647 TRP A CA    
2770 C C     . TRP A 390 ? 0.2961 0.2081 0.3334 0.0221  -0.0595 0.0476  647 TRP A C     
2771 O O     . TRP A 390 ? 0.2848 0.2012 0.3356 0.0285  -0.0629 0.0435  647 TRP A O     
2772 C CB    . TRP A 390 ? 0.3083 0.2226 0.3125 0.0126  -0.0605 0.0630  647 TRP A CB    
2773 C CG    . TRP A 390 ? 0.3208 0.2288 0.3054 0.0068  -0.0599 0.0747  647 TRP A CG    
2774 C CD1   . TRP A 390 ? 0.3484 0.2457 0.3281 0.0061  -0.0661 0.0882  647 TRP A CD1   
2775 C CD2   . TRP A 390 ? 0.3132 0.2248 0.2787 0.0009  -0.0517 0.0747  647 TRP A CD2   
2776 N NE1   . TRP A 390 ? 0.3496 0.2446 0.3067 0.0003  -0.0611 0.0964  647 TRP A NE1   
2777 C CE2   . TRP A 390 ? 0.3544 0.2581 0.3030 -0.0026 -0.0524 0.0880  647 TRP A CE2   
2778 C CE3   . TRP A 390 ? 0.3161 0.2362 0.2766 -0.0010 -0.0443 0.0654  647 TRP A CE3   
2779 C CZ2   . TRP A 390 ? 0.3632 0.2688 0.2913 -0.0077 -0.0440 0.0903  647 TRP A CZ2   
2780 C CZ3   . TRP A 390 ? 0.3214 0.2426 0.2640 -0.0058 -0.0375 0.0676  647 TRP A CZ3   
2781 C CH2   . TRP A 390 ? 0.3372 0.2519 0.2640 -0.0088 -0.0368 0.0792  647 TRP A CH2   
2782 N N     . LEU A 391 ? 0.2734 0.1864 0.3064 0.0195  -0.0523 0.0405  648 LEU A N     
2783 C CA    . LEU A 391 ? 0.2702 0.1883 0.3085 0.0235  -0.0477 0.0276  648 LEU A CA    
2784 C C     . LEU A 391 ? 0.2639 0.1897 0.2886 0.0194  -0.0407 0.0231  648 LEU A C     
2785 O O     . LEU A 391 ? 0.2750 0.2006 0.2889 0.0134  -0.0388 0.0284  648 LEU A O     
2786 C CB    . LEU A 391 ? 0.2680 0.1749 0.3169 0.0258  -0.0491 0.0219  648 LEU A CB    
2787 C CG    . LEU A 391 ? 0.2835 0.1800 0.3493 0.0309  -0.0565 0.0247  648 LEU A CG    
2788 C CD1   . LEU A 391 ? 0.2974 0.1796 0.3736 0.0309  -0.0592 0.0205  648 LEU A CD1   
2789 C CD2   . LEU A 391 ? 0.2858 0.1895 0.3633 0.0399  -0.0573 0.0180  648 LEU A CD2   
2790 N N     . ILE A 392 ? 0.2493 0.1817 0.2748 0.0232  -0.0365 0.0136  649 ILE A N     
2791 C CA    . ILE A 392 ? 0.2404 0.1783 0.2546 0.0206  -0.0309 0.0092  649 ILE A CA    
2792 C C     . ILE A 392 ? 0.2454 0.1762 0.2586 0.0209  -0.0306 0.0027  649 ILE A C     
2793 O O     . ILE A 392 ? 0.2509 0.1763 0.2709 0.0260  -0.0323 -0.0041 649 ILE A O     
2794 C CB    . ILE A 392 ? 0.2452 0.1935 0.2599 0.0243  -0.0262 0.0040  649 ILE A CB    
2795 C CG1   . ILE A 392 ? 0.2607 0.2169 0.2813 0.0237  -0.0284 0.0097  649 ILE A CG1   
2796 C CG2   . ILE A 392 ? 0.2341 0.1862 0.2360 0.0217  -0.0206 0.0006  649 ILE A CG2   
2797 C CD1   . ILE A 392 ? 0.2432 0.2000 0.2530 0.0172  -0.0305 0.0164  649 ILE A CD1   
2798 N N     . PHE A 393 ? 0.2457 0.1765 0.2510 0.0159  -0.0289 0.0037  650 PHE A N     
2799 C CA    . PHE A 393 ? 0.2587 0.1840 0.2643 0.0153  -0.0303 -0.0022 650 PHE A CA    
2800 C C     . PHE A 393 ? 0.2468 0.1782 0.2407 0.0147  -0.0268 -0.0057 650 PHE A C     
2801 O O     . PHE A 393 ? 0.2501 0.1871 0.2385 0.0113  -0.0238 -0.0008 650 PHE A O     
2802 C CB    . PHE A 393 ? 0.2556 0.1760 0.2677 0.0094  -0.0320 0.0042  650 PHE A CB    
2803 C CG    . PHE A 393 ? 0.2626 0.1783 0.2805 0.0079  -0.0349 -0.0013 650 PHE A CG    
2804 C CD1   . PHE A 393 ? 0.2660 0.1865 0.2788 0.0058  -0.0334 -0.0036 650 PHE A CD1   
2805 C CD2   . PHE A 393 ? 0.2834 0.1892 0.3142 0.0088  -0.0406 -0.0044 650 PHE A CD2   
2806 C CE1   . PHE A 393 ? 0.2569 0.1737 0.2774 0.0047  -0.0382 -0.0091 650 PHE A CE1   
2807 C CE2   . PHE A 393 ? 0.2858 0.1873 0.3244 0.0070  -0.0453 -0.0104 650 PHE A CE2   
2808 C CZ    . PHE A 393 ? 0.2766 0.1842 0.3100 0.0051  -0.0444 -0.0127 650 PHE A CZ    
2809 N N     . ALA A 394 ? 0.2459 0.1750 0.2348 0.0184  -0.0279 -0.0142 651 ALA A N     
2810 C CA    . ALA A 394 ? 0.2410 0.1739 0.2172 0.0187  -0.0257 -0.0167 651 ALA A CA    
2811 C C     . ALA A 394 ? 0.2492 0.1758 0.2243 0.0191  -0.0317 -0.0229 651 ALA A C     
2812 O O     . ALA A 394 ? 0.2666 0.1862 0.2447 0.0225  -0.0364 -0.0301 651 ALA A O     
2813 C CB    . ALA A 394 ? 0.2404 0.1769 0.2075 0.0240  -0.0210 -0.0206 651 ALA A CB    
2814 N N     . ALA A 395 ? 0.2459 0.1747 0.2177 0.0162  -0.0325 -0.0212 652 ALA A N     
2815 C CA    . ALA A 395 ? 0.2582 0.1823 0.2316 0.0163  -0.0399 -0.0265 652 ALA A CA    
2816 C C     . ALA A 395 ? 0.2735 0.1999 0.2323 0.0178  -0.0399 -0.0267 652 ALA A C     
2817 O O     . ALA A 395 ? 0.2817 0.2134 0.2393 0.0152  -0.0350 -0.0205 652 ALA A O     
2818 C CB    . ALA A 395 ? 0.2483 0.1733 0.2395 0.0106  -0.0419 -0.0225 652 ALA A CB    
2819 N N     . ASP A 396 ? 0.2859 0.2068 0.2328 0.0221  -0.0460 -0.0338 653 ASP A N     
2820 C CA    . ASP A 396 ? 0.3083 0.2292 0.2388 0.0240  -0.0474 -0.0330 653 ASP A CA    
2821 C C     . ASP A 396 ? 0.2932 0.2085 0.2227 0.0255  -0.0597 -0.0387 653 ASP A C     
2822 O O     . ASP A 396 ? 0.2817 0.1906 0.2133 0.0277  -0.0677 -0.0473 653 ASP A O     
2823 C CB    . ASP A 396 ? 0.3562 0.2766 0.2651 0.0288  -0.0410 -0.0340 653 ASP A CB    
2824 C CG    . ASP A 396 ? 0.4287 0.3422 0.3271 0.0346  -0.0452 -0.0445 653 ASP A CG    
2825 O OD1   . ASP A 396 ? 0.4699 0.3815 0.3805 0.0353  -0.0457 -0.0492 653 ASP A OD1   
2826 O OD2   . ASP A 396 ? 0.5457 0.4540 0.4223 0.0390  -0.0490 -0.0487 653 ASP A OD2   
2827 N N     . TYR A 397 ? 0.2731 0.1897 0.1999 0.0248  -0.0626 -0.0346 654 TYR A N     
2828 C CA    . TYR A 397 ? 0.2892 0.2005 0.2117 0.0273  -0.0757 -0.0393 654 TYR A CA    
2829 C C     . TYR A 397 ? 0.3192 0.2231 0.2121 0.0334  -0.0787 -0.0443 654 TYR A C     
2830 O O     . TYR A 397 ? 0.3370 0.2416 0.2107 0.0352  -0.0694 -0.0396 654 TYR A O     
2831 C CB    . TYR A 397 ? 0.2908 0.2047 0.2173 0.0263  -0.0787 -0.0334 654 TYR A CB    
2832 C CG    . TYR A 397 ? 0.2721 0.1935 0.2273 0.0214  -0.0764 -0.0302 654 TYR A CG    
2833 C CD1   . TYR A 397 ? 0.2816 0.2046 0.2592 0.0199  -0.0856 -0.0343 654 TYR A CD1   
2834 C CD2   . TYR A 397 ? 0.2737 0.2007 0.2334 0.0185  -0.0652 -0.0235 654 TYR A CD2   
2835 C CE1   . TYR A 397 ? 0.2690 0.2004 0.2730 0.0156  -0.0812 -0.0310 654 TYR A CE1   
2836 C CE2   . TYR A 397 ? 0.2629 0.1968 0.2454 0.0147  -0.0616 -0.0213 654 TYR A CE2   
2837 C CZ    . TYR A 397 ? 0.2529 0.1894 0.2576 0.0134  -0.0687 -0.0248 654 TYR A CZ    
2838 O OH    . TYR A 397 ? 0.2548 0.1994 0.2827 0.0098  -0.0630 -0.0225 654 TYR A OH    
2839 N N     . SER A 398 ? 0.2551 0.2940 0.1996 0.0690  -0.0271 0.0296  655 SER A N     
2840 C CA    . SER A 398 ? 0.2554 0.2802 0.2123 0.0612  -0.0242 0.0250  655 SER A CA    
2841 C C     . SER A 398 ? 0.2401 0.2479 0.1979 0.0442  -0.0259 0.0130  655 SER A C     
2842 O O     . SER A 398 ? 0.2464 0.2332 0.2001 0.0410  -0.0218 0.0136  655 SER A O     
2843 C CB    . SER A 398 ? 0.2858 0.2851 0.2460 0.0697  -0.0111 0.0357  655 SER A CB    
2844 O OG    . SER A 398 ? 0.2970 0.2848 0.2669 0.0607  -0.0086 0.0284  655 SER A OG    
2845 N N     . GLN A 399 ? 0.2234 0.2408 0.1879 0.0343  -0.0304 0.0031  656 GLN A N     
2846 C CA    . GLN A 399 ? 0.2251 0.2260 0.1904 0.0214  -0.0296 -0.0049 656 GLN A CA    
2847 C C     . GLN A 399 ? 0.2224 0.2128 0.1792 0.0179  -0.0296 -0.0077 656 GLN A C     
2848 O O     . GLN A 399 ? 0.2233 0.1953 0.1791 0.0148  -0.0265 -0.0070 656 GLN A O     
2849 C CB    . GLN A 399 ? 0.2412 0.2231 0.2092 0.0205  -0.0243 -0.0018 656 GLN A CB    
2850 C CG    . GLN A 399 ? 0.2624 0.2506 0.2383 0.0228  -0.0217 -0.0009 656 GLN A CG    
2851 C CD    . GLN A 399 ? 0.2778 0.2802 0.2608 0.0153  -0.0238 -0.0077 656 GLN A CD    
2852 O OE1   . GLN A 399 ? 0.3313 0.3272 0.3125 0.0060  -0.0237 -0.0131 656 GLN A OE1   
2853 N NE2   . GLN A 399 ? 0.2960 0.3160 0.2884 0.0196  -0.0230 -0.0068 656 GLN A NE2   
2854 N N     . ILE A 400 ? 0.2292 0.2348 0.1800 0.0190  -0.0331 -0.0115 657 ILE A N     
2855 C CA    . ILE A 400 ? 0.2225 0.2177 0.1648 0.0159  -0.0313 -0.0154 657 ILE A CA    
2856 C C     . ILE A 400 ? 0.2267 0.2044 0.1725 0.0053  -0.0272 -0.0232 657 ILE A C     
2857 O O     . ILE A 400 ? 0.2202 0.1810 0.1632 0.0063  -0.0231 -0.0205 657 ILE A O     
2858 C CB    . ILE A 400 ? 0.2314 0.2483 0.1636 0.0188  -0.0351 -0.0201 657 ILE A CB    
2859 C CG1   . ILE A 400 ? 0.2426 0.2447 0.1648 0.0180  -0.0305 -0.0222 657 ILE A CG1   
2860 C CG2   . ILE A 400 ? 0.2295 0.2725 0.1661 0.0097  -0.0402 -0.0346 657 ILE A CG2   
2861 C CD1   . ILE A 400 ? 0.2633 0.2862 0.1709 0.0218  -0.0330 -0.0265 657 ILE A CD1   
2862 N N     . GLU A 401 ? 0.2362 0.2179 0.1894 -0.0033 -0.0265 -0.0308 658 GLU A N     
2863 C CA    . GLU A 401 ? 0.2505 0.2119 0.2060 -0.0114 -0.0187 -0.0356 658 GLU A CA    
2864 C C     . GLU A 401 ? 0.2462 0.1894 0.2018 -0.0061 -0.0157 -0.0243 658 GLU A C     
2865 O O     . GLU A 401 ? 0.2623 0.1896 0.2152 -0.0042 -0.0104 -0.0216 658 GLU A O     
2866 C CB    . GLU A 401 ? 0.2683 0.2368 0.2328 -0.0231 -0.0155 -0.0464 658 GLU A CB    
2867 C CG    . GLU A 401 ? 0.2950 0.2905 0.2608 -0.0301 -0.0199 -0.0613 658 GLU A CG    
2868 C CD    . GLU A 401 ? 0.3234 0.3539 0.2933 -0.0233 -0.0305 -0.0579 658 GLU A CD    
2869 O OE1   . GLU A 401 ? 0.3120 0.3408 0.2833 -0.0126 -0.0328 -0.0439 658 GLU A OE1   
2870 O OE2   . GLU A 401 ? 0.3491 0.4114 0.3209 -0.0279 -0.0359 -0.0700 658 GLU A OE2   
2871 N N     . LEU A 402 ? 0.2440 0.1926 0.2026 -0.0027 -0.0188 -0.0181 659 LEU A N     
2872 C CA    . LEU A 402 ? 0.2450 0.1831 0.2023 0.0014  -0.0170 -0.0101 659 LEU A CA    
2873 C C     . LEU A 402 ? 0.2308 0.1673 0.1858 0.0070  -0.0187 -0.0061 659 LEU A C     
2874 O O     . LEU A 402 ? 0.2433 0.1758 0.1979 0.0100  -0.0174 -0.0018 659 LEU A O     
2875 C CB    . LEU A 402 ? 0.2351 0.1797 0.1954 0.0016  -0.0183 -0.0081 659 LEU A CB    
2876 C CG    . LEU A 402 ? 0.2499 0.1949 0.2138 -0.0041 -0.0140 -0.0105 659 LEU A CG    
2877 C CD1   . LEU A 402 ? 0.2528 0.2069 0.2201 -0.0032 -0.0145 -0.0098 659 LEU A CD1   
2878 C CD2   . LEU A 402 ? 0.2542 0.1841 0.2135 -0.0041 -0.0069 -0.0056 659 LEU A CD2   
2879 N N     . ARG A 403 ? 0.2277 0.1702 0.1816 0.0096  -0.0208 -0.0064 660 ARG A N     
2880 C CA    . ARG A 403 ? 0.2256 0.1653 0.1788 0.0134  -0.0194 -0.0031 660 ARG A CA    
2881 C C     . ARG A 403 ? 0.2275 0.1606 0.1782 0.0141  -0.0164 -0.0043 660 ARG A C     
2882 O O     . ARG A 403 ? 0.2286 0.1603 0.1826 0.0171  -0.0145 -0.0009 660 ARG A O     
2883 C CB    . ARG A 403 ? 0.2326 0.1769 0.1832 0.0178  -0.0189 -0.0005 660 ARG A CB    
2884 C CG    . ARG A 403 ? 0.2435 0.1884 0.1985 0.0198  -0.0174 0.0028  660 ARG A CG    
2885 C CD    . ARG A 403 ? 0.2585 0.2062 0.2096 0.0281  -0.0140 0.0094  660 ARG A CD    
2886 N NE    . ARG A 403 ? 0.2685 0.2142 0.2248 0.0316  -0.0102 0.0128  660 ARG A NE    
2887 C CZ    . ARG A 403 ? 0.2885 0.2207 0.2497 0.0323  -0.0008 0.0153  660 ARG A CZ    
2888 N NH1   . ARG A 403 ? 0.2835 0.2063 0.2466 0.0289  0.0050  0.0149  660 ARG A NH1   
2889 N NH2   . ARG A 403 ? 0.3105 0.2382 0.2765 0.0350  0.0045  0.0165  660 ARG A NH2   
2890 N N     . VAL A 404 ? 0.2337 0.1649 0.1799 0.0111  -0.0149 -0.0103 661 VAL A N     
2891 C CA    . VAL A 404 ? 0.2364 0.1560 0.1804 0.0112  -0.0084 -0.0133 661 VAL A CA    
2892 C C     . VAL A 404 ? 0.2441 0.1528 0.1924 0.0140  -0.0036 -0.0075 661 VAL A C     
2893 O O     . VAL A 404 ? 0.2334 0.1375 0.1835 0.0205  0.0006  -0.0027 661 VAL A O     
2894 C CB    . VAL A 404 ? 0.2496 0.1691 0.1886 0.0040  -0.0059 -0.0255 661 VAL A CB    
2895 C CG1   . VAL A 404 ? 0.2530 0.1531 0.1913 0.0024  0.0053  -0.0304 661 VAL A CG1   
2896 C CG2   . VAL A 404 ? 0.2512 0.1871 0.1820 0.0060  -0.0107 -0.0284 661 VAL A CG2   
2897 N N     . LEU A 405 ? 0.2360 0.1433 0.1860 0.0109  -0.0039 -0.0064 662 LEU A N     
2898 C CA    . LEU A 405 ? 0.2565 0.1559 0.2074 0.0161  0.0011  0.0022  662 LEU A CA    
2899 C C     . LEU A 405 ? 0.2561 0.1692 0.2093 0.0245  -0.0043 0.0106  662 LEU A C     
2900 O O     . LEU A 405 ? 0.2593 0.1712 0.2135 0.0335  -0.0001 0.0184  662 LEU A O     
2901 C CB    . LEU A 405 ? 0.2607 0.1584 0.2116 0.0113  0.0026  0.0025  662 LEU A CB    
2902 C CG    . LEU A 405 ? 0.2749 0.1670 0.2228 0.0192  0.0080  0.0147  662 LEU A CG    
2903 C CD1   . LEU A 405 ? 0.2911 0.1618 0.2382 0.0251  0.0216  0.0200  662 LEU A CD1   
2904 C CD2   . LEU A 405 ? 0.2686 0.1589 0.2155 0.0137  0.0110  0.0146  662 LEU A CD2   
2905 N N     . ALA A 406 ? 0.2465 0.1738 0.2018 0.0214  -0.0120 0.0080  663 ALA A N     
2906 C CA    . ALA A 406 ? 0.2417 0.1851 0.2020 0.0246  -0.0163 0.0102  663 ALA A CA    
2907 C C     . ALA A 406 ? 0.2576 0.2036 0.2229 0.0300  -0.0136 0.0123  663 ALA A C     
2908 O O     . ALA A 406 ? 0.2713 0.2316 0.2418 0.0368  -0.0145 0.0174  663 ALA A O     
2909 C CB    . ALA A 406 ? 0.2219 0.1721 0.1854 0.0183  -0.0199 0.0043  663 ALA A CB    
2910 N N     . HIS A 407 ? 0.2692 0.2058 0.2330 0.0278  -0.0104 0.0085  664 HIS A N     
2911 C CA    . HIS A 407 ? 0.2594 0.1968 0.2273 0.0326  -0.0058 0.0097  664 HIS A CA    
2912 C C     . HIS A 407 ? 0.2705 0.1993 0.2383 0.0412  0.0011  0.0151  664 HIS A C     
2913 O O     . HIS A 407 ? 0.2649 0.2045 0.2408 0.0495  0.0033  0.0204  664 HIS A O     
2914 C CB    . HIS A 407 ? 0.2694 0.1983 0.2309 0.0289  -0.0030 0.0044  664 HIS A CB    
2915 C CG    . HIS A 407 ? 0.2800 0.2055 0.2420 0.0336  0.0042  0.0044  664 HIS A CG    
2916 N ND1   . HIS A 407 ? 0.2824 0.2174 0.2514 0.0348  0.0064  0.0060  664 HIS A ND1   
2917 C CD2   . HIS A 407 ? 0.3036 0.2153 0.2601 0.0363  0.0120  0.0015  664 HIS A CD2   
2918 C CE1   . HIS A 407 ? 0.2992 0.2290 0.2669 0.0396  0.0144  0.0056  664 HIS A CE1   
2919 N NE2   . HIS A 407 ? 0.3036 0.2180 0.2630 0.0407  0.0179  0.0023  664 HIS A NE2   
2920 N N     . ILE A 408 ? 0.2713 0.1806 0.2319 0.0396  0.0069  0.0134  665 ILE A N     
2921 C CA    A ILE A 408 ? 0.2971 0.1906 0.2579 0.0483  0.0185  0.0187  665 ILE A CA    
2922 C CA    B ILE A 408 ? 0.2903 0.1828 0.2507 0.0480  0.0187  0.0185  665 ILE A CA    
2923 C C     . ILE A 408 ? 0.3029 0.2041 0.2665 0.0602  0.0190  0.0326  665 ILE A C     
2924 O O     . ILE A 408 ? 0.3106 0.2104 0.2782 0.0735  0.0267  0.0420  665 ILE A O     
2925 C CB    A ILE A 408 ? 0.3230 0.1900 0.2771 0.0408  0.0289  0.0097  665 ILE A CB    
2926 C CB    B ILE A 408 ? 0.3009 0.1679 0.2547 0.0399  0.0281  0.0104  665 ILE A CB    
2927 C CG1   A ILE A 408 ? 0.3231 0.1858 0.2746 0.0331  0.0273  0.0084  665 ILE A CG1   
2928 C CG1   B ILE A 408 ? 0.2969 0.1621 0.2456 0.0297  0.0277  -0.0046 665 ILE A CG1   
2929 C CG2   A ILE A 408 ? 0.3153 0.1829 0.2643 0.0316  0.0276  -0.0042 665 ILE A CG2   
2930 C CG2   B ILE A 408 ? 0.3215 0.1638 0.2760 0.0489  0.0454  0.0165  665 ILE A CG2   
2931 C CD1   A ILE A 408 ? 0.3542 0.1957 0.3031 0.0217  0.0381  -0.0045 665 ILE A CD1   
2932 C CD1   B ILE A 408 ? 0.3059 0.1559 0.2503 0.0177  0.0346  -0.0179 665 ILE A CD1   
2933 N N     . ALA A 409 ? 0.2981 0.2100 0.2590 0.0573  0.0114  0.0348  666 ALA A N     
2934 C CA    . ALA A 409 ? 0.3233 0.2468 0.2828 0.0699  0.0115  0.0488  666 ALA A CA    
2935 C C     . ALA A 409 ? 0.3165 0.2783 0.2841 0.0755  0.0002  0.0510  666 ALA A C     
2936 O O     . ALA A 409 ? 0.3184 0.2998 0.2860 0.0891  -0.0010 0.0629  666 ALA A O     
2937 C CB    . ALA A 409 ? 0.3111 0.2309 0.2623 0.0644  0.0098  0.0496  666 ALA A CB    
2938 N N     . GLU A 410 ? 0.3082 0.2823 0.2830 0.0647  -0.0070 0.0393  667 GLU A N     
2939 C CA    . GLU A 410 ? 0.3010 0.3117 0.2862 0.0635  -0.0166 0.0358  667 GLU A CA    
2940 C C     . GLU A 410 ? 0.2845 0.3164 0.2638 0.0643  -0.0243 0.0374  667 GLU A C     
2941 O O     . GLU A 410 ? 0.2706 0.3370 0.2542 0.0728  -0.0300 0.0418  667 GLU A O     
2942 C CB    . GLU A 410 ? 0.3434 0.3742 0.3408 0.0762  -0.0143 0.0426  667 GLU A CB    
2943 C CG    . GLU A 410 ? 0.3835 0.3941 0.3856 0.0742  -0.0055 0.0389  667 GLU A CG    
2944 C CD    . GLU A 410 ? 0.4471 0.4775 0.4631 0.0880  -0.0012 0.0460  667 GLU A CD    
2945 O OE1   . GLU A 410 ? 0.4782 0.5438 0.5097 0.0851  -0.0073 0.0412  667 GLU A OE1   
2946 O OE2   . GLU A 410 ? 0.5011 0.5127 0.5143 0.1013  0.0098  0.0555  667 GLU A OE2   
2947 N N     . ASP A 411 ? 0.2652 0.2794 0.2338 0.0565  -0.0242 0.0342  668 ASP A N     
2948 C CA    . ASP A 411 ? 0.2741 0.3071 0.2346 0.0567  -0.0301 0.0346  668 ASP A CA    
2949 C C     . ASP A 411 ? 0.2594 0.3156 0.2281 0.0429  -0.0380 0.0181  668 ASP A C     
2950 O O     . ASP A 411 ? 0.2354 0.2737 0.2072 0.0311  -0.0358 0.0085  668 ASP A O     
2951 C CB    . ASP A 411 ? 0.2891 0.2958 0.2376 0.0527  -0.0252 0.0362  668 ASP A CB    
2952 C CG    . ASP A 411 ? 0.3199 0.3453 0.2579 0.0543  -0.0293 0.0376  668 ASP A CG    
2953 O OD1   . ASP A 411 ? 0.3033 0.3413 0.2423 0.0431  -0.0351 0.0244  668 ASP A OD1   
2954 O OD2   . ASP A 411 ? 0.3543 0.3832 0.2819 0.0680  -0.0255 0.0526  668 ASP A OD2   
2955 N N     . ASP A 412 ? 0.2795 0.3754 0.2523 0.0450  -0.0454 0.0148  669 ASP A N     
2956 C CA    . ASP A 412 ? 0.2866 0.4053 0.2711 0.0294  -0.0498 -0.0045 669 ASP A CA    
2957 C C     . ASP A 412 ? 0.2675 0.3690 0.2444 0.0167  -0.0478 -0.0155 669 ASP A C     
2958 O O     . ASP A 412 ? 0.2522 0.3422 0.2384 0.0034  -0.0434 -0.0282 669 ASP A O     
2959 C CB    . ASP A 412 ? 0.3128 0.4857 0.3027 0.0325  -0.0593 -0.0093 669 ASP A CB    
2960 C CG    . ASP A 412 ? 0.3608 0.5585 0.3652 0.0441  -0.0609 -0.0010 669 ASP A CG    
2961 O OD1   . ASP A 412 ? 0.3972 0.5714 0.4113 0.0442  -0.0538 0.0021  669 ASP A OD1   
2962 O OD2   . ASP A 412 ? 0.4200 0.6646 0.4254 0.0545  -0.0692 0.0026  669 ASP A OD2   
2963 N N     . ASN A 413 ? 0.2720 0.3688 0.2323 0.0221  -0.0485 -0.0090 670 ASN A N     
2964 C CA    . ASN A 413 ? 0.2848 0.3671 0.2378 0.0122  -0.0455 -0.0184 670 ASN A CA    
2965 C C     . ASN A 413 ? 0.2690 0.3127 0.2251 0.0077  -0.0380 -0.0174 670 ASN A C     
2966 O O     . ASN A 413 ? 0.2282 0.2608 0.1892 -0.0024 -0.0336 -0.0286 670 ASN A O     
2967 C CB    . ASN A 413 ? 0.3245 0.4129 0.2585 0.0209  -0.0465 -0.0094 670 ASN A CB    
2968 C CG    . ASN A 413 ? 0.3711 0.4553 0.2975 0.0110  -0.0438 -0.0216 670 ASN A CG    
2969 O OD1   . ASN A 413 ? 0.3786 0.4661 0.3132 -0.0022 -0.0425 -0.0396 670 ASN A OD1   
2970 N ND2   . ASN A 413 ? 0.3774 0.4538 0.2881 0.0175  -0.0405 -0.0119 670 ASN A ND2   
2971 N N     . LEU A 414 ? 0.2488 0.2726 0.2023 0.0157  -0.0353 -0.0045 671 LEU A N     
2972 C CA    . LEU A 414 ? 0.2579 0.2545 0.2138 0.0123  -0.0302 -0.0044 671 LEU A CA    
2973 C C     . LEU A 414 ? 0.2360 0.2287 0.2031 0.0074  -0.0284 -0.0101 671 LEU A C     
2974 O O     . LEU A 414 ? 0.2545 0.2327 0.2237 0.0033  -0.0242 -0.0134 671 LEU A O     
2975 C CB    . LEU A 414 ? 0.2672 0.2467 0.2186 0.0193  -0.0268 0.0066  671 LEU A CB    
2976 C CG    . LEU A 414 ? 0.2876 0.2477 0.2385 0.0151  -0.0229 0.0053  671 LEU A CG    
2977 C CD1   . LEU A 414 ? 0.2878 0.2475 0.2358 0.0108  -0.0218 0.0016  671 LEU A CD1   
2978 C CD2   . LEU A 414 ? 0.2982 0.2436 0.2463 0.0187  -0.0175 0.0118  671 LEU A CD2   
2979 N N     . MET A 415 ? 0.2439 0.2500 0.2186 0.0095  -0.0299 -0.0096 672 MET A N     
2980 C CA    . MET A 415 ? 0.2418 0.2433 0.2275 0.0044  -0.0254 -0.0143 672 MET A CA    
2981 C C     . MET A 415 ? 0.2448 0.2485 0.2373 -0.0067 -0.0214 -0.0267 672 MET A C     
2982 O O     . MET A 415 ? 0.2477 0.2321 0.2433 -0.0097 -0.0134 -0.0275 672 MET A O     
2983 C CB    . MET A 415 ? 0.2468 0.2657 0.2419 0.0081  -0.0266 -0.0124 672 MET A CB    
2984 C CG    . MET A 415 ? 0.2635 0.2702 0.2531 0.0188  -0.0252 -0.0010 672 MET A CG    
2985 S SD    . MET A 415 ? 0.3136 0.3386 0.3167 0.0251  -0.0235 0.0020  672 MET A SD    
2986 C CE    . MET A 415 ? 0.2663 0.3321 0.2751 0.0321  -0.0317 0.0039  672 MET A CE    
2987 N N     . GLU A 416 ? 0.2529 0.2794 0.2464 -0.0120 -0.0255 -0.0363 673 GLU A N     
2988 C CA    . GLU A 416 ? 0.2599 0.2883 0.2609 -0.0257 -0.0191 -0.0531 673 GLU A CA    
2989 C C     . GLU A 416 ? 0.2772 0.2758 0.2714 -0.0257 -0.0115 -0.0518 673 GLU A C     
2990 O O     . GLU A 416 ? 0.2788 0.2586 0.2804 -0.0316 0.0003  -0.0572 673 GLU A O     
2991 C CB    . GLU A 416 ? 0.2688 0.3321 0.2689 -0.0318 -0.0259 -0.0662 673 GLU A CB    
2992 C CG    . GLU A 416 ? 0.2792 0.3442 0.2863 -0.0486 -0.0177 -0.0883 673 GLU A CG    
2993 C CD    . GLU A 416 ? 0.2957 0.3614 0.3243 -0.0621 -0.0077 -0.1012 673 GLU A CD    
2994 O OE1   . GLU A 416 ? 0.3256 0.3959 0.3636 -0.0581 -0.0087 -0.0931 673 GLU A OE1   
2995 O OE2   . GLU A 416 ? 0.3172 0.3764 0.3544 -0.0774 0.0039  -0.1200 673 GLU A OE2   
2996 N N     . ALA A 417 ? 0.2628 0.2571 0.2442 -0.0181 -0.0163 -0.0435 674 ALA A N     
2997 C CA    . ALA A 417 ? 0.2661 0.2390 0.2432 -0.0162 -0.0102 -0.0411 674 ALA A CA    
2998 C C     . ALA A 417 ? 0.2539 0.2050 0.2357 -0.0118 -0.0030 -0.0333 674 ALA A C     
2999 O O     . ALA A 417 ? 0.2569 0.1916 0.2421 -0.0120 0.0075  -0.0349 674 ALA A O     
3000 C CB    . ALA A 417 ? 0.2589 0.2336 0.2245 -0.0092 -0.0160 -0.0324 674 ALA A CB    
3001 N N     . PHE A 418 ? 0.2361 0.1870 0.2166 -0.0059 -0.0072 -0.0239 675 PHE A N     
3002 C CA    . PHE A 418 ? 0.2451 0.1817 0.2264 -0.0004 -0.0016 -0.0162 675 PHE A CA    
3003 C C     . PHE A 418 ? 0.2602 0.1882 0.2508 -0.0049 0.0095  -0.0194 675 PHE A C     
3004 O O     . PHE A 418 ? 0.2716 0.1831 0.2626 -0.0001 0.0198  -0.0134 675 PHE A O     
3005 C CB    . PHE A 418 ? 0.2248 0.1644 0.1999 0.0057  -0.0083 -0.0083 675 PHE A CB    
3006 C CG    . PHE A 418 ? 0.2237 0.1650 0.1923 0.0088  -0.0136 -0.0056 675 PHE A CG    
3007 C CD1   . PHE A 418 ? 0.2294 0.1679 0.1975 0.0123  -0.0113 -0.0034 675 PHE A CD1   
3008 C CD2   . PHE A 418 ? 0.2413 0.1874 0.2059 0.0086  -0.0188 -0.0048 675 PHE A CD2   
3009 C CE1   . PHE A 418 ? 0.2330 0.1774 0.1989 0.0129  -0.0152 -0.0031 675 PHE A CE1   
3010 C CE2   . PHE A 418 ? 0.2277 0.1734 0.1889 0.0089  -0.0203 -0.0038 675 PHE A CE2   
3011 C CZ    . PHE A 418 ? 0.2369 0.1840 0.1998 0.0098  -0.0192 -0.0042 675 PHE A CZ    
3012 N N     . ARG A 419 ? 0.2603 0.2011 0.2598 -0.0138 0.0092  -0.0287 676 ARG A N     
3013 C CA    . ARG A 419 ? 0.2714 0.2043 0.2833 -0.0214 0.0225  -0.0346 676 ARG A CA    
3014 C C     . ARG A 419 ? 0.2815 0.1969 0.2983 -0.0278 0.0364  -0.0429 676 ARG A C     
3015 O O     . ARG A 419 ? 0.2914 0.1860 0.3162 -0.0305 0.0539  -0.0426 676 ARG A O     
3016 C CB    . ARG A 419 ? 0.2814 0.2395 0.3051 -0.0306 0.0183  -0.0449 676 ARG A CB    
3017 C CG    . ARG A 419 ? 0.2840 0.2526 0.3051 -0.0221 0.0103  -0.0348 676 ARG A CG    
3018 C CD    . ARG A 419 ? 0.3132 0.3132 0.3478 -0.0279 0.0052  -0.0431 676 ARG A CD    
3019 N NE    . ARG A 419 ? 0.3356 0.3403 0.3691 -0.0181 0.0018  -0.0324 676 ARG A NE    
3020 C CZ    . ARG A 419 ? 0.3683 0.4014 0.4089 -0.0145 -0.0057 -0.0324 676 ARG A CZ    
3021 N NH1   . ARG A 419 ? 0.3752 0.4410 0.4231 -0.0190 -0.0134 -0.0417 676 ARG A NH1   
3022 N NH2   . ARG A 419 ? 0.3792 0.4103 0.4191 -0.0051 -0.0049 -0.0228 676 ARG A NH2   
3023 N N     . ARG A 420 ? 0.2768 0.1975 0.2886 -0.0298 0.0317  -0.0498 677 ARG A N     
3024 C CA    . ARG A 420 ? 0.3039 0.2061 0.3189 -0.0344 0.0460  -0.0582 677 ARG A CA    
3025 C C     . ARG A 420 ? 0.3105 0.1928 0.3179 -0.0195 0.0510  -0.0431 677 ARG A C     
3026 O O     . ARG A 420 ? 0.3277 0.1916 0.3378 -0.0194 0.0650  -0.0470 677 ARG A O     
3027 C CB    . ARG A 420 ? 0.3222 0.2428 0.3343 -0.0436 0.0395  -0.0743 677 ARG A CB    
3028 C CG    . ARG A 420 ? 0.3233 0.2710 0.3441 -0.0594 0.0359  -0.0937 677 ARG A CG    
3029 C CD    . ARG A 420 ? 0.3374 0.3053 0.3493 -0.0649 0.0290  -0.1075 677 ARG A CD    
3030 N NE    . ARG A 420 ? 0.3508 0.3598 0.3661 -0.0751 0.0181  -0.1223 677 ARG A NE    
3031 C CZ    . ARG A 420 ? 0.3666 0.4024 0.3737 -0.0817 0.0119  -0.1376 677 ARG A CZ    
3032 N NH1   . ARG A 420 ? 0.3723 0.3935 0.3681 -0.0809 0.0176  -0.1415 677 ARG A NH1   
3033 N NH2   . ARG A 420 ? 0.3620 0.4426 0.3728 -0.0890 0.0008  -0.1499 677 ARG A NH2   
3034 N N     . ASP A 421 ? 0.3077 0.1952 0.3069 -0.0070 0.0409  -0.0273 678 ASP A N     
3035 C CA    . ASP A 421 ? 0.3343 0.2160 0.3272 0.0075  0.0411  -0.0139 678 ASP A CA    
3036 C C     . ASP A 421 ? 0.3360 0.2199 0.3277 0.0078  0.0407  -0.0191 678 ASP A C     
3037 O O     . ASP A 421 ? 0.3450 0.2167 0.3386 0.0174  0.0512  -0.0127 678 ASP A O     
3038 C CB    . ASP A 421 ? 0.3741 0.2340 0.3692 0.0182  0.0580  -0.0016 678 ASP A CB    
3039 C CG    . ASP A 421 ? 0.3945 0.2616 0.3821 0.0367  0.0535  0.0153  678 ASP A CG    
3040 O OD1   . ASP A 421 ? 0.4059 0.2953 0.3873 0.0384  0.0364  0.0168  678 ASP A OD1   
3041 O OD2   . ASP A 421 ? 0.4273 0.2794 0.4163 0.0496  0.0681  0.0264  678 ASP A OD2   
3042 N N     . LEU A 422 ? 0.3161 0.2166 0.3042 -0.0008 0.0298  -0.0291 679 LEU A N     
3043 C CA    . LEU A 422 ? 0.3273 0.2316 0.3124 -0.0020 0.0299  -0.0352 679 LEU A CA    
3044 C C     . LEU A 422 ? 0.3168 0.2283 0.2990 0.0091  0.0237  -0.0232 679 LEU A C     
3045 O O     . LEU A 422 ? 0.3061 0.2258 0.2862 0.0138  0.0149  -0.0143 679 LEU A O     
3046 C CB    . LEU A 422 ? 0.3206 0.2444 0.2992 -0.0117 0.0196  -0.0458 679 LEU A CB    
3047 C CG    . LEU A 422 ? 0.3387 0.2675 0.3211 -0.0250 0.0238  -0.0629 679 LEU A CG    
3048 C CD1   . LEU A 422 ? 0.3349 0.2907 0.3080 -0.0310 0.0129  -0.0720 679 LEU A CD1   
3049 C CD2   . LEU A 422 ? 0.3654 0.2731 0.3543 -0.0301 0.0424  -0.0744 679 LEU A CD2   
3050 N N     . ASP A 423 ? 0.3235 0.2345 0.3066 0.0118  0.0289  -0.0252 680 ASP A N     
3051 C CA    . ASP A 423 ? 0.3221 0.2475 0.3050 0.0180  0.0222  -0.0183 680 ASP A CA    
3052 C C     . ASP A 423 ? 0.2920 0.2302 0.2669 0.0101  0.0111  -0.0215 680 ASP A C     
3053 O O     . ASP A 423 ? 0.2737 0.2141 0.2422 0.0035  0.0119  -0.0297 680 ASP A O     
3054 C CB    . ASP A 423 ? 0.3587 0.2810 0.3455 0.0217  0.0324  -0.0211 680 ASP A CB    
3055 C CG    . ASP A 423 ? 0.4011 0.3420 0.3912 0.0261  0.0270  -0.0159 680 ASP A CG    
3056 O OD1   . ASP A 423 ? 0.3989 0.3520 0.3849 0.0202  0.0171  -0.0159 680 ASP A OD1   
3057 O OD2   . ASP A 423 ? 0.4648 0.4082 0.4635 0.0355  0.0347  -0.0119 680 ASP A OD2   
3058 N N     . ILE A 424 ? 0.2528 0.1990 0.2269 0.0114  0.0022  -0.0150 681 ILE A N     
3059 C CA    . ILE A 424 ? 0.2636 0.2150 0.2304 0.0060  -0.0047 -0.0157 681 ILE A CA    
3060 C C     . ILE A 424 ? 0.2572 0.2144 0.2207 0.0040  -0.0031 -0.0162 681 ILE A C     
3061 O O     . ILE A 424 ? 0.2891 0.2485 0.2436 0.0013  -0.0048 -0.0161 681 ILE A O     
3062 C CB    . ILE A 424 ? 0.2619 0.2153 0.2293 0.0073  -0.0109 -0.0104 681 ILE A CB    
3063 C CG1   . ILE A 424 ? 0.2738 0.2272 0.2343 0.0042  -0.0145 -0.0092 681 ILE A CG1   
3064 C CG2   . ILE A 424 ? 0.2601 0.2227 0.2334 0.0092  -0.0119 -0.0082 681 ILE A CG2   
3065 C CD1   . ILE A 424 ? 0.2992 0.2551 0.2551 0.0027  -0.0156 -0.0120 681 ILE A CD1   
3066 N N     . HIS A 425 ? 0.2515 0.2132 0.2226 0.0066  0.0008  -0.0152 682 HIS A N     
3067 C CA    . HIS A 425 ? 0.2600 0.2271 0.2301 0.0042  0.0053  -0.0159 682 HIS A CA    
3068 C C     . HIS A 425 ? 0.2643 0.2286 0.2255 0.0028  0.0113  -0.0217 682 HIS A C     
3069 O O     . HIS A 425 ? 0.2497 0.2168 0.2004 0.0002  0.0129  -0.0210 682 HIS A O     
3070 C CB    . HIS A 425 ? 0.2681 0.2469 0.2525 0.0073  0.0079  -0.0145 682 HIS A CB    
3071 C CG    . HIS A 425 ? 0.2564 0.2453 0.2485 0.0066  0.0012  -0.0124 682 HIS A CG    
3072 N ND1   . HIS A 425 ? 0.2524 0.2365 0.2395 0.0004  -0.0023 -0.0125 682 HIS A ND1   
3073 C CD2   . HIS A 425 ? 0.2461 0.2525 0.2501 0.0122  -0.0019 -0.0111 682 HIS A CD2   
3074 C CE1   . HIS A 425 ? 0.2502 0.2464 0.2453 -0.0006 -0.0069 -0.0141 682 HIS A CE1   
3075 N NE2   . HIS A 425 ? 0.2465 0.2597 0.2513 0.0068  -0.0080 -0.0132 682 HIS A NE2   
3076 N N     . THR A 426 ? 0.2575 0.2154 0.2214 0.0046  0.0163  -0.0276 683 THR A N     
3077 C CA    . THR A 426 ? 0.2797 0.2350 0.2343 0.0006  0.0228  -0.0381 683 THR A CA    
3078 C C     . THR A 426 ? 0.2800 0.2419 0.2213 -0.0052 0.0160  -0.0428 683 THR A C     
3079 O O     . THR A 426 ? 0.2849 0.2561 0.2127 -0.0078 0.0168  -0.0475 683 THR A O     
3080 C CB    . THR A 426 ? 0.2810 0.2228 0.2442 0.0028  0.0333  -0.0446 683 THR A CB    
3081 O OG1   . THR A 426 ? 0.2894 0.2323 0.2646 0.0120  0.0390  -0.0372 683 THR A OG1   
3082 C CG2   . THR A 426 ? 0.3079 0.2460 0.2628 -0.0041 0.0418  -0.0601 683 THR A CG2   
3083 N N     . LYS A 427 ? 0.2837 0.2441 0.2287 -0.0060 0.0094  -0.0410 684 LYS A N     
3084 C CA    . LYS A 427 ? 0.2869 0.2595 0.2234 -0.0099 0.0021  -0.0448 684 LYS A CA    
3085 C C     . LYS A 427 ? 0.2824 0.2655 0.2070 -0.0056 -0.0033 -0.0342 684 LYS A C     
3086 O O     . LYS A 427 ? 0.2940 0.2930 0.2058 -0.0058 -0.0061 -0.0367 684 LYS A O     
3087 C CB    . LYS A 427 ? 0.2981 0.2670 0.2436 -0.0103 -0.0021 -0.0428 684 LYS A CB    
3088 C CG    . LYS A 427 ? 0.3110 0.2970 0.2512 -0.0111 -0.0111 -0.0421 684 LYS A CG    
3089 C CD    . LYS A 427 ? 0.3517 0.3567 0.2871 -0.0186 -0.0117 -0.0573 684 LYS A CD    
3090 C CE    . LYS A 427 ? 0.3877 0.4163 0.3228 -0.0175 -0.0216 -0.0556 684 LYS A CE    
3091 N NZ    . LYS A 427 ? 0.4087 0.4692 0.3340 -0.0216 -0.0262 -0.0674 684 LYS A NZ    
3092 N N     . THR A 428 ? 0.2658 0.2409 0.1946 -0.0017 -0.0031 -0.0228 685 THR A N     
3093 C CA    . THR A 428 ? 0.2832 0.2605 0.2022 0.0022  -0.0028 -0.0120 685 THR A CA    
3094 C C     . THR A 428 ? 0.2891 0.2721 0.1959 0.0028  0.0040  -0.0121 685 THR A C     
3095 O O     . THR A 428 ? 0.3098 0.3022 0.2007 0.0075  0.0037  -0.0054 685 THR A O     
3096 C CB    . THR A 428 ? 0.2752 0.2406 0.2042 0.0025  -0.0009 -0.0044 685 THR A CB    
3097 O OG1   . THR A 428 ? 0.2880 0.2503 0.2240 0.0030  -0.0069 -0.0044 685 THR A OG1   
3098 C CG2   . THR A 428 ? 0.2869 0.2471 0.2078 0.0056  0.0046  0.0068  685 THR A CG2   
3099 N N     . ALA A 429 ? 0.2908 0.2701 0.2038 -0.0002 0.0107  -0.0189 686 ALA A N     
3100 C CA    . ALA A 429 ? 0.3039 0.2889 0.2051 -0.0002 0.0186  -0.0216 686 ALA A CA    
3101 C C     . ALA A 429 ? 0.3212 0.3219 0.2045 -0.0011 0.0155  -0.0309 686 ALA A C     
3102 O O     . ALA A 429 ? 0.3239 0.3367 0.1876 0.0024  0.0179  -0.0269 686 ALA A O     
3103 C CB    . ALA A 429 ? 0.2867 0.2661 0.2009 -0.0020 0.0272  -0.0285 686 ALA A CB    
3104 N N     . MET A 430 ? 0.3211 0.3240 0.2107 -0.0063 0.0114  -0.0442 687 MET A N     
3105 C CA    . MET A 430 ? 0.3391 0.3620 0.2152 -0.0110 0.0085  -0.0587 687 MET A CA    
3106 C C     . MET A 430 ? 0.3592 0.4060 0.2195 -0.0045 -0.0014 -0.0488 687 MET A C     
3107 O O     . MET A 430 ? 0.3656 0.4365 0.2058 -0.0030 -0.0028 -0.0532 687 MET A O     
3108 C CB    . MET A 430 ? 0.3565 0.3758 0.2465 -0.0197 0.0077  -0.0745 687 MET A CB    
3109 C CG    . MET A 430 ? 0.3837 0.3815 0.2851 -0.0243 0.0211  -0.0858 687 MET A CG    
3110 S SD    . MET A 430 ? 0.4203 0.4030 0.3413 -0.0317 0.0246  -0.0966 687 MET A SD    
3111 C CE    . MET A 430 ? 0.4155 0.4272 0.3278 -0.0457 0.0199  -0.1204 687 MET A CE    
3112 N N     . ASP A 431 ? 0.3441 0.3856 0.2127 0.0009  -0.0073 -0.0353 688 ASP A N     
3113 C CA    . ASP A 431 ? 0.3807 0.4427 0.2376 0.0105  -0.0150 -0.0229 688 ASP A CA    
3114 C C     . ASP A 431 ? 0.3903 0.4503 0.2293 0.0218  -0.0084 -0.0040 688 ASP A C     
3115 O O     . ASP A 431 ? 0.4178 0.5035 0.2366 0.0302  -0.0112 0.0014  688 ASP A O     
3116 C CB    . ASP A 431 ? 0.3866 0.4398 0.2583 0.0134  -0.0201 -0.0146 688 ASP A CB    
3117 C CG    . ASP A 431 ? 0.4212 0.4831 0.3077 0.0041  -0.0262 -0.0309 688 ASP A CG    
3118 O OD1   . ASP A 431 ? 0.4611 0.5445 0.3445 -0.0035 -0.0287 -0.0479 688 ASP A OD1   
3119 O OD2   . ASP A 431 ? 0.4951 0.5422 0.3963 0.0037  -0.0271 -0.0272 688 ASP A OD2   
3120 N N     . ILE A 432 ? 0.3815 0.4137 0.2281 0.0218  0.0014  0.0053  689 ILE A N     
3121 C CA    . ILE A 432 ? 0.4195 0.4439 0.2526 0.0306  0.0120  0.0233  689 ILE A CA    
3122 C C     . ILE A 432 ? 0.4492 0.4881 0.2617 0.0317  0.0177  0.0199  689 ILE A C     
3123 O O     . ILE A 432 ? 0.4710 0.5215 0.2610 0.0434  0.0217  0.0346  689 ILE A O     
3124 C CB    . ILE A 432 ? 0.4282 0.4227 0.2788 0.0253  0.0224  0.0280  689 ILE A CB    
3125 C CG1   . ILE A 432 ? 0.4207 0.4005 0.2844 0.0269  0.0203  0.0354  689 ILE A CG1   
3126 C CG2   . ILE A 432 ? 0.4524 0.4372 0.2918 0.0294  0.0381  0.0413  689 ILE A CG2   
3127 C CD1   . ILE A 432 ? 0.4571 0.4144 0.3388 0.0186  0.0299  0.0347  689 ILE A CD1   
3128 N N     . PHE A 433 ? 0.4392 0.4771 0.2578 0.0213  0.0198  0.0018  690 PHE A N     
3129 C CA    . PHE A 433 ? 0.4747 0.5255 0.2731 0.0214  0.0271  -0.0042 690 PHE A CA    
3130 C C     . PHE A 433 ? 0.4973 0.5806 0.2791 0.0192  0.0178  -0.0211 690 PHE A C     
3131 O O     . PHE A 433 ? 0.5237 0.6226 0.2849 0.0195  0.0227  -0.0279 690 PHE A O     
3132 C CB    . PHE A 433 ? 0.4687 0.5018 0.2818 0.0129  0.0379  -0.0147 690 PHE A CB    
3133 C CG    . PHE A 433 ? 0.4631 0.4732 0.2948 0.0127  0.0464  -0.0020 690 PHE A CG    
3134 C CD1   . PHE A 433 ? 0.5023 0.5055 0.3245 0.0184  0.0579  0.0157  690 PHE A CD1   
3135 C CD2   . PHE A 433 ? 0.4335 0.4306 0.2924 0.0066  0.0441  -0.0080 690 PHE A CD2   
3136 C CE1   . PHE A 433 ? 0.4967 0.4806 0.3393 0.0146  0.0669  0.0232  690 PHE A CE1   
3137 C CE2   . PHE A 433 ? 0.4403 0.4241 0.3173 0.0046  0.0506  0.0000  690 PHE A CE2   
3138 C CZ    . PHE A 433 ? 0.4657 0.4430 0.3361 0.0068  0.0620  0.0138  690 PHE A CZ    
3139 N N     . GLN A 434 ? 0.4990 0.5955 0.2902 0.0161  0.0049  -0.0293 691 GLN A N     
3140 C CA    . GLN A 434 ? 0.5300 0.6625 0.3104 0.0104  -0.0045 -0.0496 691 GLN A CA    
3141 C C     . GLN A 434 ? 0.5246 0.6547 0.3051 -0.0035 0.0032  -0.0762 691 GLN A C     
3142 O O     . GLN A 434 ? 0.5401 0.6994 0.2988 -0.0059 0.0026  -0.0903 691 GLN A O     
3143 C CB    . GLN A 434 ? 0.6045 0.7766 0.3543 0.0238  -0.0102 -0.0389 691 GLN A CB    
3144 C CG    . GLN A 434 ? 0.6434 0.8177 0.3894 0.0420  -0.0139 -0.0091 691 GLN A CG    
3145 C CD    . GLN A 434 ? 0.7243 0.9235 0.4361 0.0609  -0.0108 0.0115  691 GLN A CD    
3146 O OE1   . GLN A 434 ? 0.7684 0.9602 0.4746 0.0786  -0.0072 0.0401  691 GLN A OE1   
3147 N NE2   . GLN A 434 ? 0.7655 0.9922 0.4532 0.0582  -0.0100 -0.0024 691 GLN A NE2   
3148 N N     . VAL A 435 ? 0.4915 0.5886 0.2955 -0.0117 0.0111  -0.0837 692 VAL A N     
3149 C CA    . VAL A 435 ? 0.4942 0.5819 0.3022 -0.0236 0.0220  -0.1085 692 VAL A CA    
3150 C C     . VAL A 435 ? 0.4775 0.5497 0.3106 -0.0346 0.0224  -0.1236 692 VAL A C     
3151 O O     . VAL A 435 ? 0.4337 0.4975 0.2826 -0.0318 0.0153  -0.1120 692 VAL A O     
3152 C CB    . VAL A 435 ? 0.4836 0.5440 0.2965 -0.0198 0.0369  -0.1009 692 VAL A CB    
3153 C CG1   . VAL A 435 ? 0.5107 0.5837 0.2989 -0.0101 0.0403  -0.0858 692 VAL A CG1   
3154 C CG2   . VAL A 435 ? 0.4555 0.4888 0.2945 -0.0159 0.0373  -0.0852 692 VAL A CG2   
3155 N N     . SER A 436 ? 0.4867 0.5524 0.3228 -0.0467 0.0336  -0.1494 693 SER A N     
3156 C CA    . SER A 436 ? 0.4975 0.5407 0.3575 -0.0568 0.0405  -0.1632 693 SER A CA    
3157 C C     . SER A 436 ? 0.4968 0.5019 0.3752 -0.0481 0.0511  -0.1474 693 SER A C     
3158 O O     . SER A 436 ? 0.4868 0.4864 0.3605 -0.0385 0.0547  -0.1335 693 SER A O     
3159 C CB    . SER A 436 ? 0.5301 0.5751 0.3875 -0.0732 0.0532  -0.1972 693 SER A CB    
3160 O OG    . SER A 436 ? 0.5533 0.5893 0.3982 -0.0707 0.0665  -0.2023 693 SER A OG    
3161 N N     . GLU A 437 ? 0.4890 0.4711 0.3885 -0.0511 0.0568  -0.1495 694 GLU A N     
3162 C CA    . GLU A 437 ? 0.4921 0.4450 0.4089 -0.0406 0.0651  -0.1334 694 GLU A CA    
3163 C C     . GLU A 437 ? 0.5047 0.4418 0.4222 -0.0358 0.0823  -0.1366 694 GLU A C     
3164 O O     . GLU A 437 ? 0.4564 0.3892 0.3800 -0.0238 0.0831  -0.1190 694 GLU A O     
3165 C CB    . GLU A 437 ? 0.5257 0.4563 0.4615 -0.0439 0.0721  -0.1361 694 GLU A CB    
3166 C CG    . GLU A 437 ? 0.5531 0.4593 0.5046 -0.0294 0.0798  -0.1168 694 GLU A CG    
3167 C CD    . GLU A 437 ? 0.6069 0.4920 0.5739 -0.0292 0.0865  -0.1138 694 GLU A CD    
3168 O OE1   . GLU A 437 ? 0.7230 0.6068 0.6920 -0.0429 0.0895  -0.1299 694 GLU A OE1   
3169 O OE2   . GLU A 437 ? 0.6359 0.5079 0.6130 -0.0154 0.0897  -0.0954 694 GLU A OE2   
3170 N N     . ASP A 438 ? 0.5288 0.4595 0.4413 -0.0455 0.0968  -0.1605 695 ASP A N     
3171 C CA    . ASP A 438 ? 0.5788 0.4934 0.4923 -0.0397 0.1154  -0.1639 695 ASP A CA    
3172 C C     . ASP A 438 ? 0.5487 0.4849 0.4440 -0.0348 0.1111  -0.1579 695 ASP A C     
3173 O O     . ASP A 438 ? 0.5685 0.4947 0.4659 -0.0286 0.1259  -0.1582 695 ASP A O     
3174 C CB    . ASP A 438 ? 0.6649 0.5600 0.5796 -0.0521 0.1370  -0.1932 695 ASP A CB    
3175 C CG    . ASP A 438 ? 0.7302 0.6520 0.6216 -0.0681 0.1337  -0.2200 695 ASP A CG    
3176 O OD1   . ASP A 438 ? 0.7822 0.7388 0.6553 -0.0673 0.1141  -0.2130 695 ASP A OD1   
3177 O OD2   . ASP A 438 ? 0.8403 0.7490 0.7310 -0.0812 0.1521  -0.2488 695 ASP A OD2   
3178 N N     . GLU A 439 ? 0.5113 0.4758 0.3889 -0.0364 0.0934  -0.1517 696 GLU A N     
3179 C CA    . GLU A 439 ? 0.5101 0.4910 0.3712 -0.0296 0.0912  -0.1399 696 GLU A CA    
3180 C C     . GLU A 439 ? 0.4521 0.4319 0.3246 -0.0187 0.0834  -0.1122 696 GLU A C     
3181 O O     . GLU A 439 ? 0.4402 0.4297 0.3027 -0.0138 0.0844  -0.1008 696 GLU A O     
3182 C CB    . GLU A 439 ? 0.5443 0.5570 0.3773 -0.0346 0.0793  -0.1462 696 GLU A CB    
3183 C CG    . GLU A 439 ? 0.6072 0.6310 0.4239 -0.0467 0.0874  -0.1768 696 GLU A CG    
3184 C CD    . GLU A 439 ? 0.6387 0.7036 0.4294 -0.0508 0.0718  -0.1834 696 GLU A CD    
3185 O OE1   . GLU A 439 ? 0.6482 0.7278 0.4435 -0.0504 0.0556  -0.1752 696 GLU A OE1   
3186 O OE2   . GLU A 439 ? 0.7073 0.7930 0.4726 -0.0534 0.0761  -0.1967 696 GLU A OE2   
3187 N N     . VAL A 440 ? 0.3949 0.3637 0.2875 -0.0159 0.0769  -0.1023 697 VAL A N     
3188 C CA    . VAL A 440 ? 0.3578 0.3278 0.2625 -0.0081 0.0701  -0.0804 697 VAL A CA    
3189 C C     . VAL A 440 ? 0.3507 0.3141 0.2719 -0.0010 0.0831  -0.0759 697 VAL A C     
3190 O O     . VAL A 440 ? 0.3444 0.2950 0.2817 0.0033  0.0913  -0.0788 697 VAL A O     
3191 C CB    . VAL A 440 ? 0.3410 0.3050 0.2603 -0.0069 0.0592  -0.0724 697 VAL A CB    
3192 C CG1   . VAL A 440 ? 0.3124 0.2793 0.2443 -0.0010 0.0537  -0.0546 697 VAL A CG1   
3193 C CG2   . VAL A 440 ? 0.3372 0.3117 0.2432 -0.0128 0.0468  -0.0759 697 VAL A CG2   
3194 N N     . THR A 441 ? 0.3284 0.3017 0.2464 0.0011  0.0864  -0.0674 698 THR A N     
3195 C CA    . THR A 441 ? 0.3198 0.2943 0.2568 0.0075  0.0978  -0.0629 698 THR A CA    
3196 C C     . THR A 441 ? 0.2939 0.2748 0.2542 0.0114  0.0896  -0.0495 698 THR A C     
3197 O O     . THR A 441 ? 0.2838 0.2662 0.2416 0.0079  0.0765  -0.0428 698 THR A O     
3198 C CB    . THR A 441 ? 0.3374 0.3218 0.2624 0.0063  0.1072  -0.0605 698 THR A CB    
3199 O OG1   . THR A 441 ? 0.3322 0.3228 0.2495 0.0033  0.0982  -0.0480 698 THR A OG1   
3200 C CG2   . THR A 441 ? 0.3597 0.3432 0.2577 0.0030  0.1163  -0.0754 698 THR A CG2   
3201 N N     . PRO A 442 ? 0.2870 0.2756 0.2705 0.0189  0.0970  -0.0458 699 PRO A N     
3202 C CA    . PRO A 442 ? 0.2681 0.2720 0.2731 0.0212  0.0879  -0.0356 699 PRO A CA    
3203 C C     . PRO A 442 ? 0.2615 0.2745 0.2642 0.0118  0.0823  -0.0301 699 PRO A C     
3204 O O     . PRO A 442 ? 0.2400 0.2562 0.2481 0.0088  0.0707  -0.0258 699 PRO A O     
3205 C CB    . PRO A 442 ? 0.2718 0.2909 0.3008 0.0312  0.0984  -0.0337 699 PRO A CB    
3206 C CG    . PRO A 442 ? 0.2947 0.2940 0.3172 0.0385  0.1114  -0.0412 699 PRO A CG    
3207 C CD    . PRO A 442 ? 0.3070 0.2930 0.3002 0.0270  0.1137  -0.0513 699 PRO A CD    
3208 N N     . ASN A 443 ? 0.2792 0.2930 0.2718 0.0071  0.0924  -0.0302 700 ASN A N     
3209 C CA    . ASN A 443 ? 0.2847 0.3006 0.2749 -0.0014 0.0922  -0.0234 700 ASN A CA    
3210 C C     . ASN A 443 ? 0.2902 0.2919 0.2590 -0.0040 0.0815  -0.0195 700 ASN A C     
3211 O O     . ASN A 443 ? 0.2764 0.2756 0.2490 -0.0092 0.0779  -0.0135 700 ASN A O     
3212 C CB    . ASN A 443 ? 0.3042 0.3217 0.2867 -0.0043 0.1087  -0.0214 700 ASN A CB    
3213 C CG    . ASN A 443 ? 0.3133 0.3344 0.3076 -0.0133 0.1149  -0.0146 700 ASN A CG    
3214 O OD1   . ASN A 443 ? 0.3037 0.3372 0.3237 -0.0182 0.1101  -0.0163 700 ASN A OD1   
3215 N ND2   . ASN A 443 ? 0.3280 0.3387 0.3029 -0.0157 0.1269  -0.0076 700 ASN A ND2   
3216 N N     . MET A 444 ? 0.3092 0.3028 0.2564 -0.0011 0.0780  -0.0239 701 MET A N     
3217 C CA    . MET A 444 ? 0.3233 0.3101 0.2525 -0.0019 0.0671  -0.0203 701 MET A CA    
3218 C C     . MET A 444 ? 0.3044 0.2889 0.2486 -0.0023 0.0552  -0.0193 701 MET A C     
3219 O O     . MET A 444 ? 0.3205 0.3007 0.2616 -0.0042 0.0497  -0.0125 701 MET A O     
3220 C CB    . MET A 444 ? 0.3521 0.3390 0.2591 -0.0006 0.0645  -0.0292 701 MET A CB    
3221 C CG    . MET A 444 ? 0.4037 0.3966 0.2882 0.0003  0.0749  -0.0296 701 MET A CG    
3222 S SD    . MET A 444 ? 0.4829 0.4827 0.3453 -0.0012 0.0752  -0.0486 701 MET A SD    
3223 C CE    . MET A 444 ? 0.4259 0.4302 0.2833 -0.0027 0.0576  -0.0491 701 MET A CE    
3224 N N     . ARG A 445 ? 0.2879 0.2742 0.2473 0.0008  0.0532  -0.0249 702 ARG A N     
3225 C CA    . ARG A 445 ? 0.2797 0.2659 0.2512 0.0020  0.0429  -0.0228 702 ARG A CA    
3226 C C     . ARG A 445 ? 0.2729 0.2690 0.2602 -0.0016 0.0408  -0.0181 702 ARG A C     
3227 O O     . ARG A 445 ? 0.2628 0.2562 0.2505 -0.0040 0.0325  -0.0158 702 ARG A O     
3228 C CB    . ARG A 445 ? 0.2916 0.2768 0.2744 0.0091  0.0443  -0.0264 702 ARG A CB    
3229 C CG    . ARG A 445 ? 0.2909 0.2749 0.2806 0.0120  0.0344  -0.0228 702 ARG A CG    
3230 C CD    . ARG A 445 ? 0.3178 0.2986 0.3179 0.0221  0.0394  -0.0224 702 ARG A CD    
3231 N NE    . ARG A 445 ? 0.3277 0.3060 0.3307 0.0264  0.0321  -0.0173 702 ARG A NE    
3232 C CZ    . ARG A 445 ? 0.3290 0.3244 0.3426 0.0312  0.0251  -0.0108 702 ARG A CZ    
3233 N NH1   . ARG A 445 ? 0.3340 0.3519 0.3591 0.0298  0.0237  -0.0105 702 ARG A NH1   
3234 N NH2   . ARG A 445 ? 0.3440 0.3366 0.3567 0.0363  0.0200  -0.0058 702 ARG A NH2   
3235 N N     . ARG A 446 ? 0.2762 0.2850 0.2774 -0.0034 0.0493  -0.0185 703 ARG A N     
3236 C CA    . ARG A 446 ? 0.2883 0.3106 0.3075 -0.0106 0.0493  -0.0185 703 ARG A CA    
3237 C C     . ARG A 446 ? 0.3058 0.3123 0.3136 -0.0190 0.0517  -0.0147 703 ARG A C     
3238 O O     . ARG A 446 ? 0.2936 0.3006 0.3089 -0.0249 0.0471  -0.0163 703 ARG A O     
3239 C CB    . ARG A 446 ? 0.3124 0.3539 0.3504 -0.0123 0.0603  -0.0209 703 ARG A CB    
3240 C CG    . ARG A 446 ? 0.3289 0.3887 0.3890 -0.0239 0.0622  -0.0249 703 ARG A CG    
3241 C CD    . ARG A 446 ? 0.3350 0.4190 0.4172 -0.0258 0.0737  -0.0283 703 ARG A CD    
3242 N NE    . ARG A 446 ? 0.3617 0.4267 0.4300 -0.0304 0.0895  -0.0244 703 ARG A NE    
3243 C CZ    . ARG A 446 ? 0.4000 0.4521 0.4663 -0.0426 0.1004  -0.0226 703 ARG A CZ    
3244 N NH1   . ARG A 446 ? 0.3947 0.4496 0.4746 -0.0546 0.0983  -0.0278 703 ARG A NH1   
3245 N NH2   . ARG A 446 ? 0.4041 0.4394 0.4538 -0.0427 0.1158  -0.0157 703 ARG A NH2   
3246 N N     . GLN A 447 ? 0.3133 0.3060 0.3019 -0.0183 0.0603  -0.0094 704 GLN A N     
3247 C CA    . GLN A 447 ? 0.3290 0.3045 0.3045 -0.0216 0.0653  -0.0015 704 GLN A CA    
3248 C C     . GLN A 447 ? 0.3183 0.2833 0.2825 -0.0178 0.0535  0.0014  704 GLN A C     
3249 O O     . GLN A 447 ? 0.3086 0.2622 0.2750 -0.0218 0.0558  0.0046  704 GLN A O     
3250 C CB    . GLN A 447 ? 0.3717 0.3396 0.3273 -0.0183 0.0779  0.0064  704 GLN A CB    
3251 C CG    . GLN A 447 ? 0.3919 0.3690 0.3626 -0.0240 0.0930  0.0039  704 GLN A CG    
3252 C CD    . GLN A 447 ? 0.4541 0.4208 0.4038 -0.0214 0.1092  0.0144  704 GLN A CD    
3253 O OE1   . GLN A 447 ? 0.5176 0.4750 0.4731 -0.0277 0.1254  0.0204  704 GLN A OE1   
3254 N NE2   . GLN A 447 ? 0.5120 0.4799 0.4358 -0.0122 0.1056  0.0165  704 GLN A NE2   
3255 N N     . ALA A 448 ? 0.3025 0.2704 0.2568 -0.0111 0.0432  -0.0010 705 ALA A N     
3256 C CA    . ALA A 448 ? 0.2987 0.2611 0.2475 -0.0083 0.0319  0.0000  705 ALA A CA    
3257 C C     . ALA A 448 ? 0.2979 0.2623 0.2637 -0.0123 0.0261  -0.0039 705 ALA A C     
3258 O O     . ALA A 448 ? 0.3134 0.2687 0.2760 -0.0126 0.0228  -0.0012 705 ALA A O     
3259 C CB    . ALA A 448 ? 0.2805 0.2477 0.2215 -0.0037 0.0242  -0.0053 705 ALA A CB    
3260 N N     . LYS A 449 ? 0.2906 0.2693 0.2731 -0.0137 0.0247  -0.0101 706 LYS A N     
3261 C CA    . LYS A 449 ? 0.2884 0.2775 0.2852 -0.0161 0.0180  -0.0147 706 LYS A CA    
3262 C C     . LYS A 449 ? 0.3056 0.2918 0.3099 -0.0269 0.0242  -0.0174 706 LYS A C     
3263 O O     . LYS A 449 ? 0.3111 0.2959 0.3178 -0.0304 0.0195  -0.0212 706 LYS A O     
3264 C CB    . LYS A 449 ? 0.2930 0.3048 0.3061 -0.0121 0.0164  -0.0183 706 LYS A CB    
3265 C CG    . LYS A 449 ? 0.2970 0.3297 0.3237 -0.0124 0.0082  -0.0225 706 LYS A CG    
3266 C CD    . LYS A 449 ? 0.3162 0.3733 0.3564 -0.0020 0.0064  -0.0215 706 LYS A CD    
3267 C CE    . LYS A 449 ? 0.3273 0.4142 0.3792 -0.0008 -0.0030 -0.0250 706 LYS A CE    
3268 N NZ    . LYS A 449 ? 0.3371 0.4520 0.4013 0.0141  -0.0051 -0.0200 706 LYS A NZ    
3269 N N     . ALA A 450 ? 0.2994 0.2829 0.3073 -0.0328 0.0370  -0.0165 707 ALA A N     
3270 C CA    . ALA A 450 ? 0.3121 0.2863 0.3281 -0.0450 0.0488  -0.0194 707 ALA A CA    
3271 C C     . ALA A 450 ? 0.3367 0.2825 0.3369 -0.0430 0.0527  -0.0119 707 ALA A C     
3272 O O     . ALA A 450 ? 0.3407 0.2778 0.3484 -0.0519 0.0573  -0.0183 707 ALA A O     
3273 C CB    . ALA A 450 ? 0.3324 0.3067 0.3553 -0.0512 0.0654  -0.0180 707 ALA A CB    
3274 N N     . VAL A 451 ? 0.3298 0.2639 0.3091 -0.0313 0.0513  0.0001  708 VAL A N     
3275 C CA    . VAL A 451 ? 0.3547 0.2681 0.3195 -0.0249 0.0532  0.0096  708 VAL A CA    
3276 C C     . VAL A 451 ? 0.3591 0.2751 0.3281 -0.0249 0.0410  0.0029  708 VAL A C     
3277 O O     . VAL A 451 ? 0.3777 0.2780 0.3486 -0.0282 0.0469  0.0020  708 VAL A O     
3278 C CB    . VAL A 451 ? 0.3640 0.2767 0.3064 -0.0114 0.0509  0.0224  708 VAL A CB    
3279 C CG1   . VAL A 451 ? 0.3870 0.2860 0.3168 -0.0017 0.0514  0.0336  708 VAL A CG1   
3280 C CG2   . VAL A 451 ? 0.3800 0.2893 0.3144 -0.0104 0.0651  0.0303  708 VAL A CG2   
3281 N N     . ASN A 452 ? 0.3201 0.2538 0.2910 -0.0216 0.0268  -0.0022 709 ASN A N     
3282 C CA    . ASN A 452 ? 0.3258 0.2631 0.2991 -0.0205 0.0165  -0.0071 709 ASN A CA    
3283 C C     . ASN A 452 ? 0.3417 0.2835 0.3285 -0.0313 0.0186  -0.0184 709 ASN A C     
3284 O O     . ASN A 452 ? 0.3452 0.2779 0.3299 -0.0326 0.0182  -0.0213 709 ASN A O     
3285 C CB    . ASN A 452 ? 0.2992 0.2519 0.2729 -0.0146 0.0051  -0.0090 709 ASN A CB    
3286 C CG    . ASN A 452 ? 0.3137 0.2623 0.2745 -0.0068 0.0019  -0.0030 709 ASN A CG    
3287 O OD1   . ASN A 452 ? 0.3325 0.2721 0.2838 -0.0034 0.0031  0.0032  709 ASN A OD1   
3288 N ND2   . ASN A 452 ? 0.2747 0.2317 0.2362 -0.0039 -0.0016 -0.0058 709 ASN A ND2   
3289 N N     . PHE A 453 ? 0.3449 0.3031 0.3460 -0.0397 0.0217  -0.0263 710 PHE A N     
3290 C CA    . PHE A 453 ? 0.3572 0.3284 0.3734 -0.0527 0.0235  -0.0409 710 PHE A CA    
3291 C C     . PHE A 453 ? 0.3813 0.3248 0.3972 -0.0626 0.0391  -0.0440 710 PHE A C     
3292 O O     . PHE A 453 ? 0.3734 0.3160 0.3937 -0.0713 0.0403  -0.0564 710 PHE A O     
3293 C CB    . PHE A 453 ? 0.3789 0.3777 0.4134 -0.0596 0.0251  -0.0483 710 PHE A CB    
3294 C CG    . PHE A 453 ? 0.4402 0.4615 0.4937 -0.0759 0.0270  -0.0670 710 PHE A CG    
3295 C CD1   . PHE A 453 ? 0.4887 0.4954 0.5532 -0.0933 0.0450  -0.0762 710 PHE A CD1   
3296 C CD2   . PHE A 453 ? 0.4425 0.5021 0.5037 -0.0743 0.0124  -0.0761 710 PHE A CD2   
3297 C CE1   . PHE A 453 ? 0.5128 0.5440 0.5977 -0.1124 0.0479  -0.0985 710 PHE A CE1   
3298 C CE2   . PHE A 453 ? 0.4860 0.5759 0.5651 -0.0907 0.0126  -0.0966 710 PHE A CE2   
3299 C CZ    . PHE A 453 ? 0.4972 0.5736 0.5893 -0.1115 0.0301  -0.1100 710 PHE A CZ    
3300 N N     . GLY A 454 ? 0.3917 0.3117 0.4017 -0.0606 0.0532  -0.0328 711 GLY A N     
3301 C CA    . GLY A 454 ? 0.4239 0.3107 0.4318 -0.0658 0.0722  -0.0306 711 GLY A CA    
3302 C C     . GLY A 454 ? 0.4310 0.2991 0.4268 -0.0572 0.0699  -0.0260 711 GLY A C     
3303 O O     . GLY A 454 ? 0.4361 0.2829 0.4356 -0.0648 0.0830  -0.0331 711 GLY A O     
3304 N N     . ILE A 455 ? 0.4130 0.2882 0.3956 -0.0418 0.0556  -0.0148 712 ILE A N     
3305 C CA    . ILE A 455 ? 0.4315 0.2956 0.4047 -0.0325 0.0517  -0.0102 712 ILE A CA    
3306 C C     . ILE A 455 ? 0.4202 0.2960 0.4003 -0.0409 0.0440  -0.0270 712 ILE A C     
3307 O O     . ILE A 455 ? 0.4589 0.3173 0.4384 -0.0435 0.0522  -0.0319 712 ILE A O     
3308 C CB    . ILE A 455 ? 0.4604 0.3348 0.4211 -0.0168 0.0391  0.0034  712 ILE A CB    
3309 C CG1   . ILE A 455 ? 0.4660 0.3280 0.4161 -0.0074 0.0497  0.0200  712 ILE A CG1   
3310 C CG2   . ILE A 455 ? 0.4815 0.3559 0.4373 -0.0086 0.0311  0.0051  712 ILE A CG2   
3311 C CD1   . ILE A 455 ? 0.4841 0.3648 0.4230 0.0039  0.0372  0.0282  712 ILE A CD1   
3312 N N     . VAL A 456 ? 0.4119 0.3176 0.3984 -0.0448 0.0303  -0.0361 713 VAL A N     
3313 C CA    . VAL A 456 ? 0.3875 0.3106 0.3770 -0.0502 0.0219  -0.0504 713 VAL A CA    
3314 C C     . VAL A 456 ? 0.4096 0.3291 0.4097 -0.0684 0.0340  -0.0697 713 VAL A C     
3315 O O     . VAL A 456 ? 0.4065 0.3252 0.4038 -0.0727 0.0340  -0.0808 713 VAL A O     
3316 C CB    . VAL A 456 ? 0.3734 0.3327 0.3671 -0.0470 0.0062  -0.0527 713 VAL A CB    
3317 C CG1   . VAL A 456 ? 0.3489 0.3341 0.3451 -0.0524 -0.0016 -0.0676 713 VAL A CG1   
3318 C CG2   . VAL A 456 ? 0.3533 0.3109 0.3369 -0.0313 -0.0026 -0.0376 713 VAL A CG2   
3319 N N     . TYR A 457 ? 0.4047 0.3213 0.4173 -0.0804 0.0462  -0.0750 714 TYR A N     
3320 C CA    . TYR A 457 ? 0.4500 0.3668 0.4770 -0.1019 0.0591  -0.0977 714 TYR A CA    
3321 C C     . TYR A 457 ? 0.4664 0.3362 0.4947 -0.1090 0.0863  -0.0965 714 TYR A C     
3322 O O     . TYR A 457 ? 0.4927 0.3554 0.5341 -0.1295 0.1018  -0.1179 714 TYR A O     
3323 C CB    . TYR A 457 ? 0.4578 0.4125 0.5035 -0.1140 0.0548  -0.1100 714 TYR A CB    
3324 C CG    . TYR A 457 ? 0.4756 0.4769 0.5205 -0.1067 0.0312  -0.1137 714 TYR A CG    
3325 C CD1   . TYR A 457 ? 0.4988 0.5215 0.5408 -0.1118 0.0228  -0.1300 714 TYR A CD1   
3326 C CD2   . TYR A 457 ? 0.4972 0.5199 0.5422 -0.0928 0.0189  -0.0996 714 TYR A CD2   
3327 C CE1   . TYR A 457 ? 0.4959 0.5610 0.5341 -0.1012 0.0026  -0.1291 714 TYR A CE1   
3328 C CE2   . TYR A 457 ? 0.4848 0.5456 0.5283 -0.0826 0.0007  -0.0991 714 TYR A CE2   
3329 C CZ    . TYR A 457 ? 0.5100 0.5924 0.5496 -0.0859 -0.0074 -0.1124 714 TYR A CZ    
3330 O OH    . TYR A 457 ? 0.5554 0.6755 0.5912 -0.0728 -0.0237 -0.1083 714 TYR A OH    
3331 N N     . GLY A 458 ? 0.4489 0.2880 0.4637 -0.0918 0.0929  -0.0724 715 GLY A N     
3332 C CA    . GLY A 458 ? 0.4929 0.2848 0.5058 -0.0915 0.1202  -0.0643 715 GLY A CA    
3333 C C     . GLY A 458 ? 0.5246 0.3038 0.5519 -0.1070 0.1419  -0.0689 715 GLY A C     
3334 O O     . GLY A 458 ? 0.5546 0.3017 0.5907 -0.1205 0.1678  -0.0788 715 GLY A O     
3335 N N     . ILE A 459 ? 0.5063 0.3095 0.5372 -0.1058 0.1337  -0.0625 716 ILE A N     
3336 C CA    A ILE A 459 ? 0.5326 0.3247 0.5775 -0.1197 0.1559  -0.0647 716 ILE A CA    
3337 C CA    B ILE A 459 ? 0.5421 0.3358 0.5865 -0.1187 0.1547  -0.0638 716 ILE A CA    
3338 C C     . ILE A 459 ? 0.5639 0.3125 0.5931 -0.1033 0.1774  -0.0364 716 ILE A C     
3339 O O     . ILE A 459 ? 0.5642 0.3074 0.5724 -0.0798 0.1676  -0.0145 716 ILE A O     
3340 C CB    A ILE A 459 ? 0.4996 0.3354 0.5563 -0.1247 0.1417  -0.0696 716 ILE A CB    
3341 C CB    B ILE A 459 ? 0.5187 0.3558 0.5700 -0.1187 0.1371  -0.0643 716 ILE A CB    
3342 C CG1   A ILE A 459 ? 0.4759 0.3128 0.5150 -0.1035 0.1345  -0.0438 716 ILE A CG1   
3343 C CG1   B ILE A 459 ? 0.5131 0.3914 0.5893 -0.1406 0.1291  -0.0936 716 ILE A CG1   
3344 C CG2   A ILE A 459 ? 0.4639 0.3479 0.5282 -0.1286 0.1145  -0.0874 716 ILE A CG2   
3345 C CG2   B ILE A 459 ? 0.5336 0.3568 0.5839 -0.1159 0.1540  -0.0485 716 ILE A CG2   
3346 C CD1   A ILE A 459 ? 0.4419 0.3190 0.4919 -0.1061 0.1218  -0.0485 716 ILE A CD1   
3347 C CD1   B ILE A 459 ? 0.4881 0.3952 0.5598 -0.1370 0.1048  -0.1046 716 ILE A CD1   
3348 N N     . SER A 460 ? 0.6225 0.3425 0.6622 -0.1156 0.2076  -0.0367 717 SER A N     
3349 C CA    . SER A 460 ? 0.6720 0.3501 0.6961 -0.0990 0.2325  -0.0074 717 SER A CA    
3350 C C     . SER A 460 ? 0.6847 0.3839 0.6966 -0.0856 0.2230  0.0116  717 SER A C     
3351 O O     . SER A 460 ? 0.6137 0.3546 0.6340 -0.0925 0.2019  -0.0005 717 SER A O     
3352 C CB    . SER A 460 ? 0.7309 0.3660 0.7713 -0.1179 0.2732  -0.0141 717 SER A CB    
3353 O OG    . SER A 460 ? 0.7199 0.3784 0.7858 -0.1446 0.2779  -0.0367 717 SER A OG    
3354 N N     . ASP A 461 ? 0.7515 0.4233 0.7426 -0.0649 0.2393  0.0416  718 ASP A N     
3355 C CA    . ASP A 461 ? 0.7505 0.4379 0.7285 -0.0545 0.2375  0.0585  718 ASP A CA    
3356 C C     . ASP A 461 ? 0.7286 0.4196 0.7289 -0.0780 0.2551  0.0446  718 ASP A C     
3357 O O     . ASP A 461 ? 0.7046 0.4262 0.7042 -0.0778 0.2437  0.0443  718 ASP A O     
3358 C CB    . ASP A 461 ? 0.8039 0.4655 0.7524 -0.0260 0.2528  0.0946  718 ASP A CB    
3359 C CG    . ASP A 461 ? 0.9053 0.5113 0.8560 -0.0262 0.2945  0.1078  718 ASP A CG    
3360 O OD1   . ASP A 461 ? 0.9774 0.5595 0.9519 -0.0486 0.3116  0.0869  718 ASP A OD1   
3361 O OD2   . ASP A 461 ? 0.9673 0.5528 0.8947 -0.0029 0.3121  0.1397  718 ASP A OD2   
3362 N N     . TYR A 462 ? 0.7457 0.4069 0.7676 -0.0992 0.2834  0.0312  719 TYR A N     
3363 C CA    . TYR A 462 ? 0.7547 0.4236 0.8046 -0.1260 0.3010  0.0128  719 TYR A CA    
3364 C C     . TYR A 462 ? 0.6902 0.4158 0.7612 -0.1414 0.2705  -0.0154 719 TYR A C     
3365 O O     . TYR A 462 ? 0.6458 0.4030 0.7292 -0.1487 0.2663  -0.0213 719 TYR A O     
3366 C CB    . TYR A 462 ? 0.8267 0.4569 0.9002 -0.1507 0.3353  -0.0044 719 TYR A CB    
3367 C CG    . TYR A 462 ? 0.9217 0.4892 0.9846 -0.1426 0.3787  0.0207  719 TYR A CG    
3368 C CD1   . TYR A 462 ? 0.9645 0.5150 1.0378 -0.1537 0.4106  0.0264  719 TYR A CD1   
3369 C CD2   . TYR A 462 ? 0.9820 0.5054 1.0260 -0.1233 0.3910  0.0392  719 TYR A CD2   
3370 C CE1   . TYR A 462 ? 1.0495 0.5374 1.1123 -0.1449 0.4550  0.0520  719 TYR A CE1   
3371 C CE2   . TYR A 462 ? 1.0413 0.5044 1.0752 -0.1123 0.4340  0.0654  719 TYR A CE2   
3372 C CZ    . TYR A 462 ? 1.0805 0.5244 1.1230 -0.1230 0.4665  0.0723  719 TYR A CZ    
3373 O OH    . TYR A 462 ? 1.1685 0.5491 1.1994 -0.1098 0.5121  0.1014  719 TYR A OH    
3374 N N     . GLY A 463 ? 0.6543 0.3930 0.7289 -0.1447 0.2506  -0.0320 720 GLY A N     
3375 C CA    . GLY A 463 ? 0.6052 0.3991 0.6951 -0.1536 0.2197  -0.0548 720 GLY A CA    
3376 C C     . GLY A 463 ? 0.5500 0.3760 0.6254 -0.1342 0.1948  -0.0407 720 GLY A C     
3377 O O     . GLY A 463 ? 0.5190 0.3864 0.6117 -0.1419 0.1829  -0.0532 720 GLY A O     
3378 N N     . LEU A 464 ? 0.5338 0.3424 0.5790 -0.1092 0.1885  -0.0156 721 LEU A N     
3379 C CA    . LEU A 464 ? 0.5126 0.3483 0.5425 -0.0921 0.1665  -0.0049 721 LEU A CA    
3380 C C     . LEU A 464 ? 0.5209 0.3629 0.5537 -0.0940 0.1802  0.0016  721 LEU A C     
3381 O O     . LEU A 464 ? 0.5108 0.3874 0.5507 -0.0935 0.1658  -0.0049 721 LEU A O     
3382 C CB    . LEU A 464 ? 0.5100 0.3305 0.5082 -0.0673 0.1573  0.0172  721 LEU A CB    
3383 C CG    . LEU A 464 ? 0.4834 0.3322 0.4664 -0.0528 0.1361  0.0238  721 LEU A CG    
3384 C CD1   . LEU A 464 ? 0.4409 0.3226 0.4363 -0.0565 0.1111  0.0068  721 LEU A CD1   
3385 C CD2   . LEU A 464 ? 0.4812 0.3213 0.4346 -0.0309 0.1301  0.0440  721 LEU A CD2   
3386 N N     . ALA A 465 ? 0.5464 0.3531 0.5717 -0.0934 0.2091  0.0165  722 ALA A N     
3387 C CA    . ALA A 465 ? 0.5727 0.3791 0.6029 -0.0985 0.2297  0.0223  722 ALA A CA    
3388 C C     . ALA A 465 ? 0.5679 0.4089 0.6349 -0.1217 0.2292  -0.0029 722 ALA A C     
3389 O O     . ALA A 465 ? 0.5490 0.4160 0.6206 -0.1202 0.2264  -0.0030 722 ALA A O     
3390 C CB    . ALA A 465 ? 0.6134 0.3708 0.6379 -0.1001 0.2670  0.0380  722 ALA A CB    
3391 N N     . GLN A 466 ? 0.5887 0.4322 0.6820 -0.1427 0.2327  -0.0251 723 GLN A N     
3392 C CA    . GLN A 466 ? 0.5947 0.4781 0.7265 -0.1666 0.2318  -0.0522 723 GLN A CA    
3393 C C     . GLN A 466 ? 0.5566 0.4924 0.6924 -0.1574 0.1976  -0.0599 723 GLN A C     
3394 O O     . GLN A 466 ? 0.5434 0.5154 0.6977 -0.1608 0.1953  -0.0660 723 GLN A O     
3395 C CB    . GLN A 466 ? 0.6430 0.5167 0.7970 -0.1908 0.2424  -0.0759 723 GLN A CB    
3396 C CG    . GLN A 466 ? 0.6486 0.5749 0.8425 -0.2163 0.2351  -0.1092 723 GLN A CG    
3397 C CD    . GLN A 466 ? 0.6998 0.6125 0.9139 -0.2434 0.2509  -0.1354 723 GLN A CD    
3398 O OE1   . GLN A 466 ? 0.7658 0.6911 1.0133 -0.2715 0.2711  -0.1575 723 GLN A OE1   
3399 N NE2   . GLN A 466 ? 0.7215 0.6097 0.9169 -0.2366 0.2432  -0.1351 723 GLN A NE2   
3400 N N     . ASN A 467 ? 0.5199 0.4582 0.6385 -0.1438 0.1734  -0.0577 724 ASN A N     
3401 C CA    . ASN A 467 ? 0.4838 0.4652 0.6044 -0.1330 0.1446  -0.0622 724 ASN A CA    
3402 C C     . ASN A 467 ? 0.4700 0.4583 0.5763 -0.1153 0.1405  -0.0463 724 ASN A C     
3403 O O     . ASN A 467 ? 0.4639 0.4893 0.5812 -0.1098 0.1257  -0.0516 724 ASN A O     
3404 C CB    . ASN A 467 ? 0.4709 0.4474 0.5739 -0.1218 0.1234  -0.0609 724 ASN A CB    
3405 C CG    . ASN A 467 ? 0.4849 0.4668 0.6033 -0.1392 0.1229  -0.0816 724 ASN A CG    
3406 O OD1   . ASN A 467 ? 0.4827 0.4798 0.6283 -0.1613 0.1355  -0.1006 724 ASN A OD1   
3407 N ND2   . ASN A 467 ? 0.4558 0.4273 0.5577 -0.1305 0.1094  -0.0799 724 ASN A ND2   
3408 N N     . LEU A 468 ? 0.4647 0.4187 0.5456 -0.1052 0.1542  -0.0271 725 LEU A N     
3409 C CA    . LEU A 468 ? 0.4495 0.4100 0.5127 -0.0891 0.1504  -0.0148 725 LEU A CA    
3410 C C     . LEU A 468 ? 0.4745 0.4330 0.5445 -0.0950 0.1745  -0.0104 725 LEU A C     
3411 O O     . LEU A 468 ? 0.4753 0.4374 0.5293 -0.0832 0.1757  -0.0012 725 LEU A O     
3412 C CB    . LEU A 468 ? 0.4457 0.3802 0.4712 -0.0705 0.1443  0.0031  725 LEU A CB    
3413 C CG    . LEU A 468 ? 0.4187 0.3623 0.4363 -0.0612 0.1186  -0.0004 725 LEU A CG    
3414 C CD1   . LEU A 468 ? 0.4194 0.3438 0.4043 -0.0451 0.1133  0.0149  725 LEU A CD1   
3415 C CD2   . LEU A 468 ? 0.3918 0.3684 0.4212 -0.0574 0.1038  -0.0096 725 LEU A CD2   
3416 N N     . ASN A 469 ? 0.4935 0.4457 0.5871 -0.1145 0.1953  -0.0184 726 ASN A N     
3417 C CA    . ASN A 469 ? 0.5297 0.4747 0.6312 -0.1224 0.2234  -0.0134 726 ASN A CA    
3418 C C     . ASN A 469 ? 0.5338 0.4460 0.5961 -0.1047 0.2369  0.0123  726 ASN A C     
3419 O O     . ASN A 469 ? 0.5210 0.4415 0.5767 -0.0992 0.2461  0.0189  726 ASN A O     
3420 C CB    . ASN A 469 ? 0.5353 0.5264 0.6643 -0.1270 0.2193  -0.0258 726 ASN A CB    
3421 C CG    . ASN A 469 ? 0.5830 0.5727 0.7315 -0.1416 0.2502  -0.0265 726 ASN A CG    
3422 O OD1   . ASN A 469 ? 0.6592 0.6177 0.8127 -0.1559 0.2756  -0.0248 726 ASN A OD1   
3423 N ND2   . ASN A 469 ? 0.6052 0.6256 0.7652 -0.1378 0.2516  -0.0283 726 ASN A ND2   
3424 N N     . ILE A 470 ? 0.5336 0.4118 0.5696 -0.0946 0.2380  0.0267  727 ILE A N     
3425 C CA    . ILE A 470 ? 0.5683 0.4201 0.5653 -0.0755 0.2499  0.0529  727 ILE A CA    
3426 C C     . ILE A 470 ? 0.6025 0.4102 0.5951 -0.0782 0.2769  0.0663  727 ILE A C     
3427 O O     . ILE A 470 ? 0.6079 0.4053 0.6271 -0.0961 0.2840  0.0520  727 ILE A O     
3428 C CB    . ILE A 470 ? 0.5452 0.4043 0.5102 -0.0539 0.2229  0.0611  727 ILE A CB    
3429 C CG1   . ILE A 470 ? 0.5471 0.3960 0.5149 -0.0537 0.2078  0.0568  727 ILE A CG1   
3430 C CG2   . ILE A 470 ? 0.5103 0.4058 0.4782 -0.0508 0.2023  0.0488  727 ILE A CG2   
3431 C CD1   . ILE A 470 ? 0.5131 0.3726 0.4561 -0.0357 0.1814  0.0618  727 ILE A CD1   
3432 N N     . SER A 471 ? 0.6424 0.4248 0.6009 -0.0597 0.2928  0.0935  728 SER A N     
3433 C CA    . SER A 471 ? 0.7043 0.4398 0.6555 -0.0570 0.3220  0.1116  728 SER A CA    
3434 C C     . SER A 471 ? 0.7073 0.4284 0.6493 -0.0468 0.3073  0.1149  728 SER A C     
3435 O O     . SER A 471 ? 0.6538 0.4011 0.5844 -0.0358 0.2748  0.1106  728 SER A O     
3436 C CB    . SER A 471 ? 0.7546 0.4711 0.6691 -0.0357 0.3444  0.1439  728 SER A CB    
3437 O OG    . SER A 471 ? 0.7502 0.4871 0.6282 -0.0100 0.3185  0.1569  728 SER A OG    
3438 N N     . ARG A 472 ? 0.7641 0.4416 0.7127 -0.0510 0.3344  0.1222  729 ARG A N     
3439 C CA    . ARG A 472 ? 0.7961 0.4539 0.7359 -0.0397 0.3274  0.1283  729 ARG A CA    
3440 C C     . ARG A 472 ? 0.7953 0.4623 0.6946 -0.0061 0.3115  0.1554  729 ARG A C     
3441 O O     . ARG A 472 ? 0.7684 0.4511 0.6616 0.0034  0.2848  0.1517  729 ARG A O     
3442 C CB    . ARG A 472 ? 0.8800 0.4815 0.8302 -0.0466 0.3672  0.1358  729 ARG A CB    
3443 C CG    . ARG A 472 ? 0.9160 0.4996 0.8672 -0.0413 0.3595  0.1325  729 ARG A CG    
3444 C CD    . ARG A 472 ? 1.0023 0.5234 0.9594 -0.0433 0.4022  0.1431  729 ARG A CD    
3445 N NE    . ARG A 472 ? 1.1017 0.5856 1.0473 -0.0353 0.4430  0.1705  729 ARG A NE    
3446 C CZ    . ARG A 472 ? 1.1592 0.6402 1.0675 -0.0022 0.4482  0.2086  729 ARG A CZ    
3447 N NH1   . ARG A 472 ? 1.1427 0.6604 1.0229 0.0246  0.4130  0.2215  729 ARG A NH1   
3448 N NH2   . ARG A 472 ? 1.1938 0.6383 1.0928 0.0035  0.4893  0.2332  729 ARG A NH2   
3449 N N     . LYS A 473 ? 0.8364 0.4972 0.7089 0.0111  0.3285  0.1815  730 LYS A N     
3450 C CA    . LYS A 473 ? 0.8528 0.5308 0.6845 0.0433  0.3151  0.2075  730 LYS A CA    
3451 C C     . LYS A 473 ? 0.7975 0.5271 0.6230 0.0452  0.2732  0.1903  730 LYS A C     
3452 O O     . LYS A 473 ? 0.7649 0.5117 0.5749 0.0620  0.2513  0.1960  730 LYS A O     
3453 C CB    . LYS A 473 ? 0.9051 0.5767 0.7107 0.0565  0.3398  0.2328  730 LYS A CB    
3454 C CG    . LYS A 473 ? 0.9401 0.6299 0.7002 0.0920  0.3316  0.2632  730 LYS A CG    
3455 C CD    . LYS A 473 ? 1.0081 0.6745 0.7413 0.1086  0.3683  0.2964  730 LYS A CD    
3456 C CE    . LYS A 473 ? 1.0503 0.7193 0.7419 0.1484  0.3715  0.3353  730 LYS A CE    
3457 N NZ    . LYS A 473 ? 1.1153 0.7499 0.7829 0.1661  0.4143  0.3721  730 LYS A NZ    
3458 N N     . GLU A 474 ? 0.7691 0.5230 0.6087 0.0280  0.2643  0.1692  731 GLU A N     
3459 C CA    . GLU A 474 ? 0.7161 0.5130 0.5533 0.0276  0.2294  0.1510  731 GLU A CA    
3460 C C     . GLU A 474 ? 0.6565 0.4604 0.5137 0.0198  0.2058  0.1325  731 GLU A C     
3461 O O     . GLU A 474 ? 0.6199 0.4499 0.4662 0.0285  0.1797  0.1277  731 GLU A O     
3462 C CB    . GLU A 474 ? 0.7190 0.5355 0.5708 0.0118  0.2299  0.1334  731 GLU A CB    
3463 C CG    . GLU A 474 ? 0.7845 0.6028 0.6092 0.0229  0.2478  0.1509  731 GLU A CG    
3464 C CD    . GLU A 474 ? 0.8009 0.6361 0.6407 0.0086  0.2532  0.1354  731 GLU A CD    
3465 O OE1   . GLU A 474 ? 0.8111 0.6380 0.6861 -0.0119 0.2670  0.1226  731 GLU A OE1   
3466 O OE2   . GLU A 474 ? 0.8179 0.6767 0.6336 0.0185  0.2451  0.1360  731 GLU A OE2   
3467 N N     . ALA A 475 ? 0.6300 0.4122 0.5164 0.0023  0.2162  0.1208  732 ALA A N     
3468 C CA    . ALA A 475 ? 0.6120 0.4003 0.5154 -0.0049 0.1962  0.1037  732 ALA A CA    
3469 C C     . ALA A 475 ? 0.6177 0.3952 0.5016 0.0154  0.1905  0.1206  732 ALA A C     
3470 O O     . ALA A 475 ? 0.5657 0.3640 0.4486 0.0197  0.1650  0.1124  732 ALA A O     
3471 C CB    . ALA A 475 ? 0.6057 0.3771 0.5425 -0.0289 0.2101  0.0855  732 ALA A CB    
3472 N N     . ALA A 476 ? 0.6634 0.4108 0.5315 0.0297  0.2155  0.1458  733 ALA A N     
3473 C CA    . ALA A 476 ? 0.6800 0.4197 0.5287 0.0539  0.2135  0.1669  733 ALA A CA    
3474 C C     . ALA A 476 ? 0.6720 0.4552 0.4959 0.0721  0.1863  0.1729  733 ALA A C     
3475 O O     . ALA A 476 ? 0.6343 0.4343 0.4554 0.0818  0.1668  0.1721  733 ALA A O     
3476 C CB    . ALA A 476 ? 0.7362 0.4352 0.5712 0.0695  0.2493  0.1970  733 ALA A CB    
3477 N N     . GLU A 477 ? 0.6843 0.4875 0.4917 0.0746  0.1859  0.1762  734 GLU A N     
3478 C CA    . GLU A 477 ? 0.6705 0.5186 0.4569 0.0854  0.1604  0.1736  734 GLU A CA    
3479 C C     . GLU A 477 ? 0.6148 0.4884 0.4190 0.0713  0.1312  0.1453  734 GLU A C     
3480 O O     . GLU A 477 ? 0.6102 0.5125 0.4046 0.0806  0.1102  0.1430  734 GLU A O     
3481 C CB    . GLU A 477 ? 0.7048 0.5658 0.4746 0.0847  0.1682  0.1755  734 GLU A CB    
3482 C CG    . GLU A 477 ? 0.7851 0.6335 0.5255 0.1058  0.1926  0.2078  734 GLU A CG    
3483 C CD    . GLU A 477 ? 0.8168 0.6765 0.5404 0.1039  0.2027  0.2087  734 GLU A CD    
3484 O OE1   . GLU A 477 ? 0.8293 0.7114 0.5615 0.0888  0.1884  0.1843  734 GLU A OE1   
3485 O OE2   . GLU A 477 ? 0.8780 0.7229 0.5790 0.1190  0.2273  0.2353  734 GLU A OE2   
3486 N N     . PHE A 478 ? 0.5981 0.7217 0.3758 0.0187  0.1245  -0.0947 735 PHE A N     
3487 C CA    . PHE A 478 ? 0.5604 0.6870 0.3737 0.0373  0.1050  -0.1055 735 PHE A CA    
3488 C C     . PHE A 478 ? 0.5446 0.6368 0.3569 0.0421  0.0876  -0.0851 735 PHE A C     
3489 O O     . PHE A 478 ? 0.5125 0.5914 0.3276 0.0552  0.0699  -0.0855 735 PHE A O     
3490 C CB    . PHE A 478 ? 0.5481 0.7033 0.4044 0.0385  0.1091  -0.1233 735 PHE A CB    
3491 C CG    . PHE A 478 ? 0.5715 0.7625 0.4469 0.0465  0.1126  -0.1531 735 PHE A CG    
3492 C CD1   . PHE A 478 ? 0.5821 0.7708 0.4670 0.0656  0.0935  -0.1658 735 PHE A CD1   
3493 C CD2   . PHE A 478 ? 0.5909 0.8187 0.4752 0.0345  0.1350  -0.1699 735 PHE A CD2   
3494 C CE1   . PHE A 478 ? 0.5980 0.8196 0.5015 0.0749  0.0946  -0.1955 735 PHE A CE1   
3495 C CE2   . PHE A 478 ? 0.6028 0.8682 0.5079 0.0430  0.1382  -0.2012 735 PHE A CE2   
3496 C CZ    . PHE A 478 ? 0.6066 0.8685 0.5215 0.0644  0.1170  -0.2144 735 PHE A CZ    
3497 N N     . ILE A 479 ? 0.5358 0.6161 0.3463 0.0305  0.0936  -0.0692 736 ILE A N     
3498 C CA    . ILE A 479 ? 0.5121 0.5652 0.3256 0.0333  0.0801  -0.0522 736 ILE A CA    
3499 C C     . ILE A 479 ? 0.5249 0.5521 0.3088 0.0383  0.0685  -0.0404 736 ILE A C     
3500 O O     . ILE A 479 ? 0.4971 0.5111 0.2902 0.0479  0.0525  -0.0376 736 ILE A O     
3501 C CB    . ILE A 479 ? 0.5151 0.5618 0.3304 0.0194  0.0897  -0.0393 736 ILE A CB    
3502 C CG1   . ILE A 479 ? 0.5107 0.5822 0.3637 0.0186  0.0952  -0.0530 736 ILE A CG1   
3503 C CG2   . ILE A 479 ? 0.5008 0.5196 0.3159 0.0225  0.0757  -0.0226 736 ILE A CG2   
3504 C CD1   . ILE A 479 ? 0.5148 0.5865 0.3733 0.0037  0.1072  -0.0449 736 ILE A CD1   
3505 N N     . GLU A 480 ? 0.5690 0.5898 0.3167 0.0315  0.0765  -0.0354 737 GLU A N     
3506 C CA    . GLU A 480 ? 0.6049 0.6011 0.3219 0.0373  0.0642  -0.0264 737 GLU A CA    
3507 C C     . GLU A 480 ? 0.5936 0.5972 0.3192 0.0524  0.0517  -0.0403 737 GLU A C     
3508 O O     . GLU A 480 ? 0.5786 0.5651 0.2998 0.0613  0.0355  -0.0362 737 GLU A O     
3509 C CB    . GLU A 480 ? 0.6827 0.6684 0.3533 0.0257  0.0759  -0.0189 737 GLU A CB    
3510 C CG    . GLU A 480 ? 0.7548 0.7217 0.3900 0.0338  0.0642  -0.0166 737 GLU A CG    
3511 C CD    . GLU A 480 ? 0.8612 0.8164 0.4446 0.0208  0.0769  -0.0100 737 GLU A CD    
3512 O OE1   . GLU A 480 ? 0.9488 0.9004 0.5194 0.0033  0.0927  -0.0010 737 GLU A OE1   
3513 O OE2   . GLU A 480 ? 0.9055 0.8541 0.4589 0.0269  0.0716  -0.0140 737 GLU A OE2   
3514 N N     . ARG A 481 ? 0.5704 0.6005 0.3099 0.0553  0.0587  -0.0585 738 ARG A N     
3515 C CA    . ARG A 481 ? 0.5849 0.6213 0.3337 0.0696  0.0460  -0.0733 738 ARG A CA    
3516 C C     . ARG A 481 ? 0.5178 0.5470 0.2995 0.0779  0.0301  -0.0739 738 ARG A C     
3517 O O     . ARG A 481 ? 0.5023 0.5204 0.2859 0.0872  0.0146  -0.0761 738 ARG A O     
3518 C CB    . ARG A 481 ? 0.6232 0.6909 0.3791 0.0708  0.0575  -0.0948 738 ARG A CB    
3519 C CG    . ARG A 481 ? 0.6779 0.7524 0.4321 0.0841  0.0472  -0.1111 738 ARG A CG    
3520 C CD    . ARG A 481 ? 0.7397 0.7967 0.4543 0.0855  0.0429  -0.1038 738 ARG A CD    
3521 N NE    . ARG A 481 ? 0.7900 0.8442 0.5122 0.1008  0.0249  -0.1157 738 ARG A NE    
3522 C CZ    . ARG A 481 ? 0.8042 0.8433 0.5475 0.1087  0.0066  -0.1131 738 ARG A CZ    
3523 N NH1   . ARG A 481 ? 0.7816 0.8081 0.5410 0.1039  0.0035  -0.0998 738 ARG A NH1   
3524 N NH2   . ARG A 481 ? 0.8510 0.8878 0.5986 0.1206  -0.0084 -0.1251 738 ARG A NH2   
3525 N N     . TYR A 482 ? 0.4784 0.5118 0.2830 0.0731  0.0342  -0.0711 739 TYR A N     
3526 C CA    . TYR A 482 ? 0.4489 0.4723 0.2777 0.0782  0.0210  -0.0697 739 TYR A CA    
3527 C C     . TYR A 482 ? 0.4591 0.4584 0.2784 0.0778  0.0104  -0.0547 739 TYR A C     
3528 O O     . TYR A 482 ? 0.4435 0.4335 0.2720 0.0837  -0.0031 -0.0573 739 TYR A O     
3529 C CB    . TYR A 482 ? 0.4242 0.4557 0.2757 0.0730  0.0272  -0.0695 739 TYR A CB    
3530 C CG    . TYR A 482 ? 0.4039 0.4217 0.2745 0.0771  0.0137  -0.0671 739 TYR A CG    
3531 C CD1   . TYR A 482 ? 0.3987 0.3986 0.2668 0.0722  0.0101  -0.0515 739 TYR A CD1   
3532 C CD2   . TYR A 482 ? 0.4033 0.4245 0.2927 0.0857  0.0036  -0.0814 739 TYR A CD2   
3533 C CE1   . TYR A 482 ? 0.3849 0.3723 0.2667 0.0736  -0.0005 -0.0495 739 TYR A CE1   
3534 C CE2   . TYR A 482 ? 0.3840 0.3873 0.2842 0.0874  -0.0091 -0.0776 739 TYR A CE2   
3535 C CZ    . TYR A 482 ? 0.3862 0.3737 0.2817 0.0802  -0.0096 -0.0614 739 TYR A CZ    
3536 O OH    . TYR A 482 ? 0.3887 0.3591 0.2912 0.0796  -0.0200 -0.0579 739 TYR A OH    
3537 N N     . PHE A 483 ? 0.4757 0.4650 0.2779 0.0703  0.0162  -0.0404 740 PHE A N     
3538 C CA    . PHE A 483 ? 0.4725 0.4423 0.2688 0.0711  0.0056  -0.0293 740 PHE A CA    
3539 C C     . PHE A 483 ? 0.4906 0.4533 0.2725 0.0791  -0.0059 -0.0336 740 PHE A C     
3540 O O     . PHE A 483 ? 0.5044 0.4573 0.2940 0.0821  -0.0175 -0.0317 740 PHE A O     
3541 C CB    . PHE A 483 ? 0.4766 0.4348 0.2565 0.0631  0.0115  -0.0148 740 PHE A CB    
3542 C CG    . PHE A 483 ? 0.4704 0.4327 0.2678 0.0556  0.0196  -0.0099 740 PHE A CG    
3543 C CD1   . PHE A 483 ? 0.4500 0.4155 0.2747 0.0575  0.0147  -0.0127 740 PHE A CD1   
3544 C CD2   . PHE A 483 ? 0.5071 0.4678 0.2911 0.0455  0.0318  -0.0021 740 PHE A CD2   
3545 C CE1   . PHE A 483 ? 0.4534 0.4220 0.2934 0.0516  0.0207  -0.0090 740 PHE A CE1   
3546 C CE2   . PHE A 483 ? 0.4910 0.4557 0.2929 0.0387  0.0383  0.0015  740 PHE A CE2   
3547 C CZ    . PHE A 483 ? 0.4706 0.4400 0.3011 0.0427  0.0324  -0.0024 740 PHE A CZ    
3548 N N     . GLU A 484 ? 0.5174 0.4862 0.2799 0.0822  -0.0026 -0.0408 741 GLU A N     
3549 C CA    . GLU A 484 ? 0.5504 0.5136 0.3010 0.0912  -0.0149 -0.0473 741 GLU A CA    
3550 C C     . GLU A 484 ? 0.5234 0.4909 0.3002 0.0980  -0.0261 -0.0591 741 GLU A C     
3551 O O     . GLU A 484 ? 0.5056 0.4654 0.2826 0.1034  -0.0388 -0.0625 741 GLU A O     
3552 C CB    . GLU A 484 ? 0.6308 0.6013 0.3541 0.0930  -0.0082 -0.0544 741 GLU A CB    
3553 C CG    . GLU A 484 ? 0.7201 0.6779 0.4048 0.0861  -0.0007 -0.0425 741 GLU A CG    
3554 C CD    . GLU A 484 ? 0.8196 0.7866 0.4751 0.0856  0.0085  -0.0508 741 GLU A CD    
3555 O OE1   . GLU A 484 ? 0.9240 0.8896 0.5684 0.0956  -0.0018 -0.0599 741 GLU A OE1   
3556 O OE2   . GLU A 484 ? 0.9090 0.8863 0.5528 0.0746  0.0268  -0.0497 741 GLU A OE2   
3557 N N     . SER A 485 ? 0.4814 0.4595 0.2789 0.0974  -0.0223 -0.0661 742 SER A N     
3558 C CA    . SER A 485 ? 0.4608 0.4362 0.2785 0.1025  -0.0343 -0.0758 742 SER A CA    
3559 C C     . SER A 485 ? 0.4132 0.3766 0.2475 0.0968  -0.0396 -0.0677 742 SER A C     
3560 O O     . SER A 485 ? 0.3951 0.3498 0.2391 0.0981  -0.0507 -0.0724 742 SER A O     
3561 C CB    . SER A 485 ? 0.4665 0.4547 0.2976 0.1060  -0.0314 -0.0884 742 SER A CB    
3562 O OG    . SER A 485 ? 0.5098 0.5122 0.3289 0.1119  -0.0276 -0.1005 742 SER A OG    
3563 N N     . PHE A 486 ? 0.3811 0.3440 0.2183 0.0897  -0.0311 -0.0565 743 PHE A N     
3564 C CA    . PHE A 486 ? 0.3629 0.3168 0.2141 0.0834  -0.0337 -0.0491 743 PHE A CA    
3565 C C     . PHE A 486 ? 0.3575 0.3077 0.2020 0.0791  -0.0306 -0.0376 743 PHE A C     
3566 O O     . PHE A 486 ? 0.3434 0.2939 0.1911 0.0739  -0.0232 -0.0295 743 PHE A O     
3567 C CB    . PHE A 486 ? 0.3512 0.3080 0.2155 0.0807  -0.0288 -0.0492 743 PHE A CB    
3568 C CG    . PHE A 486 ? 0.3643 0.3229 0.2356 0.0871  -0.0351 -0.0624 743 PHE A CG    
3569 C CD1   . PHE A 486 ? 0.3712 0.3144 0.2486 0.0875  -0.0479 -0.0662 743 PHE A CD1   
3570 C CD2   . PHE A 486 ? 0.3731 0.3479 0.2441 0.0925  -0.0292 -0.0725 743 PHE A CD2   
3571 C CE1   . PHE A 486 ? 0.3876 0.3273 0.2697 0.0948  -0.0574 -0.0789 743 PHE A CE1   
3572 C CE2   . PHE A 486 ? 0.3926 0.3698 0.2723 0.1009  -0.0378 -0.0879 743 PHE A CE2   
3573 C CZ    . PHE A 486 ? 0.3945 0.3520 0.2794 0.1031  -0.0534 -0.0909 743 PHE A CZ    
3574 N N     . PRO A 487 ? 0.3601 0.3059 0.1956 0.0825  -0.0380 -0.0384 744 PRO A N     
3575 C CA    . PRO A 487 ? 0.3629 0.3031 0.1913 0.0812  -0.0389 -0.0299 744 PRO A CA    
3576 C C     . PRO A 487 ? 0.3384 0.2772 0.1851 0.0751  -0.0390 -0.0254 744 PRO A C     
3577 O O     . PRO A 487 ? 0.3249 0.2599 0.1686 0.0735  -0.0374 -0.0179 744 PRO A O     
3578 C CB    . PRO A 487 ? 0.3842 0.3206 0.2033 0.0885  -0.0509 -0.0362 744 PRO A CB    
3579 C CG    . PRO A 487 ? 0.3787 0.3191 0.2093 0.0904  -0.0565 -0.0476 744 PRO A CG    
3580 C CD    . PRO A 487 ? 0.3705 0.3157 0.2032 0.0889  -0.0480 -0.0487 744 PRO A CD    
3581 N N     . GLY A 488 ? 0.3203 0.2605 0.1843 0.0709  -0.0409 -0.0299 745 GLY A N     
3582 C CA    . GLY A 488 ? 0.3066 0.2466 0.1856 0.0636  -0.0393 -0.0268 745 GLY A CA    
3583 C C     . GLY A 488 ? 0.2996 0.2394 0.1800 0.0599  -0.0303 -0.0189 745 GLY A C     
3584 O O     . GLY A 488 ? 0.2821 0.2221 0.1688 0.0563  -0.0278 -0.0140 745 GLY A O     
3585 N N     . VAL A 489 ? 0.3059 0.2470 0.1823 0.0616  -0.0260 -0.0198 746 VAL A N     
3586 C CA    . VAL A 489 ? 0.3039 0.2474 0.1836 0.0586  -0.0176 -0.0145 746 VAL A CA    
3587 C C     . VAL A 489 ? 0.3142 0.2581 0.1827 0.0583  -0.0120 -0.0067 746 VAL A C     
3588 O O     . VAL A 489 ? 0.3126 0.2550 0.1858 0.0542  -0.0078 -0.0002 746 VAL A O     
3589 C CB    . VAL A 489 ? 0.3062 0.2547 0.1876 0.0616  -0.0152 -0.0209 746 VAL A CB    
3590 C CG1   . VAL A 489 ? 0.3098 0.2641 0.1973 0.0586  -0.0064 -0.0176 746 VAL A CG1   
3591 C CG2   . VAL A 489 ? 0.3013 0.2420 0.1901 0.0623  -0.0239 -0.0277 746 VAL A CG2   
3592 N N     . LYS A 490 ? 0.3379 0.2805 0.1892 0.0622  -0.0133 -0.0072 747 LYS A N     
3593 C CA    . LYS A 490 ? 0.3713 0.3066 0.2047 0.0608  -0.0102 0.0015  747 LYS A CA    
3594 C C     . LYS A 490 ? 0.3752 0.3025 0.2144 0.0608  -0.0173 0.0062  747 LYS A C     
3595 O O     . LYS A 490 ? 0.3604 0.2818 0.1979 0.0571  -0.0142 0.0138  747 LYS A O     
3596 C CB    . LYS A 490 ? 0.4168 0.3472 0.2250 0.0655  -0.0133 0.0003  747 LYS A CB    
3597 C CG    . LYS A 490 ? 0.4566 0.3732 0.2379 0.0621  -0.0103 0.0107  747 LYS A CG    
3598 C CD    . LYS A 490 ? 0.5085 0.4148 0.2602 0.0676  -0.0170 0.0099  747 LYS A CD    
3599 C CE    . LYS A 490 ? 0.5667 0.4551 0.2834 0.0614  -0.0119 0.0213  747 LYS A CE    
3600 N NZ    . LYS A 490 ? 0.6152 0.4866 0.2983 0.0679  -0.0227 0.0217  747 LYS A NZ    
3601 N N     . ARG A 491 ? 0.3792 0.3078 0.2279 0.0646  -0.0269 -0.0003 748 ARG A N     
3602 C CA    . ARG A 491 ? 0.4016 0.3279 0.2605 0.0656  -0.0344 -0.0007 748 ARG A CA    
3603 C C     . ARG A 491 ? 0.3721 0.3025 0.2487 0.0593  -0.0288 0.0020  748 ARG A C     
3604 O O     . ARG A 491 ? 0.3588 0.2849 0.2379 0.0596  -0.0313 0.0053  748 ARG A O     
3605 C CB    . ARG A 491 ? 0.4369 0.3697 0.3074 0.0687  -0.0434 -0.0117 748 ARG A CB    
3606 C CG    . ARG A 491 ? 0.5028 0.4392 0.3883 0.0704  -0.0515 -0.0172 748 ARG A CG    
3607 C CD    . ARG A 491 ? 0.5946 0.5407 0.4932 0.0720  -0.0592 -0.0303 748 ARG A CD    
3608 N NE    . ARG A 491 ? 0.6329 0.5747 0.5164 0.0772  -0.0634 -0.0327 748 ARG A NE    
3609 C CZ    . ARG A 491 ? 0.6746 0.6209 0.5630 0.0737  -0.0613 -0.0378 748 ARG A CZ    
3610 N NH1   . ARG A 491 ? 0.7147 0.6663 0.6189 0.0638  -0.0553 -0.0397 748 ARG A NH1   
3611 N NH2   . ARG A 491 ? 0.6891 0.6318 0.5637 0.0799  -0.0662 -0.0412 748 ARG A NH2   
3612 N N     . TYR A 492 ? 0.3473 0.2838 0.2344 0.0544  -0.0228 -0.0001 749 TYR A N     
3613 C CA    . TYR A 492 ? 0.3394 0.2778 0.2391 0.0487  -0.0176 0.0025  749 TYR A CA    
3614 C C     . TYR A 492 ? 0.3406 0.2751 0.2352 0.0474  -0.0116 0.0107  749 TYR A C     
3615 O O     . TYR A 492 ? 0.3428 0.2761 0.2452 0.0453  -0.0113 0.0136  749 TYR A O     
3616 C CB    . TYR A 492 ? 0.3313 0.2710 0.2369 0.0447  -0.0151 -0.0009 749 TYR A CB    
3617 C CG    . TYR A 492 ? 0.3285 0.2673 0.2407 0.0407  -0.0100 0.0027  749 TYR A CG    
3618 C CD1   . TYR A 492 ? 0.3358 0.2750 0.2568 0.0360  -0.0097 0.0031  749 TYR A CD1   
3619 C CD2   . TYR A 492 ? 0.3255 0.2652 0.2361 0.0419  -0.0053 0.0042  749 TYR A CD2   
3620 C CE1   . TYR A 492 ? 0.3309 0.2684 0.2567 0.0332  -0.0063 0.0060  749 TYR A CE1   
3621 C CE2   . TYR A 492 ? 0.3288 0.2683 0.2475 0.0392  -0.0021 0.0061  749 TYR A CE2   
3622 C CZ    . TYR A 492 ? 0.3288 0.2656 0.2537 0.0352  -0.0033 0.0076  749 TYR A CZ    
3623 O OH    . TYR A 492 ? 0.3234 0.2590 0.2551 0.0331  -0.0014 0.0091  749 TYR A OH    
3624 N N     . MET A 493 ? 0.3395 0.2731 0.2218 0.0478  -0.0066 0.0132  750 MET A N     
3625 C CA    A MET A 493 ? 0.3678 0.2990 0.2453 0.0437  0.0010  0.0200  750 MET A CA    
3626 C CA    B MET A 493 ? 0.3461 0.2772 0.2239 0.0437  0.0009  0.0200  750 MET A CA    
3627 C C     . MET A 493 ? 0.3674 0.2854 0.2334 0.0440  -0.0035 0.0273  750 MET A C     
3628 O O     . MET A 493 ? 0.3653 0.2790 0.2363 0.0403  -0.0015 0.0322  750 MET A O     
3629 C CB    A MET A 493 ? 0.3986 0.3351 0.2651 0.0422  0.0093  0.0187  750 MET A CB    
3630 C CB    B MET A 493 ? 0.3489 0.2860 0.2173 0.0423  0.0091  0.0183  750 MET A CB    
3631 C CG    A MET A 493 ? 0.4231 0.3722 0.3026 0.0435  0.0122  0.0095  750 MET A CG    
3632 C CG    B MET A 493 ? 0.3316 0.2800 0.2158 0.0431  0.0113  0.0100  750 MET A CG    
3633 S SD    A MET A 493 ? 0.4733 0.4285 0.3749 0.0405  0.0155  0.0071  750 MET A SD    
3634 S SD    B MET A 493 ? 0.3334 0.2952 0.2129 0.0420  0.0217  0.0035  750 MET A SD    
3635 C CE    A MET A 493 ? 0.4394 0.4028 0.3486 0.0464  0.0122  -0.0059 750 MET A CE    
3636 C CE    B MET A 493 ? 0.3639 0.3177 0.2231 0.0335  0.0303  0.0149  750 MET A CE    
3637 N N     . GLU A 494 ? 0.3764 0.2861 0.2271 0.0493  -0.0118 0.0271  751 GLU A N     
3638 C CA    . GLU A 494 ? 0.4161 0.3088 0.2546 0.0520  -0.0210 0.0325  751 GLU A CA    
3639 C C     . GLU A 494 ? 0.3905 0.2861 0.2506 0.0548  -0.0284 0.0283  751 GLU A C     
3640 O O     . GLU A 494 ? 0.3806 0.2656 0.2402 0.0540  -0.0316 0.0331  751 GLU A O     
3641 C CB    . GLU A 494 ? 0.4535 0.3369 0.2725 0.0595  -0.0317 0.0302  751 GLU A CB    
3642 C CG    . GLU A 494 ? 0.4904 0.3695 0.2833 0.0567  -0.0246 0.0339  751 GLU A CG    
3643 C CD    . GLU A 494 ? 0.5469 0.4199 0.3223 0.0653  -0.0355 0.0292  751 GLU A CD    
3644 O OE1   . GLU A 494 ? 0.5457 0.4253 0.3371 0.0729  -0.0465 0.0198  751 GLU A OE1   
3645 O OE2   . GLU A 494 ? 0.5899 0.4530 0.3354 0.0634  -0.0322 0.0337  751 GLU A OE2   
3646 N N     . ASN A 495 ? 0.3706 0.2811 0.2498 0.0567  -0.0305 0.0185  752 ASN A N     
3647 C CA    . ASN A 495 ? 0.3663 0.2842 0.2662 0.0586  -0.0364 0.0112  752 ASN A CA    
3648 C C     . ASN A 495 ? 0.3506 0.2721 0.2630 0.0528  -0.0292 0.0141  752 ASN A C     
3649 O O     . ASN A 495 ? 0.3533 0.2743 0.2755 0.0548  -0.0342 0.0116  752 ASN A O     
3650 C CB    . ASN A 495 ? 0.3509 0.2849 0.2666 0.0582  -0.0377 -0.0005 752 ASN A CB    
3651 C CG    . ASN A 495 ? 0.3994 0.3327 0.3099 0.0658  -0.0487 -0.0076 752 ASN A CG    
3652 O OD1   . ASN A 495 ? 0.4164 0.3353 0.3101 0.0727  -0.0574 -0.0039 752 ASN A OD1   
3653 N ND2   . ASN A 495 ? 0.4162 0.3626 0.3384 0.0636  -0.0485 -0.0174 752 ASN A ND2   
3654 N N     . ILE A 496 ? 0.3310 0.2564 0.2441 0.0468  -0.0188 0.0175  753 ILE A N     
3655 C CA    . ILE A 496 ? 0.3168 0.2454 0.2417 0.0422  -0.0135 0.0188  753 ILE A CA    
3656 C C     . ILE A 496 ? 0.3278 0.2452 0.2475 0.0411  -0.0127 0.0269  753 ILE A C     
3657 O O     . ILE A 496 ? 0.3061 0.2241 0.2371 0.0399  -0.0131 0.0264  753 ILE A O     
3658 C CB    . ILE A 496 ? 0.3128 0.2473 0.2407 0.0379  -0.0061 0.0179  753 ILE A CB    
3659 C CG1   . ILE A 496 ? 0.3133 0.2507 0.2534 0.0341  -0.0034 0.0167  753 ILE A CG1   
3660 C CG2   . ILE A 496 ? 0.3192 0.2512 0.2377 0.0369  -0.0001 0.0226  753 ILE A CG2   
3661 C CD1   . ILE A 496 ? 0.3146 0.2580 0.2634 0.0321  -0.0059 0.0101  753 ILE A CD1   
3662 N N     . VAL A 497 ? 0.3347 0.2412 0.2358 0.0401  -0.0111 0.0340  754 VAL A N     
3663 C CA    . VAL A 497 ? 0.3598 0.2514 0.2518 0.0365  -0.0108 0.0424  754 VAL A CA    
3664 C C     . VAL A 497 ? 0.3778 0.2561 0.2689 0.0427  -0.0247 0.0420  754 VAL A C     
3665 O O     . VAL A 497 ? 0.3722 0.2419 0.2682 0.0411  -0.0271 0.0449  754 VAL A O     
3666 C CB    . VAL A 497 ? 0.3915 0.2734 0.2591 0.0313  -0.0046 0.0499  754 VAL A CB    
3667 C CG1   . VAL A 497 ? 0.4219 0.2806 0.2719 0.0256  -0.0063 0.0603  754 VAL A CG1   
3668 C CG2   . VAL A 497 ? 0.3833 0.2824 0.2591 0.0258  0.0089  0.0468  754 VAL A CG2   
3669 N N     . GLN A 498 ? 0.3949 0.2718 0.2817 0.0507  -0.0351 0.0366  755 GLN A N     
3670 C CA    . GLN A 498 ? 0.4252 0.2920 0.3147 0.0593  -0.0512 0.0320  755 GLN A CA    
3671 C C     . GLN A 498 ? 0.3998 0.2849 0.3188 0.0608  -0.0515 0.0214  755 GLN A C     
3672 O O     . GLN A 498 ? 0.3666 0.2447 0.2930 0.0648  -0.0602 0.0188  755 GLN A O     
3673 C CB    . GLN A 498 ? 0.4704 0.3358 0.3525 0.0685  -0.0630 0.0251  755 GLN A CB    
3674 C CG    . GLN A 498 ? 0.5527 0.3932 0.3994 0.0699  -0.0686 0.0345  755 GLN A CG    
3675 C CD    . GLN A 498 ? 0.6317 0.4578 0.4534 0.0582  -0.0554 0.0496  755 GLN A CD    
3676 O OE1   . GLN A 498 ? 0.6707 0.4737 0.4775 0.0538  -0.0581 0.0592  755 GLN A OE1   
3677 N NE2   . GLN A 498 ? 0.6004 0.4391 0.4160 0.0527  -0.0421 0.0506  755 GLN A NE2   
3678 N N     . GLU A 499 ? 0.3750 0.2819 0.3089 0.0570  -0.0422 0.0150  756 GLU A N     
3679 C CA    . GLU A 499 ? 0.3759 0.2991 0.3321 0.0557  -0.0400 0.0058  756 GLU A CA    
3680 C C     . GLU A 499 ? 0.3484 0.2660 0.3086 0.0518  -0.0358 0.0115  756 GLU A C     
3681 O O     . GLU A 499 ? 0.3479 0.2698 0.3220 0.0546  -0.0406 0.0046  756 GLU A O     
3682 C CB    . GLU A 499 ? 0.3972 0.3381 0.3611 0.0496  -0.0306 0.0003  756 GLU A CB    
3683 C CG    . GLU A 499 ? 0.4538 0.4083 0.4342 0.0456  -0.0264 -0.0074 756 GLU A CG    
3684 C CD    . GLU A 499 ? 0.5295 0.5008 0.5178 0.0403  -0.0222 -0.0178 756 GLU A CD    
3685 O OE1   . GLU A 499 ? 0.5326 0.5018 0.5117 0.0357  -0.0174 -0.0140 756 GLU A OE1   
3686 O OE2   . GLU A 499 ? 0.6123 0.5989 0.6162 0.0402  -0.0237 -0.0305 756 GLU A OE2   
3687 N N     . ALA A 500 ? 0.3308 0.2418 0.2814 0.0455  -0.0269 0.0216  757 ALA A N     
3688 C CA    . ALA A 500 ? 0.3221 0.2282 0.2774 0.0413  -0.0230 0.0263  757 ALA A CA    
3689 C C     . ALA A 500 ? 0.3491 0.2365 0.3000 0.0443  -0.0331 0.0300  757 ALA A C     
3690 O O     . ALA A 500 ? 0.3113 0.1970 0.2735 0.0443  -0.0354 0.0282  757 ALA A O     
3691 C CB    . ALA A 500 ? 0.3150 0.2192 0.2621 0.0343  -0.0126 0.0339  757 ALA A CB    
3692 N N     . LYS A 501 ? 0.3729 0.2427 0.3040 0.0466  -0.0398 0.0358  758 LYS A N     
3693 C CA    . LYS A 501 ? 0.4247 0.2687 0.3446 0.0500  -0.0530 0.0403  758 LYS A CA    
3694 C C     . LYS A 501 ? 0.3983 0.2468 0.3360 0.0610  -0.0674 0.0275  758 LYS A C     
3695 O O     . LYS A 501 ? 0.3963 0.2322 0.3385 0.0631  -0.0758 0.0272  758 LYS A O     
3696 C CB    . LYS A 501 ? 0.4807 0.3018 0.3705 0.0508  -0.0592 0.0486  758 LYS A CB    
3697 C CG    . LYS A 501 ? 0.5917 0.3772 0.4617 0.0513  -0.0728 0.0568  758 LYS A CG    
3698 C CD    . LYS A 501 ? 0.6726 0.4287 0.5035 0.0495  -0.0783 0.0679  758 LYS A CD    
3699 C CE    . LYS A 501 ? 0.7486 0.4686 0.5528 0.0384  -0.0795 0.0828  758 LYS A CE    
3700 N NZ    . LYS A 501 ? 0.8257 0.5101 0.5844 0.0358  -0.0870 0.0944  758 LYS A NZ    
3701 N N     . GLN A 502 ? 0.3738 0.2418 0.3230 0.0675  -0.0703 0.0152  759 GLN A N     
3702 C CA    . GLN A 502 ? 0.3778 0.2559 0.3468 0.0784  -0.0838 -0.0013 759 GLN A CA    
3703 C C     . GLN A 502 ? 0.3423 0.2416 0.3360 0.0762  -0.0774 -0.0110 759 GLN A C     
3704 O O     . GLN A 502 ? 0.3247 0.2222 0.3308 0.0834  -0.0886 -0.0199 759 GLN A O     
3705 C CB    . GLN A 502 ? 0.3787 0.2751 0.3546 0.0834  -0.0863 -0.0131 759 GLN A CB    
3706 C CG    . GLN A 502 ? 0.3890 0.3032 0.3900 0.0938  -0.0985 -0.0343 759 GLN A CG    
3707 C CD    . GLN A 502 ? 0.3709 0.3209 0.3968 0.0874  -0.0849 -0.0480 759 GLN A CD    
3708 O OE1   . GLN A 502 ? 0.3745 0.3389 0.3998 0.0798  -0.0734 -0.0482 759 GLN A OE1   
3709 N NE2   . GLN A 502 ? 0.3344 0.2979 0.3812 0.0904  -0.0876 -0.0611 759 GLN A NE2   
3710 N N     . LYS A 503 ? 0.3118 0.2298 0.3108 0.0672  -0.0611 -0.0104 760 LYS A N     
3711 C CA    . LYS A 503 ? 0.3101 0.2469 0.3263 0.0637  -0.0538 -0.0188 760 LYS A CA    
3712 C C     . LYS A 503 ? 0.2998 0.2251 0.3142 0.0592  -0.0500 -0.0097 760 LYS A C     
3713 O O     . LYS A 503 ? 0.2801 0.2131 0.3079 0.0604  -0.0509 -0.0175 760 LYS A O     
3714 C CB    . LYS A 503 ? 0.3185 0.2748 0.3360 0.0554  -0.0404 -0.0219 760 LYS A CB    
3715 C CG    . LYS A 503 ? 0.3708 0.3458 0.3977 0.0574  -0.0423 -0.0359 760 LYS A CG    
3716 C CD    . LYS A 503 ? 0.4041 0.3936 0.4291 0.0463  -0.0288 -0.0378 760 LYS A CD    
3717 C CE    . LYS A 503 ? 0.4446 0.4574 0.4837 0.0449  -0.0285 -0.0550 760 LYS A CE    
3718 N NZ    . LYS A 503 ? 0.4758 0.4887 0.5203 0.0552  -0.0411 -0.0615 760 LYS A NZ    
3719 N N     . GLY A 504 ? 0.2933 0.2017 0.2923 0.0538  -0.0456 0.0051  761 GLY A N     
3720 C CA    . GLY A 504 ? 0.2858 0.1876 0.2865 0.0480  -0.0401 0.0118  761 GLY A CA    
3721 C C     . GLY A 504 ? 0.2642 0.1782 0.2665 0.0411  -0.0273 0.0133  761 GLY A C     
3722 O O     . GLY A 504 ? 0.2510 0.1616 0.2567 0.0366  -0.0231 0.0173  761 GLY A O     
3723 N N     . TYR A 505 ? 0.2407 0.1674 0.2405 0.0402  -0.0224 0.0095  762 TYR A N     
3724 C CA    . TYR A 505 ? 0.2451 0.1788 0.2436 0.0350  -0.0138 0.0101  762 TYR A CA    
3725 C C     . TYR A 505 ? 0.2449 0.1839 0.2346 0.0334  -0.0102 0.0096  762 TYR A C     
3726 O O     . TYR A 505 ? 0.2589 0.2012 0.2477 0.0362  -0.0139 0.0059  762 TYR A O     
3727 C CB    . TYR A 505 ? 0.2304 0.1727 0.2374 0.0345  -0.0135 0.0018  762 TYR A CB    
3728 C CG    . TYR A 505 ? 0.2327 0.1879 0.2437 0.0354  -0.0147 -0.0088 762 TYR A CG    
3729 C CD1   . TYR A 505 ? 0.2318 0.1950 0.2357 0.0297  -0.0088 -0.0121 762 TYR A CD1   
3730 C CD2   . TYR A 505 ? 0.2400 0.2001 0.2630 0.0412  -0.0220 -0.0174 762 TYR A CD2   
3731 C CE1   . TYR A 505 ? 0.2386 0.2172 0.2483 0.0278  -0.0077 -0.0239 762 TYR A CE1   
3732 C CE2   . TYR A 505 ? 0.2439 0.2214 0.2750 0.0418  -0.0222 -0.0309 762 TYR A CE2   
3733 C CZ    . TYR A 505 ? 0.2406 0.2288 0.2655 0.0341  -0.0139 -0.0342 762 TYR A CZ    
3734 O OH    . TYR A 505 ? 0.2420 0.2503 0.2775 0.0327  -0.0126 -0.0494 762 TYR A OH    
3735 N N     . VAL A 506 ? 0.2435 0.1830 0.2280 0.0297  -0.0048 0.0116  763 VAL A N     
3736 C CA    . VAL A 506 ? 0.2505 0.1931 0.2269 0.0275  -0.0027 0.0099  763 VAL A CA    
3737 C C     . VAL A 506 ? 0.2597 0.2030 0.2327 0.0229  -0.0008 0.0060  763 VAL A C     
3738 O O     . VAL A 506 ? 0.2402 0.1810 0.2161 0.0226  -0.0012 0.0054  763 VAL A O     
3739 C CB    . VAL A 506 ? 0.2611 0.1994 0.2296 0.0279  -0.0003 0.0153  763 VAL A CB    
3740 C CG1   . VAL A 506 ? 0.2588 0.1930 0.2233 0.0305  -0.0017 0.0201  763 VAL A CG1   
3741 C CG2   . VAL A 506 ? 0.2533 0.1895 0.2246 0.0270  0.0021  0.0166  763 VAL A CG2   
3742 N N     . THR A 507 ? 0.2735 0.2177 0.2383 0.0185  0.0005  0.0033  764 THR A N     
3743 C CA    . THR A 507 ? 0.2867 0.2263 0.2417 0.0116  0.0020  0.0007  764 THR A CA    
3744 C C     . THR A 507 ? 0.2972 0.2255 0.2380 0.0085  0.0009  0.0032  764 THR A C     
3745 O O     . THR A 507 ? 0.3068 0.2359 0.2474 0.0109  0.0001  0.0045  764 THR A O     
3746 C CB    . THR A 507 ? 0.3141 0.2652 0.2713 0.0050  0.0056  -0.0075 764 THR A CB    
3747 O OG1   . THR A 507 ? 0.3716 0.3296 0.3305 0.0032  0.0064  -0.0104 764 THR A OG1   
3748 C CG2   . THR A 507 ? 0.3020 0.2651 0.2756 0.0102  0.0043  -0.0128 764 THR A CG2   
3749 N N     . THR A 508 ? 0.3062 0.2212 0.2328 0.0037  -0.0008 0.0036  765 THR A N     
3750 C CA    . THR A 508 ? 0.3127 0.2114 0.2226 0.0005  -0.0046 0.0054  765 THR A CA    
3751 C C     . THR A 508 ? 0.3496 0.2441 0.2452 -0.0126 -0.0009 0.0034  765 THR A C     
3752 O O     . THR A 508 ? 0.3351 0.2417 0.2342 -0.0195 0.0056  -0.0011 765 THR A O     
3753 C CB    . THR A 508 ? 0.3220 0.2021 0.2203 0.0032  -0.0120 0.0069  765 THR A CB    
3754 O OG1   . THR A 508 ? 0.3195 0.1919 0.2042 -0.0046 -0.0108 0.0063  765 THR A OG1   
3755 C CG2   . THR A 508 ? 0.2920 0.1805 0.2090 0.0145  -0.0142 0.0064  765 THR A CG2   
3756 N N     . LEU A 509 ? 0.3517 0.2280 0.2304 -0.0170 -0.0053 0.0054  766 LEU A N     
3757 C CA    . LEU A 509 ? 0.3951 0.2625 0.2565 -0.0324 -0.0018 0.0043  766 LEU A CA    
3758 C C     . LEU A 509 ? 0.3988 0.2614 0.2448 -0.0448 0.0037  0.0034  766 LEU A C     
3759 O O     . LEU A 509 ? 0.3852 0.2581 0.2292 -0.0586 0.0130  -0.0015 766 LEU A O     
3760 C CB    . LEU A 509 ? 0.4576 0.2964 0.2980 -0.0339 -0.0113 0.0082  766 LEU A CB    
3761 C CG    . LEU A 509 ? 0.5418 0.3688 0.3654 -0.0499 -0.0090 0.0078  766 LEU A CG    
3762 C CD1   . LEU A 509 ? 0.5454 0.3899 0.3882 -0.0454 -0.0078 0.0037  766 LEU A CD1   
3763 C CD2   . LEU A 509 ? 0.6077 0.3938 0.3990 -0.0542 -0.0209 0.0132  766 LEU A CD2   
3764 N N     . LEU A 510 ? 0.3840 0.2319 0.2187 -0.0406 -0.0017 0.0065  767 LEU A N     
3765 C CA    . LEU A 510 ? 0.3993 0.2413 0.2160 -0.0517 0.0031  0.0054  767 LEU A CA    
3766 C C     . LEU A 510 ? 0.3677 0.2343 0.2059 -0.0449 0.0079  0.0000  767 LEU A C     
3767 O O     . LEU A 510 ? 0.3635 0.2249 0.1879 -0.0499 0.0096  -0.0015 767 LEU A O     
3768 C CB    . LEU A 510 ? 0.4353 0.2368 0.2154 -0.0544 -0.0083 0.0119  767 LEU A CB    
3769 C CG    . LEU A 510 ? 0.4750 0.2440 0.2265 -0.0634 -0.0155 0.0171  767 LEU A CG    
3770 C CD1   . LEU A 510 ? 0.5173 0.2416 0.2275 -0.0665 -0.0288 0.0230  767 LEU A CD1   
3771 C CD2   . LEU A 510 ? 0.4852 0.2592 0.2271 -0.0844 -0.0028 0.0155  767 LEU A CD2   
3772 N N     . HIS A 511 ? 0.3393 0.2302 0.2087 -0.0339 0.0093  -0.0030 768 HIS A N     
3773 C CA    . HIS A 511 ? 0.3292 0.2446 0.2214 -0.0287 0.0136  -0.0097 768 HIS A CA    
3774 C C     . HIS A 511 ? 0.3156 0.2265 0.2151 -0.0170 0.0069  -0.0072 768 HIS A C     
3775 O O     . HIS A 511 ? 0.2916 0.2144 0.2019 -0.0145 0.0086  -0.0122 768 HIS A O     
3776 C CB    . HIS A 511 ? 0.3610 0.2891 0.2480 -0.0413 0.0231  -0.0186 768 HIS A CB    
3777 C CG    . HIS A 511 ? 0.3937 0.3333 0.2794 -0.0552 0.0319  -0.0246 768 HIS A CG    
3778 N ND1   . HIS A 511 ? 0.4310 0.3795 0.3317 -0.0516 0.0308  -0.0254 768 HIS A ND1   
3779 C CD2   . HIS A 511 ? 0.4601 0.4051 0.3312 -0.0740 0.0428  -0.0316 768 HIS A CD2   
3780 C CE1   . HIS A 511 ? 0.4265 0.3850 0.3244 -0.0668 0.0393  -0.0327 768 HIS A CE1   
3781 N NE2   . HIS A 511 ? 0.4604 0.4175 0.3405 -0.0816 0.0477  -0.0365 768 HIS A NE2   
3782 N N     . ARG A 512 ? 0.3164 0.2104 0.2106 -0.0101 -0.0011 -0.0011 769 ARG A N     
3783 C CA    . ARG A 512 ? 0.3169 0.2116 0.2251 0.0011  -0.0068 -0.0006 769 ARG A CA    
3784 C C     . ARG A 512 ? 0.2966 0.2105 0.2307 0.0077  -0.0038 -0.0009 769 ARG A C     
3785 O O     . ARG A 512 ? 0.2729 0.1929 0.2102 0.0068  -0.0010 0.0001  769 ARG A O     
3786 C CB    . ARG A 512 ? 0.3448 0.2217 0.2455 0.0070  -0.0159 0.0026  769 ARG A CB    
3787 C CG    . ARG A 512 ? 0.3637 0.2389 0.2753 0.0163  -0.0228 0.0004  769 ARG A CG    
3788 C CD    . ARG A 512 ? 0.3769 0.2381 0.2846 0.0232  -0.0329 -0.0004 769 ARG A CD    
3789 N NE    . ARG A 512 ? 0.4036 0.2379 0.2798 0.0183  -0.0404 0.0013  769 ARG A NE    
3790 C CZ    . ARG A 512 ? 0.4130 0.2265 0.2673 0.0169  -0.0483 0.0007  769 ARG A CZ    
3791 N NH1   . ARG A 512 ? 0.4380 0.2569 0.3017 0.0218  -0.0506 -0.0030 769 ARG A NH1   
3792 N NH2   . ARG A 512 ? 0.4584 0.2425 0.2785 0.0102  -0.0552 0.0040  769 ARG A NH2   
3793 N N     . ARG A 513 ? 0.2777 0.1975 0.2274 0.0140  -0.0055 -0.0019 770 ARG A N     
3794 C CA    . ARG A 513 ? 0.2866 0.2183 0.2554 0.0187  -0.0041 -0.0013 770 ARG A CA    
3795 C C     . ARG A 513 ? 0.2772 0.2066 0.2575 0.0242  -0.0068 0.0015  770 ARG A C     
3796 O O     . ARG A 513 ? 0.2862 0.2101 0.2672 0.0260  -0.0105 -0.0004 770 ARG A O     
3797 C CB    . ARG A 513 ? 0.3038 0.2456 0.2800 0.0181  -0.0032 -0.0079 770 ARG A CB    
3798 C CG    . ARG A 513 ? 0.3239 0.2732 0.3174 0.0237  -0.0053 -0.0092 770 ARG A CG    
3799 C CD    . ARG A 513 ? 0.3225 0.2826 0.3232 0.0240  -0.0059 -0.0195 770 ARG A CD    
3800 N NE    . ARG A 513 ? 0.3156 0.2885 0.3138 0.0189  -0.0013 -0.0272 770 ARG A NE    
3801 C CZ    . ARG A 513 ? 0.3084 0.2971 0.3207 0.0217  -0.0027 -0.0384 770 ARG A CZ    
3802 N NH1   . ARG A 513 ? 0.3097 0.2986 0.3367 0.0304  -0.0101 -0.0416 770 ARG A NH1   
3803 N NH2   . ARG A 513 ? 0.2994 0.3034 0.3120 0.0157  0.0028  -0.0479 770 ARG A NH2   
3804 N N     . ARG A 514 ? 0.2578 0.1911 0.2463 0.0260  -0.0049 0.0054  771 ARG A N     
3805 C CA    . ARG A 514 ? 0.2505 0.1837 0.2505 0.0277  -0.0046 0.0078  771 ARG A CA    
3806 C C     . ARG A 514 ? 0.2479 0.1814 0.2533 0.0279  -0.0044 0.0113  771 ARG A C     
3807 O O     . ARG A 514 ? 0.2372 0.1708 0.2359 0.0280  -0.0035 0.0139  771 ARG A O     
3808 C CB    . ARG A 514 ? 0.2521 0.1859 0.2500 0.0277  -0.0020 0.0095  771 ARG A CB    
3809 C CG    . ARG A 514 ? 0.2614 0.1991 0.2727 0.0268  0.0008  0.0095  771 ARG A CG    
3810 C CD    . ARG A 514 ? 0.2708 0.2141 0.2819 0.0270  0.0043  0.0075  771 ARG A CD    
3811 N NE    . ARG A 514 ? 0.2666 0.2182 0.2933 0.0240  0.0088  0.0045  771 ARG A NE    
3812 C CZ    . ARG A 514 ? 0.2744 0.2364 0.3093 0.0246  0.0116  -0.0025 771 ARG A CZ    
3813 N NH1   . ARG A 514 ? 0.2821 0.2446 0.3098 0.0295  0.0086  -0.0065 771 ARG A NH1   
3814 N NH2   . ARG A 514 ? 0.2687 0.2414 0.3207 0.0199  0.0172  -0.0071 771 ARG A NH2   
3815 N N     . TYR A 515 ? 0.2410 0.1723 0.2570 0.0285  -0.0070 0.0107  772 TYR A N     
3816 C CA    . TYR A 515 ? 0.2566 0.1816 0.2752 0.0290  -0.0100 0.0141  772 TYR A CA    
3817 C C     . TYR A 515 ? 0.2611 0.1798 0.2764 0.0241  -0.0054 0.0219  772 TYR A C     
3818 O O     . TYR A 515 ? 0.2402 0.1628 0.2618 0.0204  -0.0006 0.0215  772 TYR A O     
3819 C CB    . TYR A 515 ? 0.2667 0.1889 0.2971 0.0311  -0.0159 0.0099  772 TYR A CB    
3820 C CG    . TYR A 515 ? 0.2655 0.1956 0.2977 0.0354  -0.0196 0.0008  772 TYR A CG    
3821 C CD1   . TYR A 515 ? 0.2736 0.2057 0.3062 0.0393  -0.0241 -0.0030 772 TYR A CD1   
3822 C CD2   . TYR A 515 ? 0.2581 0.1940 0.2900 0.0350  -0.0183 -0.0050 772 TYR A CD2   
3823 C CE1   . TYR A 515 ? 0.2678 0.2124 0.3043 0.0416  -0.0253 -0.0140 772 TYR A CE1   
3824 C CE2   . TYR A 515 ? 0.2704 0.2149 0.3004 0.0361  -0.0189 -0.0138 772 TYR A CE2   
3825 C CZ    . TYR A 515 ? 0.2712 0.2224 0.3053 0.0388  -0.0213 -0.0190 772 TYR A CZ    
3826 O OH    . TYR A 515 ? 0.2713 0.2357 0.3070 0.0387  -0.0203 -0.0305 772 TYR A OH    
3827 N N     . LEU A 516 ? 0.2780 0.1875 0.2828 0.0236  -0.0071 0.0277  773 LEU A N     
3828 C CA    . LEU A 516 ? 0.3153 0.2174 0.3109 0.0166  -0.0010 0.0357  773 LEU A CA    
3829 C C     . LEU A 516 ? 0.3435 0.2252 0.3300 0.0143  -0.0070 0.0427  773 LEU A C     
3830 O O     . LEU A 516 ? 0.3447 0.2145 0.3130 0.0145  -0.0095 0.0486  773 LEU A O     
3831 C CB    . LEU A 516 ? 0.3297 0.2364 0.3119 0.0167  0.0037  0.0375  773 LEU A CB    
3832 C CG    . LEU A 516 ? 0.3255 0.2475 0.3136 0.0185  0.0081  0.0311  773 LEU A CG    
3833 C CD1   . LEU A 516 ? 0.3418 0.2657 0.3167 0.0208  0.0089  0.0318  773 LEU A CD1   
3834 C CD2   . LEU A 516 ? 0.3143 0.2444 0.3122 0.0134  0.0155  0.0287  773 LEU A CD2   
3835 N N     . PRO A 517 ? 0.3599 0.2344 0.3570 0.0120  -0.0105 0.0423  774 PRO A N     
3836 C CA    . PRO A 517 ? 0.4086 0.2570 0.3943 0.0094  -0.0189 0.0496  774 PRO A CA    
3837 C C     . PRO A 517 ? 0.4287 0.2617 0.3946 -0.0036 -0.0110 0.0609  774 PRO A C     
3838 O O     . PRO A 517 ? 0.4405 0.2467 0.3867 -0.0056 -0.0190 0.0690  774 PRO A O     
3839 C CB    . PRO A 517 ? 0.4008 0.2475 0.4052 0.0096  -0.0240 0.0447  774 PRO A CB    
3840 C CG    . PRO A 517 ? 0.3807 0.2493 0.4016 0.0060  -0.0131 0.0391  774 PRO A CG    
3841 C CD    . PRO A 517 ? 0.3485 0.2343 0.3660 0.0117  -0.0089 0.0352  774 PRO A CD    
3842 N N     . ASP A 518 ? 0.4210 0.2709 0.3905 -0.0116 0.0037  0.0602  775 ASP A N     
3843 C CA    . ASP A 518 ? 0.4545 0.2964 0.4064 -0.0262 0.0151  0.0684  775 ASP A CA    
3844 C C     . ASP A 518 ? 0.4573 0.2872 0.3795 -0.0250 0.0141  0.0755  775 ASP A C     
3845 O O     . ASP A 518 ? 0.4720 0.2880 0.3707 -0.0375 0.0216  0.0841  775 ASP A O     
3846 C CB    . ASP A 518 ? 0.4513 0.3209 0.4209 -0.0332 0.0305  0.0607  775 ASP A CB    
3847 C CG    . ASP A 518 ? 0.4845 0.3590 0.4764 -0.0415 0.0340  0.0564  775 ASP A CG    
3848 O OD1   . ASP A 518 ? 0.5313 0.3862 0.5237 -0.0421 0.0247  0.0603  775 ASP A OD1   
3849 O OD2   . ASP A 518 ? 0.4986 0.3968 0.5091 -0.0466 0.0449  0.0475  775 ASP A OD2   
3850 N N     . ILE A 519 ? 0.4390 0.2747 0.3614 -0.0110 0.0054  0.0711  776 ILE A N     
3851 C CA    . ILE A 519 ? 0.4813 0.3106 0.3799 -0.0078 0.0038  0.0749  776 ILE A CA    
3852 C C     . ILE A 519 ? 0.5320 0.3250 0.3981 -0.0115 -0.0053 0.0866  776 ILE A C     
3853 O O     . ILE A 519 ? 0.5751 0.3578 0.4136 -0.0172 -0.0007 0.0933  776 ILE A O     
3854 C CB    . ILE A 519 ? 0.4735 0.3157 0.3819 0.0073  -0.0053 0.0664  776 ILE A CB    
3855 C CG1   . ILE A 519 ? 0.5055 0.3537 0.3986 0.0094  -0.0017 0.0664  776 ILE A CG1   
3856 C CG2   . ILE A 519 ? 0.4667 0.2913 0.3731 0.0168  -0.0230 0.0655  776 ILE A CG2   
3857 C CD1   . ILE A 519 ? 0.4803 0.3557 0.3891 0.0098  0.0087  0.0585  776 ILE A CD1   
3858 N N     . THR A 520 ? 0.5536 0.3254 0.4209 -0.0077 -0.0196 0.0883  777 THR A N     
3859 C CA    . THR A 520 ? 0.6240 0.3540 0.4585 -0.0110 -0.0320 0.0997  777 THR A CA    
3860 C C     . THR A 520 ? 0.6621 0.3719 0.4722 -0.0326 -0.0195 0.1124  777 THR A C     
3861 O O     . THR A 520 ? 0.7337 0.4112 0.5043 -0.0394 -0.0231 0.1240  777 THR A O     
3862 C CB    . THR A 520 ? 0.6283 0.3400 0.4730 -0.0009 -0.0522 0.0962  777 THR A CB    
3863 O OG1   . THR A 520 ? 0.6639 0.3866 0.5346 -0.0068 -0.0461 0.0928  777 THR A OG1   
3864 C CG2   . THR A 520 ? 0.5993 0.3294 0.4632 0.0188  -0.0647 0.0826  777 THR A CG2   
3865 N N     . SER A 521 ? 0.6272 0.3555 0.4603 -0.0438 -0.0052 0.1095  778 SER A N     
3866 C CA    . SER A 521 ? 0.6517 0.3644 0.4705 -0.0665 0.0074  0.1186  778 SER A CA    
3867 C C     . SER A 521 ? 0.7033 0.3859 0.4730 -0.0808 0.0123  0.1326  778 SER A C     
3868 O O     . SER A 521 ? 0.6920 0.3835 0.4461 -0.0766 0.0164  0.1321  778 SER A O     
3869 C CB    . SER A 521 ? 0.6139 0.3679 0.4639 -0.0753 0.0286  0.1087  778 SER A CB    
3870 O OG    . SER A 521 ? 0.6408 0.3881 0.4827 -0.0989 0.0439  0.1140  778 SER A OG    
3871 N N     . ARG A 522 ? 0.7595 0.4050 0.5026 -0.0987 0.0120  0.1451  779 ARG A N     
3872 C CA    . ARG A 522 ? 0.8320 0.4497 0.5249 -0.1167 0.0206  0.1586  779 ARG A CA    
3873 C C     . ARG A 522 ? 0.8390 0.4851 0.5354 -0.1406 0.0513  0.1562  779 ARG A C     
3874 O O     . ARG A 522 ? 0.8794 0.5080 0.5339 -0.1577 0.0624  0.1659  779 ARG A O     
3875 C CB    . ARG A 522 ? 0.9073 0.4624 0.5567 -0.1259 0.0040  0.1753  779 ARG A CB    
3876 C CG    . ARG A 522 ? 0.9424 0.4633 0.5625 -0.1052 -0.0236 0.1797  779 ARG A CG    
3877 C CD    . ARG A 522 ? 0.9280 0.4643 0.5896 -0.0784 -0.0442 0.1663  779 ARG A CD    
3878 N NE    . ARG A 522 ? 0.9474 0.4631 0.6221 -0.0825 -0.0539 0.1677  779 ARG A NE    
3879 C CZ    . ARG A 522 ? 0.9040 0.4393 0.6215 -0.0663 -0.0646 0.1548  779 ARG A CZ    
3880 N NH1   . ARG A 522 ? 0.8415 0.4171 0.5924 -0.0459 -0.0665 0.1398  779 ARG A NH1   
3881 N NH2   . ARG A 522 ? 0.9488 0.4607 0.6730 -0.0720 -0.0735 0.1570  779 ARG A NH2   
3882 N N     . ASN A 523 ? 0.7953 0.4854 0.5405 -0.1414 0.0642  0.1420  780 ASN A N     
3883 C CA    . ASN A 523 ? 0.7770 0.5051 0.5350 -0.1586 0.0919  0.1334  780 ASN A CA    
3884 C C     . ASN A 523 ? 0.7279 0.4896 0.4932 -0.1430 0.0960  0.1231  780 ASN A C     
3885 O O     . ASN A 523 ? 0.6711 0.4534 0.4660 -0.1203 0.0848  0.1134  780 ASN A O     
3886 C CB    . ASN A 523 ? 0.7527 0.5125 0.5603 -0.1639 0.1007  0.1203  780 ASN A CB    
3887 C CG    . ASN A 523 ? 0.7622 0.5672 0.5908 -0.1791 0.1276  0.1064  780 ASN A CG    
3888 O OD1   . ASN A 523 ? 0.7464 0.5858 0.5891 -0.1677 0.1335  0.0945  780 ASN A OD1   
3889 N ND2   . ASN A 523 ? 0.8085 0.6136 0.6401 -0.2052 0.1435  0.1065  780 ASN A ND2   
3890 N N     . PHE A 524 ? 0.7511 0.5161 0.4870 -0.1558 0.1116  0.1253  781 PHE A N     
3891 C CA    . PHE A 524 ? 0.7372 0.5283 0.4743 -0.1418 0.1141  0.1164  781 PHE A CA    
3892 C C     . PHE A 524 ? 0.6749 0.5185 0.4660 -0.1311 0.1213  0.0957  781 PHE A C     
3893 O O     . PHE A 524 ? 0.6146 0.4733 0.4204 -0.1102 0.1114  0.0883  781 PHE A O     
3894 C CB    . PHE A 524 ? 0.8032 0.5908 0.4993 -0.1597 0.1316  0.1207  781 PHE A CB    
3895 C CG    . PHE A 524 ? 0.8063 0.6253 0.5075 -0.1463 0.1359  0.1086  781 PHE A CG    
3896 C CD1   . PHE A 524 ? 0.8253 0.6269 0.5060 -0.1266 0.1176  0.1133  781 PHE A CD1   
3897 C CD2   . PHE A 524 ? 0.7953 0.6624 0.5245 -0.1524 0.1567  0.0906  781 PHE A CD2   
3898 C CE1   . PHE A 524 ? 0.8231 0.6525 0.5099 -0.1142 0.1204  0.1017  781 PHE A CE1   
3899 C CE2   . PHE A 524 ? 0.7858 0.6800 0.5207 -0.1388 0.1584  0.0784  781 PHE A CE2   
3900 C CZ    . PHE A 524 ? 0.7987 0.6729 0.5113 -0.1203 0.1405  0.0848  781 PHE A CZ    
3901 N N     . ASN A 525 ? 0.6561 0.5253 0.4762 -0.1453 0.1370  0.0858  782 ASN A N     
3902 C CA    . ASN A 525 ? 0.6125 0.5297 0.4806 -0.1344 0.1422  0.0645  782 ASN A CA    
3903 C C     . ASN A 525 ? 0.5485 0.4666 0.4474 -0.1136 0.1230  0.0608  782 ASN A C     
3904 O O     . ASN A 525 ? 0.4956 0.4338 0.4137 -0.0955 0.1162  0.0505  782 ASN A O     
3905 C CB    . ASN A 525 ? 0.6383 0.5863 0.5315 -0.1547 0.1637  0.0513  782 ASN A CB    
3906 C CG    . ASN A 525 ? 0.6999 0.6550 0.5643 -0.1765 0.1862  0.0512  782 ASN A CG    
3907 O OD1   . ASN A 525 ? 0.7502 0.7048 0.5893 -0.1703 0.1869  0.0525  782 ASN A OD1   
3908 N ND2   . ASN A 525 ? 0.7448 0.7069 0.6121 -0.2034 0.2054  0.0488  782 ASN A ND2   
3909 N N     . VAL A 526 ? 0.5405 0.4337 0.4402 -0.1169 0.1138  0.0698  783 VAL A N     
3910 C CA    . VAL A 526 ? 0.4968 0.3880 0.4206 -0.0984 0.0958  0.0670  783 VAL A CA    
3911 C C     . VAL A 526 ? 0.4789 0.3594 0.3892 -0.0783 0.0801  0.0708  783 VAL A C     
3912 O O     . VAL A 526 ? 0.4346 0.3339 0.3680 -0.0620 0.0729  0.0610  783 VAL A O     
3913 C CB    . VAL A 526 ? 0.5212 0.3841 0.4436 -0.1055 0.0877  0.0760  783 VAL A CB    
3914 C CG1   . VAL A 526 ? 0.4793 0.3372 0.4188 -0.0850 0.0679  0.0738  783 VAL A CG1   
3915 C CG2   . VAL A 526 ? 0.5243 0.4040 0.4709 -0.1241 0.1023  0.0683  783 VAL A CG2   
3916 N N     . ARG A 527 ? 0.4952 0.3452 0.3675 -0.0802 0.0745  0.0841  784 ARG A N     
3917 C CA    . ARG A 527 ? 0.4963 0.3372 0.3564 -0.0624 0.0597  0.0862  784 ARG A CA    
3918 C C     . ARG A 527 ? 0.4648 0.3340 0.3323 -0.0533 0.0650  0.0760  784 ARG A C     
3919 O O     . ARG A 527 ? 0.4314 0.3082 0.3113 -0.0372 0.0543  0.0707  784 ARG A O     
3920 C CB    . ARG A 527 ? 0.5453 0.3465 0.3611 -0.0659 0.0512  0.1010  784 ARG A CB    
3921 C CG    . ARG A 527 ? 0.5578 0.3525 0.3649 -0.0469 0.0350  0.1003  784 ARG A CG    
3922 C CD    . ARG A 527 ? 0.6276 0.3797 0.3950 -0.0454 0.0196  0.1127  784 ARG A CD    
3923 N NE    . ARG A 527 ? 0.6860 0.4248 0.4136 -0.0567 0.0287  0.1206  784 ARG A NE    
3924 C CZ    . ARG A 527 ? 0.7500 0.4568 0.4408 -0.0748 0.0332  0.1337  784 ARG A CZ    
3925 N NH1   . ARG A 527 ? 0.7860 0.4668 0.4737 -0.0842 0.0284  0.1415  784 ARG A NH1   
3926 N NH2   . ARG A 527 ? 0.8160 0.5160 0.4708 -0.0849 0.0436  0.1388  784 ARG A NH2   
3927 N N     . SER A 528 ? 0.4857 0.3688 0.3438 -0.0643 0.0811  0.0731  785 SER A N     
3928 C CA    . SER A 528 ? 0.4786 0.3876 0.3430 -0.0559 0.0857  0.0621  785 SER A CA    
3929 C C     . SER A 528 ? 0.4304 0.3672 0.3343 -0.0445 0.0829  0.0475  785 SER A C     
3930 O O     . SER A 528 ? 0.4141 0.3588 0.3228 -0.0309 0.0754  0.0419  785 SER A O     
3931 C CB    . SER A 528 ? 0.5155 0.4396 0.3672 -0.0712 0.1054  0.0580  785 SER A CB    
3932 O OG    . SER A 528 ? 0.6033 0.4974 0.4107 -0.0835 0.1083  0.0726  785 SER A OG    
3933 N N     . PHE A 529 ? 0.4336 0.3821 0.3634 -0.0505 0.0876  0.0417  786 PHE A N     
3934 C CA    . PHE A 529 ? 0.3985 0.3669 0.3625 -0.0392 0.0817  0.0288  786 PHE A CA    
3935 C C     . PHE A 529 ? 0.3672 0.3214 0.3316 -0.0247 0.0649  0.0329  786 PHE A C     
3936 O O     . PHE A 529 ? 0.3226 0.2862 0.2961 -0.0129 0.0582  0.0255  786 PHE A O     
3937 C CB    . PHE A 529 ? 0.4175 0.3987 0.4086 -0.0479 0.0878  0.0213  786 PHE A CB    
3938 C CG    . PHE A 529 ? 0.4219 0.4212 0.4445 -0.0351 0.0797  0.0070  786 PHE A CG    
3939 C CD1   . PHE A 529 ? 0.4271 0.4520 0.4658 -0.0292 0.0826  -0.0091 786 PHE A CD1   
3940 C CD2   . PHE A 529 ? 0.4182 0.4063 0.4509 -0.0273 0.0670  0.0092  786 PHE A CD2   
3941 C CE1   . PHE A 529 ? 0.4207 0.4558 0.4833 -0.0162 0.0716  -0.0218 786 PHE A CE1   
3942 C CE2   . PHE A 529 ? 0.4029 0.4025 0.4577 -0.0156 0.0581  -0.0029 786 PHE A CE2   
3943 C CZ    . PHE A 529 ? 0.3888 0.4097 0.4570 -0.0100 0.0595  -0.0178 786 PHE A CZ    
3944 N N     . ALA A 530 ? 0.3606 0.2913 0.3141 -0.0263 0.0576  0.0439  787 ALA A N     
3945 C CA    . ALA A 530 ? 0.3325 0.2530 0.2874 -0.0139 0.0431  0.0457  787 ALA A CA    
3946 C C     . ALA A 530 ? 0.3227 0.2431 0.2638 -0.0049 0.0383  0.0455  787 ALA A C     
3947 O O     . ALA A 530 ? 0.3048 0.2307 0.2548 0.0047  0.0310  0.0403  787 ALA A O     
3948 C CB    . ALA A 530 ? 0.3376 0.2331 0.2824 -0.0165 0.0352  0.0555  787 ALA A CB    
3949 N N     . GLU A 531 ? 0.3552 0.2684 0.2729 -0.0090 0.0424  0.0509  788 GLU A N     
3950 C CA    . GLU A 531 ? 0.3687 0.2812 0.2734 -0.0001 0.0367  0.0499  788 GLU A CA    
3951 C C     . GLU A 531 ? 0.3445 0.2789 0.2639 0.0053  0.0397  0.0387  788 GLU A C     
3952 O O     . GLU A 531 ? 0.3296 0.2652 0.2507 0.0140  0.0319  0.0353  788 GLU A O     
3953 C CB    . GLU A 531 ? 0.4174 0.3166 0.2910 -0.0054 0.0400  0.0573  788 GLU A CB    
3954 C CG    . GLU A 531 ? 0.4527 0.3220 0.3050 -0.0072 0.0308  0.0688  788 GLU A CG    
3955 C CD    . GLU A 531 ? 0.5236 0.3737 0.3384 -0.0154 0.0344  0.0779  788 GLU A CD    
3956 O OE1   . GLU A 531 ? 0.5488 0.4127 0.3556 -0.0216 0.0474  0.0747  788 GLU A OE1   
3957 O OE2   . GLU A 531 ? 0.5444 0.3638 0.3358 -0.0157 0.0236  0.0877  788 GLU A OE2   
3958 N N     . ARG A 532 ? 0.3562 0.3067 0.2863 -0.0002 0.0501  0.0320  789 ARG A N     
3959 C CA    . ARG A 532 ? 0.3645 0.3338 0.3095 0.0062  0.0504  0.0193  789 ARG A CA    
3960 C C     . ARG A 532 ? 0.3405 0.3094 0.3029 0.0137  0.0406  0.0150  789 ARG A C     
3961 O O     . ARG A 532 ? 0.3411 0.3108 0.3043 0.0213  0.0337  0.0101  789 ARG A O     
3962 C CB    . ARG A 532 ? 0.3842 0.3739 0.3399 -0.0007 0.0631  0.0097  789 ARG A CB    
3963 C CG    . ARG A 532 ? 0.4344 0.4255 0.3670 -0.0079 0.0734  0.0122  789 ARG A CG    
3964 C CD    . ARG A 532 ? 0.4525 0.4706 0.3969 -0.0138 0.0870  -0.0019 789 ARG A CD    
3965 N NE    . ARG A 532 ? 0.4638 0.4945 0.4316 -0.0221 0.0942  -0.0076 789 ARG A NE    
3966 C CZ    . ARG A 532 ? 0.5084 0.5351 0.4694 -0.0384 0.1059  -0.0008 789 ARG A CZ    
3967 N NH1   . ARG A 532 ? 0.5927 0.6004 0.5196 -0.0490 0.1120  0.0130  789 ARG A NH1   
3968 N NH2   . ARG A 532 ? 0.5117 0.5522 0.4988 -0.0449 0.1111  -0.0085 789 ARG A NH2   
3969 N N     . MET A 533 ? 0.3341 0.2984 0.3067 0.0108  0.0392  0.0179  790 MET A N     
3970 C CA    . MET A 533 ? 0.3088 0.2706 0.2934 0.0169  0.0301  0.0145  790 MET A CA    
3971 C C     . MET A 533 ? 0.2886 0.2391 0.2619 0.0216  0.0221  0.0192  790 MET A C     
3972 O O     . MET A 533 ? 0.2775 0.2266 0.2524 0.0261  0.0159  0.0150  790 MET A O     
3973 C CB    . MET A 533 ? 0.3363 0.2969 0.3345 0.0129  0.0306  0.0152  790 MET A CB    
3974 C CG    . MET A 533 ? 0.3799 0.3562 0.3955 0.0081  0.0381  0.0067  790 MET A CG    
3975 S SD    . MET A 533 ? 0.4703 0.4609 0.5000 0.0179  0.0327  -0.0093 790 MET A SD    
3976 C CE    . MET A 533 ? 0.4484 0.4501 0.4679 0.0176  0.0401  -0.0132 790 MET A CE    
3977 N N     . ALA A 534 ? 0.2778 0.2196 0.2381 0.0200  0.0217  0.0266  791 ALA A N     
3978 C CA    . ALA A 534 ? 0.2807 0.2164 0.2341 0.0245  0.0145  0.0277  791 ALA A CA    
3979 C C     . ALA A 534 ? 0.2932 0.2331 0.2407 0.0279  0.0132  0.0233  791 ALA A C     
3980 O O     . ALA A 534 ? 0.2774 0.2162 0.2255 0.0299  0.0082  0.0203  791 ALA A O     
3981 C CB    . ALA A 534 ? 0.2853 0.2100 0.2267 0.0243  0.0114  0.0343  791 ALA A CB    
3982 N N     . MET A 535 ? 0.3078 0.2524 0.2493 0.0273  0.0182  0.0221  792 MET A N     
3983 C CA    . MET A 535 ? 0.3309 0.2787 0.2666 0.0313  0.0160  0.0170  792 MET A CA    
3984 C C     . MET A 535 ? 0.3205 0.2709 0.2659 0.0340  0.0124  0.0095  792 MET A C     
3985 O O     . MET A 535 ? 0.3589 0.3041 0.3002 0.0362  0.0063  0.0069  792 MET A O     
3986 C CB    . MET A 535 ? 0.3438 0.2979 0.2705 0.0301  0.0231  0.0159  792 MET A CB    
3987 C CG    . MET A 535 ? 0.3907 0.3359 0.2985 0.0273  0.0248  0.0242  792 MET A CG    
3988 S SD    . MET A 535 ? 0.4447 0.3967 0.3357 0.0231  0.0355  0.0228  792 MET A SD    
3989 C CE    . MET A 535 ? 0.4765 0.4120 0.3485 0.0131  0.0404  0.0358  792 MET A CE    
3990 N N     . ASN A 536 ? 0.3022 0.2587 0.2593 0.0334  0.0151  0.0056  793 ASN A N     
3991 C CA    . ASN A 536 ? 0.3050 0.2624 0.2702 0.0380  0.0094  -0.0033 793 ASN A CA    
3992 C C     . ASN A 536 ? 0.2922 0.2377 0.2583 0.0383  0.0016  -0.0023 793 ASN A C     
3993 O O     . ASN A 536 ? 0.2831 0.2192 0.2449 0.0418  -0.0070 -0.0069 793 ASN A O     
3994 C CB    . ASN A 536 ? 0.3034 0.2753 0.2838 0.0378  0.0148  -0.0108 793 ASN A CB    
3995 C CG    . ASN A 536 ? 0.3344 0.3080 0.3247 0.0452  0.0062  -0.0230 793 ASN A CG    
3996 O OD1   . ASN A 536 ? 0.3317 0.3043 0.3334 0.0469  0.0017  -0.0272 793 ASN A OD1   
3997 N ND2   . ASN A 536 ? 0.3673 0.3414 0.3527 0.0509  0.0016  -0.0301 793 ASN A ND2   
3998 N N     . THR A 537 ? 0.2738 0.2178 0.2434 0.0346  0.0038  0.0030  794 THR A N     
3999 C CA    . THR A 537 ? 0.2739 0.2083 0.2427 0.0343  -0.0022 0.0030  794 THR A CA    
4000 C C     . THR A 537 ? 0.2710 0.1933 0.2245 0.0323  -0.0071 0.0045  794 THR A C     
4001 O O     . THR A 537 ? 0.2940 0.2040 0.2401 0.0326  -0.0141 0.0020  794 THR A O     
4002 C CB    . THR A 537 ? 0.2816 0.2183 0.2584 0.0313  0.0009  0.0069  794 THR A CB    
4003 O OG1   . THR A 537 ? 0.2899 0.2354 0.2810 0.0314  0.0045  0.0040  794 THR A OG1   
4004 C CG2   . THR A 537 ? 0.2770 0.2045 0.2503 0.0308  -0.0049 0.0056  794 THR A CG2   
4005 N N     . PRO A 538 ? 0.2646 0.1889 0.2122 0.0295  -0.0043 0.0076  795 PRO A N     
4006 C CA    . PRO A 538 ? 0.2781 0.1930 0.2137 0.0254  -0.0077 0.0071  795 PRO A CA    
4007 C C     . PRO A 538 ? 0.3028 0.2060 0.2287 0.0275  -0.0146 0.0037  795 PRO A C     
4008 O O     . PRO A 538 ? 0.3267 0.2145 0.2387 0.0224  -0.0193 0.0038  795 PRO A O     
4009 C CB    . PRO A 538 ? 0.2741 0.1975 0.2105 0.0237  -0.0042 0.0084  795 PRO A CB    
4010 C CG    . PRO A 538 ? 0.2634 0.1952 0.2090 0.0264  -0.0006 0.0112  795 PRO A CG    
4011 C CD    . PRO A 538 ? 0.2634 0.1962 0.2139 0.0294  0.0007  0.0112  795 PRO A CD    
4012 N N     . ILE A 539 ? 0.2912 0.2004 0.2234 0.0344  -0.0155 -0.0002 796 ILE A N     
4013 C CA    . ILE A 539 ? 0.3055 0.2043 0.2311 0.0389  -0.0242 -0.0060 796 ILE A CA    
4014 C C     . ILE A 539 ? 0.3132 0.1993 0.2378 0.0426  -0.0335 -0.0101 796 ILE A C     
4015 O O     . ILE A 539 ? 0.3134 0.1762 0.2211 0.0405  -0.0433 -0.0097 796 ILE A O     
4016 C CB    . ILE A 539 ? 0.3043 0.2180 0.2385 0.0455  -0.0215 -0.0118 796 ILE A CB    
4017 C CG1   . ILE A 539 ? 0.3094 0.2312 0.2396 0.0425  -0.0147 -0.0073 796 ILE A CG1   
4018 C CG2   . ILE A 539 ? 0.3192 0.2224 0.2494 0.0522  -0.0329 -0.0206 796 ILE A CG2   
4019 C CD1   . ILE A 539 ? 0.3305 0.2670 0.2640 0.0471  -0.0096 -0.0114 796 ILE A CD1   
4020 N N     . GLN A 540 ? 0.2591 0.2530 0.2340 0.0219  -0.0024 0.0588  797 GLN A N     
4021 C CA    . GLN A 540 ? 0.2780 0.2683 0.2629 0.0173  -0.0009 0.0571  797 GLN A CA    
4022 C C     . GLN A 540 ? 0.2672 0.2457 0.2594 0.0130  -0.0066 0.0468  797 GLN A C     
4023 O O     . GLN A 540 ? 0.2472 0.2230 0.2381 0.0107  -0.0064 0.0388  797 GLN A O     
4024 C CB    . GLN A 540 ? 0.3304 0.3242 0.3310 0.0153  0.0019  0.0727  797 GLN A CB    
4025 C CG    . GLN A 540 ? 0.4002 0.4091 0.3928 0.0211  0.0104  0.0840  797 GLN A CG    
4026 C CD    . GLN A 540 ? 0.5063 0.5221 0.5038 0.0207  0.0164  0.0867  797 GLN A CD    
4027 O OE1   . GLN A 540 ? 0.5705 0.5827 0.5881 0.0141  0.0143  0.0907  797 GLN A OE1   
4028 N NE2   . GLN A 540 ? 0.5349 0.5601 0.5143 0.0284  0.0229  0.0843  797 GLN A NE2   
4029 N N     . GLY A 541 ? 0.2515 0.2233 0.2498 0.0133  -0.0114 0.0471  798 GLY A N     
4030 C CA    . GLY A 541 ? 0.2446 0.2058 0.2472 0.0121  -0.0161 0.0373  798 GLY A CA    
4031 C C     . GLY A 541 ? 0.2425 0.2064 0.2349 0.0136  -0.0156 0.0263  798 GLY A C     
4032 O O     . GLY A 541 ? 0.2413 0.2004 0.2335 0.0126  -0.0164 0.0184  798 GLY A O     
4033 N N     . SER A 542 ? 0.2358 0.2077 0.2201 0.0161  -0.0148 0.0264  799 SER A N     
4034 C CA    . SER A 542 ? 0.2225 0.1980 0.2011 0.0162  -0.0153 0.0177  799 SER A CA    
4035 C C     . SER A 542 ? 0.2234 0.1994 0.1966 0.0133  -0.0129 0.0129  799 SER A C     
4036 O O     . SER A 542 ? 0.2151 0.1903 0.1889 0.0118  -0.0131 0.0066  799 SER A O     
4037 C CB    . SER A 542 ? 0.2269 0.2098 0.2004 0.0188  -0.0179 0.0188  799 SER A CB    
4038 O OG    . SER A 542 ? 0.2165 0.1992 0.1962 0.0219  -0.0204 0.0231  799 SER A OG    
4039 N N     . ALA A 543 ? 0.2142 0.1925 0.1830 0.0136  -0.0102 0.0169  800 ALA A N     
4040 C CA    . ALA A 543 ? 0.2204 0.1985 0.1854 0.0121  -0.0077 0.0132  800 ALA A CA    
4041 C C     . ALA A 543 ? 0.2213 0.1934 0.1946 0.0085  -0.0076 0.0113  800 ALA A C     
4042 O O     . ALA A 543 ? 0.2029 0.1736 0.1742 0.0068  -0.0075 0.0056  800 ALA A O     
4043 C CB    . ALA A 543 ? 0.2141 0.1974 0.1735 0.0152  -0.0035 0.0194  800 ALA A CB    
4044 N N     . ALA A 544 ? 0.2167 0.1846 0.1991 0.0076  -0.0090 0.0159  801 ALA A N     
4045 C CA    . ALA A 544 ? 0.2288 0.1891 0.2173 0.0051  -0.0116 0.0127  801 ALA A CA    
4046 C C     . ALA A 544 ? 0.2299 0.1872 0.2142 0.0066  -0.0133 0.0044  801 ALA A C     
4047 O O     . ALA A 544 ? 0.2343 0.1895 0.2161 0.0054  -0.0133 -0.0005 801 ALA A O     
4048 C CB    . ALA A 544 ? 0.2342 0.1880 0.2347 0.0038  -0.0155 0.0190  801 ALA A CB    
4049 N N     . ASP A 545 ? 0.2321 0.1906 0.2157 0.0097  -0.0141 0.0038  802 ASP A N     
4050 C CA    . ASP A 545 ? 0.2386 0.1979 0.2198 0.0125  -0.0140 -0.0021 802 ASP A CA    
4051 C C     . ASP A 545 ? 0.2321 0.1978 0.2092 0.0103  -0.0113 -0.0049 802 ASP A C     
4052 O O     . ASP A 545 ? 0.2122 0.1776 0.1873 0.0111  -0.0102 -0.0083 802 ASP A O     
4053 C CB    . ASP A 545 ? 0.2595 0.2235 0.2428 0.0162  -0.0144 -0.0005 802 ASP A CB    
4054 C CG    . ASP A 545 ? 0.2875 0.2439 0.2759 0.0197  -0.0177 0.0017  802 ASP A CG    
4055 O OD1   . ASP A 545 ? 0.2831 0.2286 0.2738 0.0197  -0.0208 0.0003  802 ASP A OD1   
4056 O OD2   . ASP A 545 ? 0.3001 0.2609 0.2912 0.0227  -0.0183 0.0048  802 ASP A OD2   
4057 N N     . ILE A 546 ? 0.2197 0.1904 0.1950 0.0082  -0.0109 -0.0031 803 ILE A N     
4058 C CA    . ILE A 546 ? 0.2180 0.1925 0.1916 0.0058  -0.0105 -0.0054 803 ILE A CA    
4059 C C     . ILE A 546 ? 0.2236 0.1942 0.1955 0.0036  -0.0091 -0.0071 803 ILE A C     
4060 O O     . ILE A 546 ? 0.2082 0.1805 0.1810 0.0024  -0.0083 -0.0084 803 ILE A O     
4061 C CB    . ILE A 546 ? 0.2217 0.1988 0.1915 0.0052  -0.0126 -0.0051 803 ILE A CB    
4062 C CG1   . ILE A 546 ? 0.2318 0.2142 0.2039 0.0071  -0.0156 -0.0034 803 ILE A CG1   
4063 C CG2   . ILE A 546 ? 0.2206 0.1973 0.1896 0.0023  -0.0141 -0.0083 803 ILE A CG2   
4064 C CD1   . ILE A 546 ? 0.2430 0.2263 0.2073 0.0084  -0.0190 -0.0034 803 ILE A CD1   
4065 N N     . ILE A 547 ? 0.2294 0.1965 0.2006 0.0032  -0.0086 -0.0055 804 ILE A N     
4066 C CA    . ILE A 547 ? 0.2476 0.2119 0.2186 0.0013  -0.0079 -0.0066 804 ILE A CA    
4067 C C     . ILE A 547 ? 0.2329 0.1933 0.2044 0.0017  -0.0092 -0.0086 804 ILE A C     
4068 O O     . ILE A 547 ? 0.2210 0.1810 0.1907 0.0008  -0.0089 -0.0100 804 ILE A O     
4069 C CB    . ILE A 547 ? 0.2750 0.2391 0.2478 0.0012  -0.0067 -0.0032 804 ILE A CB    
4070 C CG1   . ILE A 547 ? 0.3034 0.2659 0.2773 -0.0003 -0.0064 -0.0042 804 ILE A CG1   
4071 C CG2   . ILE A 547 ? 0.2756 0.2377 0.2550 0.0010  -0.0079 0.0013  804 ILE A CG2   
4072 C CD1   . ILE A 547 ? 0.2952 0.2607 0.2701 0.0012  -0.0035 -0.0012 804 ILE A CD1   
4073 N N     . LYS A 548 ? 0.2222 0.1793 0.1948 0.0041  -0.0111 -0.0091 805 LYS A N     
4074 C CA    . LYS A 548 ? 0.2264 0.1784 0.1954 0.0070  -0.0132 -0.0132 805 LYS A CA    
4075 C C     . LYS A 548 ? 0.2296 0.1881 0.1939 0.0096  -0.0097 -0.0145 805 LYS A C     
4076 O O     . LYS A 548 ? 0.2172 0.1753 0.1762 0.0111  -0.0093 -0.0161 805 LYS A O     
4077 C CB    . LYS A 548 ? 0.2357 0.1804 0.2064 0.0104  -0.0171 -0.0146 805 LYS A CB    
4078 C CG    . LYS A 548 ? 0.2399 0.1776 0.2187 0.0070  -0.0219 -0.0114 805 LYS A CG    
4079 C CD    . LYS A 548 ? 0.2695 0.1976 0.2523 0.0099  -0.0273 -0.0123 805 LYS A CD    
4080 C CE    . LYS A 548 ? 0.3004 0.2193 0.2943 0.0057  -0.0348 -0.0091 805 LYS A CE    
4081 N NZ    . LYS A 548 ? 0.3368 0.2439 0.3366 0.0082  -0.0417 -0.0097 805 LYS A NZ    
4082 N N     . LYS A 549 ? 0.2329 0.1988 0.2004 0.0102  -0.0072 -0.0125 806 LYS A N     
4083 C CA    . LYS A 549 ? 0.2430 0.2181 0.2114 0.0114  -0.0036 -0.0107 806 LYS A CA    
4084 C C     . LYS A 549 ? 0.2419 0.2192 0.2113 0.0067  -0.0028 -0.0085 806 LYS A C     
4085 O O     . LYS A 549 ? 0.2339 0.2160 0.2019 0.0081  0.0000  -0.0064 806 LYS A O     
4086 C CB    . LYS A 549 ? 0.2595 0.2430 0.2354 0.0116  -0.0030 -0.0078 806 LYS A CB    
4087 C CG    . LYS A 549 ? 0.2948 0.2903 0.2753 0.0140  0.0012  -0.0040 806 LYS A CG    
4088 C CD    . LYS A 549 ? 0.3350 0.3407 0.3262 0.0141  0.0009  -0.0001 806 LYS A CD    
4089 C CE    . LYS A 549 ? 0.3492 0.3701 0.3504 0.0147  0.0054  0.0069  806 LYS A CE    
4090 N NZ    . LYS A 549 ? 0.2999 0.3222 0.3064 0.0072  0.0042  0.0109  806 LYS A NZ    
4091 N N     . ALA A 550 ? 0.2179 0.1917 0.1892 0.0021  -0.0050 -0.0086 807 ALA A N     
4092 C CA    . ALA A 550 ? 0.2299 0.2030 0.2026 -0.0016 -0.0054 -0.0074 807 ALA A CA    
4093 C C     . ALA A 550 ? 0.2381 0.2081 0.2062 -0.0007 -0.0047 -0.0075 807 ALA A C     
4094 O O     . ALA A 550 ? 0.2357 0.2081 0.2049 -0.0021 -0.0037 -0.0044 807 ALA A O     
4095 C CB    . ALA A 550 ? 0.2093 0.1777 0.1816 -0.0035 -0.0076 -0.0091 807 ALA A CB    
4096 N N     . MET A 551 ? 0.2255 0.1899 0.1895 0.0015  -0.0065 -0.0103 808 MET A N     
4097 C CA    . MET A 551 ? 0.2313 0.1916 0.1903 0.0025  -0.0084 -0.0113 808 MET A CA    
4098 C C     . MET A 551 ? 0.2421 0.2061 0.1937 0.0071  -0.0063 -0.0110 808 MET A C     
4099 O O     . MET A 551 ? 0.2480 0.2133 0.1958 0.0073  -0.0059 -0.0087 808 MET A O     
4100 C CB    . MET A 551 ? 0.2498 0.2026 0.2090 0.0032  -0.0131 -0.0141 808 MET A CB    
4101 C CG    . MET A 551 ? 0.2526 0.2049 0.2199 -0.0006 -0.0136 -0.0116 808 MET A CG    
4102 S SD    . MET A 551 ? 0.2804 0.2266 0.2549 -0.0015 -0.0189 -0.0108 808 MET A SD    
4103 C CE    . MET A 551 ? 0.2526 0.1937 0.2262 -0.0021 -0.0254 -0.0125 808 MET A CE    
4104 N N     . ILE A 552 ? 0.2472 0.2140 0.1963 0.0118  -0.0044 -0.0124 809 ILE A N     
4105 C CA    . ILE A 552 ? 0.2512 0.2245 0.1926 0.0186  -0.0005 -0.0114 809 ILE A CA    
4106 C C     . ILE A 552 ? 0.2501 0.2354 0.1978 0.0161  0.0050  -0.0028 809 ILE A C     
4107 O O     . ILE A 552 ? 0.2519 0.2417 0.1933 0.0191  0.0077  0.0010  809 ILE A O     
4108 C CB    . ILE A 552 ? 0.2617 0.2361 0.2009 0.0254  0.0009  -0.0145 809 ILE A CB    
4109 C CG1   . ILE A 552 ? 0.2834 0.2431 0.2168 0.0281  -0.0064 -0.0226 809 ILE A CG1   
4110 C CG2   . ILE A 552 ? 0.2805 0.2652 0.2118 0.0346  0.0073  -0.0122 809 ILE A CG2   
4111 C CD1   . ILE A 552 ? 0.2916 0.2494 0.2271 0.0330  -0.0066 -0.0253 809 ILE A CD1   
4112 N N     . ASP A 553 ? 0.2399 0.2294 0.2002 0.0105  0.0055  0.0006  810 ASP A N     
4113 C CA    . ASP A 553 ? 0.2455 0.2443 0.2166 0.0062  0.0079  0.0090  810 ASP A CA    
4114 C C     . ASP A 553 ? 0.2406 0.2344 0.2116 0.0020  0.0060  0.0114  810 ASP A C     
4115 O O     . ASP A 553 ? 0.2233 0.2241 0.1976 0.0015  0.0089  0.0195  810 ASP A O     
4116 C CB    . ASP A 553 ? 0.2391 0.2390 0.2231 0.0005  0.0049  0.0095  810 ASP A CB    
4117 C CG    . ASP A 553 ? 0.2787 0.2871 0.2672 0.0041  0.0070  0.0102  810 ASP A CG    
4118 O OD1   . ASP A 553 ? 0.3090 0.3245 0.2926 0.0118  0.0122  0.0114  810 ASP A OD1   
4119 O OD2   . ASP A 553 ? 0.3179 0.3262 0.3146 0.0002  0.0030  0.0095  810 ASP A OD2   
4120 N N     . LEU A 554 ? 0.2381 0.2209 0.2064 -0.0006 0.0014  0.0057  811 LEU A N     
4121 C CA    . LEU A 554 ? 0.2402 0.2181 0.2091 -0.0035 -0.0007 0.0076  811 LEU A CA    
4122 C C     . LEU A 554 ? 0.2656 0.2449 0.2247 0.0006  0.0005  0.0102  811 LEU A C     
4123 O O     . LEU A 554 ? 0.2484 0.2303 0.2103 -0.0009 0.0013  0.0172  811 LEU A O     
4124 C CB    . LEU A 554 ? 0.2507 0.2191 0.2192 -0.0052 -0.0047 0.0017  811 LEU A CB    
4125 C CG    . LEU A 554 ? 0.2531 0.2164 0.2239 -0.0072 -0.0070 0.0032  811 LEU A CG    
4126 C CD1   . LEU A 554 ? 0.2377 0.2013 0.2177 -0.0109 -0.0076 0.0082  811 LEU A CD1   
4127 C CD2   . LEU A 554 ? 0.2622 0.2198 0.2336 -0.0070 -0.0090 -0.0017 811 LEU A CD2   
4128 N N     . ASN A 555 ? 0.2622 0.2387 0.2094 0.0062  -0.0006 0.0045  812 ASN A N     
4129 C CA    . ASN A 555 ? 0.2732 0.2501 0.2072 0.0119  -0.0011 0.0051  812 ASN A CA    
4130 C C     . ASN A 555 ? 0.2739 0.2636 0.2053 0.0159  0.0060  0.0142  812 ASN A C     
4131 O O     . ASN A 555 ? 0.2516 0.2442 0.1778 0.0174  0.0067  0.0203  812 ASN A O     
4132 C CB    . ASN A 555 ? 0.3068 0.2771 0.2287 0.0181  -0.0049 -0.0040 812 ASN A CB    
4133 C CG    . ASN A 555 ? 0.3685 0.3373 0.2728 0.0258  -0.0073 -0.0059 812 ASN A CG    
4134 O OD1   . ASN A 555 ? 0.4206 0.3825 0.3217 0.0244  -0.0141 -0.0079 812 ASN A OD1   
4135 N ND2   . ASN A 555 ? 0.4002 0.3757 0.2923 0.0350  -0.0023 -0.0057 812 ASN A ND2   
4136 N N     . ALA A 556 ? 0.2631 0.2619 0.1998 0.0176  0.0114  0.0168  813 ALA A N     
4137 C CA    . ALA A 556 ? 0.2829 0.2976 0.2210 0.0218  0.0195  0.0280  813 ALA A CA    
4138 C C     . ALA A 556 ? 0.2719 0.2911 0.2267 0.0131  0.0201  0.0399  813 ALA A C     
4139 O O     . ALA A 556 ? 0.2713 0.2991 0.2243 0.0153  0.0242  0.0506  813 ALA A O     
4140 C CB    . ALA A 556 ? 0.2816 0.3067 0.2264 0.0251  0.0248  0.0291  813 ALA A CB    
4141 N N     . ARG A 557 ? 0.2678 0.2802 0.2379 0.0041  0.0152  0.0379  814 ARG A N     
4142 C CA    . ARG A 557 ? 0.2760 0.2882 0.2629 -0.0042 0.0130  0.0469  814 ARG A CA    
4143 C C     . ARG A 557 ? 0.2561 0.2611 0.2382 -0.0050 0.0102  0.0494  814 ARG A C     
4144 O O     . ARG A 557 ? 0.2387 0.2487 0.2302 -0.0078 0.0115  0.0616  814 ARG A O     
4145 C CB    . ARG A 557 ? 0.3060 0.3089 0.3051 -0.0113 0.0065  0.0406  814 ARG A CB    
4146 C CG    . ARG A 557 ? 0.3745 0.3869 0.3879 -0.0140 0.0073  0.0445  814 ARG A CG    
4147 C CD    . ARG A 557 ? 0.4166 0.4435 0.4462 -0.0166 0.0113  0.0608  814 ARG A CD    
4148 N NE    . ARG A 557 ? 0.4605 0.4797 0.5037 -0.0245 0.0052  0.0668  814 ARG A NE    
4149 C CZ    . ARG A 557 ? 0.5040 0.5148 0.5633 -0.0324 -0.0037 0.0652  814 ARG A CZ    
4150 N NH1   . ARG A 557 ? 0.4853 0.4960 0.5484 -0.0336 -0.0073 0.0585  814 ARG A NH1   
4151 N NH2   . ARG A 557 ? 0.5073 0.5086 0.5782 -0.0384 -0.0101 0.0700  814 ARG A NH2   
4152 N N     . LEU A 558 ? 0.2445 0.2386 0.2143 -0.0027 0.0061  0.0392  815 LEU A N     
4153 C CA    . LEU A 558 ? 0.2615 0.2497 0.2272 -0.0027 0.0028  0.0414  815 LEU A CA    
4154 C C     . LEU A 558 ? 0.2755 0.2736 0.2308 0.0031  0.0072  0.0512  815 LEU A C     
4155 O O     . LEU A 558 ? 0.2805 0.2789 0.2401 0.0012  0.0065  0.0606  815 LEU A O     
4156 C CB    . LEU A 558 ? 0.2594 0.2370 0.2159 -0.0009 -0.0026 0.0300  815 LEU A CB    
4157 C CG    . LEU A 558 ? 0.2581 0.2271 0.2236 -0.0053 -0.0061 0.0225  815 LEU A CG    
4158 C CD1   . LEU A 558 ? 0.2655 0.2286 0.2242 -0.0030 -0.0100 0.0142  815 LEU A CD1   
4159 C CD2   . LEU A 558 ? 0.2506 0.2137 0.2284 -0.0098 -0.0088 0.0264  815 LEU A CD2   
4160 N N     . LYS A 559 ? 0.3023 0.3082 0.2431 0.0111  0.0117  0.0492  816 LYS A N     
4161 C CA    . LYS A 559 ? 0.3516 0.3689 0.2782 0.0195  0.0173  0.0582  816 LYS A CA    
4162 C C     . LYS A 559 ? 0.3379 0.3711 0.2796 0.0173  0.0253  0.0761  816 LYS A C     
4163 O O     . LYS A 559 ? 0.3220 0.3619 0.2620 0.0189  0.0278  0.0889  816 LYS A O     
4164 C CB    . LYS A 559 ? 0.4026 0.4233 0.3077 0.0312  0.0200  0.0498  816 LYS A CB    
4165 C CG    . LYS A 559 ? 0.4764 0.4815 0.3663 0.0341  0.0105  0.0343  816 LYS A CG    
4166 C CD    . LYS A 559 ? 0.5780 0.5824 0.4467 0.0460  0.0109  0.0243  816 LYS A CD    
4167 C CE    . LYS A 559 ? 0.6270 0.6139 0.4848 0.0470  -0.0016 0.0096  816 LYS A CE    
4168 N NZ    . LYS A 559 ? 0.6961 0.6771 0.5333 0.0588  -0.0045 -0.0024 816 LYS A NZ    
4169 N N     . GLU A 560 ? 0.3282 0.3683 0.2860 0.0136  0.0287  0.0785  817 GLU A N     
4170 C CA    . GLU A 560 ? 0.3618 0.4172 0.3413 0.0089  0.0344  0.0969  817 GLU A CA    
4171 C C     . GLU A 560 ? 0.3513 0.3996 0.3481 -0.0008 0.0289  0.1064  817 GLU A C     
4172 O O     . GLU A 560 ? 0.3458 0.4063 0.3526 -0.0017 0.0336  0.1249  817 GLU A O     
4173 C CB    . GLU A 560 ? 0.4109 0.4706 0.4099 0.0034  0.0345  0.0960  817 GLU A CB    
4174 C CG    . GLU A 560 ? 0.4857 0.5591 0.4779 0.0124  0.0423  0.0942  817 GLU A CG    
4175 C CD    . GLU A 560 ? 0.5632 0.6343 0.5728 0.0057  0.0381  0.0882  817 GLU A CD    
4176 O OE1   . GLU A 560 ? 0.6085 0.6817 0.6437 -0.0048 0.0344  0.0972  817 GLU A OE1   
4177 O OE2   . GLU A 560 ? 0.6647 0.7294 0.6627 0.0103  0.0367  0.0741  817 GLU A OE2   
4178 N N     . GLU A 561 ? 0.3248 0.3538 0.3248 -0.0070 0.0193  0.0946  818 GLU A N     
4179 C CA    . GLU A 561 ? 0.3443 0.3627 0.3606 -0.0153 0.0125  0.1005  818 GLU A CA    
4180 C C     . GLU A 561 ? 0.3476 0.3610 0.3519 -0.0117 0.0108  0.1037  818 GLU A C     
4181 O O     . GLU A 561 ? 0.3337 0.3373 0.3505 -0.0171 0.0051  0.1087  818 GLU A O     
4182 C CB    . GLU A 561 ? 0.3555 0.3557 0.3780 -0.0208 0.0036  0.0855  818 GLU A CB    
4183 C CG    . GLU A 561 ? 0.3729 0.3747 0.4084 -0.0254 0.0020  0.0818  818 GLU A CG    
4184 C CD    . GLU A 561 ? 0.4535 0.4595 0.5155 -0.0337 -0.0006 0.0960  818 GLU A CD    
4185 O OE1   . GLU A 561 ? 0.5436 0.5451 0.6150 -0.0371 -0.0034 0.1060  818 GLU A OE1   
4186 O OE2   . GLU A 561 ? 0.4765 0.4910 0.5515 -0.0369 -0.0003 0.0984  818 GLU A OE2   
4187 N N     . ARG A 562 ? 0.3404 0.3591 0.3204 -0.0022 0.0145  0.0997  819 ARG A N     
4188 C CA    . ARG A 562 ? 0.3364 0.3524 0.3019 0.0027  0.0122  0.1021  819 ARG A CA    
4189 C C     . ARG A 562 ? 0.3318 0.3299 0.3010 -0.0014 0.0026  0.0923  819 ARG A C     
4190 O O     . ARG A 562 ? 0.3477 0.3421 0.3182 -0.0016 -0.0007 0.0994  819 ARG A O     
4191 C CB    . ARG A 562 ? 0.3440 0.3712 0.3180 0.0021  0.0167  0.1239  819 ARG A CB    
4192 C CG    . ARG A 562 ? 0.3484 0.3969 0.3257 0.0054  0.0277  0.1382  819 ARG A CG    
4193 C CD    . ARG A 562 ? 0.3482 0.4053 0.2961 0.0185  0.0333  0.1301  819 ARG A CD    
4194 N NE    . ARG A 562 ? 0.3494 0.4299 0.2923 0.0269  0.0458  0.1463  819 ARG A NE    
4195 C CZ    . ARG A 562 ? 0.3481 0.4401 0.2802 0.0356  0.0535  0.1418  819 ARG A CZ    
4196 N NH1   . ARG A 562 ? 0.3429 0.4241 0.2699 0.0358  0.0492  0.1223  819 ARG A NH1   
4197 N NH2   . ARG A 562 ? 0.3677 0.4832 0.2942 0.0453  0.0660  0.1580  819 ARG A NH2   
4198 N N     . LEU A 563 ? 0.3081 0.2966 0.2794 -0.0038 -0.0011 0.0774  820 LEU A N     
4199 C CA    . LEU A 563 ? 0.3170 0.2915 0.2918 -0.0059 -0.0084 0.0684  820 LEU A CA    
4200 C C     . LEU A 563 ? 0.3234 0.2963 0.2805 0.0001  -0.0118 0.0600  820 LEU A C     
4201 O O     . LEU A 563 ? 0.3190 0.2971 0.2612 0.0050  -0.0098 0.0554  820 LEU A O     
4202 C CB    . LEU A 563 ? 0.3051 0.2720 0.2899 -0.0101 -0.0102 0.0579  820 LEU A CB    
4203 C CG    . LEU A 563 ? 0.3108 0.2743 0.3145 -0.0166 -0.0113 0.0635  820 LEU A CG    
4204 C CD1   . LEU A 563 ? 0.3157 0.2757 0.3231 -0.0189 -0.0122 0.0529  820 LEU A CD1   
4205 C CD2   . LEU A 563 ? 0.3257 0.2770 0.3405 -0.0189 -0.0173 0.0664  820 LEU A CD2   
4206 N N     . GLN A 564 ? 0.3358 0.3013 0.2958 -0.0001 -0.0177 0.0587  821 GLN A N     
4207 C CA    . GLN A 564 ? 0.3380 0.3012 0.2875 0.0037  -0.0234 0.0510  821 GLN A CA    
4208 C C     . GLN A 564 ? 0.3393 0.2970 0.2943 0.0018  -0.0254 0.0389  821 GLN A C     
4209 O O     . GLN A 564 ? 0.3658 0.3221 0.3155 0.0037  -0.0306 0.0327  821 GLN A O     
4210 C CB    . GLN A 564 ? 0.3634 0.3237 0.3160 0.0047  -0.0290 0.0570  821 GLN A CB    
4211 C CG    . GLN A 564 ? 0.3806 0.3473 0.3266 0.0073  -0.0271 0.0709  821 GLN A CG    
4212 C CD    . GLN A 564 ? 0.4107 0.3745 0.3590 0.0089  -0.0336 0.0772  821 GLN A CD    
4213 O OE1   . GLN A 564 ? 0.4495 0.4119 0.4085 0.0070  -0.0329 0.0886  821 GLN A OE1   
4214 N NE2   . GLN A 564 ? 0.3960 0.3587 0.3360 0.0121  -0.0409 0.0706  821 GLN A NE2   
4215 N N     . ALA A 565 ? 0.3088 0.2634 0.2753 -0.0020 -0.0223 0.0364  822 ALA A N     
4216 C CA    . ALA A 565 ? 0.2944 0.2457 0.2656 -0.0030 -0.0227 0.0271  822 ALA A CA    
4217 C C     . ALA A 565 ? 0.3097 0.2634 0.2710 -0.0012 -0.0237 0.0206  822 ALA A C     
4218 O O     . ALA A 565 ? 0.3069 0.2644 0.2585 0.0006  -0.0212 0.0207  822 ALA A O     
4219 C CB    . ALA A 565 ? 0.2676 0.2163 0.2467 -0.0060 -0.0192 0.0253  822 ALA A CB    
4220 N N     . ARG A 566 ? 0.3167 0.2683 0.2819 -0.0012 -0.0275 0.0155  823 ARG A N     
4221 C CA    . ARG A 566 ? 0.3401 0.2916 0.2988 -0.0003 -0.0295 0.0094  823 ARG A CA    
4222 C C     . ARG A 566 ? 0.3189 0.2695 0.2874 -0.0024 -0.0287 0.0053  823 ARG A C     
4223 O O     . ARG A 566 ? 0.2841 0.2354 0.2642 -0.0033 -0.0287 0.0069  823 ARG A O     
4224 C CB    . ARG A 566 ? 0.3976 0.3475 0.3483 0.0022  -0.0378 0.0080  823 ARG A CB    
4225 C CG    . ARG A 566 ? 0.4383 0.3877 0.4011 0.0006  -0.0442 0.0095  823 ARG A CG    
4226 C CD    . ARG A 566 ? 0.5079 0.4546 0.4615 0.0029  -0.0552 0.0073  823 ARG A CD    
4227 N NE    . ARG A 566 ? 0.5531 0.5018 0.5166 0.0023  -0.0605 0.0125  823 ARG A NE    
4228 C CZ    . ARG A 566 ? 0.5969 0.5467 0.5531 0.0050  -0.0635 0.0174  823 ARG A CZ    
4229 N NH1   . ARG A 566 ? 0.6499 0.5996 0.5862 0.0093  -0.0620 0.0183  823 ARG A NH1   
4230 N NH2   . ARG A 566 ? 0.6094 0.5615 0.5788 0.0042  -0.0684 0.0223  823 ARG A NH2   
4231 N N     . LEU A 567 ? 0.2819 0.2319 0.2452 -0.0021 -0.0276 0.0010  824 LEU A N     
4232 C CA    . LEU A 567 ? 0.2928 0.2424 0.2636 -0.0036 -0.0272 -0.0016 824 LEU A CA    
4233 C C     . LEU A 567 ? 0.2534 0.2016 0.2320 -0.0048 -0.0346 -0.0015 824 LEU A C     
4234 O O     . LEU A 567 ? 0.2533 0.1974 0.2253 -0.0037 -0.0421 -0.0040 824 LEU A O     
4235 C CB    . LEU A 567 ? 0.3190 0.2673 0.2822 -0.0024 -0.0258 -0.0057 824 LEU A CB    
4236 C CG    . LEU A 567 ? 0.3668 0.3178 0.3315 -0.0030 -0.0194 -0.0058 824 LEU A CG    
4237 C CD1   . LEU A 567 ? 0.3445 0.2944 0.3022 -0.0005 -0.0194 -0.0095 824 LEU A CD1   
4238 C CD2   . LEU A 567 ? 0.3497 0.3018 0.3246 -0.0047 -0.0177 -0.0047 824 LEU A CD2   
4239 N N     . LEU A 568 ? 0.2345 0.1864 0.2273 -0.0065 -0.0329 0.0018  825 LEU A N     
4240 C CA    . LEU A 568 ? 0.2449 0.1983 0.2513 -0.0087 -0.0397 0.0047  825 LEU A CA    
4241 C C     . LEU A 568 ? 0.2458 0.2003 0.2619 -0.0108 -0.0393 0.0062  825 LEU A C     
4242 O O     . LEU A 568 ? 0.2495 0.2005 0.2730 -0.0135 -0.0482 0.0064  825 LEU A O     
4243 C CB    . LEU A 568 ? 0.2447 0.2053 0.2645 -0.0081 -0.0378 0.0109  825 LEU A CB    
4244 C CG    . LEU A 568 ? 0.2721 0.2316 0.2874 -0.0064 -0.0404 0.0118  825 LEU A CG    
4245 C CD1   . LEU A 568 ? 0.2942 0.2610 0.3249 -0.0046 -0.0378 0.0179  825 LEU A CD1   
4246 C CD2   . LEU A 568 ? 0.2895 0.2444 0.2983 -0.0071 -0.0514 0.0098  825 LEU A CD2   
4247 N N     . LEU A 569 ? 0.2360 0.1949 0.2527 -0.0096 -0.0303 0.0078  826 LEU A N     
4248 C CA    . LEU A 569 ? 0.2405 0.2026 0.2666 -0.0109 -0.0285 0.0116  826 LEU A CA    
4249 C C     . LEU A 569 ? 0.2348 0.1971 0.2509 -0.0086 -0.0210 0.0092  826 LEU A C     
4250 O O     . LEU A 569 ? 0.2167 0.1788 0.2226 -0.0061 -0.0162 0.0058  826 LEU A O     
4251 C CB    . LEU A 569 ? 0.2563 0.2298 0.3001 -0.0105 -0.0244 0.0210  826 LEU A CB    
4252 C CG    . LEU A 569 ? 0.3039 0.2816 0.3648 -0.0130 -0.0312 0.0267  826 LEU A CG    
4253 C CD1   . LEU A 569 ? 0.3049 0.2978 0.3828 -0.0103 -0.0232 0.0373  826 LEU A CD1   
4254 C CD2   . LEU A 569 ? 0.2960 0.2670 0.3664 -0.0188 -0.0435 0.0271  826 LEU A CD2   
4255 N N     . GLN A 570 ? 0.2311 0.1932 0.2517 -0.0099 -0.0214 0.0115  827 GLN A N     
4256 C CA    . GLN A 570 ? 0.2345 0.1987 0.2488 -0.0076 -0.0152 0.0115  827 GLN A CA    
4257 C C     . GLN A 570 ? 0.2480 0.2206 0.2762 -0.0078 -0.0120 0.0215  827 GLN A C     
4258 O O     . GLN A 570 ? 0.2405 0.2128 0.2841 -0.0118 -0.0177 0.0272  827 GLN A O     
4259 C CB    . GLN A 570 ? 0.2526 0.2089 0.2592 -0.0080 -0.0187 0.0062  827 GLN A CB    
4260 C CG    . GLN A 570 ? 0.2649 0.2237 0.2648 -0.0057 -0.0135 0.0059  827 GLN A CG    
4261 C CD    . GLN A 570 ? 0.2821 0.2408 0.2901 -0.0065 -0.0147 0.0115  827 GLN A CD    
4262 O OE1   . GLN A 570 ? 0.3091 0.2715 0.3308 -0.0085 -0.0154 0.0197  827 GLN A OE1   
4263 N NE2   . GLN A 570 ? 0.3116 0.2661 0.3136 -0.0052 -0.0157 0.0081  827 GLN A NE2   
4264 N N     . VAL A 571 ? 0.2473 0.2276 0.2706 -0.0033 -0.0036 0.0241  828 VAL A N     
4265 C CA    . VAL A 571 ? 0.2746 0.2659 0.3078 -0.0012 0.0021  0.0353  828 VAL A CA    
4266 C C     . VAL A 571 ? 0.3054 0.2976 0.3255 0.0027  0.0067  0.0342  828 VAL A C     
4267 O O     . VAL A 571 ? 0.3681 0.3663 0.3782 0.0092  0.0132  0.0342  828 VAL A O     
4268 C CB    . VAL A 571 ? 0.2870 0.2903 0.3259 0.0039  0.0092  0.0412  828 VAL A CB    
4269 C CG1   . VAL A 571 ? 0.2882 0.3062 0.3416 0.0059  0.0155  0.0561  828 VAL A CG1   
4270 C CG2   . VAL A 571 ? 0.2710 0.2733 0.3208 0.0008  0.0042  0.0408  828 VAL A CG2   
4271 N N     . HIS A 572 ? 0.3036 0.2883 0.3219 -0.0004 0.0018  0.0318  829 HIS A N     
4272 C CA    . HIS A 572 ? 0.3060 0.2908 0.3147 0.0023  0.0037  0.0315  829 HIS A CA    
4273 C C     . HIS A 572 ? 0.3128 0.2952 0.3038 0.0059  0.0051  0.0222  829 HIS A C     
4274 O O     . HIS A 572 ? 0.3371 0.3140 0.3224 0.0049  0.0016  0.0171  829 HIS A O     
4275 C CB    . HIS A 572 ? 0.3174 0.3133 0.3329 0.0051  0.0095  0.0447  829 HIS A CB    
4276 C CG    . HIS A 572 ? 0.3304 0.3285 0.3688 -0.0003 0.0065  0.0561  829 HIS A CG    
4277 N ND1   . HIS A 572 ? 0.3215 0.3078 0.3691 -0.0063 -0.0030 0.0539  829 HIS A ND1   
4278 C CD2   . HIS A 572 ? 0.3393 0.3498 0.3951 -0.0005 0.0107  0.0696  829 HIS A CD2   
4279 C CE1   . HIS A 572 ? 0.3356 0.3250 0.4058 -0.0111 -0.0062 0.0654  829 HIS A CE1   
4280 N NE2   . HIS A 572 ? 0.3426 0.3483 0.4195 -0.0080 0.0026  0.0761  829 HIS A NE2   
4281 N N     . ASP A 573 ? 0.3042 0.2910 0.2874 0.0109  0.0095  0.0205  830 ASP A N     
4282 C CA    . ASP A 573 ? 0.2980 0.2802 0.2663 0.0136  0.0082  0.0110  830 ASP A CA    
4283 C C     . ASP A 573 ? 0.2986 0.2765 0.2650 0.0139  0.0073  0.0047  830 ASP A C     
4284 O O     . ASP A 573 ? 0.2524 0.2257 0.2086 0.0163  0.0054  -0.0025 830 ASP A O     
4285 C CB    . ASP A 573 ? 0.3366 0.3240 0.2921 0.0211  0.0117  0.0120  830 ASP A CB    
4286 C CG    . ASP A 573 ? 0.4004 0.3953 0.3527 0.0288  0.0184  0.0156  830 ASP A CG    
4287 O OD1   . ASP A 573 ? 0.4100 0.4081 0.3746 0.0272  0.0208  0.0199  830 ASP A OD1   
4288 O OD2   . ASP A 573 ? 0.4774 0.4753 0.4139 0.0377  0.0212  0.0139  830 ASP A OD2   
4289 N N     . GLU A 574 ? 0.2915 0.2701 0.2685 0.0112  0.0074  0.0077  831 GLU A N     
4290 C CA    . GLU A 574 ? 0.3098 0.2839 0.2863 0.0111  0.0060  0.0029  831 GLU A CA    
4291 C C     . GLU A 574 ? 0.2759 0.2464 0.2606 0.0053  0.0017  0.0031  831 GLU A C     
4292 O O     . GLU A 574 ? 0.2367 0.2086 0.2300 0.0021  -0.0003 0.0075  831 GLU A O     
4293 C CB    . GLU A 574 ? 0.3788 0.3587 0.3567 0.0176  0.0111  0.0058  831 GLU A CB    
4294 C CG    . GLU A 574 ? 0.4492 0.4382 0.4428 0.0167  0.0137  0.0155  831 GLU A CG    
4295 C CD    . GLU A 574 ? 0.5683 0.5648 0.5634 0.0249  0.0200  0.0183  831 GLU A CD    
4296 O OE1   . GLU A 574 ? 0.6279 0.6178 0.6178 0.0277  0.0185  0.0115  831 GLU A OE1   
4297 O OE2   . GLU A 574 ? 0.5718 0.5813 0.5740 0.0291  0.0266  0.0281  831 GLU A OE2   
4298 N N     . LEU A 575 ? 0.2602 0.2253 0.2418 0.0044  -0.0006 -0.0015 832 LEU A N     
4299 C CA    . LEU A 575 ? 0.2545 0.2165 0.2399 0.0006  -0.0046 -0.0015 832 LEU A CA    
4300 C C     . LEU A 575 ? 0.2588 0.2206 0.2482 0.0024  -0.0044 -0.0005 832 LEU A C     
4301 O O     . LEU A 575 ? 0.2537 0.2130 0.2393 0.0059  -0.0028 -0.0032 832 LEU A O     
4302 C CB    . LEU A 575 ? 0.2483 0.2058 0.2272 -0.0018 -0.0068 -0.0054 832 LEU A CB    
4303 C CG    . LEU A 575 ? 0.2451 0.2031 0.2207 -0.0026 -0.0071 -0.0066 832 LEU A CG    
4304 C CD1   . LEU A 575 ? 0.2490 0.2060 0.2212 -0.0041 -0.0080 -0.0083 832 LEU A CD1   
4305 C CD2   . LEU A 575 ? 0.2568 0.2145 0.2361 -0.0035 -0.0093 -0.0049 832 LEU A CD2   
4306 N N     . ILE A 576 ? 0.2468 0.2105 0.2444 0.0004  -0.0073 0.0032  833 ILE A N     
4307 C CA    A ILE A 576 ? 0.2360 0.2011 0.2402 0.0022  -0.0079 0.0057  833 ILE A CA    
4308 C CA    B ILE A 576 ? 0.2363 0.2013 0.2402 0.0022  -0.0079 0.0055  833 ILE A CA    
4309 C C     . ILE A 576 ? 0.2363 0.1967 0.2381 -0.0010 -0.0137 0.0049  833 ILE A C     
4310 O O     . ILE A 576 ? 0.2300 0.1892 0.2310 -0.0039 -0.0184 0.0047  833 ILE A O     
4311 C CB    A ILE A 576 ? 0.2363 0.2103 0.2548 0.0030  -0.0071 0.0126  833 ILE A CB    
4312 C CB    B ILE A 576 ? 0.2308 0.2048 0.2490 0.0032  -0.0069 0.0125  833 ILE A CB    
4313 C CG1   A ILE A 576 ? 0.2386 0.2202 0.2596 0.0061  -0.0007 0.0163  833 ILE A CG1   
4314 C CG1   B ILE A 576 ? 0.2296 0.2110 0.2487 0.0088  0.0009  0.0151  833 ILE A CG1   
4315 C CG2   A ILE A 576 ? 0.2359 0.2133 0.2624 0.0066  -0.0066 0.0156  833 ILE A CG2   
4316 C CG2   B ILE A 576 ? 0.2312 0.2071 0.2579 0.0045  -0.0092 0.0155  833 ILE A CG2   
4317 C CD1   A ILE A 576 ? 0.2486 0.2319 0.2615 0.0140  0.0062  0.0139  833 ILE A CD1   
4318 C CD1   B ILE A 576 ? 0.2212 0.2083 0.2462 0.0065  0.0021  0.0204  833 ILE A CD1   
4319 N N     . LEU A 577 ? 0.2400 0.1968 0.2396 0.0004  -0.0138 0.0044  834 LEU A N     
4320 C CA    . LEU A 577 ? 0.2504 0.2041 0.2467 -0.0014 -0.0181 0.0057  834 LEU A CA    
4321 C C     . LEU A 577 ? 0.2431 0.1973 0.2471 0.0009  -0.0199 0.0094  834 LEU A C     
4322 O O     . LEU A 577 ? 0.2330 0.1891 0.2436 0.0046  -0.0166 0.0099  834 LEU A O     
4323 C CB    . LEU A 577 ? 0.2651 0.2144 0.2540 -0.0024 -0.0168 0.0043  834 LEU A CB    
4324 C CG    . LEU A 577 ? 0.2770 0.2268 0.2597 -0.0041 -0.0148 0.0014  834 LEU A CG    
4325 C CD1   . LEU A 577 ? 0.2932 0.2419 0.2763 -0.0030 -0.0119 -0.0020 834 LEU A CD1   
4326 C CD2   . LEU A 577 ? 0.3223 0.2721 0.3000 -0.0056 -0.0149 0.0037  834 LEU A CD2   
4327 N N     . GLU A 578 ? 0.2495 0.2027 0.2517 -0.0003 -0.0249 0.0123  835 GLU A N     
4328 C CA    . GLU A 578 ? 0.2488 0.2013 0.2572 0.0020  -0.0270 0.0165  835 GLU A CA    
4329 C C     . GLU A 578 ? 0.2539 0.2018 0.2538 0.0008  -0.0283 0.0190  835 GLU A C     
4330 O O     . GLU A 578 ? 0.2561 0.2045 0.2460 -0.0010 -0.0287 0.0185  835 GLU A O     
4331 C CB    . GLU A 578 ? 0.2452 0.2030 0.2621 0.0021  -0.0328 0.0202  835 GLU A CB    
4332 C CG    . GLU A 578 ? 0.2612 0.2181 0.2690 -0.0003 -0.0402 0.0198  835 GLU A CG    
4333 C CD    . GLU A 578 ? 0.2911 0.2520 0.3088 -0.0008 -0.0492 0.0228  835 GLU A CD    
4334 O OE1   . GLU A 578 ? 0.2968 0.2637 0.3313 0.0005  -0.0484 0.0271  835 GLU A OE1   
4335 O OE2   . GLU A 578 ? 0.2923 0.2506 0.3006 -0.0017 -0.0579 0.0210  835 GLU A OE2   
4336 N N     . ALA A 579 ? 0.2653 0.2089 0.2701 0.0025  -0.0285 0.0225  836 ALA A N     
4337 C CA    . ALA A 579 ? 0.2631 0.2032 0.2638 0.0009  -0.0293 0.0278  836 ALA A CA    
4338 C C     . ALA A 579 ? 0.2645 0.2001 0.2740 0.0034  -0.0321 0.0331  836 ALA A C     
4339 O O     . ALA A 579 ? 0.2483 0.1821 0.2664 0.0072  -0.0316 0.0304  836 ALA A O     
4340 C CB    . ALA A 579 ? 0.2657 0.2014 0.2657 -0.0016 -0.0258 0.0255  836 ALA A CB    
4341 N N     . PRO A 580 ? 0.2728 0.2073 0.2802 0.0023  -0.0344 0.0415  837 PRO A N     
4342 C CA    . PRO A 580 ? 0.2886 0.2169 0.3056 0.0044  -0.0373 0.0477  837 PRO A CA    
4343 C C     . PRO A 580 ? 0.2923 0.2099 0.3180 0.0055  -0.0362 0.0428  837 PRO A C     
4344 O O     . PRO A 580 ? 0.3008 0.2152 0.3243 0.0026  -0.0341 0.0383  837 PRO A O     
4345 C CB    . PRO A 580 ? 0.3003 0.2297 0.3129 0.0017  -0.0381 0.0587  837 PRO A CB    
4346 C CG    . PRO A 580 ? 0.2947 0.2337 0.2922 0.0010  -0.0363 0.0580  837 PRO A CG    
4347 C CD    . PRO A 580 ? 0.2818 0.2213 0.2778 0.0000  -0.0333 0.0465  837 PRO A CD    
4348 N N     . LYS A 581 ? 0.3008 0.2124 0.3357 0.0106  -0.0385 0.0428  838 LYS A N     
4349 C CA    . LYS A 581 ? 0.3351 0.2334 0.3758 0.0139  -0.0390 0.0365  838 LYS A CA    
4350 C C     . LYS A 581 ? 0.3399 0.2278 0.3835 0.0081  -0.0421 0.0399  838 LYS A C     
4351 O O     . LYS A 581 ? 0.3360 0.2144 0.3801 0.0081  -0.0433 0.0321  838 LYS A O     
4352 C CB    . LYS A 581 ? 0.3498 0.2423 0.4000 0.0221  -0.0413 0.0365  838 LYS A CB    
4353 C CG    . LYS A 581 ? 0.3950 0.2817 0.4532 0.0216  -0.0467 0.0473  838 LYS A CG    
4354 C CD    . LYS A 581 ? 0.4230 0.3068 0.4911 0.0311  -0.0484 0.0475  838 LYS A CD    
4355 C CE    . LYS A 581 ? 0.4736 0.3500 0.5505 0.0305  -0.0546 0.0594  838 LYS A CE    
4356 N NZ    . LYS A 581 ? 0.5031 0.3789 0.5907 0.0402  -0.0566 0.0611  838 LYS A NZ    
4357 N N     . GLU A 582 ? 0.3420 0.2328 0.3878 0.0033  -0.0438 0.0523  839 GLU A N     
4358 C CA    . GLU A 582 ? 0.3595 0.2438 0.4124 -0.0033 -0.0463 0.0596  839 GLU A CA    
4359 C C     . GLU A 582 ? 0.3416 0.2320 0.3897 -0.0087 -0.0429 0.0566  839 GLU A C     
4360 O O     . GLU A 582 ? 0.3319 0.2187 0.3891 -0.0147 -0.0452 0.0633  839 GLU A O     
4361 C CB    . GLU A 582 ? 0.4085 0.2990 0.4643 -0.0064 -0.0468 0.0767  839 GLU A CB    
4362 C CG    . GLU A 582 ? 0.4659 0.3548 0.5244 -0.0012 -0.0500 0.0826  839 GLU A CG    
4363 C CD    . GLU A 582 ? 0.5098 0.4137 0.5544 0.0022  -0.0471 0.0806  839 GLU A CD    
4364 O OE1   . GLU A 582 ? 0.6097 0.5254 0.6433 0.0002  -0.0448 0.0879  839 GLU A OE1   
4365 O OE2   . GLU A 582 ? 0.4313 0.3355 0.4757 0.0070  -0.0473 0.0713  839 GLU A OE2   
4366 N N     . GLU A 583 ? 0.3019 0.2023 0.3379 -0.0072 -0.0380 0.0486  840 GLU A N     
4367 C CA    . GLU A 583 ? 0.2993 0.2057 0.3310 -0.0113 -0.0348 0.0457  840 GLU A CA    
4368 C C     . GLU A 583 ? 0.2884 0.1877 0.3186 -0.0096 -0.0357 0.0323  840 GLU A C     
4369 O O     . GLU A 583 ? 0.2743 0.1773 0.3025 -0.0131 -0.0343 0.0297  840 GLU A O     
4370 C CB    . GLU A 583 ? 0.2931 0.2147 0.3117 -0.0107 -0.0294 0.0466  840 GLU A CB    
4371 C CG    . GLU A 583 ? 0.3190 0.2491 0.3340 -0.0112 -0.0282 0.0596  840 GLU A CG    
4372 C CD    . GLU A 583 ? 0.3275 0.2698 0.3267 -0.0089 -0.0242 0.0579  840 GLU A CD    
4373 O OE1   . GLU A 583 ? 0.3249 0.2683 0.3186 -0.0082 -0.0227 0.0474  840 GLU A OE1   
4374 O OE2   . GLU A 583 ? 0.3418 0.2917 0.3329 -0.0070 -0.0231 0.0669  840 GLU A OE2   
4375 N N     . MET A 584 ? 0.2938 0.1837 0.3246 -0.0033 -0.0378 0.0245  841 MET A N     
4376 C CA    . MET A 584 ? 0.3002 0.1854 0.3251 0.0009  -0.0375 0.0116  841 MET A CA    
4377 C C     . MET A 584 ? 0.2947 0.1697 0.3234 -0.0034 -0.0433 0.0080  841 MET A C     
4378 O O     . MET A 584 ? 0.2737 0.1518 0.2958 -0.0037 -0.0420 0.0015  841 MET A O     
4379 C CB    . MET A 584 ? 0.3254 0.2023 0.3502 0.0108  -0.0383 0.0047  841 MET A CB    
4380 C CG    . MET A 584 ? 0.3290 0.2183 0.3527 0.0153  -0.0329 0.0075  841 MET A CG    
4381 S SD    . MET A 584 ? 0.3508 0.2562 0.3655 0.0148  -0.0258 0.0042  841 MET A SD    
4382 C CE    . MET A 584 ? 0.3071 0.2233 0.3210 0.0070  -0.0257 0.0134  841 MET A CE    
4383 N N     . GLU A 585 ? 0.2984 0.1613 0.3394 -0.0070 -0.0506 0.0133  842 GLU A N     
4384 C CA    . GLU A 585 ? 0.3139 0.1640 0.3622 -0.0113 -0.0595 0.0093  842 GLU A CA    
4385 C C     . GLU A 585 ? 0.3111 0.1749 0.3620 -0.0197 -0.0568 0.0153  842 GLU A C     
4386 O O     . GLU A 585 ? 0.2947 0.1557 0.3442 -0.0214 -0.0608 0.0081  842 GLU A O     
4387 C CB    . GLU A 585 ? 0.3377 0.1711 0.4023 -0.0143 -0.0692 0.0153  842 GLU A CB    
4388 C CG    . GLU A 585 ? 0.3576 0.1740 0.4194 -0.0040 -0.0734 0.0063  842 GLU A CG    
4389 C CD    . GLU A 585 ? 0.3906 0.1847 0.4685 -0.0063 -0.0862 0.0085  842 GLU A CD    
4390 O OE1   . GLU A 585 ? 0.4203 0.1984 0.5033 -0.0090 -0.0974 0.0012  842 GLU A OE1   
4391 O OE2   . GLU A 585 ? 0.4208 0.2121 0.5080 -0.0058 -0.0866 0.0183  842 GLU A OE2   
4392 N N     . ARG A 586 ? 0.2960 0.1751 0.3493 -0.0237 -0.0502 0.0283  843 ARG A N     
4393 C CA    . ARG A 586 ? 0.2948 0.1891 0.3495 -0.0293 -0.0458 0.0344  843 ARG A CA    
4394 C C     . ARG A 586 ? 0.2713 0.1739 0.3107 -0.0254 -0.0401 0.0243  843 ARG A C     
4395 O O     . ARG A 586 ? 0.2607 0.1681 0.3015 -0.0284 -0.0405 0.0228  843 ARG A O     
4396 C CB    . ARG A 586 ? 0.3115 0.2201 0.3684 -0.0314 -0.0393 0.0497  843 ARG A CB    
4397 C CG    . ARG A 586 ? 0.3611 0.2638 0.4363 -0.0366 -0.0445 0.0636  843 ARG A CG    
4398 C CD    . ARG A 586 ? 0.4115 0.3324 0.4938 -0.0412 -0.0384 0.0800  843 ARG A CD    
4399 N NE    . ARG A 586 ? 0.4630 0.3952 0.5341 -0.0368 -0.0311 0.0885  843 ARG A NE    
4400 C CZ    . ARG A 586 ? 0.4813 0.4328 0.5452 -0.0351 -0.0221 0.0979  843 ARG A CZ    
4401 N NH1   . ARG A 586 ? 0.4900 0.4539 0.5572 -0.0372 -0.0177 0.1004  843 ARG A NH1   
4402 N NH2   . ARG A 586 ? 0.5060 0.4641 0.5577 -0.0300 -0.0180 0.1043  843 ARG A NH2   
4403 N N     . LEU A 587 ? 0.2567 0.1614 0.2839 -0.0190 -0.0356 0.0188  844 LEU A N     
4404 C CA    . LEU A 587 ? 0.2721 0.1842 0.2872 -0.0157 -0.0307 0.0108  844 LEU A CA    
4405 C C     . LEU A 587 ? 0.2729 0.1768 0.2843 -0.0132 -0.0345 -0.0001 844 LEU A C     
4406 O O     . LEU A 587 ? 0.2757 0.1863 0.2813 -0.0133 -0.0322 -0.0036 844 LEU A O     
4407 C CB    . LEU A 587 ? 0.2749 0.1910 0.2821 -0.0102 -0.0264 0.0092  844 LEU A CB    
4408 C CG    . LEU A 587 ? 0.2698 0.1952 0.2752 -0.0114 -0.0233 0.0177  844 LEU A CG    
4409 C CD1   . LEU A 587 ? 0.2922 0.2197 0.2932 -0.0067 -0.0221 0.0155  844 LEU A CD1   
4410 C CD2   . LEU A 587 ? 0.2603 0.1964 0.2598 -0.0133 -0.0194 0.0191  844 LEU A CD2   
4411 N N     . CYS A 588 ? 0.2942 0.1833 0.3078 -0.0100 -0.0409 -0.0057 845 CYS A N     
4412 C CA    . CYS A 588 ? 0.3244 0.2033 0.3314 -0.0060 -0.0464 -0.0175 845 CYS A CA    
4413 C C     . CYS A 588 ? 0.3296 0.2094 0.3422 -0.0129 -0.0520 -0.0171 845 CYS A C     
4414 O O     . CYS A 588 ? 0.3461 0.2251 0.3497 -0.0101 -0.0541 -0.0254 845 CYS A O     
4415 C CB    . CYS A 588 ? 0.3654 0.2248 0.3742 -0.0008 -0.0547 -0.0241 845 CYS A CB    
4416 S SG    . CYS A 588 ? 0.4117 0.2717 0.4115 0.0113  -0.0475 -0.0278 845 CYS A SG    
4417 N N     . ARG A 589 ? 0.3116 0.1938 0.3400 -0.0215 -0.0548 -0.0065 846 ARG A N     
4418 C CA    . ARG A 589 ? 0.3341 0.2215 0.3726 -0.0288 -0.0592 -0.0030 846 ARG A CA    
4419 C C     . ARG A 589 ? 0.3162 0.2233 0.3519 -0.0303 -0.0495 0.0031  846 ARG A C     
4420 O O     . ARG A 589 ? 0.3433 0.2555 0.3768 -0.0309 -0.0506 -0.0004 846 ARG A O     
4421 C CB    . ARG A 589 ? 0.3521 0.2350 0.4130 -0.0375 -0.0667 0.0081  846 ARG A CB    
4422 C CG    . ARG A 589 ? 0.4061 0.2657 0.4717 -0.0370 -0.0812 -0.0009 846 ARG A CG    
4423 C CD    . ARG A 589 ? 0.4224 0.2749 0.5132 -0.0460 -0.0899 0.0111  846 ARG A CD    
4424 N NE    . ARG A 589 ? 0.4390 0.3022 0.5509 -0.0565 -0.0938 0.0225  846 ARG A NE    
4425 C CZ    . ARG A 589 ? 0.4844 0.3382 0.6069 -0.0613 -0.1080 0.0172  846 ARG A CZ    
4426 N NH1   . ARG A 589 ? 0.4979 0.3309 0.6061 -0.0549 -0.1190 -0.0015 846 ARG A NH1   
4427 N NH2   . ARG A 589 ? 0.4739 0.3401 0.6209 -0.0716 -0.1114 0.0307  846 ARG A NH2   
4428 N N     . LEU A 590 ? 0.2989 0.2161 0.3325 -0.0296 -0.0407 0.0110  847 LEU A N     
4429 C CA    . LEU A 590 ? 0.2861 0.2205 0.3169 -0.0299 -0.0324 0.0167  847 LEU A CA    
4430 C C     . LEU A 590 ? 0.2712 0.2092 0.2872 -0.0247 -0.0282 0.0078  847 LEU A C     
4431 O O     . LEU A 590 ? 0.2762 0.2226 0.2925 -0.0255 -0.0265 0.0082  847 LEU A O     
4432 C CB    . LEU A 590 ? 0.3022 0.2442 0.3321 -0.0292 -0.0260 0.0264  847 LEU A CB    
4433 C CG    . LEU A 590 ? 0.3383 0.2964 0.3619 -0.0270 -0.0175 0.0318  847 LEU A CG    
4434 C CD1   . LEU A 590 ? 0.3475 0.3165 0.3834 -0.0309 -0.0167 0.0388  847 LEU A CD1   
4435 C CD2   . LEU A 590 ? 0.3499 0.3127 0.3708 -0.0253 -0.0135 0.0412  847 LEU A CD2   
4436 N N     . VAL A 591 ? 0.2646 0.1974 0.2696 -0.0194 -0.0263 0.0013  848 VAL A N     
4437 C CA    . VAL A 591 ? 0.2498 0.1874 0.2440 -0.0152 -0.0218 -0.0038 848 VAL A CA    
4438 C C     . VAL A 591 ? 0.2521 0.1885 0.2428 -0.0141 -0.0247 -0.0101 848 VAL A C     
4439 O O     . VAL A 591 ? 0.2344 0.1785 0.2226 -0.0140 -0.0218 -0.0097 848 VAL A O     
4440 C CB    . VAL A 591 ? 0.2591 0.1942 0.2468 -0.0103 -0.0191 -0.0064 848 VAL A CB    
4441 C CG1   . VAL A 591 ? 0.2503 0.1909 0.2308 -0.0071 -0.0152 -0.0095 848 VAL A CG1   
4442 C CG2   . VAL A 591 ? 0.2539 0.1922 0.2437 -0.0112 -0.0171 0.0003  848 VAL A CG2   
4443 N N     . PRO A 592 ? 0.2780 0.2036 0.2675 -0.0126 -0.0312 -0.0165 849 PRO A N     
4444 C CA    . PRO A 592 ? 0.2869 0.2110 0.2701 -0.0106 -0.0352 -0.0229 849 PRO A CA    
4445 C C     . PRO A 592 ? 0.2963 0.2273 0.2895 -0.0166 -0.0384 -0.0186 849 PRO A C     
4446 O O     . PRO A 592 ? 0.2905 0.2275 0.2789 -0.0151 -0.0376 -0.0203 849 PRO A O     
4447 C CB    . PRO A 592 ? 0.3037 0.2126 0.2830 -0.0069 -0.0434 -0.0311 849 PRO A CB    
4448 C CG    . PRO A 592 ? 0.3139 0.2189 0.2933 -0.0039 -0.0395 -0.0298 849 PRO A CG    
4449 C CD    . PRO A 592 ? 0.2885 0.2018 0.2792 -0.0105 -0.0355 -0.0193 849 PRO A CD    
4450 N N     . GLU A 593 ? 0.2922 0.2240 0.3005 -0.0230 -0.0416 -0.0117 850 GLU A N     
4451 C CA    . GLU A 593 ? 0.3113 0.2523 0.3331 -0.0287 -0.0442 -0.0053 850 GLU A CA    
4452 C C     . GLU A 593 ? 0.2934 0.2499 0.3130 -0.0270 -0.0346 -0.0003 850 GLU A C     
4453 O O     . GLU A 593 ? 0.2784 0.2422 0.3005 -0.0271 -0.0356 -0.0002 850 GLU A O     
4454 C CB    . GLU A 593 ? 0.3774 0.3186 0.4190 -0.0359 -0.0480 0.0045  850 GLU A CB    
4455 C CG    . GLU A 593 ? 0.4347 0.3893 0.4957 -0.0422 -0.0498 0.0146  850 GLU A CG    
4456 C CD    . GLU A 593 ? 0.5398 0.4891 0.6082 -0.0455 -0.0627 0.0093  850 GLU A CD    
4457 O OE1   . GLU A 593 ? 0.6633 0.5949 0.7250 -0.0444 -0.0733 -0.0014 850 GLU A OE1   
4458 O OE2   . GLU A 593 ? 0.6453 0.6083 0.7264 -0.0485 -0.0631 0.0156  850 GLU A OE2   
4459 N N     . VAL A 594 ? 0.2666 0.2271 0.2809 -0.0245 -0.0263 0.0031  851 VAL A N     
4460 C CA    . VAL A 594 ? 0.2595 0.2309 0.2688 -0.0212 -0.0187 0.0055  851 VAL A CA    
4461 C C     . VAL A 594 ? 0.2474 0.2173 0.2460 -0.0170 -0.0183 -0.0017 851 VAL A C     
4462 O O     . VAL A 594 ? 0.2675 0.2451 0.2673 -0.0156 -0.0165 -0.0005 851 VAL A O     
4463 C CB    . VAL A 594 ? 0.2624 0.2352 0.2652 -0.0186 -0.0126 0.0085  851 VAL A CB    
4464 C CG1   . VAL A 594 ? 0.2571 0.2371 0.2518 -0.0136 -0.0068 0.0079  851 VAL A CG1   
4465 C CG2   . VAL A 594 ? 0.2599 0.2375 0.2734 -0.0220 -0.0117 0.0186  851 VAL A CG2   
4466 N N     . MET A 595 ? 0.2427 0.2038 0.2320 -0.0145 -0.0195 -0.0078 852 MET A N     
4467 C CA    . MET A 595 ? 0.2360 0.1969 0.2165 -0.0105 -0.0185 -0.0121 852 MET A CA    
4468 C C     . MET A 595 ? 0.2487 0.2105 0.2302 -0.0109 -0.0241 -0.0144 852 MET A C     
4469 O O     . MET A 595 ? 0.2676 0.2340 0.2459 -0.0085 -0.0229 -0.0143 852 MET A O     
4470 C CB    . MET A 595 ? 0.2509 0.2049 0.2234 -0.0070 -0.0177 -0.0160 852 MET A CB    
4471 C CG    . MET A 595 ? 0.2486 0.2032 0.2211 -0.0065 -0.0132 -0.0133 852 MET A CG    
4472 S SD    . MET A 595 ? 0.2663 0.2164 0.2344 -0.0022 -0.0115 -0.0153 852 MET A SD    
4473 C CE    . MET A 595 ? 0.2650 0.2196 0.2270 0.0020  -0.0088 -0.0156 852 MET A CE    
4474 N N     . GLU A 596 ? 0.2532 0.2092 0.2390 -0.0136 -0.0316 -0.0166 853 GLU A N     
4475 C CA    . GLU A 596 ? 0.2783 0.2332 0.2641 -0.0138 -0.0397 -0.0201 853 GLU A CA    
4476 C C     . GLU A 596 ? 0.2957 0.2623 0.2949 -0.0175 -0.0403 -0.0137 853 GLU A C     
4477 O O     . GLU A 596 ? 0.3041 0.2739 0.3024 -0.0164 -0.0447 -0.0151 853 GLU A O     
4478 C CB    . GLU A 596 ? 0.3070 0.2497 0.2947 -0.0157 -0.0504 -0.0255 853 GLU A CB    
4479 C CG    . GLU A 596 ? 0.3381 0.2695 0.3080 -0.0082 -0.0510 -0.0343 853 GLU A CG    
4480 C CD    . GLU A 596 ? 0.3962 0.3122 0.3669 -0.0084 -0.0616 -0.0410 853 GLU A CD    
4481 O OE1   . GLU A 596 ? 0.4009 0.3147 0.3888 -0.0162 -0.0690 -0.0373 853 GLU A OE1   
4482 O OE2   . GLU A 596 ? 0.4368 0.3428 0.3916 -0.0002 -0.0629 -0.0495 853 GLU A OE2   
4483 N N     . GLN A 597 ? 0.2722 0.2464 0.2838 -0.0210 -0.0357 -0.0060 854 GLN A N     
4484 C CA    . GLN A 597 ? 0.2805 0.2685 0.3072 -0.0234 -0.0351 0.0017  854 GLN A CA    
4485 C C     . GLN A 597 ? 0.2679 0.2653 0.2900 -0.0181 -0.0254 0.0044  854 GLN A C     
4486 O O     . GLN A 597 ? 0.2455 0.2559 0.2790 -0.0178 -0.0225 0.0110  854 GLN A O     
4487 C CB    . GLN A 597 ? 0.2996 0.2926 0.3442 -0.0294 -0.0355 0.0107  854 GLN A CB    
4488 C CG    . GLN A 597 ? 0.3404 0.3227 0.3946 -0.0357 -0.0483 0.0087  854 GLN A CG    
4489 C CD    . GLN A 597 ? 0.3907 0.3728 0.4502 -0.0374 -0.0594 0.0051  854 GLN A CD    
4490 O OE1   . GLN A 597 ? 0.4440 0.4406 0.5159 -0.0384 -0.0585 0.0116  854 GLN A OE1   
4491 N NE2   . GLN A 597 ? 0.4275 0.3937 0.4768 -0.0367 -0.0702 -0.0055 854 GLN A NE2   
4492 N N     . ALA A 598 ? 0.2556 0.2467 0.2627 -0.0135 -0.0209 -0.0005 855 ALA A N     
4493 C CA    . ALA A 598 ? 0.2635 0.2593 0.2656 -0.0083 -0.0138 0.0005  855 ALA A CA    
4494 C C     . ALA A 598 ? 0.2748 0.2785 0.2816 -0.0055 -0.0145 0.0021  855 ALA A C     
4495 O O     . ALA A 598 ? 0.2511 0.2632 0.2617 -0.0015 -0.0095 0.0055  855 ALA A O     
4496 C CB    . ALA A 598 ? 0.2444 0.2308 0.2336 -0.0055 -0.0120 -0.0044 855 ALA A CB    
4497 N N     . VAL A 599 ? 0.2716 0.2729 0.2776 -0.0066 -0.0211 -0.0004 856 VAL A N     
4498 C CA    . VAL A 599 ? 0.2988 0.3087 0.3121 -0.0049 -0.0240 0.0021  856 VAL A CA    
4499 C C     . VAL A 599 ? 0.3108 0.3203 0.3301 -0.0096 -0.0346 0.0012  856 VAL A C     
4500 O O     . VAL A 599 ? 0.3580 0.3581 0.3721 -0.0124 -0.0394 -0.0032 856 VAL A O     
4501 C CB    . VAL A 599 ? 0.3139 0.3197 0.3168 0.0003  -0.0228 -0.0001 856 VAL A CB    
4502 C CG1   . VAL A 599 ? 0.2945 0.2974 0.2924 0.0045  -0.0154 -0.0004 856 VAL A CG1   
4503 C CG2   . VAL A 599 ? 0.3243 0.3207 0.3144 0.0000  -0.0268 -0.0046 856 VAL A CG2   
4504 N N     . THR A 600 ? 0.3004 0.3195 0.3311 -0.0098 -0.0392 0.0048  857 THR A N     
4505 C CA    . THR A 600 ? 0.2929 0.3104 0.3280 -0.0136 -0.0518 0.0028  857 THR A CA    
4506 C C     . THR A 600 ? 0.2841 0.3006 0.3081 -0.0086 -0.0556 0.0002  857 THR A C     
4507 O O     . THR A 600 ? 0.2745 0.2997 0.3033 -0.0048 -0.0519 0.0046  857 THR A O     
4508 C CB    . THR A 600 ? 0.3192 0.3507 0.3804 -0.0188 -0.0563 0.0112  857 THR A CB    
4509 O OG1   . THR A 600 ? 0.3485 0.3831 0.4200 -0.0226 -0.0504 0.0164  857 THR A OG1   
4510 C CG2   . THR A 600 ? 0.3354 0.3622 0.4035 -0.0245 -0.0732 0.0082  857 THR A CG2   
4511 N N     . LEU A 601 ? 0.2848 0.2905 0.2930 -0.0074 -0.0629 -0.0068 858 LEU A N     
4512 C CA    . LEU A 601 ? 0.2864 0.2910 0.2804 -0.0017 -0.0664 -0.0085 858 LEU A CA    
4513 C C     . LEU A 601 ? 0.2954 0.2980 0.2899 -0.0036 -0.0822 -0.0126 858 LEU A C     
4514 O O     . LEU A 601 ? 0.3294 0.3285 0.3345 -0.0097 -0.0904 -0.0149 858 LEU A O     
4515 C CB    . LEU A 601 ? 0.2878 0.2823 0.2592 0.0035  -0.0606 -0.0129 858 LEU A CB    
4516 C CG    . LEU A 601 ? 0.2811 0.2751 0.2508 0.0051  -0.0475 -0.0098 858 LEU A CG    
4517 C CD1   . LEU A 601 ? 0.3022 0.2895 0.2532 0.0101  -0.0437 -0.0120 858 LEU A CD1   
4518 C CD2   . LEU A 601 ? 0.2712 0.2726 0.2492 0.0072  -0.0425 -0.0034 858 LEU A CD2   
4519 N N     . ARG A 602 ? 0.3016 0.3047 0.2837 0.0016  -0.0880 -0.0136 859 ARG A N     
4520 C CA    . ARG A 602 ? 0.3221 0.3210 0.2992 0.0014  -0.1052 -0.0194 859 ARG A CA    
4521 C C     . ARG A 602 ? 0.3251 0.3078 0.2814 0.0040  -0.1116 -0.0307 859 ARG A C     
4522 O O     . ARG A 602 ? 0.3548 0.3304 0.3058 0.0040  -0.1278 -0.0379 859 ARG A O     
4523 C CB    . ARG A 602 ? 0.3569 0.3608 0.3219 0.0083  -0.1090 -0.0171 859 ARG A CB    
4524 C CG    . ARG A 602 ? 0.3705 0.3896 0.3581 0.0065  -0.1074 -0.0071 859 ARG A CG    
4525 C CD    . ARG A 602 ? 0.4019 0.4254 0.3773 0.0142  -0.1072 -0.0027 859 ARG A CD    
4526 N NE    . ARG A 602 ? 0.4181 0.4554 0.4177 0.0128  -0.1049 0.0062  859 ARG A NE    
4527 C CZ    . ARG A 602 ? 0.4385 0.4807 0.4431 0.0166  -0.0928 0.0131  859 ARG A CZ    
4528 N NH1   . ARG A 602 ? 0.4071 0.4422 0.3957 0.0213  -0.0825 0.0139  859 ARG A NH1   
4529 N NH2   . ARG A 602 ? 0.4872 0.5424 0.5152 0.0163  -0.0923 0.0200  859 ARG A NH2   
4530 N N     . VAL A 603 ? 0.3049 0.2817 0.2489 0.0072  -0.0995 -0.0325 860 VAL A N     
4531 C CA    . VAL A 603 ? 0.3164 0.2787 0.2426 0.0109  -0.1032 -0.0427 860 VAL A CA    
4532 C C     . VAL A 603 ? 0.2992 0.2582 0.2384 0.0051  -0.0952 -0.0415 860 VAL A C     
4533 O O     . VAL A 603 ? 0.2787 0.2469 0.2316 0.0016  -0.0835 -0.0331 860 VAL A O     
4534 C CB    . VAL A 603 ? 0.3197 0.2800 0.2166 0.0226  -0.0960 -0.0448 860 VAL A CB    
4535 C CG1   . VAL A 603 ? 0.3330 0.2969 0.2162 0.0287  -0.1056 -0.0452 860 VAL A CG1   
4536 C CG2   . VAL A 603 ? 0.3029 0.2718 0.2031 0.0236  -0.0779 -0.0352 860 VAL A CG2   
4537 N N     . PRO A 604 ? 0.3139 0.2590 0.2475 0.0051  -0.1018 -0.0502 861 PRO A N     
4538 C CA    . PRO A 604 ? 0.3070 0.2486 0.2503 0.0010  -0.0935 -0.0484 861 PRO A CA    
4539 C C     . PRO A 604 ? 0.3088 0.2538 0.2402 0.0069  -0.0772 -0.0455 861 PRO A C     
4540 O O     . PRO A 604 ? 0.3280 0.2741 0.2400 0.0156  -0.0733 -0.0470 861 PRO A O     
4541 C CB    . PRO A 604 ? 0.3316 0.2550 0.2668 0.0026  -0.1057 -0.0598 861 PRO A CB    
4542 C CG    . PRO A 604 ? 0.3490 0.2665 0.2745 0.0056  -0.1223 -0.0675 861 PRO A CG    
4543 C CD    . PRO A 604 ? 0.3413 0.2718 0.2579 0.0102  -0.1175 -0.0625 861 PRO A CD    
4544 N N     . LEU A 605 ? 0.2945 0.2419 0.2382 0.0023  -0.0682 -0.0404 862 LEU A N     
4545 C CA    . LEU A 605 ? 0.2953 0.2426 0.2308 0.0066  -0.0561 -0.0391 862 LEU A CA    
4546 C C     . LEU A 605 ? 0.3169 0.2518 0.2494 0.0074  -0.0593 -0.0456 862 LEU A C     
4547 O O     . LEU A 605 ? 0.3329 0.2610 0.2769 0.0015  -0.0684 -0.0477 862 LEU A O     
4548 C CB    . LEU A 605 ? 0.2774 0.2339 0.2266 0.0019  -0.0459 -0.0303 862 LEU A CB    
4549 C CG    . LEU A 605 ? 0.2933 0.2601 0.2447 0.0029  -0.0415 -0.0243 862 LEU A CG    
4550 C CD1   . LEU A 605 ? 0.2855 0.2582 0.2496 -0.0008 -0.0341 -0.0183 862 LEU A CD1   
4551 C CD2   . LEU A 605 ? 0.3035 0.2712 0.2394 0.0102  -0.0364 -0.0234 862 LEU A CD2   
4552 N N     . LYS A 606 ? 0.3228 0.2548 0.2407 0.0154  -0.0524 -0.0482 863 LYS A N     
4553 C CA    . LYS A 606 ? 0.3372 0.2573 0.2493 0.0193  -0.0545 -0.0550 863 LYS A CA    
4554 C C     . LYS A 606 ? 0.3247 0.2501 0.2392 0.0210  -0.0416 -0.0494 863 LYS A C     
4555 O O     . LYS A 606 ? 0.3036 0.2389 0.2127 0.0252  -0.0322 -0.0441 863 LYS A O     
4556 C CB    . LYS A 606 ? 0.3821 0.2937 0.2707 0.0312  -0.0599 -0.0653 863 LYS A CB    
4557 C CG    . LYS A 606 ? 0.4240 0.3196 0.3069 0.0364  -0.0650 -0.0748 863 LYS A CG    
4558 C CD    . LYS A 606 ? 0.4821 0.3690 0.3379 0.0506  -0.0707 -0.0864 863 LYS A CD    
4559 C CE    . LYS A 606 ? 0.5279 0.4001 0.3740 0.0601  -0.0725 -0.0961 863 LYS A CE    
4560 N NZ    . LYS A 606 ? 0.5875 0.4548 0.4022 0.0777  -0.0743 -0.1067 863 LYS A NZ    
4561 N N     . VAL A 607 ? 0.3118 0.2312 0.2365 0.0172  -0.0419 -0.0493 864 VAL A N     
4562 C CA    . VAL A 607 ? 0.2946 0.2187 0.2234 0.0182  -0.0317 -0.0439 864 VAL A CA    
4563 C C     . VAL A 607 ? 0.3323 0.2456 0.2557 0.0248  -0.0332 -0.0501 864 VAL A C     
4564 O O     . VAL A 607 ? 0.3630 0.2634 0.2900 0.0226  -0.0427 -0.0556 864 VAL A O     
4565 C CB    . VAL A 607 ? 0.2731 0.2019 0.2189 0.0084  -0.0297 -0.0364 864 VAL A CB    
4566 C CG1   . VAL A 607 ? 0.2514 0.1827 0.2021 0.0086  -0.0226 -0.0318 864 VAL A CG1   
4567 C CG2   . VAL A 607 ? 0.2478 0.1874 0.1968 0.0050  -0.0265 -0.0310 864 VAL A CG2   
4568 N N     . ASP A 608 ? 0.3340 0.2524 0.2500 0.0334  -0.0245 -0.0489 865 ASP A N     
4569 C CA    . ASP A 608 ? 0.3574 0.2676 0.2694 0.0413  -0.0242 -0.0538 865 ASP A CA    
4570 C C     . ASP A 608 ? 0.3412 0.2567 0.2687 0.0366  -0.0183 -0.0457 865 ASP A C     
4571 O O     . ASP A 608 ? 0.3166 0.2433 0.2525 0.0306  -0.0129 -0.0373 865 ASP A O     
4572 C CB    . ASP A 608 ? 0.4031 0.3183 0.2981 0.0557  -0.0175 -0.0563 865 ASP A CB    
4573 C CG    . ASP A 608 ? 0.4732 0.3815 0.3478 0.0631  -0.0248 -0.0660 865 ASP A CG    
4574 O OD1   . ASP A 608 ? 0.5462 0.4378 0.4168 0.0625  -0.0377 -0.0764 865 ASP A OD1   
4575 O OD2   . ASP A 608 ? 0.5206 0.4401 0.3836 0.0698  -0.0183 -0.0627 865 ASP A OD2   
4576 N N     . TYR A 609 ? 0.3373 0.2434 0.2679 0.0396  -0.0206 -0.0487 866 TYR A N     
4577 C CA    . TYR A 609 ? 0.3330 0.2436 0.2777 0.0353  -0.0166 -0.0409 866 TYR A CA    
4578 C C     . TYR A 609 ? 0.3298 0.2348 0.2743 0.0445  -0.0153 -0.0436 866 TYR A C     
4579 O O     . TYR A 609 ? 0.3144 0.2063 0.2488 0.0533  -0.0202 -0.0533 866 TYR A O     
4580 C CB    . TYR A 609 ? 0.3511 0.2565 0.3081 0.0235  -0.0228 -0.0374 866 TYR A CB    
4581 C CG    . TYR A 609 ? 0.4050 0.2936 0.3622 0.0230  -0.0334 -0.0442 866 TYR A CG    
4582 C CD1   . TYR A 609 ? 0.4599 0.3434 0.4128 0.0206  -0.0408 -0.0495 866 TYR A CD1   
4583 C CD2   . TYR A 609 ? 0.4465 0.3238 0.4097 0.0250  -0.0374 -0.0453 866 TYR A CD2   
4584 C CE1   . TYR A 609 ? 0.4987 0.3655 0.4542 0.0192  -0.0529 -0.0558 866 TYR A CE1   
4585 C CE2   . TYR A 609 ? 0.4977 0.3569 0.4630 0.0242  -0.0490 -0.0516 866 TYR A CE2   
4586 C CZ    . TYR A 609 ? 0.5273 0.3813 0.4894 0.0208  -0.0572 -0.0569 866 TYR A CZ    
4587 O OH    . TYR A 609 ? 0.6067 0.4417 0.5735 0.0189  -0.0713 -0.0631 866 TYR A OH    
4588 N N     . HIS A 610 ? 0.3038 0.2177 0.2595 0.0431  -0.0097 -0.0354 867 HIS A N     
4589 C CA    . HIS A 610 ? 0.3235 0.2359 0.2822 0.0523  -0.0071 -0.0356 867 HIS A CA    
4590 C C     . HIS A 610 ? 0.3025 0.2210 0.2771 0.0451  -0.0063 -0.0262 867 HIS A C     
4591 O O     . HIS A 610 ? 0.2759 0.2030 0.2561 0.0361  -0.0054 -0.0198 867 HIS A O     
4592 C CB    . HIS A 610 ? 0.3503 0.2757 0.3029 0.0647  0.0029  -0.0342 867 HIS A CB    
4593 C CG    . HIS A 610 ? 0.3819 0.3051 0.3151 0.0734  0.0036  -0.0422 867 HIS A CG    
4594 N ND1   . HIS A 610 ? 0.4406 0.3515 0.3588 0.0866  0.0008  -0.0533 867 HIS A ND1   
4595 C CD2   . HIS A 610 ? 0.3796 0.3113 0.3052 0.0713  0.0062  -0.0403 867 HIS A CD2   
4596 C CE1   . HIS A 610 ? 0.4515 0.3634 0.3514 0.0928  0.0013  -0.0587 867 HIS A CE1   
4597 N NE2   . HIS A 610 ? 0.4243 0.3497 0.3298 0.0830  0.0050  -0.0498 867 HIS A NE2   
4598 N N     . TYR A 611 ? 0.3014 0.2152 0.2823 0.0504  -0.0072 -0.0256 868 TYR A N     
4599 C CA    . TYR A 611 ? 0.2827 0.2033 0.2777 0.0451  -0.0070 -0.0163 868 TYR A CA    
4600 C C     . TYR A 611 ? 0.2768 0.1998 0.2785 0.0556  -0.0039 -0.0147 868 TYR A C     
4601 O O     . TYR A 611 ? 0.2771 0.1916 0.2719 0.0668  -0.0035 -0.0221 868 TYR A O     
4602 C CB    . TYR A 611 ? 0.3067 0.2175 0.3060 0.0349  -0.0147 -0.0141 868 TYR A CB    
4603 C CG    . TYR A 611 ? 0.3437 0.2363 0.3434 0.0378  -0.0216 -0.0189 868 TYR A CG    
4604 C CD1   . TYR A 611 ? 0.3679 0.2555 0.3760 0.0426  -0.0234 -0.0162 868 TYR A CD1   
4605 C CD2   . TYR A 611 ? 0.3739 0.2538 0.3675 0.0357  -0.0275 -0.0260 868 TYR A CD2   
4606 C CE1   . TYR A 611 ? 0.4101 0.2784 0.4201 0.0453  -0.0310 -0.0206 868 TYR A CE1   
4607 C CE2   . TYR A 611 ? 0.4014 0.2624 0.3977 0.0376  -0.0361 -0.0306 868 TYR A CE2   
4608 C CZ    . TYR A 611 ? 0.4373 0.2918 0.4417 0.0424  -0.0378 -0.0280 868 TYR A CZ    
4609 O OH    . TYR A 611 ? 0.4789 0.3120 0.4868 0.0443  -0.0476 -0.0328 868 TYR A OH    
4610 N N     . GLY A 612 ? 0.2570 0.1915 0.2721 0.0529  -0.0024 -0.0054 869 GLY A N     
4611 C CA    . GLY A 612 ? 0.2613 0.2000 0.2865 0.0623  -0.0001 -0.0021 869 GLY A CA    
4612 C C     . GLY A 612 ? 0.2500 0.2024 0.2916 0.0566  -0.0009 0.0091  869 GLY A C     
4613 O O     . GLY A 612 ? 0.2391 0.1934 0.2813 0.0455  -0.0050 0.0125  869 GLY A O     
4614 N N     . SER A 613 ? 0.2601 0.2216 0.3146 0.0651  0.0022  0.0143  870 SER A N     
4615 C CA    . SER A 613 ? 0.2674 0.2400 0.3393 0.0601  -0.0016 0.0247  870 SER A CA    
4616 C C     . SER A 613 ? 0.2550 0.2455 0.3371 0.0542  0.0004  0.0322  870 SER A C     
4617 O O     . SER A 613 ? 0.2478 0.2453 0.3426 0.0478  -0.0058 0.0395  870 SER A O     
4618 C CB    . SER A 613 ? 0.2891 0.2686 0.3751 0.0719  0.0014  0.0292  870 SER A CB    
4619 O OG    . SER A 613 ? 0.3422 0.3041 0.4224 0.0772  -0.0024 0.0235  870 SER A OG    
4620 N N     . THR A 614 ? 0.2411 0.2393 0.3193 0.0576  0.0083  0.0312  871 THR A N     
4621 C CA    . THR A 614 ? 0.2404 0.2547 0.3305 0.0520  0.0101  0.0395  871 THR A CA    
4622 C C     . THR A 614 ? 0.2392 0.2504 0.3135 0.0506  0.0145  0.0342  871 THR A C     
4623 O O     . THR A 614 ? 0.2416 0.2410 0.2977 0.0559  0.0169  0.0246  871 THR A O     
4624 C CB    . THR A 614 ? 0.2484 0.2847 0.3591 0.0613  0.0185  0.0504  871 THR A CB    
4625 O OG1   . THR A 614 ? 0.2706 0.3102 0.3697 0.0736  0.0300  0.0469  871 THR A OG1   
4626 C CG2   . THR A 614 ? 0.2439 0.2843 0.3694 0.0674  0.0166  0.0549  871 THR A CG2   
4627 N N     . TRP A 615 ? 0.2255 0.2462 0.3075 0.0433  0.0143  0.0403  872 TRP A N     
4628 C CA    . TRP A 615 ? 0.2421 0.2605 0.3105 0.0421  0.0182  0.0366  872 TRP A CA    
4629 C C     . TRP A 615 ? 0.2458 0.2717 0.3069 0.0558  0.0297  0.0362  872 TRP A C     
4630 O O     . TRP A 615 ? 0.2475 0.2654 0.2894 0.0589  0.0319  0.0283  872 TRP A O     
4631 C CB    . TRP A 615 ? 0.2457 0.2739 0.3284 0.0329  0.0156  0.0454  872 TRP A CB    
4632 C CG    . TRP A 615 ? 0.2430 0.2680 0.3147 0.0294  0.0171  0.0429  872 TRP A CG    
4633 C CD1   . TRP A 615 ? 0.2480 0.2617 0.2974 0.0316  0.0188  0.0329  872 TRP A CD1   
4634 C CD2   . TRP A 615 ? 0.2443 0.2764 0.3284 0.0220  0.0150  0.0510  872 TRP A CD2   
4635 N NE1   . TRP A 615 ? 0.2502 0.2652 0.2969 0.0272  0.0192  0.0347  872 TRP A NE1   
4636 C CE2   . TRP A 615 ? 0.2445 0.2689 0.3110 0.0211  0.0168  0.0451  872 TRP A CE2   
4637 C CE3   . TRP A 615 ? 0.2457 0.2882 0.3548 0.0157  0.0105  0.0625  872 TRP A CE3   
4638 C CZ2   . TRP A 615 ? 0.2560 0.2835 0.3294 0.0152  0.0153  0.0509  872 TRP A CZ2   
4639 C CZ3   . TRP A 615 ? 0.2474 0.2913 0.3641 0.0089  0.0079  0.0679  872 TRP A CZ3   
4640 C CH2   . TRP A 615 ? 0.2501 0.2864 0.3486 0.0091  0.0107  0.0622  872 TRP A CH2   
4641 N N     . TYR A 616 ? 0.2542 0.2964 0.3303 0.0648  0.0369  0.0451  873 TYR A N     
4642 C CA    . TYR A 616 ? 0.2964 0.3475 0.3638 0.0812  0.0491  0.0450  873 TYR A CA    
4643 C C     . TYR A 616 ? 0.3332 0.3638 0.3750 0.0902  0.0475  0.0287  873 TYR A C     
4644 O O     . TYR A 616 ? 0.3309 0.3580 0.3527 0.0988  0.0522  0.0220  873 TYR A O     
4645 C CB    . TYR A 616 ? 0.3164 0.3872 0.4054 0.0907  0.0562  0.0564  873 TYR A CB    
4646 C CG    . TYR A 616 ? 0.3482 0.4294 0.4273 0.1115  0.0700  0.0562  873 TYR A CG    
4647 C CD1   . TYR A 616 ? 0.3616 0.4642 0.4437 0.1182  0.0822  0.0675  873 TYR A CD1   
4648 C CD2   . TYR A 616 ? 0.3735 0.4433 0.4405 0.1253  0.0708  0.0455  873 TYR A CD2   
4649 C CE1   . TYR A 616 ? 0.3965 0.5108 0.4674 0.1393  0.0959  0.0680  873 TYR A CE1   
4650 C CE2   . TYR A 616 ? 0.4042 0.4828 0.4597 0.1467  0.0832  0.0440  873 TYR A CE2   
4651 C CZ    . TYR A 616 ? 0.4089 0.5107 0.4648 0.1543  0.0964  0.0552  873 TYR A CZ    
4652 O OH    . TYR A 616 ? 0.4515 0.5647 0.4935 0.1776  0.1102  0.0548  873 TYR A OH    
4653 N N     . ASP A 617 ? 0.3523 0.3684 0.3955 0.0876  0.0393  0.0228  874 ASP A N     
4654 C CA    . ASP A 617 ? 0.3904 0.3855 0.4147 0.0953  0.0356  0.0087  874 ASP A CA    
4655 C C     . ASP A 617 ? 0.4044 0.3824 0.4131 0.0857  0.0279  -0.0004 874 ASP A C     
4656 O O     . ASP A 617 ? 0.4518 0.4123 0.4448 0.0913  0.0239  -0.0122 874 ASP A O     
4657 C CB    . ASP A 617 ? 0.4174 0.4028 0.4514 0.0950  0.0290  0.0079  874 ASP A CB    
4658 C CG    . ASP A 617 ? 0.4406 0.4434 0.4935 0.1038  0.0352  0.0177  874 ASP A CG    
4659 O OD1   . ASP A 617 ? 0.4813 0.4917 0.5297 0.1208  0.0448  0.0166  874 ASP A OD1   
4660 O OD2   . ASP A 617 ? 0.4602 0.4703 0.5323 0.0944  0.0305  0.0269  874 ASP A OD2   
4661 N N     . ALA A 618 ? 0.3663 0.3479 0.3798 0.0716  0.0246  0.0043  875 ALA A N     
4662 C CA    . ALA A 618 ? 0.3981 0.3656 0.3979 0.0635  0.0182  -0.0036 875 ALA A CA    
4663 C C     . ALA A 618 ? 0.4536 0.4242 0.4380 0.0702  0.0235  -0.0074 875 ALA A C     
4664 O O     . ALA A 618 ? 0.4185 0.3932 0.4009 0.0630  0.0235  -0.0050 875 ALA A O     
4665 C CB    . ALA A 618 ? 0.3545 0.3235 0.3625 0.0484  0.0128  0.0016  875 ALA A CB    
4666 N N     . LYS A 619 ? 0.5506 0.5178 0.5227 0.0853  0.0274  -0.0141 876 LYS A N     
4667 C CA    . LYS A 619 ? 0.6042 0.5764 0.5584 0.0965  0.0337  -0.0175 876 LYS A CA    
4668 C C     . LYS A 619 ? 0.6440 0.5969 0.5772 0.1085  0.0287  -0.0331 876 LYS A C     
4669 O O     . LYS A 619 ? 0.7209 0.6724 0.6337 0.1182  0.0304  -0.0397 876 LYS A O     
4670 C CB    . LYS A 619 ? 0.6295 0.6245 0.5904 0.1089  0.0472  -0.0068 876 LYS A CB    
4671 C CG    . LYS A 619 ? 0.6289 0.6225 0.5910 0.1238  0.0506  -0.0099 876 LYS A CG    
4672 C CD    . LYS A 619 ? 0.6109 0.6294 0.5788 0.1393  0.0657  0.0010  876 LYS A CD    
4673 C CE    . LYS A 619 ? 0.6367 0.6538 0.6120 0.1513  0.0676  -0.0008 876 LYS A CE    
4674 N NZ    . LYS A 619 ? 0.6860 0.7137 0.6477 0.1758  0.0800  -0.0022 876 LYS A NZ    
4675 O OXT   . LYS A 619 ? 0.6611 0.5986 0.5967 0.1096  0.0219  -0.0396 876 LYS A OXT   
4897 P P     . DT  C 3   ? 1.0995 1.3135 0.6833 0.1999  -0.2263 -0.0349 4   DT  C P     
4898 O OP1   . DT  C 3   ? 1.0874 1.4385 0.6710 0.2206  -0.2327 -0.0624 4   DT  C OP1   
4899 O OP2   . DT  C 3   ? 1.0968 1.2626 0.6925 0.1759  -0.2277 -0.0602 4   DT  C OP2   
4900 O "O5'" . DT  C 3   ? 1.0692 1.1983 0.6643 0.1782  -0.2269 -0.0400 4   DT  C "O5'" 
4901 C "C5'" . DT  C 3   ? 1.0473 1.0663 0.6561 0.1469  -0.2259 -0.0505 4   DT  C "C5'" 
4902 C "C4'" . DT  C 3   ? 1.0378 1.0156 0.6609 0.1305  -0.2278 -0.0675 4   DT  C "C4'" 
4903 O "O4'" . DT  C 3   ? 1.0313 1.0420 0.6846 0.1114  -0.2322 -0.1280 4   DT  C "O4'" 
4904 C "C3'" . DT  C 3   ? 1.0265 0.8877 0.6526 0.1110  -0.2234 -0.0486 4   DT  C "C3'" 
4905 O "O3'" . DT  C 3   ? 1.0281 0.8582 0.6391 0.1242  -0.2184 -0.0044 4   DT  C "O3'" 
4906 C "C2'" . DT  C 3   ? 1.0181 0.8591 0.6716 0.0881  -0.2255 -0.0902 4   DT  C "C2'" 
4907 C "C1'" . DT  C 3   ? 1.0179 0.9393 0.6929 0.0847  -0.2285 -0.1407 4   DT  C "C1'" 
4908 N N1    . DT  C 3   ? 1.0032 0.8977 0.6964 0.0681  -0.2248 -0.1618 4   DT  C N1    
4909 C C2    . DT  C 3   ? 0.9917 0.8239 0.7167 0.0441  -0.2180 -0.1833 4   DT  C C2    
4910 O O2    . DT  C 3   ? 0.9925 0.7915 0.7303 0.0361  -0.2154 -0.1859 4   DT  C O2    
4911 N N3    . DT  C 3   ? 0.9832 0.7952 0.7267 0.0317  -0.2125 -0.1991 4   DT  C N3    
4912 C C4    . DT  C 3   ? 0.9880 0.8340 0.7195 0.0390  -0.2149 -0.1983 4   DT  C C4    
4913 O O4    . DT  C 3   ? 0.9865 0.8076 0.7385 0.0258  -0.2087 -0.2137 4   DT  C O4    
4914 C C5    . DT  C 3   ? 0.9994 0.9118 0.6961 0.0645  -0.2227 -0.1755 4   DT  C C5    
4915 C C7    . DT  C 3   ? 1.0081 0.9644 0.6903 0.0761  -0.2245 -0.1702 4   DT  C C7    
4916 C C6    . DT  C 3   ? 1.0017 0.9353 0.6824 0.0784  -0.2262 -0.1571 4   DT  C C6    
4917 O O1P   . FOX C 4   ? 1.0672 0.7855 0.6693 0.1300  -0.2036 0.0656  5   FOX C O1P   
4918 P P     . FOX C 4   ? 1.0341 0.7719 0.6402 0.1184  -0.2102 0.0324  5   FOX C P     
4919 O O2P   . FOX C 4   ? 1.0340 0.7764 0.6330 0.1253  -0.2059 0.0474  5   FOX C O2P   
4920 O "O5'" . FOX C 4   ? 1.0265 0.6960 0.6482 0.0895  -0.2133 0.0053  5   FOX C "O5'" 
4921 C "C5'" . FOX C 4   ? 1.0518 0.6559 0.6755 0.0810  -0.2104 0.0202  5   FOX C "C5'" 
4922 C "C4'" . FOX C 4   ? 1.0495 0.6484 0.6884 0.0676  -0.2145 -0.0083 5   FOX C "C4'" 
4923 C "C6'" . FOX C 4   ? 1.0521 0.7192 0.7036 0.0673  -0.2188 -0.0454 5   FOX C "C6'" 
4924 C "C3'" . FOX C 4   ? 1.0174 0.5564 0.6695 0.0482  -0.2122 -0.0180 5   FOX C "C3'" 
4925 O "O3'" . FOX C 4   ? 0.9827 0.4870 0.6400 0.0423  -0.2114 -0.0144 5   FOX C "O3'" 
4926 C "C2'" . FOX C 4   ? 1.0347 0.5975 0.7099 0.0372  -0.2116 -0.0551 5   FOX C "C2'" 
4927 C "C1'" . FOX C 4   ? 1.0447 0.6877 0.7184 0.0486  -0.2161 -0.0731 5   FOX C "C1'" 
4928 N N9    . FOX C 4   ? 1.0761 0.7388 0.7408 0.0539  -0.2162 -0.0694 5   FOX C N9    
4929 C C4    . FOX C 4   ? 1.0814 0.7187 0.7612 0.0404  -0.2125 -0.0843 5   FOX C C4    
4930 N N3    . FOX C 4   ? 1.0861 0.6802 0.7923 0.0235  -0.2063 -0.1000 5   FOX C N3    
4931 C C2    . FOX C 4   ? 1.0943 0.6643 0.8191 0.0123  -0.1995 -0.1110 5   FOX C C2    
4932 N N2    . FOX C 4   ? 1.0930 0.6229 0.8483 -0.0006 -0.1892 -0.1202 5   FOX C N2    
4933 N N1    . FOX C 4   ? 1.0951 0.6808 0.8113 0.0152  -0.2008 -0.1105 5   FOX C N1    
4934 C C6    . FOX C 4   ? 1.0862 0.7141 0.7754 0.0306  -0.2078 -0.0970 5   FOX C C6    
4935 O O6    . FOX C 4   ? 1.0705 0.7135 0.7526 0.0339  -0.2082 -0.0956 5   FOX C O6    
4936 C C5    . FOX C 4   ? 1.0979 0.7562 0.7679 0.0459  -0.2130 -0.0806 5   FOX C C5    
4937 N N7    . FOX C 4   ? 1.1161 0.8207 0.7629 0.0658  -0.2159 -0.0601 5   FOX C N7    
4938 C C8    . FOX C 4   ? 1.1195 0.8297 0.7559 0.0714  -0.2146 -0.0483 5   FOX C C8    
4939 O O8    . FOX C 4   ? 1.1509 0.9073 0.7698 0.0920  -0.2145 -0.0270 5   FOX C O8    
4940 P P     . DA  C 5   ? 0.9461 0.3989 0.5933 0.0427  -0.2083 0.0143  6   DA  C P     
4941 O OP1   . DA  C 5   ? 0.9463 0.3902 0.5952 0.0434  -0.2091 0.0181  6   DA  C OP1   
4942 O OP2   . DA  C 5   ? 0.9605 0.4183 0.5955 0.0536  -0.2051 0.0365  6   DA  C OP2   
4943 O "O5'" . DA  C 5   ? 0.9465 0.3602 0.6037 0.0293  -0.2055 0.0074  6   DA  C "O5'" 
4944 C "C5'" . DA  C 5   ? 0.9185 0.3396 0.5835 0.0242  -0.2039 -0.0060 6   DA  C "C5'" 
4945 C "C4'" . DA  C 5   ? 0.8958 0.2805 0.5723 0.0150  -0.1984 -0.0056 6   DA  C "C4'" 
4946 O "O4'" . DA  C 5   ? 0.8945 0.2863 0.5833 0.0102  -0.1946 -0.0189 6   DA  C "O4'" 
4947 C "C3'" . DA  C 5   ? 0.8854 0.2411 0.5484 0.0164  -0.1981 0.0148  6   DA  C "C3'" 
4948 O "O3'" . DA  C 5   ? 0.8557 0.1898 0.5281 0.0123  -0.1936 0.0177  6   DA  C "O3'" 
4949 C "C2'" . DA  C 5   ? 0.8896 0.2484 0.5470 0.0167  -0.1975 0.0163  6   DA  C "C2'" 
4950 C "C1'" . DA  C 5   ? 0.8872 0.2642 0.5616 0.0118  -0.1950 -0.0045 6   DA  C "C1'" 
4951 N N9    . DA  C 5   ? 0.8896 0.2974 0.5578 0.0157  -0.1979 -0.0113 6   DA  C N9    
4952 C C8    . DA  C 5   ? 0.8930 0.3299 0.5451 0.0267  -0.2023 -0.0028 6   DA  C C8    
4953 N N7    . DA  C 5   ? 0.8872 0.3567 0.5365 0.0308  -0.2034 -0.0098 6   DA  C N7    
4954 C C5    . DA  C 5   ? 0.8828 0.3394 0.5490 0.0195  -0.1998 -0.0269 6   DA  C C5    
4955 C C6    . DA  C 5   ? 0.8817 0.3595 0.5564 0.0166  -0.1984 -0.0433 6   DA  C C6    
4956 N N6    . DA  C 5   ? 0.8804 0.4035 0.5437 0.0261  -0.2024 -0.0454 6   DA  C N6    
4957 N N1    . DA  C 5   ? 0.8795 0.3337 0.5773 0.0052  -0.1910 -0.0558 6   DA  C N1    
4958 C C2    . DA  C 5   ? 0.8821 0.2985 0.5919 -0.0002 -0.1850 -0.0487 6   DA  C C2    
4959 N N3    . DA  C 5   ? 0.8756 0.2741 0.5764 0.0025  -0.1870 -0.0340 6   DA  C N3    
4960 C C4    . DA  C 5   ? 0.8824 0.3006 0.5616 0.0112  -0.1951 -0.0256 6   DA  C C4    
4961 P P     . DG  C 6   ? 0.8438 0.1614 0.5076 0.0130  -0.1926 0.0306  7   DG  C P     
4962 O OP1   . DG  C 6   ? 0.8473 0.1594 0.5182 0.0138  -0.1894 0.0352  7   DG  C OP1   
4963 O OP2   . DG  C 6   ? 0.8434 0.1606 0.4954 0.0159  -0.1954 0.0373  7   DG  C OP2   
4964 O "O5'" . DG  C 6   ? 0.8281 0.1443 0.4967 0.0106  -0.1886 0.0286  7   DG  C "O5'" 
4965 C "C5'" . DG  C 6   ? 0.8222 0.1359 0.5114 0.0088  -0.1798 0.0256  7   DG  C "C5'" 
4966 C "C4'" . DG  C 6   ? 0.8174 0.1271 0.5082 0.0086  -0.1752 0.0300  7   DG  C "C4'" 
4967 O "O4'" . DG  C 6   ? 0.8165 0.1338 0.5046 0.0053  -0.1781 0.0192  7   DG  C "O4'" 
4968 C "C3'" . DG  C 6   ? 0.8091 0.1172 0.4827 0.0118  -0.1787 0.0411  7   DG  C "C3'" 
4969 O "O3'" . DG  C 6   ? 0.8056 0.1153 0.4873 0.0153  -0.1707 0.0499  7   DG  C "O3'" 
4970 C "C2'" . DG  C 6   ? 0.8104 0.1188 0.4705 0.0096  -0.1847 0.0372  7   DG  C "C2'" 
4971 C "C1'" . DG  C 6   ? 0.8145 0.1288 0.4844 0.0067  -0.1825 0.0269  7   DG  C "C1'" 
4972 N N9    . DG  C 6   ? 0.8174 0.1447 0.4767 0.0078  -0.1882 0.0221  7   DG  C N9    
4973 C C8    . DG  C 6   ? 0.8221 0.1565 0.4708 0.0125  -0.1927 0.0270  7   DG  C C8    
4974 N N7    . DG  C 6   ? 0.8248 0.1788 0.4667 0.0172  -0.1946 0.0268  7   DG  C N7    
4975 C C5    . DG  C 6   ? 0.8218 0.1815 0.4691 0.0133  -0.1932 0.0172  7   DG  C C5    
4976 C C6    . DG  C 6   ? 0.8266 0.2121 0.4704 0.0165  -0.1945 0.0114  7   DG  C C6    
4977 O O6    . DG  C 6   ? 0.8296 0.2425 0.4631 0.0260  -0.1967 0.0172  7   DG  C O6    
4978 N N1    . DG  C 6   ? 0.8232 0.2053 0.4787 0.0096  -0.1911 -0.0004 7   DG  C N1    
4979 C C2    . DG  C 6   ? 0.8214 0.1784 0.4918 0.0029  -0.1849 -0.0017 7   DG  C C2    
4980 N N2    . DG  C 6   ? 0.8215 0.1783 0.5065 -0.0018 -0.1791 -0.0110 7   DG  C N2    
4981 N N3    . DG  C 6   ? 0.8176 0.1554 0.4901 0.0027  -0.1829 0.0075  7   DG  C N3    
4982 C C4    . DG  C 6   ? 0.8191 0.1596 0.4789 0.0071  -0.1884 0.0144  7   DG  C C4    
4983 P P     . DA  C 7   ? 0.3560 0.5520 0.4029 0.0488  -0.0227 -0.0550 8   DA  C P     
4984 O OP1   . DA  C 7   ? 0.3365 0.5804 0.4230 0.0578  0.0068  -0.0217 8   DA  C OP1   
4985 O OP2   . DA  C 7   ? 0.3691 0.5547 0.3655 0.0554  -0.0533 -0.0747 8   DA  C OP2   
4986 O "O5'" . DA  C 7   ? 0.3641 0.5284 0.3988 0.0329  -0.0208 -0.0479 8   DA  C "O5'" 
4987 C "C5'" . DA  C 7   ? 0.3681 0.5259 0.4490 0.0226  0.0040  -0.0419 8   DA  C "C5'" 
4988 C "C4'" . DA  C 7   ? 0.3844 0.5148 0.4427 0.0086  -0.0001 -0.0379 8   DA  C "C4'" 
4989 O "O4'" . DA  C 7   ? 0.4022 0.5004 0.4329 0.0021  -0.0215 -0.0669 8   DA  C "O4'" 
4990 C "C3'" . DA  C 7   ? 0.4002 0.5331 0.4126 0.0087  -0.0130 -0.0236 8   DA  C "C3'" 
4991 O "O3'" . DA  C 7   ? 0.4105 0.5488 0.4368 0.0006  0.0049  -0.0007 8   DA  C "O3'" 
4992 C "C2'" . DA  C 7   ? 0.4225 0.5136 0.3830 0.0029  -0.0422 -0.0477 8   DA  C "C2'" 
4993 C "C1'" . DA  C 7   ? 0.4223 0.4934 0.3992 -0.0032 -0.0406 -0.0642 8   DA  C "C1'" 
4994 N N9    . DA  C 7   ? 0.4422 0.4877 0.3817 0.0021  -0.0652 -0.0868 8   DA  C N9    
4995 C C8    . DA  C 7   ? 0.4562 0.4985 0.3728 0.0167  -0.0827 -0.0987 8   DA  C C8    
4996 N N7    . DA  C 7   ? 0.4797 0.4985 0.3653 0.0234  -0.1001 -0.1125 8   DA  C N7    
4997 C C5    . DA  C 7   ? 0.4804 0.4912 0.3667 0.0117  -0.0948 -0.1110 8   DA  C C5    
4998 C C6    . DA  C 7   ? 0.5029 0.5006 0.3625 0.0147  -0.1057 -0.1188 8   DA  C C6    
4999 N N6    . DA  C 7   ? 0.5320 0.5189 0.3577 0.0337  -0.1234 -0.1255 8   DA  C N6    
5000 N N1    . DA  C 7   ? 0.4982 0.4995 0.3679 0.0003  -0.0962 -0.1174 8   DA  C N1    
5001 C C2    . DA  C 7   ? 0.4735 0.4844 0.3799 -0.0156 -0.0761 -0.1079 8   DA  C C2    
5002 N N3    . DA  C 7   ? 0.4489 0.4715 0.3828 -0.0170 -0.0627 -0.0950 8   DA  C N3    
5003 C C4    . DA  C 7   ? 0.4563 0.4809 0.3770 -0.0030 -0.0737 -0.0977 8   DA  C C4    
5004 P P     . DG  C 8   ? 0.4202 0.5904 0.4233 0.0033  0.0050  0.0205  9   DG  C P     
5005 O OP1   . DG  C 8   ? 0.4242 0.6440 0.4716 0.0173  0.0360  0.0569  9   DG  C OP1   
5006 O OP2   . DG  C 8   ? 0.4313 0.6054 0.3908 0.0063  -0.0205 0.0010  9   DG  C OP2   
5007 O "O5'" . DG  C 8   ? 0.4278 0.5645 0.4145 -0.0151 0.0026  0.0184  9   DG  C "O5'" 
5008 C "C5'" . DG  C 8   ? 0.4230 0.5327 0.4394 -0.0250 0.0151  0.0145  9   DG  C "C5'" 
5009 C "C4'" . DG  C 8   ? 0.4358 0.5099 0.4165 -0.0419 0.0006  0.0020  9   DG  C "C4'" 
5010 O "O4'" . DG  C 8   ? 0.4533 0.4943 0.4049 -0.0438 -0.0214 -0.0246 9   DG  C "O4'" 
5011 C "C3'" . DG  C 8   ? 0.4493 0.5287 0.3894 -0.0473 -0.0100 0.0081  9   DG  C "C3'" 
5012 O "O3'" . DG  C 8   ? 0.4474 0.5187 0.3885 -0.0609 -0.0017 0.0159  9   DG  C "O3'" 
5013 C "C2'" . DG  C 8   ? 0.4766 0.5190 0.3705 -0.0508 -0.0357 -0.0155 9   DG  C "C2'" 
5014 C "C1'" . DG  C 8   ? 0.4866 0.5008 0.3866 -0.0508 -0.0400 -0.0296 9   DG  C "C1'" 
5015 N N9    . DG  C 8   ? 0.5145 0.5059 0.3862 -0.0418 -0.0598 -0.0469 9   DG  C N9    
5016 C C8    . DG  C 8   ? 0.5228 0.5260 0.3922 -0.0284 -0.0673 -0.0529 9   DG  C C8    
5017 N N7    . DG  C 8   ? 0.5535 0.5293 0.3969 -0.0201 -0.0839 -0.0676 9   DG  C N7    
5018 C C5    . DG  C 8   ? 0.5664 0.5151 0.3920 -0.0267 -0.0872 -0.0685 9   DG  C C5    
5019 C C6    . DG  C 8   ? 0.6088 0.5287 0.4027 -0.0174 -0.1010 -0.0756 9   DG  C C6    
5020 O O6    . DG  C 8   ? 0.6403 0.5476 0.4169 -0.0009 -0.1129 -0.0827 9   DG  C O6    
5021 N N1    . DG  C 8   ? 0.6207 0.5315 0.4040 -0.0261 -0.0986 -0.0715 9   DG  C N1    
5022 C C2    . DG  C 8   ? 0.6024 0.5255 0.4053 -0.0437 -0.0852 -0.0651 9   DG  C C2    
5023 N N2    . DG  C 8   ? 0.6228 0.5394 0.4117 -0.0499 -0.0854 -0.0646 9   DG  C N2    
5024 N N3    . DG  C 8   ? 0.5513 0.4963 0.3855 -0.0518 -0.0715 -0.0577 9   DG  C N3    
5025 C C4    . DG  C 8   ? 0.5435 0.5020 0.3864 -0.0416 -0.0732 -0.0583 9   DG  C C4    
5026 P P     . DT  C 9   ? 0.4618 0.5470 0.3736 -0.0701 -0.0057 0.0215  10  DT  C P     
5027 O OP1   . DT  C 9   ? 0.4525 0.5515 0.3917 -0.0746 0.0142  0.0401  10  DT  C OP1   
5028 O OP2   . DT  C 9   ? 0.4438 0.5690 0.3434 -0.0603 -0.0115 0.0209  10  DT  C OP2   
5029 O "O5'" . DT  C 9   ? 0.4761 0.5068 0.3452 -0.0866 -0.0247 0.0000  10  DT  C "O5'" 
5030 C "C5'" . DT  C 9   ? 0.4877 0.4886 0.3587 -0.0963 -0.0230 -0.0039 10  DT  C "C5'" 
5031 C "C4'" . DT  C 9   ? 0.5271 0.4836 0.3527 -0.1048 -0.0399 -0.0171 10  DT  C "C4'" 
5032 O "O4'" . DT  C 9   ? 0.5508 0.4912 0.3641 -0.0915 -0.0528 -0.0279 10  DT  C "O4'" 
5033 C "C3'" . DT  C 9   ? 0.5486 0.4984 0.3464 -0.1170 -0.0430 -0.0188 10  DT  C "C3'" 
5034 O "O3'" . DT  C 9   ? 0.5604 0.4927 0.3450 -0.1336 -0.0392 -0.0158 10  DT  C "O3'" 
5035 C "C2'" . DT  C 9   ? 0.5786 0.4960 0.3507 -0.1113 -0.0561 -0.0319 10  DT  C "C2'" 
5036 C "C1'" . DT  C 9   ? 0.5872 0.4911 0.3622 -0.0958 -0.0632 -0.0339 10  DT  C "C1'" 
5037 N N1    . DT  C 9   ? 0.6076 0.5039 0.3767 -0.0801 -0.0735 -0.0436 10  DT  C N1    
5038 C C2    . DT  C 9   ? 0.6460 0.5059 0.3914 -0.0697 -0.0836 -0.0474 10  DT  C C2    
5039 O O2    . DT  C 9   ? 0.6640 0.5021 0.3910 -0.0718 -0.0844 -0.0416 10  DT  C O2    
5040 N N3    . DT  C 9   ? 0.6460 0.5019 0.3895 -0.0538 -0.0922 -0.0566 10  DT  C N3    
5041 C C4    . DT  C 9   ? 0.6352 0.5220 0.3978 -0.0488 -0.0923 -0.0642 10  DT  C C4    
5042 O O4    . DT  C 9   ? 0.6556 0.5364 0.4148 -0.0343 -0.1007 -0.0742 10  DT  C O4    
5043 C C5    . DT  C 9   ? 0.6047 0.5353 0.3899 -0.0589 -0.0811 -0.0579 10  DT  C C5    
5044 C C7    . DT  C 9   ? 0.5934 0.5722 0.3977 -0.0503 -0.0794 -0.0620 10  DT  C C7    
5045 C C6    . DT  C 9   ? 0.5944 0.5263 0.3819 -0.0730 -0.0721 -0.0470 10  DT  C C6    
5046 P P     . DC  C 10  ? 0.5849 0.5084 0.3472 -0.1524 -0.0375 -0.0207 11  DC  C P     
5047 O OP1   . DC  C 10  ? 0.5884 0.5149 0.3518 -0.1668 -0.0292 -0.0131 11  DC  C OP1   
5048 O OP2   . DC  C 10  ? 0.5653 0.5273 0.3356 -0.1510 -0.0365 -0.0292 11  DC  C OP2   
5049 O "O5'" . DC  C 10  ? 0.6088 0.4734 0.3390 -0.1532 -0.0458 -0.0275 11  DC  C "O5'" 
5050 C "C5'" . DC  C 10  ? 0.6260 0.4613 0.3404 -0.1486 -0.0492 -0.0200 11  DC  C "C5'" 
5051 C "C4'" . DC  C 10  ? 0.6732 0.4575 0.3583 -0.1433 -0.0531 -0.0193 11  DC  C "C4'" 
5052 O "O4'" . DC  C 10  ? 0.6709 0.4521 0.3601 -0.1252 -0.0615 -0.0267 11  DC  C "O4'" 
5053 C "C3'" . DC  C 10  ? 0.7058 0.4597 0.3806 -0.1622 -0.0431 -0.0237 11  DC  C "C3'" 
5054 O "O3'" . DC  C 10  ? 0.7458 0.4585 0.3948 -0.1633 -0.0379 -0.0080 11  DC  C "O3'" 
5055 C "C2'" . DC  C 10  ? 0.7217 0.4623 0.4027 -0.1547 -0.0454 -0.0384 11  DC  C "C2'" 
5056 C "C1'" . DC  C 10  ? 0.7225 0.4642 0.4004 -0.1280 -0.0580 -0.0328 11  DC  C "C1'" 
5057 N N1    . DC  C 10  ? 0.7191 0.4775 0.4121 -0.1156 -0.0649 -0.0475 11  DC  C N1    
5058 C C2    . DC  C 10  ? 0.7567 0.4857 0.4396 -0.0944 -0.0719 -0.0469 11  DC  C C2    
5059 O O2    . DC  C 10  ? 0.7928 0.4840 0.4533 -0.0847 -0.0710 -0.0314 11  DC  C O2    
5060 N N3    . DC  C 10  ? 0.7421 0.4902 0.4395 -0.0827 -0.0788 -0.0615 11  DC  C N3    
5061 C C4    . DC  C 10  ? 0.7040 0.5037 0.4238 -0.0895 -0.0785 -0.0735 11  DC  C C4    
5062 N N4    . DC  C 10  ? 0.7023 0.5255 0.4351 -0.0765 -0.0850 -0.0870 11  DC  C N4    
5063 C C5    . DC  C 10  ? 0.6788 0.5135 0.4085 -0.1076 -0.0707 -0.0707 11  DC  C C5    
5064 C C6    . DC  C 10  ? 0.6836 0.4945 0.4001 -0.1205 -0.0646 -0.0586 11  DC  C C6    
5065 P P     . DA  C 11  ? 0.8005 0.4694 0.4389 -0.1840 -0.0207 -0.0053 12  DA  C P     
5066 O OP1   . DA  C 11  ? 0.8058 0.4626 0.4204 -0.1818 -0.0172 0.0174  12  DA  C OP1   
5067 O OP2   . DA  C 11  ? 0.7577 0.4549 0.4178 -0.2081 -0.0139 -0.0265 12  DA  C OP2   
5068 O "O5'" . DA  C 11  ? 0.8542 0.4717 0.4887 -0.1706 -0.0164 -0.0054 12  DA  C "O5'" 
5069 C "C5'" . DA  C 11  ? 0.9039 0.4968 0.5169 -0.1419 -0.0218 0.0160  12  DA  C "C5'" 
5070 C "C4'" . DA  C 11  ? 0.9793 0.5194 0.5971 -0.1326 -0.0118 0.0145  12  DA  C "C4'" 
5071 O "O4'" . DA  C 11  ? 0.9581 0.5239 0.5958 -0.1258 -0.0244 -0.0101 12  DA  C "O4'" 
5072 C "C3'" . DA  C 11  ? 1.0354 0.5333 0.6705 -0.1596 0.0129  0.0036  12  DA  C "C3'" 
5073 O "O3'" . DA  C 11  ? 1.1331 0.5639 0.7632 -0.1435 0.0304  0.0240  12  DA  C "O3'" 
5074 C "C2'" . DA  C 11  ? 1.0039 0.5324 0.6711 -0.1729 0.0086  -0.0364 12  DA  C "C2'" 
5075 C "C1'" . DA  C 11  ? 0.9735 0.5174 0.6360 -0.1426 -0.0108 -0.0349 12  DA  C "C1'" 
5076 N N9    . DA  C 11  ? 0.9159 0.5165 0.5998 -0.1446 -0.0242 -0.0636 12  DA  C N9    
5077 C C8    . DA  C 11  ? 0.8640 0.5261 0.5632 -0.1622 -0.0278 -0.0813 12  DA  C C8    
5078 N N7    . DA  C 11  ? 0.8244 0.5341 0.5400 -0.1539 -0.0383 -0.0996 12  DA  C N7    
5079 C C5    . DA  C 11  ? 0.8542 0.5291 0.5654 -0.1319 -0.0434 -0.0972 12  DA  C C5    
5080 C C6    . DA  C 11  ? 0.8402 0.5391 0.5628 -0.1145 -0.0544 -0.1117 12  DA  C C6    
5081 N N6    . DA  C 11  ? 0.7987 0.5670 0.5392 -0.1157 -0.0614 -0.1291 12  DA  C N6    
5082 N N1    . DA  C 11  ? 0.8698 0.5233 0.5842 -0.0928 -0.0570 -0.1049 12  DA  C N1    
5083 C C2    . DA  C 11  ? 0.9205 0.5117 0.6159 -0.0861 -0.0477 -0.0809 12  DA  C C2    
5084 N N3    . DA  C 11  ? 0.9394 0.5045 0.6217 -0.0998 -0.0357 -0.0626 12  DA  C N3    
5085 C C4    . DA  C 11  ? 0.9032 0.5116 0.5948 -0.1245 -0.0349 -0.0743 12  DA  C C4    
5086 P P     . DG  C 12  ? 1.2376 0.6009 0.8771 -0.1606 0.0660  0.0371  13  DG  C P     
5087 O OP1   . DG  C 12  ? 1.2445 0.6027 0.8464 -0.1429 0.0679  0.0824  13  DG  C OP1   
5088 O OP2   . DG  C 12  ? 1.2172 0.5937 0.8889 -0.2021 0.0785  -0.0009 13  DG  C OP2   
5089 O "O5'" . DG  C 12  ? 1.2820 0.5875 0.9392 -0.1396 0.0798  0.0385  13  DG  C "O5'" 
5090 C "C5'" . DG  C 12  ? 1.2793 0.5958 0.9191 -0.1009 0.0593  0.0514  13  DG  C "C5'" 
5091 C "C4'" . DG  C 12  ? 1.3168 0.5964 0.9896 -0.0946 0.0693  0.0288  13  DG  C "C4'" 
5092 O "O4'" . DG  C 12  ? 1.2437 0.5825 0.9331 -0.1041 0.0455  -0.0146 13  DG  C "O4'" 
5093 C "C3'" . DG  C 12  ? 1.3815 0.5977 1.0976 -0.1215 0.1082  0.0116  13  DG  C "C3'" 
5094 O "O3'" . DG  C 12  ? 1.4751 0.6215 1.2042 -0.0936 0.1303  0.0328  13  DG  C "O3'" 
5095 C "C2'" . DG  C 12  ? 1.3273 0.5938 1.0791 -0.1542 0.0994  -0.0499 13  DG  C "C2'" 
5096 C "C1'" . DG  C 12  ? 1.2617 0.5887 0.9965 -0.1311 0.0627  -0.0583 13  DG  C "C1'" 
5097 N N9    . DG  C 12  ? 1.1850 0.5935 0.9295 -0.1521 0.0425  -0.0959 13  DG  C N9    
5098 C C8    . DG  C 12  ? 1.1465 0.5979 0.8901 -0.1796 0.0416  -0.1053 13  DG  C C8    
5099 N N7    . DG  C 12  ? 1.0876 0.6155 0.8419 -0.1873 0.0241  -0.1346 13  DG  C N7    
5100 C C5    . DG  C 12  ? 1.0837 0.6196 0.8463 -0.1661 0.0127  -0.1470 13  DG  C C5    
5101 C C6    . DG  C 12  ? 1.0350 0.6444 0.8105 -0.1611 -0.0055 -0.1744 13  DG  C C6    
5102 O O6    . DG  C 12  ? 0.9686 0.6542 0.7505 -0.1722 -0.0142 -0.1901 13  DG  C O6    
5103 N N1    . DG  C 12  ? 1.0468 0.6385 0.8278 -0.1379 -0.0117 -0.1798 13  DG  C N1    
5104 C C2    . DG  C 12  ? 1.1039 0.6176 0.8792 -0.1190 -0.0016 -0.1597 13  DG  C C2    
5105 N N2    . DG  C 12  ? 1.1093 0.6209 0.8921 -0.0960 -0.0101 -0.1692 13  DG  C N2    
5106 N N3    . DG  C 12  ? 1.1551 0.6016 0.9180 -0.1198 0.0169  -0.1294 13  DG  C N3    
5107 C C4    . DG  C 12  ? 1.1422 0.6041 0.8994 -0.1449 0.0230  -0.1254 13  DG  C C4    
5108 P P     . DG  C 13  ? 1.5650 0.6401 1.3565 -0.1108 0.1712  0.0047  14  DG  C P     
5109 O OP1   . DG  C 13  ? 1.6459 0.6433 1.4344 -0.0715 0.1978  0.0568  14  DG  C OP1   
5110 O OP2   . DG  C 13  ? 1.5552 0.6281 1.3822 -0.1599 0.1945  -0.0299 14  DG  C OP2   
5111 O "O5'" . DG  C 13  ? 1.5660 0.6905 1.3784 -0.1102 0.1453  -0.0477 14  DG  C "O5'" 
5112 C "C5'" . DG  C 13  ? 1.6393 0.7361 1.4606 -0.0759 0.1442  -0.0434 14  DG  C "C5'" 
5113 C "C4'" . DG  C 13  ? 1.6531 0.7871 1.5193 -0.0958 0.1372  -0.1109 14  DG  C "C4'" 
5114 O "O4'" . DG  C 13  ? 1.5447 0.7735 1.3957 -0.1182 0.1054  -0.1409 14  DG  C "O4'" 
5115 C "C3'" . DG  C 13  ? 1.7615 0.8497 1.6974 -0.1310 0.1794  -0.1562 14  DG  C "C3'" 
5116 O "O3'" . DG  C 13  ? 1.9514 1.0334 1.9326 -0.1251 0.1849  -0.1989 14  DG  C "O3'" 
5117 C "C2'" . DG  C 13  ? 1.6662 0.8320 1.6110 -0.1740 0.1681  -0.2025 14  DG  C "C2'" 
5118 C "C1'" . DG  C 13  ? 1.5335 0.7886 1.4363 -0.1565 0.1197  -0.2031 14  DG  C "C1'" 
5119 N N9    . DG  C 13  ? 1.4145 0.7534 1.3016 -0.1809 0.0996  -0.2198 14  DG  C N9    
5120 C C8    . DG  C 13  ? 1.3902 0.7308 1.2649 -0.2037 0.1081  -0.2057 14  DG  C C8    
5121 N N7    . DG  C 13  ? 1.3076 0.7356 1.1752 -0.2204 0.0878  -0.2279 14  DG  C N7    
5122 C C5    . DG  C 13  ? 1.2685 0.7573 1.1448 -0.2080 0.0663  -0.2570 14  DG  C C5    
5123 C C6    . DG  C 13  ? 1.1930 0.7881 1.0681 -0.2124 0.0425  -0.2830 14  DG  C C6    
5124 O O6    . DG  C 13  ? 1.1429 0.7999 1.0092 -0.2273 0.0353  -0.2854 14  DG  C O6    
5125 N N1    . DG  C 13  ? 1.1783 0.8086 1.0642 -0.1939 0.0280  -0.3043 14  DG  C N1    
5126 C C2    . DG  C 13  ? 1.2262 0.7964 1.1238 -0.1748 0.0343  -0.3044 14  DG  C C2    
5127 N N2    . DG  C 13  ? 1.2044 0.8261 1.1120 -0.1594 0.0178  -0.3289 14  DG  C N2    
5128 N N3    . DG  C 13  ? 1.2895 0.7593 1.1899 -0.1688 0.0570  -0.2796 14  DG  C N3    
5129 C C4    . DG  C 13  ? 1.3202 0.7552 1.2091 -0.1856 0.0725  -0.2553 14  DG  C C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   258 ?   ?   ?   A . n 
A 1 2   ALA 2   259 ?   ?   ?   A . n 
A 1 3   SER 3   260 ?   ?   ?   A . n 
A 1 4   TRP 4   261 ?   ?   ?   A . n 
A 1 5   SER 5   262 ?   ?   ?   A . n 
A 1 6   HIS 6   263 ?   ?   ?   A . n 
A 1 7   PRO 7   264 ?   ?   ?   A . n 
A 1 8   GLN 8   265 ?   ?   ?   A . n 
A 1 9   PHE 9   266 ?   ?   ?   A . n 
A 1 10  GLU 10  267 ?   ?   ?   A . n 
A 1 11  LYS 11  268 ?   ?   ?   A . n 
A 1 12  GLY 12  269 ?   ?   ?   A . n 
A 1 13  ALA 13  270 ?   ?   ?   A . n 
A 1 14  SER 14  271 ?   ?   ?   A . n 
A 1 15  THR 15  272 ?   ?   ?   A . n 
A 1 16  SER 16  273 ?   ?   ?   A . n 
A 1 17  LEU 17  274 ?   ?   ?   A . n 
A 1 18  TYR 18  275 ?   ?   ?   A . n 
A 1 19  LYS 19  276 ?   ?   ?   A . n 
A 1 20  LYS 20  277 ?   ?   ?   A . n 
A 1 21  ALA 21  278 ?   ?   ?   A . n 
A 1 22  GLY 22  279 ?   ?   ?   A . n 
A 1 23  SER 23  280 ?   ?   ?   A . n 
A 1 24  ALA 24  281 ?   ?   ?   A . n 
A 1 25  ALA 25  282 ?   ?   ?   A . n 
A 1 26  ALA 26  283 ?   ?   ?   A . n 
A 1 27  VAL 27  284 ?   ?   ?   A . n 
A 1 28  LEU 28  285 ?   ?   ?   A . n 
A 1 29  GLU 29  286 ?   ?   ?   A . n 
A 1 30  GLU 30  287 ?   ?   ?   A . n 
A 1 31  ASN 31  288 ?   ?   ?   A . n 
A 1 32  LEU 32  289 ?   ?   ?   A . n 
A 1 33  TYR 33  290 ?   ?   ?   A . n 
A 1 34  PHE 34  291 ?   ?   ?   A . n 
A 1 35  GLN 35  292 ?   ?   ?   A . n 
A 1 36  GLY 36  293 ?   ?   ?   A . n 
A 1 37  SER 37  294 ?   ?   ?   A . n 
A 1 38  PHE 38  295 ?   ?   ?   A . n 
A 1 39  THR 39  296 ?   ?   ?   A . n 
A 1 40  ALA 40  297 ?   ?   ?   A . n 
A 1 41  LYS 41  298 298 LYS LYS A . n 
A 1 42  MET 42  299 299 MET MET A . n 
A 1 43  ALA 43  300 300 ALA ALA A . n 
A 1 44  PHE 44  301 301 PHE PHE A . n 
A 1 45  THR 45  302 302 THR THR A . n 
A 1 46  LEU 46  303 303 LEU LEU A . n 
A 1 47  ALA 47  304 304 ALA ALA A . n 
A 1 48  ASP 48  305 305 ASP ASP A . n 
A 1 49  ARG 49  306 306 ARG ARG A . n 
A 1 50  VAL 50  307 307 VAL VAL A . n 
A 1 51  THR 51  308 308 THR THR A . n 
A 1 52  GLU 52  309 309 GLU GLU A . n 
A 1 53  GLU 53  310 310 GLU GLU A . n 
A 1 54  MET 54  311 311 MET MET A . n 
A 1 55  LEU 55  312 312 LEU LEU A . n 
A 1 56  ALA 56  313 313 ALA ALA A . n 
A 1 57  ASP 57  314 314 ASP ASP A . n 
A 1 58  LYS 58  315 315 LYS LYS A . n 
A 1 59  ALA 59  316 316 ALA ALA A . n 
A 1 60  ALA 60  317 317 ALA ALA A . n 
A 1 61  LEU 61  318 318 LEU LEU A . n 
A 1 62  VAL 62  319 319 VAL VAL A . n 
A 1 63  VAL 63  320 320 VAL VAL A . n 
A 1 64  GLU 64  321 321 GLU GLU A . n 
A 1 65  VAL 65  322 322 VAL VAL A . n 
A 1 66  VAL 66  323 323 VAL VAL A . n 
A 1 67  GLU 67  324 324 GLU GLU A . n 
A 1 68  GLU 68  325 325 GLU GLU A . n 
A 1 69  ASN 69  326 326 ASN ASN A . n 
A 1 70  TYR 70  327 327 TYR TYR A . n 
A 1 71  HIS 71  328 328 HIS HIS A . n 
A 1 72  ASP 72  329 329 ASP ASP A . n 
A 1 73  ALA 73  330 330 ALA ALA A . n 
A 1 74  PRO 74  331 331 PRO PRO A . n 
A 1 75  ILE 75  332 332 ILE ILE A . n 
A 1 76  VAL 76  333 333 VAL VAL A . n 
A 1 77  GLY 77  334 334 GLY GLY A . n 
A 1 78  ILE 78  335 335 ILE ILE A . n 
A 1 79  ALA 79  336 336 ALA ALA A . n 
A 1 80  VAL 80  337 337 VAL VAL A . n 
A 1 81  VAL 81  338 338 VAL VAL A . n 
A 1 82  ASN 82  339 339 ASN ASN A . n 
A 1 83  GLU 83  340 340 GLU GLU A . n 
A 1 84  HIS 84  341 341 HIS HIS A . n 
A 1 85  GLY 85  342 342 GLY GLY A . n 
A 1 86  ARG 86  343 343 ARG ARG A . n 
A 1 87  PHE 87  344 344 PHE PHE A . n 
A 1 88  PHE 88  345 345 PHE PHE A . n 
A 1 89  LEU 89  346 346 LEU LEU A . n 
A 1 90  ARG 90  347 347 ARG ARG A . n 
A 1 91  PRO 91  348 348 PRO PRO A . n 
A 1 92  GLU 92  349 349 GLU GLU A . n 
A 1 93  THR 93  350 350 THR THR A . n 
A 1 94  ALA 94  351 351 ALA ALA A . n 
A 1 95  LEU 95  352 352 LEU LEU A . n 
A 1 96  ALA 96  353 353 ALA ALA A . n 
A 1 97  ASP 97  354 354 ASP ASP A . n 
A 1 98  PRO 98  355 355 PRO PRO A . n 
A 1 99  GLN 99  356 356 GLN GLN A . n 
A 1 100 PHE 100 357 357 PHE PHE A . n 
A 1 101 VAL 101 358 358 VAL VAL A . n 
A 1 102 ALA 102 359 359 ALA ALA A . n 
A 1 103 TRP 103 360 360 TRP TRP A . n 
A 1 104 LEU 104 361 361 LEU LEU A . n 
A 1 105 GLY 105 362 362 GLY GLY A . n 
A 1 106 ASP 106 363 363 ASP ASP A . n 
A 1 107 GLU 107 364 364 GLU GLU A . n 
A 1 108 THR 108 365 365 THR THR A . n 
A 1 109 LYS 109 366 366 LYS LYS A . n 
A 1 110 LYS 110 367 367 LYS LYS A . n 
A 1 111 LYS 111 368 368 LYS LYS A . n 
A 1 112 SER 112 369 369 SER SER A . n 
A 1 113 MET 113 370 370 MET MET A . n 
A 1 114 PHE 114 371 371 PHE PHE A . n 
A 1 115 ASP 115 372 372 ASP ASP A . n 
A 1 116 SER 116 373 373 SER SER A . n 
A 1 117 LYS 117 374 374 LYS LYS A . n 
A 1 118 ARG 118 375 375 ARG ARG A . n 
A 1 119 ALA 119 376 376 ALA ALA A . n 
A 1 120 ALA 120 377 377 ALA ALA A . n 
A 1 121 VAL 121 378 378 VAL VAL A . n 
A 1 122 ALA 122 379 379 ALA ALA A . n 
A 1 123 LEU 123 380 380 LEU LEU A . n 
A 1 124 LYS 124 381 381 LYS LYS A . n 
A 1 125 TRP 125 382 382 TRP TRP A . n 
A 1 126 LYS 126 383 383 LYS LYS A . n 
A 1 127 GLY 127 384 384 GLY GLY A . n 
A 1 128 ILE 128 385 385 ILE ILE A . n 
A 1 129 GLU 129 386 386 GLU GLU A . n 
A 1 130 LEU 130 387 387 LEU LEU A . n 
A 1 131 CYS 131 388 388 CYS CYS A . n 
A 1 132 GLY 132 389 389 GLY GLY A . n 
A 1 133 VAL 133 390 390 VAL VAL A . n 
A 1 134 SER 134 391 391 SER SER A . n 
A 1 135 PHE 135 392 392 PHE PHE A . n 
A 1 136 ASP 136 393 393 ASP ASP A . n 
A 1 137 LEU 137 394 394 LEU LEU A . n 
A 1 138 LEU 138 395 395 LEU LEU A . n 
A 1 139 LEU 139 396 396 LEU LEU A . n 
A 1 140 ALA 140 397 397 ALA ALA A . n 
A 1 141 ALA 141 398 398 ALA ALA A . n 
A 1 142 TYR 142 399 399 TYR TYR A . n 
A 1 143 LEU 143 400 400 LEU LEU A . n 
A 1 144 LEU 144 401 401 LEU LEU A . n 
A 1 145 ASP 145 402 402 ASP ASP A . n 
A 1 146 PRO 146 403 403 PRO PRO A . n 
A 1 147 ALA 147 404 404 ALA ALA A . n 
A 1 148 GLN 148 405 405 GLN GLN A . n 
A 1 149 GLY 149 406 406 GLY GLY A . n 
A 1 150 VAL 150 407 407 VAL VAL A . n 
A 1 151 ASP 151 408 408 ASP ASP A . n 
A 1 152 ASP 152 409 409 ASP ASP A . n 
A 1 153 VAL 153 410 410 VAL VAL A . n 
A 1 154 ALA 154 411 411 ALA ALA A . n 
A 1 155 ALA 155 412 412 ALA ALA A . n 
A 1 156 ALA 156 413 413 ALA ALA A . n 
A 1 157 ALA 157 414 414 ALA ALA A . n 
A 1 158 LYS 158 415 415 LYS LYS A . n 
A 1 159 MET 159 416 416 MET MET A . n 
A 1 160 LYS 160 417 417 LYS LYS A . n 
A 1 161 GLN 161 418 418 GLN GLN A . n 
A 1 162 TYR 162 419 419 TYR TYR A . n 
A 1 163 GLU 163 420 420 GLU GLU A . n 
A 1 164 ALA 164 421 421 ALA ALA A . n 
A 1 165 VAL 165 422 422 VAL VAL A . n 
A 1 166 ARG 166 423 423 ARG ARG A . n 
A 1 167 PRO 167 424 424 PRO PRO A . n 
A 1 168 ASP 168 425 425 ASP ASP A . n 
A 1 169 GLU 169 426 426 GLU GLU A . n 
A 1 170 ALA 170 427 427 ALA ALA A . n 
A 1 171 VAL 171 428 428 VAL VAL A . n 
A 1 172 TYR 172 429 429 TYR TYR A . n 
A 1 173 GLY 173 430 430 GLY GLY A . n 
A 1 174 LYS 174 431 431 LYS LYS A . n 
A 1 175 GLY 175 432 432 GLY GLY A . n 
A 1 176 ALA 176 433 433 ALA ALA A . n 
A 1 177 LYS 177 434 434 LYS LYS A . n 
A 1 178 ARG 178 435 435 ARG ARG A . n 
A 1 179 ALA 179 436 436 ALA ALA A . n 
A 1 180 VAL 180 437 437 VAL VAL A . n 
A 1 181 PRO 181 438 438 PRO PRO A . n 
A 1 182 ASP 182 439 439 ASP ASP A . n 
A 1 183 GLU 183 440 440 GLU GLU A . n 
A 1 184 PRO 184 441 441 PRO PRO A . n 
A 1 185 VAL 185 442 442 VAL VAL A . n 
A 1 186 LEU 186 443 443 LEU LEU A . n 
A 1 187 ALA 187 444 444 ALA ALA A . n 
A 1 188 GLU 188 445 445 GLU GLU A . n 
A 1 189 HIS 189 446 446 HIS HIS A . n 
A 1 190 LEU 190 447 447 LEU LEU A . n 
A 1 191 VAL 191 448 448 VAL VAL A . n 
A 1 192 ARG 192 449 449 ARG ARG A . n 
A 1 193 LYS 193 450 450 LYS LYS A . n 
A 1 194 ALA 194 451 451 ALA ALA A . n 
A 1 195 ALA 195 452 452 ALA ALA A . n 
A 1 196 ALA 196 453 453 ALA ALA A . n 
A 1 197 ILE 197 454 454 ILE ILE A . n 
A 1 198 TRP 198 455 455 TRP TRP A . n 
A 1 199 ALA 199 456 456 ALA ALA A . n 
A 1 200 LEU 200 457 457 LEU LEU A . n 
A 1 201 GLU 201 458 458 GLU GLU A . n 
A 1 202 ARG 202 459 459 ARG ARG A . n 
A 1 203 PRO 203 460 460 PRO PRO A . n 
A 1 204 PHE 204 461 461 PHE PHE A . n 
A 1 205 LEU 205 462 462 LEU LEU A . n 
A 1 206 ASP 206 463 463 ASP ASP A . n 
A 1 207 GLU 207 464 464 GLU GLU A . n 
A 1 208 LEU 208 465 465 LEU LEU A . n 
A 1 209 ARG 209 466 466 ARG ARG A . n 
A 1 210 ARG 210 467 467 ARG ARG A . n 
A 1 211 ASN 211 468 468 ASN ASN A . n 
A 1 212 GLU 212 469 469 GLU GLU A . n 
A 1 213 GLN 213 470 470 GLN GLN A . n 
A 1 214 ASP 214 471 471 ASP ASP A . n 
A 1 215 ARG 215 472 472 ARG ARG A . n 
A 1 216 LEU 216 473 473 LEU LEU A . n 
A 1 217 LEU 217 474 474 LEU LEU A . n 
A 1 218 VAL 218 475 475 VAL VAL A . n 
A 1 219 GLU 219 476 476 GLU GLU A . n 
A 1 220 LEU 220 477 477 LEU LEU A . n 
A 1 221 GLU 221 478 478 GLU GLU A . n 
A 1 222 GLN 222 479 479 GLN GLN A . n 
A 1 223 PRO 223 480 480 PRO PRO A . n 
A 1 224 LEU 224 481 481 LEU LEU A . n 
A 1 225 SER 225 482 482 SER SER A . n 
A 1 226 SER 226 483 483 SER SER A . n 
A 1 227 ILE 227 484 484 ILE ILE A . n 
A 1 228 LEU 228 485 485 LEU LEU A . n 
A 1 229 ALA 229 486 486 ALA ALA A . n 
A 1 230 GLU 230 487 487 GLU GLU A . n 
A 1 231 MET 231 488 488 MET MET A . n 
A 1 232 GLU 232 489 489 GLU GLU A . n 
A 1 233 PHE 233 490 490 PHE PHE A . n 
A 1 234 ALA 234 491 491 ALA ALA A . n 
A 1 235 GLY 235 492 492 GLY GLY A . n 
A 1 236 VAL 236 493 493 VAL VAL A . n 
A 1 237 LYS 237 494 494 LYS LYS A . n 
A 1 238 VAL 238 495 495 VAL VAL A . n 
A 1 239 ASP 239 496 496 ASP ASP A . n 
A 1 240 THR 240 497 497 THR THR A . n 
A 1 241 LYS 241 498 498 LYS LYS A . n 
A 1 242 ARG 242 499 499 ARG ARG A . n 
A 1 243 LEU 243 500 500 LEU LEU A . n 
A 1 244 GLU 244 501 501 GLU GLU A . n 
A 1 245 GLN 245 502 502 GLN GLN A . n 
A 1 246 MET 246 503 503 MET MET A . n 
A 1 247 GLY 247 504 504 GLY GLY A . n 
A 1 248 GLU 248 505 505 GLU GLU A . n 
A 1 249 GLU 249 506 506 GLU GLU A . n 
A 1 250 LEU 250 507 507 LEU LEU A . n 
A 1 251 ALA 251 508 508 ALA ALA A . n 
A 1 252 GLU 252 509 509 GLU GLU A . n 
A 1 253 GLN 253 510 510 GLN GLN A . n 
A 1 254 LEU 254 511 511 LEU LEU A . n 
A 1 255 ARG 255 512 512 ARG ARG A . n 
A 1 256 THR 256 513 513 THR THR A . n 
A 1 257 VAL 257 514 514 VAL VAL A . n 
A 1 258 GLU 258 515 515 GLU GLU A . n 
A 1 259 GLN 259 516 516 GLN GLN A . n 
A 1 260 ARG 260 517 517 ARG ARG A . n 
A 1 261 ILE 261 518 518 ILE ILE A . n 
A 1 262 TYR 262 519 519 TYR TYR A . n 
A 1 263 GLU 263 520 520 GLU GLU A . n 
A 1 264 LEU 264 521 521 LEU LEU A . n 
A 1 265 ALA 265 522 522 ALA ALA A . n 
A 1 266 GLY 266 523 523 GLY GLY A . n 
A 1 267 GLN 267 524 524 GLN GLN A . n 
A 1 268 GLU 268 525 525 GLU GLU A . n 
A 1 269 PHE 269 526 526 PHE PHE A . n 
A 1 270 ASN 270 527 527 ASN ASN A . n 
A 1 271 ILE 271 528 528 ILE ILE A . n 
A 1 272 ASN 272 529 529 ASN ASN A . n 
A 1 273 SER 273 530 530 SER SER A . n 
A 1 274 PRO 274 531 531 PRO PRO A . n 
A 1 275 LYS 275 532 532 LYS LYS A . n 
A 1 276 GLN 276 533 533 GLN GLN A . n 
A 1 277 LEU 277 534 534 LEU LEU A . n 
A 1 278 GLY 278 535 535 GLY GLY A . n 
A 1 279 VAL 279 536 536 VAL VAL A . n 
A 1 280 ILE 280 537 537 ILE ILE A . n 
A 1 281 LEU 281 538 538 LEU LEU A . n 
A 1 282 PHE 282 539 539 PHE PHE A . n 
A 1 283 GLU 283 540 540 GLU GLU A . n 
A 1 284 LYS 284 541 541 LYS LYS A . n 
A 1 285 LEU 285 542 542 LEU LEU A . n 
A 1 286 GLN 286 543 543 GLN GLN A . n 
A 1 287 LEU 287 544 544 LEU LEU A . n 
A 1 288 PRO 288 545 545 PRO PRO A . n 
A 1 289 VAL 289 546 546 VAL VAL A . n 
A 1 290 LEU 290 547 547 LEU LEU A . n 
A 1 291 LYS 291 548 548 LYS LYS A . n 
A 1 292 LYS 292 549 549 LYS LYS A . n 
A 1 293 SER 293 550 550 SER SER A . n 
A 1 294 LYS 294 551 551 LYS LYS A . n 
A 1 295 THR 295 552 552 THR THR A . n 
A 1 296 GLY 296 553 553 GLY GLY A . n 
A 1 297 TYR 297 554 554 TYR TYR A . n 
A 1 298 SER 298 555 555 SER SER A . n 
A 1 299 THR 299 556 556 THR THR A . n 
A 1 300 SER 300 557 557 SER SER A . n 
A 1 301 ALA 301 558 558 ALA ALA A . n 
A 1 302 ASP 302 559 559 ASP ASP A . n 
A 1 303 VAL 303 560 560 VAL VAL A . n 
A 1 304 LEU 304 561 561 LEU LEU A . n 
A 1 305 GLU 305 562 562 GLU GLU A . n 
A 1 306 LYS 306 563 563 LYS LYS A . n 
A 1 307 LEU 307 564 564 LEU LEU A . n 
A 1 308 ALA 308 565 565 ALA ALA A . n 
A 1 309 PRO 309 566 566 PRO PRO A . n 
A 1 310 TYR 310 567 567 TYR TYR A . n 
A 1 311 HIS 311 568 568 HIS HIS A . n 
A 1 312 GLU 312 569 569 GLU GLU A . n 
A 1 313 ILE 313 570 570 ILE ILE A . n 
A 1 314 VAL 314 571 571 VAL VAL A . n 
A 1 315 GLU 315 572 572 GLU GLU A . n 
A 1 316 ASN 316 573 573 ASN ASN A . n 
A 1 317 ILE 317 574 574 ILE ILE A . n 
A 1 318 LEU 318 575 575 LEU LEU A . n 
A 1 319 HIS 319 576 576 HIS HIS A . n 
A 1 320 TYR 320 577 577 TYR TYR A . n 
A 1 321 ARG 321 578 578 ARG ARG A . n 
A 1 322 GLN 322 579 579 GLN GLN A . n 
A 1 323 LEU 323 580 580 LEU LEU A . n 
A 1 324 GLY 324 581 581 GLY GLY A . n 
A 1 325 LYS 325 582 582 LYS LYS A . n 
A 1 326 LEU 326 583 583 LEU LEU A . n 
A 1 327 GLN 327 584 584 GLN GLN A . n 
A 1 328 SER 328 585 585 SER SER A . n 
A 1 329 THR 329 586 586 THR THR A . n 
A 1 330 TYR 330 587 587 TYR TYR A . n 
A 1 331 ILE 331 588 588 ILE ILE A . n 
A 1 332 GLU 332 589 589 GLU GLU A . n 
A 1 333 GLY 333 590 590 GLY GLY A . n 
A 1 334 LEU 334 591 591 LEU LEU A . n 
A 1 335 LEU 335 592 592 LEU LEU A . n 
A 1 336 LYS 336 593 593 LYS LYS A . n 
A 1 337 VAL 337 594 594 VAL VAL A . n 
A 1 338 VAL 338 595 595 VAL VAL A . n 
A 1 339 ARG 339 596 596 ARG ARG A . n 
A 1 340 PRO 340 597 597 PRO PRO A . n 
A 1 341 ASP 341 598 598 ASP ASP A . n 
A 1 342 THR 342 599 599 THR THR A . n 
A 1 343 LYS 343 600 600 LYS LYS A . n 
A 1 344 LYS 344 601 601 LYS LYS A . n 
A 1 345 VAL 345 602 602 VAL VAL A . n 
A 1 346 HIS 346 603 603 HIS HIS A . n 
A 1 347 THR 347 604 604 THR THR A . n 
A 1 348 ILE 348 605 605 ILE ILE A . n 
A 1 349 PHE 349 606 606 PHE PHE A . n 
A 1 350 ASN 350 607 607 ASN ASN A . n 
A 1 351 GLN 351 608 608 GLN GLN A . n 
A 1 352 ALA 352 609 609 ALA ALA A . n 
A 1 353 LEU 353 610 610 LEU LEU A . n 
A 1 354 THR 354 611 611 THR THR A . n 
A 1 355 GLN 355 612 612 GLN GLN A . n 
A 1 356 THR 356 613 613 THR THR A . n 
A 1 357 GLY 357 614 614 GLY GLY A . n 
A 1 358 ARG 358 615 615 ARG ARG A . n 
A 1 359 LEU 359 616 616 LEU LEU A . n 
A 1 360 SER 360 617 617 SER SER A . n 
A 1 361 SER 361 618 618 SER SER A . n 
A 1 362 THR 362 619 619 THR THR A . n 
A 1 363 GLU 363 620 620 GLU GLU A . n 
A 1 364 PRO 364 621 621 PRO PRO A . n 
A 1 365 ASN 365 622 622 ASN ASN A . n 
A 1 366 LEU 366 623 623 LEU LEU A . n 
A 1 367 GLN 367 624 624 GLN GLN A . n 
A 1 368 ASN 368 625 625 ASN ASN A . n 
A 1 369 ILE 369 626 626 ILE ILE A . n 
A 1 370 PRO 370 627 627 PRO PRO A . n 
A 1 371 ILE 371 628 628 ILE ILE A . n 
A 1 372 ARG 372 629 629 ARG ARG A . n 
A 1 373 LEU 373 630 630 LEU LEU A . n 
A 1 374 GLU 374 631 631 GLU GLU A . n 
A 1 375 GLU 375 632 632 GLU GLU A . n 
A 1 376 GLY 376 633 633 GLY GLY A . n 
A 1 377 ARG 377 634 634 ARG ARG A . n 
A 1 378 LYS 378 635 635 LYS LYS A . n 
A 1 379 ILE 379 636 636 ILE ILE A . n 
A 1 380 ARG 380 637 637 ARG ARG A . n 
A 1 381 GLN 381 638 638 GLN GLN A . n 
A 1 382 ALA 382 639 639 ALA ALA A . n 
A 1 383 PHE 383 640 640 PHE PHE A . n 
A 1 384 VAL 384 641 641 VAL VAL A . n 
A 1 385 PRO 385 642 642 PRO PRO A . n 
A 1 386 SER 386 643 643 SER SER A . n 
A 1 387 GLU 387 644 644 GLU GLU A . n 
A 1 388 SER 388 645 645 SER SER A . n 
A 1 389 ASP 389 646 646 ASP ASP A . n 
A 1 390 TRP 390 647 647 TRP TRP A . n 
A 1 391 LEU 391 648 648 LEU LEU A . n 
A 1 392 ILE 392 649 649 ILE ILE A . n 
A 1 393 PHE 393 650 650 PHE PHE A . n 
A 1 394 ALA 394 651 651 ALA ALA A . n 
A 1 395 ALA 395 652 652 ALA ALA A . n 
A 1 396 ASP 396 653 653 ASP ASP A . n 
A 1 397 TYR 397 654 654 TYR TYR A . n 
A 1 398 SER 398 655 655 SER SER A . n 
A 1 399 GLN 399 656 656 GLN GLN A . n 
A 1 400 ILE 400 657 657 ILE ILE A . n 
A 1 401 GLU 401 658 658 GLU GLU A . n 
A 1 402 LEU 402 659 659 LEU LEU A . n 
A 1 403 ARG 403 660 660 ARG ARG A . n 
A 1 404 VAL 404 661 661 VAL VAL A . n 
A 1 405 LEU 405 662 662 LEU LEU A . n 
A 1 406 ALA 406 663 663 ALA ALA A . n 
A 1 407 HIS 407 664 664 HIS HIS A . n 
A 1 408 ILE 408 665 665 ILE ILE A . n 
A 1 409 ALA 409 666 666 ALA ALA A . n 
A 1 410 GLU 410 667 667 GLU GLU A . n 
A 1 411 ASP 411 668 668 ASP ASP A . n 
A 1 412 ASP 412 669 669 ASP ASP A . n 
A 1 413 ASN 413 670 670 ASN ASN A . n 
A 1 414 LEU 414 671 671 LEU LEU A . n 
A 1 415 MET 415 672 672 MET MET A . n 
A 1 416 GLU 416 673 673 GLU GLU A . n 
A 1 417 ALA 417 674 674 ALA ALA A . n 
A 1 418 PHE 418 675 675 PHE PHE A . n 
A 1 419 ARG 419 676 676 ARG ARG A . n 
A 1 420 ARG 420 677 677 ARG ARG A . n 
A 1 421 ASP 421 678 678 ASP ASP A . n 
A 1 422 LEU 422 679 679 LEU LEU A . n 
A 1 423 ASP 423 680 680 ASP ASP A . n 
A 1 424 ILE 424 681 681 ILE ILE A . n 
A 1 425 HIS 425 682 682 HIS HIS A . n 
A 1 426 THR 426 683 683 THR THR A . n 
A 1 427 LYS 427 684 684 LYS LYS A . n 
A 1 428 THR 428 685 685 THR THR A . n 
A 1 429 ALA 429 686 686 ALA ALA A . n 
A 1 430 MET 430 687 687 MET MET A . n 
A 1 431 ASP 431 688 688 ASP ASP A . n 
A 1 432 ILE 432 689 689 ILE ILE A . n 
A 1 433 PHE 433 690 690 PHE PHE A . n 
A 1 434 GLN 434 691 691 GLN GLN A . n 
A 1 435 VAL 435 692 692 VAL VAL A . n 
A 1 436 SER 436 693 693 SER SER A . n 
A 1 437 GLU 437 694 694 GLU GLU A . n 
A 1 438 ASP 438 695 695 ASP ASP A . n 
A 1 439 GLU 439 696 696 GLU GLU A . n 
A 1 440 VAL 440 697 697 VAL VAL A . n 
A 1 441 THR 441 698 698 THR THR A . n 
A 1 442 PRO 442 699 699 PRO PRO A . n 
A 1 443 ASN 443 700 700 ASN ASN A . n 
A 1 444 MET 444 701 701 MET MET A . n 
A 1 445 ARG 445 702 702 ARG ARG A . n 
A 1 446 ARG 446 703 703 ARG ARG A . n 
A 1 447 GLN 447 704 704 GLN GLN A . n 
A 1 448 ALA 448 705 705 ALA ALA A . n 
A 1 449 LYS 449 706 706 LYS LYS A . n 
A 1 450 ALA 450 707 707 ALA ALA A . n 
A 1 451 VAL 451 708 708 VAL VAL A . n 
A 1 452 ASN 452 709 709 ASN ASN A . n 
A 1 453 PHE 453 710 710 PHE PHE A . n 
A 1 454 GLY 454 711 711 GLY GLY A . n 
A 1 455 ILE 455 712 712 ILE ILE A . n 
A 1 456 VAL 456 713 713 VAL VAL A . n 
A 1 457 TYR 457 714 714 TYR TYR A . n 
A 1 458 GLY 458 715 715 GLY GLY A . n 
A 1 459 ILE 459 716 716 ILE ILE A . n 
A 1 460 SER 460 717 717 SER SER A . n 
A 1 461 ASP 461 718 718 ASP ASP A . n 
A 1 462 TYR 462 719 719 TYR TYR A . n 
A 1 463 GLY 463 720 720 GLY GLY A . n 
A 1 464 LEU 464 721 721 LEU LEU A . n 
A 1 465 ALA 465 722 722 ALA ALA A . n 
A 1 466 GLN 466 723 723 GLN GLN A . n 
A 1 467 ASN 467 724 724 ASN ASN A . n 
A 1 468 LEU 468 725 725 LEU LEU A . n 
A 1 469 ASN 469 726 726 ASN ASN A . n 
A 1 470 ILE 470 727 727 ILE ILE A . n 
A 1 471 SER 471 728 728 SER SER A . n 
A 1 472 ARG 472 729 729 ARG ARG A . n 
A 1 473 LYS 473 730 730 LYS LYS A . n 
A 1 474 GLU 474 731 731 GLU GLU A . n 
A 1 475 ALA 475 732 732 ALA ALA A . n 
A 1 476 ALA 476 733 733 ALA ALA A . n 
A 1 477 GLU 477 734 734 GLU GLU A . n 
A 1 478 PHE 478 735 735 PHE PHE A . n 
A 1 479 ILE 479 736 736 ILE ILE A . n 
A 1 480 GLU 480 737 737 GLU GLU A . n 
A 1 481 ARG 481 738 738 ARG ARG A . n 
A 1 482 TYR 482 739 739 TYR TYR A . n 
A 1 483 PHE 483 740 740 PHE PHE A . n 
A 1 484 GLU 484 741 741 GLU GLU A . n 
A 1 485 SER 485 742 742 SER SER A . n 
A 1 486 PHE 486 743 743 PHE PHE A . n 
A 1 487 PRO 487 744 744 PRO PRO A . n 
A 1 488 GLY 488 745 745 GLY GLY A . n 
A 1 489 VAL 489 746 746 VAL VAL A . n 
A 1 490 LYS 490 747 747 LYS LYS A . n 
A 1 491 ARG 491 748 748 ARG ARG A . n 
A 1 492 TYR 492 749 749 TYR TYR A . n 
A 1 493 MET 493 750 750 MET MET A . n 
A 1 494 GLU 494 751 751 GLU GLU A . n 
A 1 495 ASN 495 752 752 ASN ASN A . n 
A 1 496 ILE 496 753 753 ILE ILE A . n 
A 1 497 VAL 497 754 754 VAL VAL A . n 
A 1 498 GLN 498 755 755 GLN GLN A . n 
A 1 499 GLU 499 756 756 GLU GLU A . n 
A 1 500 ALA 500 757 757 ALA ALA A . n 
A 1 501 LYS 501 758 758 LYS LYS A . n 
A 1 502 GLN 502 759 759 GLN GLN A . n 
A 1 503 LYS 503 760 760 LYS LYS A . n 
A 1 504 GLY 504 761 761 GLY GLY A . n 
A 1 505 TYR 505 762 762 TYR TYR A . n 
A 1 506 VAL 506 763 763 VAL VAL A . n 
A 1 507 THR 507 764 764 THR THR A . n 
A 1 508 THR 508 765 765 THR THR A . n 
A 1 509 LEU 509 766 766 LEU LEU A . n 
A 1 510 LEU 510 767 767 LEU LEU A . n 
A 1 511 HIS 511 768 768 HIS HIS A . n 
A 1 512 ARG 512 769 769 ARG ARG A . n 
A 1 513 ARG 513 770 770 ARG ARG A . n 
A 1 514 ARG 514 771 771 ARG ARG A . n 
A 1 515 TYR 515 772 772 TYR TYR A . n 
A 1 516 LEU 516 773 773 LEU LEU A . n 
A 1 517 PRO 517 774 774 PRO PRO A . n 
A 1 518 ASP 518 775 775 ASP ASP A . n 
A 1 519 ILE 519 776 776 ILE ILE A . n 
A 1 520 THR 520 777 777 THR THR A . n 
A 1 521 SER 521 778 778 SER SER A . n 
A 1 522 ARG 522 779 779 ARG ARG A . n 
A 1 523 ASN 523 780 780 ASN ASN A . n 
A 1 524 PHE 524 781 781 PHE PHE A . n 
A 1 525 ASN 525 782 782 ASN ASN A . n 
A 1 526 VAL 526 783 783 VAL VAL A . n 
A 1 527 ARG 527 784 784 ARG ARG A . n 
A 1 528 SER 528 785 785 SER SER A . n 
A 1 529 PHE 529 786 786 PHE PHE A . n 
A 1 530 ALA 530 787 787 ALA ALA A . n 
A 1 531 GLU 531 788 788 GLU GLU A . n 
A 1 532 ARG 532 789 789 ARG ARG A . n 
A 1 533 MET 533 790 790 MET MET A . n 
A 1 534 ALA 534 791 791 ALA ALA A . n 
A 1 535 MET 535 792 792 MET MET A . n 
A 1 536 ASN 536 793 793 ASN ASN A . n 
A 1 537 THR 537 794 794 THR THR A . n 
A 1 538 PRO 538 795 795 PRO PRO A . n 
A 1 539 ILE 539 796 796 ILE ILE A . n 
A 1 540 GLN 540 797 797 GLN GLN A . n 
A 1 541 GLY 541 798 798 GLY GLY A . n 
A 1 542 SER 542 799 799 SER SER A . n 
A 1 543 ALA 543 800 800 ALA ALA A . n 
A 1 544 ALA 544 801 801 ALA ALA A . n 
A 1 545 ASP 545 802 802 ASP ASP A . n 
A 1 546 ILE 546 803 803 ILE ILE A . n 
A 1 547 ILE 547 804 804 ILE ILE A . n 
A 1 548 LYS 548 805 805 LYS LYS A . n 
A 1 549 LYS 549 806 806 LYS LYS A . n 
A 1 550 ALA 550 807 807 ALA ALA A . n 
A 1 551 MET 551 808 808 MET MET A . n 
A 1 552 ILE 552 809 809 ILE ILE A . n 
A 1 553 ASP 553 810 810 ASP ASP A . n 
A 1 554 LEU 554 811 811 LEU LEU A . n 
A 1 555 ASN 555 812 812 ASN ASN A . n 
A 1 556 ALA 556 813 813 ALA ALA A . n 
A 1 557 ARG 557 814 814 ARG ARG A . n 
A 1 558 LEU 558 815 815 LEU LEU A . n 
A 1 559 LYS 559 816 816 LYS LYS A . n 
A 1 560 GLU 560 817 817 GLU GLU A . n 
A 1 561 GLU 561 818 818 GLU GLU A . n 
A 1 562 ARG 562 819 819 ARG ARG A . n 
A 1 563 LEU 563 820 820 LEU LEU A . n 
A 1 564 GLN 564 821 821 GLN GLN A . n 
A 1 565 ALA 565 822 822 ALA ALA A . n 
A 1 566 ARG 566 823 823 ARG ARG A . n 
A 1 567 LEU 567 824 824 LEU LEU A . n 
A 1 568 LEU 568 825 825 LEU LEU A . n 
A 1 569 LEU 569 826 826 LEU LEU A . n 
A 1 570 GLN 570 827 827 GLN GLN A . n 
A 1 571 VAL 571 828 828 VAL VAL A . n 
A 1 572 HIS 572 829 829 HIS HIS A . n 
A 1 573 ASP 573 830 830 ASP ASP A . n 
A 1 574 GLU 574 831 831 GLU GLU A . n 
A 1 575 LEU 575 832 832 LEU LEU A . n 
A 1 576 ILE 576 833 833 ILE ILE A . n 
A 1 577 LEU 577 834 834 LEU LEU A . n 
A 1 578 GLU 578 835 835 GLU GLU A . n 
A 1 579 ALA 579 836 836 ALA ALA A . n 
A 1 580 PRO 580 837 837 PRO PRO A . n 
A 1 581 LYS 581 838 838 LYS LYS A . n 
A 1 582 GLU 582 839 839 GLU GLU A . n 
A 1 583 GLU 583 840 840 GLU GLU A . n 
A 1 584 MET 584 841 841 MET MET A . n 
A 1 585 GLU 585 842 842 GLU GLU A . n 
A 1 586 ARG 586 843 843 ARG ARG A . n 
A 1 587 LEU 587 844 844 LEU LEU A . n 
A 1 588 CYS 588 845 845 CYS CYS A . n 
A 1 589 ARG 589 846 846 ARG ARG A . n 
A 1 590 LEU 590 847 847 LEU LEU A . n 
A 1 591 VAL 591 848 848 VAL VAL A . n 
A 1 592 PRO 592 849 849 PRO PRO A . n 
A 1 593 GLU 593 850 850 GLU GLU A . n 
A 1 594 VAL 594 851 851 VAL VAL A . n 
A 1 595 MET 595 852 852 MET MET A . n 
A 1 596 GLU 596 853 853 GLU GLU A . n 
A 1 597 GLN 597 854 854 GLN GLN A . n 
A 1 598 ALA 598 855 855 ALA ALA A . n 
A 1 599 VAL 599 856 856 VAL VAL A . n 
A 1 600 THR 600 857 857 THR THR A . n 
A 1 601 LEU 601 858 858 LEU LEU A . n 
A 1 602 ARG 602 859 859 ARG ARG A . n 
A 1 603 VAL 603 860 860 VAL VAL A . n 
A 1 604 PRO 604 861 861 PRO PRO A . n 
A 1 605 LEU 605 862 862 LEU LEU A . n 
A 1 606 LYS 606 863 863 LYS LYS A . n 
A 1 607 VAL 607 864 864 VAL VAL A . n 
A 1 608 ASP 608 865 865 ASP ASP A . n 
A 1 609 TYR 609 866 866 TYR TYR A . n 
A 1 610 HIS 610 867 867 HIS HIS A . n 
A 1 611 TYR 611 868 868 TYR TYR A . n 
A 1 612 GLY 612 869 869 GLY GLY A . n 
A 1 613 SER 613 870 870 SER SER A . n 
A 1 614 THR 614 871 871 THR THR A . n 
A 1 615 TRP 615 872 872 TRP TRP A . n 
A 1 616 TYR 616 873 873 TYR TYR A . n 
A 1 617 ASP 617 874 874 ASP ASP A . n 
A 1 618 ALA 618 875 875 ALA ALA A . n 
A 1 619 LYS 619 876 876 LYS LYS A . n 
B 2 1   DC  1   1   1   DC  DC  B . n 
B 2 2   DC  2   2   2   DC  DC  B . n 
B 2 3   DT  3   3   3   DT  DT  B . n 
B 2 4   DG  4   4   4   DG  DG  B . n 
B 2 5   DA  5   5   5   DA  DA  B . n 
B 2 6   DC  6   6   6   DC  DC  B . n 
B 2 7   DT  7   7   7   DT  DT  B . n 
B 2 8   DC  8   8   8   DC  DC  B . n 
B 2 9   DT  9   9   9   DT  DT  B . n 
B 2 10  DA  10  10  10  DA  DA  B . n 
B 2 11  DA  11  11  11  DA  DA  B . n 
C 3 1   DC  1   2   ?   ?   ?   C . n 
C 3 2   DA  2   3   ?   ?   ?   C . n 
C 3 3   DT  3   4   4   DT  DT  C . n 
C 3 4   FOX 4   5   5   FOX FOX C . n 
C 3 5   DA  5   6   6   DA  DA  C . n 
C 3 6   DG  6   7   7   DG  DG  C . n 
C 3 7   DA  7   8   8   DA  DA  C . n 
C 3 8   DG  8   9   9   DG  DG  C . n 
C 3 9   DT  9   10  10  DT  DT  C . n 
C 3 10  DC  10  11  11  DC  DC  C . n 
C 3 11  DA  11  12  12  DA  DA  C . n 
C 3 12  DG  12  13  13  DG  DG  C . n 
C 3 13  DG  13  14  14  DG  DG  C . n 
C 3 14  DC  14  15  15  DC  DC  C . n 
C 3 15  DT  15  16  ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SO4 1   1877 1877 SO4 SO4 A . 
E 4 SO4 1   1878 1878 SO4 SO4 A . 
F 4 SO4 1   1879 1879 SO4 SO4 A . 
G 4 SO4 1   1880 1880 SO4 SO4 A . 
H 4 SO4 1   1881 1881 SO4 SO4 A . 
I 4 SO4 1   1882 1882 SO4 SO4 A . 
J 5 MG  1   1883 1883 MG  MG  A . 
K 6 HOH 1   2001 2001 HOH HOH A . 
K 6 HOH 2   2002 2002 HOH HOH A . 
K 6 HOH 3   2003 2003 HOH HOH A . 
K 6 HOH 4   2004 2004 HOH HOH A . 
K 6 HOH 5   2005 2005 HOH HOH A . 
K 6 HOH 6   2006 2006 HOH HOH A . 
K 6 HOH 7   2007 2007 HOH HOH A . 
K 6 HOH 8   2008 2008 HOH HOH A . 
K 6 HOH 9   2009 2009 HOH HOH A . 
K 6 HOH 10  2010 2010 HOH HOH A . 
K 6 HOH 11  2011 2011 HOH HOH A . 
K 6 HOH 12  2012 2012 HOH HOH A . 
K 6 HOH 13  2013 2013 HOH HOH A . 
K 6 HOH 14  2014 2014 HOH HOH A . 
K 6 HOH 15  2015 2015 HOH HOH A . 
K 6 HOH 16  2016 2016 HOH HOH A . 
K 6 HOH 17  2017 2017 HOH HOH A . 
K 6 HOH 18  2018 2018 HOH HOH A . 
K 6 HOH 19  2019 2019 HOH HOH A . 
K 6 HOH 20  2020 2020 HOH HOH A . 
K 6 HOH 21  2021 2021 HOH HOH A . 
K 6 HOH 22  2022 2022 HOH HOH A . 
K 6 HOH 23  2023 2023 HOH HOH A . 
K 6 HOH 24  2024 2024 HOH HOH A . 
K 6 HOH 25  2025 2025 HOH HOH A . 
K 6 HOH 26  2026 2026 HOH HOH A . 
K 6 HOH 27  2027 2027 HOH HOH A . 
K 6 HOH 28  2028 2028 HOH HOH A . 
K 6 HOH 29  2029 2029 HOH HOH A . 
K 6 HOH 30  2030 2030 HOH HOH A . 
K 6 HOH 31  2031 2031 HOH HOH A . 
K 6 HOH 32  2032 2032 HOH HOH A . 
K 6 HOH 33  2033 2033 HOH HOH A . 
K 6 HOH 34  2034 2034 HOH HOH A . 
K 6 HOH 35  2035 2035 HOH HOH A . 
K 6 HOH 36  2036 2036 HOH HOH A . 
K 6 HOH 37  2037 2037 HOH HOH A . 
K 6 HOH 38  2038 2038 HOH HOH A . 
K 6 HOH 39  2039 2039 HOH HOH A . 
K 6 HOH 40  2040 2040 HOH HOH A . 
K 6 HOH 41  2041 2041 HOH HOH A . 
K 6 HOH 42  2042 2042 HOH HOH A . 
K 6 HOH 43  2043 2043 HOH HOH A . 
K 6 HOH 44  2044 2044 HOH HOH A . 
K 6 HOH 45  2045 2045 HOH HOH A . 
K 6 HOH 46  2046 2046 HOH HOH A . 
K 6 HOH 47  2047 2047 HOH HOH A . 
K 6 HOH 48  2048 2048 HOH HOH A . 
K 6 HOH 49  2049 2049 HOH HOH A . 
K 6 HOH 50  2050 2050 HOH HOH A . 
K 6 HOH 51  2051 2051 HOH HOH A . 
K 6 HOH 52  2052 2052 HOH HOH A . 
K 6 HOH 53  2053 2053 HOH HOH A . 
K 6 HOH 54  2054 2054 HOH HOH A . 
K 6 HOH 55  2055 2055 HOH HOH A . 
K 6 HOH 56  2056 2056 HOH HOH A . 
K 6 HOH 57  2057 2057 HOH HOH A . 
K 6 HOH 58  2058 2058 HOH HOH A . 
K 6 HOH 59  2059 2059 HOH HOH A . 
K 6 HOH 60  2060 2060 HOH HOH A . 
K 6 HOH 61  2061 2061 HOH HOH A . 
K 6 HOH 62  2062 2062 HOH HOH A . 
K 6 HOH 63  2063 2063 HOH HOH A . 
K 6 HOH 64  2064 2064 HOH HOH A . 
K 6 HOH 65  2065 2065 HOH HOH A . 
K 6 HOH 66  2066 2066 HOH HOH A . 
K 6 HOH 67  2067 2067 HOH HOH A . 
K 6 HOH 68  2068 2068 HOH HOH A . 
K 6 HOH 69  2069 2069 HOH HOH A . 
K 6 HOH 70  2070 2070 HOH HOH A . 
K 6 HOH 71  2071 2071 HOH HOH A . 
K 6 HOH 72  2072 2072 HOH HOH A . 
K 6 HOH 73  2073 2073 HOH HOH A . 
K 6 HOH 74  2074 2074 HOH HOH A . 
K 6 HOH 75  2075 2075 HOH HOH A . 
K 6 HOH 76  2076 2076 HOH HOH A . 
K 6 HOH 77  2077 2077 HOH HOH A . 
K 6 HOH 78  2078 2078 HOH HOH A . 
K 6 HOH 79  2079 2079 HOH HOH A . 
K 6 HOH 80  2080 2080 HOH HOH A . 
K 6 HOH 81  2081 2081 HOH HOH A . 
K 6 HOH 82  2082 2082 HOH HOH A . 
K 6 HOH 83  2083 2083 HOH HOH A . 
K 6 HOH 84  2084 2084 HOH HOH A . 
K 6 HOH 85  2085 2085 HOH HOH A . 
K 6 HOH 86  2086 2086 HOH HOH A . 
K 6 HOH 87  2087 2087 HOH HOH A . 
K 6 HOH 88  2088 2088 HOH HOH A . 
K 6 HOH 89  2089 2089 HOH HOH A . 
K 6 HOH 90  2090 2090 HOH HOH A . 
K 6 HOH 91  2091 2091 HOH HOH A . 
K 6 HOH 92  2092 2092 HOH HOH A . 
K 6 HOH 93  2093 2093 HOH HOH A . 
K 6 HOH 94  2094 2094 HOH HOH A . 
K 6 HOH 95  2095 2095 HOH HOH A . 
K 6 HOH 96  2096 2096 HOH HOH A . 
K 6 HOH 97  2097 2097 HOH HOH A . 
K 6 HOH 98  2098 2098 HOH HOH A . 
K 6 HOH 99  2099 2099 HOH HOH A . 
K 6 HOH 100 2100 2100 HOH HOH A . 
K 6 HOH 101 2101 2101 HOH HOH A . 
K 6 HOH 102 2102 2102 HOH HOH A . 
K 6 HOH 103 2103 2103 HOH HOH A . 
K 6 HOH 104 2104 2104 HOH HOH A . 
K 6 HOH 105 2105 2105 HOH HOH A . 
K 6 HOH 106 2106 2106 HOH HOH A . 
K 6 HOH 107 2107 2107 HOH HOH A . 
K 6 HOH 108 2108 2108 HOH HOH A . 
K 6 HOH 109 2109 2109 HOH HOH A . 
K 6 HOH 110 2110 2110 HOH HOH A . 
K 6 HOH 111 2111 2111 HOH HOH A . 
K 6 HOH 112 2112 2112 HOH HOH A . 
K 6 HOH 113 2113 2113 HOH HOH A . 
K 6 HOH 114 2114 2114 HOH HOH A . 
K 6 HOH 115 2115 2115 HOH HOH A . 
K 6 HOH 116 2116 2116 HOH HOH A . 
K 6 HOH 117 2117 2117 HOH HOH A . 
K 6 HOH 118 2118 2118 HOH HOH A . 
K 6 HOH 119 2119 2119 HOH HOH A . 
K 6 HOH 120 2120 2120 HOH HOH A . 
K 6 HOH 121 2121 2121 HOH HOH A . 
K 6 HOH 122 2122 2122 HOH HOH A . 
K 6 HOH 123 2123 2123 HOH HOH A . 
K 6 HOH 124 2124 2124 HOH HOH A . 
K 6 HOH 125 2125 2125 HOH HOH A . 
K 6 HOH 126 2126 2126 HOH HOH A . 
K 6 HOH 127 2127 2127 HOH HOH A . 
K 6 HOH 128 2128 2128 HOH HOH A . 
K 6 HOH 129 2129 2129 HOH HOH A . 
K 6 HOH 130 2130 2130 HOH HOH A . 
K 6 HOH 131 2131 2131 HOH HOH A . 
K 6 HOH 132 2132 2132 HOH HOH A . 
K 6 HOH 133 2133 2133 HOH HOH A . 
K 6 HOH 134 2134 2134 HOH HOH A . 
K 6 HOH 135 2135 2135 HOH HOH A . 
K 6 HOH 136 2136 2136 HOH HOH A . 
K 6 HOH 137 2137 2137 HOH HOH A . 
K 6 HOH 138 2138 2138 HOH HOH A . 
K 6 HOH 139 2139 2139 HOH HOH A . 
K 6 HOH 140 2140 2140 HOH HOH A . 
K 6 HOH 141 2141 2141 HOH HOH A . 
K 6 HOH 142 2142 2142 HOH HOH A . 
K 6 HOH 143 2143 2143 HOH HOH A . 
K 6 HOH 144 2144 2144 HOH HOH A . 
K 6 HOH 145 2145 2145 HOH HOH A . 
K 6 HOH 146 2146 2146 HOH HOH A . 
K 6 HOH 147 2147 2147 HOH HOH A . 
K 6 HOH 148 2148 2148 HOH HOH A . 
K 6 HOH 149 2149 2149 HOH HOH A . 
K 6 HOH 150 2150 2150 HOH HOH A . 
K 6 HOH 151 2151 2151 HOH HOH A . 
K 6 HOH 152 2152 2152 HOH HOH A . 
K 6 HOH 153 2153 2153 HOH HOH A . 
K 6 HOH 154 2154 2154 HOH HOH A . 
K 6 HOH 155 2155 2155 HOH HOH A . 
K 6 HOH 156 2156 2156 HOH HOH A . 
K 6 HOH 157 2157 2157 HOH HOH A . 
K 6 HOH 158 2158 2158 HOH HOH A . 
K 6 HOH 159 2159 2159 HOH HOH A . 
K 6 HOH 160 2160 2160 HOH HOH A . 
K 6 HOH 161 2161 2161 HOH HOH A . 
K 6 HOH 162 2162 2162 HOH HOH A . 
K 6 HOH 163 2163 2163 HOH HOH A . 
K 6 HOH 164 2164 2164 HOH HOH A . 
K 6 HOH 165 2165 2165 HOH HOH A . 
K 6 HOH 166 2166 2166 HOH HOH A . 
K 6 HOH 167 2167 2167 HOH HOH A . 
K 6 HOH 168 2168 2168 HOH HOH A . 
K 6 HOH 169 2169 2169 HOH HOH A . 
K 6 HOH 170 2170 2170 HOH HOH A . 
K 6 HOH 171 2171 2171 HOH HOH A . 
K 6 HOH 172 2172 2172 HOH HOH A . 
K 6 HOH 173 2173 2173 HOH HOH A . 
L 6 HOH 1   2001 2001 HOH HOH B . 
M 6 HOH 1   2001 2001 HOH HOH C . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    C 
_pdbx_struct_mod_residue.label_comp_id    FOX 
_pdbx_struct_mod_residue.label_seq_id     4 
_pdbx_struct_mod_residue.auth_asym_id     C 
_pdbx_struct_mod_residue.auth_comp_id     FOX 
_pdbx_struct_mod_residue.auth_seq_id      5 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6240   ? 
1 MORE         -111.2 ? 
1 'SSA (A^2)'  28130  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2 ? A ASP 396 ? A ASP 653 ? 1_555 MG ? J MG . ? A MG 1883 ? 1_555 O   ? A TYR 397 ? A TYR 654 ? 1_555 78.2  ? 
2 OD2 ? A ASP 396 ? A ASP 653 ? 1_555 MG ? J MG . ? A MG 1883 ? 1_555 OD2 ? A ASP 573 ? A ASP 830 ? 1_555 126.7 ? 
3 O   ? A TYR 397 ? A TYR 654 ? 1_555 MG ? J MG . ? A MG 1883 ? 1_555 OD2 ? A ASP 573 ? A ASP 830 ? 1_555 75.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-04-17 
2 'Structure model' 1 1 2013-05-22 
3 'Structure model' 1 2 2013-05-29 
4 'Structure model' 1 3 2013-07-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 2 'Structure model' 'Structure summary'   
3 3 'Structure model' 'Database references' 
4 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 11.4078 21.1037 54.0956 0.1323 0.0920 0.0358 0.0063  -0.0171 -0.0372 4.1416 3.7943 2.2008 -2.2055 
-0.6406 1.6023  -0.1177 -0.6114 0.2607  0.3866  0.2588  -0.1703 -0.1115 0.0703  -0.1411 
'X-RAY DIFFRACTION' 2  ? refined 8.6612  13.8418 46.2635 0.0942 0.0348 0.0342 -0.0241 -0.0006 0.0111  3.4344 1.3028 2.2787 -1.5516 
1.1398  -0.0630 -0.0813 -0.2488 -0.1636 0.2292  0.0834  0.0840  -0.1005 0.0466  -0.0021 
'X-RAY DIFFRACTION' 3  ? refined 9.2997  20.3200 39.7807 0.0281 0.0173 0.0234 -0.0061 0.0007  0.0019  1.0103 2.2198 1.1495 -0.9124 
-0.1307 0.5766  0.0009  -0.0174 0.1411  -0.0002 -0.0014 -0.0748 -0.0944 0.0351  0.0004  
'X-RAY DIFFRACTION' 4  ? refined 38.4610 7.9211  12.1882 0.1758 0.2266 0.1621 -0.0307 0.0140  0.0309  0.5620 1.1710 7.3412 0.5188  
-1.9919 -1.4474 -0.0034 -0.1013 -0.0394 -0.1615 -0.0296 -0.0998 -0.0630 0.3077  0.0330  
'X-RAY DIFFRACTION' 5  ? refined 20.3495 -0.6472 28.2462 0.0583 0.0414 0.0404 0.0032  0.0032  0.0110  2.0130 2.4683 0.9982 -0.2311 
0.4045  0.0358  0.0558  0.1278  -0.0217 -0.1224 -0.0624 -0.2817 -0.0055 0.1910  0.0065  
'X-RAY DIFFRACTION' 6  ? refined 6.7158  0.9382  3.4508  0.1042 0.0514 0.0468 -0.0019 0.0088  0.0051  3.6892 1.8112 3.2095 -0.5173 
-2.3773 0.3536  0.1332  0.2798  0.1890  -0.2468 0.0084  -0.1959 -0.2273 0.0301  -0.1416 
'X-RAY DIFFRACTION' 7  ? refined 0.6056  16.3420 9.9735  0.1516 0.0807 0.0662 0.0272  0.0152  0.0326  1.4542 2.3695 2.2737 0.2727  
1.1213  1.7853  -0.0135 0.2874  0.1335  -0.3716 0.0189  -0.0989 -0.2056 0.1402  -0.0055 
'X-RAY DIFFRACTION' 8  ? refined 7.4073  -7.3073 29.4217 0.0606 0.0075 0.0379 -0.0062 -0.0118 -0.0085 2.1069 1.8341 1.3020 -0.9163 
0.7787  -0.8405 0.0677  0.0030  -0.1837 -0.0493 -0.0280 0.0158  0.1177  -0.0278 -0.0397 
'X-RAY DIFFRACTION' 9  ? refined 0.0000  0.0000  0.0000  0.1290 0.1290 0.1290 0.0000  0.0000  0.0000  0.0000 0.0000 0.0000 0.0000  
0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  
'X-RAY DIFFRACTION' 10 ? refined 0.0000  0.0000  0.0000  0.1290 0.1290 0.1290 0.0000  0.0000  0.0000  0.0000 0.0000 0.0000 0.0000  
0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  0.0000  
'X-RAY DIFFRACTION' 11 ? refined 17.4730 12.8786 18.5721 0.7457 0.2509 0.4110 0.0292  -0.2055 -0.0355 6.9751 0.3521 1.1807 -1.5477 
-2.8649 0.6412  0.0750  1.2253  -0.4307 -0.0917 -0.2700 0.1348  -0.0840 -0.5057 0.1950  
'X-RAY DIFFRACTION' 12 ? refined 34.9778 20.6624 21.1122 0.5545 0.3220 0.2612 -0.0880 -0.0778 -0.0673 8.2763 0.6765 3.0500 -1.6109 
-3.2403 1.4341  0.0955  -0.3353 0.7674  -0.4423 -0.0373 -0.0247 -0.9765 0.0316  -0.0582 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 298 ? ? A 348 ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 349 ? ? A 408 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 409 ? ? A 498 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 499 ? ? A 597 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 598 ? ? A 654 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 655 ? ? A 734 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 735 ? ? A 796 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 797 ? ? A 876 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  B 1   ? ? B 5   ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 6   ? ? B 11  ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 C 3   ? ? C 7   ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 C 8   ? ? C 14  ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.6.0117 ? 1 
XDS    'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             4B9V 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;((1R,2S,4R)-4-{[2-AMINO-5-(FORMYLAMINO)-6-OXO-3,
 6-DIHYDROPYRIMIDIN-4-YL]AMINO}-2-HYDROXYCYCLOPENTYL)METHYL
 5'-PHOSPHATE (FOX): ALSO PRESENT IN PDB CODE 1TDZ
;
_pdbx_entry_details.sequence_details     
;CHAIN A 1-40 DISORDERED
CHAIN B RESI 1 DISORDERED
CHAIN C RESIDUES 1,2 AND 15 ARE DISORDERED
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 843 ? ? CZ A ARG 843 ? ? NH1 A ARG 843 ? ? 123.87 120.30 3.57  0.50 N 
2 1 NE A ARG 843 ? ? CZ A ARG 843 ? ? NH2 A ARG 843 ? ? 117.15 120.30 -3.15 0.50 N 
3 1 NE A ARG 859 ? ? CZ A ARG 859 ? ? NH1 A ARG 859 ? ? 123.56 120.30 3.26  0.50 N 
4 1 NE A ARG 859 ? ? CZ A ARG 859 ? ? NH2 A ARG 859 ? ? 116.73 120.30 -3.57 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 372 ? ? 62.73   60.62  
2  1 ASP A 402 ? ? -167.15 95.96  
3  1 ALA A 421 ? ? -90.67  43.15  
4  1 LEU A 477 ? ? -123.14 -65.57 
5  1 GLN A 524 ? ? -176.78 145.48 
6  1 LEU A 610 ? ? -121.42 -53.64 
7  1 ILE A 628 ? ? -149.33 -31.58 
8  1 HIS A 768 ? ? 87.38   19.51  
9  1 SER A 778 ? ? -25.35  142.30 
10 1 HIS A 829 ? ? 66.66   -59.85 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 298 ? CG ? A LYS 41 CG 
2 1 Y 1 A LYS 298 ? CD ? A LYS 41 CD 
3 1 Y 1 A LYS 298 ? CE ? A LYS 41 CE 
4 1 Y 1 A LYS 298 ? NZ ? A LYS 41 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 258 ? A MET 1  
2  1 Y 1 A ALA 259 ? A ALA 2  
3  1 Y 1 A SER 260 ? A SER 3  
4  1 Y 1 A TRP 261 ? A TRP 4  
5  1 Y 1 A SER 262 ? A SER 5  
6  1 Y 1 A HIS 263 ? A HIS 6  
7  1 Y 1 A PRO 264 ? A PRO 7  
8  1 Y 1 A GLN 265 ? A GLN 8  
9  1 Y 1 A PHE 266 ? A PHE 9  
10 1 Y 1 A GLU 267 ? A GLU 10 
11 1 Y 1 A LYS 268 ? A LYS 11 
12 1 Y 1 A GLY 269 ? A GLY 12 
13 1 Y 1 A ALA 270 ? A ALA 13 
14 1 Y 1 A SER 271 ? A SER 14 
15 1 Y 1 A THR 272 ? A THR 15 
16 1 Y 1 A SER 273 ? A SER 16 
17 1 Y 1 A LEU 274 ? A LEU 17 
18 1 Y 1 A TYR 275 ? A TYR 18 
19 1 Y 1 A LYS 276 ? A LYS 19 
20 1 Y 1 A LYS 277 ? A LYS 20 
21 1 Y 1 A ALA 278 ? A ALA 21 
22 1 Y 1 A GLY 279 ? A GLY 22 
23 1 Y 1 A SER 280 ? A SER 23 
24 1 Y 1 A ALA 281 ? A ALA 24 
25 1 Y 1 A ALA 282 ? A ALA 25 
26 1 Y 1 A ALA 283 ? A ALA 26 
27 1 Y 1 A VAL 284 ? A VAL 27 
28 1 Y 1 A LEU 285 ? A LEU 28 
29 1 Y 1 A GLU 286 ? A GLU 29 
30 1 Y 1 A GLU 287 ? A GLU 30 
31 1 Y 1 A ASN 288 ? A ASN 31 
32 1 Y 1 A LEU 289 ? A LEU 32 
33 1 Y 1 A TYR 290 ? A TYR 33 
34 1 Y 1 A PHE 291 ? A PHE 34 
35 1 Y 1 A GLN 292 ? A GLN 35 
36 1 Y 1 A GLY 293 ? A GLY 36 
37 1 Y 1 A SER 294 ? A SER 37 
38 1 Y 1 A PHE 295 ? A PHE 38 
39 1 Y 1 A THR 296 ? A THR 39 
40 1 Y 1 A ALA 297 ? A ALA 40 
41 1 Y 1 C DC  2   ? C DC  1  
42 1 Y 1 C DA  3   ? C DA  2  
43 1 Y 1 C DT  16  ? C DT  15 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4B9V 'double helix'        
4B9V 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG  13 1_555 -0.389 -0.062 0.294  -8.745 -7.757  -4.310 1  B_DC1:DG14_C  B 1  ? C 14 ? 19 1 
1 B DC 2  1_555 C DG  12 1_555 -0.162 0.103  0.234  -7.052 -11.289 1.460  2  B_DC2:DG13_C  B 2  ? C 13 ? 19 1 
1 B DT 3  1_555 C DA  11 1_555 -0.196 -0.074 -0.008 -5.733 -7.919  -3.376 3  B_DT3:DA12_C  B 3  ? C 12 ? 20 1 
1 B DG 4  1_555 C DC  10 1_555 0.073  -0.066 -0.010 -4.623 -10.226 -0.073 4  B_DG4:DC11_C  B 4  ? C 11 ? 19 1 
1 B DA 5  1_555 C DT  9  1_555 -0.025 -0.097 -0.108 -6.132 -12.135 1.758  5  B_DA5:DT10_C  B 5  ? C 10 ? 20 1 
1 B DC 6  1_555 C DG  8  1_555 0.134  -0.153 0.051  -1.001 -8.637  -1.685 6  B_DC6:DG9_C   B 6  ? C 9  ? 19 1 
1 B DT 7  1_555 C DA  7  1_555 -0.264 0.076  -0.091 -1.766 -6.672  2.773  7  B_DT7:DA8_C   B 7