data_4BBZ
# 
_entry.id   4BBZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BBZ         
PDBE  EBI-54212    
WWPDB D_1290054212 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1EHO unspecified 'MODEL OF (-)-COCAINE-BOUND BCHE COMPLEX.' 
PDB 1EHQ unspecified 'MODEL OF (+)-COCAINE-BOUND BCHE COMPLEX' 
PDB 1KCJ unspecified 'MODEL OF (-)-COCAINE-BOUND (-)-COCAINE HYDROLASE COMPLEX' 
PDB 1P0I unspecified 'CRYSTAL STRUCTURE OF HUMAN BUTYRYL CHOLINESTERASE' 
PDB 1P0M unspecified 'CRYSTAL STRUCTURE OF HUMAN BUTYRYL CHOLINESTERASE INCOMPLEX WITH A CHOLINE MOLECULE' 
PDB 1P0P unspecified 
'CRYSTAL STRUCTURE OF SOMAN-AGED HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH THE SUBSTRATE ANALOGBUTYRYLTHIOCHOLINE'          
PDB 1P0Q unspecified 'CRYSTAL STRUCTURE OF SOMAN-AGED HUMAN BUTYRYL CHOLINESTERASE' 
PDB 1XLU unspecified 'X-RAY STRUCTURE OF DI-ISOPROPYL-PHOSPHORO-FLUORIDATE ( DFP)INHIBITED BUTYRYLCHOLINESTERASE AFTER AGING' 
PDB 1XLV unspecified 'ETHYLPHOSPHORYLATED BUTYRYLCHOLINESTERASE (AGED) OBTAINEDBY REACTION WITH ECHOTHIOPHATE' 
PDB 1XLW unspecified 'DIETHYLPHOSPHORYLATED BUTYRYLCHOLINESTERASE (NONAGED)OBTAINED BY REACTION WITH ECHOTHIOPHATE' 
PDB 2J4C unspecified 'STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH 10MM HGCL2' 
PDB 2WID unspecified 'AGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA1' 
PDB 2WIF unspecified 'AGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA1' 
PDB 2WIG unspecified 'NONAGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA4' 
PDB 2WIJ unspecified 'NONAGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA5' 
PDB 2WIK unspecified 'NONAGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA6' 
PDB 2WIL unspecified 'AGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA5' 
PDB 2WSL unspecified 'AGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA4' 
PDB 2XMB unspecified 'G117H MUTANT OF HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH SULFATE' 
PDB 2XMC unspecified 'G117H MUTANT OF HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH FLUORIDE ANION' 
PDB 2XMD unspecified 'G117H MUTANT OF HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH ECHOTHIOPHATE' 
PDB 2XMG unspecified 'G117H MUTANT OF HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH VX' 
PDB 2XQF unspecified 'X-RAY STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY RACEMIC VX' 
PDB 2XQG unspecified 'X-RAY STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY RACEMIC VR' 
PDB 2XQI unspecified 'X-RAY STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY RACEMIC CVX' 
PDB 2XQJ unspecified 'X-RAY STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY PURE ENANTIOMER VX-(R)' 
PDB 2XQK unspecified 'X-RAY STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY PURE ENANTIOMER VX-(S)' 
PDB 2Y1K unspecified 'STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY CBDP (12H SOAK): PHOSPHOSERINE ADDUCT' 
PDB 4AQD unspecified 'CRYSTAL STRUCTURE OF FULLY GLYCOSYLATED HUMAN BUTYRYLCHOLINESTERASE' 
PDB 4AXB unspecified 'CRYSTAL STRUCTURE OF SOMAN-AGED HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH 2-PAM' 
PDB 4B0O unspecified 
'CRYSTAL STRUCTURE OF SOMAN-AGED HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH BENZYL PYRIDINIUM-4 -METHYLTRICHLOROACETIMIDATE' 
PDB 4B0P unspecified 
'CRYSTAL STRUCTURE OF SOMAN-AGED HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH METHYL 2-( PENTAFLUOROBENZYLOXYIMINO)PYRIDINIUM' 
PDB 4BC0 unspecified 'STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY CBDP (12-H SOAK): CRESYL-PHOSPHOSERINE ADDUCT' 
PDB 4BC1 unspecified 
'STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY CBDP (30-MIN SOAK): CRESYL-SALIGENIN-PHOSPHOSERINE ADDUCT'              
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BBZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-09-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Carletti, E.'     1 
'Colletier, J.-P.' 2 
'Schopfer, L.M.'   3 
'Santoni, G.'      4 
'Masson, P.'       5 
'Lockridge, O.'    6 
'Nachon, F.'       7 
'Weik, M.'         8 
# 
_citation.id                        primary 
_citation.title                     
;Inhibition Pathways of the Potent Organophosphate Cbdp with Cholinesterases Revealed by X-Ray Crystallographic Snapshots and Mass Spectrometry
;
_citation.journal_abbrev            Chem.Res.Toxicol. 
_citation.journal_volume            26 
_citation.page_first                280 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           CRTOEC 
_citation.country                   US 
_citation.journal_id_ISSN           0893-228X 
_citation.journal_id_CSD            2140 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23339663 
_citation.pdbx_database_id_DOI      10.1021/TX3004505 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Carletti, E.'     1 
primary 'Colletier, J.-P.' 2 
primary 'Schopfer, L.M.'   3 
primary 'Santoni, G.'      4 
primary 'Masson, P.'       5 
primary 'Lockridge, O.'    6 
primary 'Nachon, F.'       7 
primary 'Weik, M.'         8 
# 
_cell.entry_id           4BBZ 
_cell.length_a           154.680 
_cell.length_b           154.680 
_cell.length_c           126.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BBZ 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man CHOLINESTERASE                          59699.480 1   3.1.1.8 YES 'CATALYTIC DOMAIN, RESIDUES 29-557' 
'CRESYL-PHOSPHATE ADDUCT ON S198' 
2 non-polymer syn 'UNKNOWN ATOM OR ION'                   ?         7   ?       ?   ?                                   ? 
3 non-polymer man N-ACETYL-D-GLUCOSAMINE                  221.208   8   ?       ?   ?                                   ? 
4 non-polymer man BETA-L-FUCOSE                           164.156   3   ?       ?   ?                                   ? 
5 non-polymer syn 'SULFATE ION'                           96.063    5   ?       ?   ?                                   ? 
6 non-polymer syn 'CHLORIDE ION'                          35.453    1   ?       ?   ?                                   ? 
7 non-polymer syn '(2-methylphenyl) dihydrogen phosphate' 188.118   1   ?       ?   ?                                   ? 
8 water       nat water                                   18.015    139 ?       ?   ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ACYLCHOLINE ACYLHYDROLASE, BUTYRYLCHOLINE ESTERASE, CHOLINE ESTERASE II, PSEUDOCHOLINESTERASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EDDIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSE
MWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNP
EAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVG
VNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAKYGNP
QETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EDDIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSE
MWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNP
EAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVG
VNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAKYGNP
QETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   ILE n 
1 6   ILE n 
1 7   ALA n 
1 8   THR n 
1 9   LYS n 
1 10  ASN n 
1 11  GLY n 
1 12  LYS n 
1 13  VAL n 
1 14  ARG n 
1 15  GLY n 
1 16  MET n 
1 17  GLN n 
1 18  LEU n 
1 19  THR n 
1 20  VAL n 
1 21  PHE n 
1 22  GLY n 
1 23  GLY n 
1 24  THR n 
1 25  VAL n 
1 26  THR n 
1 27  ALA n 
1 28  PHE n 
1 29  LEU n 
1 30  GLY n 
1 31  ILE n 
1 32  PRO n 
1 33  TYR n 
1 34  ALA n 
1 35  GLN n 
1 36  PRO n 
1 37  PRO n 
1 38  LEU n 
1 39  GLY n 
1 40  ARG n 
1 41  LEU n 
1 42  ARG n 
1 43  PHE n 
1 44  LYS n 
1 45  LYS n 
1 46  PRO n 
1 47  GLN n 
1 48  SER n 
1 49  LEU n 
1 50  THR n 
1 51  LYS n 
1 52  TRP n 
1 53  SER n 
1 54  ASP n 
1 55  ILE n 
1 56  TRP n 
1 57  ASN n 
1 58  ALA n 
1 59  THR n 
1 60  LYS n 
1 61  TYR n 
1 62  ALA n 
1 63  ASN n 
1 64  SER n 
1 65  CYS n 
1 66  CYS n 
1 67  GLN n 
1 68  ASN n 
1 69  ILE n 
1 70  ASP n 
1 71  GLN n 
1 72  SER n 
1 73  PHE n 
1 74  PRO n 
1 75  GLY n 
1 76  PHE n 
1 77  HIS n 
1 78  GLY n 
1 79  SER n 
1 80  GLU n 
1 81  MET n 
1 82  TRP n 
1 83  ASN n 
1 84  PRO n 
1 85  ASN n 
1 86  THR n 
1 87  ASP n 
1 88  LEU n 
1 89  SER n 
1 90  GLU n 
1 91  ASP n 
1 92  CYS n 
1 93  LEU n 
1 94  TYR n 
1 95  LEU n 
1 96  ASN n 
1 97  VAL n 
1 98  TRP n 
1 99  ILE n 
1 100 PRO n 
1 101 ALA n 
1 102 PRO n 
1 103 LYS n 
1 104 PRO n 
1 105 LYS n 
1 106 ASN n 
1 107 ALA n 
1 108 THR n 
1 109 VAL n 
1 110 LEU n 
1 111 ILE n 
1 112 TRP n 
1 113 ILE n 
1 114 TYR n 
1 115 GLY n 
1 116 GLY n 
1 117 GLY n 
1 118 PHE n 
1 119 GLN n 
1 120 THR n 
1 121 GLY n 
1 122 THR n 
1 123 SER n 
1 124 SER n 
1 125 LEU n 
1 126 HIS n 
1 127 VAL n 
1 128 TYR n 
1 129 ASP n 
1 130 GLY n 
1 131 LYS n 
1 132 PHE n 
1 133 LEU n 
1 134 ALA n 
1 135 ARG n 
1 136 VAL n 
1 137 GLU n 
1 138 ARG n 
1 139 VAL n 
1 140 ILE n 
1 141 VAL n 
1 142 VAL n 
1 143 SER n 
1 144 MET n 
1 145 ASN n 
1 146 TYR n 
1 147 ARG n 
1 148 VAL n 
1 149 GLY n 
1 150 ALA n 
1 151 LEU n 
1 152 GLY n 
1 153 PHE n 
1 154 LEU n 
1 155 ALA n 
1 156 LEU n 
1 157 PRO n 
1 158 GLY n 
1 159 ASN n 
1 160 PRO n 
1 161 GLU n 
1 162 ALA n 
1 163 PRO n 
1 164 GLY n 
1 165 ASN n 
1 166 MET n 
1 167 GLY n 
1 168 LEU n 
1 169 PHE n 
1 170 ASP n 
1 171 GLN n 
1 172 GLN n 
1 173 LEU n 
1 174 ALA n 
1 175 LEU n 
1 176 GLN n 
1 177 TRP n 
1 178 VAL n 
1 179 GLN n 
1 180 LYS n 
1 181 ASN n 
1 182 ILE n 
1 183 ALA n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 GLY n 
1 188 ASN n 
1 189 PRO n 
1 190 LYS n 
1 191 SER n 
1 192 VAL n 
1 193 THR n 
1 194 LEU n 
1 195 PHE n 
1 196 GLY n 
1 197 GLU n 
1 198 SER n 
1 199 ALA n 
1 200 GLY n 
1 201 ALA n 
1 202 ALA n 
1 203 SER n 
1 204 VAL n 
1 205 SER n 
1 206 LEU n 
1 207 HIS n 
1 208 LEU n 
1 209 LEU n 
1 210 SER n 
1 211 PRO n 
1 212 GLY n 
1 213 SER n 
1 214 HIS n 
1 215 SER n 
1 216 LEU n 
1 217 PHE n 
1 218 THR n 
1 219 ARG n 
1 220 ALA n 
1 221 ILE n 
1 222 LEU n 
1 223 GLN n 
1 224 SER n 
1 225 GLY n 
1 226 SER n 
1 227 PHE n 
1 228 ASN n 
1 229 ALA n 
1 230 PRO n 
1 231 TRP n 
1 232 ALA n 
1 233 VAL n 
1 234 THR n 
1 235 SER n 
1 236 LEU n 
1 237 TYR n 
1 238 GLU n 
1 239 ALA n 
1 240 ARG n 
1 241 ASN n 
1 242 ARG n 
1 243 THR n 
1 244 LEU n 
1 245 ASN n 
1 246 LEU n 
1 247 ALA n 
1 248 LYS n 
1 249 LEU n 
1 250 THR n 
1 251 GLY n 
1 252 CYS n 
1 253 SER n 
1 254 ARG n 
1 255 GLU n 
1 256 ASN n 
1 257 GLU n 
1 258 THR n 
1 259 GLU n 
1 260 ILE n 
1 261 ILE n 
1 262 LYS n 
1 263 CYS n 
1 264 LEU n 
1 265 ARG n 
1 266 ASN n 
1 267 LYS n 
1 268 ASP n 
1 269 PRO n 
1 270 GLN n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 LEU n 
1 275 ASN n 
1 276 GLU n 
1 277 ALA n 
1 278 PHE n 
1 279 VAL n 
1 280 VAL n 
1 281 PRO n 
1 282 TYR n 
1 283 GLY n 
1 284 THR n 
1 285 PRO n 
1 286 LEU n 
1 287 SER n 
1 288 VAL n 
1 289 ASN n 
1 290 PHE n 
1 291 GLY n 
1 292 PRO n 
1 293 THR n 
1 294 VAL n 
1 295 ASP n 
1 296 GLY n 
1 297 ASP n 
1 298 PHE n 
1 299 LEU n 
1 300 THR n 
1 301 ASP n 
1 302 MET n 
1 303 PRO n 
1 304 ASP n 
1 305 ILE n 
1 306 LEU n 
1 307 LEU n 
1 308 GLU n 
1 309 LEU n 
1 310 GLY n 
1 311 GLN n 
1 312 PHE n 
1 313 LYS n 
1 314 LYS n 
1 315 THR n 
1 316 GLN n 
1 317 ILE n 
1 318 LEU n 
1 319 VAL n 
1 320 GLY n 
1 321 VAL n 
1 322 ASN n 
1 323 LYS n 
1 324 ASP n 
1 325 GLU n 
1 326 GLY n 
1 327 THR n 
1 328 ALA n 
1 329 PHE n 
1 330 LEU n 
1 331 VAL n 
1 332 TYR n 
1 333 GLY n 
1 334 ALA n 
1 335 PRO n 
1 336 GLY n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 ASP n 
1 341 ASN n 
1 342 ASN n 
1 343 SER n 
1 344 ILE n 
1 345 ILE n 
1 346 THR n 
1 347 ARG n 
1 348 LYS n 
1 349 GLU n 
1 350 PHE n 
1 351 GLN n 
1 352 GLU n 
1 353 GLY n 
1 354 LEU n 
1 355 LYS n 
1 356 ILE n 
1 357 PHE n 
1 358 PHE n 
1 359 PRO n 
1 360 GLY n 
1 361 VAL n 
1 362 SER n 
1 363 GLU n 
1 364 PHE n 
1 365 GLY n 
1 366 LYS n 
1 367 GLU n 
1 368 SER n 
1 369 ILE n 
1 370 LEU n 
1 371 PHE n 
1 372 HIS n 
1 373 TYR n 
1 374 THR n 
1 375 ASP n 
1 376 TRP n 
1 377 VAL n 
1 378 ASP n 
1 379 ASP n 
1 380 GLN n 
1 381 ARG n 
1 382 PRO n 
1 383 GLU n 
1 384 ASN n 
1 385 TYR n 
1 386 ARG n 
1 387 GLU n 
1 388 ALA n 
1 389 LEU n 
1 390 GLY n 
1 391 ASP n 
1 392 VAL n 
1 393 VAL n 
1 394 GLY n 
1 395 ASP n 
1 396 TYR n 
1 397 ASN n 
1 398 PHE n 
1 399 ILE n 
1 400 CYS n 
1 401 PRO n 
1 402 ALA n 
1 403 LEU n 
1 404 GLU n 
1 405 PHE n 
1 406 THR n 
1 407 LYS n 
1 408 LYS n 
1 409 PHE n 
1 410 SER n 
1 411 GLU n 
1 412 TRP n 
1 413 GLY n 
1 414 ASN n 
1 415 ASN n 
1 416 ALA n 
1 417 PHE n 
1 418 PHE n 
1 419 TYR n 
1 420 TYR n 
1 421 PHE n 
1 422 GLU n 
1 423 HIS n 
1 424 ARG n 
1 425 SER n 
1 426 SER n 
1 427 LYS n 
1 428 LEU n 
1 429 PRO n 
1 430 TRP n 
1 431 PRO n 
1 432 GLU n 
1 433 TRP n 
1 434 MET n 
1 435 GLY n 
1 436 VAL n 
1 437 MET n 
1 438 HIS n 
1 439 GLY n 
1 440 TYR n 
1 441 GLU n 
1 442 ILE n 
1 443 GLU n 
1 444 PHE n 
1 445 VAL n 
1 446 PHE n 
1 447 GLY n 
1 448 LEU n 
1 449 PRO n 
1 450 LEU n 
1 451 GLU n 
1 452 ARG n 
1 453 ARG n 
1 454 ASP n 
1 455 GLN n 
1 456 TYR n 
1 457 THR n 
1 458 LYS n 
1 459 ALA n 
1 460 GLU n 
1 461 GLU n 
1 462 ILE n 
1 463 LEU n 
1 464 SER n 
1 465 ARG n 
1 466 SER n 
1 467 ILE n 
1 468 VAL n 
1 469 LYS n 
1 470 ARG n 
1 471 TRP n 
1 472 ALA n 
1 473 ASN n 
1 474 PHE n 
1 475 ALA n 
1 476 LYS n 
1 477 TYR n 
1 478 GLY n 
1 479 ASN n 
1 480 PRO n 
1 481 GLN n 
1 482 GLU n 
1 483 THR n 
1 484 GLN n 
1 485 ASN n 
1 486 ASN n 
1 487 SER n 
1 488 THR n 
1 489 SER n 
1 490 TRP n 
1 491 PRO n 
1 492 VAL n 
1 493 PHE n 
1 494 LYS n 
1 495 SER n 
1 496 THR n 
1 497 GLU n 
1 498 GLN n 
1 499 LYS n 
1 500 TYR n 
1 501 LEU n 
1 502 THR n 
1 503 LEU n 
1 504 ASN n 
1 505 THR n 
1 506 GLU n 
1 507 SER n 
1 508 THR n 
1 509 ARG n 
1 510 ILE n 
1 511 MET n 
1 512 THR n 
1 513 LYS n 
1 514 LEU n 
1 515 ARG n 
1 516 ALA n 
1 517 GLN n 
1 518 GLN n 
1 519 CYS n 
1 520 ARG n 
1 521 PHE n 
1 522 TRP n 
1 523 THR n 
1 524 SER n 
1 525 PHE n 
1 526 PHE n 
1 527 PRO n 
1 528 LYS n 
1 529 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'CHINESE HAMSTER' 
_entity_src_gen.pdbx_host_org_scientific_name      'CRICETULUS GRISEUS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            CHO-K1 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CHLE_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P06276 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4BBZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 529 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06276 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  557 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       529 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4BBZ GLN A 17  ? UNP P06276 ASN 45  'engineered mutation' 17  1 
1 4BBZ GLN A 455 ? UNP P06276 ASN 483 'engineered mutation' 455 2 
1 4BBZ GLN A 481 ? UNP P06276 ASN 509 'engineered mutation' 481 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4OJ non-polymer         . '(2-methylphenyl) dihydrogen phosphate' o-cresyl-phosphate       'C7 H9 O4 P'     188.118 
ALA 'L-peptide linking' y ALANINE                                 ?                        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ?                        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ?                        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ?                        'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                          ?                        'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                                ?                        'C3 H7 N O2 S'   121.158 
FUL L-saccharide        . BETA-L-FUCOSE                           6-DEOXY-BETA-L-GALACTOSE 'C6 H12 O5'      164.156 
GLN 'L-peptide linking' y GLUTAMINE                               ?                        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ?                        'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ?                        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ?                        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ?                        'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ?                        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ?                        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ?                        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ?                        'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                  ?                        'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE                           ?                        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ?                        'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ?                        'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                           ?                        'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                               ?                        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ?                        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ?                        'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                   ?                        ?                ?       
VAL 'L-peptide linking' y VALINE                                  ?                        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4BBZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.18 
_exptl_crystal.density_percent_sol   61 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PROTEIN WAS CRYSTALLIZED FROM 2.1 M AMMONIUM SULFATE, 0.1 M MES BUFFER PH 6.5.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9765 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9765 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BBZ 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             54.70 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   21049 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        29.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.46 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.20 
_reflns_shell.pdbx_redundancy        9.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BBZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     21049 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54.688 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    98.14 
_refine.ls_R_factor_obs                          0.1693 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1663 
_refine.ls_R_factor_R_free                       0.2248 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1053 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1P0I' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.28 
_refine.pdbx_overall_phase_error                 24.19 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4202 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         186 
_refine_hist.number_atoms_solvent             139 
_refine_hist.number_atoms_total               4527 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        54.688 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 4534 'X-RAY DIFFRACTION' ? 
f_angle_d          1.269  ? ? 6176 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.883 ? ? 1681 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.088  ? ? 674  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 775  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.7001 2.8230  2470 0.2015 99.00 0.2752 . . 130 . . 
'X-RAY DIFFRACTION' . 2.8230 2.9718  2477 0.1983 99.00 0.2715 . . 131 . . 
'X-RAY DIFFRACTION' . 2.9718 3.1580  2495 0.1853 99.00 0.2914 . . 131 . . 
'X-RAY DIFFRACTION' . 3.1580 3.4018  2464 0.1768 99.00 0.2329 . . 130 . . 
'X-RAY DIFFRACTION' . 3.4018 3.7440  2475 0.1545 98.00 0.2021 . . 130 . . 
'X-RAY DIFFRACTION' . 3.7440 4.2856  2503 0.1430 98.00 0.2186 . . 131 . . 
'X-RAY DIFFRACTION' . 4.2856 5.3987  2510 0.1454 98.00 0.1948 . . 133 . . 
'X-RAY DIFFRACTION' . 5.3987 54.6988 2602 0.1815 96.00 0.2212 . . 137 . . 
# 
_struct.entry_id                  4BBZ 
_struct.title                     
'Structure of human butyrylcholinesterase inhibited by CBDP (2-min soak): Cresyl-phosphoserine adduct' 
_struct.pdbx_descriptor           'CHOLINESTERASE (E.C.3.1.1.8)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BBZ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, ACETYLCHOLINESTERASE, NERVE TRANSMISSION, INHIBITION, ALPHA-BETA HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 6 ? 
Z  N N 7 ? 
AA N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 38  ? ARG A 42  ? LEU A 38  ARG A 42  5 ? 5  
HELX_P HELX_P2  2  PHE A 76  ? MET A 81  ? PHE A 76  MET A 81  1 ? 6  
HELX_P HELX_P3  3  LEU A 125 ? ASP A 129 ? LEU A 125 ASP A 129 5 ? 5  
HELX_P HELX_P4  4  GLY A 130 ? ARG A 138 ? GLY A 130 ARG A 138 1 ? 9  
HELX_P HELX_P5  5  GLY A 149 ? LEU A 154 ? GLY A 149 LEU A 154 1 ? 6  
HELX_P HELX_P6  6  ASN A 165 ? ILE A 182 ? ASN A 165 ILE A 182 1 ? 18 
HELX_P HELX_P7  7  ALA A 183 ? PHE A 185 ? ALA A 183 PHE A 185 5 ? 3  
HELX_P HELX_P8  8  SER A 198 ? SER A 210 ? SER A 198 SER A 210 1 ? 13 
HELX_P HELX_P9  9  PRO A 211 ? PHE A 217 ? PRO A 211 PHE A 217 5 ? 7  
HELX_P HELX_P10 10 SER A 235 ? THR A 250 ? SER A 235 THR A 250 1 ? 16 
HELX_P HELX_P11 11 ASN A 256 ? ASN A 266 ? ASN A 256 ASN A 266 1 ? 11 
HELX_P HELX_P12 12 ASP A 268 ? GLU A 276 ? ASP A 268 GLU A 276 1 ? 9  
HELX_P HELX_P13 13 ALA A 277 ? VAL A 279 ? ALA A 277 VAL A 279 5 ? 3  
HELX_P HELX_P14 14 MET A 302 ? LEU A 309 ? MET A 302 LEU A 309 1 ? 8  
HELX_P HELX_P15 15 GLY A 326 ? VAL A 331 ? GLY A 326 VAL A 331 1 ? 6  
HELX_P HELX_P16 16 THR A 346 ? PHE A 358 ? THR A 346 PHE A 358 1 ? 13 
HELX_P HELX_P17 17 SER A 362 ? THR A 374 ? SER A 362 THR A 374 1 ? 13 
HELX_P HELX_P18 18 GLU A 383 ? PHE A 398 ? GLU A 383 PHE A 398 1 ? 16 
HELX_P HELX_P19 19 PHE A 398 ? GLU A 411 ? PHE A 398 GLU A 411 1 ? 14 
HELX_P HELX_P20 20 PRO A 431 ? GLY A 435 ? PRO A 431 GLY A 435 5 ? 5  
HELX_P HELX_P21 21 GLU A 441 ? PHE A 446 ? GLU A 441 PHE A 446 1 ? 6  
HELX_P HELX_P22 22 GLY A 447 ? GLU A 451 ? GLY A 447 GLU A 451 5 ? 5  
HELX_P HELX_P23 23 THR A 457 ? GLY A 478 ? THR A 457 GLY A 478 1 ? 22 
HELX_P HELX_P24 24 ARG A 515 ? PHE A 525 ? ARG A 515 PHE A 525 1 ? 11 
HELX_P HELX_P25 25 PHE A 526 ? VAL A 529 ? PHE A 526 VAL A 529 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 65  SG  ? ? ? 1_555 A CYS 92  SG  ? ? A CYS 65  A CYS 92   1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf2 disulf ? ? A CYS 252 SG  ? ? ? 1_555 A CYS 263 SG  ? ? A CYS 252 A CYS 263  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf3 disulf ? ? A CYS 400 SG  ? ? ? 1_555 A CYS 519 SG  ? ? A CYS 400 A CYS 519  1_555 ? ? ? ? ? ? ? 2.039 ? 
covale1 covale ? ? A ASN 106 ND2 ? ? ? 1_555 K NAG .   C1  ? ? A ASN 106 A NAG 550  1_555 ? ? ? ? ? ? ? 1.458 ? 
covale2 covale ? ? A SER 198 OG  ? ? ? 1_555 Z 4OJ .   P13 ? ? A SER 198 A 4OJ 1530 1_555 ? ? ? ? ? ? ? 2.017 ? 
covale3 covale ? ? A ASN 256 ND2 ? ? ? 1_555 S NAG .   C1  ? ? A ASN 256 A NAG 590  1_555 ? ? ? ? ? ? ? 1.439 ? 
covale4 covale ? ? I NAG .   O6  ? ? ? 1_555 J FUL .   C1  ? ? A NAG 540 A FUL 541  1_555 ? ? ? ? ? ? ? 1.444 ? 
covale5 covale ? ? L NAG .   O4  ? ? ? 1_555 M NAG .   C1  ? ? A NAG 560 A NAG 561  1_555 ? ? ? ? ? ? ? 1.459 ? 
covale6 covale ? ? L NAG .   O6  ? ? ? 1_555 N FUL .   C1  ? ? A NAG 560 A FUL 562  1_555 ? ? ? ? ? ? ? 1.443 ? 
covale7 covale ? ? O NAG .   O6  ? ? ? 1_555 Q FUL .   C1  ? ? A NAG 570 A FUL 572  1_555 ? ? ? ? ? ? ? 1.449 ? 
covale8 covale ? ? O NAG .   O4  ? ? ? 1_555 P NAG .   C1  ? ? A NAG 570 A NAG 571  1_555 ? ? ? ? ? ? ? 1.450 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 101 A . ? ALA 101 A PRO 102 A ? PRO 102 A 1 2.82   
2 ASP 378 A . ? ASP 378 A ASP 379 A ? ASP 379 A 1 -16.83 
3 ASP 379 A . ? ASP 379 A GLN 380 A ? GLN 380 A 1 -3.81  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ILE A 5   ? THR A 8   ? ILE A 5   THR A 8   
AA 2  GLY A 11  ? ARG A 14  ? GLY A 11  ARG A 14  
AA 3  ILE A 55  ? ASN A 57  ? ILE A 55  ASN A 57  
AB 1  MET A 16  ? VAL A 20  ? MET A 16  VAL A 20  
AB 2  GLY A 23  ? PRO A 32  ? GLY A 23  PRO A 32  
AB 3  TYR A 94  ? PRO A 100 ? TYR A 94  PRO A 100 
AB 4  ILE A 140 ? MET A 144 ? ILE A 140 MET A 144 
AB 5  ALA A 107 ? ILE A 113 ? ALA A 107 ILE A 113 
AB 6  GLY A 187 ? GLU A 197 ? GLY A 187 GLU A 197 
AB 7  ARG A 219 ? GLN A 223 ? ARG A 219 GLN A 223 
AB 8  ILE A 317 ? ASN A 322 ? ILE A 317 ASN A 322 
AB 9  ALA A 416 ? PHE A 421 ? ALA A 416 PHE A 421 
AB 10 LYS A 499 ? LEU A 503 ? LYS A 499 LEU A 503 
AB 11 ILE A 510 ? THR A 512 ? ILE A 510 THR A 512 
AC 1  SER A 64  ? CYS A 65  ? SER A 64  CYS A 65  
AC 2  LEU A 88  ? SER A 89  ? LEU A 88  SER A 89  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 8   ? N THR A 8   O GLY A 11  ? O GLY A 11  
AA 2  3  N ARG A 14  ? N ARG A 14  O TRP A 56  ? O TRP A 56  
AB 1  2  N VAL A 20  ? N VAL A 20  O GLY A 23  ? O GLY A 23  
AB 2  3  N ILE A 31  ? N ILE A 31  O LEU A 95  ? O LEU A 95  
AB 3  4  N TRP A 98  ? N TRP A 98  O VAL A 141 ? O VAL A 141 
AB 4  5  N ILE A 140 ? N ILE A 140 O THR A 108 ? O THR A 108 
AB 5  6  O ALA A 107 ? O ALA A 107 N ASN A 188 ? N ASN A 188 
AB 6  7  N LEU A 194 ? N LEU A 194 O ARG A 219 ? O ARG A 219 
AB 7  8  N LEU A 222 ? N LEU A 222 O LEU A 318 ? O LEU A 318 
AB 8  9  N VAL A 319 ? N VAL A 319 O PHE A 417 ? O PHE A 417 
AB 9  10 N TYR A 420 ? N TYR A 420 O LEU A 501 ? O LEU A 501 
AB 10 11 N TYR A 500 ? N TYR A 500 O MET A 511 ? O MET A 511 
AC 1  2  O SER A 64  ? O SER A 64  N SER A 89  ? N SER A 89  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NAG A 580'                             
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 700'                             
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 701'                             
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 702'                             
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 703'                             
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 704'                             
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 713'                              
AC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 4OJ A 1530'                            
AC9 Software ? ? ? ? 3 'BINDING SITE FOR MONO-SACCHARIDE NAG A 550 BOUND TO ASN A 106'  
BC1 Software ? ? ? ? 2 'BINDING SITE FOR MONO-SACCHARIDE NAG A 590 BOUND TO ASN A 256'  
BC2 Software ? ? ? ? 2 'BINDING SITE FOR CHAIN A OF POLYSACCHARIDE RESIDUES 540 TO 541' 
BC3 Software ? ? ? ? 4 'BINDING SITE FOR CHAIN A OF POLYSACCHARIDE RESIDUES 560 TO 562' 
BC4 Software ? ? ? ? 4 'BINDING SITE FOR CHAIN A OF POLYSACCHARIDE RESIDUES 570 TO 572' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ARG A  465 ? ARG A 465  . ? 1_555 ? 
2  AC1 2 ASN A  485 ? ASN A 485  . ? 1_555 ? 
3  AC2 4 GLN A  316 ? GLN A 316  . ? 1_555 ? 
4  AC2 4 GLY A  413 ? GLY A 413  . ? 1_555 ? 
5  AC2 4 ASN A  414 ? ASN A 414  . ? 1_555 ? 
6  AC2 4 ASN A  415 ? ASN A 415  . ? 1_555 ? 
7  AC3 5 LYS A  323 ? LYS A 323  . ? 1_555 ? 
8  AC3 5 TYR A  420 ? TYR A 420  . ? 1_555 ? 
9  AC3 5 ARG A  509 ? ARG A 509  . ? 7_555 ? 
10 AC3 5 ARG A  515 ? ARG A 515  . ? 1_555 ? 
11 AC3 5 SO4 W  .   ? SO4 A 703  . ? 1_555 ? 
12 AC4 2 ARG A  347 ? ARG A 347  . ? 1_555 ? 
13 AC4 2 GLN A  351 ? GLN A 351  . ? 1_555 ? 
14 AC5 4 ARG A  509 ? ARG A 509  . ? 7_555 ? 
15 AC5 4 LEU A  514 ? LEU A 514  . ? 1_555 ? 
16 AC5 4 ARG A  515 ? ARG A 515  . ? 1_555 ? 
17 AC5 4 SO4 U  .   ? SO4 A 701  . ? 1_555 ? 
18 AC6 2 THR A  488 ? THR A 488  . ? 1_555 ? 
19 AC6 2 THR A  508 ? THR A 508  . ? 1_555 ? 
20 AC7 1 LYS A  45  ? LYS A 45   . ? 1_555 ? 
21 AC8 7 GLY A  116 ? GLY A 116  . ? 1_555 ? 
22 AC8 7 GLY A  117 ? GLY A 117  . ? 1_555 ? 
23 AC8 7 SER A  198 ? SER A 198  . ? 1_555 ? 
24 AC8 7 TRP A  231 ? TRP A 231  . ? 1_555 ? 
25 AC8 7 LEU A  286 ? LEU A 286  . ? 1_555 ? 
26 AC8 7 VAL A  288 ? VAL A 288  . ? 1_555 ? 
27 AC8 7 HIS A  438 ? HIS A 438  . ? 1_555 ? 
28 AC9 3 ASN A  106 ? ASN A 106  . ? 1_555 ? 
29 AC9 3 ASN A  188 ? ASN A 188  . ? 1_555 ? 
30 AC9 3 LYS A  190 ? LYS A 190  . ? 1_555 ? 
31 BC1 2 ASN A  256 ? ASN A 256  . ? 1_555 ? 
32 BC1 2 THR A  258 ? THR A 258  . ? 1_555 ? 
33 BC2 2 ARG A  14  ? ARG A 14   . ? 1_555 ? 
34 BC2 2 ASN A  57  ? ASN A 57   . ? 1_555 ? 
35 BC3 4 ASN A  241 ? ASN A 241  . ? 1_555 ? 
36 BC3 4 ASN A  245 ? ASN A 245  . ? 1_555 ? 
37 BC3 4 LEU A  249 ? LEU A 249  . ? 1_555 ? 
38 BC3 4 PHE A  278 ? PHE A 278  . ? 1_555 ? 
39 BC4 4 SER A  338 ? SER A 338  . ? 1_555 ? 
40 BC4 4 ASN A  341 ? ASN A 341  . ? 1_555 ? 
41 BC4 4 GLU A  349 ? GLU A 349  . ? 1_555 ? 
42 BC4 4 HOH AA .   ? HOH A 2075 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BBZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BBZ 
_atom_sites.fract_transf_matrix[1][1]   0.006465 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006465 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007875 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A  1 3   ? -38.012 -17.614 -50.453 1.00   96.32  ? 3    ASP A N   1 
ATOM   2    C  CA  . ASP A  1 3   ? -36.759 -18.361 -50.531 1.00   98.35  ? 3    ASP A CA  1 
ATOM   3    C  C   . ASP A  1 3   ? -35.616 -17.607 -49.838 1.00   99.01  ? 3    ASP A C   1 
ATOM   4    O  O   . ASP A  1 3   ? -35.559 -16.376 -49.874 1.00   103.15 ? 3    ASP A O   1 
ATOM   5    C  CB  . ASP A  1 3   ? -36.398 -18.658 -51.991 1.00   99.97  ? 3    ASP A CB  1 
ATOM   6    C  CG  . ASP A  1 3   ? -35.629 -19.962 -52.149 1.00   100.64 ? 3    ASP A CG  1 
ATOM   7    O  OD1 . ASP A  1 3   ? -35.081 -20.461 -51.142 1.00   101.18 ? 3    ASP A OD1 1 
ATOM   8    O  OD2 . ASP A  1 3   ? -35.571 -20.488 -53.282 1.00   99.88  ? 3    ASP A OD2 1 
ATOM   9    N  N   . ILE A  1 4   ? -34.706 -18.352 -49.212 1.00   89.96  ? 4    ILE A N   1 
ATOM   10   C  CA  . ILE A  1 4   ? -33.628 -17.756 -48.423 1.00   77.03  ? 4    ILE A CA  1 
ATOM   11   C  C   . ILE A  1 4   ? -32.246 -18.282 -48.817 1.00   63.89  ? 4    ILE A C   1 
ATOM   12   O  O   . ILE A  1 4   ? -31.780 -19.286 -48.282 1.00   57.81  ? 4    ILE A O   1 
ATOM   13   C  CB  . ILE A  1 4   ? -33.849 -17.983 -46.913 1.00   75.61  ? 4    ILE A CB  1 
ATOM   14   C  CG1 . ILE A  1 4   ? -35.126 -18.800 -46.670 1.00   73.36  ? 4    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A  1 4   ? -33.907 -16.643 -46.177 1.00   76.40  ? 4    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A  1 4   ? -34.952 -20.301 -46.791 1.00   69.16  ? 4    ILE A CD1 1 
ATOM   17   N  N   . ILE A  1 5   ? -31.591 -17.589 -49.745 1.00   59.53  ? 5    ILE A N   1 
ATOM   18   C  CA  . ILE A  1 5   ? -30.302 -18.029 -50.272 1.00   53.75  ? 5    ILE A CA  1 
ATOM   19   C  C   . ILE A  1 5   ? -29.148 -17.114 -49.853 1.00   55.44  ? 5    ILE A C   1 
ATOM   20   O  O   . ILE A  1 5   ? -29.233 -15.889 -49.972 1.00   60.61  ? 5    ILE A O   1 
ATOM   21   C  CB  . ILE A  1 5   ? -30.344 -18.151 -51.814 1.00   51.88  ? 5    ILE A CB  1 
ATOM   22   C  CG1 . ILE A  1 5   ? -31.267 -19.295 -52.235 1.00   55.24  ? 5    ILE A CG1 1 
ATOM   23   C  CG2 . ILE A  1 5   ? -28.956 -18.376 -52.390 1.00   43.59  ? 5    ILE A CG2 1 
ATOM   24   C  CD1 . ILE A  1 5   ? -31.340 -19.479 -53.731 1.00   59.99  ? 5    ILE A CD1 1 
ATOM   25   N  N   . ILE A  1 6   ? -28.071 -17.721 -49.360 1.00   49.46  ? 6    ILE A N   1 
ATOM   26   C  CA  . ILE A  1 6   ? -26.879 -16.980 -48.968 1.00   47.91  ? 6    ILE A CA  1 
ATOM   27   C  C   . ILE A  1 6   ? -25.710 -17.339 -49.871 1.00   49.11  ? 6    ILE A C   1 
ATOM   28   O  O   . ILE A  1 6   ? -25.473 -18.510 -50.149 1.00   55.53  ? 6    ILE A O   1 
ATOM   29   C  CB  . ILE A  1 6   ? -26.491 -17.281 -47.511 1.00   47.15  ? 6    ILE A CB  1 
ATOM   30   C  CG1 . ILE A  1 6   ? -27.623 -16.873 -46.563 1.00   53.27  ? 6    ILE A CG1 1 
ATOM   31   C  CG2 . ILE A  1 6   ? -25.190 -16.587 -47.140 1.00   35.29  ? 6    ILE A CG2 1 
ATOM   32   C  CD1 . ILE A  1 6   ? -28.042 -15.431 -46.679 1.00   35.62  ? 6    ILE A CD1 1 
ATOM   33   N  N   . ALA A  1 7   ? -24.988 -16.327 -50.336 1.00   47.31  ? 7    ALA A N   1 
ATOM   34   C  CA  . ALA A  1 7   ? -23.795 -16.550 -51.143 1.00   48.23  ? 7    ALA A CA  1 
ATOM   35   C  C   . ALA A  1 7   ? -22.555 -16.649 -50.256 1.00   52.14  ? 7    ALA A C   1 
ATOM   36   O  O   . ALA A  1 7   ? -22.212 -15.698 -49.545 1.00   35.64  ? 7    ALA A O   1 
ATOM   37   C  CB  . ALA A  1 7   ? -23.625 -15.433 -52.157 1.00   43.90  ? 7    ALA A CB  1 
ATOM   38   N  N   . THR A  1 8   ? -21.888 -17.801 -50.299 1.00   49.10  ? 8    THR A N   1 
ATOM   39   C  CA  . THR A  1 8   ? -20.640 -17.992 -49.564 1.00   47.97  ? 8    THR A CA  1 
ATOM   40   C  C   . THR A  1 8   ? -19.493 -18.030 -50.555 1.00   54.01  ? 8    THR A C   1 
ATOM   41   O  O   . THR A  1 8   ? -19.729 -18.162 -51.760 1.00   61.38  ? 8    THR A O   1 
ATOM   42   C  CB  . THR A  1 8   ? -20.635 -19.318 -48.806 1.00   42.82  ? 8    THR A CB  1 
ATOM   43   O  OG1 . THR A  1 8   ? -20.406 -20.392 -49.730 1.00   42.45  ? 8    THR A OG1 1 
ATOM   44   C  CG2 . THR A  1 8   ? -21.963 -19.523 -48.082 1.00   38.16  ? 8    THR A CG2 1 
ATOM   45   N  N   . LYS A  1 9   ? -18.261 -17.941 -50.048 1.00   48.68  ? 9    LYS A N   1 
ATOM   46   C  CA  . LYS A  1 9   ? -17.062 -17.938 -50.895 1.00   55.75  ? 9    LYS A CA  1 
ATOM   47   C  C   . LYS A  1 9   ? -17.022 -19.111 -51.891 1.00   60.55  ? 9    LYS A C   1 
ATOM   48   O  O   . LYS A  1 9   ? -16.583 -18.949 -53.034 1.00   57.73  ? 9    LYS A O   1 
ATOM   49   C  CB  . LYS A  1 9   ? -15.787 -17.937 -50.042 1.00   57.65  ? 9    LYS A CB  1 
ATOM   50   C  CG  . LYS A  1 9   ? -15.702 -16.834 -48.969 1.00   60.03  ? 9    LYS A CG  1 
ATOM   51   C  CD  . LYS A  1 9   ? -15.278 -15.473 -49.530 1.00   59.45  ? 9    LYS A CD  1 
ATOM   52   C  CE  . LYS A  1 9   ? -16.472 -14.594 -49.887 1.00   57.00  ? 9    LYS A CE  1 
ATOM   53   N  NZ  . LYS A  1 9   ? -17.375 -14.379 -48.720 1.00   53.86  ? 9    LYS A NZ  1 
ATOM   54   N  N   . ASN A  1 10  ? -17.498 -20.278 -51.459 1.00   61.90  ? 10   ASN A N   1 
ATOM   55   C  CA  . ASN A  1 10  ? -17.472 -21.479 -52.291 1.00   64.18  ? 10   ASN A CA  1 
ATOM   56   C  C   . ASN A  1 10  ? -18.755 -21.702 -53.092 1.00   66.13  ? 10   ASN A C   1 
ATOM   57   O  O   . ASN A  1 10  ? -18.807 -22.583 -53.952 1.00   69.57  ? 10   ASN A O   1 
ATOM   58   C  CB  . ASN A  1 10  ? -17.165 -22.721 -51.445 1.00   69.48  ? 10   ASN A CB  1 
ATOM   59   C  CG  . ASN A  1 10  ? -15.847 -22.608 -50.696 1.00   74.62  ? 10   ASN A CG  1 
ATOM   60   O  OD1 . ASN A  1 10  ? -14.787 -22.951 -51.224 1.00   77.05  ? 10   ASN A OD1 1 
ATOM   61   N  ND2 . ASN A  1 10  ? -15.907 -22.123 -49.458 1.00   75.47  ? 10   ASN A ND2 1 
ATOM   62   N  N   . GLY A  1 11  ? -19.790 -20.914 -52.813 1.00   62.93  ? 11   GLY A N   1 
ATOM   63   C  CA  . GLY A  1 11  ? -21.015 -21.001 -53.588 1.00   56.38  ? 11   GLY A CA  1 
ATOM   64   C  C   . GLY A  1 11  ? -22.294 -20.697 -52.832 1.00   50.35  ? 11   GLY A C   1 
ATOM   65   O  O   . GLY A  1 11  ? -22.280 -20.455 -51.620 1.00   45.67  ? 11   GLY A O   1 
ATOM   66   N  N   . LYS A  1 12  ? -23.405 -20.702 -53.567 1.00   49.89  ? 12   LYS A N   1 
ATOM   67   C  CA  . LYS A  1 12  ? -24.731 -20.456 -53.006 1.00   52.08  ? 12   LYS A CA  1 
ATOM   68   C  C   . LYS A  1 12  ? -25.211 -21.607 -52.111 1.00   53.69  ? 12   LYS A C   1 
ATOM   69   O  O   . LYS A  1 12  ? -24.972 -22.779 -52.413 1.00   56.98  ? 12   LYS A O   1 
ATOM   70   C  CB  . LYS A  1 12  ? -25.746 -20.220 -54.130 1.00   56.57  ? 12   LYS A CB  1 
ATOM   71   C  CG  . LYS A  1 12  ? -25.679 -18.848 -54.788 1.00   65.27  ? 12   LYS A CG  1 
ATOM   72   C  CD  . LYS A  1 12  ? -26.817 -18.669 -55.798 1.00   75.15  ? 12   LYS A CD  1 
ATOM   73   C  CE  . LYS A  1 12  ? -27.093 -17.194 -56.131 1.00   81.50  ? 12   LYS A CE  1 
ATOM   74   N  NZ  . LYS A  1 12  ? -26.003 -16.522 -56.903 1.00   83.44  ? 12   LYS A NZ  1 
ATOM   75   N  N   . VAL A  1 13  ? -25.879 -21.269 -51.007 1.00   47.19  ? 13   VAL A N   1 
ATOM   76   C  CA  . VAL A  1 13  ? -26.517 -22.279 -50.162 1.00   43.82  ? 13   VAL A CA  1 
ATOM   77   C  C   . VAL A  1 13  ? -27.933 -21.860 -49.744 1.00   43.03  ? 13   VAL A C   1 
ATOM   78   O  O   . VAL A  1 13  ? -28.168 -20.704 -49.380 1.00   41.19  ? 13   VAL A O   1 
ATOM   79   C  CB  . VAL A  1 13  ? -25.661 -22.643 -48.901 1.00   40.35  ? 13   VAL A CB  1 
ATOM   80   C  CG1 . VAL A  1 13  ? -24.205 -22.915 -49.279 1.00   38.88  ? 13   VAL A CG1 1 
ATOM   81   C  CG2 . VAL A  1 13  ? -25.739 -21.563 -47.830 1.00   36.56  ? 13   VAL A CG2 1 
ATOM   82   N  N   . ARG A  1 14  ? -28.876 -22.800 -49.803 1.00   45.32  ? 14   ARG A N   1 
ATOM   83   C  CA  . ARG A  1 14  ? -30.252 -22.531 -49.373 1.00   46.93  ? 14   ARG A CA  1 
ATOM   84   C  C   . ARG A  1 14  ? -30.575 -23.188 -48.035 1.00   50.87  ? 14   ARG A C   1 
ATOM   85   O  O   . ARG A  1 14  ? -30.174 -24.325 -47.773 1.00   52.66  ? 14   ARG A O   1 
ATOM   86   C  CB  . ARG A  1 14  ? -31.249 -22.995 -50.434 1.00   46.25  ? 14   ARG A CB  1 
ATOM   87   C  CG  . ARG A  1 14  ? -32.647 -23.285 -49.923 1.00   52.12  ? 14   ARG A CG  1 
ATOM   88   C  CD  . ARG A  1 14  ? -33.523 -23.885 -51.023 1.00   61.83  ? 14   ARG A CD  1 
ATOM   89   N  NE  . ARG A  1 14  ? -33.641 -22.989 -52.173 1.00   68.95  ? 14   ARG A NE  1 
ATOM   90   C  CZ  . ARG A  1 14  ? -33.269 -23.294 -53.415 1.00   70.78  ? 14   ARG A CZ  1 
ATOM   91   N  NH1 . ARG A  1 14  ? -32.758 -24.488 -53.697 1.00   67.14  ? 14   ARG A NH1 1 
ATOM   92   N  NH2 . ARG A  1 14  ? -33.423 -22.400 -54.382 1.00   74.67  ? 14   ARG A NH2 1 
ATOM   93   N  N   . GLY A  1 15  ? -31.302 -22.468 -47.187 1.00   49.11  ? 15   GLY A N   1 
ATOM   94   C  CA  . GLY A  1 15  ? -31.708 -23.002 -45.902 1.00   46.71  ? 15   GLY A CA  1 
ATOM   95   C  C   . GLY A  1 15  ? -33.200 -23.257 -45.822 1.00   44.95  ? 15   GLY A C   1 
ATOM   96   O  O   . GLY A  1 15  ? -33.858 -23.547 -46.820 1.00   51.13  ? 15   GLY A O   1 
ATOM   97   N  N   . MET A  1 16  ? -33.739 -23.139 -44.618 1.00   38.21  ? 16   MET A N   1 
ATOM   98   C  CA  . MET A  1 16  ? -35.152 -23.373 -44.385 1.00   38.58  ? 16   MET A CA  1 
ATOM   99   C  C   . MET A  1 16  ? -35.618 -22.566 -43.173 1.00   42.39  ? 16   MET A C   1 
ATOM   100  O  O   . MET A  1 16  ? -34.832 -22.278 -42.265 1.00   42.02  ? 16   MET A O   1 
ATOM   101  C  CB  . MET A  1 16  ? -35.418 -24.871 -44.183 1.00   40.33  ? 16   MET A CB  1 
ATOM   102  C  CG  . MET A  1 16  ? -34.709 -25.499 -42.976 1.00   42.54  ? 16   MET A CG  1 
ATOM   103  S  SD  . MET A  1 16  ? -34.962 -27.284 -42.856 1.00   60.03  ? 16   MET A SD  1 
ATOM   104  C  CE  . MET A  1 16  ? -34.257 -27.614 -41.253 1.00   50.39  ? 16   MET A CE  1 
ATOM   105  N  N   . GLN A  1 17  ? -36.893 -22.194 -43.166 1.00   50.65  ? 17   GLN A N   1 
ATOM   106  C  CA  . GLN A  1 17  ? -37.441 -21.399 -42.073 1.00   50.37  ? 17   GLN A CA  1 
ATOM   107  C  C   . GLN A  1 17  ? -38.041 -22.291 -41.001 1.00   41.74  ? 17   GLN A C   1 
ATOM   108  O  O   . GLN A  1 17  ? -38.745 -23.255 -41.296 1.00   43.40  ? 17   GLN A O   1 
ATOM   109  C  CB  . GLN A  1 17  ? -38.480 -20.385 -42.579 1.00   60.89  ? 17   GLN A CB  1 
ATOM   110  C  CG  . GLN A  1 17  ? -37.973 -19.411 -43.651 1.00   73.13  ? 17   GLN A CG  1 
ATOM   111  C  CD  . GLN A  1 17  ? -36.937 -18.405 -43.137 1.00   82.49  ? 17   GLN A CD  1 
ATOM   112  O  OE1 . GLN A  1 17  ? -36.361 -18.570 -42.063 1.00   86.51  ? 17   GLN A OE1 1 
ATOM   113  N  NE2 . GLN A  1 17  ? -36.700 -17.356 -43.917 1.00   85.46  ? 17   GLN A NE2 1 
ATOM   114  N  N   . LEU A  1 18  ? -37.742 -21.965 -39.752 1.00   38.00  ? 18   LEU A N   1 
ATOM   115  C  CA  . LEU A  1 18  ? -38.231 -22.726 -38.617 1.00   39.39  ? 18   LEU A CA  1 
ATOM   116  C  C   . LEU A  1 18  ? -39.017 -21.767 -37.763 1.00   41.77  ? 18   LEU A C   1 
ATOM   117  O  O   . LEU A  1 18  ? -38.580 -20.650 -37.529 1.00   50.89  ? 18   LEU A O   1 
ATOM   118  C  CB  . LEU A  1 18  ? -37.060 -23.281 -37.796 1.00   41.13  ? 18   LEU A CB  1 
ATOM   119  C  CG  . LEU A  1 18  ? -35.972 -24.124 -38.481 1.00   38.08  ? 18   LEU A CG  1 
ATOM   120  C  CD1 . LEU A  1 18  ? -34.917 -24.555 -37.486 1.00   29.91  ? 18   LEU A CD1 1 
ATOM   121  C  CD2 . LEU A  1 18  ? -36.579 -25.348 -39.152 1.00   36.21  ? 18   LEU A CD2 1 
ATOM   122  N  N   . THR A  1 19  ? -40.180 -22.180 -37.295 1.00   44.45  ? 19   THR A N   1 
ATOM   123  C  CA  . THR A  1 19  ? -40.891 -21.335 -36.356 1.00   48.87  ? 19   THR A CA  1 
ATOM   124  C  C   . THR A  1 19  ? -40.575 -21.786 -34.934 1.00   47.61  ? 19   THR A C   1 
ATOM   125  O  O   . THR A  1 19  ? -40.826 -22.930 -34.554 1.00   40.36  ? 19   THR A O   1 
ATOM   126  C  CB  . THR A  1 19  ? -42.399 -21.307 -36.620 1.00   51.51  ? 19   THR A CB  1 
ATOM   127  O  OG1 . THR A  1 19  ? -42.930 -22.621 -36.451 1.00   62.01  ? 19   THR A OG1 1 
ATOM   128  C  CG2 . THR A  1 19  ? -42.677 -20.834 -38.039 1.00   50.48  ? 19   THR A CG2 1 
ATOM   129  N  N   . VAL A  1 20  ? -39.983 -20.872 -34.174 1.00   48.32  ? 20   VAL A N   1 
ATOM   130  C  CA  . VAL A  1 20  ? -39.638 -21.096 -32.782 1.00   46.98  ? 20   VAL A CA  1 
ATOM   131  C  C   . VAL A  1 20  ? -40.267 -19.988 -31.954 1.00   46.83  ? 20   VAL A C   1 
ATOM   132  O  O   . VAL A  1 20  ? -40.069 -18.812 -32.257 1.00   50.99  ? 20   VAL A O   1 
ATOM   133  C  CB  . VAL A  1 20  ? -38.108 -21.010 -32.560 1.00   44.62  ? 20   VAL A CB  1 
ATOM   134  C  CG1 . VAL A  1 20  ? -37.755 -21.379 -31.125 1.00   40.17  ? 20   VAL A CG1 1 
ATOM   135  C  CG2 . VAL A  1 20  ? -37.360 -21.889 -33.552 1.00   41.11  ? 20   VAL A CG2 1 
ATOM   136  N  N   . PHE A  1 21  ? -41.014 -20.364 -30.917 1.00   44.28  ? 21   PHE A N   1 
ATOM   137  C  CA  . PHE A  1 21  ? -41.538 -19.409 -29.935 1.00   43.09  ? 21   PHE A CA  1 
ATOM   138  C  C   . PHE A  1 21  ? -42.190 -18.223 -30.611 1.00   45.89  ? 21   PHE A C   1 
ATOM   139  O  O   . PHE A  1 21  ? -41.767 -17.095 -30.396 1.00   51.29  ? 21   PHE A O   1 
ATOM   140  C  CB  . PHE A  1 21  ? -40.420 -18.868 -29.032 1.00   40.51  ? 21   PHE A CB  1 
ATOM   141  C  CG  . PHE A  1 21  ? -39.646 -19.926 -28.292 1.00   36.56  ? 21   PHE A CG  1 
ATOM   142  C  CD1 . PHE A  1 21  ? -40.242 -21.115 -27.911 1.00   37.32  ? 21   PHE A CD1 1 
ATOM   143  C  CD2 . PHE A  1 21  ? -38.313 -19.714 -27.963 1.00   43.40  ? 21   PHE A CD2 1 
ATOM   144  C  CE1 . PHE A  1 21  ? -39.523 -22.090 -27.225 1.00   40.54  ? 21   PHE A CE1 1 
ATOM   145  C  CE2 . PHE A  1 21  ? -37.581 -20.682 -27.274 1.00   47.54  ? 21   PHE A CE2 1 
ATOM   146  C  CZ  . PHE A  1 21  ? -38.195 -21.875 -26.905 1.00   45.89  ? 21   PHE A CZ  1 
ATOM   147  N  N   . GLY A  1 22  ? -43.182 -18.479 -31.457 1.00   49.93  ? 22   GLY A N   1 
ATOM   148  C  CA  . GLY A  1 22  ? -43.877 -17.421 -32.167 1.00   45.48  ? 22   GLY A CA  1 
ATOM   149  C  C   . GLY A  1 22  ? -42.993 -16.537 -33.026 1.00   45.34  ? 22   GLY A C   1 
ATOM   150  O  O   . GLY A  1 22  ? -43.375 -15.424 -33.375 1.00   57.39  ? 22   GLY A O   1 
ATOM   151  N  N   . GLY A  1 23  ? -41.809 -17.025 -33.373 1.00   41.64  ? 23   GLY A N   1 
ATOM   152  C  CA  . GLY A  1 23  ? -40.887 -16.267 -34.198 1.00   43.83  ? 23   GLY A CA  1 
ATOM   153  C  C   . GLY A  1 23  ? -40.361 -17.117 -35.333 1.00   50.80  ? 23   GLY A C   1 
ATOM   154  O  O   . GLY A  1 23  ? -40.970 -18.122 -35.690 1.00   57.48  ? 23   GLY A O   1 
ATOM   155  N  N   . THR A  1 24  ? -39.228 -16.723 -35.900 1.00   50.04  ? 24   THR A N   1 
ATOM   156  C  CA  . THR A  1 24  ? -38.643 -17.468 -37.002 1.00   47.88  ? 24   THR A CA  1 
ATOM   157  C  C   . THR A  1 24  ? -37.133 -17.539 -36.864 1.00   51.11  ? 24   THR A C   1 
ATOM   158  O  O   . THR A  1 24  ? -36.491 -16.555 -36.497 1.00   60.51  ? 24   THR A O   1 
ATOM   159  C  CB  . THR A  1 24  ? -39.013 -16.845 -38.358 1.00   51.55  ? 24   THR A CB  1 
ATOM   160  O  OG1 . THR A  1 24  ? -40.433 -16.899 -38.530 1.00   56.70  ? 24   THR A OG1 1 
ATOM   161  C  CG2 . THR A  1 24  ? -38.351 -17.591 -39.498 1.00   37.98  ? 24   THR A CG2 1 
ATOM   162  N  N   . VAL A  1 25  ? -36.577 -18.718 -37.132 1.00   46.28  ? 25   VAL A N   1 
ATOM   163  C  CA  . VAL A  1 25  ? -35.133 -18.900 -37.198 1.00   44.66  ? 25   VAL A CA  1 
ATOM   164  C  C   . VAL A  1 25  ? -34.779 -19.556 -38.526 1.00   46.44  ? 25   VAL A C   1 
ATOM   165  O  O   . VAL A  1 25  ? -35.478 -20.463 -38.971 1.00   45.64  ? 25   VAL A O   1 
ATOM   166  C  CB  . VAL A  1 25  ? -34.623 -19.775 -36.039 1.00   36.78  ? 25   VAL A CB  1 
ATOM   167  C  CG1 . VAL A  1 25  ? -33.223 -20.311 -36.334 1.00   32.49  ? 25   VAL A CG1 1 
ATOM   168  C  CG2 . VAL A  1 25  ? -34.648 -18.991 -34.728 1.00   32.64  ? 25   VAL A CG2 1 
ATOM   169  N  N   . THR A  1 26  ? -33.707 -19.089 -39.165 1.00   44.97  ? 26   THR A N   1 
ATOM   170  C  CA  . THR A  1 26  ? -33.236 -19.701 -40.406 1.00   43.74  ? 26   THR A CA  1 
ATOM   171  C  C   . THR A  1 26  ? -32.138 -20.741 -40.161 1.00   38.47  ? 26   THR A C   1 
ATOM   172  O  O   . THR A  1 26  ? -31.088 -20.428 -39.610 1.00   26.81  ? 26   THR A O   1 
ATOM   173  C  CB  . THR A  1 26  ? -32.725 -18.643 -41.385 1.00   42.76  ? 26   THR A CB  1 
ATOM   174  O  OG1 . THR A  1 26  ? -33.694 -17.599 -41.489 1.00   46.04  ? 26   THR A OG1 1 
ATOM   175  C  CG2 . THR A  1 26  ? -32.500 -19.249 -42.755 1.00   43.21  ? 26   THR A CG2 1 
ATOM   176  N  N   . ALA A  1 27  ? -32.387 -21.980 -40.577 1.00   37.39  ? 27   ALA A N   1 
ATOM   177  C  CA  . ALA A  1 27  ? -31.411 -23.050 -40.376 1.00   34.89  ? 27   ALA A CA  1 
ATOM   178  C  C   . ALA A  1 27  ? -30.729 -23.448 -41.680 1.00   30.10  ? 27   ALA A C   1 
ATOM   179  O  O   . ALA A  1 27  ? -31.381 -23.698 -42.691 1.00   31.77  ? 27   ALA A O   1 
ATOM   180  C  CB  . ALA A  1 27  ? -32.057 -24.253 -39.724 1.00   26.33  ? 27   ALA A CB  1 
ATOM   181  N  N   . PHE A  1 28  ? -29.405 -23.459 -41.656 1.00   29.38  ? 28   PHE A N   1 
ATOM   182  C  CA  . PHE A  1 28  ? -28.623 -24.001 -42.753 1.00   36.25  ? 28   PHE A CA  1 
ATOM   183  C  C   . PHE A  1 28  ? -27.956 -25.263 -42.237 1.00   35.45  ? 28   PHE A C   1 
ATOM   184  O  O   . PHE A  1 28  ? -26.876 -25.200 -41.635 1.00   34.03  ? 28   PHE A O   1 
ATOM   185  C  CB  . PHE A  1 28  ? -27.575 -22.993 -43.230 1.00   36.64  ? 28   PHE A CB  1 
ATOM   186  C  CG  . PHE A  1 28  ? -28.165 -21.784 -43.898 1.00   39.78  ? 28   PHE A CG  1 
ATOM   187  C  CD1 . PHE A  1 28  ? -28.561 -20.686 -43.148 1.00   37.25  ? 28   PHE A CD1 1 
ATOM   188  C  CD2 . PHE A  1 28  ? -28.340 -21.751 -45.277 1.00   41.70  ? 28   PHE A CD2 1 
ATOM   189  C  CE1 . PHE A  1 28  ? -29.119 -19.574 -43.756 1.00   38.73  ? 28   PHE A CE1 1 
ATOM   190  C  CE2 . PHE A  1 28  ? -28.894 -20.643 -45.892 1.00   45.52  ? 28   PHE A CE2 1 
ATOM   191  C  CZ  . PHE A  1 28  ? -29.285 -19.550 -45.127 1.00   42.40  ? 28   PHE A CZ  1 
ATOM   192  N  N   . LEU A  1 29  ? -28.618 -26.400 -42.447 1.00   26.75  ? 29   LEU A N   1 
ATOM   193  C  CA  . LEU A  1 29  ? -28.129 -27.669 -41.935 1.00   24.21  ? 29   LEU A CA  1 
ATOM   194  C  C   . LEU A  1 29  ? -27.288 -28.405 -42.982 1.00   29.76  ? 29   LEU A C   1 
ATOM   195  O  O   . LEU A  1 29  ? -27.714 -28.601 -44.122 1.00   31.65  ? 29   LEU A O   1 
ATOM   196  C  CB  . LEU A  1 29  ? -29.294 -28.546 -41.472 1.00   24.69  ? 29   LEU A CB  1 
ATOM   197  C  CG  . LEU A  1 29  ? -30.292 -28.000 -40.439 1.00   34.75  ? 29   LEU A CG  1 
ATOM   198  C  CD1 . LEU A  1 29  ? -31.255 -29.090 -39.991 1.00   25.13  ? 29   LEU A CD1 1 
ATOM   199  C  CD2 . LEU A  1 29  ? -29.606 -27.370 -39.226 1.00   25.09  ? 29   LEU A CD2 1 
ATOM   200  N  N   . GLY A  1 30  ? -26.088 -28.814 -42.588 1.00   26.94  ? 30   GLY A N   1 
ATOM   201  C  CA  . GLY A  1 30  ? -25.234 -29.615 -43.450 1.00   33.32  ? 30   GLY A CA  1 
ATOM   202  C  C   . GLY A  1 30  ? -24.561 -28.869 -44.589 1.00   36.82  ? 30   GLY A C   1 
ATOM   203  O  O   . GLY A  1 30  ? -24.740 -29.208 -45.757 1.00   37.29  ? 30   GLY A O   1 
ATOM   204  N  N   . ILE A  1 31  ? -23.785 -27.845 -44.255 1.00   34.11  ? 31   ILE A N   1 
ATOM   205  C  CA  . ILE A  1 31  ? -22.968 -27.172 -45.247 1.00   37.81  ? 31   ILE A CA  1 
ATOM   206  C  C   . ILE A  1 31  ? -21.592 -27.828 -45.249 1.00   40.56  ? 31   ILE A C   1 
ATOM   207  O  O   . ILE A  1 31  ? -20.985 -27.973 -44.190 1.00   41.76  ? 31   ILE A O   1 
ATOM   208  C  CB  . ILE A  1 31  ? -22.774 -25.690 -44.884 1.00   41.03  ? 31   ILE A CB  1 
ATOM   209  C  CG1 . ILE A  1 31  ? -24.118 -24.978 -44.739 1.00   39.71  ? 31   ILE A CG1 1 
ATOM   210  C  CG2 . ILE A  1 31  ? -21.872 -24.989 -45.906 1.00   40.31  ? 31   ILE A CG2 1 
ATOM   211  C  CD1 . ILE A  1 31  ? -23.966 -23.527 -44.325 1.00   37.87  ? 31   ILE A CD1 1 
ATOM   212  N  N   . PRO A  1 32  ? -21.081 -28.207 -46.432 1.00   41.48  ? 32   PRO A N   1 
ATOM   213  C  CA  . PRO A  1 32  ? -19.746 -28.832 -46.481 1.00   40.22  ? 32   PRO A CA  1 
ATOM   214  C  C   . PRO A  1 32  ? -18.645 -27.813 -46.193 1.00   39.16  ? 32   PRO A C   1 
ATOM   215  O  O   . PRO A  1 32  ? -18.791 -26.650 -46.569 1.00   39.14  ? 32   PRO A O   1 
ATOM   216  C  CB  . PRO A  1 32  ? -19.648 -29.329 -47.929 1.00   41.87  ? 32   PRO A CB  1 
ATOM   217  C  CG  . PRO A  1 32  ? -20.548 -28.375 -48.712 1.00   37.05  ? 32   PRO A CG  1 
ATOM   218  C  CD  . PRO A  1 32  ? -21.672 -28.012 -47.773 1.00   37.21  ? 32   PRO A CD  1 
ATOM   219  N  N   . TYR A  1 33  ? -17.561 -28.223 -45.539 1.00   33.73  ? 33   TYR A N   1 
ATOM   220  C  CA  . TYR A  1 33  ? -16.484 -27.275 -45.279 1.00   32.17  ? 33   TYR A CA  1 
ATOM   221  C  C   . TYR A  1 33  ? -15.096 -27.805 -45.660 1.00   37.09  ? 33   TYR A C   1 
ATOM   222  O  O   . TYR A  1 33  ? -14.079 -27.130 -45.425 1.00   32.91  ? 33   TYR A O   1 
ATOM   223  C  CB  . TYR A  1 33  ? -16.523 -26.761 -43.832 1.00   33.94  ? 33   TYR A CB  1 
ATOM   224  C  CG  . TYR A  1 33  ? -16.122 -27.777 -42.779 1.00   34.31  ? 33   TYR A CG  1 
ATOM   225  C  CD1 . TYR A  1 33  ? -14.788 -27.942 -42.416 1.00   36.07  ? 33   TYR A CD1 1 
ATOM   226  C  CD2 . TYR A  1 33  ? -17.072 -28.563 -42.148 1.00   25.21  ? 33   TYR A CD2 1 
ATOM   227  C  CE1 . TYR A  1 33  ? -14.416 -28.875 -41.468 1.00   34.23  ? 33   TYR A CE1 1 
ATOM   228  C  CE2 . TYR A  1 33  ? -16.711 -29.489 -41.198 1.00   24.62  ? 33   TYR A CE2 1 
ATOM   229  C  CZ  . TYR A  1 33  ? -15.382 -29.642 -40.857 1.00   29.83  ? 33   TYR A CZ  1 
ATOM   230  O  OH  . TYR A  1 33  ? -15.014 -30.566 -39.898 1.00   29.05  ? 33   TYR A OH  1 
ATOM   231  N  N   . ALA A  1 34  ? -15.065 -28.999 -46.261 1.00   37.94  ? 34   ALA A N   1 
ATOM   232  C  CA  . ALA A  1 34  ? -13.823 -29.594 -46.773 1.00   30.02  ? 34   ALA A CA  1 
ATOM   233  C  C   . ALA A  1 34  ? -14.108 -30.678 -47.802 1.00   28.64  ? 34   ALA A C   1 
ATOM   234  O  O   . ALA A  1 34  ? -15.210 -31.225 -47.840 1.00   33.93  ? 34   ALA A O   1 
ATOM   235  C  CB  . ALA A  1 34  ? -13.009 -30.162 -45.637 1.00   24.45  ? 34   ALA A CB  1 
ATOM   236  N  N   . GLN A  1 35  ? -13.130 -30.993 -48.644 1.00   33.83  ? 35   GLN A N   1 
ATOM   237  C  CA  . GLN A  1 35  ? -13.256 -32.172 -49.501 1.00   44.63  ? 35   GLN A CA  1 
ATOM   238  C  C   . GLN A  1 35  ? -13.426 -33.370 -48.591 1.00   47.45  ? 35   GLN A C   1 
ATOM   239  O  O   . GLN A  1 35  ? -12.685 -33.505 -47.609 1.00   52.51  ? 35   GLN A O   1 
ATOM   240  C  CB  . GLN A  1 35  ? -12.003 -32.411 -50.334 1.00   51.26  ? 35   GLN A CB  1 
ATOM   241  C  CG  . GLN A  1 35  ? -11.535 -31.251 -51.167 1.00   63.19  ? 35   GLN A CG  1 
ATOM   242  C  CD  . GLN A  1 35  ? -10.235 -31.581 -51.871 1.00   75.27  ? 35   GLN A CD  1 
ATOM   243  O  OE1 . GLN A  1 35  ? -9.999  -32.735 -52.246 1.00   74.35  ? 35   GLN A OE1 1 
ATOM   244  N  NE2 . GLN A  1 35  ? -9.372  -30.580 -52.034 1.00   79.69  ? 35   GLN A NE2 1 
ATOM   245  N  N   . PRO A  1 36  ? -14.401 -34.239 -48.899 1.00   40.68  ? 36   PRO A N   1 
ATOM   246  C  CA  . PRO A  1 36  ? -14.588 -35.448 -48.093 1.00   36.79  ? 36   PRO A CA  1 
ATOM   247  C  C   . PRO A  1 36  ? -13.286 -36.261 -48.002 1.00   33.18  ? 36   PRO A C   1 
ATOM   248  O  O   . PRO A  1 36  ? -12.650 -36.530 -49.020 1.00   36.75  ? 36   PRO A O   1 
ATOM   249  C  CB  . PRO A  1 36  ? -15.662 -36.222 -48.872 1.00   42.58  ? 36   PRO A CB  1 
ATOM   250  C  CG  . PRO A  1 36  ? -16.387 -35.189 -49.656 1.00   30.97  ? 36   PRO A CG  1 
ATOM   251  C  CD  . PRO A  1 36  ? -15.351 -34.165 -50.024 1.00   31.12  ? 36   PRO A CD  1 
ATOM   252  N  N   . PRO A  1 37  ? -12.883 -36.636 -46.783 1.00   28.62  ? 37   PRO A N   1 
ATOM   253  C  CA  . PRO A  1 37  ? -11.582 -37.289 -46.600 1.00   29.28  ? 37   PRO A CA  1 
ATOM   254  C  C   . PRO A  1 37  ? -11.628 -38.771 -46.942 1.00   30.78  ? 37   PRO A C   1 
ATOM   255  O  O   . PRO A  1 37  ? -11.394 -39.613 -46.075 1.00   37.90  ? 37   PRO A O   1 
ATOM   256  C  CB  . PRO A  1 37  ? -11.300 -37.081 -45.113 1.00   33.61  ? 37   PRO A CB  1 
ATOM   257  C  CG  . PRO A  1 37  ? -12.687 -37.021 -44.482 1.00   36.16  ? 37   PRO A CG  1 
ATOM   258  C  CD  . PRO A  1 37  ? -13.606 -36.434 -45.511 1.00   35.30  ? 37   PRO A CD  1 
ATOM   259  N  N   . LEU A  1 38  ? -11.926 -39.071 -48.203 1.00   32.51  ? 38   LEU A N   1 
ATOM   260  C  CA  . LEU A  1 38  ? -12.083 -40.436 -48.685 1.00   34.24  ? 38   LEU A CA  1 
ATOM   261  C  C   . LEU A  1 38  ? -10.891 -40.858 -49.521 1.00   42.61  ? 38   LEU A C   1 
ATOM   262  O  O   . LEU A  1 38  ? -10.120 -40.013 -50.000 1.00   39.60  ? 38   LEU A O   1 
ATOM   263  C  CB  . LEU A  1 38  ? -13.303 -40.524 -49.586 1.00   38.76  ? 38   LEU A CB  1 
ATOM   264  C  CG  . LEU A  1 38  ? -14.637 -39.965 -49.122 1.00   41.81  ? 38   LEU A CG  1 
ATOM   265  C  CD1 . LEU A  1 38  ? -15.580 -39.912 -50.317 1.00   43.54  ? 38   LEU A CD1 1 
ATOM   266  C  CD2 . LEU A  1 38  ? -15.214 -40.836 -48.021 1.00   41.37  ? 38   LEU A CD2 1 
ATOM   267  N  N   . GLY A  1 39  ? -10.763 -42.166 -49.721 1.00   37.85  ? 39   GLY A N   1 
ATOM   268  C  CA  . GLY A  1 39  ? -9.738  -42.715 -50.585 1.00   40.16  ? 39   GLY A CA  1 
ATOM   269  C  C   . GLY A  1 39  ? -8.347  -42.423 -50.071 1.00   45.43  ? 39   GLY A C   1 
ATOM   270  O  O   . GLY A  1 39  ? -8.027  -42.739 -48.924 1.00   49.76  ? 39   GLY A O   1 
ATOM   271  N  N   . ARG A  1 40  ? -7.522  -41.809 -50.916 1.00   44.94  ? 40   ARG A N   1 
ATOM   272  C  CA  . ARG A  1 40  ? -6.174  -41.402 -50.513 1.00   49.25  ? 40   ARG A CA  1 
ATOM   273  C  C   . ARG A  1 40  ? -6.165  -40.266 -49.476 1.00   49.65  ? 40   ARG A C   1 
ATOM   274  O  O   . ARG A  1 40  ? -5.100  -39.855 -49.015 1.00   53.67  ? 40   ARG A O   1 
ATOM   275  C  CB  . ARG A  1 40  ? -5.337  -41.009 -51.739 1.00   51.40  ? 40   ARG A CB  1 
ATOM   276  C  CG  . ARG A  1 40  ? -5.903  -39.847 -52.553 1.00   60.39  ? 40   ARG A CG  1 
ATOM   277  C  CD  . ARG A  1 40  ? -5.787  -40.113 -54.048 0.0000 74.02  ? 40   ARG A CD  1 
ATOM   278  N  NE  . ARG A  1 40  ? -6.726  -41.141 -54.493 1.00   85.84  ? 40   ARG A NE  1 
ATOM   279  C  CZ  . ARG A  1 40  ? -7.822  -40.897 -55.204 0.82   91.25  ? 40   ARG A CZ  1 
ATOM   280  N  NH1 . ARG A  1 40  ? -8.115  -39.654 -55.564 1.00   96.25  ? 40   ARG A NH1 1 
ATOM   281  N  NH2 . ARG A  1 40  ? -8.621  -41.894 -55.559 1.00   88.33  ? 40   ARG A NH2 1 
ATOM   282  N  N   . LEU A  1 41  ? -7.341  -39.763 -49.106 1.00   43.20  ? 41   LEU A N   1 
ATOM   283  C  CA  . LEU A  1 41  ? -7.416  -38.674 -48.138 1.00   38.54  ? 41   LEU A CA  1 
ATOM   284  C  C   . LEU A  1 41  ? -7.650  -39.117 -46.684 1.00   40.68  ? 41   LEU A C   1 
ATOM   285  O  O   . LEU A  1 41  ? -7.506  -38.308 -45.757 1.00   33.58  ? 41   LEU A O   1 
ATOM   286  C  CB  . LEU A  1 41  ? -8.459  -37.645 -48.563 1.00   38.33  ? 41   LEU A CB  1 
ATOM   287  C  CG  . LEU A  1 41  ? -8.045  -36.743 -49.727 1.00   40.21  ? 41   LEU A CG  1 
ATOM   288  C  CD1 . LEU A  1 41  ? -9.092  -35.665 -49.947 1.00   35.30  ? 41   LEU A CD1 1 
ATOM   289  C  CD2 . LEU A  1 41  ? -6.665  -36.134 -49.482 1.00   35.05  ? 41   LEU A CD2 1 
ATOM   290  N  N   . ARG A  1 42  ? -7.995  -40.388 -46.485 1.00   33.51  ? 42   ARG A N   1 
ATOM   291  C  CA  . ARG A  1 42  ? -8.156  -40.927 -45.136 1.00   33.78  ? 42   ARG A CA  1 
ATOM   292  C  C   . ARG A  1 42  ? -6.877  -40.771 -44.299 1.00   33.52  ? 42   ARG A C   1 
ATOM   293  O  O   . ARG A  1 42  ? -5.774  -41.008 -44.792 1.00   33.73  ? 42   ARG A O   1 
ATOM   294  C  CB  . ARG A  1 42  ? -8.601  -42.395 -45.183 1.00   39.54  ? 42   ARG A CB  1 
ATOM   295  C  CG  . ARG A  1 42  ? -8.761  -43.051 -43.822 1.00   32.72  ? 42   ARG A CG  1 
ATOM   296  C  CD  . ARG A  1 42  ? -8.928  -44.570 -43.950 1.00   34.54  ? 42   ARG A CD  1 
ATOM   297  N  NE  . ARG A  1 42  ? -10.259 -44.936 -44.426 1.00   35.71  ? 42   ARG A NE  1 
ATOM   298  C  CZ  . ARG A  1 42  ? -10.637 -46.172 -44.741 1.00   41.18  ? 42   ARG A CZ  1 
ATOM   299  N  NH1 . ARG A  1 42  ? -9.788  -47.189 -44.637 1.00   39.27  ? 42   ARG A NH1 1 
ATOM   300  N  NH2 . ARG A  1 42  ? -11.872 -46.390 -45.166 1.00   36.62  ? 42   ARG A NH2 1 
ATOM   301  N  N   . PHE A  1 43  ? -7.056  -40.369 -43.039 1.00   35.88  ? 43   PHE A N   1 
ATOM   302  C  CA  . PHE A  1 43  ? -5.983  -40.055 -42.088 1.00   34.37  ? 43   PHE A CA  1 
ATOM   303  C  C   . PHE A  1 43  ? -5.201  -38.766 -42.385 1.00   37.33  ? 43   PHE A C   1 
ATOM   304  O  O   . PHE A  1 43  ? -4.367  -38.351 -41.584 1.00   34.31  ? 43   PHE A O   1 
ATOM   305  C  CB  . PHE A  1 43  ? -4.991  -41.210 -41.910 1.00   36.77  ? 43   PHE A CB  1 
ATOM   306  C  CG  . PHE A  1 43  ? -5.627  -42.545 -41.673 1.00   38.49  ? 43   PHE A CG  1 
ATOM   307  C  CD1 . PHE A  1 43  ? -6.430  -42.762 -40.565 1.00   30.82  ? 43   PHE A CD1 1 
ATOM   308  C  CD2 . PHE A  1 43  ? -5.377  -43.603 -42.544 1.00   36.16  ? 43   PHE A CD2 1 
ATOM   309  C  CE1 . PHE A  1 43  ? -6.987  -43.997 -40.336 1.00   31.66  ? 43   PHE A CE1 1 
ATOM   310  C  CE2 . PHE A  1 43  ? -5.940  -44.844 -42.327 1.00   35.36  ? 43   PHE A CE2 1 
ATOM   311  C  CZ  . PHE A  1 43  ? -6.749  -45.044 -41.225 1.00   33.94  ? 43   PHE A CZ  1 
ATOM   312  N  N   . LYS A  1 44  ? -5.435  -38.141 -43.532 1.00   30.01  ? 44   LYS A N   1 
ATOM   313  C  CA  . LYS A  1 44  ? -4.773  -36.872 -43.790 1.00   34.45  ? 44   LYS A CA  1 
ATOM   314  C  C   . LYS A  1 44  ? -5.561  -35.716 -43.187 1.00   35.48  ? 44   LYS A C   1 
ATOM   315  O  O   . LYS A  1 44  ? -6.768  -35.832 -42.923 1.00   33.58  ? 44   LYS A O   1 
ATOM   316  C  CB  . LYS A  1 44  ? -4.605  -36.619 -45.284 1.00   34.65  ? 44   LYS A CB  1 
ATOM   317  C  CG  . LYS A  1 44  ? -3.831  -37.671 -46.018 1.00   45.45  ? 44   LYS A CG  1 
ATOM   318  C  CD  . LYS A  1 44  ? -3.567  -37.244 -47.455 1.00   53.45  ? 44   LYS A CD  1 
ATOM   319  C  CE  . LYS A  1 44  ? -2.259  -36.482 -47.562 1.00   56.00  ? 44   LYS A CE  1 
ATOM   320  N  NZ  . LYS A  1 44  ? -1.159  -37.294 -46.971 1.00   58.70  ? 44   LYS A NZ  1 
ATOM   321  N  N   . LYS A  1 45  ? -4.856  -34.606 -42.974 1.00   30.08  ? 45   LYS A N   1 
ATOM   322  C  CA  . LYS A  1 45  ? -5.461  -33.309 -42.708 1.00   25.95  ? 45   LYS A CA  1 
ATOM   323  C  C   . LYS A  1 45  ? -6.571  -33.019 -43.728 1.00   42.61  ? 45   LYS A C   1 
ATOM   324  O  O   . LYS A  1 45  ? -6.570  -33.575 -44.834 1.00   49.44  ? 45   LYS A O   1 
ATOM   325  C  CB  . LYS A  1 45  ? -4.386  -32.222 -42.833 1.00   26.44  ? 45   LYS A CB  1 
ATOM   326  C  CG  . LYS A  1 45  ? -3.378  -32.131 -41.712 1.00   26.08  ? 45   LYS A CG  1 
ATOM   327  C  CD  . LYS A  1 45  ? -2.612  -30.840 -41.875 1.00   37.59  ? 45   LYS A CD  1 
ATOM   328  C  CE  . LYS A  1 45  ? -1.632  -30.613 -40.748 1.00   40.03  ? 45   LYS A CE  1 
ATOM   329  N  NZ  . LYS A  1 45  ? -1.279  -29.171 -40.639 1.00   39.59  ? 45   LYS A NZ  1 
ATOM   330  N  N   . PRO A  1 46  ? -7.515  -32.131 -43.374 1.00   27.79  ? 46   PRO A N   1 
ATOM   331  C  CA  . PRO A  1 46  ? -8.606  -31.819 -44.309 1.00   25.06  ? 46   PRO A CA  1 
ATOM   332  C  C   . PRO A  1 46  ? -8.182  -30.862 -45.419 1.00   39.36  ? 46   PRO A C   1 
ATOM   333  O  O   . PRO A  1 46  ? -7.536  -29.852 -45.148 1.00   35.68  ? 46   PRO A O   1 
ATOM   334  C  CB  . PRO A  1 46  ? -9.650  -31.146 -43.417 1.00   27.16  ? 46   PRO A CB  1 
ATOM   335  C  CG  . PRO A  1 46  ? -8.857  -30.537 -42.290 1.00   22.28  ? 46   PRO A CG  1 
ATOM   336  C  CD  . PRO A  1 46  ? -7.650  -31.421 -42.086 1.00   23.01  ? 46   PRO A CD  1 
ATOM   337  N  N   . GLN A  1 47  ? -8.552  -31.181 -46.655 1.00   42.26  ? 47   GLN A N   1 
ATOM   338  C  CA  . GLN A  1 47  ? -8.237  -30.344 -47.803 1.00   39.79  ? 47   GLN A CA  1 
ATOM   339  C  C   . GLN A  1 47  ? -9.364  -29.354 -48.031 1.00   45.51  ? 47   GLN A C   1 
ATOM   340  O  O   . GLN A  1 47  ? -10.530 -29.697 -47.858 1.00   43.23  ? 47   GLN A O   1 
ATOM   341  C  CB  . GLN A  1 47  ? -8.071  -31.203 -49.050 1.00   44.84  ? 47   GLN A CB  1 
ATOM   342  C  CG  . GLN A  1 47  ? -7.105  -32.355 -48.883 1.00   56.58  ? 47   GLN A CG  1 
ATOM   343  C  CD  . GLN A  1 47  ? -5.698  -31.894 -48.590 1.00   66.35  ? 47   GLN A CD  1 
ATOM   344  O  OE1 . GLN A  1 47  ? -5.184  -32.088 -47.485 1.00   73.11  ? 47   GLN A OE1 1 
ATOM   345  N  NE2 . GLN A  1 47  ? -5.059  -31.283 -49.580 1.00   65.53  ? 47   GLN A NE2 1 
ATOM   346  N  N   . SER A  1 48  ? -9.011  -28.135 -48.438 1.00   63.16  ? 48   SER A N   1 
ATOM   347  C  CA  . SER A  1 48  ? -9.982  -27.057 -48.654 1.00   70.37  ? 48   SER A CA  1 
ATOM   348  C  C   . SER A  1 48  ? -10.977 -27.426 -49.746 1.00   64.35  ? 48   SER A C   1 
ATOM   349  O  O   . SER A  1 48  ? -10.700 -28.289 -50.574 1.00   57.03  ? 48   SER A O   1 
ATOM   350  C  CB  . SER A  1 48  ? -9.277  -25.742 -49.014 1.00   73.63  ? 48   SER A CB  1 
ATOM   351  O  OG  . SER A  1 48  ? -8.864  -25.749 -50.371 1.00   77.60  ? 48   SER A OG  1 
ATOM   352  N  N   . LEU A  1 49  ? -12.126 -26.758 -49.753 1.00   68.31  ? 49   LEU A N   1 
ATOM   353  C  CA  . LEU A  1 49  ? -13.232 -27.191 -50.601 1.00   74.65  ? 49   LEU A CA  1 
ATOM   354  C  C   . LEU A  1 49  ? -13.251 -26.600 -52.017 1.00   81.46  ? 49   LEU A C   1 
ATOM   355  O  O   . LEU A  1 49  ? -13.005 -25.408 -52.229 1.00   82.51  ? 49   LEU A O   1 
ATOM   356  C  CB  . LEU A  1 49  ? -14.577 -26.977 -49.896 1.00   71.01  ? 49   LEU A CB  1 
ATOM   357  C  CG  . LEU A  1 49  ? -15.730 -27.781 -50.496 1.00   71.18  ? 49   LEU A CG  1 
ATOM   358  C  CD1 . LEU A  1 49  ? -15.313 -29.226 -50.717 1.00   72.08  ? 49   LEU A CD1 1 
ATOM   359  C  CD2 . LEU A  1 49  ? -16.957 -27.715 -49.611 1.00   70.47  ? 49   LEU A CD2 1 
ATOM   360  N  N   . THR A  1 50  ? -13.539 -27.478 -52.973 1.00   82.80  ? 50   THR A N   1 
ATOM   361  C  CA  . THR A  1 50  ? -13.696 -27.135 -54.376 1.00   82.77  ? 50   THR A CA  1 
ATOM   362  C  C   . THR A  1 50  ? -14.948 -26.292 -54.603 1.00   81.28  ? 50   THR A C   1 
ATOM   363  O  O   . THR A  1 50  ? -16.056 -26.707 -54.257 1.00   78.30  ? 50   THR A O   1 
ATOM   364  C  CB  . THR A  1 50  ? -13.843 -28.421 -55.210 1.00   86.62  ? 50   THR A CB  1 
ATOM   365  O  OG1 . THR A  1 50  ? -14.732 -29.319 -54.531 1.00   83.07  ? 50   THR A OG1 1 
ATOM   366  C  CG2 . THR A  1 50  ? -12.497 -29.111 -55.388 1.00   88.74  ? 50   THR A CG2 1 
ATOM   367  N  N   . LYS A  1 51  ? -14.758 -25.113 -55.187 1.00   85.90  ? 51   LYS A N   1 
ATOM   368  C  CA  . LYS A  1 51  ? -15.855 -24.231 -55.597 1.00   88.00  ? 51   LYS A CA  1 
ATOM   369  C  C   . LYS A  1 51  ? -16.987 -24.977 -56.314 1.00   86.90  ? 51   LYS A C   1 
ATOM   370  O  O   . LYS A  1 51  ? -16.736 -25.960 -57.012 1.00   88.36  ? 51   LYS A O   1 
ATOM   371  C  CB  . LYS A  1 51  ? -15.303 -23.136 -56.516 1.00   91.87  ? 51   LYS A CB  1 
ATOM   372  C  CG  . LYS A  1 51  ? -13.991 -23.520 -57.221 1.00   93.42  ? 51   LYS A CG  1 
ATOM   373  C  CD  . LYS A  1 51  ? -13.567 -22.480 -58.260 1.00   91.39  ? 51   LYS A CD  1 
ATOM   374  C  CE  . LYS A  1 51  ? -12.088 -22.609 -58.606 1.00   84.00  ? 51   LYS A CE  1 
ATOM   375  N  NZ  . LYS A  1 51  ? -11.205 -22.286 -57.442 1.00   73.59  ? 51   LYS A NZ  1 
ATOM   376  N  N   . TRP A  1 52  ? -18.228 -24.522 -56.136 1.00   82.25  ? 52   TRP A N   1 
ATOM   377  C  CA  . TRP A  1 52  ? -19.360 -25.127 -56.852 1.00   78.63  ? 52   TRP A CA  1 
ATOM   378  C  C   . TRP A  1 52  ? -20.336 -24.106 -57.440 1.00   82.75  ? 52   TRP A C   1 
ATOM   379  O  O   . TRP A  1 52  ? -20.656 -23.084 -56.821 1.00   78.28  ? 52   TRP A O   1 
ATOM   380  C  CB  . TRP A  1 52  ? -20.124 -26.148 -55.983 1.00   67.84  ? 52   TRP A CB  1 
ATOM   381  C  CG  . TRP A  1 52  ? -21.018 -25.526 -54.951 1.00   63.21  ? 52   TRP A CG  1 
ATOM   382  C  CD1 . TRP A  1 52  ? -22.282 -25.044 -55.141 1.00   64.85  ? 52   TRP A CD1 1 
ATOM   383  C  CD2 . TRP A  1 52  ? -20.715 -25.315 -53.565 1.00   56.41  ? 52   TRP A CD2 1 
ATOM   384  N  NE1 . TRP A  1 52  ? -22.780 -24.540 -53.963 1.00   60.80  ? 52   TRP A NE1 1 
ATOM   385  C  CE2 . TRP A  1 52  ? -21.837 -24.693 -52.981 1.00   53.44  ? 52   TRP A CE2 1 
ATOM   386  C  CE3 . TRP A  1 52  ? -19.602 -25.588 -52.764 1.00   53.68  ? 52   TRP A CE3 1 
ATOM   387  C  CZ2 . TRP A  1 52  ? -21.879 -24.341 -51.636 1.00   49.60  ? 52   TRP A CZ2 1 
ATOM   388  C  CZ3 . TRP A  1 52  ? -19.649 -25.241 -51.425 1.00   52.81  ? 52   TRP A CZ3 1 
ATOM   389  C  CH2 . TRP A  1 52  ? -20.779 -24.624 -50.876 1.00   48.10  ? 52   TRP A CH2 1 
ATOM   390  N  N   . SER A  1 53  ? -20.795 -24.401 -58.652 1.00   88.71  ? 53   SER A N   1 
ATOM   391  C  CA  . SER A  1 53  ? -21.896 -23.677 -59.264 1.00   89.76  ? 53   SER A CA  1 
ATOM   392  C  C   . SER A  1 53  ? -23.194 -24.303 -58.768 1.00   90.52  ? 53   SER A C   1 
ATOM   393  O  O   . SER A  1 53  ? -23.168 -25.282 -58.013 1.00   90.48  ? 53   SER A O   1 
ATOM   394  C  CB  . SER A  1 53  ? -21.809 -23.767 -60.786 1.00   92.96  ? 53   SER A CB  1 
ATOM   395  O  OG  . SER A  1 53  ? -22.937 -23.172 -61.398 1.00   97.49  ? 53   SER A OG  1 
ATOM   396  N  N   . ASP A  1 54  ? -24.321 -23.746 -59.200 1.00   89.63  ? 54   ASP A N   1 
ATOM   397  C  CA  . ASP A  1 54  ? -25.633 -24.132 -58.679 1.00   89.86  ? 54   ASP A CA  1 
ATOM   398  C  C   . ASP A  1 54  ? -25.714 -23.876 -57.178 1.00   81.41  ? 54   ASP A C   1 
ATOM   399  O  O   . ASP A  1 54  ? -24.833 -23.249 -56.583 1.00   76.27  ? 54   ASP A O   1 
ATOM   400  C  CB  . ASP A  1 54  ? -25.984 -25.598 -58.994 0.93   94.00  ? 54   ASP A CB  1 
ATOM   401  C  CG  . ASP A  1 54  ? -26.446 -25.803 -60.434 0.63   98.39  ? 54   ASP A CG  1 
ATOM   402  O  OD1 . ASP A  1 54  ? -26.791 -24.808 -61.109 1.00   99.82  ? 54   ASP A OD1 1 
ATOM   403  O  OD2 . ASP A  1 54  ? -26.477 -26.968 -60.887 1.00   98.71  ? 54   ASP A OD2 1 
ATOM   404  N  N   . ILE A  1 55  ? -26.779 -24.361 -56.560 1.00   77.79  ? 55   ILE A N   1 
ATOM   405  C  CA  . ILE A  1 55  ? -26.983 -24.081 -55.152 1.00   71.17  ? 55   ILE A CA  1 
ATOM   406  C  C   . ILE A  1 55  ? -26.888 -25.358 -54.318 1.00   69.20  ? 55   ILE A C   1 
ATOM   407  O  O   . ILE A  1 55  ? -27.245 -26.446 -54.774 1.00   67.37  ? 55   ILE A O   1 
ATOM   408  C  CB  . ILE A  1 55  ? -28.326 -23.346 -54.919 1.00   65.22  ? 55   ILE A CB  1 
ATOM   409  C  CG1 . ILE A  1 55  ? -29.425 -24.323 -54.499 1.00   69.83  ? 55   ILE A CG1 1 
ATOM   410  C  CG2 . ILE A  1 55  ? -28.737 -22.544 -56.163 1.00   52.54  ? 55   ILE A CG2 1 
ATOM   411  C  CD1 . ILE A  1 55  ? -29.632 -24.378 -53.021 1.00   66.34  ? 55   ILE A CD1 1 
ATOM   412  N  N   . TRP A  1 56  ? -26.395 -25.219 -53.093 1.00   69.57  ? 56   TRP A N   1 
ATOM   413  C  CA  . TRP A  1 56  ? -26.355 -26.344 -52.169 1.00   63.91  ? 56   TRP A CA  1 
ATOM   414  C  C   . TRP A  1 56  ? -27.531 -26.289 -51.207 1.00   60.56  ? 56   TRP A C   1 
ATOM   415  O  O   . TRP A  1 56  ? -27.675 -25.335 -50.440 1.00   53.89  ? 56   TRP A O   1 
ATOM   416  C  CB  . TRP A  1 56  ? -25.054 -26.374 -51.371 1.00   55.58  ? 56   TRP A CB  1 
ATOM   417  C  CG  . TRP A  1 56  ? -24.997 -27.555 -50.476 1.00   48.41  ? 56   TRP A CG  1 
ATOM   418  C  CD1 . TRP A  1 56  ? -25.688 -27.739 -49.312 1.00   41.88  ? 56   TRP A CD1 1 
ATOM   419  C  CD2 . TRP A  1 56  ? -24.215 -28.735 -50.669 1.00   53.83  ? 56   TRP A CD2 1 
ATOM   420  N  NE1 . TRP A  1 56  ? -25.382 -28.963 -48.766 1.00   47.52  ? 56   TRP A NE1 1 
ATOM   421  C  CE2 . TRP A  1 56  ? -24.478 -29.595 -49.580 1.00   53.94  ? 56   TRP A CE2 1 
ATOM   422  C  CE3 . TRP A  1 56  ? -23.310 -29.147 -51.652 1.00   57.17  ? 56   TRP A CE3 1 
ATOM   423  C  CZ2 . TRP A  1 56  ? -23.877 -30.845 -49.451 1.00   54.85  ? 56   TRP A CZ2 1 
ATOM   424  C  CZ3 . TRP A  1 56  ? -22.710 -30.390 -51.523 1.00   57.39  ? 56   TRP A CZ3 1 
ATOM   425  C  CH2 . TRP A  1 56  ? -22.997 -31.225 -50.431 1.00   57.18  ? 56   TRP A CH2 1 
ATOM   426  N  N   . ASN A  1 57  ? -28.361 -27.324 -51.247 1.00   62.27  ? 57   ASN A N   1 
ATOM   427  C  CA  . ASN A  1 57  ? -29.493 -27.431 -50.348 1.00   61.27  ? 57   ASN A CA  1 
ATOM   428  C  C   . ASN A  1 57  ? -29.052 -27.848 -48.952 1.00   54.75  ? 57   ASN A C   1 
ATOM   429  O  O   . ASN A  1 57  ? -28.761 -29.015 -48.701 1.00   58.45  ? 57   ASN A O   1 
ATOM   430  C  CB  . ASN A  1 57  ? -30.509 -28.432 -50.893 1.00   74.23  ? 57   ASN A CB  1 
ATOM   431  C  CG  . ASN A  1 57  ? -31.292 -27.888 -52.066 1.00   89.45  ? 57   ASN A CG  1 
ATOM   432  O  OD1 . ASN A  1 57  ? -31.519 -26.683 -52.170 1.00   88.48  ? 57   ASN A OD1 1 
ATOM   433  N  ND2 . ASN A  1 57  ? -31.724 -28.781 -52.954 1.00   104.79 ? 57   ASN A ND2 1 
ATOM   434  N  N   . ALA A  1 58  ? -29.006 -26.884 -48.042 1.00   50.76  ? 58   ALA A N   1 
ATOM   435  C  CA  . ALA A  1 58  ? -28.635 -27.150 -46.658 1.00   44.85  ? 58   ALA A CA  1 
ATOM   436  C  C   . ALA A  1 58  ? -29.880 -27.293 -45.792 1.00   43.06  ? 58   ALA A C   1 
ATOM   437  O  O   . ALA A  1 58  ? -30.113 -26.474 -44.895 1.00   34.48  ? 58   ALA A O   1 
ATOM   438  C  CB  . ALA A  1 58  ? -27.760 -26.027 -46.122 1.00   41.08  ? 58   ALA A CB  1 
ATOM   439  N  N   . THR A  1 59  ? -30.667 -28.338 -46.044 1.00   38.76  ? 59   THR A N   1 
ATOM   440  C  CA  . THR A  1 59  ? -31.982 -28.443 -45.425 1.00   40.55  ? 59   THR A CA  1 
ATOM   441  C  C   . THR A  1 59  ? -32.204 -29.692 -44.564 1.00   47.02  ? 59   THR A C   1 
ATOM   442  O  O   . THR A  1 59  ? -33.266 -29.856 -43.967 1.00   51.15  ? 59   THR A O   1 
ATOM   443  C  CB  . THR A  1 59  ? -33.082 -28.308 -46.480 1.00   42.80  ? 59   THR A CB  1 
ATOM   444  O  OG1 . THR A  1 59  ? -32.852 -29.262 -47.522 1.00   48.76  ? 59   THR A OG1 1 
ATOM   445  C  CG2 . THR A  1 59  ? -33.049 -26.910 -47.079 1.00   37.67  ? 59   THR A CG2 1 
ATOM   446  N  N   . LYS A  1 60  ? -31.200 -30.560 -44.495 1.00   55.02  ? 60   LYS A N   1 
ATOM   447  C  CA  . LYS A  1 60  ? -31.203 -31.683 -43.550 1.00   53.68  ? 60   LYS A CA  1 
ATOM   448  C  C   . LYS A  1 60  ? -29.807 -31.870 -42.954 1.00   37.99  ? 60   LYS A C   1 
ATOM   449  O  O   . LYS A  1 60  ? -28.810 -31.495 -43.575 1.00   32.08  ? 60   LYS A O   1 
ATOM   450  C  CB  . LYS A  1 60  ? -31.687 -32.977 -44.219 1.00   58.11  ? 60   LYS A CB  1 
ATOM   451  C  CG  . LYS A  1 60  ? -30.870 -33.413 -45.428 1.00   68.07  ? 60   LYS A CG  1 
ATOM   452  C  CD  . LYS A  1 60  ? -31.228 -34.840 -45.883 1.00   75.28  ? 60   LYS A CD  1 
ATOM   453  C  CE  . LYS A  1 60  ? -30.458 -35.256 -47.148 1.00   78.77  ? 60   LYS A CE  1 
ATOM   454  N  NZ  . LYS A  1 60  ? -28.965 -35.081 -47.040 1.00   75.80  ? 60   LYS A NZ  1 
ATOM   455  N  N   . TYR A  1 61  ? -29.731 -32.424 -41.746 1.00   33.58  ? 61   TYR A N   1 
ATOM   456  C  CA  . TYR A  1 61  ? -28.424 -32.720 -41.148 1.00   35.28  ? 61   TYR A CA  1 
ATOM   457  C  C   . TYR A  1 61  ? -27.611 -33.684 -42.004 1.00   24.84  ? 61   TYR A C   1 
ATOM   458  O  O   . TYR A  1 61  ? -28.151 -34.636 -42.558 1.00   40.44  ? 61   TYR A O   1 
ATOM   459  C  CB  . TYR A  1 61  ? -28.580 -33.341 -39.772 1.00   29.22  ? 61   TYR A CB  1 
ATOM   460  C  CG  . TYR A  1 61  ? -29.057 -32.417 -38.683 1.00   34.70  ? 61   TYR A CG  1 
ATOM   461  C  CD1 . TYR A  1 61  ? -28.230 -31.410 -38.163 1.00   30.32  ? 61   TYR A CD1 1 
ATOM   462  C  CD2 . TYR A  1 61  ? -30.310 -32.591 -38.121 1.00   29.85  ? 61   TYR A CD2 1 
ATOM   463  C  CE1 . TYR A  1 61  ? -28.668 -30.599 -37.131 1.00   24.03  ? 61   TYR A CE1 1 
ATOM   464  C  CE2 . TYR A  1 61  ? -30.749 -31.794 -37.103 1.00   22.69  ? 61   TYR A CE2 1 
ATOM   465  C  CZ  . TYR A  1 61  ? -29.943 -30.806 -36.612 1.00   25.09  ? 61   TYR A CZ  1 
ATOM   466  O  OH  . TYR A  1 61  ? -30.432 -30.026 -35.591 1.00   31.89  ? 61   TYR A OH  1 
ATOM   467  N  N   . ALA A  1 62  ? -26.311 -33.449 -42.106 1.00   23.99  ? 62   ALA A N   1 
ATOM   468  C  CA  . ALA A  1 62  ? -25.477 -34.307 -42.946 1.00   25.96  ? 62   ALA A CA  1 
ATOM   469  C  C   . ALA A  1 62  ? -25.111 -35.629 -42.264 1.00   25.93  ? 62   ALA A C   1 
ATOM   470  O  O   . ALA A  1 62  ? -25.466 -35.866 -41.114 1.00   26.36  ? 62   ALA A O   1 
ATOM   471  C  CB  . ALA A  1 62  ? -24.226 -33.566 -43.399 1.00   24.21  ? 62   ALA A CB  1 
ATOM   472  N  N   . ASN A  1 63  ? -24.420 -36.495 -42.999 1.00   28.25  ? 63   ASN A N   1 
ATOM   473  C  CA  . ASN A  1 63  ? -23.817 -37.699 -42.434 1.00   31.89  ? 63   ASN A CA  1 
ATOM   474  C  C   . ASN A  1 63  ? -22.971 -37.452 -41.187 1.00   32.53  ? 63   ASN A C   1 
ATOM   475  O  O   . ASN A  1 63  ? -22.163 -36.524 -41.150 1.00   33.52  ? 63   ASN A O   1 
ATOM   476  C  CB  . ASN A  1 63  ? -22.943 -38.378 -43.487 1.00   38.71  ? 63   ASN A CB  1 
ATOM   477  C  CG  . ASN A  1 63  ? -23.731 -38.819 -44.697 1.00   44.33  ? 63   ASN A CG  1 
ATOM   478  O  OD1 . ASN A  1 63  ? -24.958 -38.928 -44.643 1.00   48.58  ? 63   ASN A OD1 1 
ATOM   479  N  ND2 . ASN A  1 63  ? -23.031 -39.089 -45.798 1.00   41.46  ? 63   ASN A ND2 1 
ATOM   480  N  N   . SER A  1 64  ? -23.162 -38.289 -40.167 1.00   35.53  ? 64   SER A N   1 
ATOM   481  C  CA  . SER A  1 64  ? -22.272 -38.318 -39.003 1.00   31.20  ? 64   SER A CA  1 
ATOM   482  C  C   . SER A  1 64  ? -21.012 -39.115 -39.338 1.00   37.05  ? 64   SER A C   1 
ATOM   483  O  O   . SER A  1 64  ? -21.053 -40.021 -40.178 1.00   44.97  ? 64   SER A O   1 
ATOM   484  C  CB  . SER A  1 64  ? -22.967 -38.976 -37.810 1.00   22.95  ? 64   SER A CB  1 
ATOM   485  O  OG  . SER A  1 64  ? -24.089 -38.235 -37.392 1.00   25.86  ? 64   SER A OG  1 
ATOM   486  N  N   . CYS A  1 65  ? -19.905 -38.796 -38.672 1.00   21.75  ? 65   CYS A N   1 
ATOM   487  C  CA  . CYS A  1 65  ? -18.630 -39.494 -38.897 1.00   30.26  ? 65   CYS A CA  1 
ATOM   488  C  C   . CYS A  1 65  ? -18.647 -40.935 -38.378 1.00   32.16  ? 65   CYS A C   1 
ATOM   489  O  O   . CYS A  1 65  ? -19.273 -41.227 -37.352 1.00   28.58  ? 65   CYS A O   1 
ATOM   490  C  CB  . CYS A  1 65  ? -17.455 -38.729 -38.263 1.00   26.27  ? 65   CYS A CB  1 
ATOM   491  S  SG  . CYS A  1 65  ? -17.067 -37.107 -39.035 1.00   37.11  ? 65   CYS A SG  1 
ATOM   492  N  N   . CYS A  1 66  ? -17.964 -41.820 -39.104 1.00   30.24  ? 66   CYS A N   1 
ATOM   493  C  CA  . CYS A  1 66  ? -17.809 -43.218 -38.715 1.00   31.51  ? 66   CYS A CA  1 
ATOM   494  C  C   . CYS A  1 66  ? -17.421 -43.360 -37.245 1.00   35.04  ? 66   CYS A C   1 
ATOM   495  O  O   . CYS A  1 66  ? -16.525 -42.667 -36.755 1.00   35.39  ? 66   CYS A O   1 
ATOM   496  C  CB  . CYS A  1 66  ? -16.769 -43.913 -39.609 1.00   27.09  ? 66   CYS A CB  1 
ATOM   497  S  SG  . CYS A  1 66  ? -17.316 -44.151 -41.323 1.00   52.02  ? 66   CYS A SG  1 
ATOM   498  N  N   . GLN A  1 67  ? -18.112 -44.248 -36.541 1.00   39.01  ? 67   GLN A N   1 
ATOM   499  C  CA  . GLN A  1 67  ? -17.888 -44.418 -35.114 1.00   34.47  ? 67   GLN A CA  1 
ATOM   500  C  C   . GLN A  1 67  ? -18.602 -45.640 -34.567 1.00   36.16  ? 67   GLN A C   1 
ATOM   501  O  O   . GLN A  1 67  ? -19.607 -46.094 -35.121 1.00   33.78  ? 67   GLN A O   1 
ATOM   502  C  CB  . GLN A  1 67  ? -18.367 -43.188 -34.358 1.00   28.87  ? 67   GLN A CB  1 
ATOM   503  C  CG  . GLN A  1 67  ? -19.866 -42.965 -34.402 1.00   34.27  ? 67   GLN A CG  1 
ATOM   504  C  CD  . GLN A  1 67  ? -20.243 -41.618 -33.794 1.00   39.48  ? 67   GLN A CD  1 
ATOM   505  O  OE1 . GLN A  1 67  ? -20.602 -41.536 -32.620 1.00   38.08  ? 67   GLN A OE1 1 
ATOM   506  N  NE2 . GLN A  1 67  ? -20.139 -40.554 -34.587 1.00   20.65  ? 67   GLN A NE2 1 
ATOM   507  N  N   . ASN A  1 68  ? -18.065 -46.166 -33.473 1.00   32.38  ? 68   ASN A N   1 
ATOM   508  C  CA  . ASN A  1 68  ? -18.713 -47.246 -32.756 1.00   28.95  ? 68   ASN A CA  1 
ATOM   509  C  C   . ASN A  1 68  ? -19.835 -46.707 -31.875 1.00   33.05  ? 68   ASN A C   1 
ATOM   510  O  O   . ASN A  1 68  ? -19.731 -45.615 -31.317 1.00   41.27  ? 68   ASN A O   1 
ATOM   511  C  CB  . ASN A  1 68  ? -17.687 -48.058 -31.965 1.00   31.33  ? 68   ASN A CB  1 
ATOM   512  C  CG  . ASN A  1 68  ? -16.801 -48.924 -32.874 1.00   42.14  ? 68   ASN A CG  1 
ATOM   513  O  OD1 . ASN A  1 68  ? -17.299 -49.745 -33.650 1.00   48.08  ? 68   ASN A OD1 1 
ATOM   514  N  ND2 . ASN A  1 68  ? -15.494 -48.728 -32.792 1.00   29.47  ? 68   ASN A ND2 1 
ATOM   515  N  N   . ILE A  1 69  ? -20.923 -47.464 -31.785 1.00   34.51  ? 69   ILE A N   1 
ATOM   516  C  CA  . ILE A  1 69  ? -22.098 -47.024 -31.052 1.00   37.30  ? 69   ILE A CA  1 
ATOM   517  C  C   . ILE A  1 69  ? -22.210 -47.715 -29.701 1.00   40.52  ? 69   ILE A C   1 
ATOM   518  O  O   . ILE A  1 69  ? -21.965 -48.919 -29.588 1.00   46.11  ? 69   ILE A O   1 
ATOM   519  C  CB  . ILE A  1 69  ? -23.384 -47.261 -31.881 1.00   46.23  ? 69   ILE A CB  1 
ATOM   520  C  CG1 . ILE A  1 69  ? -23.606 -46.097 -32.840 1.00   49.79  ? 69   ILE A CG1 1 
ATOM   521  C  CG2 . ILE A  1 69  ? -24.622 -47.445 -30.996 1.00   47.89  ? 69   ILE A CG2 1 
ATOM   522  C  CD1 . ILE A  1 69  ? -22.684 -46.115 -34.015 1.00   54.24  ? 69   ILE A CD1 1 
ATOM   523  N  N   . ASP A  1 70  ? -22.573 -46.942 -28.678 1.00   36.67  ? 70   ASP A N   1 
ATOM   524  C  CA  . ASP A  1 70  ? -22.951 -47.512 -27.382 1.00   42.87  ? 70   ASP A CA  1 
ATOM   525  C  C   . ASP A  1 70  ? -24.105 -48.535 -27.516 1.00   40.63  ? 70   ASP A C   1 
ATOM   526  O  O   . ASP A  1 70  ? -25.242 -48.156 -27.810 1.00   39.14  ? 70   ASP A O   1 
ATOM   527  C  CB  . ASP A  1 70  ? -23.331 -46.390 -26.400 1.00   35.67  ? 70   ASP A CB  1 
ATOM   528  C  CG  . ASP A  1 70  ? -23.646 -46.909 -24.991 1.00   47.06  ? 70   ASP A CG  1 
ATOM   529  O  OD1 . ASP A  1 70  ? -23.354 -48.096 -24.690 1.00   50.57  ? 70   ASP A OD1 1 
ATOM   530  O  OD2 . ASP A  1 70  ? -24.181 -46.119 -24.177 1.00   47.79  ? 70   ASP A OD2 1 
ATOM   531  N  N   . GLN A  1 71  ? -23.802 -49.818 -27.302 1.00   37.15  ? 71   GLN A N   1 
ATOM   532  C  CA  . GLN A  1 71  ? -24.825 -50.872 -27.332 1.00   44.38  ? 71   GLN A CA  1 
ATOM   533  C  C   . GLN A  1 71  ? -25.073 -51.498 -25.967 1.00   42.72  ? 71   GLN A C   1 
ATOM   534  O  O   . GLN A  1 71  ? -25.520 -52.633 -25.892 1.00   45.18  ? 71   GLN A O   1 
ATOM   535  C  CB  . GLN A  1 71  ? -24.438 -52.012 -28.280 1.00   52.11  ? 71   GLN A CB  1 
ATOM   536  C  CG  . GLN A  1 71  ? -23.912 -51.601 -29.632 1.00   62.10  ? 71   GLN A CG  1 
ATOM   537  C  CD  . GLN A  1 71  ? -23.087 -52.703 -30.273 1.00   70.42  ? 71   GLN A CD  1 
ATOM   538  O  OE1 . GLN A  1 71  ? -23.508 -53.861 -30.328 0.89   75.81  ? 71   GLN A OE1 1 
ATOM   539  N  NE2 . GLN A  1 71  ? -21.895 -52.351 -30.742 1.00   71.85  ? 71   GLN A NE2 1 
ATOM   540  N  N   . SER A  1 72  ? -24.782 -50.780 -24.891 1.00   47.27  ? 72   SER A N   1 
ATOM   541  C  CA  . SER A  1 72  ? -24.973 -51.339 -23.553 1.00   47.58  ? 72   SER A CA  1 
ATOM   542  C  C   . SER A  1 72  ? -26.443 -51.303 -23.114 1.00   44.74  ? 72   SER A C   1 
ATOM   543  O  O   . SER A  1 72  ? -26.923 -52.209 -22.428 1.00   41.82  ? 72   SER A O   1 
ATOM   544  C  CB  . SER A  1 72  ? -24.081 -50.625 -22.528 1.00   51.09  ? 72   SER A CB  1 
ATOM   545  O  OG  . SER A  1 72  ? -22.720 -50.620 -22.939 1.00   52.49  ? 72   SER A OG  1 
ATOM   546  N  N   . PHE A  1 73  ? -27.166 -50.266 -23.524 1.00   42.57  ? 73   PHE A N   1 
ATOM   547  C  CA  . PHE A  1 73  ? -28.571 -50.153 -23.145 1.00   45.20  ? 73   PHE A CA  1 
ATOM   548  C  C   . PHE A  1 73  ? -29.485 -49.914 -24.340 1.00   50.11  ? 73   PHE A C   1 
ATOM   549  O  O   . PHE A  1 73  ? -30.035 -48.823 -24.500 1.00   53.72  ? 73   PHE A O   1 
ATOM   550  C  CB  . PHE A  1 73  ? -28.745 -49.050 -22.104 1.00   46.43  ? 73   PHE A CB  1 
ATOM   551  C  CG  . PHE A  1 73  ? -27.748 -49.126 -20.991 1.00   47.58  ? 73   PHE A CG  1 
ATOM   552  C  CD1 . PHE A  1 73  ? -27.897 -50.066 -19.976 1.00   46.88  ? 73   PHE A CD1 1 
ATOM   553  C  CD2 . PHE A  1 73  ? -26.648 -48.275 -20.965 1.00   37.00  ? 73   PHE A CD2 1 
ATOM   554  C  CE1 . PHE A  1 73  ? -26.979 -50.150 -18.947 1.00   33.79  ? 73   PHE A CE1 1 
ATOM   555  C  CE2 . PHE A  1 73  ? -25.726 -48.359 -19.945 1.00   34.45  ? 73   PHE A CE2 1 
ATOM   556  C  CZ  . PHE A  1 73  ? -25.891 -49.302 -18.928 1.00   34.90  ? 73   PHE A CZ  1 
ATOM   557  N  N   . PRO A  1 74  ? -29.659 -50.947 -25.180 1.00   56.13  ? 74   PRO A N   1 
ATOM   558  C  CA  . PRO A  1 74  ? -30.510 -50.810 -26.369 1.00   51.82  ? 74   PRO A CA  1 
ATOM   559  C  C   . PRO A  1 74  ? -31.959 -50.473 -25.994 1.00   45.95  ? 74   PRO A C   1 
ATOM   560  O  O   . PRO A  1 74  ? -32.575 -51.186 -25.204 1.00   38.59  ? 74   PRO A O   1 
ATOM   561  C  CB  . PRO A  1 74  ? -30.429 -52.200 -27.025 1.00   38.40  ? 74   PRO A CB  1 
ATOM   562  C  CG  . PRO A  1 74  ? -29.240 -52.857 -26.410 1.00   44.84  ? 74   PRO A CG  1 
ATOM   563  C  CD  . PRO A  1 74  ? -29.121 -52.311 -25.034 1.00   37.60  ? 74   PRO A CD  1 
ATOM   564  N  N   . GLY A  1 75  ? -32.486 -49.389 -26.552 1.00   35.69  ? 75   GLY A N   1 
ATOM   565  C  CA  . GLY A  1 75  ? -33.870 -49.015 -26.321 1.00   45.22  ? 75   GLY A CA  1 
ATOM   566  C  C   . GLY A  1 75  ? -34.073 -48.025 -25.195 1.00   35.32  ? 75   GLY A C   1 
ATOM   567  O  O   . GLY A  1 75  ? -35.171 -47.534 -24.993 1.00   41.55  ? 75   GLY A O   1 
ATOM   568  N  N   . PHE A  1 76  ? -33.003 -47.738 -24.465 1.00   38.25  ? 76   PHE A N   1 
ATOM   569  C  CA  . PHE A  1 76  ? -33.025 -46.830 -23.324 1.00   32.71  ? 76   PHE A CA  1 
ATOM   570  C  C   . PHE A  1 76  ? -32.591 -45.428 -23.752 1.00   32.62  ? 76   PHE A C   1 
ATOM   571  O  O   . PHE A  1 76  ? -31.485 -45.234 -24.283 1.00   29.07  ? 76   PHE A O   1 
ATOM   572  C  CB  . PHE A  1 76  ? -32.098 -47.384 -22.238 1.00   39.01  ? 76   PHE A CB  1 
ATOM   573  C  CG  . PHE A  1 76  ? -31.911 -46.478 -21.057 1.00   39.15  ? 76   PHE A CG  1 
ATOM   574  C  CD1 . PHE A  1 76  ? -32.993 -46.094 -20.272 1.00   35.37  ? 76   PHE A CD1 1 
ATOM   575  C  CD2 . PHE A  1 76  ? -30.637 -46.037 -20.702 1.00   44.32  ? 76   PHE A CD2 1 
ATOM   576  C  CE1 . PHE A  1 76  ? -32.808 -45.264 -19.172 1.00   33.48  ? 76   PHE A CE1 1 
ATOM   577  C  CE2 . PHE A  1 76  ? -30.446 -45.212 -19.600 1.00   28.93  ? 76   PHE A CE2 1 
ATOM   578  C  CZ  . PHE A  1 76  ? -31.532 -44.828 -18.834 1.00   31.23  ? 76   PHE A CZ  1 
ATOM   579  N  N   . HIS A  1 77  ? -33.463 -44.449 -23.519 1.00   34.41  ? 77   HIS A N   1 
ATOM   580  C  CA  . HIS A  1 77  ? -33.246 -43.098 -24.018 1.00   36.57  ? 77   HIS A CA  1 
ATOM   581  C  C   . HIS A  1 77  ? -32.001 -42.468 -23.409 1.00   37.62  ? 77   HIS A C   1 
ATOM   582  O  O   . HIS A  1 77  ? -31.317 -41.669 -24.058 1.00   34.38  ? 77   HIS A O   1 
ATOM   583  C  CB  . HIS A  1 77  ? -34.466 -42.203 -23.773 1.00   28.78  ? 77   HIS A CB  1 
ATOM   584  C  CG  . HIS A  1 77  ? -34.347 -40.849 -24.403 1.00   45.70  ? 77   HIS A CG  1 
ATOM   585  N  ND1 . HIS A  1 77  ? -34.412 -39.678 -23.677 1.00   47.07  ? 77   HIS A ND1 1 
ATOM   586  C  CD2 . HIS A  1 77  ? -34.138 -40.480 -25.691 1.00   47.17  ? 77   HIS A CD2 1 
ATOM   587  C  CE1 . HIS A  1 77  ? -34.259 -38.646 -24.488 1.00   49.04  ? 77   HIS A CE1 1 
ATOM   588  N  NE2 . HIS A  1 77  ? -34.092 -39.106 -25.717 1.00   50.52  ? 77   HIS A NE2 1 
ATOM   589  N  N   . GLY A  1 78  ? -31.715 -42.841 -22.164 1.00   41.00  ? 78   GLY A N   1 
ATOM   590  C  CA  . GLY A  1 78  ? -30.596 -42.290 -21.424 1.00   25.20  ? 78   GLY A CA  1 
ATOM   591  C  C   . GLY A  1 78  ? -29.278 -42.451 -22.150 1.00   33.28  ? 78   GLY A C   1 
ATOM   592  O  O   . GLY A  1 78  ? -28.420 -41.561 -22.086 1.00   22.54  ? 78   GLY A O   1 
ATOM   593  N  N   . SER A  1 79  ? -29.118 -43.574 -22.851 1.00   28.47  ? 79   SER A N   1 
ATOM   594  C  CA  . SER A  1 79  ? -27.881 -43.830 -23.581 1.00   24.48  ? 79   SER A CA  1 
ATOM   595  C  C   . SER A  1 79  ? -28.028 -43.563 -25.071 1.00   33.42  ? 79   SER A C   1 
ATOM   596  O  O   . SER A  1 79  ? -27.081 -43.116 -25.724 1.00   36.24  ? 79   SER A O   1 
ATOM   597  C  CB  . SER A  1 79  ? -27.385 -45.259 -23.352 1.00   25.92  ? 79   SER A CB  1 
ATOM   598  O  OG  . SER A  1 79  ? -28.269 -46.197 -23.919 1.00   36.85  ? 79   SER A OG  1 
ATOM   599  N  N   . GLU A  1 80  ? -29.212 -43.831 -25.611 1.00   31.42  ? 80   GLU A N   1 
ATOM   600  C  CA  . GLU A  1 80  ? -29.384 -43.738 -27.054 1.00   34.26  ? 80   GLU A CA  1 
ATOM   601  C  C   . GLU A  1 80  ? -29.511 -42.303 -27.555 1.00   33.56  ? 80   GLU A C   1 
ATOM   602  O  O   . GLU A  1 80  ? -29.215 -42.022 -28.715 1.00   31.69  ? 80   GLU A O   1 
ATOM   603  C  CB  . GLU A  1 80  ? -30.529 -44.633 -27.540 1.00   37.58  ? 80   GLU A CB  1 
ATOM   604  C  CG  . GLU A  1 80  ? -30.157 -46.116 -27.537 1.00   41.04  ? 80   GLU A CG  1 
ATOM   605  C  CD  . GLU A  1 80  ? -31.232 -46.983 -28.148 1.00   46.54  ? 80   GLU A CD  1 
ATOM   606  O  OE1 . GLU A  1 80  ? -32.425 -46.707 -27.904 1.00   51.04  ? 80   GLU A OE1 1 
ATOM   607  O  OE2 . GLU A  1 80  ? -30.886 -47.937 -28.873 1.00   44.87  ? 80   GLU A OE2 1 
ATOM   608  N  N   . MET A  1 81  ? -29.906 -41.392 -26.668 1.00   37.14  ? 81   MET A N   1 
ATOM   609  C  CA  . MET A  1 81  ? -29.907 -39.957 -26.980 1.00   34.74  ? 81   MET A CA  1 
ATOM   610  C  C   . MET A  1 81  ? -28.522 -39.414 -27.361 1.00   34.68  ? 81   MET A C   1 
ATOM   611  O  O   . MET A  1 81  ? -28.410 -38.336 -27.943 1.00   38.59  ? 81   MET A O   1 
ATOM   612  C  CB  . MET A  1 81  ? -30.455 -39.150 -25.800 1.00   30.37  ? 81   MET A CB  1 
ATOM   613  C  CG  . MET A  1 81  ? -29.563 -39.196 -24.570 1.00   32.31  ? 81   MET A CG  1 
ATOM   614  S  SD  . MET A  1 81  ? -30.076 -38.070 -23.255 1.00   49.71  ? 81   MET A SD  1 
ATOM   615  C  CE  . MET A  1 81  ? -29.724 -36.488 -24.022 1.00   77.57  ? 81   MET A CE  1 
ATOM   616  N  N   . TRP A  1 82  ? -27.465 -40.145 -27.024 1.00   34.03  ? 82   TRP A N   1 
ATOM   617  C  CA  . TRP A  1 82  ? -26.119 -39.718 -27.414 1.00   35.15  ? 82   TRP A CA  1 
ATOM   618  C  C   . TRP A  1 82  ? -25.640 -40.393 -28.695 1.00   27.99  ? 82   TRP A C   1 
ATOM   619  O  O   . TRP A  1 82  ? -24.670 -39.948 -29.305 1.00   26.56  ? 82   TRP A O   1 
ATOM   620  C  CB  . TRP A  1 82  ? -25.115 -39.922 -26.277 1.00   18.86  ? 82   TRP A CB  1 
ATOM   621  C  CG  . TRP A  1 82  ? -25.554 -39.285 -24.980 1.00   25.72  ? 82   TRP A CG  1 
ATOM   622  C  CD1 . TRP A  1 82  ? -26.083 -39.918 -23.896 1.00   23.41  ? 82   TRP A CD1 1 
ATOM   623  C  CD2 . TRP A  1 82  ? -25.529 -37.887 -24.652 1.00   24.21  ? 82   TRP A CD2 1 
ATOM   624  N  NE1 . TRP A  1 82  ? -26.376 -39.009 -22.907 1.00   18.62  ? 82   TRP A NE1 1 
ATOM   625  C  CE2 . TRP A  1 82  ? -26.047 -37.755 -23.345 1.00   26.30  ? 82   TRP A CE2 1 
ATOM   626  C  CE3 . TRP A  1 82  ? -25.104 -36.737 -25.329 1.00   21.45  ? 82   TRP A CE3 1 
ATOM   627  C  CZ2 . TRP A  1 82  ? -26.144 -36.518 -22.695 1.00   24.07  ? 82   TRP A CZ2 1 
ATOM   628  C  CZ3 . TRP A  1 82  ? -25.211 -35.507 -24.687 1.00   21.61  ? 82   TRP A CZ3 1 
ATOM   629  C  CH2 . TRP A  1 82  ? -25.728 -35.409 -23.382 1.00   19.69  ? 82   TRP A CH2 1 
ATOM   630  N  N   . ASN A  1 83  ? -26.327 -41.459 -29.103 1.00   32.39  ? 83   ASN A N   1 
ATOM   631  C  CA  . ASN A  1 83  ? -26.010 -42.156 -30.351 1.00   31.04  ? 83   ASN A CA  1 
ATOM   632  C  C   . ASN A  1 83  ? -26.314 -41.291 -31.576 1.00   30.65  ? 83   ASN A C   1 
ATOM   633  O  O   . ASN A  1 83  ? -27.270 -40.509 -31.569 1.00   29.63  ? 83   ASN A O   1 
ATOM   634  C  CB  . ASN A  1 83  ? -26.771 -43.485 -30.437 1.00   35.47  ? 83   ASN A CB  1 
ATOM   635  C  CG  . ASN A  1 83  ? -26.191 -44.553 -29.529 1.00   37.01  ? 83   ASN A CG  1 
ATOM   636  O  OD1 . ASN A  1 83  ? -25.018 -44.494 -29.170 1.00   42.08  ? 83   ASN A OD1 1 
ATOM   637  N  ND2 . ASN A  1 83  ? -27.010 -45.545 -29.163 1.00   34.64  ? 83   ASN A ND2 1 
ATOM   638  N  N   . PRO A  1 84  ? -25.499 -41.430 -32.633 1.00   34.68  ? 84   PRO A N   1 
ATOM   639  C  CA  . PRO A  1 84  ? -25.674 -40.712 -33.905 1.00   32.29  ? 84   PRO A CA  1 
ATOM   640  C  C   . PRO A  1 84  ? -27.089 -40.851 -34.450 1.00   30.97  ? 84   PRO A C   1 
ATOM   641  O  O   . PRO A  1 84  ? -27.651 -41.954 -34.445 1.00   29.14  ? 84   PRO A O   1 
ATOM   642  C  CB  . PRO A  1 84  ? -24.712 -41.438 -34.848 1.00   30.68  ? 84   PRO A CB  1 
ATOM   643  C  CG  . PRO A  1 84  ? -23.682 -41.998 -33.979 1.00   30.61  ? 84   PRO A CG  1 
ATOM   644  C  CD  . PRO A  1 84  ? -24.354 -42.354 -32.681 1.00   33.66  ? 84   PRO A CD  1 
ATOM   645  N  N   . ASN A  1 85  ? -27.650 -39.742 -34.922 1.00   33.83  ? 85   ASN A N   1 
ATOM   646  C  CA  . ASN A  1 85  ? -29.001 -39.729 -35.482 1.00   24.61  ? 85   ASN A CA  1 
ATOM   647  C  C   . ASN A  1 85  ? -29.020 -39.426 -36.986 1.00   26.86  ? 85   ASN A C   1 
ATOM   648  O  O   . ASN A  1 85  ? -30.053 -39.054 -37.548 1.00   28.68  ? 85   ASN A O   1 
ATOM   649  C  CB  . ASN A  1 85  ? -29.872 -38.730 -34.717 1.00   24.03  ? 85   ASN A CB  1 
ATOM   650  C  CG  . ASN A  1 85  ? -29.339 -37.302 -34.796 1.00   31.62  ? 85   ASN A CG  1 
ATOM   651  O  OD1 . ASN A  1 85  ? -28.130 -37.065 -34.958 1.00   30.65  ? 85   ASN A OD1 1 
ATOM   652  N  ND2 . ASN A  1 85  ? -30.242 -36.342 -34.677 1.00   26.94  ? 85   ASN A ND2 1 
ATOM   653  N  N   . THR A  1 86  ? -27.860 -39.543 -37.627 1.00   25.96  ? 86   THR A N   1 
ATOM   654  C  CA  . THR A  1 86  ? -27.784 -39.550 -39.084 1.00   31.22  ? 86   THR A CA  1 
ATOM   655  C  C   . THR A  1 86  ? -26.857 -40.681 -39.541 1.00   30.85  ? 86   THR A C   1 
ATOM   656  O  O   . THR A  1 86  ? -26.020 -41.138 -38.768 1.00   32.42  ? 86   THR A O   1 
ATOM   657  C  CB  . THR A  1 86  ? -27.290 -38.190 -39.669 1.00   29.32  ? 86   THR A CB  1 
ATOM   658  O  OG1 . THR A  1 86  ? -25.899 -38.017 -39.399 1.00   29.95  ? 86   THR A OG1 1 
ATOM   659  C  CG2 . THR A  1 86  ? -28.057 -37.031 -39.089 1.00   24.32  ? 86   THR A CG2 1 
ATOM   660  N  N   . ASP A  1 87  ? -27.037 -41.131 -40.783 1.00   33.33  ? 87   ASP A N   1 
ATOM   661  C  CA  . ASP A  1 87  ? -26.133 -42.076 -41.452 1.00   41.98  ? 87   ASP A CA  1 
ATOM   662  C  C   . ASP A  1 87  ? -24.688 -41.811 -41.099 1.00   40.15  ? 87   ASP A C   1 
ATOM   663  O  O   . ASP A  1 87  ? -24.255 -40.663 -41.112 1.00   39.32  ? 87   ASP A O   1 
ATOM   664  C  CB  . ASP A  1 87  ? -26.227 -41.925 -42.973 1.00   47.26  ? 87   ASP A CB  1 
ATOM   665  C  CG  . ASP A  1 87  ? -27.377 -42.676 -43.569 1.00   50.40  ? 87   ASP A CG  1 
ATOM   666  O  OD1 . ASP A  1 87  ? -27.590 -43.837 -43.184 1.00   51.94  ? 87   ASP A OD1 1 
ATOM   667  O  OD2 . ASP A  1 87  ? -28.062 -42.104 -44.440 1.00   60.48  ? 87   ASP A OD2 1 
ATOM   668  N  N   . LEU A  1 88  ? -23.949 -42.873 -40.794 1.00   37.57  ? 88   LEU A N   1 
ATOM   669  C  CA  . LEU A  1 88  ? -22.510 -42.776 -40.581 1.00   33.80  ? 88   LEU A CA  1 
ATOM   670  C  C   . LEU A  1 88  ? -21.816 -42.887 -41.927 1.00   38.76  ? 88   LEU A C   1 
ATOM   671  O  O   . LEU A  1 88  ? -22.289 -43.577 -42.828 1.00   35.20  ? 88   LEU A O   1 
ATOM   672  C  CB  . LEU A  1 88  ? -22.013 -43.889 -39.661 1.00   29.54  ? 88   LEU A CB  1 
ATOM   673  C  CG  . LEU A  1 88  ? -22.768 -44.006 -38.341 1.00   33.00  ? 88   LEU A CG  1 
ATOM   674  C  CD1 . LEU A  1 88  ? -22.054 -44.990 -37.442 1.00   28.85  ? 88   LEU A CD1 1 
ATOM   675  C  CD2 . LEU A  1 88  ? -22.920 -42.634 -37.663 1.00   25.39  ? 88   LEU A CD2 1 
ATOM   676  N  N   . SER A  1 89  ? -20.680 -42.224 -42.058 1.00   42.46  ? 89   SER A N   1 
ATOM   677  C  CA  . SER A  1 89  ? -20.036 -42.128 -43.348 1.00   28.79  ? 89   SER A CA  1 
ATOM   678  C  C   . SER A  1 89  ? -18.694 -41.460 -43.160 1.00   37.03  ? 89   SER A C   1 
ATOM   679  O  O   . SER A  1 89  ? -18.525 -40.648 -42.261 1.00   45.22  ? 89   SER A O   1 
ATOM   680  C  CB  . SER A  1 89  ? -20.912 -41.293 -44.275 1.00   29.08  ? 89   SER A CB  1 
ATOM   681  O  OG  . SER A  1 89  ? -20.338 -41.181 -45.550 1.00   30.19  ? 89   SER A OG  1 
ATOM   682  N  N   . GLU A  1 90  ? -17.724 -41.800 -43.990 1.00   38.71  ? 90   GLU A N   1 
ATOM   683  C  CA  . GLU A  1 90  ? -16.460 -41.089 -43.936 1.00   36.73  ? 90   GLU A CA  1 
ATOM   684  C  C   . GLU A  1 90  ? -16.648 -39.702 -44.525 1.00   39.21  ? 90   GLU A C   1 
ATOM   685  O  O   . GLU A  1 90  ? -15.928 -38.761 -44.173 1.00   26.45  ? 90   GLU A O   1 
ATOM   686  C  CB  . GLU A  1 90  ? -15.371 -41.838 -44.689 1.00   34.63  ? 90   GLU A CB  1 
ATOM   687  C  CG  . GLU A  1 90  ? -14.723 -42.948 -43.915 1.00   30.24  ? 90   GLU A CG  1 
ATOM   688  C  CD  . GLU A  1 90  ? -13.525 -43.476 -44.648 1.00   47.54  ? 90   GLU A CD  1 
ATOM   689  O  OE1 . GLU A  1 90  ? -13.705 -44.151 -45.693 1.00   50.52  ? 90   GLU A OE1 1 
ATOM   690  O  OE2 . GLU A  1 90  ? -12.398 -43.188 -44.197 1.00   46.53  ? 90   GLU A OE2 1 
ATOM   691  N  N   . ASP A  1 91  ? -17.611 -39.582 -45.434 1.00   36.65  ? 91   ASP A N   1 
ATOM   692  C  CA  . ASP A  1 91  ? -17.960 -38.285 -45.987 1.00   40.63  ? 91   ASP A CA  1 
ATOM   693  C  C   . ASP A  1 91  ? -18.838 -37.586 -44.948 1.00   38.03  ? 91   ASP A C   1 
ATOM   694  O  O   . ASP A  1 91  ? -20.060 -37.706 -44.966 1.00   42.33  ? 91   ASP A O   1 
ATOM   695  C  CB  . ASP A  1 91  ? -18.661 -38.446 -47.344 1.00   29.88  ? 91   ASP A CB  1 
ATOM   696  C  CG  . ASP A  1 91  ? -19.164 -37.120 -47.926 1.00   43.63  ? 91   ASP A CG  1 
ATOM   697  O  OD1 . ASP A  1 91  ? -18.907 -36.039 -47.345 1.00   31.91  ? 91   ASP A OD1 1 
ATOM   698  O  OD2 . ASP A  1 91  ? -19.816 -37.162 -48.996 1.00   49.15  ? 91   ASP A OD2 1 
ATOM   699  N  N   . CYS A  1 92  ? -18.203 -36.846 -44.045 1.00   29.13  ? 92   CYS A N   1 
ATOM   700  C  CA  . CYS A  1 92  ? -18.909 -36.300 -42.895 1.00   31.43  ? 92   CYS A CA  1 
ATOM   701  C  C   . CYS A  1 92  ? -18.476 -34.887 -42.475 1.00   31.70  ? 92   CYS A C   1 
ATOM   702  O  O   . CYS A  1 92  ? -19.000 -34.348 -41.497 1.00   26.68  ? 92   CYS A O   1 
ATOM   703  C  CB  . CYS A  1 92  ? -18.765 -37.254 -41.705 1.00   30.44  ? 92   CYS A CB  1 
ATOM   704  S  SG  . CYS A  1 92  ? -17.065 -37.356 -41.061 1.00   31.03  ? 92   CYS A SG  1 
ATOM   705  N  N   . LEU A  1 93  ? -17.535 -34.281 -43.194 1.00   29.97  ? 93   LEU A N   1 
ATOM   706  C  CA  . LEU A  1 93  ? -17.079 -32.939 -42.816 1.00   32.34  ? 93   LEU A CA  1 
ATOM   707  C  C   . LEU A  1 93  ? -18.062 -31.849 -43.268 1.00   39.00  ? 93   LEU A C   1 
ATOM   708  O  O   . LEU A  1 93  ? -17.928 -31.267 -44.355 1.00   46.64  ? 93   LEU A O   1 
ATOM   709  C  CB  . LEU A  1 93  ? -15.665 -32.674 -43.331 1.00   22.07  ? 93   LEU A CB  1 
ATOM   710  C  CG  . LEU A  1 93  ? -14.661 -33.754 -42.928 1.00   29.03  ? 93   LEU A CG  1 
ATOM   711  C  CD1 . LEU A  1 93  ? -13.248 -33.415 -43.382 1.00   30.35  ? 93   LEU A CD1 1 
ATOM   712  C  CD2 . LEU A  1 93  ? -14.706 -33.997 -41.429 1.00   24.49  ? 93   LEU A CD2 1 
ATOM   713  N  N   . TYR A  1 94  ? -19.064 -31.600 -42.426 1.00   31.58  ? 94   TYR A N   1 
ATOM   714  C  CA  . TYR A  1 94  ? -20.095 -30.607 -42.703 1.00   27.94  ? 94   TYR A CA  1 
ATOM   715  C  C   . TYR A  1 94  ? -20.355 -29.793 -41.440 1.00   35.03  ? 94   TYR A C   1 
ATOM   716  O  O   . TYR A  1 94  ? -19.902 -30.168 -40.357 1.00   31.41  ? 94   TYR A O   1 
ATOM   717  C  CB  . TYR A  1 94  ? -21.400 -31.266 -43.165 1.00   27.05  ? 94   TYR A CB  1 
ATOM   718  C  CG  . TYR A  1 94  ? -21.275 -32.078 -44.437 1.00   38.21  ? 94   TYR A CG  1 
ATOM   719  C  CD1 . TYR A  1 94  ? -20.845 -33.407 -44.398 1.00   35.08  ? 94   TYR A CD1 1 
ATOM   720  C  CD2 . TYR A  1 94  ? -21.594 -31.525 -45.673 1.00   25.11  ? 94   TYR A CD2 1 
ATOM   721  C  CE1 . TYR A  1 94  ? -20.713 -34.149 -45.551 1.00   31.18  ? 94   TYR A CE1 1 
ATOM   722  C  CE2 . TYR A  1 94  ? -21.460 -32.254 -46.826 1.00   26.67  ? 94   TYR A CE2 1 
ATOM   723  C  CZ  . TYR A  1 94  ? -21.026 -33.571 -46.762 1.00   35.58  ? 94   TYR A CZ  1 
ATOM   724  O  OH  . TYR A  1 94  ? -20.904 -34.316 -47.911 1.00   41.59  ? 94   TYR A OH  1 
ATOM   725  N  N   . LEU A  1 95  ? -21.082 -28.685 -41.583 1.00   39.04  ? 95   LEU A N   1 
ATOM   726  C  CA  . LEU A  1 95  ? -21.466 -27.858 -40.438 1.00   36.90  ? 95   LEU A CA  1 
ATOM   727  C  C   . LEU A  1 95  ? -22.874 -27.252 -40.579 1.00   31.84  ? 95   LEU A C   1 
ATOM   728  O  O   . LEU A  1 95  ? -23.495 -27.306 -41.642 1.00   31.53  ? 95   LEU A O   1 
ATOM   729  C  CB  . LEU A  1 95  ? -20.426 -26.763 -40.175 1.00   18.40  ? 95   LEU A CB  1 
ATOM   730  C  CG  . LEU A  1 95  ? -20.117 -25.771 -41.308 1.00   35.86  ? 95   LEU A CG  1 
ATOM   731  C  CD1 . LEU A  1 95  ? -21.212 -24.710 -41.513 1.00   25.78  ? 95   LEU A CD1 1 
ATOM   732  C  CD2 . LEU A  1 95  ? -18.755 -25.096 -41.091 1.00   38.01  ? 95   LEU A CD2 1 
ATOM   733  N  N   . ASN A  1 96  ? -23.346 -26.648 -39.499 1.00   30.16  ? 96   ASN A N   1 
ATOM   734  C  CA  . ASN A  1 96  ? -24.668 -26.059 -39.456 1.00   31.48  ? 96   ASN A CA  1 
ATOM   735  C  C   . ASN A  1 96  ? -24.609 -24.606 -39.007 1.00   31.58  ? 96   ASN A C   1 
ATOM   736  O  O   . ASN A  1 96  ? -23.723 -24.210 -38.237 1.00   25.90  ? 96   ASN A O   1 
ATOM   737  C  CB  . ASN A  1 96  ? -25.563 -26.868 -38.515 1.00   32.22  ? 96   ASN A CB  1 
ATOM   738  C  CG  . ASN A  1 96  ? -25.348 -28.371 -38.657 1.00   32.74  ? 96   ASN A CG  1 
ATOM   739  O  OD1 . ASN A  1 96  ? -25.794 -28.989 -39.629 1.00   29.38  ? 96   ASN A OD1 1 
ATOM   740  N  ND2 . ASN A  1 96  ? -24.660 -28.963 -37.686 1.00   18.08  ? 96   ASN A ND2 1 
ATOM   741  N  N   . VAL A  1 97  ? -25.538 -23.805 -39.516 1.00   30.41  ? 97   VAL A N   1 
ATOM   742  C  CA  . VAL A  1 97  ? -25.652 -22.421 -39.094 1.00   32.54  ? 97   VAL A CA  1 
ATOM   743  C  C   . VAL A  1 97  ? -27.109 -22.084 -38.776 1.00   39.31  ? 97   VAL A C   1 
ATOM   744  O  O   . VAL A  1 97  ? -28.024 -22.352 -39.568 1.00   33.75  ? 97   VAL A O   1 
ATOM   745  C  CB  . VAL A  1 97  ? -25.128 -21.447 -40.161 1.00   30.21  ? 97   VAL A CB  1 
ATOM   746  C  CG1 . VAL A  1 97  ? -25.049 -20.029 -39.584 1.00   24.54  ? 97   VAL A CG1 1 
ATOM   747  C  CG2 . VAL A  1 97  ? -23.771 -21.900 -40.695 1.00   21.37  ? 97   VAL A CG2 1 
ATOM   748  N  N   . TRP A  1 98  ? -27.325 -21.520 -37.595 1.00   36.23  ? 98   TRP A N   1 
ATOM   749  C  CA  . TRP A  1 98  ? -28.640 -21.023 -37.251 1.00   31.14  ? 98   TRP A CA  1 
ATOM   750  C  C   . TRP A  1 98  ? -28.496 -19.522 -37.129 1.00   35.71  ? 98   TRP A C   1 
ATOM   751  O  O   . TRP A  1 98  ? -27.623 -19.030 -36.404 1.00   33.05  ? 98   TRP A O   1 
ATOM   752  C  CB  . TRP A  1 98  ? -29.117 -21.597 -35.921 1.00   28.31  ? 98   TRP A CB  1 
ATOM   753  C  CG  . TRP A  1 98  ? -29.513 -23.035 -35.942 1.00   32.30  ? 98   TRP A CG  1 
ATOM   754  C  CD1 . TRP A  1 98  ? -30.748 -23.539 -36.222 1.00   31.13  ? 98   TRP A CD1 1 
ATOM   755  C  CD2 . TRP A  1 98  ? -28.681 -24.162 -35.632 1.00   34.23  ? 98   TRP A CD2 1 
ATOM   756  N  NE1 . TRP A  1 98  ? -30.734 -24.906 -36.121 1.00   29.74  ? 98   TRP A NE1 1 
ATOM   757  C  CE2 . TRP A  1 98  ? -29.479 -25.314 -35.756 1.00   29.11  ? 98   TRP A CE2 1 
ATOM   758  C  CE3 . TRP A  1 98  ? -27.335 -24.308 -35.273 1.00   34.89  ? 98   TRP A CE3 1 
ATOM   759  C  CZ2 . TRP A  1 98  ? -28.980 -26.596 -35.530 1.00   33.96  ? 98   TRP A CZ2 1 
ATOM   760  C  CZ3 . TRP A  1 98  ? -26.839 -25.580 -35.052 1.00   31.61  ? 98   TRP A CZ3 1 
ATOM   761  C  CH2 . TRP A  1 98  ? -27.661 -26.707 -35.178 1.00   35.44  ? 98   TRP A CH2 1 
ATOM   762  N  N   . ILE A  1 99  ? -29.334 -18.792 -37.848 1.00   24.46  ? 99   ILE A N   1 
ATOM   763  C  CA  . ILE A  1 99  ? -29.312 -17.345 -37.770 1.00   44.29  ? 99   ILE A CA  1 
ATOM   764  C  C   . ILE A  1 99  ? -30.708 -16.829 -37.423 1.00   45.35  ? 99   ILE A C   1 
ATOM   765  O  O   . ILE A  1 99  ? -31.730 -17.395 -37.854 1.00   35.19  ? 99   ILE A O   1 
ATOM   766  C  CB  . ILE A  1 99  ? -28.784 -16.695 -39.077 1.00   42.79  ? 99   ILE A CB  1 
ATOM   767  C  CG1 . ILE A  1 99  ? -29.789 -16.849 -40.206 1.00   47.37  ? 99   ILE A CG1 1 
ATOM   768  C  CG2 . ILE A  1 99  ? -27.446 -17.313 -39.503 1.00   38.29  ? 99   ILE A CG2 1 
ATOM   769  C  CD1 . ILE A  1 99  ? -29.339 -16.185 -41.473 1.00   57.54  ? 99   ILE A CD1 1 
ATOM   770  N  N   . PRO A  1 100 ? -30.764 -15.771 -36.604 1.00   48.01  ? 100  PRO A N   1 
ATOM   771  C  CA  . PRO A  1 100 ? -32.087 -15.278 -36.219 1.00   43.74  ? 100  PRO A CA  1 
ATOM   772  C  C   . PRO A  1 100 ? -32.789 -14.674 -37.424 1.00   41.08  ? 100  PRO A C   1 
ATOM   773  O  O   . PRO A  1 100 ? -32.120 -14.277 -38.366 1.00   38.35  ? 100  PRO A O   1 
ATOM   774  C  CB  . PRO A  1 100 ? -31.778 -14.216 -35.156 1.00   39.35  ? 100  PRO A CB  1 
ATOM   775  C  CG  . PRO A  1 100 ? -30.337 -13.887 -35.324 1.00   44.08  ? 100  PRO A CG  1 
ATOM   776  C  CD  . PRO A  1 100 ? -29.676 -15.105 -35.869 1.00   46.73  ? 100  PRO A CD  1 
ATOM   777  N  N   . ALA A  1 101 ? -34.117 -14.664 -37.415 1.00   43.28  ? 101  ALA A N   1 
ATOM   778  C  CA  . ALA A  1 101 ? -34.881 -13.940 -38.424 1.00   44.15  ? 101  ALA A CA  1 
ATOM   779  C  C   . ALA A  1 101 ? -35.608 -12.776 -37.762 1.00   47.34  ? 101  ALA A C   1 
ATOM   780  O  O   . ALA A  1 101 ? -36.282 -12.952 -36.741 1.00   46.76  ? 101  ALA A O   1 
ATOM   781  C  CB  . ALA A  1 101 ? -35.859 -14.849 -39.123 1.00   42.10  ? 101  ALA A CB  1 
ATOM   782  N  N   . PRO A  1 102 ? -35.483 -11.579 -38.347 1.00   54.02  ? 102  PRO A N   1 
ATOM   783  C  CA  . PRO A  1 102 ? -34.749 -11.342 -39.599 1.00   51.32  ? 102  PRO A CA  1 
ATOM   784  C  C   . PRO A  1 102 ? -33.235 -11.287 -39.434 1.00   42.81  ? 102  PRO A C   1 
ATOM   785  O  O   . PRO A  1 102 ? -32.743 -11.000 -38.342 1.00   41.74  ? 102  PRO A O   1 
ATOM   786  C  CB  . PRO A  1 102 ? -35.273 -9.975  -40.057 1.00   56.14  ? 102  PRO A CB  1 
ATOM   787  C  CG  . PRO A  1 102 ? -35.714 -9.312  -38.799 1.00   55.47  ? 102  PRO A CG  1 
ATOM   788  C  CD  . PRO A  1 102 ? -36.239 -10.389 -37.911 1.00   55.74  ? 102  PRO A CD  1 
ATOM   789  N  N   . LYS A  1 103 ? -32.536 -11.578 -40.532 1.00   40.16  ? 103  LYS A N   1 
ATOM   790  C  CA  . LYS A  1 103 ? -31.081 -11.556 -40.637 1.00   38.98  ? 103  LYS A CA  1 
ATOM   791  C  C   . LYS A  1 103 ? -30.459 -10.461 -39.793 1.00   41.65  ? 103  LYS A C   1 
ATOM   792  O  O   . LYS A  1 103 ? -30.766 -9.285  -39.968 1.00   44.64  ? 103  LYS A O   1 
ATOM   793  C  CB  . LYS A  1 103 ? -30.672 -11.382 -42.106 1.00   48.02  ? 103  LYS A CB  1 
ATOM   794  C  CG  . LYS A  1 103 ? -29.183 -11.589 -42.389 1.00   59.07  ? 103  LYS A CG  1 
ATOM   795  C  CD  . LYS A  1 103 ? -28.898 -11.571 -43.897 1.00   65.56  ? 103  LYS A CD  1 
ATOM   796  C  CE  . LYS A  1 103 ? -27.401 -11.619 -44.211 1.00   65.36  ? 103  LYS A CE  1 
ATOM   797  N  NZ  . LYS A  1 103 ? -26.685 -10.322 -43.951 1.00   63.86  ? 103  LYS A NZ  1 
ATOM   798  N  N   . PRO A  1 104 ? -29.589 -10.852 -38.854 1.00   36.28  ? 104  PRO A N   1 
ATOM   799  C  CA  . PRO A  1 104 ? -28.980 -9.870  -37.963 1.00   36.50  ? 104  PRO A CA  1 
ATOM   800  C  C   . PRO A  1 104 ? -27.974 -9.041  -38.737 1.00   37.92  ? 104  PRO A C   1 
ATOM   801  O  O   . PRO A  1 104 ? -27.645 -9.397  -39.866 1.00   33.77  ? 104  PRO A O   1 
ATOM   802  C  CB  . PRO A  1 104 ? -28.281 -10.743 -36.913 1.00   29.92  ? 104  PRO A CB  1 
ATOM   803  C  CG  . PRO A  1 104 ? -27.940 -11.977 -37.639 1.00   36.99  ? 104  PRO A CG  1 
ATOM   804  C  CD  . PRO A  1 104 ? -29.067 -12.207 -38.620 1.00   30.55  ? 104  PRO A CD  1 
ATOM   805  N  N   . LYS A  1 105 ? -27.498 -7.952  -38.141 1.00   45.18  ? 105  LYS A N   1 
ATOM   806  C  CA  . LYS A  1 105 ? -26.527 -7.093  -38.802 1.00   51.54  ? 105  LYS A CA  1 
ATOM   807  C  C   . LYS A  1 105 ? -25.085 -7.512  -38.502 1.00   57.68  ? 105  LYS A C   1 
ATOM   808  O  O   . LYS A  1 105 ? -24.292 -7.713  -39.424 1.00   64.97  ? 105  LYS A O   1 
ATOM   809  C  CB  . LYS A  1 105 ? -26.755 -5.635  -38.413 1.00   48.33  ? 105  LYS A CB  1 
ATOM   810  C  CG  . LYS A  1 105 ? -27.990 -4.994  -39.024 1.00   49.26  ? 105  LYS A CG  1 
ATOM   811  C  CD  . LYS A  1 105 ? -27.798 -4.742  -40.512 1.00   54.88  ? 105  LYS A CD  1 
ATOM   812  C  CE  . LYS A  1 105 ? -28.746 -3.657  -41.048 1.00   52.89  ? 105  LYS A CE  1 
ATOM   813  N  NZ  . LYS A  1 105 ? -30.178 -3.980  -40.786 1.00   47.39  ? 105  LYS A NZ  1 
ATOM   814  N  N   . ASN A  1 106 ? -24.757 -7.659  -37.219 1.00   52.89  ? 106  ASN A N   1 
ATOM   815  C  CA  . ASN A  1 106 ? -23.380 -7.916  -36.789 1.00   53.71  ? 106  ASN A CA  1 
ATOM   816  C  C   . ASN A  1 106 ? -23.364 -8.843  -35.571 1.00   53.05  ? 106  ASN A C   1 
ATOM   817  O  O   . ASN A  1 106 ? -22.855 -8.480  -34.505 1.00   50.22  ? 106  ASN A O   1 
ATOM   818  C  CB  . ASN A  1 106 ? -22.702 -6.590  -36.427 1.00   61.37  ? 106  ASN A CB  1 
ATOM   819  C  CG  . ASN A  1 106 ? -21.297 -6.451  -37.006 1.00   69.49  ? 106  ASN A CG  1 
ATOM   820  O  OD1 . ASN A  1 106 ? -20.803 -7.344  -37.695 1.00   61.44  ? 106  ASN A OD1 1 
ATOM   821  N  ND2 . ASN A  1 106 ? -20.661 -5.288  -36.747 1.00   88.77  ? 106  ASN A ND2 1 
ATOM   822  N  N   . ALA A  1 107 ? -23.917 -10.042 -35.737 1.00   46.57  ? 107  ALA A N   1 
ATOM   823  C  CA  . ALA A  1 107 ? -24.222 -10.923 -34.608 1.00   32.41  ? 107  ALA A CA  1 
ATOM   824  C  C   . ALA A  1 107 ? -23.030 -11.692 -34.059 1.00   29.98  ? 107  ALA A C   1 
ATOM   825  O  O   . ALA A  1 107 ? -22.224 -12.239 -34.816 1.00   23.49  ? 107  ALA A O   1 
ATOM   826  C  CB  . ALA A  1 107 ? -25.323 -11.902 -34.997 1.00   27.40  ? 107  ALA A CB  1 
ATOM   827  N  N   . THR A  1 108 ? -22.946 -11.752 -32.734 1.00   21.66  ? 108  THR A N   1 
ATOM   828  C  CA  . THR A  1 108 ? -21.983 -12.603 -32.060 1.00   24.94  ? 108  THR A CA  1 
ATOM   829  C  C   . THR A  1 108 ? -22.252 -14.058 -32.436 1.00   29.24  ? 108  THR A C   1 
ATOM   830  O  O   . THR A  1 108 ? -23.413 -14.463 -32.604 1.00   28.20  ? 108  THR A O   1 
ATOM   831  C  CB  . THR A  1 108 ? -22.054 -12.418 -30.534 1.00   24.63  ? 108  THR A CB  1 
ATOM   832  O  OG1 . THR A  1 108 ? -21.561 -11.118 -30.199 1.00   28.91  ? 108  THR A OG1 1 
ATOM   833  C  CG2 . THR A  1 108 ? -21.211 -13.452 -29.816 1.00   25.98  ? 108  THR A CG2 1 
ATOM   834  N  N   . VAL A  1 109 ? -21.180 -14.836 -32.585 1.00   24.90  ? 109  VAL A N   1 
ATOM   835  C  CA  . VAL A  1 109 ? -21.302 -16.193 -33.085 1.00   27.45  ? 109  VAL A CA  1 
ATOM   836  C  C   . VAL A  1 109 ? -20.857 -17.210 -32.059 1.00   27.40  ? 109  VAL A C   1 
ATOM   837  O  O   . VAL A  1 109 ? -19.769 -17.093 -31.490 1.00   26.48  ? 109  VAL A O   1 
ATOM   838  C  CB  . VAL A  1 109 ? -20.473 -16.384 -34.362 1.00   25.42  ? 109  VAL A CB  1 
ATOM   839  C  CG1 . VAL A  1 109 ? -20.665 -17.807 -34.917 1.00   19.71  ? 109  VAL A CG1 1 
ATOM   840  C  CG2 . VAL A  1 109 ? -20.861 -15.330 -35.390 1.00   22.12  ? 109  VAL A CG2 1 
ATOM   841  N  N   . LEU A  1 110 ? -21.708 -18.204 -31.829 1.00   25.67  ? 110  LEU A N   1 
ATOM   842  C  CA  . LEU A  1 110 ? -21.374 -19.329 -30.948 1.00   28.74  ? 110  LEU A CA  1 
ATOM   843  C  C   . LEU A  1 110 ? -21.069 -20.579 -31.754 1.00   31.26  ? 110  LEU A C   1 
ATOM   844  O  O   . LEU A  1 110 ? -21.906 -21.058 -32.524 1.00   34.73  ? 110  LEU A O   1 
ATOM   845  C  CB  . LEU A  1 110 ? -22.513 -19.622 -29.967 1.00   24.88  ? 110  LEU A CB  1 
ATOM   846  C  CG  . LEU A  1 110 ? -22.729 -18.527 -28.924 1.00   32.60  ? 110  LEU A CG  1 
ATOM   847  C  CD1 . LEU A  1 110 ? -23.884 -18.861 -28.011 1.00   34.63  ? 110  LEU A CD1 1 
ATOM   848  C  CD2 . LEU A  1 110 ? -21.479 -18.392 -28.123 1.00   41.36  ? 110  LEU A CD2 1 
ATOM   849  N  N   . ILE A  1 111 ? -19.866 -21.111 -31.576 1.00   30.46  ? 111  ILE A N   1 
ATOM   850  C  CA  . ILE A  1 111 ? -19.482 -22.334 -32.270 1.00   29.41  ? 111  ILE A CA  1 
ATOM   851  C  C   . ILE A  1 111 ? -19.399 -23.523 -31.323 1.00   23.14  ? 111  ILE A C   1 
ATOM   852  O  O   . ILE A  1 111 ? -18.540 -23.563 -30.438 1.00   25.90  ? 111  ILE A O   1 
ATOM   853  C  CB  . ILE A  1 111 ? -18.152 -22.171 -32.995 1.00   27.24  ? 111  ILE A CB  1 
ATOM   854  C  CG1 . ILE A  1 111 ? -18.215 -20.963 -33.938 1.00   23.08  ? 111  ILE A CG1 1 
ATOM   855  C  CG2 . ILE A  1 111 ? -17.777 -23.478 -33.715 1.00   14.25  ? 111  ILE A CG2 1 
ATOM   856  C  CD1 . ILE A  1 111 ? -17.026 -20.858 -34.873 1.00   22.30  ? 111  ILE A CD1 1 
ATOM   857  N  N   . TRP A  1 112 ? -20.304 -24.481 -31.512 1.00   19.17  ? 112  TRP A N   1 
ATOM   858  C  CA  . TRP A  1 112 ? -20.357 -25.689 -30.677 1.00   17.71  ? 112  TRP A CA  1 
ATOM   859  C  C   . TRP A  1 112 ? -19.431 -26.815 -31.132 1.00   19.84  ? 112  TRP A C   1 
ATOM   860  O  O   . TRP A  1 112 ? -19.372 -27.132 -32.321 1.00   21.02  ? 112  TRP A O   1 
ATOM   861  C  CB  . TRP A  1 112 ? -21.779 -26.228 -30.635 1.00   22.46  ? 112  TRP A CB  1 
ATOM   862  C  CG  . TRP A  1 112 ? -21.926 -27.479 -29.837 1.00   27.51  ? 112  TRP A CG  1 
ATOM   863  C  CD1 . TRP A  1 112 ? -22.143 -28.737 -30.318 1.00   28.03  ? 112  TRP A CD1 1 
ATOM   864  C  CD2 . TRP A  1 112 ? -21.880 -27.596 -28.409 1.00   26.10  ? 112  TRP A CD2 1 
ATOM   865  N  NE1 . TRP A  1 112 ? -22.238 -29.633 -29.275 1.00   22.30  ? 112  TRP A NE1 1 
ATOM   866  C  CE2 . TRP A  1 112 ? -22.080 -28.958 -28.095 1.00   20.16  ? 112  TRP A CE2 1 
ATOM   867  C  CE3 . TRP A  1 112 ? -21.690 -26.682 -27.366 1.00   20.04  ? 112  TRP A CE3 1 
ATOM   868  C  CZ2 . TRP A  1 112 ? -22.097 -29.427 -26.783 1.00   13.14  ? 112  TRP A CZ2 1 
ATOM   869  C  CZ3 . TRP A  1 112 ? -21.706 -27.148 -26.069 1.00   15.51  ? 112  TRP A CZ3 1 
ATOM   870  C  CH2 . TRP A  1 112 ? -21.910 -28.508 -25.787 1.00   14.35  ? 112  TRP A CH2 1 
ATOM   871  N  N   . ILE A  1 113 ? -18.728 -27.423 -30.176 1.00   20.20  ? 113  ILE A N   1 
ATOM   872  C  CA  . ILE A  1 113 ? -17.926 -28.619 -30.428 1.00   17.05  ? 113  ILE A CA  1 
ATOM   873  C  C   . ILE A  1 113 ? -18.305 -29.729 -29.451 1.00   24.77  ? 113  ILE A C   1 
ATOM   874  O  O   . ILE A  1 113 ? -18.044 -29.619 -28.252 1.00   32.71  ? 113  ILE A O   1 
ATOM   875  C  CB  . ILE A  1 113 ? -16.428 -28.326 -30.287 1.00   22.20  ? 113  ILE A CB  1 
ATOM   876  C  CG1 . ILE A  1 113 ? -16.007 -27.171 -31.210 1.00   24.87  ? 113  ILE A CG1 1 
ATOM   877  C  CG2 . ILE A  1 113 ? -15.602 -29.586 -30.561 1.00   13.20  ? 113  ILE A CG2 1 
ATOM   878  C  CD1 . ILE A  1 113 ? -14.562 -26.734 -31.007 1.00   11.54  ? 113  ILE A CD1 1 
ATOM   879  N  N   . TYR A  1 114 ? -18.907 -30.802 -29.961 1.00   22.51  ? 114  TYR A N   1 
ATOM   880  C  CA  . TYR A  1 114 ? -19.426 -31.891 -29.115 1.00   19.11  ? 114  TYR A CA  1 
ATOM   881  C  C   . TYR A  1 114 ? -18.358 -32.802 -28.459 1.00   27.70  ? 114  TYR A C   1 
ATOM   882  O  O   . TYR A  1 114 ? -17.225 -32.919 -28.933 1.00   22.30  ? 114  TYR A O   1 
ATOM   883  C  CB  . TYR A  1 114 ? -20.395 -32.761 -29.930 1.00   16.13  ? 114  TYR A CB  1 
ATOM   884  C  CG  . TYR A  1 114 ? -19.798 -33.336 -31.216 1.00   20.24  ? 114  TYR A CG  1 
ATOM   885  C  CD1 . TYR A  1 114 ? -18.918 -34.431 -31.172 1.00   20.00  ? 114  TYR A CD1 1 
ATOM   886  C  CD2 . TYR A  1 114 ? -20.116 -32.797 -32.468 1.00   14.29  ? 114  TYR A CD2 1 
ATOM   887  C  CE1 . TYR A  1 114 ? -18.353 -34.959 -32.339 1.00   15.02  ? 114  TYR A CE1 1 
ATOM   888  C  CE2 . TYR A  1 114 ? -19.564 -33.326 -33.646 1.00   15.00  ? 114  TYR A CE2 1 
ATOM   889  C  CZ  . TYR A  1 114 ? -18.684 -34.407 -33.568 1.00   24.17  ? 114  TYR A CZ  1 
ATOM   890  O  OH  . TYR A  1 114 ? -18.109 -34.934 -34.704 1.00   16.19  ? 114  TYR A OH  1 
ATOM   891  N  N   . GLY A  1 115 ? -18.744 -33.461 -27.375 1.00   12.51  ? 115  GLY A N   1 
ATOM   892  C  CA  . GLY A  1 115 ? -17.941 -34.512 -26.793 1.00   21.81  ? 115  GLY A CA  1 
ATOM   893  C  C   . GLY A  1 115 ? -18.230 -35.879 -27.404 1.00   26.05  ? 115  GLY A C   1 
ATOM   894  O  O   . GLY A  1 115 ? -18.917 -35.988 -28.410 1.00   21.18  ? 115  GLY A O   1 
ATOM   895  N  N   . GLY A  1 116 ? -17.691 -36.928 -26.795 1.00   24.99  ? 116  GLY A N   1 
ATOM   896  C  CA  . GLY A  1 116 ? -17.729 -38.249 -27.381 1.00   19.84  ? 116  GLY A CA  1 
ATOM   897  C  C   . GLY A  1 116 ? -16.401 -38.972 -27.178 1.00   27.40  ? 116  GLY A C   1 
ATOM   898  O  O   . GLY A  1 116 ? -16.089 -39.934 -27.883 1.00   30.27  ? 116  GLY A O   1 
ATOM   899  N  N   . GLY A  1 117 ? -15.609 -38.500 -26.221 1.00   29.80  ? 117  GLY A N   1 
ATOM   900  C  CA  . GLY A  1 117 ? -14.333 -39.126 -25.892 1.00   29.97  ? 117  GLY A CA  1 
ATOM   901  C  C   . GLY A  1 117 ? -13.348 -39.163 -27.052 1.00   28.45  ? 117  GLY A C   1 
ATOM   902  O  O   . GLY A  1 117 ? -12.441 -39.990 -27.067 1.00   33.28  ? 117  GLY A O   1 
ATOM   903  N  N   . PHE A  1 118 ? -13.542 -38.274 -28.027 1.00   27.24  ? 118  PHE A N   1 
ATOM   904  C  CA  . PHE A  1 118 ? -12.784 -38.271 -29.282 1.00   28.01  ? 118  PHE A CA  1 
ATOM   905  C  C   . PHE A  1 118 ? -13.020 -39.535 -30.103 1.00   28.19  ? 118  PHE A C   1 
ATOM   906  O  O   . PHE A  1 118 ? -12.322 -39.774 -31.091 1.00   25.85  ? 118  PHE A O   1 
ATOM   907  C  CB  . PHE A  1 118 ? -11.276 -38.066 -29.047 1.00   26.50  ? 118  PHE A CB  1 
ATOM   908  C  CG  . PHE A  1 118 ? -10.936 -36.738 -28.448 1.00   24.81  ? 118  PHE A CG  1 
ATOM   909  C  CD1 . PHE A  1 118 ? -11.059 -35.575 -29.194 1.00   20.63  ? 118  PHE A CD1 1 
ATOM   910  C  CD2 . PHE A  1 118 ? -10.510 -36.644 -27.129 1.00   24.84  ? 118  PHE A CD2 1 
ATOM   911  C  CE1 . PHE A  1 118 ? -10.745 -34.334 -28.639 1.00   20.30  ? 118  PHE A CE1 1 
ATOM   912  C  CE2 . PHE A  1 118 ? -10.200 -35.408 -26.565 1.00   17.67  ? 118  PHE A CE2 1 
ATOM   913  C  CZ  . PHE A  1 118 ? -10.313 -34.253 -27.326 1.00   17.35  ? 118  PHE A CZ  1 
ATOM   914  N  N   . GLN A  1 119 ? -14.010 -40.329 -29.695 1.00   26.95  ? 119  GLN A N   1 
ATOM   915  C  CA  . GLN A  1 119 ? -14.286 -41.613 -30.332 1.00   32.03  ? 119  GLN A CA  1 
ATOM   916  C  C   . GLN A  1 119 ? -15.678 -41.573 -30.932 1.00   41.79  ? 119  GLN A C   1 
ATOM   917  O  O   . GLN A  1 119 ? -15.973 -42.302 -31.877 1.00   50.56  ? 119  GLN A O   1 
ATOM   918  C  CB  . GLN A  1 119 ? -14.215 -42.770 -29.326 1.00   20.50  ? 119  GLN A CB  1 
ATOM   919  C  CG  . GLN A  1 119 ? -12.990 -42.810 -28.434 1.00   44.85  ? 119  GLN A CG  1 
ATOM   920  C  CD  . GLN A  1 119 ? -11.688 -42.814 -29.220 1.00   51.62  ? 119  GLN A CD  1 
ATOM   921  O  OE1 . GLN A  1 119 ? -10.816 -41.964 -29.002 1.00   50.13  ? 119  GLN A OE1 1 
ATOM   922  N  NE2 . GLN A  1 119 ? -11.545 -43.774 -30.137 1.00   51.02  ? 119  GLN A NE2 1 
ATOM   923  N  N   . THR A  1 120 ? -16.547 -40.736 -30.368 1.00   38.30  ? 120  THR A N   1 
ATOM   924  C  CA  . THR A  1 120 ? -17.939 -40.671 -30.820 1.00   37.57  ? 120  THR A CA  1 
ATOM   925  C  C   . THR A  1 120 ? -18.443 -39.228 -30.874 1.00   33.58  ? 120  THR A C   1 
ATOM   926  O  O   . THR A  1 120 ? -17.694 -38.308 -30.577 1.00   28.37  ? 120  THR A O   1 
ATOM   927  C  CB  . THR A  1 120 ? -18.885 -41.503 -29.919 1.00   33.78  ? 120  THR A CB  1 
ATOM   928  O  OG1 . THR A  1 120 ? -18.959 -40.915 -28.608 1.00   24.06  ? 120  THR A OG1 1 
ATOM   929  C  CG2 . THR A  1 120 ? -18.418 -42.957 -29.823 1.00   20.57  ? 120  THR A CG2 1 
ATOM   930  N  N   . GLY A  1 121 ? -19.705 -39.046 -31.268 1.00   30.95  ? 121  GLY A N   1 
ATOM   931  C  CA  . GLY A  1 121 ? -20.336 -37.736 -31.285 1.00   25.27  ? 121  GLY A CA  1 
ATOM   932  C  C   . GLY A  1 121 ? -20.792 -37.256 -32.654 1.00   24.31  ? 121  GLY A C   1 
ATOM   933  O  O   . GLY A  1 121 ? -20.340 -37.745 -33.680 1.00   28.26  ? 121  GLY A O   1 
ATOM   934  N  N   . THR A  1 122 ? -21.704 -36.293 -32.659 1.00   22.49  ? 122  THR A N   1 
ATOM   935  C  CA  . THR A  1 122 ? -22.221 -35.709 -33.896 1.00   31.85  ? 122  THR A CA  1 
ATOM   936  C  C   . THR A  1 122 ? -22.975 -34.425 -33.552 1.00   34.16  ? 122  THR A C   1 
ATOM   937  O  O   . THR A  1 122 ? -23.581 -34.317 -32.479 1.00   34.37  ? 122  THR A O   1 
ATOM   938  C  CB  . THR A  1 122 ? -23.133 -36.678 -34.700 1.00   28.24  ? 122  THR A CB  1 
ATOM   939  O  OG1 . THR A  1 122 ? -23.428 -36.110 -35.979 1.00   28.79  ? 122  THR A OG1 1 
ATOM   940  C  CG2 . THR A  1 122 ? -24.446 -36.943 -33.981 1.00   18.90  ? 122  THR A CG2 1 
ATOM   941  N  N   . SER A  1 123 ? -22.915 -33.457 -34.462 1.00   28.83  ? 123  SER A N   1 
ATOM   942  C  CA  . SER A  1 123 ? -23.462 -32.125 -34.226 1.00   28.78  ? 123  SER A CA  1 
ATOM   943  C  C   . SER A  1 123 ? -24.986 -32.128 -34.305 1.00   27.12  ? 123  SER A C   1 
ATOM   944  O  O   . SER A  1 123 ? -25.634 -31.200 -33.807 1.00   26.88  ? 123  SER A O   1 
ATOM   945  C  CB  . SER A  1 123 ? -22.888 -31.131 -35.244 1.00   22.42  ? 123  SER A CB  1 
ATOM   946  O  OG  . SER A  1 123 ? -23.086 -31.623 -36.563 1.00   30.53  ? 123  SER A OG  1 
ATOM   947  N  N   . SER A  1 124 ? -25.537 -33.182 -34.917 1.00   21.33  ? 124  SER A N   1 
ATOM   948  C  CA  . SER A  1 124 ? -26.965 -33.271 -35.254 1.00   18.84  ? 124  SER A CA  1 
ATOM   949  C  C   . SER A  1 124 ? -27.854 -33.774 -34.115 1.00   23.02  ? 124  SER A C   1 
ATOM   950  O  O   . SER A  1 124 ? -29.038 -34.024 -34.324 1.00   25.76  ? 124  SER A O   1 
ATOM   951  C  CB  . SER A  1 124 ? -27.183 -34.143 -36.518 1.00   22.57  ? 124  SER A CB  1 
ATOM   952  O  OG  . SER A  1 124 ? -26.589 -35.444 -36.423 1.00   23.25  ? 124  SER A OG  1 
ATOM   953  N  N   . LEU A  1 125 ? -27.292 -33.934 -32.917 1.00   26.91  ? 125  LEU A N   1 
ATOM   954  C  CA  . LEU A  1 125 ? -28.091 -34.374 -31.761 1.00   23.40  ? 125  LEU A CA  1 
ATOM   955  C  C   . LEU A  1 125 ? -29.112 -33.328 -31.332 1.00   24.61  ? 125  LEU A C   1 
ATOM   956  O  O   . LEU A  1 125 ? -28.868 -32.120 -31.410 1.00   33.29  ? 125  LEU A O   1 
ATOM   957  C  CB  . LEU A  1 125 ? -27.205 -34.746 -30.560 1.00   23.53  ? 125  LEU A CB  1 
ATOM   958  C  CG  . LEU A  1 125 ? -26.239 -35.937 -30.699 1.00   31.36  ? 125  LEU A CG  1 
ATOM   959  C  CD1 . LEU A  1 125 ? -25.472 -36.183 -29.383 1.00   16.97  ? 125  LEU A CD1 1 
ATOM   960  C  CD2 . LEU A  1 125 ? -26.924 -37.217 -31.206 1.00   19.16  ? 125  LEU A CD2 1 
ATOM   961  N  N   . HIS A  1 126 ? -30.257 -33.818 -30.877 1.00   26.58  ? 126  HIS A N   1 
ATOM   962  C  CA  . HIS A  1 126 ? -31.349 -32.994 -30.373 1.00   21.18  ? 126  HIS A CA  1 
ATOM   963  C  C   . HIS A  1 126 ? -30.865 -31.982 -29.287 1.00   31.27  ? 126  HIS A C   1 
ATOM   964  O  O   . HIS A  1 126 ? -31.292 -30.822 -29.259 1.00   32.13  ? 126  HIS A O   1 
ATOM   965  C  CB  . HIS A  1 126 ? -32.459 -33.933 -29.851 1.00   27.82  ? 126  HIS A CB  1 
ATOM   966  C  CG  . HIS A  1 126 ? -33.701 -33.232 -29.389 1.00   53.11  ? 126  HIS A CG  1 
ATOM   967  N  ND1 . HIS A  1 126 ? -34.332 -33.545 -28.202 1.00   61.22  ? 126  HIS A ND1 1 
ATOM   968  C  CD2 . HIS A  1 126 ? -34.433 -32.241 -29.955 1.00   62.54  ? 126  HIS A CD2 1 
ATOM   969  C  CE1 . HIS A  1 126 ? -35.396 -32.775 -28.055 1.00   66.98  ? 126  HIS A CE1 1 
ATOM   970  N  NE2 . HIS A  1 126 ? -35.480 -31.974 -29.103 1.00   68.04  ? 126  HIS A NE2 1 
ATOM   971  N  N   . VAL A  1 127 ? -29.963 -32.409 -28.408 1.00   22.21  ? 127  VAL A N   1 
ATOM   972  C  CA  . VAL A  1 127 ? -29.452 -31.515 -27.368 1.00   28.54  ? 127  VAL A CA  1 
ATOM   973  C  C   . VAL A  1 127 ? -28.437 -30.469 -27.860 1.00   28.37  ? 127  VAL A C   1 
ATOM   974  O  O   . VAL A  1 127 ? -27.971 -29.634 -27.073 1.00   27.35  ? 127  VAL A O   1 
ATOM   975  C  CB  . VAL A  1 127 ? -28.856 -32.294 -26.165 1.00   29.73  ? 127  VAL A CB  1 
ATOM   976  C  CG1 . VAL A  1 127 ? -29.947 -33.063 -25.462 1.00   26.34  ? 127  VAL A CG1 1 
ATOM   977  C  CG2 . VAL A  1 127 ? -27.712 -33.232 -26.615 1.00   15.97  ? 127  VAL A CG2 1 
ATOM   978  N  N   . TYR A  1 128 ? -28.092 -30.504 -29.145 1.00   29.07  ? 128  TYR A N   1 
ATOM   979  C  CA  . TYR A  1 128 ? -27.216 -29.463 -29.701 1.00   28.50  ? 128  TYR A CA  1 
ATOM   980  C  C   . TYR A  1 128 ? -27.958 -28.594 -30.724 1.00   27.78  ? 128  TYR A C   1 
ATOM   981  O  O   . TYR A  1 128 ? -27.332 -27.957 -31.574 1.00   23.92  ? 128  TYR A O   1 
ATOM   982  C  CB  . TYR A  1 128 ? -25.967 -30.052 -30.370 1.00   24.38  ? 128  TYR A CB  1 
ATOM   983  C  CG  . TYR A  1 128 ? -25.171 -31.082 -29.570 1.00   29.38  ? 128  TYR A CG  1 
ATOM   984  C  CD1 . TYR A  1 128 ? -25.084 -31.034 -28.174 1.00   24.85  ? 128  TYR A CD1 1 
ATOM   985  C  CD2 . TYR A  1 128 ? -24.488 -32.101 -30.226 1.00   23.43  ? 128  TYR A CD2 1 
ATOM   986  C  CE1 . TYR A  1 128 ? -24.343 -31.991 -27.465 1.00   16.99  ? 128  TYR A CE1 1 
ATOM   987  C  CE2 . TYR A  1 128 ? -23.754 -33.045 -29.535 1.00   17.06  ? 128  TYR A CE2 1 
ATOM   988  C  CZ  . TYR A  1 128 ? -23.679 -32.996 -28.165 1.00   18.59  ? 128  TYR A CZ  1 
ATOM   989  O  OH  . TYR A  1 128 ? -22.933 -33.963 -27.521 1.00   17.67  ? 128  TYR A OH  1 
ATOM   990  N  N   . ASP A  1 129 ? -29.288 -28.583 -30.655 1.00   22.86  ? 129  ASP A N   1 
ATOM   991  C  CA  . ASP A  1 129 ? -30.088 -27.795 -31.582 1.00   26.04  ? 129  ASP A CA  1 
ATOM   992  C  C   . ASP A  1 129 ? -29.945 -26.309 -31.250 1.00   32.86  ? 129  ASP A C   1 
ATOM   993  O  O   . ASP A  1 129 ? -30.365 -25.857 -30.182 1.00   31.87  ? 129  ASP A O   1 
ATOM   994  C  CB  . ASP A  1 129 ? -31.549 -28.213 -31.477 1.00   32.12  ? 129  ASP A CB  1 
ATOM   995  C  CG  . ASP A  1 129 ? -32.369 -27.810 -32.682 1.00   33.50  ? 129  ASP A CG  1 
ATOM   996  O  OD1 . ASP A  1 129 ? -31.906 -26.976 -33.488 1.00   36.21  ? 129  ASP A OD1 1 
ATOM   997  O  OD2 . ASP A  1 129 ? -33.497 -28.334 -32.811 1.00   35.68  ? 129  ASP A OD2 1 
ATOM   998  N  N   . GLY A  1 130 ? -29.363 -25.549 -32.174 1.00   29.68  ? 130  GLY A N   1 
ATOM   999  C  CA  . GLY A  1 130 ? -29.087 -24.147 -31.933 1.00   26.39  ? 130  GLY A CA  1 
ATOM   1000 C  C   . GLY A  1 130 ? -30.207 -23.157 -32.229 1.00   29.86  ? 130  GLY A C   1 
ATOM   1001 O  O   . GLY A  1 130 ? -30.016 -21.938 -32.083 1.00   24.68  ? 130  GLY A O   1 
ATOM   1002 N  N   . LYS A  1 131 ? -31.377 -23.656 -32.625 1.00   30.06  ? 131  LYS A N   1 
ATOM   1003 C  CA  . LYS A  1 131 ? -32.479 -22.755 -32.963 1.00   36.39  ? 131  LYS A CA  1 
ATOM   1004 C  C   . LYS A  1 131 ? -32.990 -21.901 -31.780 1.00   37.05  ? 131  LYS A C   1 
ATOM   1005 O  O   . LYS A  1 131 ? -33.396 -20.748 -31.971 1.00   38.32  ? 131  LYS A O   1 
ATOM   1006 C  CB  . LYS A  1 131 ? -33.627 -23.502 -33.648 1.00   37.44  ? 131  LYS A CB  1 
ATOM   1007 C  CG  . LYS A  1 131 ? -34.302 -24.555 -32.797 1.00   36.21  ? 131  LYS A CG  1 
ATOM   1008 C  CD  . LYS A  1 131 ? -35.455 -25.181 -33.556 1.00   31.34  ? 131  LYS A CD  1 
ATOM   1009 C  CE  . LYS A  1 131 ? -36.126 -26.266 -32.744 1.00   35.43  ? 131  LYS A CE  1 
ATOM   1010 N  NZ  . LYS A  1 131 ? -37.129 -27.043 -33.548 1.00   40.37  ? 131  LYS A NZ  1 
ATOM   1011 N  N   . PHE A  1 132 ? -32.944 -22.446 -30.567 1.00   29.24  ? 132  PHE A N   1 
ATOM   1012 C  CA  . PHE A  1 132 ? -33.423 -21.706 -29.401 1.00   30.50  ? 132  PHE A CA  1 
ATOM   1013 C  C   . PHE A  1 132 ? -32.542 -20.515 -29.087 1.00   33.06  ? 132  PHE A C   1 
ATOM   1014 O  O   . PHE A  1 132 ? -33.049 -19.418 -28.871 1.00   43.21  ? 132  PHE A O   1 
ATOM   1015 C  CB  . PHE A  1 132 ? -33.579 -22.616 -28.176 1.00   35.92  ? 132  PHE A CB  1 
ATOM   1016 C  CG  . PHE A  1 132 ? -34.477 -23.797 -28.423 1.00   40.58  ? 132  PHE A CG  1 
ATOM   1017 C  CD1 . PHE A  1 132 ? -35.828 -23.610 -28.687 1.00   40.78  ? 132  PHE A CD1 1 
ATOM   1018 C  CD2 . PHE A  1 132 ? -33.968 -25.090 -28.420 1.00   35.60  ? 132  PHE A CD2 1 
ATOM   1019 C  CE1 . PHE A  1 132 ? -36.658 -24.689 -28.934 1.00   42.73  ? 132  PHE A CE1 1 
ATOM   1020 C  CE2 . PHE A  1 132 ? -34.793 -26.172 -28.669 1.00   39.12  ? 132  PHE A CE2 1 
ATOM   1021 C  CZ  . PHE A  1 132 ? -36.141 -25.973 -28.923 1.00   42.54  ? 132  PHE A CZ  1 
ATOM   1022 N  N   . LEU A  1 133 ? -31.229 -20.731 -29.074 1.00   31.34  ? 133  LEU A N   1 
ATOM   1023 C  CA  . LEU A  1 133 ? -30.267 -19.662 -28.815 1.00   24.73  ? 133  LEU A CA  1 
ATOM   1024 C  C   . LEU A  1 133 ? -30.371 -18.536 -29.856 1.00   27.47  ? 133  LEU A C   1 
ATOM   1025 O  O   . LEU A  1 133 ? -30.289 -17.352 -29.521 1.00   34.10  ? 133  LEU A O   1 
ATOM   1026 C  CB  . LEU A  1 133 ? -28.841 -20.226 -28.770 1.00   27.72  ? 133  LEU A CB  1 
ATOM   1027 C  CG  . LEU A  1 133 ? -28.467 -20.950 -27.471 1.00   33.38  ? 133  LEU A CG  1 
ATOM   1028 C  CD1 . LEU A  1 133 ? -27.359 -21.973 -27.701 1.00   33.72  ? 133  LEU A CD1 1 
ATOM   1029 C  CD2 . LEU A  1 133 ? -28.074 -19.956 -26.375 1.00   28.18  ? 133  LEU A CD2 1 
ATOM   1030 N  N   . ALA A  1 134 ? -30.552 -18.908 -31.117 1.00   23.78  ? 134  ALA A N   1 
ATOM   1031 C  CA  . ALA A  1 134 ? -30.658 -17.923 -32.175 1.00   31.55  ? 134  ALA A CA  1 
ATOM   1032 C  C   . ALA A  1 134 ? -31.920 -17.091 -31.950 1.00   39.69  ? 134  ALA A C   1 
ATOM   1033 O  O   . ALA A  1 134 ? -31.874 -15.864 -31.962 1.00   37.49  ? 134  ALA A O   1 
ATOM   1034 C  CB  . ALA A  1 134 ? -30.674 -18.606 -33.547 1.00   22.74  ? 134  ALA A CB  1 
ATOM   1035 N  N   . ARG A  1 135 ? -33.037 -17.771 -31.710 1.00   39.19  ? 135  ARG A N   1 
ATOM   1036 C  CA  . ARG A  1 135 ? -34.310 -17.107 -31.466 1.00   40.32  ? 135  ARG A CA  1 
ATOM   1037 C  C   . ARG A  1 135 ? -34.276 -16.131 -30.291 1.00   43.55  ? 135  ARG A C   1 
ATOM   1038 O  O   . ARG A  1 135 ? -34.670 -14.969 -30.423 1.00   40.39  ? 135  ARG A O   1 
ATOM   1039 C  CB  . ARG A  1 135 ? -35.401 -18.148 -31.203 1.00   40.03  ? 135  ARG A CB  1 
ATOM   1040 C  CG  . ARG A  1 135 ? -36.765 -17.557 -30.841 1.00   38.24  ? 135  ARG A CG  1 
ATOM   1041 C  CD  . ARG A  1 135 ? -37.438 -16.939 -32.057 1.00   45.52  ? 135  ARG A CD  1 
ATOM   1042 N  NE  . ARG A  1 135 ? -38.758 -16.399 -31.735 1.00   50.46  ? 135  ARG A NE  1 
ATOM   1043 C  CZ  . ARG A  1 135 ? -38.966 -15.213 -31.168 1.00   48.73  ? 135  ARG A CZ  1 
ATOM   1044 N  NH1 . ARG A  1 135 ? -37.942 -14.426 -30.845 1.00   50.47  ? 135  ARG A NH1 1 
ATOM   1045 N  NH2 . ARG A  1 135 ? -40.201 -14.817 -30.912 1.00   45.21  ? 135  ARG A NH2 1 
ATOM   1046 N  N   . VAL A  1 136 ? -33.806 -16.622 -29.148 1.00   44.43  ? 136  VAL A N   1 
ATOM   1047 C  CA  . VAL A  1 136 ? -33.987 -15.957 -27.866 1.00   25.78  ? 136  VAL A CA  1 
ATOM   1048 C  C   . VAL A  1 136 ? -32.930 -14.895 -27.594 1.00   35.02  ? 136  VAL A C   1 
ATOM   1049 O  O   . VAL A  1 136 ? -33.220 -13.862 -26.997 1.00   33.24  ? 136  VAL A O   1 
ATOM   1050 C  CB  . VAL A  1 136 ? -33.995 -17.006 -26.729 1.00   32.38  ? 136  VAL A CB  1 
ATOM   1051 C  CG1 . VAL A  1 136 ? -34.003 -16.357 -25.346 1.00   29.07  ? 136  VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A  1 136 ? -35.179 -17.939 -26.891 1.00   29.51  ? 136  VAL A CG2 1 
ATOM   1053 N  N   . GLU A  1 137 ? -31.705 -15.138 -28.044 1.00   38.22  ? 137  GLU A N   1 
ATOM   1054 C  CA  . GLU A  1 137 ? -30.600 -14.218 -27.767 1.00   36.74  ? 137  GLU A CA  1 
ATOM   1055 C  C   . GLU A  1 137 ? -30.023 -13.534 -29.013 1.00   38.50  ? 137  GLU A C   1 
ATOM   1056 O  O   . GLU A  1 137 ? -29.108 -12.698 -28.910 1.00   41.03  ? 137  GLU A O   1 
ATOM   1057 C  CB  . GLU A  1 137 ? -29.491 -14.951 -27.012 1.00   27.75  ? 137  GLU A CB  1 
ATOM   1058 C  CG  . GLU A  1 137 ? -29.902 -15.368 -25.623 1.00   29.32  ? 137  GLU A CG  1 
ATOM   1059 C  CD  . GLU A  1 137 ? -30.087 -14.196 -24.652 1.00   41.52  ? 137  GLU A CD  1 
ATOM   1060 O  OE1 . GLU A  1 137 ? -29.807 -13.019 -25.007 1.00   35.70  ? 137  GLU A OE1 1 
ATOM   1061 O  OE2 . GLU A  1 137 ? -30.518 -14.468 -23.510 1.00   49.76  ? 137  GLU A OE2 1 
ATOM   1062 N  N   . ARG A  1 138 ? -30.549 -13.912 -30.178 1.00   26.02  ? 138  ARG A N   1 
ATOM   1063 C  CA  . ARG A  1 138 ? -30.155 -13.326 -31.453 1.00   27.01  ? 138  ARG A CA  1 
ATOM   1064 C  C   . ARG A  1 138 ? -28.665 -13.490 -31.779 1.00   31.62  ? 138  ARG A C   1 
ATOM   1065 O  O   . ARG A  1 138 ? -28.107 -12.755 -32.587 1.00   41.31  ? 138  ARG A O   1 
ATOM   1066 C  CB  . ARG A  1 138 ? -30.621 -11.865 -31.563 1.00   36.77  ? 138  ARG A CB  1 
ATOM   1067 C  CG  . ARG A  1 138 ? -32.124 -11.722 -31.805 1.00   46.68  ? 138  ARG A CG  1 
ATOM   1068 C  CD  . ARG A  1 138 ? -32.566 -10.262 -32.053 1.00   63.36  ? 138  ARG A CD  1 
ATOM   1069 N  NE  . ARG A  1 138 ? -32.028 -9.658  -33.280 1.00   71.70  ? 138  ARG A NE  1 
ATOM   1070 C  CZ  . ARG A  1 138 ? -32.476 -9.905  -34.514 1.00   75.16  ? 138  ARG A CZ  1 
ATOM   1071 N  NH1 . ARG A  1 138 ? -33.470 -10.771 -34.721 1.00   70.38  ? 138  ARG A NH1 1 
ATOM   1072 N  NH2 . ARG A  1 138 ? -31.916 -9.291  -35.552 1.00   75.73  ? 138  ARG A NH2 1 
ATOM   1073 N  N   . VAL A  1 139 ? -28.026 -14.465 -31.152 1.00   21.90  ? 139  VAL A N   1 
ATOM   1074 C  CA  . VAL A  1 139 ? -26.695 -14.873 -31.574 1.00   25.00  ? 139  VAL A CA  1 
ATOM   1075 C  C   . VAL A  1 139 ? -26.829 -15.884 -32.707 1.00   27.37  ? 139  VAL A C   1 
ATOM   1076 O  O   . VAL A  1 139 ? -27.880 -16.491 -32.887 1.00   32.01  ? 139  VAL A O   1 
ATOM   1077 C  CB  . VAL A  1 139 ? -25.914 -15.541 -30.434 1.00   27.69  ? 139  VAL A CB  1 
ATOM   1078 C  CG1 . VAL A  1 139 ? -25.700 -14.565 -29.301 1.00   19.00  ? 139  VAL A CG1 1 
ATOM   1079 C  CG2 . VAL A  1 139 ? -26.637 -16.812 -29.957 1.00   18.30  ? 139  VAL A CG2 1 
ATOM   1080 N  N   . ILE A  1 140 ? -25.760 -16.057 -33.472 1.00   26.53  ? 140  ILE A N   1 
ATOM   1081 C  CA  . ILE A  1 140 ? -25.713 -17.089 -34.499 1.00   24.29  ? 140  ILE A CA  1 
ATOM   1082 C  C   . ILE A  1 140 ? -24.971 -18.305 -33.951 1.00   30.05  ? 140  ILE A C   1 
ATOM   1083 O  O   . ILE A  1 140 ? -23.881 -18.178 -33.392 1.00   40.79  ? 140  ILE A O   1 
ATOM   1084 C  CB  . ILE A  1 140 ? -25.013 -16.560 -35.740 1.00   25.23  ? 140  ILE A CB  1 
ATOM   1085 C  CG1 . ILE A  1 140 ? -26.004 -15.733 -36.565 1.00   22.80  ? 140  ILE A CG1 1 
ATOM   1086 C  CG2 . ILE A  1 140 ? -24.392 -17.700 -36.549 1.00   20.24  ? 140  ILE A CG2 1 
ATOM   1087 C  CD1 . ILE A  1 140 ? -25.345 -14.797 -37.546 1.00   24.12  ? 140  ILE A CD1 1 
ATOM   1088 N  N   . VAL A  1 141 ? -25.580 -19.475 -34.080 1.00   27.88  ? 141  VAL A N   1 
ATOM   1089 C  CA  . VAL A  1 141 ? -24.981 -20.714 -33.587 1.00   26.69  ? 141  VAL A CA  1 
ATOM   1090 C  C   . VAL A  1 141 ? -24.440 -21.571 -34.736 1.00   26.80  ? 141  VAL A C   1 
ATOM   1091 O  O   . VAL A  1 141 ? -25.149 -21.855 -35.707 1.00   29.75  ? 141  VAL A O   1 
ATOM   1092 C  CB  . VAL A  1 141 ? -26.002 -21.542 -32.786 1.00   30.25  ? 141  VAL A CB  1 
ATOM   1093 C  CG1 . VAL A  1 141 ? -25.334 -22.750 -32.136 1.00   15.47  ? 141  VAL A CG1 1 
ATOM   1094 C  CG2 . VAL A  1 141 ? -26.690 -20.659 -31.745 1.00   33.73  ? 141  VAL A CG2 1 
ATOM   1095 N  N   . VAL A  1 142 ? -23.174 -21.960 -34.624 1.00   24.01  ? 142  VAL A N   1 
ATOM   1096 C  CA  . VAL A  1 142 ? -22.541 -22.858 -35.584 1.00   26.36  ? 142  VAL A CA  1 
ATOM   1097 C  C   . VAL A  1 142 ? -22.047 -24.118 -34.864 1.00   26.99  ? 142  VAL A C   1 
ATOM   1098 O  O   . VAL A  1 142 ? -21.582 -24.051 -33.709 1.00   23.19  ? 142  VAL A O   1 
ATOM   1099 C  CB  . VAL A  1 142 ? -21.345 -22.178 -36.284 1.00   30.23  ? 142  VAL A CB  1 
ATOM   1100 C  CG1 . VAL A  1 142 ? -20.583 -23.177 -37.165 1.00   28.16  ? 142  VAL A CG1 1 
ATOM   1101 C  CG2 . VAL A  1 142 ? -21.808 -20.962 -37.096 1.00   29.56  ? 142  VAL A CG2 1 
ATOM   1102 N  N   . SER A  1 143 ? -22.182 -25.268 -35.525 1.00   21.74  ? 143  SER A N   1 
ATOM   1103 C  CA  . SER A  1 143 ? -21.601 -26.511 -35.018 1.00   25.22  ? 143  SER A CA  1 
ATOM   1104 C  C   . SER A  1 143 ? -21.114 -27.324 -36.202 1.00   25.71  ? 143  SER A C   1 
ATOM   1105 O  O   . SER A  1 143 ? -21.699 -27.259 -37.285 1.00   25.90  ? 143  SER A O   1 
ATOM   1106 C  CB  . SER A  1 143 ? -22.609 -27.312 -34.191 1.00   14.52  ? 143  SER A CB  1 
ATOM   1107 O  OG  . SER A  1 143 ? -23.668 -27.786 -35.000 1.00   18.80  ? 143  SER A OG  1 
ATOM   1108 N  N   . MET A  1 144 ? -20.031 -28.067 -36.013 1.00   22.97  ? 144  MET A N   1 
ATOM   1109 C  CA  . MET A  1 144 ? -19.474 -28.857 -37.110 1.00   23.32  ? 144  MET A CA  1 
ATOM   1110 C  C   . MET A  1 144 ? -19.333 -30.327 -36.727 1.00   24.58  ? 144  MET A C   1 
ATOM   1111 O  O   . MET A  1 144 ? -19.233 -30.673 -35.545 1.00   26.46  ? 144  MET A O   1 
ATOM   1112 C  CB  . MET A  1 144 ? -18.098 -28.324 -37.529 1.00   18.89  ? 144  MET A CB  1 
ATOM   1113 C  CG  . MET A  1 144 ? -16.927 -28.849 -36.666 1.00   20.41  ? 144  MET A CG  1 
ATOM   1114 S  SD  . MET A  1 144 ? -16.883 -28.177 -34.979 1.00   22.21  ? 144  MET A SD  1 
ATOM   1115 C  CE  . MET A  1 144 ? -16.554 -26.459 -35.332 1.00   51.27  ? 144  MET A CE  1 
ATOM   1116 N  N   . ASN A  1 145 ? -19.321 -31.189 -37.736 1.00   21.50  ? 145  ASN A N   1 
ATOM   1117 C  CA  . ASN A  1 145 ? -18.869 -32.554 -37.539 1.00   22.28  ? 145  ASN A CA  1 
ATOM   1118 C  C   . ASN A  1 145 ? -17.365 -32.651 -37.790 1.00   28.12  ? 145  ASN A C   1 
ATOM   1119 O  O   . ASN A  1 145 ? -16.822 -32.009 -38.699 1.00   24.93  ? 145  ASN A O   1 
ATOM   1120 C  CB  . ASN A  1 145 ? -19.633 -33.515 -38.444 1.00   22.45  ? 145  ASN A CB  1 
ATOM   1121 C  CG  . ASN A  1 145 ? -21.024 -33.798 -37.937 1.00   21.60  ? 145  ASN A CG  1 
ATOM   1122 O  OD1 . ASN A  1 145 ? -21.318 -33.597 -36.761 1.00   24.72  ? 145  ASN A OD1 1 
ATOM   1123 N  ND2 . ASN A  1 145 ? -21.889 -34.272 -38.820 1.00   24.42  ? 145  ASN A ND2 1 
ATOM   1124 N  N   . TYR A  1 146 ? -16.683 -33.434 -36.968 1.00   16.69  ? 146  TYR A N   1 
ATOM   1125 C  CA  . TYR A  1 146 ? -15.258 -33.621 -37.171 1.00   30.92  ? 146  TYR A CA  1 
ATOM   1126 C  C   . TYR A  1 146 ? -14.948 -35.086 -36.926 1.00   26.03  ? 146  TYR A C   1 
ATOM   1127 O  O   . TYR A  1 146 ? -15.659 -35.737 -36.158 1.00   17.42  ? 146  TYR A O   1 
ATOM   1128 C  CB  . TYR A  1 146 ? -14.466 -32.736 -36.218 1.00   15.89  ? 146  TYR A CB  1 
ATOM   1129 C  CG  . TYR A  1 146 ? -14.679 -33.091 -34.767 1.00   38.41  ? 146  TYR A CG  1 
ATOM   1130 C  CD1 . TYR A  1 146 ? -15.724 -32.525 -34.039 1.00   34.61  ? 146  TYR A CD1 1 
ATOM   1131 C  CD2 . TYR A  1 146 ? -13.840 -33.994 -34.124 1.00   15.30  ? 146  TYR A CD2 1 
ATOM   1132 C  CE1 . TYR A  1 146 ? -15.930 -32.845 -32.706 1.00   13.93  ? 146  TYR A CE1 1 
ATOM   1133 C  CE2 . TYR A  1 146 ? -14.043 -34.328 -32.802 1.00   24.21  ? 146  TYR A CE2 1 
ATOM   1134 C  CZ  . TYR A  1 146 ? -15.085 -33.753 -32.096 1.00   24.48  ? 146  TYR A CZ  1 
ATOM   1135 O  OH  . TYR A  1 146 ? -15.270 -34.093 -30.776 1.00   13.67  ? 146  TYR A OH  1 
ATOM   1136 N  N   . ARG A  1 147 ? -13.894 -35.591 -37.564 1.00   22.19  ? 147  ARG A N   1 
ATOM   1137 C  CA  . ARG A  1 147 ? -13.540 -37.005 -37.478 1.00   19.40  ? 147  ARG A CA  1 
ATOM   1138 C  C   . ARG A  1 147 ? -13.142 -37.405 -36.071 1.00   25.78  ? 147  ARG A C   1 
ATOM   1139 O  O   . ARG A  1 147 ? -12.468 -36.663 -35.373 1.00   34.91  ? 147  ARG A O   1 
ATOM   1140 C  CB  . ARG A  1 147 ? -12.409 -37.344 -38.441 1.00   20.71  ? 147  ARG A CB  1 
ATOM   1141 C  CG  . ARG A  1 147 ? -12.827 -37.440 -39.884 1.00   21.86  ? 147  ARG A CG  1 
ATOM   1142 C  CD  . ARG A  1 147 ? -11.592 -37.531 -40.784 1.00   25.35  ? 147  ARG A CD  1 
ATOM   1143 N  NE  . ARG A  1 147 ? -10.995 -36.215 -40.999 1.00   27.53  ? 147  ARG A NE  1 
ATOM   1144 C  CZ  . ARG A  1 147 ? -9.861  -36.007 -41.662 1.00   33.63  ? 147  ARG A CZ  1 
ATOM   1145 N  NH1 . ARG A  1 147 ? -9.200  -37.044 -42.166 1.00   34.46  ? 147  ARG A NH1 1 
ATOM   1146 N  NH2 . ARG A  1 147 ? -9.385  -34.765 -41.816 1.00   32.75  ? 147  ARG A NH2 1 
ATOM   1147 N  N   . VAL A  1 148 ? -13.564 -38.595 -35.667 1.00   22.16  ? 148  VAL A N   1 
ATOM   1148 C  CA  . VAL A  1 148 ? -13.253 -39.125 -34.345 1.00   24.39  ? 148  VAL A CA  1 
ATOM   1149 C  C   . VAL A  1 148 ? -12.624 -40.517 -34.477 1.00   20.67  ? 148  VAL A C   1 
ATOM   1150 O  O   . VAL A  1 148 ? -12.509 -41.039 -35.582 1.00   26.40  ? 148  VAL A O   1 
ATOM   1151 C  CB  . VAL A  1 148 ? -14.521 -39.169 -33.473 1.00   25.64  ? 148  VAL A CB  1 
ATOM   1152 C  CG1 . VAL A  1 148 ? -14.980 -37.756 -33.182 1.00   21.13  ? 148  VAL A CG1 1 
ATOM   1153 C  CG2 . VAL A  1 148 ? -15.636 -39.965 -34.158 1.00   19.42  ? 148  VAL A CG2 1 
ATOM   1154 N  N   . GLY A  1 149 ? -12.208 -41.104 -33.361 1.00   20.80  ? 149  GLY A N   1 
ATOM   1155 C  CA  . GLY A  1 149 ? -11.502 -42.377 -33.377 1.00   22.45  ? 149  GLY A CA  1 
ATOM   1156 C  C   . GLY A  1 149 ? -10.232 -42.381 -34.216 1.00   30.80  ? 149  GLY A C   1 
ATOM   1157 O  O   . GLY A  1 149 ? -9.644  -41.323 -34.478 1.00   29.84  ? 149  GLY A O   1 
ATOM   1158 N  N   . ALA A  1 150 ? -9.797  -43.566 -34.642 1.00   28.96  ? 150  ALA A N   1 
ATOM   1159 C  CA  . ALA A  1 150 ? -8.589  -43.679 -35.457 1.00   28.58  ? 150  ALA A CA  1 
ATOM   1160 C  C   . ALA A  1 150 ? -8.674  -42.861 -36.744 1.00   32.28  ? 150  ALA A C   1 
ATOM   1161 O  O   . ALA A  1 150 ? -7.694  -42.232 -37.136 1.00   33.13  ? 150  ALA A O   1 
ATOM   1162 C  CB  . ALA A  1 150 ? -8.270  -45.126 -35.773 1.00   28.83  ? 150  ALA A CB  1 
ATOM   1163 N  N   . LEU A  1 151 ? -9.838  -42.851 -37.389 1.00   31.95  ? 151  LEU A N   1 
ATOM   1164 C  CA  . LEU A  1 151 ? -9.986  -42.105 -38.641 1.00   34.89  ? 151  LEU A CA  1 
ATOM   1165 C  C   . LEU A  1 151 ? -9.690  -40.621 -38.471 1.00   37.72  ? 151  LEU A C   1 
ATOM   1166 O  O   . LEU A  1 151 ? -9.424  -39.924 -39.449 1.00   37.67  ? 151  LEU A O   1 
ATOM   1167 C  CB  . LEU A  1 151 ? -11.384 -42.284 -39.230 1.00   36.72  ? 151  LEU A CB  1 
ATOM   1168 C  CG  . LEU A  1 151 ? -11.704 -43.690 -39.741 1.00   41.51  ? 151  LEU A CG  1 
ATOM   1169 C  CD1 . LEU A  1 151 ? -13.193 -43.839 -39.966 1.00   43.59  ? 151  LEU A CD1 1 
ATOM   1170 C  CD2 . LEU A  1 151 ? -10.929 -44.010 -41.012 1.00   30.92  ? 151  LEU A CD2 1 
ATOM   1171 N  N   . GLY A  1 152 ? -9.724  -40.151 -37.225 1.00   38.50  ? 152  GLY A N   1 
ATOM   1172 C  CA  . GLY A  1 152 ? -9.483  -38.755 -36.920 1.00   35.45  ? 152  GLY A CA  1 
ATOM   1173 C  C   . GLY A  1 152 ? -8.264  -38.469 -36.059 1.00   35.26  ? 152  GLY A C   1 
ATOM   1174 O  O   . GLY A  1 152 ? -7.827  -37.317 -35.967 1.00   39.62  ? 152  GLY A O   1 
ATOM   1175 N  N   . PHE A  1 153 ? -7.704  -39.491 -35.420 1.00   32.64  ? 153  PHE A N   1 
ATOM   1176 C  CA  . PHE A  1 153 ? -6.582  -39.250 -34.513 1.00   29.91  ? 153  PHE A CA  1 
ATOM   1177 C  C   . PHE A  1 153 ? -5.450  -40.280 -34.592 1.00   37.60  ? 153  PHE A C   1 
ATOM   1178 O  O   . PHE A  1 153 ? -4.530  -40.266 -33.749 1.00   24.73  ? 153  PHE A O   1 
ATOM   1179 C  CB  . PHE A  1 153 ? -7.073  -39.067 -33.068 1.00   23.49  ? 153  PHE A CB  1 
ATOM   1180 C  CG  . PHE A  1 153 ? -7.902  -37.821 -32.858 1.00   19.87  ? 153  PHE A CG  1 
ATOM   1181 C  CD1 . PHE A  1 153 ? -7.297  -36.616 -32.534 1.00   19.88  ? 153  PHE A CD1 1 
ATOM   1182 C  CD2 . PHE A  1 153 ? -9.293  -37.857 -32.990 1.00   21.11  ? 153  PHE A CD2 1 
ATOM   1183 C  CE1 . PHE A  1 153 ? -8.057  -35.456 -32.335 1.00   17.87  ? 153  PHE A CE1 1 
ATOM   1184 C  CE2 . PHE A  1 153 ? -10.067 -36.702 -32.796 1.00   18.62  ? 153  PHE A CE2 1 
ATOM   1185 C  CZ  . PHE A  1 153 ? -9.448  -35.499 -32.472 1.00   16.70  ? 153  PHE A CZ  1 
ATOM   1186 N  N   . LEU A  1 154 ? -5.511  -41.158 -35.596 1.00   36.46  ? 154  LEU A N   1 
ATOM   1187 C  CA  . LEU A  1 154 ? -4.406  -42.080 -35.863 1.00   44.00  ? 154  LEU A CA  1 
ATOM   1188 C  C   . LEU A  1 154 ? -3.117  -41.275 -36.027 1.00   47.75  ? 154  LEU A C   1 
ATOM   1189 O  O   . LEU A  1 154 ? -3.064  -40.322 -36.807 1.00   44.62  ? 154  LEU A O   1 
ATOM   1190 C  CB  . LEU A  1 154 ? -4.658  -42.882 -37.136 1.00   45.63  ? 154  LEU A CB  1 
ATOM   1191 C  CG  . LEU A  1 154 ? -3.641  -43.961 -37.525 1.00   41.15  ? 154  LEU A CG  1 
ATOM   1192 C  CD1 . LEU A  1 154 ? -4.052  -45.311 -36.951 1.00   36.51  ? 154  LEU A CD1 1 
ATOM   1193 C  CD2 . LEU A  1 154 ? -3.506  -44.049 -39.033 1.00   41.50  ? 154  LEU A CD2 1 
ATOM   1194 N  N   . ALA A  1 155 ? -2.081  -41.639 -35.283 1.00   47.09  ? 155  ALA A N   1 
ATOM   1195 C  CA  . ALA A  1 155 ? -0.865  -40.839 -35.314 1.00   48.71  ? 155  ALA A CA  1 
ATOM   1196 C  C   . ALA A  1 155 ? 0.413   -41.625 -35.612 1.00   49.48  ? 155  ALA A C   1 
ATOM   1197 O  O   . ALA A  1 155 ? 0.819   -42.518 -34.865 1.00   44.64  ? 155  ALA A O   1 
ATOM   1198 C  CB  . ALA A  1 155 ? -0.721  -40.013 -34.031 1.00   48.26  ? 155  ALA A CB  1 
ATOM   1199 N  N   . LEU A  1 156 ? 1.017   -41.284 -36.742 1.00   53.06  ? 156  LEU A N   1 
ATOM   1200 C  CA  . LEU A  1 156 ? 2.369   -41.685 -37.064 1.00   61.78  ? 156  LEU A CA  1 
ATOM   1201 C  C   . LEU A  1 156 ? 3.148   -40.374 -37.150 1.00   70.97  ? 156  LEU A C   1 
ATOM   1202 O  O   . LEU A  1 156 ? 3.342   -39.830 -38.242 1.00   74.31  ? 156  LEU A O   1 
ATOM   1203 C  CB  . LEU A  1 156 ? 2.388   -42.424 -38.398 1.00   60.10  ? 156  LEU A CB  1 
ATOM   1204 C  CG  . LEU A  1 156 ? 3.150   -43.747 -38.390 1.00   62.93  ? 156  LEU A CG  1 
ATOM   1205 C  CD1 . LEU A  1 156 ? 2.939   -44.476 -37.075 1.00   63.24  ? 156  LEU A CD1 1 
ATOM   1206 C  CD2 . LEU A  1 156 ? 2.703   -44.613 -39.548 1.00   61.96  ? 156  LEU A CD2 1 
ATOM   1207 N  N   . PRO A  1 157 ? 3.580   -39.855 -35.987 1.00   71.57  ? 157  PRO A N   1 
ATOM   1208 C  CA  . PRO A  1 157 ? 4.022   -38.460 -35.836 1.00   70.17  ? 157  PRO A CA  1 
ATOM   1209 C  C   . PRO A  1 157 ? 5.170   -38.084 -36.766 1.00   64.93  ? 157  PRO A C   1 
ATOM   1210 O  O   . PRO A  1 157 ? 6.150   -38.823 -36.897 1.00   62.00  ? 157  PRO A O   1 
ATOM   1211 C  CB  . PRO A  1 157 ? 4.439   -38.372 -34.362 1.00   73.75  ? 157  PRO A CB  1 
ATOM   1212 C  CG  . PRO A  1 157 ? 4.697   -39.785 -33.946 1.00   77.47  ? 157  PRO A CG  1 
ATOM   1213 C  CD  . PRO A  1 157 ? 3.768   -40.636 -34.752 1.00   75.15  ? 157  PRO A CD  1 
ATOM   1214 N  N   . GLY A  1 158 ? 5.022   -36.933 -37.414 1.00   57.77  ? 158  GLY A N   1 
ATOM   1215 C  CA  . GLY A  1 158 ? 5.958   -36.496 -38.430 1.00   52.11  ? 158  GLY A CA  1 
ATOM   1216 C  C   . GLY A  1 158 ? 5.398   -36.766 -39.806 1.00   55.38  ? 158  GLY A C   1 
ATOM   1217 O  O   . GLY A  1 158 ? 5.057   -35.837 -40.537 1.00   54.18  ? 158  GLY A O   1 
ATOM   1218 N  N   . ASN A  1 159 ? 5.304   -38.054 -40.132 1.00   62.42  ? 159  ASN A N   1 
ATOM   1219 C  CA  . ASN A  1 159 ? 4.710   -38.582 -41.366 1.00   61.17  ? 159  ASN A CA  1 
ATOM   1220 C  C   . ASN A  1 159 ? 3.348   -37.989 -41.699 1.00   59.95  ? 159  ASN A C   1 
ATOM   1221 O  O   . ASN A  1 159 ? 2.358   -38.315 -41.039 1.00   62.88  ? 159  ASN A O   1 
ATOM   1222 C  CB  . ASN A  1 159 ? 4.560   -40.099 -41.217 1.00   62.40  ? 159  ASN A CB  1 
ATOM   1223 C  CG  . ASN A  1 159 ? 4.124   -40.781 -42.494 1.00   61.11  ? 159  ASN A CG  1 
ATOM   1224 O  OD1 . ASN A  1 159 ? 3.473   -40.185 -43.351 1.00   53.98  ? 159  ASN A OD1 1 
ATOM   1225 N  ND2 . ASN A  1 159 ? 4.480   -42.055 -42.622 1.00   66.93  ? 159  ASN A ND2 1 
ATOM   1226 N  N   . PRO A  1 160 ? 3.283   -37.153 -42.754 1.00   55.80  ? 160  PRO A N   1 
ATOM   1227 C  CA  . PRO A  1 160 ? 2.049   -36.434 -43.109 1.00   49.98  ? 160  PRO A CA  1 
ATOM   1228 C  C   . PRO A  1 160 ? 0.935   -37.319 -43.668 1.00   45.51  ? 160  PRO A C   1 
ATOM   1229 O  O   . PRO A  1 160 ? -0.180  -36.837 -43.846 1.00   42.65  ? 160  PRO A O   1 
ATOM   1230 C  CB  . PRO A  1 160 ? 2.514   -35.406 -44.150 1.00   44.34  ? 160  PRO A CB  1 
ATOM   1231 C  CG  . PRO A  1 160 ? 3.775   -35.951 -44.692 1.00   44.40  ? 160  PRO A CG  1 
ATOM   1232 C  CD  . PRO A  1 160 ? 4.422   -36.744 -43.594 1.00   50.11  ? 160  PRO A CD  1 
ATOM   1233 N  N   . GLU A  1 161 ? 1.208   -38.592 -43.923 1.00   52.04  ? 161  GLU A N   1 
ATOM   1234 C  CA  . GLU A  1 161 ? 0.143   -39.494 -44.374 1.00   53.35  ? 161  GLU A CA  1 
ATOM   1235 C  C   . GLU A  1 161 ? -0.846  -39.784 -43.242 1.00   50.82  ? 161  GLU A C   1 
ATOM   1236 O  O   . GLU A  1 161 ? -2.005  -40.127 -43.478 1.00   50.48  ? 161  GLU A O   1 
ATOM   1237 C  CB  . GLU A  1 161 ? 0.717   -40.797 -44.951 1.00   55.38  ? 161  GLU A CB  1 
ATOM   1238 C  CG  . GLU A  1 161 ? 1.680   -40.612 -46.137 1.00   59.68  ? 161  GLU A CG  1 
ATOM   1239 C  CD  . GLU A  1 161 ? 1.045   -39.906 -47.335 1.00   66.20  ? 161  GLU A CD  1 
ATOM   1240 O  OE1 . GLU A  1 161 ? -0.195  -39.953 -47.485 1.00   69.27  ? 161  GLU A OE1 1 
ATOM   1241 O  OE2 . GLU A  1 161 ? 1.793   -39.300 -48.133 1.00   69.63  ? 161  GLU A OE2 1 
ATOM   1242 N  N   . ALA A  1 162 ? -0.375  -39.631 -42.010 1.00   51.83  ? 162  ALA A N   1 
ATOM   1243 C  CA  . ALA A  1 162 ? -1.201  -39.819 -40.822 1.00   50.72  ? 162  ALA A CA  1 
ATOM   1244 C  C   . ALA A  1 162 ? -0.505  -39.130 -39.657 1.00   44.41  ? 162  ALA A C   1 
ATOM   1245 O  O   . ALA A  1 162 ? 0.083   -39.793 -38.800 1.00   41.88  ? 162  ALA A O   1 
ATOM   1246 C  CB  . ALA A  1 162 ? -1.383  -41.297 -40.531 1.00   50.46  ? 162  ALA A CB  1 
ATOM   1247 N  N   . PRO A  1 163 ? -0.573  -37.792 -39.629 1.00   40.78  ? 163  PRO A N   1 
ATOM   1248 C  CA  . PRO A  1 163 ? 0.259   -36.952 -38.766 1.00   30.00  ? 163  PRO A CA  1 
ATOM   1249 C  C   . PRO A  1 163 ? -0.292  -36.772 -37.354 1.00   36.53  ? 163  PRO A C   1 
ATOM   1250 O  O   . PRO A  1 163 ? 0.411   -36.233 -36.497 1.00   43.02  ? 163  PRO A O   1 
ATOM   1251 C  CB  . PRO A  1 163 ? 0.239   -35.617 -39.501 1.00   29.61  ? 163  PRO A CB  1 
ATOM   1252 C  CG  . PRO A  1 163 ? -1.141  -35.545 -40.054 1.00   34.30  ? 163  PRO A CG  1 
ATOM   1253 C  CD  . PRO A  1 163 ? -1.475  -36.976 -40.464 1.00   42.78  ? 163  PRO A CD  1 
ATOM   1254 N  N   . GLY A  1 164 ? -1.525  -37.208 -37.118 1.00   31.03  ? 164  GLY A N   1 
ATOM   1255 C  CA  . GLY A  1 164 ? -2.178  -36.997 -35.839 1.00   26.71  ? 164  GLY A CA  1 
ATOM   1256 C  C   . GLY A  1 164 ? -3.077  -35.773 -35.848 1.00   28.47  ? 164  GLY A C   1 
ATOM   1257 O  O   . GLY A  1 164 ? -2.909  -34.880 -36.675 1.00   36.18  ? 164  GLY A O   1 
ATOM   1258 N  N   . ASN A  1 165 ? -4.047  -35.739 -34.941 1.00   28.87  ? 165  ASN A N   1 
ATOM   1259 C  CA  . ASN A  1 165 ? -4.857  -34.539 -34.700 1.00   20.27  ? 165  ASN A CA  1 
ATOM   1260 C  C   . ASN A  1 165 ? -5.754  -34.076 -35.850 1.00   23.24  ? 165  ASN A C   1 
ATOM   1261 O  O   . ASN A  1 165 ? -6.293  -32.976 -35.800 1.00   22.00  ? 165  ASN A O   1 
ATOM   1262 C  CB  . ASN A  1 165 ? -3.980  -33.379 -34.223 1.00   19.99  ? 165  ASN A CB  1 
ATOM   1263 C  CG  . ASN A  1 165 ? -3.381  -33.625 -32.845 1.00   32.20  ? 165  ASN A CG  1 
ATOM   1264 O  OD1 . ASN A  1 165 ? -3.950  -34.351 -32.026 1.00   28.24  ? 165  ASN A OD1 1 
ATOM   1265 N  ND2 . ASN A  1 165 ? -2.230  -33.013 -32.580 1.00   28.93  ? 165  ASN A ND2 1 
ATOM   1266 N  N   . MET A  1 166 ? -5.933  -34.915 -36.865 1.00   24.74  ? 166  MET A N   1 
ATOM   1267 C  CA  . MET A  1 166 ? -6.792  -34.578 -38.001 1.00   26.30  ? 166  MET A CA  1 
ATOM   1268 C  C   . MET A  1 166 ? -8.189  -34.036 -37.611 1.00   30.47  ? 166  MET A C   1 
ATOM   1269 O  O   . MET A  1 166 ? -8.652  -33.023 -38.152 1.00   23.69  ? 166  MET A O   1 
ATOM   1270 C  CB  . MET A  1 166 ? -6.926  -35.790 -38.913 1.00   25.62  ? 166  MET A CB  1 
ATOM   1271 C  CG  . MET A  1 166 ? -5.594  -36.279 -39.458 1.00   32.55  ? 166  MET A CG  1 
ATOM   1272 S  SD  . MET A  1 166 ? -4.673  -37.369 -38.343 1.00   42.49  ? 166  MET A SD  1 
ATOM   1273 C  CE  . MET A  1 166 ? -5.591  -38.911 -38.466 1.00   27.70  ? 166  MET A CE  1 
ATOM   1274 N  N   . GLY A  1 167 ? -8.847  -34.709 -36.670 1.00   27.27  ? 167  GLY A N   1 
ATOM   1275 C  CA  . GLY A  1 167 ? -10.112 -34.237 -36.139 1.00   27.84  ? 167  GLY A CA  1 
ATOM   1276 C  C   . GLY A  1 167 ? -10.058 -32.829 -35.548 1.00   32.01  ? 167  GLY A C   1 
ATOM   1277 O  O   . GLY A  1 167 ? -11.021 -32.064 -35.669 1.00   33.45  ? 167  GLY A O   1 
ATOM   1278 N  N   . LEU A  1 168 ? -8.948  -32.480 -34.898 1.00   27.17  ? 168  LEU A N   1 
ATOM   1279 C  CA  . LEU A  1 168 ? -8.767  -31.115 -34.411 1.00   27.86  ? 168  LEU A CA  1 
ATOM   1280 C  C   . LEU A  1 168 ? -8.602  -30.133 -35.572 1.00   34.68  ? 168  LEU A C   1 
ATOM   1281 O  O   . LEU A  1 168 ? -9.040  -28.976 -35.485 1.00   29.92  ? 168  LEU A O   1 
ATOM   1282 C  CB  . LEU A  1 168 ? -7.589  -31.013 -33.448 1.00   21.72  ? 168  LEU A CB  1 
ATOM   1283 C  CG  . LEU A  1 168 ? -7.891  -31.655 -32.099 1.00   26.28  ? 168  LEU A CG  1 
ATOM   1284 C  CD1 . LEU A  1 168 ? -6.595  -31.982 -31.353 1.00   15.76  ? 168  LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A  1 168 ? -8.807  -30.749 -31.278 1.00   13.94  ? 168  LEU A CD2 1 
ATOM   1286 N  N   . PHE A  1 169 ? -7.993  -30.597 -36.661 1.00   17.64  ? 169  PHE A N   1 
ATOM   1287 C  CA  . PHE A  1 169 ? -7.834  -29.748 -37.830 1.00   22.83  ? 169  PHE A CA  1 
ATOM   1288 C  C   . PHE A  1 169 ? -9.166  -29.581 -38.557 1.00   28.18  ? 169  PHE A C   1 
ATOM   1289 O  O   . PHE A  1 169 ? -9.433  -28.532 -39.151 1.00   30.64  ? 169  PHE A O   1 
ATOM   1290 C  CB  . PHE A  1 169 ? -6.745  -30.270 -38.761 1.00   24.48  ? 169  PHE A CB  1 
ATOM   1291 C  CG  . PHE A  1 169 ? -5.346  -29.888 -38.336 1.00   28.03  ? 169  PHE A CG  1 
ATOM   1292 C  CD1 . PHE A  1 169 ? -4.967  -28.551 -38.274 1.00   25.42  ? 169  PHE A CD1 1 
ATOM   1293 C  CD2 . PHE A  1 169 ? -4.407  -30.864 -38.017 1.00   26.33  ? 169  PHE A CD2 1 
ATOM   1294 C  CE1 . PHE A  1 169 ? -3.673  -28.186 -37.896 1.00   22.38  ? 169  PHE A CE1 1 
ATOM   1295 C  CE2 . PHE A  1 169 ? -3.121  -30.508 -37.628 1.00   30.68  ? 169  PHE A CE2 1 
ATOM   1296 C  CZ  . PHE A  1 169 ? -2.746  -29.168 -37.574 1.00   24.09  ? 169  PHE A CZ  1 
ATOM   1297 N  N   . ASP A  1 170 ? -10.009 -30.607 -38.487 1.00   27.56  ? 170  ASP A N   1 
ATOM   1298 C  CA  . ASP A  1 170 ? -11.362 -30.495 -39.011 1.00   26.40  ? 170  ASP A CA  1 
ATOM   1299 C  C   . ASP A  1 170 ? -12.060 -29.319 -38.317 1.00   28.73  ? 170  ASP A C   1 
ATOM   1300 O  O   . ASP A  1 170 ? -12.609 -28.422 -38.978 1.00   23.13  ? 170  ASP A O   1 
ATOM   1301 C  CB  . ASP A  1 170 ? -12.144 -31.795 -38.794 1.00   18.91  ? 170  ASP A CB  1 
ATOM   1302 C  CG  . ASP A  1 170 ? -11.598 -32.953 -39.609 1.00   27.37  ? 170  ASP A CG  1 
ATOM   1303 O  OD1 . ASP A  1 170 ? -11.128 -32.726 -40.744 1.00   34.87  ? 170  ASP A OD1 1 
ATOM   1304 O  OD2 . ASP A  1 170 ? -11.646 -34.101 -39.119 1.00   26.57  ? 170  ASP A OD2 1 
ATOM   1305 N  N   . GLN A  1 171 ? -12.025 -29.322 -36.984 1.00   25.07  ? 171  GLN A N   1 
ATOM   1306 C  CA  . GLN A  1 171 ? -12.585 -28.223 -36.207 1.00   23.51  ? 171  GLN A CA  1 
ATOM   1307 C  C   . GLN A  1 171 ? -11.954 -26.907 -36.658 1.00   31.59  ? 171  GLN A C   1 
ATOM   1308 O  O   . GLN A  1 171 ? -12.653 -25.906 -36.842 1.00   36.42  ? 171  GLN A O   1 
ATOM   1309 C  CB  . GLN A  1 171 ? -12.345 -28.430 -34.710 1.00   19.36  ? 171  GLN A CB  1 
ATOM   1310 C  CG  . GLN A  1 171 ? -12.835 -29.766 -34.168 1.00   21.35  ? 171  GLN A CG  1 
ATOM   1311 C  CD  . GLN A  1 171 ? -12.457 -29.992 -32.701 1.00   26.19  ? 171  GLN A CD  1 
ATOM   1312 O  OE1 . GLN A  1 171 ? -11.930 -29.088 -32.022 1.00   22.79  ? 171  GLN A OE1 1 
ATOM   1313 N  NE2 . GLN A  1 171 ? -12.719 -31.211 -32.206 1.00   21.50  ? 171  GLN A NE2 1 
ATOM   1314 N  N   . GLN A  1 172 ? -10.638 -26.911 -36.862 1.00   31.92  ? 172  GLN A N   1 
ATOM   1315 C  CA  . GLN A  1 172 ? -9.932  -25.669 -37.186 1.00   31.45  ? 172  GLN A CA  1 
ATOM   1316 C  C   . GLN A  1 172 ? -10.298 -25.116 -38.561 1.00   28.27  ? 172  GLN A C   1 
ATOM   1317 O  O   . GLN A  1 172 ? -10.431 -23.909 -38.750 1.00   24.60  ? 172  GLN A O   1 
ATOM   1318 C  CB  . GLN A  1 172 ? -8.421  -25.840 -37.094 1.00   29.02  ? 172  GLN A CB  1 
ATOM   1319 C  CG  . GLN A  1 172 ? -7.685  -24.542 -37.348 1.00   26.29  ? 172  GLN A CG  1 
ATOM   1320 C  CD  . GLN A  1 172 ? -6.194  -24.712 -37.290 1.00   27.32  ? 172  GLN A CD  1 
ATOM   1321 O  OE1 . GLN A  1 172 ? -5.568  -25.080 -38.282 1.00   27.80  ? 172  GLN A OE1 1 
ATOM   1322 N  NE2 . GLN A  1 172 ? -5.611  -24.459 -36.123 1.00   34.28  ? 172  GLN A NE2 1 
ATOM   1323 N  N   . LEU A  1 173 ? -10.466 -26.006 -39.522 1.00   31.62  ? 173  LEU A N   1 
ATOM   1324 C  CA  . LEU A  1 173 ? -10.888 -25.586 -40.842 1.00   34.24  ? 173  LEU A CA  1 
ATOM   1325 C  C   . LEU A  1 173 ? -12.310 -25.020 -40.788 1.00   36.83  ? 173  LEU A C   1 
ATOM   1326 O  O   . LEU A  1 173 ? -12.680 -24.175 -41.603 1.00   40.95  ? 173  LEU A O   1 
ATOM   1327 C  CB  . LEU A  1 173 ? -10.799 -26.762 -41.816 1.00   37.58  ? 173  LEU A CB  1 
ATOM   1328 C  CG  . LEU A  1 173 ? -11.065 -26.420 -43.277 1.00   40.92  ? 173  LEU A CG  1 
ATOM   1329 C  CD1 . LEU A  1 173 ? -10.142 -25.287 -43.747 1.00   22.83  ? 173  LEU A CD1 1 
ATOM   1330 C  CD2 . LEU A  1 173 ? -10.908 -27.665 -44.138 1.00   37.85  ? 173  LEU A CD2 1 
ATOM   1331 N  N   . ALA A  1 174 ? -13.103 -25.486 -39.823 1.00   32.65  ? 174  ALA A N   1 
ATOM   1332 C  CA  . ALA A  1 174 ? -14.468 -24.995 -39.666 1.00   27.93  ? 174  ALA A CA  1 
ATOM   1333 C  C   . ALA A  1 174 ? -14.509 -23.606 -39.035 1.00   28.28  ? 174  ALA A C   1 
ATOM   1334 O  O   . ALA A  1 174 ? -15.275 -22.745 -39.472 1.00   26.97  ? 174  ALA A O   1 
ATOM   1335 C  CB  . ALA A  1 174 ? -15.317 -25.983 -38.876 1.00   24.19  ? 174  ALA A CB  1 
ATOM   1336 N  N   . LEU A  1 175 ? -13.677 -23.380 -38.019 1.00   30.04  ? 175  LEU A N   1 
ATOM   1337 C  CA  . LEU A  1 175 ? -13.541 -22.041 -37.439 1.00   28.94  ? 175  LEU A CA  1 
ATOM   1338 C  C   . LEU A  1 175 ? -13.120 -21.052 -38.529 1.00   31.36  ? 175  LEU A C   1 
ATOM   1339 O  O   . LEU A  1 175 ? -13.562 -19.886 -38.561 1.00   30.26  ? 175  LEU A O   1 
ATOM   1340 C  CB  . LEU A  1 175 ? -12.506 -22.045 -36.322 1.00   24.80  ? 175  LEU A CB  1 
ATOM   1341 C  CG  . LEU A  1 175 ? -12.630 -23.121 -35.246 1.00   27.82  ? 175  LEU A CG  1 
ATOM   1342 C  CD1 . LEU A  1 175 ? -11.626 -22.854 -34.121 1.00   26.58  ? 175  LEU A CD1 1 
ATOM   1343 C  CD2 . LEU A  1 175 ? -14.056 -23.200 -34.714 1.00   30.39  ? 175  LEU A CD2 1 
ATOM   1344 N  N   . GLN A  1 176 ? -12.262 -21.548 -39.418 1.00   24.48  ? 176  GLN A N   1 
ATOM   1345 C  CA  . GLN A  1 176 ? -11.833 -20.827 -40.607 1.00   24.74  ? 176  GLN A CA  1 
ATOM   1346 C  C   . GLN A  1 176 ? -13.004 -20.478 -41.523 1.00   27.79  ? 176  GLN A C   1 
ATOM   1347 O  O   . GLN A  1 176 ? -13.104 -19.351 -42.006 1.00   27.17  ? 176  GLN A O   1 
ATOM   1348 C  CB  . GLN A  1 176 ? -10.804 -21.660 -41.377 1.00   32.11  ? 176  GLN A CB  1 
ATOM   1349 C  CG  . GLN A  1 176 ? -10.263 -21.001 -42.637 1.00   51.84  ? 176  GLN A CG  1 
ATOM   1350 C  CD  . GLN A  1 176 ? -9.259  -19.894 -42.342 1.00   69.32  ? 176  GLN A CD  1 
ATOM   1351 O  OE1 . GLN A  1 176 ? -9.410  -19.126 -41.387 1.00   71.76  ? 176  GLN A OE1 1 
ATOM   1352 N  NE2 . GLN A  1 176 ? -8.219  -19.814 -43.162 1.00   76.64  ? 176  GLN A NE2 1 
ATOM   1353 N  N   . TRP A  1 177 ? -13.880 -21.455 -41.765 1.00   27.45  ? 177  TRP A N   1 
ATOM   1354 C  CA  . TRP A  1 177 ? -15.055 -21.246 -42.597 1.00   24.19  ? 177  TRP A CA  1 
ATOM   1355 C  C   . TRP A  1 177 ? -15.915 -20.105 -42.035 1.00   26.25  ? 177  TRP A C   1 
ATOM   1356 O  O   . TRP A  1 177 ? -16.372 -19.226 -42.776 1.00   23.59  ? 177  TRP A O   1 
ATOM   1357 C  CB  . TRP A  1 177 ? -15.871 -22.534 -42.700 1.00   24.27  ? 177  TRP A CB  1 
ATOM   1358 C  CG  . TRP A  1 177 ? -17.055 -22.421 -43.648 1.00   31.68  ? 177  TRP A CG  1 
ATOM   1359 C  CD1 . TRP A  1 177 ? -17.087 -22.775 -44.976 1.00   27.24  ? 177  TRP A CD1 1 
ATOM   1360 C  CD2 . TRP A  1 177 ? -18.362 -21.917 -43.338 1.00   32.36  ? 177  TRP A CD2 1 
ATOM   1361 N  NE1 . TRP A  1 177 ? -18.327 -22.513 -45.506 1.00   28.28  ? 177  TRP A NE1 1 
ATOM   1362 C  CE2 . TRP A  1 177 ? -19.132 -21.992 -44.525 1.00   33.00  ? 177  TRP A CE2 1 
ATOM   1363 C  CE3 . TRP A  1 177 ? -18.958 -21.407 -42.177 1.00   33.01  ? 177  TRP A CE3 1 
ATOM   1364 C  CZ2 . TRP A  1 177 ? -20.471 -21.581 -44.582 1.00   38.65  ? 177  TRP A CZ2 1 
ATOM   1365 C  CZ3 . TRP A  1 177 ? -20.291 -20.997 -42.234 1.00   40.49  ? 177  TRP A CZ3 1 
ATOM   1366 C  CH2 . TRP A  1 177 ? -21.031 -21.087 -43.431 1.00   43.08  ? 177  TRP A CH2 1 
ATOM   1367 N  N   . VAL A  1 178 ? -16.117 -20.112 -40.721 1.00   23.57  ? 178  VAL A N   1 
ATOM   1368 C  CA  . VAL A  1 178 ? -16.834 -19.023 -40.068 1.00   24.13  ? 178  VAL A CA  1 
ATOM   1369 C  C   . VAL A  1 178 ? -16.135 -17.683 -40.315 1.00   31.55  ? 178  VAL A C   1 
ATOM   1370 O  O   . VAL A  1 178 ? -16.788 -16.704 -40.651 1.00   38.21  ? 178  VAL A O   1 
ATOM   1371 C  CB  . VAL A  1 178 ? -17.031 -19.286 -38.553 1.00   22.75  ? 178  VAL A CB  1 
ATOM   1372 C  CG1 . VAL A  1 178 ? -17.724 -18.104 -37.884 1.00   21.66  ? 178  VAL A CG1 1 
ATOM   1373 C  CG2 . VAL A  1 178 ? -17.823 -20.570 -38.337 1.00   20.93  ? 178  VAL A CG2 1 
ATOM   1374 N  N   . GLN A  1 179 ? -14.811 -17.649 -40.180 1.00   35.10  ? 179  GLN A N   1 
ATOM   1375 C  CA  . GLN A  1 179 ? -14.043 -16.426 -40.457 1.00   35.37  ? 179  GLN A CA  1 
ATOM   1376 C  C   . GLN A  1 179 ? -14.306 -15.824 -41.855 1.00   40.15  ? 179  GLN A C   1 
ATOM   1377 O  O   . GLN A  1 179 ? -14.533 -14.620 -41.996 1.00   42.54  ? 179  GLN A O   1 
ATOM   1378 C  CB  . GLN A  1 179 ? -12.538 -16.666 -40.256 1.00   30.84  ? 179  GLN A CB  1 
ATOM   1379 C  CG  . GLN A  1 179 ? -12.093 -16.689 -38.796 1.00   36.11  ? 179  GLN A CG  1 
ATOM   1380 C  CD  . GLN A  1 179 ? -12.479 -15.423 -38.042 1.00   37.62  ? 179  GLN A CD  1 
ATOM   1381 O  OE1 . GLN A  1 179 ? -11.967 -14.340 -38.324 1.00   47.01  ? 179  GLN A OE1 1 
ATOM   1382 N  NE2 . GLN A  1 179 ? -13.397 -15.553 -37.091 1.00   32.67  ? 179  GLN A NE2 1 
ATOM   1383 N  N   . LYS A  1 180 ? -14.290 -16.665 -42.880 1.00   40.76  ? 180  LYS A N   1 
ATOM   1384 C  CA  . LYS A  1 180 ? -14.476 -16.195 -44.246 1.00   46.19  ? 180  LYS A CA  1 
ATOM   1385 C  C   . LYS A  1 180 ? -15.940 -16.102 -44.695 1.00   49.14  ? 180  LYS A C   1 
ATOM   1386 O  O   . LYS A  1 180 ? -16.227 -15.492 -45.729 1.00   52.71  ? 180  LYS A O   1 
ATOM   1387 C  CB  . LYS A  1 180 ? -13.720 -17.102 -45.220 1.00   45.33  ? 180  LYS A CB  1 
ATOM   1388 C  CG  . LYS A  1 180 ? -12.241 -17.221 -44.941 1.00   50.66  ? 180  LYS A CG  1 
ATOM   1389 C  CD  . LYS A  1 180 ? -11.595 -18.146 -45.955 1.00   57.74  ? 180  LYS A CD  1 
ATOM   1390 C  CE  . LYS A  1 180 ? -10.246 -18.659 -45.480 1.00   59.53  ? 180  LYS A CE  1 
ATOM   1391 N  NZ  . LYS A  1 180 ? -9.708  -19.699 -46.404 1.00   64.41  ? 180  LYS A NZ  1 
ATOM   1392 N  N   . ASN A  1 181 ? -16.866 -16.704 -43.949 1.00   37.85  ? 181  ASN A N   1 
ATOM   1393 C  CA  . ASN A  1 181 ? -18.234 -16.795 -44.466 1.00   36.19  ? 181  ASN A CA  1 
ATOM   1394 C  C   . ASN A  1 181 ? -19.348 -16.219 -43.617 1.00   29.73  ? 181  ASN A C   1 
ATOM   1395 O  O   . ASN A  1 181 ? -20.401 -15.875 -44.145 1.00   28.41  ? 181  ASN A O   1 
ATOM   1396 C  CB  . ASN A  1 181 ? -18.591 -18.236 -44.841 1.00   38.41  ? 181  ASN A CB  1 
ATOM   1397 C  CG  . ASN A  1 181 ? -17.694 -18.787 -45.911 1.00   37.23  ? 181  ASN A CG  1 
ATOM   1398 O  OD1 . ASN A  1 181 ? -17.787 -18.396 -47.072 1.00   40.95  ? 181  ASN A OD1 1 
ATOM   1399 N  ND2 . ASN A  1 181 ? -16.808 -19.697 -45.529 1.00   32.41  ? 181  ASN A ND2 1 
ATOM   1400 N  N   . ILE A  1 182 ? -19.128 -16.114 -42.316 1.00   24.61  ? 182  ILE A N   1 
ATOM   1401 C  CA  . ILE A  1 182 ? -20.223 -15.786 -41.415 1.00   24.21  ? 182  ILE A CA  1 
ATOM   1402 C  C   . ILE A  1 182 ? -20.807 -14.373 -41.596 1.00   33.39  ? 182  ILE A C   1 
ATOM   1403 O  O   . ILE A  1 182 ? -21.962 -14.127 -41.234 1.00   32.33  ? 182  ILE A O   1 
ATOM   1404 C  CB  . ILE A  1 182 ? -19.842 -16.032 -39.944 1.00   24.31  ? 182  ILE A CB  1 
ATOM   1405 C  CG1 . ILE A  1 182 ? -21.040 -16.605 -39.174 1.00   29.65  ? 182  ILE A CG1 1 
ATOM   1406 C  CG2 . ILE A  1 182 ? -19.285 -14.758 -39.307 1.00   28.50  ? 182  ILE A CG2 1 
ATOM   1407 C  CD1 . ILE A  1 182 ? -21.624 -17.870 -39.804 1.00   22.90  ? 182  ILE A CD1 1 
ATOM   1408 N  N   . ALA A  1 183 ? -20.024 -13.453 -42.157 1.00   35.18  ? 183  ALA A N   1 
ATOM   1409 C  CA  . ALA A  1 183 ? -20.514 -12.092 -42.361 1.00   37.58  ? 183  ALA A CA  1 
ATOM   1410 C  C   . ALA A  1 183 ? -21.632 -12.086 -43.391 1.00   34.59  ? 183  ALA A C   1 
ATOM   1411 O  O   . ALA A  1 183 ? -22.526 -11.239 -43.342 1.00   32.69  ? 183  ALA A O   1 
ATOM   1412 C  CB  . ALA A  1 183 ? -19.381 -11.143 -42.771 1.00   29.90  ? 183  ALA A CB  1 
ATOM   1413 N  N   . ALA A  1 184 ? -21.591 -13.044 -44.310 1.00   30.62  ? 184  ALA A N   1 
ATOM   1414 C  CA  . ALA A  1 184 ? -22.637 -13.162 -45.324 1.00   34.87  ? 184  ALA A CA  1 
ATOM   1415 C  C   . ALA A  1 184 ? -23.964 -13.626 -44.718 1.00   39.60  ? 184  ALA A C   1 
ATOM   1416 O  O   . ALA A  1 184 ? -25.030 -13.399 -45.294 1.00   45.42  ? 184  ALA A O   1 
ATOM   1417 C  CB  . ALA A  1 184 ? -22.201 -14.103 -46.427 1.00   32.62  ? 184  ALA A CB  1 
ATOM   1418 N  N   . PHE A  1 185 ? -23.876 -14.284 -43.561 1.00   37.82  ? 185  PHE A N   1 
ATOM   1419 C  CA  . PHE A  1 185 ? -25.030 -14.736 -42.782 1.00   35.05  ? 185  PHE A CA  1 
ATOM   1420 C  C   . PHE A  1 185 ? -25.363 -13.735 -41.674 1.00   39.04  ? 185  PHE A C   1 
ATOM   1421 O  O   . PHE A  1 185 ? -26.144 -14.038 -40.773 1.00   38.05  ? 185  PHE A O   1 
ATOM   1422 C  CB  . PHE A  1 185 ? -24.726 -16.081 -42.120 1.00   31.40  ? 185  PHE A CB  1 
ATOM   1423 C  CG  . PHE A  1 185 ? -24.526 -17.205 -43.084 1.00   35.25  ? 185  PHE A CG  1 
ATOM   1424 C  CD1 . PHE A  1 185 ? -23.313 -17.369 -43.739 1.00   35.79  ? 185  PHE A CD1 1 
ATOM   1425 C  CD2 . PHE A  1 185 ? -25.553 -18.118 -43.328 1.00   38.86  ? 185  PHE A CD2 1 
ATOM   1426 C  CE1 . PHE A  1 185 ? -23.128 -18.422 -44.638 1.00   38.16  ? 185  PHE A CE1 1 
ATOM   1427 C  CE2 . PHE A  1 185 ? -25.378 -19.168 -44.220 1.00   38.43  ? 185  PHE A CE2 1 
ATOM   1428 C  CZ  . PHE A  1 185 ? -24.165 -19.322 -44.879 1.00   37.80  ? 185  PHE A CZ  1 
ATOM   1429 N  N   . GLY A  1 186 ? -24.746 -12.557 -41.724 1.00   38.87  ? 186  GLY A N   1 
ATOM   1430 C  CA  . GLY A  1 186 ? -24.999 -11.524 -40.737 1.00   38.97  ? 186  GLY A CA  1 
ATOM   1431 C  C   . GLY A  1 186 ? -24.213 -11.699 -39.452 1.00   41.01  ? 186  GLY A C   1 
ATOM   1432 O  O   . GLY A  1 186 ? -24.556 -11.117 -38.412 1.00   43.91  ? 186  GLY A O   1 
ATOM   1433 N  N   . GLY A  1 187 ? -23.150 -12.496 -39.519 1.00   34.45  ? 187  GLY A N   1 
ATOM   1434 C  CA  . GLY A  1 187 ? -22.350 -12.776 -38.341 1.00   28.32  ? 187  GLY A CA  1 
ATOM   1435 C  C   . GLY A  1 187 ? -21.149 -11.862 -38.240 1.00   27.44  ? 187  GLY A C   1 
ATOM   1436 O  O   . GLY A  1 187 ? -20.686 -11.328 -39.238 1.00   33.27  ? 187  GLY A O   1 
ATOM   1437 N  N   . ASN A  1 188 ? -20.652 -11.678 -37.023 1.00   32.47  ? 188  ASN A N   1 
ATOM   1438 C  CA  . ASN A  1 188 ? -19.443 -10.898 -36.772 1.00   34.62  ? 188  ASN A CA  1 
ATOM   1439 C  C   . ASN A  1 188 ? -18.227 -11.804 -36.504 1.00   33.85  ? 188  ASN A C   1 
ATOM   1440 O  O   . ASN A  1 188 ? -18.063 -12.330 -35.394 1.00   25.61  ? 188  ASN A O   1 
ATOM   1441 C  CB  . ASN A  1 188 ? -19.681 -9.978  -35.577 1.00   34.08  ? 188  ASN A CB  1 
ATOM   1442 C  CG  . ASN A  1 188 ? -18.520 -9.040  -35.316 1.00   34.21  ? 188  ASN A CG  1 
ATOM   1443 O  OD1 . ASN A  1 188 ? -17.565 -8.963  -36.096 1.00   35.84  ? 188  ASN A OD1 1 
ATOM   1444 N  ND2 . ASN A  1 188 ? -18.604 -8.307  -34.213 1.00   27.00  ? 188  ASN A ND2 1 
ATOM   1445 N  N   . PRO A  1 189 ? -17.360 -11.977 -37.519 1.00   34.70  ? 189  PRO A N   1 
ATOM   1446 C  CA  . PRO A  1 189 ? -16.179 -12.843 -37.394 1.00   34.62  ? 189  PRO A CA  1 
ATOM   1447 C  C   . PRO A  1 189 ? -15.254 -12.391 -36.251 1.00   38.09  ? 189  PRO A C   1 
ATOM   1448 O  O   . PRO A  1 189 ? -14.461 -13.200 -35.744 1.00   31.25  ? 189  PRO A O   1 
ATOM   1449 C  CB  . PRO A  1 189 ? -15.473 -12.665 -38.738 1.00   23.54  ? 189  PRO A CB  1 
ATOM   1450 C  CG  . PRO A  1 189 ? -15.885 -11.311 -39.190 1.00   25.06  ? 189  PRO A CG  1 
ATOM   1451 C  CD  . PRO A  1 189 ? -17.311 -11.157 -38.742 1.00   30.95  ? 189  PRO A CD  1 
ATOM   1452 N  N   . LYS A  1 190 ? -15.363 -11.121 -35.852 1.00   34.00  ? 190  LYS A N   1 
ATOM   1453 C  CA  . LYS A  1 190 ? -14.584 -10.608 -34.727 1.00   32.37  ? 190  LYS A CA  1 
ATOM   1454 C  C   . LYS A  1 190 ? -15.222 -10.921 -33.370 1.00   32.24  ? 190  LYS A C   1 
ATOM   1455 O  O   . LYS A  1 190 ? -14.664 -10.590 -32.324 1.00   34.58  ? 190  LYS A O   1 
ATOM   1456 C  CB  . LYS A  1 190 ? -14.318 -9.111  -34.871 1.00   34.49  ? 190  LYS A CB  1 
ATOM   1457 C  CG  . LYS A  1 190 ? -13.402 -8.777  -36.039 1.00   46.55  ? 190  LYS A CG  1 
ATOM   1458 C  CD  . LYS A  1 190 ? -13.203 -7.282  -36.201 1.00   56.32  ? 190  LYS A CD  1 
ATOM   1459 C  CE  . LYS A  1 190 ? -12.318 -6.978  -37.406 1.00   66.38  ? 190  LYS A CE  1 
ATOM   1460 N  NZ  . LYS A  1 190 ? -12.095 -5.507  -37.599 1.00   72.09  ? 190  LYS A NZ  1 
ATOM   1461 N  N   . SER A  1 191 ? -16.381 -11.570 -33.381 1.00   24.79  ? 191  SER A N   1 
ATOM   1462 C  CA  . SER A  1 191 ? -17.028 -11.925 -32.129 1.00   19.67  ? 191  SER A CA  1 
ATOM   1463 C  C   . SER A  1 191 ? -17.501 -13.364 -32.171 1.00   21.08  ? 191  SER A C   1 
ATOM   1464 O  O   . SER A  1 191 ? -18.702 -13.642 -32.273 1.00   30.40  ? 191  SER A O   1 
ATOM   1465 C  CB  . SER A  1 191 ? -18.197 -10.980 -31.803 1.00   22.07  ? 191  SER A CB  1 
ATOM   1466 O  OG  . SER A  1 191 ? -18.668 -11.185 -30.473 1.00   19.02  ? 191  SER A OG  1 
ATOM   1467 N  N   . VAL A  1 192 ? -16.541 -14.270 -32.055 1.00   19.40  ? 192  VAL A N   1 
ATOM   1468 C  CA  . VAL A  1 192 ? -16.792 -15.699 -32.111 1.00   21.14  ? 192  VAL A CA  1 
ATOM   1469 C  C   . VAL A  1 192 ? -16.405 -16.333 -30.782 1.00   21.86  ? 192  VAL A C   1 
ATOM   1470 O  O   . VAL A  1 192 ? -15.282 -16.158 -30.294 1.00   28.63  ? 192  VAL A O   1 
ATOM   1471 C  CB  . VAL A  1 192 ? -15.985 -16.367 -33.259 1.00   23.72  ? 192  VAL A CB  1 
ATOM   1472 C  CG1 . VAL A  1 192 ? -16.252 -17.853 -33.295 1.00   14.89  ? 192  VAL A CG1 1 
ATOM   1473 C  CG2 . VAL A  1 192 ? -16.324 -15.727 -34.612 1.00   17.19  ? 192  VAL A CG2 1 
ATOM   1474 N  N   . THR A  1 193 ? -17.338 -17.060 -30.185 1.00   18.59  ? 193  THR A N   1 
ATOM   1475 C  CA  . THR A  1 193 ? -17.050 -17.771 -28.948 1.00   20.65  ? 193  THR A CA  1 
ATOM   1476 C  C   . THR A  1 193 ? -17.139 -19.268 -29.179 1.00   21.11  ? 193  THR A C   1 
ATOM   1477 O  O   . THR A  1 193 ? -18.185 -19.763 -29.577 1.00   22.53  ? 193  THR A O   1 
ATOM   1478 C  CB  . THR A  1 193 ? -18.046 -17.400 -27.851 1.00   18.67  ? 193  THR A CB  1 
ATOM   1479 O  OG1 . THR A  1 193 ? -17.888 -16.018 -27.504 1.00   24.24  ? 193  THR A OG1 1 
ATOM   1480 C  CG2 . THR A  1 193 ? -17.828 -18.254 -26.619 1.00   11.79  ? 193  THR A CG2 1 
ATOM   1481 N  N   . LEU A  1 194 ? -16.044 -19.987 -28.944 1.00   19.88  ? 194  LEU A N   1 
ATOM   1482 C  CA  . LEU A  1 194 ? -16.078 -21.443 -28.996 1.00   21.00  ? 194  LEU A CA  1 
ATOM   1483 C  C   . LEU A  1 194 ? -16.702 -21.901 -27.702 1.00   25.01  ? 194  LEU A C   1 
ATOM   1484 O  O   . LEU A  1 194 ? -16.387 -21.349 -26.630 1.00   18.07  ? 194  LEU A O   1 
ATOM   1485 C  CB  . LEU A  1 194 ? -14.661 -22.044 -29.114 1.00   17.15  ? 194  LEU A CB  1 
ATOM   1486 C  CG  . LEU A  1 194 ? -13.784 -21.481 -30.244 1.00   20.56  ? 194  LEU A CG  1 
ATOM   1487 C  CD1 . LEU A  1 194 ? -12.415 -22.153 -30.315 1.00   11.68  ? 194  LEU A CD1 1 
ATOM   1488 C  CD2 . LEU A  1 194 ? -14.527 -21.558 -31.592 1.00   20.36  ? 194  LEU A CD2 1 
ATOM   1489 N  N   . PHE A  1 195 ? -17.596 -22.888 -27.802 1.00   21.22  ? 195  PHE A N   1 
ATOM   1490 C  CA  . PHE A  1 195 ? -18.040 -23.634 -26.632 1.00   19.16  ? 195  PHE A CA  1 
ATOM   1491 C  C   . PHE A  1 195 ? -18.205 -25.110 -26.955 1.00   24.98  ? 195  PHE A C   1 
ATOM   1492 O  O   . PHE A  1 195 ? -18.476 -25.468 -28.098 1.00   24.52  ? 195  PHE A O   1 
ATOM   1493 C  CB  . PHE A  1 195 ? -19.293 -23.022 -25.959 1.00   20.83  ? 195  PHE A CB  1 
ATOM   1494 C  CG  . PHE A  1 195 ? -20.589 -23.159 -26.746 1.00   19.39  ? 195  PHE A CG  1 
ATOM   1495 C  CD1 . PHE A  1 195 ? -20.624 -23.028 -28.127 1.00   23.74  ? 195  PHE A CD1 1 
ATOM   1496 C  CD2 . PHE A  1 195 ? -21.786 -23.388 -26.074 1.00   15.22  ? 195  PHE A CD2 1 
ATOM   1497 C  CE1 . PHE A  1 195 ? -21.828 -23.135 -28.829 1.00   23.33  ? 195  PHE A CE1 1 
ATOM   1498 C  CE2 . PHE A  1 195 ? -22.985 -23.504 -26.761 1.00   23.42  ? 195  PHE A CE2 1 
ATOM   1499 C  CZ  . PHE A  1 195 ? -23.010 -23.376 -28.149 1.00   20.17  ? 195  PHE A CZ  1 
ATOM   1500 N  N   . GLY A  1 196 ? -18.009 -25.955 -25.940 1.00   24.82  ? 196  GLY A N   1 
ATOM   1501 C  CA  . GLY A  1 196 ? -18.019 -27.397 -26.097 1.00   17.53  ? 196  GLY A CA  1 
ATOM   1502 C  C   . GLY A  1 196 ? -18.060 -28.125 -24.766 1.00   21.65  ? 196  GLY A C   1 
ATOM   1503 O  O   . GLY A  1 196 ? -17.874 -27.517 -23.713 1.00   22.17  ? 196  GLY A O   1 
ATOM   1504 N  N   . GLU A  1 197 ? -18.315 -29.430 -24.807 1.00   21.49  ? 197  GLU A N   1 
ATOM   1505 C  CA  . GLU A  1 197 ? -18.475 -30.212 -23.583 1.00   19.36  ? 197  GLU A CA  1 
ATOM   1506 C  C   . GLU A  1 197 ? -17.668 -31.528 -23.621 1.00   21.78  ? 197  GLU A C   1 
ATOM   1507 O  O   . GLU A  1 197 ? -17.585 -32.172 -24.669 1.00   24.67  ? 197  GLU A O   1 
ATOM   1508 C  CB  . GLU A  1 197 ? -19.972 -30.461 -23.337 1.00   17.88  ? 197  GLU A CB  1 
ATOM   1509 C  CG  . GLU A  1 197 ? -20.340 -31.125 -22.008 1.00   19.19  ? 197  GLU A CG  1 
ATOM   1510 C  CD  . GLU A  1 197 ? -20.294 -32.647 -22.080 1.00   28.32  ? 197  GLU A CD  1 
ATOM   1511 O  OE1 . GLU A  1 197 ? -20.086 -33.188 -23.196 1.00   31.91  ? 197  GLU A OE1 1 
ATOM   1512 O  OE2 . GLU A  1 197 ? -20.466 -33.297 -21.020 1.00   23.50  ? 197  GLU A OE2 1 
ATOM   1513 N  N   . SER A  1 198 ? -17.078 -31.919 -22.484 1.00   18.64  ? 198  SER A N   1 
ATOM   1514 C  CA  . SER A  1 198 ? -16.225 -33.137 -22.405 1.00   20.58  ? 198  SER A CA  1 
ATOM   1515 C  C   . SER A  1 198 ? -15.036 -33.001 -23.387 1.00   16.76  ? 198  SER A C   1 
ATOM   1516 O  O   . SER A  1 198 ? -14.277 -32.032 -23.317 1.00   22.00  ? 198  SER A O   1 
ATOM   1517 C  CB  . SER A  1 198 ? -17.137 -34.509 -22.386 1.00   12.11  ? 198  SER A CB  1 
ATOM   1518 O  OG  . SER A  1 198 ? -16.610 -36.099 -22.371 1.00   40.29  ? 198  SER A OG  1 
ATOM   1519 N  N   . ALA A  1 199 ? -14.887 -33.955 -24.300 1.00   16.59  ? 199  ALA A N   1 
ATOM   1520 C  CA  . ALA A  1 199 ? -13.847 -33.880 -25.318 1.00   24.05  ? 199  ALA A CA  1 
ATOM   1521 C  C   . ALA A  1 199 ? -13.994 -32.612 -26.160 1.00   26.60  ? 199  ALA A C   1 
ATOM   1522 O  O   . ALA A  1 199 ? -13.002 -32.088 -26.697 1.00   21.10  ? 199  ALA A O   1 
ATOM   1523 C  CB  . ALA A  1 199 ? -13.858 -35.132 -26.212 1.00   16.55  ? 199  ALA A CB  1 
ATOM   1524 N  N   . GLY A  1 200 ? -15.231 -32.127 -26.269 1.00   25.64  ? 200  GLY A N   1 
ATOM   1525 C  CA  . GLY A  1 200 ? -15.490 -30.861 -26.932 1.00   22.48  ? 200  GLY A CA  1 
ATOM   1526 C  C   . GLY A  1 200 ? -14.818 -29.743 -26.157 1.00   20.19  ? 200  GLY A C   1 
ATOM   1527 O  O   . GLY A  1 200 ? -14.086 -28.935 -26.728 1.00   20.56  ? 200  GLY A O   1 
ATOM   1528 N  N   . ALA A  1 201 ? -15.053 -29.718 -24.846 1.00   18.65  ? 201  ALA A N   1 
ATOM   1529 C  CA  . ALA A  1 201 ? -14.422 -28.742 -23.961 1.00   20.59  ? 201  ALA A CA  1 
ATOM   1530 C  C   . ALA A  1 201 ? -12.894 -28.878 -23.976 1.00   26.88  ? 201  ALA A C   1 
ATOM   1531 O  O   . ALA A  1 201 ? -12.166 -27.877 -24.069 1.00   21.22  ? 201  ALA A O   1 
ATOM   1532 C  CB  . ALA A  1 201 ? -14.975 -28.875 -22.543 1.00   13.24  ? 201  ALA A CB  1 
ATOM   1533 N  N   . ALA A  1 202 ? -12.400 -30.112 -23.903 1.00   18.92  ? 202  ALA A N   1 
ATOM   1534 C  CA  . ALA A  1 202 ? -10.961 -30.313 -24.066 1.00   21.69  ? 202  ALA A CA  1 
ATOM   1535 C  C   . ALA A  1 202 ? -10.487 -29.845 -25.450 1.00   22.63  ? 202  ALA A C   1 
ATOM   1536 O  O   . ALA A  1 202 ? -9.370  -29.348 -25.594 1.00   24.79  ? 202  ALA A O   1 
ATOM   1537 C  CB  . ALA A  1 202 ? -10.561 -31.765 -23.814 1.00   11.63  ? 202  ALA A CB  1 
ATOM   1538 N  N   . SER A  1 203 ? -11.330 -29.980 -26.469 1.00   17.22  ? 203  SER A N   1 
ATOM   1539 C  CA  . SER A  1 203 ? -10.943 -29.469 -27.770 1.00   13.11  ? 203  SER A CA  1 
ATOM   1540 C  C   . SER A  1 203 ? -10.799 -27.952 -27.717 1.00   21.01  ? 203  SER A C   1 
ATOM   1541 O  O   . SER A  1 203 ? -9.807  -27.389 -28.211 1.00   20.17  ? 203  SER A O   1 
ATOM   1542 C  CB  . SER A  1 203 ? -11.920 -29.893 -28.856 1.00   16.10  ? 203  SER A CB  1 
ATOM   1543 O  OG  . SER A  1 203 ? -11.852 -31.302 -29.056 1.00   24.97  ? 203  SER A OG  1 
ATOM   1544 N  N   . VAL A  1 204 ? -11.770 -27.298 -27.087 1.00   19.42  ? 204  VAL A N   1 
ATOM   1545 C  CA  . VAL A  1 204 ? -11.769 -25.846 -26.995 1.00   23.57  ? 204  VAL A CA  1 
ATOM   1546 C  C   . VAL A  1 204 ? -10.482 -25.406 -26.326 1.00   24.04  ? 204  VAL A C   1 
ATOM   1547 O  O   . VAL A  1 204 ? -9.763  -24.543 -26.834 1.00   18.82  ? 204  VAL A O   1 
ATOM   1548 C  CB  . VAL A  1 204 ? -12.982 -25.321 -26.188 1.00   27.99  ? 204  VAL A CB  1 
ATOM   1549 C  CG1 . VAL A  1 204 ? -12.706 -23.917 -25.638 1.00   19.87  ? 204  VAL A CG1 1 
ATOM   1550 C  CG2 . VAL A  1 204 ? -14.247 -25.336 -27.045 1.00   26.10  ? 204  VAL A CG2 1 
ATOM   1551 N  N   . SER A  1 205 ? -10.176 -26.037 -25.199 1.00   26.58  ? 205  SER A N   1 
ATOM   1552 C  CA  . SER A  1 205 ? -8.948  -25.735 -24.481 1.00   26.17  ? 205  SER A CA  1 
ATOM   1553 C  C   . SER A  1 205 ? -7.715  -25.877 -25.374 1.00   22.28  ? 205  SER A C   1 
ATOM   1554 O  O   . SER A  1 205 ? -6.788  -25.074 -25.261 1.00   18.41  ? 205  SER A O   1 
ATOM   1555 C  CB  . SER A  1 205 ? -8.809  -26.617 -23.239 1.00   24.97  ? 205  SER A CB  1 
ATOM   1556 O  OG  . SER A  1 205 ? -8.663  -27.974 -23.615 1.00   23.95  ? 205  SER A OG  1 
ATOM   1557 N  N   . LEU A  1 206 ? -7.702  -26.878 -26.261 1.00   19.69  ? 206  LEU A N   1 
ATOM   1558 C  CA  . LEU A  1 206 ? -6.553  -27.061 -27.161 1.00   18.57  ? 206  LEU A CA  1 
ATOM   1559 C  C   . LEU A  1 206 ? -6.447  -25.963 -28.222 1.00   22.94  ? 206  LEU A C   1 
ATOM   1560 O  O   . LEU A  1 206 ? -5.338  -25.569 -28.598 1.00   23.00  ? 206  LEU A O   1 
ATOM   1561 C  CB  . LEU A  1 206 ? -6.537  -28.449 -27.800 1.00   19.86  ? 206  LEU A CB  1 
ATOM   1562 C  CG  . LEU A  1 206 ? -6.172  -29.609 -26.850 1.00   21.73  ? 206  LEU A CG  1 
ATOM   1563 C  CD1 . LEU A  1 206 ? -6.500  -30.952 -27.488 1.00   20.05  ? 206  LEU A CD1 1 
ATOM   1564 C  CD2 . LEU A  1 206 ? -4.707  -29.569 -26.454 1.00   15.27  ? 206  LEU A CD2 1 
ATOM   1565 N  N   . HIS A  1 207 ? -7.591  -25.449 -28.676 1.00   14.44  ? 207  HIS A N   1 
ATOM   1566 C  CA  . HIS A  1 207 ? -7.597  -24.312 -29.590 1.00   17.59  ? 207  HIS A CA  1 
ATOM   1567 C  C   . HIS A  1 207 ? -6.997  -23.050 -28.938 1.00   25.88  ? 207  HIS A C   1 
ATOM   1568 O  O   . HIS A  1 207 ? -6.434  -22.185 -29.617 1.00   30.46  ? 207  HIS A O   1 
ATOM   1569 C  CB  . HIS A  1 207 ? -9.017  -24.043 -30.101 1.00   12.34  ? 207  HIS A CB  1 
ATOM   1570 C  CG  . HIS A  1 207 ? -9.490  -25.040 -31.108 1.00   18.27  ? 207  HIS A CG  1 
ATOM   1571 N  ND1 . HIS A  1 207 ? -8.952  -25.126 -32.376 1.00   14.74  ? 207  HIS A ND1 1 
ATOM   1572 C  CD2 . HIS A  1 207 ? -10.435 -26.006 -31.034 1.00   23.28  ? 207  HIS A CD2 1 
ATOM   1573 C  CE1 . HIS A  1 207 ? -9.547  -26.103 -33.037 1.00   14.19  ? 207  HIS A CE1 1 
ATOM   1574 N  NE2 . HIS A  1 207 ? -10.451 -26.653 -32.245 1.00   19.73  ? 207  HIS A NE2 1 
ATOM   1575 N  N   . LEU A  1 208 ? -7.136  -22.954 -27.619 1.00   17.43  ? 208  LEU A N   1 
ATOM   1576 C  CA  . LEU A  1 208 ? -6.488  -21.913 -26.850 1.00   19.80  ? 208  LEU A CA  1 
ATOM   1577 C  C   . LEU A  1 208 ? -4.963  -22.031 -26.930 1.00   28.27  ? 208  LEU A C   1 
ATOM   1578 O  O   . LEU A  1 208 ? -4.256  -21.032 -26.794 1.00   29.26  ? 208  LEU A O   1 
ATOM   1579 C  CB  . LEU A  1 208 ? -6.938  -21.963 -25.383 1.00   19.57  ? 208  LEU A CB  1 
ATOM   1580 C  CG  . LEU A  1 208 ? -8.330  -21.408 -25.057 1.00   28.40  ? 208  LEU A CG  1 
ATOM   1581 C  CD1 . LEU A  1 208 ? -8.632  -21.544 -23.564 1.00   30.20  ? 208  LEU A CD1 1 
ATOM   1582 C  CD2 . LEU A  1 208 ? -8.464  -19.946 -25.506 1.00   24.43  ? 208  LEU A CD2 1 
ATOM   1583 N  N   . LEU A  1 209 ? -4.447  -23.242 -27.139 1.00   24.50  ? 209  LEU A N   1 
ATOM   1584 C  CA  . LEU A  1 209 ? -3.000  -23.402 -27.159 1.00   22.06  ? 209  LEU A CA  1 
ATOM   1585 C  C   . LEU A  1 209 ? -2.444  -23.420 -28.571 1.00   23.86  ? 209  LEU A C   1 
ATOM   1586 O  O   . LEU A  1 209 ? -1.250  -23.211 -28.772 1.00   28.95  ? 209  LEU A O   1 
ATOM   1587 C  CB  . LEU A  1 209 ? -2.555  -24.667 -26.414 1.00   23.00  ? 209  LEU A CB  1 
ATOM   1588 C  CG  . LEU A  1 209 ? -3.032  -24.891 -24.976 1.00   21.29  ? 209  LEU A CG  1 
ATOM   1589 C  CD1 . LEU A  1 209 ? -2.182  -25.911 -24.268 1.00   21.66  ? 209  LEU A CD1 1 
ATOM   1590 C  CD2 . LEU A  1 209 ? -3.050  -23.625 -24.193 1.00   14.70  ? 209  LEU A CD2 1 
ATOM   1591 N  N   . SER A  1 210 ? -3.302  -23.683 -29.547 1.00   15.63  ? 210  SER A N   1 
ATOM   1592 C  CA  . SER A  1 210 ? -2.832  -23.863 -30.913 1.00   26.94  ? 210  SER A CA  1 
ATOM   1593 C  C   . SER A  1 210 ? -2.705  -22.538 -31.656 1.00   32.94  ? 210  SER A C   1 
ATOM   1594 O  O   . SER A  1 210 ? -3.699  -21.859 -31.897 1.00   34.59  ? 210  SER A O   1 
ATOM   1595 C  CB  . SER A  1 210 ? -3.759  -24.806 -31.674 1.00   24.86  ? 210  SER A CB  1 
ATOM   1596 O  OG  . SER A  1 210 ? -3.150  -25.235 -32.876 1.00   27.20  ? 210  SER A OG  1 
ATOM   1597 N  N   . PRO A  1 211 ? -1.474  -22.170 -32.032 1.00   46.32  ? 211  PRO A N   1 
ATOM   1598 C  CA  . PRO A  1 211 ? -1.222  -20.891 -32.712 1.00   47.81  ? 211  PRO A CA  1 
ATOM   1599 C  C   . PRO A  1 211 ? -2.075  -20.715 -33.969 1.00   41.38  ? 211  PRO A C   1 
ATOM   1600 O  O   . PRO A  1 211 ? -2.498  -19.594 -34.265 1.00   46.86  ? 211  PRO A O   1 
ATOM   1601 C  CB  . PRO A  1 211 ? 0.266   -20.975 -33.067 1.00   45.48  ? 211  PRO A CB  1 
ATOM   1602 C  CG  . PRO A  1 211 ? 0.832   -21.845 -32.004 1.00   49.90  ? 211  PRO A CG  1 
ATOM   1603 C  CD  . PRO A  1 211 ? -0.226  -22.914 -31.799 1.00   49.81  ? 211  PRO A CD  1 
ATOM   1604 N  N   . GLY A  1 212 ? -2.351  -21.808 -34.673 1.00   33.34  ? 212  GLY A N   1 
ATOM   1605 C  CA  . GLY A  1 212 ? -3.214  -21.768 -35.837 1.00   19.84  ? 212  GLY A CA  1 
ATOM   1606 C  C   . GLY A  1 212 ? -4.665  -21.445 -35.507 1.00   27.15  ? 212  GLY A C   1 
ATOM   1607 O  O   . GLY A  1 212 ? -5.447  -21.106 -36.392 1.00   22.83  ? 212  GLY A O   1 
ATOM   1608 N  N   . SER A  1 213 ? -5.040  -21.556 -34.235 1.00   26.51  ? 213  SER A N   1 
ATOM   1609 C  CA  . SER A  1 213 ? -6.399  -21.220 -33.830 1.00   27.35  ? 213  SER A CA  1 
ATOM   1610 C  C   . SER A  1 213 ? -6.539  -19.815 -33.239 1.00   29.38  ? 213  SER A C   1 
ATOM   1611 O  O   . SER A  1 213 ? -7.650  -19.291 -33.151 1.00   39.35  ? 213  SER A O   1 
ATOM   1612 C  CB  . SER A  1 213 ? -6.940  -22.260 -32.845 1.00   21.70  ? 213  SER A CB  1 
ATOM   1613 O  OG  . SER A  1 213 ? -7.135  -23.498 -33.509 1.00   27.17  ? 213  SER A OG  1 
ATOM   1614 N  N   . HIS A  1 214 ? -5.424  -19.205 -32.851 1.00   20.08  ? 214  HIS A N   1 
ATOM   1615 C  CA  A HIS A  1 214 ? -5.419  -17.920 -32.131 0.54   25.21  ? 214  HIS A CA  1 
ATOM   1616 C  CA  B HIS A  1 214 ? -5.500  -17.963 -32.098 0.46   25.47  ? 214  HIS A CA  1 
ATOM   1617 C  C   . HIS A  1 214 ? -6.313  -16.857 -32.778 1.00   28.76  ? 214  HIS A C   1 
ATOM   1618 O  O   . HIS A  1 214 ? -7.087  -16.168 -32.109 1.00   31.31  ? 214  HIS A O   1 
ATOM   1619 C  CB  A HIS A  1 214 ? -3.975  -17.388 -31.998 0.54   23.15  ? 214  HIS A CB  1 
ATOM   1620 C  CB  B HIS A  1 214 ? -4.107  -17.495 -31.662 0.46   24.83  ? 214  HIS A CB  1 
ATOM   1621 C  CG  A HIS A  1 214 ? -3.862  -16.066 -31.293 0.54   24.60  ? 214  HIS A CG  1 
ATOM   1622 C  CG  B HIS A  1 214 ? -3.526  -18.330 -30.563 0.46   27.71  ? 214  HIS A CG  1 
ATOM   1623 N  ND1 A HIS A  1 214 ? -4.098  -14.859 -31.919 0.54   29.04  ? 214  HIS A ND1 1 
ATOM   1624 N  ND1 B HIS A  1 214 ? -2.357  -18.002 -29.909 0.46   22.62  ? 214  HIS A ND1 1 
ATOM   1625 C  CD2 A HIS A  1 214 ? -3.498  -15.761 -30.023 0.54   25.25  ? 214  HIS A CD2 1 
ATOM   1626 C  CD2 B HIS A  1 214 ? -3.966  -19.482 -30.000 0.46   16.21  ? 214  HIS A CD2 1 
ATOM   1627 C  CE1 A HIS A  1 214 ? -3.904  -13.871 -31.063 0.54   28.13  ? 214  HIS A CE1 1 
ATOM   1628 C  CE1 B HIS A  1 214 ? -2.099  -18.917 -28.992 0.46   19.47  ? 214  HIS A CE1 1 
ATOM   1629 N  NE2 A HIS A  1 214 ? -3.533  -14.390 -29.906 0.54   19.15  ? 214  HIS A NE2 1 
ATOM   1630 N  NE2 B HIS A  1 214 ? -3.059  -19.826 -29.028 0.46   24.75  ? 214  HIS A NE2 1 
ATOM   1631 N  N   . SER A  1 215 ? -6.191  -16.717 -34.092 1.00   25.36  ? 215  SER A N   1 
ATOM   1632 C  CA  . SER A  1 215 ? -6.884  -15.635 -34.782 1.00   25.26  ? 215  SER A CA  1 
ATOM   1633 C  C   . SER A  1 215 ? -8.295  -16.010 -35.221 1.00   28.24  ? 215  SER A C   1 
ATOM   1634 O  O   . SER A  1 215 ? -8.989  -15.192 -35.828 1.00   32.18  ? 215  SER A O   1 
ATOM   1635 C  CB  . SER A  1 215 ? -6.084  -15.179 -36.003 1.00   25.80  ? 215  SER A CB  1 
ATOM   1636 O  OG  . SER A  1 215 ? -6.450  -15.952 -37.142 1.00   36.52  ? 215  SER A OG  1 
ATOM   1637 N  N   . LEU A  1 216 ? -8.707  -17.241 -34.915 1.00   24.05  ? 216  LEU A N   1 
ATOM   1638 C  CA  . LEU A  1 216 ? -9.959  -17.809 -35.421 1.00   18.85  ? 216  LEU A CA  1 
ATOM   1639 C  C   . LEU A  1 216 ? -11.132 -17.685 -34.451 1.00   20.36  ? 216  LEU A C   1 
ATOM   1640 O  O   . LEU A  1 216 ? -12.256 -18.093 -34.774 1.00   23.90  ? 216  LEU A O   1 
ATOM   1641 C  CB  . LEU A  1 216 ? -9.748  -19.278 -35.796 1.00   24.89  ? 216  LEU A CB  1 
ATOM   1642 C  CG  . LEU A  1 216 ? -9.372  -19.624 -37.244 1.00   26.71  ? 216  LEU A CG  1 
ATOM   1643 C  CD1 . LEU A  1 216 ? -8.395  -18.629 -37.820 1.00   19.40  ? 216  LEU A CD1 1 
ATOM   1644 C  CD2 . LEU A  1 216 ? -8.788  -21.012 -37.298 1.00   22.20  ? 216  LEU A CD2 1 
ATOM   1645 N  N   . PHE A  1 217 ? -10.874 -17.136 -33.266 1.00   15.76  ? 217  PHE A N   1 
ATOM   1646 C  CA  . PHE A  1 217 ? -11.926 -16.931 -32.268 1.00   17.59  ? 217  PHE A CA  1 
ATOM   1647 C  C   . PHE A  1 217 ? -11.556 -15.871 -31.234 1.00   19.91  ? 217  PHE A C   1 
ATOM   1648 O  O   . PHE A  1 217 ? -10.450 -15.354 -31.236 1.00   33.44  ? 217  PHE A O   1 
ATOM   1649 C  CB  . PHE A  1 217 ? -12.358 -18.247 -31.591 1.00   15.61  ? 217  PHE A CB  1 
ATOM   1650 C  CG  . PHE A  1 217 ? -11.331 -18.843 -30.662 1.00   16.00  ? 217  PHE A CG  1 
ATOM   1651 C  CD1 . PHE A  1 217 ? -10.195 -19.477 -31.164 1.00   18.98  ? 217  PHE A CD1 1 
ATOM   1652 C  CD2 . PHE A  1 217 ? -11.521 -18.805 -29.287 1.00   18.76  ? 217  PHE A CD2 1 
ATOM   1653 C  CE1 . PHE A  1 217 ? -9.257  -20.049 -30.304 1.00   23.59  ? 217  PHE A CE1 1 
ATOM   1654 C  CE2 . PHE A  1 217 ? -10.588 -19.357 -28.422 1.00   20.08  ? 217  PHE A CE2 1 
ATOM   1655 C  CZ  . PHE A  1 217 ? -9.452  -19.987 -28.930 1.00   24.59  ? 217  PHE A CZ  1 
ATOM   1656 N  N   . THR A  1 218 ? -12.501 -15.538 -30.368 1.00   20.93  ? 218  THR A N   1 
ATOM   1657 C  CA  . THR A  1 218 ? -12.325 -14.452 -29.422 1.00   26.44  ? 218  THR A CA  1 
ATOM   1658 C  C   . THR A  1 218 ? -12.276 -14.980 -27.988 1.00   24.58  ? 218  THR A C   1 
ATOM   1659 O  O   . THR A  1 218 ? -11.332 -14.700 -27.238 1.00   17.20  ? 218  THR A O   1 
ATOM   1660 C  CB  . THR A  1 218 ? -13.507 -13.498 -29.533 1.00   34.49  ? 218  THR A CB  1 
ATOM   1661 O  OG1 . THR A  1 218 ? -13.776 -13.245 -30.919 1.00   36.44  ? 218  THR A OG1 1 
ATOM   1662 C  CG2 . THR A  1 218 ? -13.234 -12.187 -28.772 1.00   30.22  ? 218  THR A CG2 1 
ATOM   1663 N  N   . ARG A  1 219 ? -13.301 -15.751 -27.628 1.00   14.63  ? 219  ARG A N   1 
ATOM   1664 C  CA  . ARG A  1 219 ? -13.468 -16.258 -26.277 1.00   17.86  ? 219  ARG A CA  1 
ATOM   1665 C  C   . ARG A  1 219 ? -13.800 -17.749 -26.249 1.00   21.20  ? 219  ARG A C   1 
ATOM   1666 O  O   . ARG A  1 219 ? -14.017 -18.383 -27.294 1.00   22.72  ? 219  ARG A O   1 
ATOM   1667 C  CB  . ARG A  1 219 ? -14.587 -15.495 -25.573 1.00   21.57  ? 219  ARG A CB  1 
ATOM   1668 C  CG  . ARG A  1 219 ? -14.112 -14.279 -24.837 1.00   31.44  ? 219  ARG A CG  1 
ATOM   1669 C  CD  . ARG A  1 219 ? -15.260 -13.583 -24.153 1.00   30.77  ? 219  ARG A CD  1 
ATOM   1670 N  NE  . ARG A  1 219 ? -16.134 -12.918 -25.107 1.00   33.28  ? 219  ARG A NE  1 
ATOM   1671 C  CZ  . ARG A  1 219 ? -15.912 -11.702 -25.599 1.00   32.52  ? 219  ARG A CZ  1 
ATOM   1672 N  NH1 . ARG A  1 219 ? -14.833 -11.018 -25.233 1.00   16.39  ? 219  ARG A NH1 1 
ATOM   1673 N  NH2 . ARG A  1 219 ? -16.771 -11.173 -26.459 1.00   25.50  ? 219  ARG A NH2 1 
ATOM   1674 N  N   . ALA A  1 220 ? -13.881 -18.294 -25.042 1.00   14.89  ? 220  ALA A N   1 
ATOM   1675 C  CA  . ALA A  1 220 ? -13.983 -19.738 -24.876 1.00   17.89  ? 220  ALA A CA  1 
ATOM   1676 C  C   . ALA A  1 220 ? -14.780 -20.146 -23.633 1.00   22.49  ? 220  ALA A C   1 
ATOM   1677 O  O   . ALA A  1 220 ? -14.666 -19.540 -22.563 1.00   24.33  ? 220  ALA A O   1 
ATOM   1678 C  CB  . ALA A  1 220 ? -12.581 -20.369 -24.859 1.00   13.15  ? 220  ALA A CB  1 
ATOM   1679 N  N   . ILE A  1 221 ? -15.597 -21.175 -23.812 1.00   17.22  ? 221  ILE A N   1 
ATOM   1680 C  CA  . ILE A  1 221 ? -16.441 -21.738 -22.770 1.00   15.51  ? 221  ILE A CA  1 
ATOM   1681 C  C   . ILE A  1 221 ? -16.128 -23.242 -22.714 1.00   18.28  ? 221  ILE A C   1 
ATOM   1682 O  O   . ILE A  1 221 ? -16.217 -23.938 -23.740 1.00   14.11  ? 221  ILE A O   1 
ATOM   1683 C  CB  . ILE A  1 221 ? -17.945 -21.540 -23.126 1.00   16.88  ? 221  ILE A CB  1 
ATOM   1684 C  CG1 . ILE A  1 221 ? -18.329 -20.061 -23.113 1.00   19.65  ? 221  ILE A CG1 1 
ATOM   1685 C  CG2 . ILE A  1 221 ? -18.862 -22.345 -22.195 1.00   14.61  ? 221  ILE A CG2 1 
ATOM   1686 C  CD1 . ILE A  1 221 ? -19.770 -19.781 -23.611 1.00   11.02  ? 221  ILE A CD1 1 
ATOM   1687 N  N   . LEU A  1 222 ? -15.758 -23.749 -21.541 1.00   17.77  ? 222  LEU A N   1 
ATOM   1688 C  CA  . LEU A  1 222 ? -15.367 -25.162 -21.421 1.00   19.23  ? 222  LEU A CA  1 
ATOM   1689 C  C   . LEU A  1 222 ? -16.279 -25.904 -20.451 1.00   21.30  ? 222  LEU A C   1 
ATOM   1690 O  O   . LEU A  1 222 ? -16.156 -25.762 -19.230 1.00   16.24  ? 222  LEU A O   1 
ATOM   1691 C  CB  . LEU A  1 222 ? -13.912 -25.304 -20.957 1.00   21.64  ? 222  LEU A CB  1 
ATOM   1692 C  CG  . LEU A  1 222 ? -12.730 -24.882 -21.848 1.00   22.22  ? 222  LEU A CG  1 
ATOM   1693 C  CD1 . LEU A  1 222 ? -12.793 -23.418 -22.205 1.00   18.98  ? 222  LEU A CD1 1 
ATOM   1694 C  CD2 . LEU A  1 222 ? -11.401 -25.178 -21.148 1.00   20.63  ? 222  LEU A CD2 1 
ATOM   1695 N  N   . GLN A  1 223 ? -17.190 -26.709 -20.987 1.00   20.57  ? 223  GLN A N   1 
ATOM   1696 C  CA  . GLN A  1 223 ? -18.102 -27.474 -20.138 1.00   18.70  ? 223  GLN A CA  1 
ATOM   1697 C  C   . GLN A  1 223 ? -17.608 -28.903 -19.812 1.00   19.91  ? 223  GLN A C   1 
ATOM   1698 O  O   . GLN A  1 223 ? -17.466 -29.741 -20.701 1.00   22.61  ? 223  GLN A O   1 
ATOM   1699 C  CB  . GLN A  1 223 ? -19.492 -27.483 -20.769 1.00   18.30  ? 223  GLN A CB  1 
ATOM   1700 C  CG  . GLN A  1 223 ? -20.104 -26.087 -20.877 1.00   15.58  ? 223  GLN A CG  1 
ATOM   1701 C  CD  . GLN A  1 223 ? -21.315 -26.029 -21.791 1.00   22.37  ? 223  GLN A CD  1 
ATOM   1702 O  OE1 . GLN A  1 223 ? -21.614 -24.984 -22.359 1.00   22.81  ? 223  GLN A OE1 1 
ATOM   1703 N  NE2 . GLN A  1 223 ? -22.030 -27.148 -21.923 1.00   28.58  ? 223  GLN A NE2 1 
ATOM   1704 N  N   . SER A  1 224 ? -17.342 -29.169 -18.533 1.00   20.11  ? 224  SER A N   1 
ATOM   1705 C  CA  . SER A  1 224 ? -16.845 -30.483 -18.093 1.00   26.42  ? 224  SER A CA  1 
ATOM   1706 C  C   . SER A  1 224 ? -15.689 -31.029 -18.945 1.00   23.35  ? 224  SER A C   1 
ATOM   1707 O  O   . SER A  1 224 ? -15.790 -32.113 -19.488 1.00   17.37  ? 224  SER A O   1 
ATOM   1708 C  CB  . SER A  1 224 ? -17.979 -31.514 -18.082 1.00   13.70  ? 224  SER A CB  1 
ATOM   1709 O  OG  . SER A  1 224 ? -19.120 -30.994 -17.424 1.00   19.00  ? 224  SER A OG  1 
ATOM   1710 N  N   . GLY A  1 225 ? -14.599 -30.287 -19.083 1.00   16.66  ? 225  GLY A N   1 
ATOM   1711 C  CA  . GLY A  1 225 ? -13.510 -30.799 -19.884 1.00   16.11  ? 225  GLY A CA  1 
ATOM   1712 C  C   . GLY A  1 225 ? -12.368 -29.836 -20.092 1.00   22.90  ? 225  GLY A C   1 
ATOM   1713 O  O   . GLY A  1 225 ? -12.570 -28.629 -20.238 1.00   28.07  ? 225  GLY A O   1 
ATOM   1714 N  N   . SER A  1 226 ? -11.155 -30.377 -20.094 1.00   20.03  ? 226  SER A N   1 
ATOM   1715 C  CA  . SER A  1 226 ? -9.988  -29.593 -20.460 1.00   23.27  ? 226  SER A CA  1 
ATOM   1716 C  C   . SER A  1 226 ? -8.853  -30.520 -20.880 1.00   27.21  ? 226  SER A C   1 
ATOM   1717 O  O   . SER A  1 226 ? -8.871  -31.706 -20.583 1.00   28.71  ? 226  SER A O   1 
ATOM   1718 C  CB  . SER A  1 226 ? -9.580  -28.640 -19.321 1.00   21.38  ? 226  SER A CB  1 
ATOM   1719 O  OG  . SER A  1 226 ? -9.523  -29.299 -18.065 1.00   19.82  ? 226  SER A OG  1 
ATOM   1720 N  N   . PHE A  1 227 ? -7.864  -29.980 -21.577 1.00   25.57  ? 227  PHE A N   1 
ATOM   1721 C  CA  . PHE A  1 227 ? -6.833  -30.821 -22.156 1.00   22.49  ? 227  PHE A CA  1 
ATOM   1722 C  C   . PHE A  1 227 ? -5.976  -31.500 -21.091 1.00   25.71  ? 227  PHE A C   1 
ATOM   1723 O  O   . PHE A  1 227 ? -5.331  -32.500 -21.373 1.00   33.22  ? 227  PHE A O   1 
ATOM   1724 C  CB  . PHE A  1 227 ? -5.938  -30.007 -23.098 1.00   24.74  ? 227  PHE A CB  1 
ATOM   1725 C  CG  . PHE A  1 227 ? -5.019  -29.055 -22.379 1.00   27.60  ? 227  PHE A CG  1 
ATOM   1726 C  CD1 . PHE A  1 227 ? -3.839  -29.509 -21.790 1.00   28.80  ? 227  PHE A CD1 1 
ATOM   1727 C  CD2 . PHE A  1 227 ? -5.334  -27.707 -22.296 1.00   26.95  ? 227  PHE A CD2 1 
ATOM   1728 C  CE1 . PHE A  1 227 ? -3.015  -28.640 -21.112 1.00   37.01  ? 227  PHE A CE1 1 
ATOM   1729 C  CE2 . PHE A  1 227 ? -4.509  -26.831 -21.637 1.00   34.51  ? 227  PHE A CE2 1 
ATOM   1730 C  CZ  . PHE A  1 227 ? -3.346  -27.292 -21.043 1.00   40.23  ? 227  PHE A CZ  1 
ATOM   1731 N  N   . ASN A  1 228 ? -5.925  -30.929 -19.887 1.00   26.38  ? 228  ASN A N   1 
ATOM   1732 C  CA  . ASN A  1 228 ? -5.085  -31.479 -18.812 1.00   14.76  ? 228  ASN A CA  1 
ATOM   1733 C  C   . ASN A  1 228 ? -5.787  -32.621 -18.098 1.00   15.07  ? 228  ASN A C   1 
ATOM   1734 O  O   . ASN A  1 228 ? -5.284  -33.127 -17.114 1.00   31.02  ? 228  ASN A O   1 
ATOM   1735 C  CB  . ASN A  1 228 ? -4.696  -30.397 -17.796 1.00   14.72  ? 228  ASN A CB  1 
ATOM   1736 C  CG  . ASN A  1 228 ? -5.905  -29.653 -17.249 1.00   23.37  ? 228  ASN A CG  1 
ATOM   1737 O  OD1 . ASN A  1 228 ? -6.932  -29.539 -17.928 1.00   20.09  ? 228  ASN A OD1 1 
ATOM   1738 N  ND2 . ASN A  1 228 ? -5.802  -29.156 -16.027 1.00   13.93  ? 228  ASN A ND2 1 
ATOM   1739 N  N   . ALA A  1 229 ? -6.972  -32.995 -18.578 1.00   16.57  ? 229  ALA A N   1 
ATOM   1740 C  CA  . ALA A  1 229 ? -7.666  -34.175 -18.080 1.00   19.32  ? 229  ALA A CA  1 
ATOM   1741 C  C   . ALA A  1 229 ? -6.887  -35.439 -18.505 1.00   25.22  ? 229  ALA A C   1 
ATOM   1742 O  O   . ALA A  1 229 ? -6.282  -35.475 -19.582 1.00   22.49  ? 229  ALA A O   1 
ATOM   1743 C  CB  . ALA A  1 229 ? -9.087  -34.210 -18.606 1.00   19.00  ? 229  ALA A CB  1 
ATOM   1744 N  N   . PRO A  1 230 ? -6.883  -36.477 -17.656 1.00   23.75  ? 230  PRO A N   1 
ATOM   1745 C  CA  . PRO A  1 230 ? -5.951  -37.578 -17.942 1.00   29.18  ? 230  PRO A CA  1 
ATOM   1746 C  C   . PRO A  1 230 ? -6.307  -38.366 -19.211 1.00   31.82  ? 230  PRO A C   1 
ATOM   1747 O  O   . PRO A  1 230 ? -5.417  -38.972 -19.808 1.00   34.61  ? 230  PRO A O   1 
ATOM   1748 C  CB  . PRO A  1 230 ? -6.009  -38.442 -16.675 1.00   20.04  ? 230  PRO A CB  1 
ATOM   1749 C  CG  . PRO A  1 230 ? -7.322  -38.133 -16.041 1.00   30.90  ? 230  PRO A CG  1 
ATOM   1750 C  CD  . PRO A  1 230 ? -7.708  -36.720 -16.458 1.00   25.48  ? 230  PRO A CD  1 
ATOM   1751 N  N   . TRP A  1 231 ? -7.570  -38.312 -19.629 1.00   18.09  ? 231  TRP A N   1 
ATOM   1752 C  CA  . TRP A  1 231 ? -8.033  -38.976 -20.849 1.00   22.64  ? 231  TRP A CA  1 
ATOM   1753 C  C   . TRP A  1 231 ? -7.799  -38.119 -22.122 1.00   18.55  ? 231  TRP A C   1 
ATOM   1754 O  O   . TRP A  1 231 ? -7.975  -38.594 -23.247 1.00   26.79  ? 231  TRP A O   1 
ATOM   1755 C  CB  . TRP A  1 231 ? -9.527  -39.355 -20.714 1.00   17.88  ? 231  TRP A CB  1 
ATOM   1756 C  CG  . TRP A  1 231 ? -10.397 -38.194 -20.241 1.00   21.38  ? 231  TRP A CG  1 
ATOM   1757 C  CD1 . TRP A  1 231 ? -10.813 -37.946 -18.958 1.00   22.60  ? 231  TRP A CD1 1 
ATOM   1758 C  CD2 . TRP A  1 231 ? -10.910 -37.110 -21.036 1.00   17.02  ? 231  TRP A CD2 1 
ATOM   1759 N  NE1 . TRP A  1 231 ? -11.570 -36.794 -18.913 1.00   21.38  ? 231  TRP A NE1 1 
ATOM   1760 C  CE2 . TRP A  1 231 ? -11.637 -36.258 -20.172 1.00   23.14  ? 231  TRP A CE2 1 
ATOM   1761 C  CE3 . TRP A  1 231 ? -10.830 -36.780 -22.392 1.00   20.33  ? 231  TRP A CE3 1 
ATOM   1762 C  CZ2 . TRP A  1 231 ? -12.286 -35.092 -20.625 1.00   24.67  ? 231  TRP A CZ2 1 
ATOM   1763 C  CZ3 . TRP A  1 231 ? -11.479 -35.615 -22.841 1.00   25.63  ? 231  TRP A CZ3 1 
ATOM   1764 C  CH2 . TRP A  1 231 ? -12.190 -34.787 -21.958 1.00   16.18  ? 231  TRP A CH2 1 
ATOM   1765 N  N   . ALA A  1 232 ? -7.364  -36.877 -21.945 1.00   16.60  ? 232  ALA A N   1 
ATOM   1766 C  CA  . ALA A  1 232 ? -7.385  -35.892 -23.032 1.00   20.16  ? 232  ALA A CA  1 
ATOM   1767 C  C   . ALA A  1 232 ? -6.239  -35.944 -24.052 1.00   24.09  ? 232  ALA A C   1 
ATOM   1768 O  O   . ALA A  1 232 ? -6.449  -35.717 -25.246 1.00   27.96  ? 232  ALA A O   1 
ATOM   1769 C  CB  . ALA A  1 232 ? -7.506  -34.487 -22.463 1.00   14.64  ? 232  ALA A CB  1 
ATOM   1770 N  N   . VAL A  1 233 ? -5.023  -36.201 -23.603 1.00   27.75  ? 233  VAL A N   1 
ATOM   1771 C  CA  . VAL A  1 233 ? -3.911  -36.183 -24.543 1.00   31.63  ? 233  VAL A CA  1 
ATOM   1772 C  C   . VAL A  1 233 ? -3.086  -37.459 -24.482 1.00   33.39  ? 233  VAL A C   1 
ATOM   1773 O  O   . VAL A  1 233 ? -2.540  -37.799 -23.435 1.00   36.73  ? 233  VAL A O   1 
ATOM   1774 C  CB  . VAL A  1 233 ? -3.011  -34.953 -24.321 1.00   39.05  ? 233  VAL A CB  1 
ATOM   1775 C  CG1 . VAL A  1 233 ? -1.787  -35.029 -25.213 1.00   19.64  ? 233  VAL A CG1 1 
ATOM   1776 C  CG2 . VAL A  1 233 ? -3.816  -33.630 -24.548 1.00   20.90  ? 233  VAL A CG2 1 
ATOM   1777 N  N   . THR A  1 234 ? -3.028  -38.164 -25.611 1.00   35.60  ? 234  THR A N   1 
ATOM   1778 C  CA  . THR A  1 234 ? -2.168  -39.340 -25.806 1.00   39.09  ? 234  THR A CA  1 
ATOM   1779 C  C   . THR A  1 234 ? -0.683  -38.959 -25.995 1.00   45.36  ? 234  THR A C   1 
ATOM   1780 O  O   . THR A  1 234 ? -0.366  -37.996 -26.701 1.00   42.45  ? 234  THR A O   1 
ATOM   1781 C  CB  . THR A  1 234 ? -2.601  -40.108 -27.065 1.00   38.57  ? 234  THR A CB  1 
ATOM   1782 O  OG1 . THR A  1 234 ? -3.991  -40.465 -26.971 1.00   42.72  ? 234  THR A OG1 1 
ATOM   1783 C  CG2 . THR A  1 234 ? -1.754  -41.342 -27.251 1.00   42.58  ? 234  THR A CG2 1 
ATOM   1784 N  N   . SER A  1 235 ? 0.225   -39.711 -25.376 1.00   51.47  ? 235  SER A N   1 
ATOM   1785 C  CA  . SER A  1 235 ? 1.659   -39.466 -25.553 1.00   57.32  ? 235  SER A CA  1 
ATOM   1786 C  C   . SER A  1 235 ? 2.146   -39.983 -26.905 1.00   59.37  ? 235  SER A C   1 
ATOM   1787 O  O   . SER A  1 235 ? 1.497   -40.834 -27.525 1.00   57.86  ? 235  SER A O   1 
ATOM   1788 C  CB  . SER A  1 235 ? 2.474   -40.127 -24.440 1.00   61.13  ? 235  SER A CB  1 
ATOM   1789 O  OG  . SER A  1 235 ? 2.543   -41.532 -24.625 1.00   63.07  ? 235  SER A OG  1 
ATOM   1790 N  N   . LEU A  1 236 ? 3.291   -39.475 -27.354 1.00   54.93  ? 236  LEU A N   1 
ATOM   1791 C  CA  . LEU A  1 236 ? 3.871   -39.910 -28.619 1.00   55.08  ? 236  LEU A CA  1 
ATOM   1792 C  C   . LEU A  1 236 ? 4.214   -41.389 -28.578 1.00   54.47  ? 236  LEU A C   1 
ATOM   1793 O  O   . LEU A  1 236 ? 3.993   -42.107 -29.550 1.00   48.96  ? 236  LEU A O   1 
ATOM   1794 C  CB  . LEU A  1 236 ? 5.111   -39.083 -28.965 1.00   63.42  ? 236  LEU A CB  1 
ATOM   1795 C  CG  . LEU A  1 236 ? 4.768   -37.601 -29.152 1.00   69.29  ? 236  LEU A CG  1 
ATOM   1796 C  CD1 . LEU A  1 236 ? 5.997   -36.754 -29.511 1.00   67.82  ? 236  LEU A CD1 1 
ATOM   1797 C  CD2 . LEU A  1 236 ? 3.646   -37.447 -30.187 1.00   63.39  ? 236  LEU A CD2 1 
ATOM   1798 N  N   . TYR A  1 237 ? 4.742   -41.842 -27.445 1.00   60.44  ? 237  TYR A N   1 
ATOM   1799 C  CA  . TYR A  1 237 ? 5.113   -43.244 -27.300 1.00   65.63  ? 237  TYR A CA  1 
ATOM   1800 C  C   . TYR A  1 237 ? 3.911   -44.181 -27.391 1.00   65.18  ? 237  TYR A C   1 
ATOM   1801 O  O   . TYR A  1 237 ? 4.007   -45.255 -27.995 1.00   71.51  ? 237  TYR A O   1 
ATOM   1802 C  CB  . TYR A  1 237 ? 5.886   -43.518 -26.001 1.00   70.31  ? 237  TYR A CB  1 
ATOM   1803 C  CG  . TYR A  1 237 ? 6.074   -45.006 -25.749 0.12   81.02  ? 237  TYR A CG  1 
ATOM   1804 C  CD1 . TYR A  1 237 ? 7.046   -45.728 -26.435 1.00   86.05  ? 237  TYR A CD1 1 
ATOM   1805 C  CD2 . TYR A  1 237 ? 5.264   -45.693 -24.846 0.70   86.06  ? 237  TYR A CD2 1 
ATOM   1806 C  CE1 . TYR A  1 237 ? 7.214   -47.088 -26.223 0.78   92.70  ? 237  TYR A CE1 1 
ATOM   1807 C  CE2 . TYR A  1 237 ? 5.426   -47.058 -24.628 0.93   91.94  ? 237  TYR A CE2 1 
ATOM   1808 C  CZ  . TYR A  1 237 ? 6.404   -47.749 -25.320 0.52   94.34  ? 237  TYR A CZ  1 
ATOM   1809 O  OH  . TYR A  1 237 ? 6.578   -49.103 -25.116 1.00   96.44  ? 237  TYR A OH  1 
ATOM   1810 N  N   . GLU A  1 238 ? 2.783   -43.809 -26.794 1.00   55.21  ? 238  GLU A N   1 
ATOM   1811 C  CA  . GLU A  1 238 ? 1.671   -44.749 -26.834 1.00   58.26  ? 238  GLU A CA  1 
ATOM   1812 C  C   . GLU A  1 238 ? 0.723   -44.570 -28.023 1.00   52.67  ? 238  GLU A C   1 
ATOM   1813 O  O   . GLU A  1 238 ? -0.025  -45.484 -28.348 1.00   56.50  ? 238  GLU A O   1 
ATOM   1814 C  CB  . GLU A  1 238 ? 0.948   -44.894 -25.487 1.00   67.66  ? 238  GLU A CB  1 
ATOM   1815 C  CG  . GLU A  1 238 ? 0.258   -43.660 -24.963 1.00   81.44  ? 238  GLU A CG  1 
ATOM   1816 C  CD  . GLU A  1 238 ? -0.451  -43.928 -23.642 1.00   92.53  ? 238  GLU A CD  1 
ATOM   1817 O  OE1 . GLU A  1 238 ? -0.412  -45.093 -23.175 1.00   97.90  ? 238  GLU A OE1 1 
ATOM   1818 O  OE2 . GLU A  1 238 ? -1.044  -42.980 -23.075 1.00   91.45  ? 238  GLU A OE2 1 
ATOM   1819 N  N   . ALA A  1 239 ? 0.779   -43.424 -28.697 1.00   46.78  ? 239  ALA A N   1 
ATOM   1820 C  CA  . ALA A  1 239 ? 0.082   -43.295 -29.978 1.00   47.38  ? 239  ALA A CA  1 
ATOM   1821 C  C   . ALA A  1 239 ? 0.775   -44.188 -30.998 1.00   51.09  ? 239  ALA A C   1 
ATOM   1822 O  O   . ALA A  1 239 ? 0.134   -44.804 -31.850 1.00   50.78  ? 239  ALA A O   1 
ATOM   1823 C  CB  . ALA A  1 239 ? 0.072   -41.857 -30.461 1.00   29.59  ? 239  ALA A CB  1 
ATOM   1824 N  N   . ARG A  1 240 ? 2.096   -44.247 -30.896 1.00   55.53  ? 240  ARG A N   1 
ATOM   1825 C  CA  . ARG A  1 240 ? 2.898   -45.097 -31.752 1.00   57.94  ? 240  ARG A CA  1 
ATOM   1826 C  C   . ARG A  1 240 ? 2.520   -46.564 -31.573 1.00   50.39  ? 240  ARG A C   1 
ATOM   1827 O  O   . ARG A  1 240 ? 2.262   -47.255 -32.561 1.00   52.29  ? 240  ARG A O   1 
ATOM   1828 C  CB  . ARG A  1 240 ? 4.384   -44.886 -31.458 1.00   73.49  ? 240  ARG A CB  1 
ATOM   1829 C  CG  . ARG A  1 240 ? 5.319   -45.767 -32.277 1.00   91.93  ? 240  ARG A CG  1 
ATOM   1830 C  CD  . ARG A  1 240 ? 5.074   -45.599 -33.773 1.00   102.68 ? 240  ARG A CD  1 
ATOM   1831 N  NE  . ARG A  1 240 ? 5.360   -44.243 -34.241 1.00   103.92 ? 240  ARG A NE  1 
ATOM   1832 C  CZ  . ARG A  1 240 ? 6.515   -43.869 -34.785 1.00   101.80 ? 240  ARG A CZ  1 
ATOM   1833 N  NH1 . ARG A  1 240 ? 7.496   -44.751 -34.931 1.00   102.51 ? 240  ARG A NH1 1 
ATOM   1834 N  NH2 . ARG A  1 240 ? 6.685   -42.613 -35.184 1.00   98.98  ? 240  ARG A NH2 1 
ATOM   1835 N  N   . ASN A  1 241 ? 2.476   -47.037 -30.325 1.00   46.24  ? 241  ASN A N   1 
ATOM   1836 C  CA  . ASN A  1 241 ? 2.188   -48.454 -30.059 1.00   58.51  ? 241  ASN A CA  1 
ATOM   1837 C  C   . ASN A  1 241 ? 0.805   -48.776 -30.618 1.00   56.77  ? 241  ASN A C   1 
ATOM   1838 O  O   . ASN A  1 241 ? 0.588   -49.844 -31.206 1.00   56.26  ? 241  ASN A O   1 
ATOM   1839 C  CB  . ASN A  1 241 ? 2.281   -48.793 -28.551 1.00   70.30  ? 241  ASN A CB  1 
ATOM   1840 C  CG  . ASN A  1 241 ? 2.797   -50.227 -28.276 1.00   85.72  ? 241  ASN A CG  1 
ATOM   1841 O  OD1 . ASN A  1 241 ? 3.995   -50.493 -28.376 1.00   80.39  ? 241  ASN A OD1 1 
ATOM   1842 N  ND2 . ASN A  1 241 ? 1.884   -51.143 -27.912 1.00   106.10 ? 241  ASN A ND2 1 
ATOM   1843 N  N   . ARG A  1 242 ? -0.111  -47.819 -30.472 1.00   50.61  ? 242  ARG A N   1 
ATOM   1844 C  CA  . ARG A  1 242 ? -1.500  -47.998 -30.902 1.00   50.85  ? 242  ARG A CA  1 
ATOM   1845 C  C   . ARG A  1 242 ? -1.677  -48.074 -32.426 1.00   46.46  ? 242  ARG A C   1 
ATOM   1846 O  O   . ARG A  1 242 ? -2.358  -48.975 -32.941 1.00   42.19  ? 242  ARG A O   1 
ATOM   1847 C  CB  . ARG A  1 242 ? -2.393  -46.922 -30.280 1.00   45.89  ? 242  ARG A CB  1 
ATOM   1848 C  CG  . ARG A  1 242 ? -2.567  -47.122 -28.782 1.00   47.06  ? 242  ARG A CG  1 
ATOM   1849 C  CD  . ARG A  1 242 ? -3.196  -45.930 -28.119 1.00   50.57  ? 242  ARG A CD  1 
ATOM   1850 N  NE  . ARG A  1 242 ? -2.993  -45.942 -26.674 1.00   53.00  ? 242  ARG A NE  1 
ATOM   1851 C  CZ  . ARG A  1 242 ? -3.578  -45.093 -25.834 1.00   49.14  ? 242  ARG A CZ  1 
ATOM   1852 N  NH1 . ARG A  1 242 ? -4.420  -44.170 -26.292 1.00   43.03  ? 242  ARG A NH1 1 
ATOM   1853 N  NH2 . ARG A  1 242 ? -3.329  -45.175 -24.534 1.00   47.58  ? 242  ARG A NH2 1 
ATOM   1854 N  N   . THR A  1 243 ? -1.059  -47.139 -33.138 1.00   39.65  ? 243  THR A N   1 
ATOM   1855 C  CA  . THR A  1 243 ? -1.039  -47.190 -34.590 1.00   39.51  ? 243  THR A CA  1 
ATOM   1856 C  C   . THR A  1 243 ? -0.476  -48.534 -35.077 1.00   45.43  ? 243  THR A C   1 
ATOM   1857 O  O   . THR A  1 243 ? -1.023  -49.153 -35.992 1.00   46.12  ? 243  THR A O   1 
ATOM   1858 C  CB  . THR A  1 243 ? -0.211  -46.035 -35.180 1.00   42.29  ? 243  THR A CB  1 
ATOM   1859 O  OG1 . THR A  1 243 ? -0.801  -44.780 -34.810 1.00   34.40  ? 243  THR A OG1 1 
ATOM   1860 C  CG2 . THR A  1 243 ? -0.147  -46.145 -36.703 1.00   45.30  ? 243  THR A CG2 1 
ATOM   1861 N  N   . LEU A  1 244 ? 0.599   -48.999 -34.451 1.00   44.37  ? 244  LEU A N   1 
ATOM   1862 C  CA  . LEU A  1 244 ? 1.196   -50.276 -34.841 1.00   49.17  ? 244  LEU A CA  1 
ATOM   1863 C  C   . LEU A  1 244 ? 0.288   -51.454 -34.509 1.00   54.35  ? 244  LEU A C   1 
ATOM   1864 O  O   . LEU A  1 244 ? 0.107   -52.369 -35.321 1.00   52.27  ? 244  LEU A O   1 
ATOM   1865 C  CB  . LEU A  1 244 ? 2.543   -50.472 -34.157 1.00   52.58  ? 244  LEU A CB  1 
ATOM   1866 C  CG  . LEU A  1 244 ? 3.618   -49.439 -34.468 1.00   54.33  ? 244  LEU A CG  1 
ATOM   1867 C  CD1 . LEU A  1 244 ? 4.871   -49.747 -33.657 1.00   56.29  ? 244  LEU A CD1 1 
ATOM   1868 C  CD2 . LEU A  1 244 ? 3.899   -49.418 -35.965 1.00   52.55  ? 244  LEU A CD2 1 
ATOM   1869 N  N   . ASN A  1 245 ? -0.268  -51.438 -33.301 1.00   55.24  ? 245  ASN A N   1 
ATOM   1870 C  CA  . ASN A  1 245 ? -1.163  -52.499 -32.869 1.00   53.71  ? 245  ASN A CA  1 
ATOM   1871 C  C   . ASN A  1 245 ? -2.384  -52.593 -33.771 1.00   56.19  ? 245  ASN A C   1 
ATOM   1872 O  O   . ASN A  1 245 ? -2.816  -53.695 -34.127 1.00   60.85  ? 245  ASN A O   1 
ATOM   1873 C  CB  . ASN A  1 245 ? -1.577  -52.295 -31.415 1.00   51.87  ? 245  ASN A CB  1 
ATOM   1874 C  CG  . ASN A  1 245 ? -0.474  -52.656 -30.452 1.00   57.42  ? 245  ASN A CG  1 
ATOM   1875 O  OD1 . ASN A  1 245 ? 0.443   -53.406 -30.799 1.00   66.98  ? 245  ASN A OD1 1 
ATOM   1876 N  ND2 . ASN A  1 245 ? -0.555  -52.136 -29.234 1.00   52.14  ? 245  ASN A ND2 1 
ATOM   1877 N  N   . LEU A  1 246 ? -2.927  -51.435 -34.145 1.00   48.56  ? 246  LEU A N   1 
ATOM   1878 C  CA  . LEU A  1 246 ? -3.998  -51.392 -35.124 1.00   47.64  ? 246  LEU A CA  1 
ATOM   1879 C  C   . LEU A  1 246 ? -3.562  -52.072 -36.425 1.00   51.96  ? 246  LEU A C   1 
ATOM   1880 O  O   . LEU A  1 246 ? -4.339  -52.799 -37.031 1.00   54.76  ? 246  LEU A O   1 
ATOM   1881 C  CB  . LEU A  1 246 ? -4.456  -49.954 -35.396 1.00   42.03  ? 246  LEU A CB  1 
ATOM   1882 C  CG  . LEU A  1 246 ? -5.678  -49.893 -36.324 1.00   42.20  ? 246  LEU A CG  1 
ATOM   1883 C  CD1 . LEU A  1 246 ? -6.927  -50.475 -35.648 1.00   37.76  ? 246  LEU A CD1 1 
ATOM   1884 C  CD2 . LEU A  1 246 ? -5.935  -48.490 -36.801 1.00   36.03  ? 246  LEU A CD2 1 
ATOM   1885 N  N   . ALA A  1 247 ? -2.313  -51.847 -36.829 1.00   51.83  ? 247  ALA A N   1 
ATOM   1886 C  CA  . ALA A  1 247 ? -1.757  -52.463 -38.033 1.00   47.71  ? 247  ALA A CA  1 
ATOM   1887 C  C   . ALA A  1 247 ? -1.640  -53.981 -37.936 1.00   50.66  ? 247  ALA A C   1 
ATOM   1888 O  O   . ALA A  1 247 ? -1.925  -54.684 -38.905 1.00   62.72  ? 247  ALA A O   1 
ATOM   1889 C  CB  . ALA A  1 247 ? -0.403  -51.856 -38.370 1.00   49.06  ? 247  ALA A CB  1 
ATOM   1890 N  N   . LYS A  1 248 ? -1.214  -54.494 -36.787 1.00   51.42  ? 248  LYS A N   1 
ATOM   1891 C  CA  . LYS A  1 248 ? -1.086  -55.948 -36.640 1.00   70.64  ? 248  LYS A CA  1 
ATOM   1892 C  C   . LYS A  1 248 ? -2.470  -56.593 -36.703 1.00   69.48  ? 248  LYS A C   1 
ATOM   1893 O  O   . LYS A  1 248 ? -2.689  -57.552 -37.445 1.00   69.14  ? 248  LYS A O   1 
ATOM   1894 C  CB  . LYS A  1 248 ? -0.380  -56.348 -35.332 1.00   75.05  ? 248  LYS A CB  1 
ATOM   1895 C  CG  . LYS A  1 248 ? 0.757   -55.426 -34.850 1.00   82.61  ? 248  LYS A CG  1 
ATOM   1896 C  CD  . LYS A  1 248 ? 2.091   -55.646 -35.565 1.00   88.93  ? 248  LYS A CD  1 
ATOM   1897 C  CE  . LYS A  1 248 ? 2.475   -57.132 -35.635 1.00   96.62  ? 248  LYS A CE  1 
ATOM   1898 N  NZ  . LYS A  1 248 ? 3.891   -57.347 -36.064 1.00   63.94  ? 248  LYS A NZ  1 
ATOM   1899 N  N   . LEU A  1 249 ? -3.401  -56.038 -35.930 1.00   66.07  ? 249  LEU A N   1 
ATOM   1900 C  CA  . LEU A  1 249 ? -4.769  -56.544 -35.847 1.00   60.49  ? 249  LEU A CA  1 
ATOM   1901 C  C   . LEU A  1 249 ? -5.458  -56.577 -37.199 1.00   59.92  ? 249  LEU A C   1 
ATOM   1902 O  O   . LEU A  1 249 ? -6.258  -57.465 -37.491 1.00   61.46  ? 249  LEU A O   1 
ATOM   1903 C  CB  . LEU A  1 249 ? -5.578  -55.668 -34.898 1.00   49.69  ? 249  LEU A CB  1 
ATOM   1904 C  CG  . LEU A  1 249 ? -5.232  -55.908 -33.435 1.00   52.01  ? 249  LEU A CG  1 
ATOM   1905 C  CD1 . LEU A  1 249 ? -5.481  -54.657 -32.598 1.00   52.64  ? 249  LEU A CD1 1 
ATOM   1906 C  CD2 . LEU A  1 249 ? -6.044  -57.077 -32.915 1.00   49.90  ? 249  LEU A CD2 1 
ATOM   1907 N  N   . THR A  1 250 ? -5.130  -55.596 -38.023 1.00   56.86  ? 250  THR A N   1 
ATOM   1908 C  CA  . THR A  1 250 ? -5.793  -55.409 -39.293 1.00   56.78  ? 250  THR A CA  1 
ATOM   1909 C  C   . THR A  1 250 ? -4.960  -56.067 -40.393 1.00   64.11  ? 250  THR A C   1 
ATOM   1910 O  O   . THR A  1 250 ? -5.299  -56.009 -41.575 1.00   70.34  ? 250  THR A O   1 
ATOM   1911 C  CB  . THR A  1 250 ? -5.969  -53.904 -39.557 1.00   52.31  ? 250  THR A CB  1 
ATOM   1912 O  OG1 . THR A  1 250 ? -7.018  -53.679 -40.501 1.00   60.24  ? 250  THR A OG1 1 
ATOM   1913 C  CG2 . THR A  1 250 ? -4.694  -53.318 -40.069 1.00   48.42  ? 250  THR A CG2 1 
ATOM   1914 N  N   . GLY A  1 251 ? -3.867  -56.705 -39.992 1.00   59.10  ? 251  GLY A N   1 
ATOM   1915 C  CA  . GLY A  1 251 ? -2.976  -57.345 -40.939 1.00   59.09  ? 251  GLY A CA  1 
ATOM   1916 C  C   . GLY A  1 251 ? -2.242  -56.385 -41.859 1.00   61.19  ? 251  GLY A C   1 
ATOM   1917 O  O   . GLY A  1 251 ? -1.911  -56.744 -42.985 1.00   60.06  ? 251  GLY A O   1 
ATOM   1918 N  N   . CYS A  1 252 ? -1.974  -55.170 -41.387 1.00   61.37  ? 252  CYS A N   1 
ATOM   1919 C  CA  . CYS A  1 252 ? -1.315  -54.165 -42.223 1.00   67.67  ? 252  CYS A CA  1 
ATOM   1920 C  C   . CYS A  1 252 ? 0.110   -53.861 -41.802 1.00   72.97  ? 252  CYS A C   1 
ATOM   1921 O  O   . CYS A  1 252 ? 0.710   -52.902 -42.291 1.00   73.56  ? 252  CYS A O   1 
ATOM   1922 C  CB  . CYS A  1 252 ? -2.106  -52.856 -42.255 1.00   62.43  ? 252  CYS A CB  1 
ATOM   1923 S  SG  . CYS A  1 252 ? -3.578  -52.899 -43.288 1.00   73.60  ? 252  CYS A SG  1 
ATOM   1924 N  N   . SER A  1 253 ? 0.643   -54.665 -40.892 1.00   74.59  ? 253  SER A N   1 
ATOM   1925 C  CA  . SER A  1 253 ? 2.012   -54.477 -40.441 1.00   74.15  ? 253  SER A CA  1 
ATOM   1926 C  C   . SER A  1 253 ? 2.956   -54.491 -41.628 1.00   79.40  ? 253  SER A C   1 
ATOM   1927 O  O   . SER A  1 253 ? 3.089   -55.498 -42.317 1.00   63.45  ? 253  SER A O   1 
ATOM   1928 C  CB  . SER A  1 253 ? 2.407   -55.569 -39.457 1.00   73.06  ? 253  SER A CB  1 
ATOM   1929 O  OG  . SER A  1 253 ? 1.416   -55.708 -38.466 1.00   70.37  ? 253  SER A OG  1 
ATOM   1930 N  N   . ARG A  1 254 ? 3.578   -53.347 -41.880 1.00   82.90  ? 254  ARG A N   1 
ATOM   1931 C  CA  . ARG A  1 254 ? 4.612   -53.238 -42.895 1.00   85.83  ? 254  ARG A CA  1 
ATOM   1932 C  C   . ARG A  1 254 ? 5.887   -52.737 -42.236 1.00   91.29  ? 254  ARG A C   1 
ATOM   1933 O  O   . ARG A  1 254 ? 5.957   -52.597 -41.013 1.00   92.26  ? 254  ARG A O   1 
ATOM   1934 C  CB  . ARG A  1 254 ? 4.180   -52.293 -44.021 1.00   79.22  ? 254  ARG A CB  1 
ATOM   1935 C  CG  . ARG A  1 254 ? 3.904   -52.973 -45.356 1.00   78.84  ? 254  ARG A CG  1 
ATOM   1936 C  CD  . ARG A  1 254 ? 3.152   -54.275 -45.174 1.00   72.37  ? 254  ARG A CD  1 
ATOM   1937 N  NE  . ARG A  1 254 ? 2.123   -54.460 -46.188 1.00   68.68  ? 254  ARG A NE  1 
ATOM   1938 C  CZ  . ARG A  1 254 ? 0.970   -55.074 -45.957 1.00   69.28  ? 254  ARG A CZ  1 
ATOM   1939 N  NH1 . ARG A  1 254 ? 0.711   -55.557 -44.749 1.00   62.62  ? 254  ARG A NH1 1 
ATOM   1940 N  NH2 . ARG A  1 254 ? 0.076   -55.197 -46.929 1.00   67.84  ? 254  ARG A NH2 1 
ATOM   1941 N  N   . GLU A  1 255 ? 6.892   -52.468 -43.056 1.00   96.12  ? 255  GLU A N   1 
ATOM   1942 C  CA  . GLU A  1 255 ? 8.187   -52.013 -42.578 1.00   99.61  ? 255  GLU A CA  1 
ATOM   1943 C  C   . GLU A  1 255 ? 8.330   -50.527 -42.883 1.00   90.72  ? 255  GLU A C   1 
ATOM   1944 O  O   . GLU A  1 255 ? 8.791   -49.744 -42.054 1.00   84.84  ? 255  GLU A O   1 
ATOM   1945 C  CB  . GLU A  1 255 ? 9.305   -52.825 -43.243 1.00   110.00 ? 255  GLU A CB  1 
ATOM   1946 C  CG  . GLU A  1 255 ? 9.211   -52.947 -44.781 1.00   119.27 ? 255  GLU A CG  1 
ATOM   1947 C  CD  . GLU A  1 255 ? 8.139   -53.927 -45.269 1.00   125.20 ? 255  GLU A CD  1 
ATOM   1948 O  OE1 . GLU A  1 255 ? 7.466   -54.563 -44.429 1.00   126.13 ? 255  GLU A OE1 1 
ATOM   1949 O  OE2 . GLU A  1 255 ? 7.966   -54.057 -46.500 1.00   128.13 ? 255  GLU A OE2 1 
ATOM   1950 N  N   . ASN A  1 256 ? 7.921   -50.161 -44.090 1.00   88.31  ? 256  ASN A N   1 
ATOM   1951 C  CA  . ASN A  1 256 ? 7.842   -48.782 -44.514 1.00   87.38  ? 256  ASN A CA  1 
ATOM   1952 C  C   . ASN A  1 256 ? 6.572   -48.206 -43.903 1.00   82.25  ? 256  ASN A C   1 
ATOM   1953 O  O   . ASN A  1 256 ? 5.468   -48.648 -44.233 1.00   77.98  ? 256  ASN A O   1 
ATOM   1954 C  CB  . ASN A  1 256 ? 7.771   -48.744 -46.041 1.00   97.26  ? 256  ASN A CB  1 
ATOM   1955 C  CG  . ASN A  1 256 ? 7.958   -47.357 -46.612 1.00   107.78 ? 256  ASN A CG  1 
ATOM   1956 O  OD1 . ASN A  1 256 ? 7.324   -46.398 -46.177 1.00   106.05 ? 256  ASN A OD1 1 
ATOM   1957 N  ND2 . ASN A  1 256 ? 8.826   -47.248 -47.608 1.00   125.49 ? 256  ASN A ND2 1 
ATOM   1958 N  N   . GLU A  1 257 ? 6.728   -47.239 -43.000 1.00   76.09  ? 257  GLU A N   1 
ATOM   1959 C  CA  . GLU A  1 257 ? 5.584   -46.663 -42.296 1.00   71.82  ? 257  GLU A CA  1 
ATOM   1960 C  C   . GLU A  1 257 ? 4.507   -46.137 -43.229 1.00   71.18  ? 257  GLU A C   1 
ATOM   1961 O  O   . GLU A  1 257 ? 3.317   -46.282 -42.947 1.00   68.69  ? 257  GLU A O   1 
ATOM   1962 C  CB  . GLU A  1 257 ? 6.022   -45.537 -41.364 1.00   71.23  ? 257  GLU A CB  1 
ATOM   1963 C  CG  . GLU A  1 257 ? 6.425   -46.000 -39.986 1.00   71.30  ? 257  GLU A CG  1 
ATOM   1964 C  CD  . GLU A  1 257 ? 6.850   -44.849 -39.104 1.00   70.89  ? 257  GLU A CD  1 
ATOM   1965 O  OE1 . GLU A  1 257 ? 6.444   -43.693 -39.391 1.00   64.91  ? 257  GLU A OE1 1 
ATOM   1966 O  OE2 . GLU A  1 257 ? 7.593   -45.111 -38.129 1.00   73.47  ? 257  GLU A OE2 1 
ATOM   1967 N  N   . THR A  1 258 ? 4.924   -45.517 -44.329 1.00   71.12  ? 258  THR A N   1 
ATOM   1968 C  CA  . THR A  1 258 ? 3.976   -44.969 -45.291 1.00   64.45  ? 258  THR A CA  1 
ATOM   1969 C  C   . THR A  1 258 ? 3.161   -46.091 -45.920 0.88   61.28  ? 258  THR A C   1 
ATOM   1970 O  O   . THR A  1 258 ? 1.979   -45.912 -46.215 0.89   53.41  ? 258  THR A O   1 
ATOM   1971 C  CB  . THR A  1 258 ? 4.678   -44.148 -46.383 1.00   63.89  ? 258  THR A CB  1 
ATOM   1972 O  OG1 . THR A  1 258 ? 5.735   -44.927 -46.954 0.23   68.84  ? 258  THR A OG1 1 
ATOM   1973 C  CG2 . THR A  1 258 ? 5.264   -42.876 -45.794 1.00   61.93  ? 258  THR A CG2 1 
ATOM   1974 N  N   . GLU A  1 259 ? 3.798   -47.249 -46.101 1.00   67.69  ? 259  GLU A N   1 
ATOM   1975 C  CA  . GLU A  1 259 ? 3.124   -48.434 -46.628 1.00   72.46  ? 259  GLU A CA  1 
ATOM   1976 C  C   . GLU A  1 259 ? 2.073   -48.970 -45.657 1.00   64.54  ? 259  GLU A C   1 
ATOM   1977 O  O   . GLU A  1 259 ? 1.047   -49.508 -46.078 1.00   66.45  ? 259  GLU A O   1 
ATOM   1978 C  CB  . GLU A  1 259 ? 4.129   -49.542 -46.967 1.00   81.82  ? 259  GLU A CB  1 
ATOM   1979 C  CG  . GLU A  1 259 ? 4.941   -49.318 -48.238 1.00   90.50  ? 259  GLU A CG  1 
ATOM   1980 C  CD  . GLU A  1 259 ? 5.920   -50.456 -48.507 1.00   100.24 ? 259  GLU A CD  1 
ATOM   1981 O  OE1 . GLU A  1 259 ? 5.560   -51.626 -48.250 1.00   101.96 ? 259  GLU A OE1 1 
ATOM   1982 O  OE2 . GLU A  1 259 ? 7.053   -50.181 -48.966 1.00   103.40 ? 259  GLU A OE2 1 
ATOM   1983 N  N   . ILE A  1 260 ? 2.332   -48.840 -44.360 1.00   55.98  ? 260  ILE A N   1 
ATOM   1984 C  CA  . ILE A  1 260 ? 1.344   -49.234 -43.365 1.00   57.77  ? 260  ILE A CA  1 
ATOM   1985 C  C   . ILE A  1 260 ? 0.074   -48.399 -43.533 1.00   55.62  ? 260  ILE A C   1 
ATOM   1986 O  O   . ILE A  1 260 ? -1.036  -48.923 -43.497 1.00   55.27  ? 260  ILE A O   1 
ATOM   1987 C  CB  . ILE A  1 260 ? 1.881   -49.102 -41.922 1.00   57.52  ? 260  ILE A CB  1 
ATOM   1988 C  CG1 . ILE A  1 260 ? 3.040   -50.070 -41.695 1.00   59.26  ? 260  ILE A CG1 1 
ATOM   1989 C  CG2 . ILE A  1 260 ? 0.777   -49.376 -40.906 1.00   56.81  ? 260  ILE A CG2 1 
ATOM   1990 C  CD1 . ILE A  1 260 ? 3.673   -49.962 -40.326 1.00   61.11  ? 260  ILE A CD1 1 
ATOM   1991 N  N   . ILE A  1 261 ? 0.252   -47.101 -43.744 1.00   55.03  ? 261  ILE A N   1 
ATOM   1992 C  CA  . ILE A  1 261 ? -0.870  -46.198 -43.935 1.00   52.53  ? 261  ILE A CA  1 
ATOM   1993 C  C   . ILE A  1 261 ? -1.617  -46.527 -45.216 1.00   57.16  ? 261  ILE A C   1 
ATOM   1994 O  O   . ILE A  1 261 ? -2.845  -46.558 -45.223 1.00   60.36  ? 261  ILE A O   1 
ATOM   1995 C  CB  . ILE A  1 261 ? -0.424  -44.721 -43.966 1.00   50.60  ? 261  ILE A CB  1 
ATOM   1996 C  CG1 . ILE A  1 261 ? 0.423   -44.393 -42.737 1.00   48.81  ? 261  ILE A CG1 1 
ATOM   1997 C  CG2 . ILE A  1 261 ? -1.631  -43.805 -44.019 1.00   39.89  ? 261  ILE A CG2 1 
ATOM   1998 C  CD1 . ILE A  1 261 ? -0.305  -44.619 -41.428 1.00   49.14  ? 261  ILE A CD1 1 
ATOM   1999 N  N   . LYS A  1 262 ? -0.876  -46.780 -46.292 1.00   47.23  ? 262  LYS A N   1 
ATOM   2000 C  CA  . LYS A  1 262 ? -1.479  -47.136 -47.576 1.00   52.82  ? 262  LYS A CA  1 
ATOM   2001 C  C   . LYS A  1 262 ? -2.310  -48.407 -47.437 1.00   53.45  ? 262  LYS A C   1 
ATOM   2002 O  O   . LYS A  1 262 ? -3.368  -48.543 -48.066 1.00   51.06  ? 262  LYS A O   1 
ATOM   2003 C  CB  . LYS A  1 262 ? -0.410  -47.328 -48.662 1.00   51.52  ? 262  LYS A CB  1 
ATOM   2004 C  CG  . LYS A  1 262 ? -0.979  -47.470 -50.069 1.00   66.04  ? 262  LYS A CG  1 
ATOM   2005 C  CD  . LYS A  1 262 ? 0.109   -47.753 -51.108 1.00   71.15  ? 262  LYS A CD  1 
ATOM   2006 C  CE  . LYS A  1 262 ? 0.332   -49.255 -51.303 1.00   74.24  ? 262  LYS A CE  1 
ATOM   2007 N  NZ  . LYS A  1 262 ? 1.541   -49.553 -52.128 1.00   74.06  ? 262  LYS A NZ  1 
ATOM   2008 N  N   . CYS A  1 263 ? -1.823  -49.335 -46.613 1.00   53.82  ? 263  CYS A N   1 
ATOM   2009 C  CA  . CYS A  1 263 ? -2.541  -50.578 -46.343 1.00   56.09  ? 263  CYS A CA  1 
ATOM   2010 C  C   . CYS A  1 263 ? -3.828  -50.283 -45.579 1.00   55.45  ? 263  CYS A C   1 
ATOM   2011 O  O   . CYS A  1 263 ? -4.903  -50.763 -45.932 1.00   48.72  ? 263  CYS A O   1 
ATOM   2012 C  CB  . CYS A  1 263 ? -1.668  -51.547 -45.543 1.00   60.65  ? 263  CYS A CB  1 
ATOM   2013 S  SG  . CYS A  1 263 ? -2.521  -53.064 -45.022 1.00   69.39  ? 263  CYS A SG  1 
ATOM   2014 N  N   . LEU A  1 264 ? -3.703  -49.477 -44.533 1.00   51.23  ? 264  LEU A N   1 
ATOM   2015 C  CA  . LEU A  1 264 ? -4.843  -49.072 -43.729 1.00   44.98  ? 264  LEU A CA  1 
ATOM   2016 C  C   . LEU A  1 264 ? -5.892  -48.306 -44.541 1.00   43.79  ? 264  LEU A C   1 
ATOM   2017 O  O   . LEU A  1 264 ? -7.067  -48.314 -44.203 1.00   41.16  ? 264  LEU A O   1 
ATOM   2018 C  CB  . LEU A  1 264 ? -4.364  -48.248 -42.541 1.00   44.10  ? 264  LEU A CB  1 
ATOM   2019 C  CG  . LEU A  1 264 ? -3.713  -49.048 -41.410 1.00   46.26  ? 264  LEU A CG  1 
ATOM   2020 C  CD1 . LEU A  1 264 ? -2.964  -48.111 -40.485 1.00   40.97  ? 264  LEU A CD1 1 
ATOM   2021 C  CD2 . LEU A  1 264 ? -4.758  -49.834 -40.632 1.00   42.08  ? 264  LEU A CD2 1 
ATOM   2022 N  N   . ARG A  1 265 ? -5.468  -47.659 -45.618 1.00   44.06  ? 265  ARG A N   1 
ATOM   2023 C  CA  . ARG A  1 265 ? -6.395  -46.947 -46.489 1.00   47.96  ? 265  ARG A CA  1 
ATOM   2024 C  C   . ARG A  1 265 ? -7.275  -47.878 -47.343 1.00   50.25  ? 265  ARG A C   1 
ATOM   2025 O  O   . ARG A  1 265 ? -8.330  -47.468 -47.816 1.00   52.37  ? 265  ARG A O   1 
ATOM   2026 C  CB  . ARG A  1 265 ? -5.639  -45.972 -47.402 1.00   56.98  ? 265  ARG A CB  1 
ATOM   2027 C  CG  . ARG A  1 265 ? -5.016  -44.750 -46.723 1.00   56.89  ? 265  ARG A CG  1 
ATOM   2028 C  CD  . ARG A  1 265 ? -4.191  -43.952 -47.741 1.00   65.26  ? 265  ARG A CD  1 
ATOM   2029 N  NE  . ARG A  1 265 ? -3.236  -43.043 -47.113 1.00   72.73  ? 265  ARG A NE  1 
ATOM   2030 C  CZ  . ARG A  1 265 ? -3.529  -41.795 -46.757 1.00   81.62  ? 265  ARG A CZ  1 
ATOM   2031 N  NH1 . ARG A  1 265 ? -4.748  -41.319 -46.972 1.00   87.75  ? 265  ARG A NH1 1 
ATOM   2032 N  NH2 . ARG A  1 265 ? -2.617  -41.024 -46.183 1.00   77.17  ? 265  ARG A NH2 1 
ATOM   2033 N  N   . ASN A  1 266 ? -6.853  -49.122 -47.554 1.00   53.64  ? 266  ASN A N   1 
ATOM   2034 C  CA  . ASN A  1 266 ? -7.671  -50.056 -48.334 1.00   56.10  ? 266  ASN A CA  1 
ATOM   2035 C  C   . ASN A  1 266 ? -8.442  -51.010 -47.440 1.00   53.66  ? 266  ASN A C   1 
ATOM   2036 O  O   . ASN A  1 266 ? -8.572  -52.192 -47.732 1.00   70.62  ? 266  ASN A O   1 
ATOM   2037 C  CB  . ASN A  1 266 ? -6.829  -50.841 -49.347 1.00   64.80  ? 266  ASN A CB  1 
ATOM   2038 C  CG  . ASN A  1 266 ? -5.994  -49.939 -50.231 1.00   73.12  ? 266  ASN A CG  1 
ATOM   2039 O  OD1 . ASN A  1 266 ? -4.771  -50.067 -50.283 1.00   77.48  ? 266  ASN A OD1 1 
ATOM   2040 N  ND2 . ASN A  1 266 ? -6.650  -49.009 -50.922 1.00   73.23  ? 266  ASN A ND2 1 
ATOM   2041 N  N   . LYS A  1 267 ? -8.941  -50.484 -46.336 1.00   51.16  ? 267  LYS A N   1 
ATOM   2042 C  CA  . LYS A  1 267 ? -9.748  -51.257 -45.416 1.00   54.79  ? 267  LYS A CA  1 
ATOM   2043 C  C   . LYS A  1 267 ? -11.129 -50.635 -45.325 1.00   57.60  ? 267  LYS A C   1 
ATOM   2044 O  O   . LYS A  1 267 ? -11.281 -49.423 -45.465 1.00   59.79  ? 267  LYS A O   1 
ATOM   2045 C  CB  . LYS A  1 267 ? -9.095  -51.283 -44.031 1.00   56.18  ? 267  LYS A CB  1 
ATOM   2046 C  CG  . LYS A  1 267 ? -7.786  -52.068 -43.976 1.00   61.95  ? 267  LYS A CG  1 
ATOM   2047 C  CD  . LYS A  1 267 ? -8.013  -53.554 -44.266 1.00   64.84  ? 267  LYS A CD  1 
ATOM   2048 C  CE  . LYS A  1 267 ? -6.721  -54.237 -44.692 1.00   70.87  ? 267  LYS A CE  1 
ATOM   2049 N  NZ  . LYS A  1 267 ? -6.924  -55.663 -45.054 1.00   75.37  ? 267  LYS A NZ  1 
ATOM   2050 N  N   . ASP A  1 268 ? -12.140 -51.466 -45.112 1.00   62.67  ? 268  ASP A N   1 
ATOM   2051 C  CA  . ASP A  1 268 ? -13.462 -50.961 -44.788 1.00   68.10  ? 268  ASP A CA  1 
ATOM   2052 C  C   . ASP A  1 268 ? -13.382 -50.310 -43.418 1.00   61.77  ? 268  ASP A C   1 
ATOM   2053 O  O   . ASP A  1 268 ? -12.721 -50.834 -42.519 1.00   65.87  ? 268  ASP A O   1 
ATOM   2054 C  CB  . ASP A  1 268 ? -14.488 -52.096 -44.763 1.00   77.87  ? 268  ASP A CB  1 
ATOM   2055 C  CG  . ASP A  1 268 ? -14.762 -52.664 -46.137 1.00   86.01  ? 268  ASP A CG  1 
ATOM   2056 O  OD1 . ASP A  1 268 ? -14.976 -51.862 -47.071 1.00   87.58  ? 268  ASP A OD1 1 
ATOM   2057 O  OD2 . ASP A  1 268 ? -14.755 -53.908 -46.284 1.00   91.32  ? 268  ASP A OD2 1 
ATOM   2058 N  N   . PRO A  1 269 ? -14.046 -49.160 -43.254 1.00   50.33  ? 269  PRO A N   1 
ATOM   2059 C  CA  . PRO A  1 269 ? -14.094 -48.487 -41.954 1.00   45.83  ? 269  PRO A CA  1 
ATOM   2060 C  C   . PRO A  1 269 ? -14.514 -49.439 -40.831 1.00   54.38  ? 269  PRO A C   1 
ATOM   2061 O  O   . PRO A  1 269 ? -14.009 -49.312 -39.713 1.00   59.23  ? 269  PRO A O   1 
ATOM   2062 C  CB  . PRO A  1 269 ? -15.153 -47.404 -42.168 1.00   45.29  ? 269  PRO A CB  1 
ATOM   2063 C  CG  . PRO A  1 269 ? -15.080 -47.096 -43.648 1.00   44.68  ? 269  PRO A CG  1 
ATOM   2064 C  CD  . PRO A  1 269 ? -14.779 -48.423 -44.300 1.00   47.31  ? 269  PRO A CD  1 
ATOM   2065 N  N   . GLN A  1 270 ? -15.403 -50.389 -41.128 1.00   54.89  ? 270  GLN A N   1 
ATOM   2066 C  CA  A GLN A  1 270 ? -15.837 -51.357 -40.125 0.54   50.10  ? 270  GLN A CA  1 
ATOM   2067 C  CA  B GLN A  1 270 ? -15.848 -51.373 -40.147 0.46   50.55  ? 270  GLN A CA  1 
ATOM   2068 C  C   . GLN A  1 270 ? -14.675 -52.165 -39.573 1.00   47.87  ? 270  GLN A C   1 
ATOM   2069 O  O   . GLN A  1 270 ? -14.585 -52.378 -38.362 1.00   40.85  ? 270  GLN A O   1 
ATOM   2070 C  CB  A GLN A  1 270 ? -16.916 -52.291 -40.672 0.54   53.97  ? 270  GLN A CB  1 
ATOM   2071 C  CB  B GLN A  1 270 ? -16.870 -52.327 -40.772 0.46   54.07  ? 270  GLN A CB  1 
ATOM   2072 C  CG  A GLN A  1 270 ? -18.324 -51.760 -40.485 0.54   55.34  ? 270  GLN A CG  1 
ATOM   2073 C  CG  B GLN A  1 270 ? -18.196 -51.677 -41.167 0.46   57.35  ? 270  GLN A CG  1 
ATOM   2074 C  CD  A GLN A  1 270 ? -18.514 -51.094 -39.136 0.54   49.26  ? 270  GLN A CD  1 
ATOM   2075 C  CD  B GLN A  1 270 ? -18.152 -50.986 -42.524 0.46   59.97  ? 270  GLN A CD  1 
ATOM   2076 O  OE1 A GLN A  1 270 ? -18.367 -51.729 -38.089 0.54   44.63  ? 270  GLN A OE1 1 
ATOM   2077 O  OE1 B GLN A  1 270 ? -17.298 -51.285 -43.362 0.46   58.90  ? 270  GLN A OE1 1 
ATOM   2078 N  NE2 A GLN A  1 270 ? -18.829 -49.802 -39.155 0.54   46.00  ? 270  GLN A NE2 1 
ATOM   2079 N  NE2 B GLN A  1 270 ? -19.081 -50.060 -42.746 0.46   57.71  ? 270  GLN A NE2 1 
ATOM   2080 N  N   . GLU A  1 271 ? -13.778 -52.601 -40.458 1.00   46.78  ? 271  GLU A N   1 
ATOM   2081 C  CA  . GLU A  1 271 ? -12.614 -53.368 -40.035 1.00   52.15  ? 271  GLU A CA  1 
ATOM   2082 C  C   . GLU A  1 271 ? -11.721 -52.546 -39.113 1.00   56.44  ? 271  GLU A C   1 
ATOM   2083 O  O   . GLU A  1 271 ? -11.136 -53.078 -38.170 1.00   60.12  ? 271  GLU A O   1 
ATOM   2084 C  CB  . GLU A  1 271 ? -11.822 -53.880 -41.240 1.00   66.95  ? 271  GLU A CB  1 
ATOM   2085 C  CG  . GLU A  1 271 ? -10.534 -54.615 -40.859 1.00   79.70  ? 271  GLU A CG  1 
ATOM   2086 C  CD  . GLU A  1 271 ? -10.148 -55.711 -41.845 1.00   89.16  ? 271  GLU A CD  1 
ATOM   2087 O  OE1 . GLU A  1 271 ? -10.877 -55.904 -42.845 1.00   93.14  ? 271  GLU A OE1 1 
ATOM   2088 O  OE2 . GLU A  1 271 ? -9.114  -56.381 -41.612 1.00   89.16  ? 271  GLU A OE2 1 
ATOM   2089 N  N   . ILE A  1 272 ? -11.636 -51.244 -39.379 1.00   55.05  ? 272  ILE A N   1 
ATOM   2090 C  CA  . ILE A  1 272 ? -10.849 -50.335 -38.551 1.00   46.56  ? 272  ILE A CA  1 
ATOM   2091 C  C   . ILE A  1 272 ? -11.590 -49.989 -37.263 1.00   49.80  ? 272  ILE A C   1 
ATOM   2092 O  O   . ILE A  1 272 ? -10.981 -49.927 -36.194 1.00   57.57  ? 272  ILE A O   1 
ATOM   2093 C  CB  . ILE A  1 272 ? -10.465 -49.059 -39.327 1.00   40.80  ? 272  ILE A CB  1 
ATOM   2094 C  CG1 . ILE A  1 272 ? -9.480  -49.407 -40.441 1.00   40.50  ? 272  ILE A CG1 1 
ATOM   2095 C  CG2 . ILE A  1 272 ? -9.839  -48.021 -38.409 1.00   41.59  ? 272  ILE A CG2 1 
ATOM   2096 C  CD1 . ILE A  1 272 ? -9.205  -48.286 -41.393 1.00   38.21  ? 272  ILE A CD1 1 
ATOM   2097 N  N   . LEU A  1 273 ? -12.904 -49.788 -37.352 1.00   40.24  ? 273  LEU A N   1 
ATOM   2098 C  CA  . LEU A  1 273 ? -13.700 -49.532 -36.155 1.00   41.66  ? 273  LEU A CA  1 
ATOM   2099 C  C   . LEU A  1 273 ? -13.675 -50.708 -35.174 1.00   47.02  ? 273  LEU A C   1 
ATOM   2100 O  O   . LEU A  1 273 ? -13.616 -50.523 -33.951 1.00   43.38  ? 273  LEU A O   1 
ATOM   2101 C  CB  . LEU A  1 273 ? -15.140 -49.207 -36.530 1.00   32.20  ? 273  LEU A CB  1 
ATOM   2102 C  CG  . LEU A  1 273 ? -15.293 -47.826 -37.146 1.00   46.67  ? 273  LEU A CG  1 
ATOM   2103 C  CD1 . LEU A  1 273 ? -16.733 -47.586 -37.630 1.00   51.00  ? 273  LEU A CD1 1 
ATOM   2104 C  CD2 . LEU A  1 273 ? -14.845 -46.783 -36.128 1.00   29.79  ? 273  LEU A CD2 1 
ATOM   2105 N  N   . LEU A  1 274 ? -13.709 -51.923 -35.711 1.00   49.24  ? 274  LEU A N   1 
ATOM   2106 C  CA  . LEU A  1 274 ? -13.845 -53.088 -34.855 1.00   52.84  ? 274  LEU A CA  1 
ATOM   2107 C  C   . LEU A  1 274 ? -12.536 -53.467 -34.174 1.00   53.13  ? 274  LEU A C   1 
ATOM   2108 O  O   . LEU A  1 274 ? -12.537 -54.178 -33.171 1.00   51.24  ? 274  LEU A O   1 
ATOM   2109 C  CB  . LEU A  1 274 ? -14.477 -54.259 -35.620 1.00   61.07  ? 274  LEU A CB  1 
ATOM   2110 C  CG  . LEU A  1 274 ? -15.901 -53.903 -36.087 1.00   65.81  ? 274  LEU A CG  1 
ATOM   2111 C  CD1 . LEU A  1 274 ? -16.682 -55.126 -36.549 1.00   66.94  ? 274  LEU A CD1 1 
ATOM   2112 C  CD2 . LEU A  1 274 ? -16.691 -53.098 -35.022 1.00   48.29  ? 274  LEU A CD2 1 
ATOM   2113 N  N   . ASN A  1 275 ? -11.424 -52.958 -34.694 1.00   54.90  ? 275  ASN A N   1 
ATOM   2114 C  CA  . ASN A  1 275 ? -10.123 -53.228 -34.090 1.00   53.95  ? 275  ASN A CA  1 
ATOM   2115 C  C   . ASN A  1 275 ? -9.625  -52.136 -33.141 1.00   52.18  ? 275  ASN A C   1 
ATOM   2116 O  O   . ASN A  1 275 ? -8.739  -52.387 -32.318 1.00   53.43  ? 275  ASN A O   1 
ATOM   2117 C  CB  . ASN A  1 275 ? -9.076  -53.519 -35.164 1.00   52.60  ? 275  ASN A CB  1 
ATOM   2118 C  CG  . ASN A  1 275 ? -9.365  -54.799 -35.927 1.00   52.03  ? 275  ASN A CG  1 
ATOM   2119 O  OD1 . ASN A  1 275 ? -9.254  -54.840 -37.153 1.00   54.24  ? 275  ASN A OD1 1 
ATOM   2120 N  ND2 . ASN A  1 275 ? -9.743  -55.850 -35.205 1.00   46.58  ? 275  ASN A ND2 1 
ATOM   2121 N  N   . GLU A  1 276 ? -10.198 -50.939 -33.263 1.00   46.64  ? 276  GLU A N   1 
ATOM   2122 C  CA  . GLU A  1 276 ? -9.813  -49.778 -32.454 1.00   45.18  ? 276  GLU A CA  1 
ATOM   2123 C  C   . GLU A  1 276 ? -9.691  -50.079 -30.960 1.00   45.31  ? 276  GLU A C   1 
ATOM   2124 O  O   . GLU A  1 276 ? -8.778  -49.593 -30.291 1.00   42.80  ? 276  GLU A O   1 
ATOM   2125 C  CB  . GLU A  1 276 ? -10.815 -48.635 -32.648 1.00   45.64  ? 276  GLU A CB  1 
ATOM   2126 C  CG  . GLU A  1 276 ? -10.479 -47.680 -33.786 1.00   49.99  ? 276  GLU A CG  1 
ATOM   2127 C  CD  . GLU A  1 276 ? -11.404 -46.458 -33.837 1.00   53.47  ? 276  GLU A CD  1 
ATOM   2128 O  OE1 . GLU A  1 276 ? -12.121 -46.171 -32.846 1.00   49.74  ? 276  GLU A OE1 1 
ATOM   2129 O  OE2 . GLU A  1 276 ? -11.416 -45.783 -34.885 1.00   59.22  ? 276  GLU A OE2 1 
ATOM   2130 N  N   . ALA A  1 277 ? -10.611 -50.894 -30.453 1.00   49.61  ? 277  ALA A N   1 
ATOM   2131 C  CA  . ALA A  1 277 ? -10.735 -51.151 -29.020 1.00   47.15  ? 277  ALA A CA  1 
ATOM   2132 C  C   . ALA A  1 277 ? -9.607  -52.009 -28.439 1.00   54.03  ? 277  ALA A C   1 
ATOM   2133 O  O   . ALA A  1 277 ? -9.383  -52.006 -27.229 1.00   56.32  ? 277  ALA A O   1 
ATOM   2134 C  CB  . ALA A  1 277 ? -12.104 -51.783 -28.719 1.00   39.51  ? 277  ALA A CB  1 
ATOM   2135 N  N   . PHE A  1 278 ? -8.896  -52.731 -29.300 1.00   61.53  ? 278  PHE A N   1 
ATOM   2136 C  CA  . PHE A  1 278 ? -7.899  -53.696 -28.846 1.00   68.23  ? 278  PHE A CA  1 
ATOM   2137 C  C   . PHE A  1 278 ? -6.466  -53.229 -29.068 1.00   68.21  ? 278  PHE A C   1 
ATOM   2138 O  O   . PHE A  1 278 ? -5.529  -54.017 -28.918 1.00   71.79  ? 278  PHE A O   1 
ATOM   2139 C  CB  . PHE A  1 278 ? -8.097  -55.052 -29.544 1.00   75.74  ? 278  PHE A CB  1 
ATOM   2140 C  CG  . PHE A  1 278 ? -9.516  -55.540 -29.533 1.00   73.25  ? 278  PHE A CG  1 
ATOM   2141 C  CD1 . PHE A  1 278 ? -9.995  -56.289 -28.476 1.00   75.23  ? 278  PHE A CD1 1 
ATOM   2142 C  CD2 . PHE A  1 278 ? -10.368 -55.248 -30.581 1.00   73.42  ? 278  PHE A CD2 1 
ATOM   2143 C  CE1 . PHE A  1 278 ? -11.301 -56.736 -28.463 1.00   76.84  ? 278  PHE A CE1 1 
ATOM   2144 C  CE2 . PHE A  1 278 ? -11.673 -55.694 -30.573 1.00   75.89  ? 278  PHE A CE2 1 
ATOM   2145 C  CZ  . PHE A  1 278 ? -12.140 -56.439 -29.513 1.00   76.62  ? 278  PHE A CZ  1 
ATOM   2146 N  N   . VAL A  1 279 ? -6.284  -51.960 -29.430 1.00   65.12  ? 279  VAL A N   1 
ATOM   2147 C  CA  . VAL A  1 279 ? -4.931  -51.430 -29.613 1.00   65.67  ? 279  VAL A CA  1 
ATOM   2148 C  C   . VAL A  1 279 ? -4.269  -51.162 -28.256 1.00   61.65  ? 279  VAL A C   1 
ATOM   2149 O  O   . VAL A  1 279 ? -3.137  -50.682 -28.180 1.00   60.73  ? 279  VAL A O   1 
ATOM   2150 C  CB  . VAL A  1 279 ? -4.908  -50.153 -30.494 1.00   60.08  ? 279  VAL A CB  1 
ATOM   2151 C  CG1 . VAL A  1 279 ? -5.556  -50.422 -31.838 1.00   60.95  ? 279  VAL A CG1 1 
ATOM   2152 C  CG2 . VAL A  1 279 ? -5.598  -48.999 -29.790 1.00   55.76  ? 279  VAL A CG2 1 
ATOM   2153 N  N   . VAL A  1 280 ? -4.990  -51.491 -27.191 1.00   57.95  ? 280  VAL A N   1 
ATOM   2154 C  CA  . VAL A  1 280 ? -4.534  -51.271 -25.830 1.00   62.71  ? 280  VAL A CA  1 
ATOM   2155 C  C   . VAL A  1 280 ? -4.691  -52.588 -25.066 1.00   73.48  ? 280  VAL A C   1 
ATOM   2156 O  O   . VAL A  1 280 ? -5.587  -53.378 -25.370 1.00   80.80  ? 280  VAL A O   1 
ATOM   2157 C  CB  . VAL A  1 280 ? -5.344  -50.114 -25.174 1.00   57.01  ? 280  VAL A CB  1 
ATOM   2158 C  CG1 . VAL A  1 280 ? -6.190  -50.612 -24.010 1.00   57.76  ? 280  VAL A CG1 1 
ATOM   2159 C  CG2 . VAL A  1 280 ? -4.422  -48.974 -24.746 1.00   50.68  ? 280  VAL A CG2 1 
ATOM   2160 N  N   . PRO A  1 281 ? -3.806  -52.848 -24.090 1.00   78.93  ? 281  PRO A N   1 
ATOM   2161 C  CA  . PRO A  1 281 ? -3.846  -54.138 -23.385 1.00   82.82  ? 281  PRO A CA  1 
ATOM   2162 C  C   . PRO A  1 281 ? -5.010  -54.242 -22.396 1.00   82.96  ? 281  PRO A C   1 
ATOM   2163 O  O   . PRO A  1 281 ? -5.566  -55.327 -22.199 1.00   80.35  ? 281  PRO A O   1 
ATOM   2164 C  CB  . PRO A  1 281 ? -2.508  -54.171 -22.647 1.00   84.23  ? 281  PRO A CB  1 
ATOM   2165 C  CG  . PRO A  1 281 ? -2.166  -52.731 -22.424 1.00   86.28  ? 281  PRO A CG  1 
ATOM   2166 C  CD  . PRO A  1 281 ? -2.718  -51.977 -23.606 1.00   84.14  ? 281  PRO A CD  1 
ATOM   2167 N  N   . TYR A  1 282 ? -5.369  -53.119 -21.782 1.00   81.18  ? 282  TYR A N   1 
ATOM   2168 C  CA  . TYR A  1 282 ? -6.501  -53.077 -20.865 1.00   82.13  ? 282  TYR A CA  1 
ATOM   2169 C  C   . TYR A  1 282 ? -7.180  -51.712 -20.918 1.00   73.42  ? 282  TYR A C   1 
ATOM   2170 O  O   . TYR A  1 282 ? -6.527  -50.673 -20.820 1.00   78.78  ? 282  TYR A O   1 
ATOM   2171 C  CB  . TYR A  1 282 ? -6.068  -53.435 -19.435 1.00   90.29  ? 282  TYR A CB  1 
ATOM   2172 C  CG  . TYR A  1 282 ? -4.768  -52.794 -18.992 1.00   96.66  ? 282  TYR A CG  1 
ATOM   2173 C  CD1 . TYR A  1 282 ? -4.713  -51.444 -18.658 1.00   94.74  ? 282  TYR A CD1 1 
ATOM   2174 C  CD2 . TYR A  1 282 ? -3.598  -53.539 -18.895 1.00   100.91 ? 282  TYR A CD2 1 
ATOM   2175 C  CE1 . TYR A  1 282 ? -3.535  -50.848 -18.252 1.00   94.22  ? 282  TYR A CE1 1 
ATOM   2176 C  CE2 . TYR A  1 282 ? -2.409  -52.949 -18.486 1.00   103.00 ? 282  TYR A CE2 1 
ATOM   2177 C  CZ  . TYR A  1 282 ? -2.387  -51.600 -18.167 1.00   98.36  ? 282  TYR A CZ  1 
ATOM   2178 O  OH  . TYR A  1 282 ? -1.219  -50.997 -17.759 1.00   97.09  ? 282  TYR A OH  1 
ATOM   2179 N  N   . GLY A  1 283 ? -8.493  -51.713 -21.093 1.00   61.06  ? 283  GLY A N   1 
ATOM   2180 C  CA  . GLY A  1 283 ? -9.218  -50.467 -21.239 1.00   50.76  ? 283  GLY A CA  1 
ATOM   2181 C  C   . GLY A  1 283 ? -10.103 -50.127 -20.059 1.00   48.04  ? 283  GLY A C   1 
ATOM   2182 O  O   . GLY A  1 283 ? -10.339 -50.948 -19.167 1.00   51.50  ? 283  GLY A O   1 
ATOM   2183 N  N   . THR A  1 284 ? -10.585 -48.892 -20.046 1.00   36.39  ? 284  THR A N   1 
ATOM   2184 C  CA  . THR A  1 284 ? -11.504 -48.451 -19.013 1.00   36.19  ? 284  THR A CA  1 
ATOM   2185 C  C   . THR A  1 284 ? -12.702 -47.826 -19.716 1.00   40.60  ? 284  THR A C   1 
ATOM   2186 O  O   . THR A  1 284 ? -12.623 -47.533 -20.906 1.00   40.93  ? 284  THR A O   1 
ATOM   2187 C  CB  . THR A  1 284 ? -10.832 -47.432 -18.099 1.00   39.87  ? 284  THR A CB  1 
ATOM   2188 O  OG1 . THR A  1 284 ? -10.721 -46.174 -18.782 1.00   50.37  ? 284  THR A OG1 1 
ATOM   2189 C  CG2 . THR A  1 284 ? -9.456  -47.908 -17.710 1.00   29.99  ? 284  THR A CG2 1 
ATOM   2190 N  N   . PRO A  1 285 ? -13.826 -47.629 -18.999 1.00   39.18  ? 285  PRO A N   1 
ATOM   2191 C  CA  . PRO A  1 285 ? -14.979 -46.962 -19.620 1.00   33.72  ? 285  PRO A CA  1 
ATOM   2192 C  C   . PRO A  1 285 ? -14.629 -45.559 -20.106 1.00   39.17  ? 285  PRO A C   1 
ATOM   2193 O  O   . PRO A  1 285 ? -15.409 -44.967 -20.857 1.00   38.47  ? 285  PRO A O   1 
ATOM   2194 C  CB  . PRO A  1 285 ? -15.983 -46.865 -18.474 1.00   28.64  ? 285  PRO A CB  1 
ATOM   2195 C  CG  . PRO A  1 285 ? -15.646 -48.012 -17.598 1.00   36.43  ? 285  PRO A CG  1 
ATOM   2196 C  CD  . PRO A  1 285 ? -14.149 -48.129 -17.650 1.00   39.33  ? 285  PRO A CD  1 
ATOM   2197 N  N   . LEU A  1 286 ? -13.475 -45.046 -19.673 1.00   36.46  ? 286  LEU A N   1 
ATOM   2198 C  CA  . LEU A  1 286 ? -12.984 -43.740 -20.097 1.00   31.71  ? 286  LEU A CA  1 
ATOM   2199 C  C   . LEU A  1 286 ? -11.767 -43.837 -21.001 1.00   28.52  ? 286  LEU A C   1 
ATOM   2200 O  O   . LEU A  1 286 ? -10.998 -42.887 -21.093 1.00   28.14  ? 286  LEU A O   1 
ATOM   2201 C  CB  . LEU A  1 286 ? -12.617 -42.895 -18.884 1.00   30.08  ? 286  LEU A CB  1 
ATOM   2202 C  CG  . LEU A  1 286 ? -13.808 -42.439 -18.062 1.00   27.59  ? 286  LEU A CG  1 
ATOM   2203 C  CD1 . LEU A  1 286 ? -13.545 -42.750 -16.629 1.00   30.23  ? 286  LEU A CD1 1 
ATOM   2204 C  CD2 . LEU A  1 286 ? -14.016 -40.953 -18.260 1.00   26.02  ? 286  LEU A CD2 1 
ATOM   2205 N  N   . SER A  1 287 ? -11.579 -44.983 -21.652 1.00   31.31  ? 287  SER A N   1 
ATOM   2206 C  CA  . SER A  1 287 ? -10.444 -45.145 -22.556 1.00   28.56  ? 287  SER A CA  1 
ATOM   2207 C  C   . SER A  1 287 ? -10.592 -44.256 -23.773 1.00   30.86  ? 287  SER A C   1 
ATOM   2208 O  O   . SER A  1 287 ? -11.645 -44.228 -24.411 1.00   42.06  ? 287  SER A O   1 
ATOM   2209 C  CB  . SER A  1 287 ? -10.278 -46.596 -22.999 1.00   30.00  ? 287  SER A CB  1 
ATOM   2210 O  OG  . SER A  1 287 ? -9.858  -47.416 -21.919 1.00   38.53  ? 287  SER A OG  1 
ATOM   2211 N  N   . VAL A  1 288 ? -9.536  -43.509 -24.074 1.00   24.04  ? 288  VAL A N   1 
ATOM   2212 C  CA  . VAL A  1 288 ? -9.479  -42.725 -25.298 1.00   25.04  ? 288  VAL A CA  1 
ATOM   2213 C  C   . VAL A  1 288 ? -8.352  -43.296 -26.135 1.00   29.47  ? 288  VAL A C   1 
ATOM   2214 O  O   . VAL A  1 288 ? -7.191  -42.904 -25.983 1.00   38.27  ? 288  VAL A O   1 
ATOM   2215 C  CB  . VAL A  1 288 ? -9.235  -41.245 -25.013 1.00   19.86  ? 288  VAL A CB  1 
ATOM   2216 C  CG1 . VAL A  1 288 ? -9.016  -40.487 -26.310 1.00   30.29  ? 288  VAL A CG1 1 
ATOM   2217 C  CG2 . VAL A  1 288 ? -10.404 -40.677 -24.251 1.00   18.64  ? 288  VAL A CG2 1 
ATOM   2218 N  N   . ASN A  1 289 ? -8.689  -44.257 -26.989 1.00   30.16  ? 289  ASN A N   1 
ATOM   2219 C  CA  . ASN A  1 289 ? -7.664  -45.015 -27.698 1.00   39.95  ? 289  ASN A CA  1 
ATOM   2220 C  C   . ASN A  1 289 ? -6.978  -44.189 -28.772 1.00   39.27  ? 289  ASN A C   1 
ATOM   2221 O  O   . ASN A  1 289 ? -5.763  -44.271 -28.947 1.00   33.80  ? 289  ASN A O   1 
ATOM   2222 C  CB  . ASN A  1 289 ? -8.228  -46.320 -28.255 1.00   45.66  ? 289  ASN A CB  1 
ATOM   2223 C  CG  . ASN A  1 289 ? -8.509  -47.337 -27.159 1.00   55.20  ? 289  ASN A CG  1 
ATOM   2224 O  OD1 . ASN A  1 289 ? -7.913  -47.280 -26.078 1.00   59.75  ? 289  ASN A OD1 1 
ATOM   2225 N  ND2 . ASN A  1 289 ? -9.419  -48.270 -27.429 1.00   52.93  ? 289  ASN A ND2 1 
ATOM   2226 N  N   . PHE A  1 290 ? -7.757  -43.375 -29.474 1.00   35.27  ? 290  PHE A N   1 
ATOM   2227 C  CA  . PHE A  1 290 ? -7.188  -42.470 -30.455 1.00   33.50  ? 290  PHE A CA  1 
ATOM   2228 C  C   . PHE A  1 290 ? -7.667  -41.051 -30.218 1.00   35.44  ? 290  PHE A C   1 
ATOM   2229 O  O   . PHE A  1 290 ? -8.789  -40.699 -30.583 1.00   41.78  ? 290  PHE A O   1 
ATOM   2230 C  CB  . PHE A  1 290 ? -7.518  -42.926 -31.869 1.00   24.52  ? 290  PHE A CB  1 
ATOM   2231 C  CG  . PHE A  1 290 ? -6.838  -44.201 -32.259 1.00   27.04  ? 290  PHE A CG  1 
ATOM   2232 C  CD1 . PHE A  1 290 ? -5.499  -44.200 -32.643 1.00   31.87  ? 290  PHE A CD1 1 
ATOM   2233 C  CD2 . PHE A  1 290 ? -7.534  -45.415 -32.250 1.00   27.87  ? 290  PHE A CD2 1 
ATOM   2234 C  CE1 . PHE A  1 290 ? -4.863  -45.386 -33.013 1.00   41.59  ? 290  PHE A CE1 1 
ATOM   2235 C  CE2 . PHE A  1 290 ? -6.904  -46.599 -32.613 1.00   30.14  ? 290  PHE A CE2 1 
ATOM   2236 C  CZ  . PHE A  1 290 ? -5.572  -46.587 -32.993 1.00   44.39  ? 290  PHE A CZ  1 
ATOM   2237 N  N   . GLY A  1 291 ? -6.810  -40.243 -29.599 1.00   31.14  ? 291  GLY A N   1 
ATOM   2238 C  CA  . GLY A  1 291 ? -7.132  -38.855 -29.317 1.00   27.30  ? 291  GLY A CA  1 
ATOM   2239 C  C   . GLY A  1 291 ? -5.992  -37.906 -29.626 1.00   29.68  ? 291  GLY A C   1 
ATOM   2240 O  O   . GLY A  1 291 ? -5.045  -38.261 -30.320 1.00   32.90  ? 291  GLY A O   1 
ATOM   2241 N  N   . PRO A  1 292 ? -6.077  -36.676 -29.120 1.00   30.34  ? 292  PRO A N   1 
ATOM   2242 C  CA  . PRO A  1 292 ? -5.046  -35.678 -29.450 1.00   34.66  ? 292  PRO A CA  1 
ATOM   2243 C  C   . PRO A  1 292 ? -3.621  -36.132 -29.094 1.00   36.91  ? 292  PRO A C   1 
ATOM   2244 O  O   . PRO A  1 292 ? -3.415  -36.826 -28.097 1.00   36.93  ? 292  PRO A O   1 
ATOM   2245 C  CB  . PRO A  1 292 ? -5.455  -34.460 -28.610 1.00   27.49  ? 292  PRO A CB  1 
ATOM   2246 C  CG  . PRO A  1 292 ? -6.940  -34.630 -28.396 1.00   23.04  ? 292  PRO A CG  1 
ATOM   2247 C  CD  . PRO A  1 292 ? -7.172  -36.114 -28.312 1.00   19.09  ? 292  PRO A CD  1 
ATOM   2248 N  N   . THR A  1 293 ? -2.650  -35.759 -29.919 1.00   35.58  ? 293  THR A N   1 
ATOM   2249 C  CA  . THR A  1 293 ? -1.248  -35.962 -29.570 1.00   35.49  ? 293  THR A CA  1 
ATOM   2250 C  C   . THR A  1 293 ? -0.468  -34.684 -29.811 1.00   32.83  ? 293  THR A C   1 
ATOM   2251 O  O   . THR A  1 293 ? -0.995  -33.718 -30.360 1.00   36.08  ? 293  THR A O   1 
ATOM   2252 C  CB  . THR A  1 293 ? -0.566  -37.091 -30.389 1.00   32.39  ? 293  THR A CB  1 
ATOM   2253 O  OG1 . THR A  1 293 ? -0.870  -36.939 -31.784 1.00   27.76  ? 293  THR A OG1 1 
ATOM   2254 C  CG2 . THR A  1 293 ? -1.014  -38.453 -29.908 1.00   38.54  ? 293  THR A CG2 1 
ATOM   2255 N  N   . VAL A  1 294 ? 0.791   -34.689 -29.394 1.00   24.69  ? 294  VAL A N   1 
ATOM   2256 C  CA  . VAL A  1 294 ? 1.684   -33.595 -29.697 1.00   29.06  ? 294  VAL A CA  1 
ATOM   2257 C  C   . VAL A  1 294 ? 2.232   -33.828 -31.092 1.00   27.49  ? 294  VAL A C   1 
ATOM   2258 O  O   . VAL A  1 294 ? 3.226   -34.508 -31.276 1.00   32.53  ? 294  VAL A O   1 
ATOM   2259 C  CB  . VAL A  1 294 ? 2.820   -33.475 -28.648 1.00   40.37  ? 294  VAL A CB  1 
ATOM   2260 C  CG1 . VAL A  1 294 ? 3.638   -32.218 -28.891 1.00   31.71  ? 294  VAL A CG1 1 
ATOM   2261 C  CG2 . VAL A  1 294 ? 2.237   -33.473 -27.228 1.00   23.39  ? 294  VAL A CG2 1 
ATOM   2262 N  N   . ASP A  1 295 ? 1.556   -33.274 -32.084 1.00   33.45  ? 295  ASP A N   1 
ATOM   2263 C  CA  . ASP A  1 295 ? 1.917   -33.507 -33.478 1.00   35.03  ? 295  ASP A CA  1 
ATOM   2264 C  C   . ASP A  1 295 ? 3.066   -32.616 -33.993 1.00   33.66  ? 295  ASP A C   1 
ATOM   2265 O  O   . ASP A  1 295 ? 3.620   -32.860 -35.061 1.00   35.88  ? 295  ASP A O   1 
ATOM   2266 C  CB  . ASP A  1 295 ? 0.675   -33.346 -34.360 1.00   32.31  ? 295  ASP A CB  1 
ATOM   2267 C  CG  . ASP A  1 295 ? 0.092   -31.945 -34.302 1.00   33.66  ? 295  ASP A CG  1 
ATOM   2268 O  OD1 . ASP A  1 295 ? 0.438   -31.182 -33.375 1.00   35.27  ? 295  ASP A OD1 1 
ATOM   2269 O  OD2 . ASP A  1 295 ? -0.714  -31.602 -35.191 1.00   36.03  ? 295  ASP A OD2 1 
ATOM   2270 N  N   . GLY A  1 296 ? 3.431   -31.588 -33.232 1.00   34.09  ? 296  GLY A N   1 
ATOM   2271 C  CA  . GLY A  1 296 ? 4.415   -30.625 -33.702 1.00   32.14  ? 296  GLY A CA  1 
ATOM   2272 C  C   . GLY A  1 296 ? 3.834   -29.688 -34.749 1.00   42.04  ? 296  GLY A C   1 
ATOM   2273 O  O   . GLY A  1 296 ? 4.562   -29.045 -35.511 1.00   43.34  ? 296  GLY A O   1 
ATOM   2274 N  N   . ASP A  1 297 ? 2.506   -29.617 -34.786 1.00   46.45  ? 297  ASP A N   1 
ATOM   2275 C  CA  . ASP A  1 297 ? 1.804   -28.782 -35.752 1.00   41.01  ? 297  ASP A CA  1 
ATOM   2276 C  C   . ASP A  1 297 ? 0.661   -28.028 -35.062 1.00   35.65  ? 297  ASP A C   1 
ATOM   2277 O  O   . ASP A  1 297 ? 0.784   -26.843 -34.778 1.00   36.29  ? 297  ASP A O   1 
ATOM   2278 C  CB  . ASP A  1 297 ? 1.295   -29.628 -36.921 1.00   33.85  ? 297  ASP A CB  1 
ATOM   2279 C  CG  . ASP A  1 297 ? 0.855   -28.785 -38.109 1.00   39.19  ? 297  ASP A CG  1 
ATOM   2280 O  OD1 . ASP A  1 297 ? 0.616   -27.566 -37.932 1.00   41.74  ? 297  ASP A OD1 1 
ATOM   2281 O  OD2 . ASP A  1 297 ? 0.741   -29.348 -39.223 1.00   37.17  ? 297  ASP A OD2 1 
ATOM   2282 N  N   . PHE A  1 298 ? -0.444  -28.716 -34.795 1.00   31.88  ? 298  PHE A N   1 
ATOM   2283 C  CA  . PHE A  1 298 ? -1.551  -28.123 -34.061 1.00   23.43  ? 298  PHE A CA  1 
ATOM   2284 C  C   . PHE A  1 298 ? -1.102  -27.873 -32.641 1.00   29.92  ? 298  PHE A C   1 
ATOM   2285 O  O   . PHE A  1 298 ? -1.467  -26.872 -32.031 1.00   32.59  ? 298  PHE A O   1 
ATOM   2286 C  CB  . PHE A  1 298 ? -2.744  -29.078 -34.033 1.00   22.53  ? 298  PHE A CB  1 
ATOM   2287 C  CG  . PHE A  1 298 ? -3.971  -28.492 -33.404 1.00   19.89  ? 298  PHE A CG  1 
ATOM   2288 C  CD1 . PHE A  1 298 ? -4.156  -28.536 -32.025 1.00   16.62  ? 298  PHE A CD1 1 
ATOM   2289 C  CD2 . PHE A  1 298 ? -4.943  -27.888 -34.190 1.00   21.12  ? 298  PHE A CD2 1 
ATOM   2290 C  CE1 . PHE A  1 298 ? -5.290  -27.990 -31.438 1.00   28.14  ? 298  PHE A CE1 1 
ATOM   2291 C  CE2 . PHE A  1 298 ? -6.089  -27.340 -33.611 1.00   24.69  ? 298  PHE A CE2 1 
ATOM   2292 C  CZ  . PHE A  1 298 ? -6.262  -27.387 -32.235 1.00   24.12  ? 298  PHE A CZ  1 
ATOM   2293 N  N   . LEU A  1 299 ? -0.330  -28.825 -32.123 1.00   31.34  ? 299  LEU A N   1 
ATOM   2294 C  CA  . LEU A  1 299 ? 0.227   -28.790 -30.783 1.00   27.67  ? 299  LEU A CA  1 
ATOM   2295 C  C   . LEU A  1 299 ? 1.740   -28.919 -30.918 1.00   36.06  ? 299  LEU A C   1 
ATOM   2296 O  O   . LEU A  1 299 ? 2.228   -29.929 -31.437 1.00   34.25  ? 299  LEU A O   1 
ATOM   2297 C  CB  . LEU A  1 299 ? -0.280  -29.988 -30.005 1.00   26.74  ? 299  LEU A CB  1 
ATOM   2298 C  CG  . LEU A  1 299 ? -1.221  -29.742 -28.842 1.00   39.62  ? 299  LEU A CG  1 
ATOM   2299 C  CD1 . LEU A  1 299 ? -1.551  -31.079 -28.189 1.00   40.47  ? 299  LEU A CD1 1 
ATOM   2300 C  CD2 . LEU A  1 299 ? -0.582  -28.780 -27.847 1.00   42.87  ? 299  LEU A CD2 1 
ATOM   2301 N  N   . THR A  1 300 ? 2.478   -27.916 -30.443 1.00   36.50  ? 300  THR A N   1 
ATOM   2302 C  CA  . THR A  1 300 ? 3.922   -27.839 -30.676 1.00   34.23  ? 300  THR A CA  1 
ATOM   2303 C  C   . THR A  1 300 ? 4.773   -28.332 -29.512 1.00   30.29  ? 300  THR A C   1 
ATOM   2304 O  O   . THR A  1 300 ? 5.994   -28.380 -29.618 1.00   42.71  ? 300  THR A O   1 
ATOM   2305 C  CB  . THR A  1 300 ? 4.366   -26.396 -30.995 1.00   36.33  ? 300  THR A CB  1 
ATOM   2306 O  OG1 . THR A  1 300 ? 4.280   -25.596 -29.809 1.00   37.30  ? 300  THR A OG1 1 
ATOM   2307 C  CG2 . THR A  1 300 ? 3.481   -25.790 -32.065 1.00   36.53  ? 300  THR A CG2 1 
ATOM   2308 N  N   . ASP A  1 301 ? 4.131   -28.684 -28.406 1.00   26.38  ? 301  ASP A N   1 
ATOM   2309 C  CA  . ASP A  1 301 ? 4.830   -29.154 -27.213 1.00   32.81  ? 301  ASP A CA  1 
ATOM   2310 C  C   . ASP A  1 301 ? 3.790   -29.798 -26.302 1.00   31.04  ? 301  ASP A C   1 
ATOM   2311 O  O   . ASP A  1 301 ? 2.600   -29.701 -26.563 1.00   28.16  ? 301  ASP A O   1 
ATOM   2312 C  CB  . ASP A  1 301 ? 5.499   -27.970 -26.498 1.00   36.38  ? 301  ASP A CB  1 
ATOM   2313 C  CG  . ASP A  1 301 ? 6.620   -28.396 -25.546 1.00   36.88  ? 301  ASP A CG  1 
ATOM   2314 O  OD1 . ASP A  1 301 ? 6.736   -29.602 -25.233 1.00   26.96  ? 301  ASP A OD1 1 
ATOM   2315 O  OD2 . ASP A  1 301 ? 7.389   -27.509 -25.106 1.00   37.65  ? 301  ASP A OD2 1 
ATOM   2316 N  N   . MET A  1 302 ? 4.225   -30.457 -25.234 1.00   34.79  ? 302  MET A N   1 
ATOM   2317 C  CA  . MET A  1 302 ? 3.271   -30.986 -24.263 1.00   35.17  ? 302  MET A CA  1 
ATOM   2318 C  C   . MET A  1 302 ? 2.447   -29.856 -23.649 1.00   35.54  ? 302  MET A C   1 
ATOM   2319 O  O   . MET A  1 302 ? 2.994   -28.875 -23.140 1.00   42.85  ? 302  MET A O   1 
ATOM   2320 C  CB  . MET A  1 302 ? 3.988   -31.790 -23.191 1.00   34.46  ? 302  MET A CB  1 
ATOM   2321 C  CG  . MET A  1 302 ? 4.949   -32.817 -23.770 1.00   38.68  ? 302  MET A CG  1 
ATOM   2322 S  SD  . MET A  1 302 ? 5.668   -33.868 -22.495 1.00   78.10  ? 302  MET A SD  1 
ATOM   2323 C  CE  . MET A  1 302 ? 4.161   -34.634 -21.867 1.00   82.78  ? 302  MET A CE  1 
ATOM   2324 N  N   . PRO A  1 303 ? 1.120   -29.985 -23.710 1.00   32.56  ? 303  PRO A N   1 
ATOM   2325 C  CA  . PRO A  1 303 ? 0.251   -28.852 -23.359 1.00   27.94  ? 303  PRO A CA  1 
ATOM   2326 C  C   . PRO A  1 303 ? 0.292   -28.469 -21.873 1.00   27.73  ? 303  PRO A C   1 
ATOM   2327 O  O   . PRO A  1 303 ? -0.045  -27.335 -21.533 1.00   30.06  ? 303  PRO A O   1 
ATOM   2328 C  CB  . PRO A  1 303 ? -1.148  -29.326 -23.797 1.00   22.27  ? 303  PRO A CB  1 
ATOM   2329 C  CG  . PRO A  1 303 ? -1.058  -30.813 -23.826 1.00   26.71  ? 303  PRO A CG  1 
ATOM   2330 C  CD  . PRO A  1 303 ? 0.364   -31.176 -24.141 1.00   25.94  ? 303  PRO A CD  1 
ATOM   2331 N  N   . ASP A  1 304 ? 0.702   -29.383 -21.001 1.00   24.76  ? 304  ASP A N   1 
ATOM   2332 C  CA  . ASP A  1 304 ? 0.884   -29.026 -19.600 1.00   33.05  ? 304  ASP A CA  1 
ATOM   2333 C  C   . ASP A  1 304 ? 2.000   -27.987 -19.438 1.00   31.12  ? 304  ASP A C   1 
ATOM   2334 O  O   . ASP A  1 304 ? 1.917   -27.084 -18.588 1.00   26.85  ? 304  ASP A O   1 
ATOM   2335 C  CB  . ASP A  1 304 ? 1.134   -30.264 -18.729 1.00   49.63  ? 304  ASP A CB  1 
ATOM   2336 C  CG  . ASP A  1 304 ? 2.053   -31.268 -19.390 1.00   69.04  ? 304  ASP A CG  1 
ATOM   2337 O  OD1 . ASP A  1 304 ? 1.862   -31.538 -20.597 1.00   78.92  ? 304  ASP A OD1 1 
ATOM   2338 O  OD2 . ASP A  1 304 ? 2.964   -31.791 -18.706 1.00   73.16  ? 304  ASP A OD2 1 
ATOM   2339 N  N   . ILE A  1 305 ? 3.032   -28.100 -20.269 1.00   30.20  ? 305  ILE A N   1 
ATOM   2340 C  CA  . ILE A  1 305 ? 4.118   -27.124 -20.254 1.00   29.99  ? 305  ILE A CA  1 
ATOM   2341 C  C   . ILE A  1 305 ? 3.660   -25.752 -20.785 1.00   28.53  ? 305  ILE A C   1 
ATOM   2342 O  O   . ILE A  1 305 ? 3.928   -24.722 -20.161 1.00   27.41  ? 305  ILE A O   1 
ATOM   2343 C  CB  . ILE A  1 305 ? 5.363   -27.640 -21.015 1.00   30.48  ? 305  ILE A CB  1 
ATOM   2344 C  CG1 . ILE A  1 305 ? 5.777   -29.007 -20.463 1.00   35.25  ? 305  ILE A CG1 1 
ATOM   2345 C  CG2 . ILE A  1 305 ? 6.519   -26.645 -20.915 1.00   25.21  ? 305  ILE A CG2 1 
ATOM   2346 C  CD1 . ILE A  1 305 ? 6.760   -29.786 -21.342 1.00   26.74  ? 305  ILE A CD1 1 
ATOM   2347 N  N   . LEU A  1 306 ? 2.961   -25.747 -21.922 1.00   24.02  ? 306  LEU A N   1 
ATOM   2348 C  CA  . LEU A  1 306 ? 2.452   -24.513 -22.524 1.00   24.17  ? 306  LEU A CA  1 
ATOM   2349 C  C   . LEU A  1 306 ? 1.553   -23.730 -21.550 1.00   30.92  ? 306  LEU A C   1 
ATOM   2350 O  O   . LEU A  1 306 ? 1.701   -22.500 -21.388 1.00   27.29  ? 306  LEU A O   1 
ATOM   2351 C  CB  . LEU A  1 306 ? 1.685   -24.823 -23.813 1.00   18.81  ? 306  LEU A CB  1 
ATOM   2352 C  CG  . LEU A  1 306 ? 2.447   -25.538 -24.938 1.00   25.03  ? 306  LEU A CG  1 
ATOM   2353 C  CD1 . LEU A  1 306 ? 1.537   -25.797 -26.130 1.00   25.97  ? 306  LEU A CD1 1 
ATOM   2354 C  CD2 . LEU A  1 306 ? 3.660   -24.752 -25.379 1.00   21.46  ? 306  LEU A CD2 1 
ATOM   2355 N  N   . LEU A  1 307 ? 0.632   -24.459 -20.913 1.00   27.70  ? 307  LEU A N   1 
ATOM   2356 C  CA  . LEU A  1 307 ? -0.248  -23.921 -19.882 1.00   25.96  ? 307  LEU A CA  1 
ATOM   2357 C  C   . LEU A  1 307 ? 0.567   -23.329 -18.736 1.00   32.25  ? 307  LEU A C   1 
ATOM   2358 O  O   . LEU A  1 307 ? 0.396   -22.159 -18.369 1.00   32.47  ? 307  LEU A O   1 
ATOM   2359 C  CB  . LEU A  1 307 ? -1.179  -25.021 -19.339 1.00   28.18  ? 307  LEU A CB  1 
ATOM   2360 C  CG  . LEU A  1 307 ? -2.100  -24.653 -18.160 1.00   32.03  ? 307  LEU A CG  1 
ATOM   2361 C  CD1 . LEU A  1 307 ? -2.802  -23.304 -18.380 1.00   30.72  ? 307  LEU A CD1 1 
ATOM   2362 C  CD2 . LEU A  1 307 ? -3.142  -25.736 -17.883 1.00   27.47  ? 307  LEU A CD2 1 
ATOM   2363 N  N   . GLU A  1 308 ? 1.452   -24.148 -18.177 1.00   33.82  ? 308  GLU A N   1 
ATOM   2364 C  CA  . GLU A  1 308 ? 2.253   -23.751 -17.023 1.00   31.03  ? 308  GLU A CA  1 
ATOM   2365 C  C   . GLU A  1 308 ? 3.069   -22.494 -17.312 1.00   31.69  ? 308  GLU A C   1 
ATOM   2366 O  O   . GLU A  1 308 ? 3.317   -21.680 -16.423 1.00   29.64  ? 308  GLU A O   1 
ATOM   2367 C  CB  . GLU A  1 308 ? 3.176   -24.903 -16.615 1.00   27.75  ? 308  GLU A CB  1 
ATOM   2368 C  CG  . GLU A  1 308 ? 4.146   -24.585 -15.495 1.00   30.53  ? 308  GLU A CG  1 
ATOM   2369 C  CD  . GLU A  1 308 ? 3.461   -24.317 -14.174 1.00   36.79  ? 308  GLU A CD  1 
ATOM   2370 O  OE1 . GLU A  1 308 ? 2.301   -24.740 -14.014 1.00   48.32  ? 308  GLU A OE1 1 
ATOM   2371 O  OE2 . GLU A  1 308 ? 4.085   -23.696 -13.285 1.00   37.31  ? 308  GLU A OE2 1 
ATOM   2372 N  N   . LEU A  1 309 ? 3.454   -22.327 -18.572 1.00   30.25  ? 309  LEU A N   1 
ATOM   2373 C  CA  . LEU A  1 309 ? 4.384   -21.276 -18.947 1.00   30.34  ? 309  LEU A CA  1 
ATOM   2374 C  C   . LEU A  1 309 ? 3.721   -20.141 -19.707 1.00   35.22  ? 309  LEU A C   1 
ATOM   2375 O  O   . LEU A  1 309 ? 4.401   -19.325 -20.339 1.00   38.09  ? 309  LEU A O   1 
ATOM   2376 C  CB  . LEU A  1 309 ? 5.549   -21.862 -19.751 1.00   23.38  ? 309  LEU A CB  1 
ATOM   2377 C  CG  . LEU A  1 309 ? 6.481   -22.783 -18.955 1.00   29.93  ? 309  LEU A CG  1 
ATOM   2378 C  CD1 . LEU A  1 309 ? 7.656   -23.219 -19.824 1.00   26.39  ? 309  LEU A CD1 1 
ATOM   2379 C  CD2 . LEU A  1 309 ? 6.947   -22.134 -17.653 1.00   25.55  ? 309  LEU A CD2 1 
ATOM   2380 N  N   . GLY A  1 310 ? 2.393   -20.096 -19.647 1.00   35.29  ? 310  GLY A N   1 
ATOM   2381 C  CA  . GLY A  1 310 ? 1.641   -18.966 -20.165 1.00   32.12  ? 310  GLY A CA  1 
ATOM   2382 C  C   . GLY A  1 310 ? 1.584   -18.867 -21.673 1.00   32.05  ? 310  GLY A C   1 
ATOM   2383 O  O   . GLY A  1 310 ? 1.390   -17.788 -22.225 1.00   28.50  ? 310  GLY A O   1 
ATOM   2384 N  N   . GLN A  1 311 ? 1.750   -19.991 -22.350 1.00   33.61  ? 311  GLN A N   1 
ATOM   2385 C  CA  . GLN A  1 311 ? 1.745   -19.961 -23.803 1.00   35.91  ? 311  GLN A CA  1 
ATOM   2386 C  C   . GLN A  1 311 ? 0.390   -20.339 -24.357 1.00   34.92  ? 311  GLN A C   1 
ATOM   2387 O  O   . GLN A  1 311 ? 0.171   -21.484 -24.752 1.00   34.73  ? 311  GLN A O   1 
ATOM   2388 C  CB  . GLN A  1 311 ? 2.812   -20.888 -24.343 1.00   34.16  ? 311  GLN A CB  1 
ATOM   2389 C  CG  . GLN A  1 311 ? 4.154   -20.515 -23.813 1.00   43.46  ? 311  GLN A CG  1 
ATOM   2390 C  CD  . GLN A  1 311 ? 4.633   -19.206 -24.390 1.00   49.89  ? 311  GLN A CD  1 
ATOM   2391 O  OE1 . GLN A  1 311 ? 4.654   -19.033 -25.611 1.00   54.30  ? 311  GLN A OE1 1 
ATOM   2392 N  NE2 . GLN A  1 311 ? 5.021   -18.272 -23.519 1.00   44.80  ? 311  GLN A NE2 1 
ATOM   2393 N  N   . PHE A  1 312 ? -0.516  -19.366 -24.368 1.00   31.95  ? 312  PHE A N   1 
ATOM   2394 C  CA  . PHE A  1 312 ? -1.849  -19.554 -24.927 1.00   29.45  ? 312  PHE A CA  1 
ATOM   2395 C  C   . PHE A  1 312 ? -2.503  -18.227 -25.307 1.00   27.88  ? 312  PHE A C   1 
ATOM   2396 O  O   . PHE A  1 312 ? -1.968  -17.153 -25.018 1.00   32.48  ? 312  PHE A O   1 
ATOM   2397 C  CB  . PHE A  1 312 ? -2.740  -20.304 -23.945 1.00   21.90  ? 312  PHE A CB  1 
ATOM   2398 C  CG  . PHE A  1 312 ? -2.609  -19.843 -22.534 1.00   21.78  ? 312  PHE A CG  1 
ATOM   2399 C  CD1 . PHE A  1 312 ? -3.359  -18.776 -22.068 1.00   29.33  ? 312  PHE A CD1 1 
ATOM   2400 C  CD2 . PHE A  1 312 ? -1.734  -20.475 -21.662 1.00   26.81  ? 312  PHE A CD2 1 
ATOM   2401 C  CE1 . PHE A  1 312 ? -3.245  -18.344 -20.741 1.00   33.08  ? 312  PHE A CE1 1 
ATOM   2402 C  CE2 . PHE A  1 312 ? -1.611  -20.054 -20.338 1.00   30.08  ? 312  PHE A CE2 1 
ATOM   2403 C  CZ  . PHE A  1 312 ? -2.364  -18.981 -19.880 1.00   32.03  ? 312  PHE A CZ  1 
ATOM   2404 N  N   . LYS A  1 313 ? -3.660  -18.315 -25.956 1.00   22.91  ? 313  LYS A N   1 
ATOM   2405 C  CA  . LYS A  1 313 ? -4.442  -17.136 -26.290 1.00   26.26  ? 313  LYS A CA  1 
ATOM   2406 C  C   . LYS A  1 313 ? -4.899  -16.440 -25.017 1.00   28.60  ? 313  LYS A C   1 
ATOM   2407 O  O   . LYS A  1 313 ? -5.517  -17.054 -24.142 1.00   34.01  ? 313  LYS A O   1 
ATOM   2408 C  CB  . LYS A  1 313 ? -5.659  -17.516 -27.132 1.00   22.61  ? 313  LYS A CB  1 
ATOM   2409 C  CG  . LYS A  1 313 ? -6.567  -16.336 -27.467 1.00   24.84  ? 313  LYS A CG  1 
ATOM   2410 C  CD  . LYS A  1 313 ? -7.793  -16.814 -28.255 1.00   33.57  ? 313  LYS A CD  1 
ATOM   2411 C  CE  . LYS A  1 313 ? -8.597  -15.654 -28.823 1.00   30.53  ? 313  LYS A CE  1 
ATOM   2412 N  NZ  . LYS A  1 313 ? -7.813  -14.820 -29.785 1.00   32.69  ? 313  LYS A NZ  1 
ATOM   2413 N  N   . LYS A  1 314 ? -4.573  -15.159 -24.911 1.00   23.03  ? 314  LYS A N   1 
ATOM   2414 C  CA  . LYS A  1 314 ? -4.989  -14.343 -23.771 1.00   24.63  ? 314  LYS A CA  1 
ATOM   2415 C  C   . LYS A  1 314 ? -6.393  -13.772 -23.996 1.00   26.47  ? 314  LYS A C   1 
ATOM   2416 O  O   . LYS A  1 314 ? -6.591  -12.899 -24.841 1.00   30.60  ? 314  LYS A O   1 
ATOM   2417 C  CB  . LYS A  1 314 ? -3.986  -13.208 -23.544 1.00   20.48  ? 314  LYS A CB  1 
ATOM   2418 C  CG  . LYS A  1 314 ? -2.571  -13.680 -23.213 1.00   22.59  ? 314  LYS A CG  1 
ATOM   2419 C  CD  . LYS A  1 314 ? -2.582  -14.686 -22.054 1.00   28.52  ? 314  LYS A CD  1 
ATOM   2420 C  CE  . LYS A  1 314 ? -1.190  -15.162 -21.706 1.00   29.35  ? 314  LYS A CE  1 
ATOM   2421 N  NZ  . LYS A  1 314 ? -0.475  -15.515 -22.960 1.00   38.14  ? 314  LYS A NZ  1 
ATOM   2422 N  N   . THR A  1 315 ? -7.364  -14.279 -23.248 1.00   20.79  ? 315  THR A N   1 
ATOM   2423 C  CA  . THR A  1 315 ? -8.758  -13.895 -23.432 1.00   19.72  ? 315  THR A CA  1 
ATOM   2424 C  C   . THR A  1 315 ? -9.593  -14.418 -22.250 1.00   22.70  ? 315  THR A C   1 
ATOM   2425 O  O   . THR A  1 315 ? -9.063  -15.018 -21.315 1.00   23.39  ? 315  THR A O   1 
ATOM   2426 C  CB  . THR A  1 315 ? -9.313  -14.472 -24.753 1.00   19.11  ? 315  THR A CB  1 
ATOM   2427 O  OG1 . THR A  1 315 ? -10.664 -14.040 -24.941 1.00   20.85  ? 315  THR A OG1 1 
ATOM   2428 C  CG2 . THR A  1 315 ? -9.279  -15.998 -24.722 1.00   14.31  ? 315  THR A CG2 1 
ATOM   2429 N  N   . GLN A  1 316 ? -10.901 -14.209 -22.287 1.00   20.71  ? 316  GLN A N   1 
ATOM   2430 C  CA  . GLN A  1 316 ? -11.733 -14.637 -21.173 1.00   19.95  ? 316  GLN A CA  1 
ATOM   2431 C  C   . GLN A  1 316 ? -12.137 -16.073 -21.364 1.00   21.15  ? 316  GLN A C   1 
ATOM   2432 O  O   . GLN A  1 316 ? -12.355 -16.514 -22.484 1.00   27.39  ? 316  GLN A O   1 
ATOM   2433 C  CB  . GLN A  1 316 ? -12.980 -13.762 -21.038 1.00   23.88  ? 316  GLN A CB  1 
ATOM   2434 C  CG  . GLN A  1 316 ? -12.677 -12.303 -20.776 1.00   20.85  ? 316  GLN A CG  1 
ATOM   2435 C  CD  . GLN A  1 316 ? -12.240 -11.572 -22.043 1.00   23.73  ? 316  GLN A CD  1 
ATOM   2436 O  OE1 . GLN A  1 316 ? -12.768 -11.816 -23.137 1.00   25.46  ? 316  GLN A OE1 1 
ATOM   2437 N  NE2 . GLN A  1 316 ? -11.262 -10.687 -21.902 1.00   16.89  ? 316  GLN A NE2 1 
ATOM   2438 N  N   . ILE A  1 317 ? -12.212 -16.811 -20.267 1.00   25.34  ? 317  ILE A N   1 
ATOM   2439 C  CA  . ILE A  1 317 ? -12.771 -18.148 -20.314 1.00   25.63  ? 317  ILE A CA  1 
ATOM   2440 C  C   . ILE A  1 317 ? -13.884 -18.325 -19.292 1.00   24.54  ? 317  ILE A C   1 
ATOM   2441 O  O   . ILE A  1 317 ? -13.882 -17.701 -18.229 1.00   17.43  ? 317  ILE A O   1 
ATOM   2442 C  CB  . ILE A  1 317 ? -11.728 -19.249 -20.073 1.00   18.48  ? 317  ILE A CB  1 
ATOM   2443 C  CG1 . ILE A  1 317 ? -11.103 -19.102 -18.692 1.00   20.53  ? 317  ILE A CG1 1 
ATOM   2444 C  CG2 . ILE A  1 317 ? -10.696 -19.280 -21.186 1.00   19.70  ? 317  ILE A CG2 1 
ATOM   2445 C  CD1 . ILE A  1 317 ? -10.062 -20.185 -18.404 1.00   26.76  ? 317  ILE A CD1 1 
ATOM   2446 N  N   . LEU A  1 318 ? -14.827 -19.191 -19.643 1.00   20.01  ? 318  LEU A N   1 
ATOM   2447 C  CA  . LEU A  1 318 ? -15.903 -19.587 -18.764 1.00   19.46  ? 318  LEU A CA  1 
ATOM   2448 C  C   . LEU A  1 318 ? -15.801 -21.109 -18.646 1.00   20.83  ? 318  LEU A C   1 
ATOM   2449 O  O   . LEU A  1 318 ? -15.888 -21.841 -19.650 1.00   17.82  ? 318  LEU A O   1 
ATOM   2450 C  CB  . LEU A  1 318 ? -17.249 -19.149 -19.358 1.00   18.37  ? 318  LEU A CB  1 
ATOM   2451 C  CG  . LEU A  1 318 ? -18.519 -19.152 -18.504 1.00   20.60  ? 318  LEU A CG  1 
ATOM   2452 C  CD1 . LEU A  1 318 ? -19.622 -18.428 -19.250 1.00   25.16  ? 318  LEU A CD1 1 
ATOM   2453 C  CD2 . LEU A  1 318 ? -18.970 -20.570 -18.143 1.00   18.39  ? 318  LEU A CD2 1 
ATOM   2454 N  N   . VAL A  1 319 ? -15.614 -21.581 -17.416 1.00   18.04  ? 319  VAL A N   1 
ATOM   2455 C  CA  . VAL A  1 319 ? -15.327 -22.986 -17.164 1.00   11.71  ? 319  VAL A CA  1 
ATOM   2456 C  C   . VAL A  1 319 ? -16.277 -23.489 -16.090 1.00   23.69  ? 319  VAL A C   1 
ATOM   2457 O  O   . VAL A  1 319 ? -16.677 -22.724 -15.199 1.00   29.65  ? 319  VAL A O   1 
ATOM   2458 C  CB  . VAL A  1 319 ? -13.854 -23.168 -16.686 1.00   20.17  ? 319  VAL A CB  1 
ATOM   2459 C  CG1 . VAL A  1 319 ? -13.474 -24.638 -16.628 1.00   13.26  ? 319  VAL A CG1 1 
ATOM   2460 C  CG2 . VAL A  1 319 ? -12.874 -22.405 -17.598 1.00   12.20  ? 319  VAL A CG2 1 
ATOM   2461 N  N   . GLY A  1 320 ? -16.666 -24.761 -16.177 1.00   13.27  ? 320  GLY A N   1 
ATOM   2462 C  CA  . GLY A  1 320 ? -17.483 -25.352 -15.136 1.00   11.32  ? 320  GLY A CA  1 
ATOM   2463 C  C   . GLY A  1 320 ? -17.637 -26.851 -15.227 1.00   25.89  ? 320  GLY A C   1 
ATOM   2464 O  O   . GLY A  1 320 ? -17.180 -27.489 -16.189 1.00   24.42  ? 320  GLY A O   1 
ATOM   2465 N  N   . VAL A  1 321 ? -18.270 -27.415 -14.202 1.00   18.04  ? 321  VAL A N   1 
ATOM   2466 C  CA  . VAL A  1 321 ? -18.484 -28.853 -14.119 1.00   22.08  ? 321  VAL A CA  1 
ATOM   2467 C  C   . VAL A  1 321 ? -19.816 -29.116 -13.434 1.00   21.14  ? 321  VAL A C   1 
ATOM   2468 O  O   . VAL A  1 321 ? -20.391 -28.224 -12.811 1.00   28.91  ? 321  VAL A O   1 
ATOM   2469 C  CB  . VAL A  1 321 ? -17.398 -29.544 -13.272 1.00   21.25  ? 321  VAL A CB  1 
ATOM   2470 C  CG1 . VAL A  1 321 ? -16.007 -29.385 -13.900 1.00   11.30  ? 321  VAL A CG1 1 
ATOM   2471 C  CG2 . VAL A  1 321 ? -17.436 -28.998 -11.858 1.00   11.91  ? 321  VAL A CG2 1 
ATOM   2472 N  N   . ASN A  1 322 ? -20.279 -30.355 -13.530 1.00   18.03  ? 322  ASN A N   1 
ATOM   2473 C  CA  . ASN A  1 322 ? -21.511 -30.793 -12.891 1.00   13.13  ? 322  ASN A CA  1 
ATOM   2474 C  C   . ASN A  1 322 ? -21.187 -31.526 -11.598 1.00   24.55  ? 322  ASN A C   1 
ATOM   2475 O  O   . ASN A  1 322 ? -20.093 -32.087 -11.456 1.00   23.86  ? 322  ASN A O   1 
ATOM   2476 C  CB  . ASN A  1 322 ? -22.285 -31.727 -13.827 1.00   16.42  ? 322  ASN A CB  1 
ATOM   2477 C  CG  . ASN A  1 322 ? -22.682 -31.050 -15.132 1.00   25.35  ? 322  ASN A CG  1 
ATOM   2478 O  OD1 . ASN A  1 322 ? -22.629 -29.823 -15.254 1.00   34.21  ? 322  ASN A OD1 1 
ATOM   2479 N  ND2 . ASN A  1 322 ? -23.089 -31.846 -16.109 1.00   21.46  ? 322  ASN A ND2 1 
ATOM   2480 N  N   . LYS A  1 323 ? -22.143 -31.534 -10.666 1.00   21.95  ? 323  LYS A N   1 
ATOM   2481 C  CA  . LYS A  1 323 ? -21.944 -32.094 -9.323  1.00   19.84  ? 323  LYS A CA  1 
ATOM   2482 C  C   . LYS A  1 323 ? -21.603 -33.594 -9.292  1.00   27.85  ? 323  LYS A C   1 
ATOM   2483 O  O   . LYS A  1 323 ? -20.849 -34.047 -8.423  1.00   38.50  ? 323  LYS A O   1 
ATOM   2484 C  CB  . LYS A  1 323 ? -23.166 -31.811 -8.448  1.00   20.29  ? 323  LYS A CB  1 
ATOM   2485 C  CG  . LYS A  1 323 ? -23.134 -32.438 -7.072  1.00   19.78  ? 323  LYS A CG  1 
ATOM   2486 C  CD  . LYS A  1 323 ? -24.430 -32.150 -6.320  1.00   31.29  ? 323  LYS A CD  1 
ATOM   2487 C  CE  . LYS A  1 323 ? -24.566 -33.066 -5.105  1.00   45.04  ? 323  LYS A CE  1 
ATOM   2488 N  NZ  . LYS A  1 323 ? -25.646 -32.623 -4.173  1.00   52.83  ? 323  LYS A NZ  1 
ATOM   2489 N  N   . ASP A  1 324 ? -22.137 -34.364 -10.234 1.00   18.03  ? 324  ASP A N   1 
ATOM   2490 C  CA  . ASP A  1 324 ? -21.854 -35.801 -10.248 1.00   23.82  ? 324  ASP A CA  1 
ATOM   2491 C  C   . ASP A  1 324 ? -21.302 -36.296 -11.588 1.00   20.80  ? 324  ASP A C   1 
ATOM   2492 O  O   . ASP A  1 324 ? -21.836 -37.236 -12.173 1.00   25.77  ? 324  ASP A O   1 
ATOM   2493 C  CB  . ASP A  1 324 ? -23.101 -36.619 -9.838  1.00   27.56  ? 324  ASP A CB  1 
ATOM   2494 C  CG  . ASP A  1 324 ? -23.620 -36.252 -8.448  1.00   30.41  ? 324  ASP A CG  1 
ATOM   2495 O  OD1 . ASP A  1 324 ? -22.951 -36.588 -7.443  1.00   32.52  ? 324  ASP A OD1 1 
ATOM   2496 O  OD2 . ASP A  1 324 ? -24.704 -35.633 -8.358  1.00   33.84  ? 324  ASP A OD2 1 
ATOM   2497 N  N   . GLU A  1 325 ? -20.233 -35.664 -12.062 1.00   19.78  ? 325  GLU A N   1 
ATOM   2498 C  CA  . GLU A  1 325 ? -19.580 -36.053 -13.320 1.00   22.91  ? 325  GLU A CA  1 
ATOM   2499 C  C   . GLU A  1 325 ? -19.305 -37.567 -13.501 1.00   27.73  ? 325  GLU A C   1 
ATOM   2500 O  O   . GLU A  1 325 ? -19.540 -38.121 -14.579 1.00   32.81  ? 325  GLU A O   1 
ATOM   2501 C  CB  . GLU A  1 325 ? -18.266 -35.287 -13.483 1.00   24.00  ? 325  GLU A CB  1 
ATOM   2502 C  CG  . GLU A  1 325 ? -18.401 -33.781 -13.558 1.00   25.80  ? 325  GLU A CG  1 
ATOM   2503 C  CD  . GLU A  1 325 ? -18.798 -33.313 -14.939 1.00   26.60  ? 325  GLU A CD  1 
ATOM   2504 O  OE1 . GLU A  1 325 ? -18.952 -34.184 -15.820 1.00   21.80  ? 325  GLU A OE1 1 
ATOM   2505 O  OE2 . GLU A  1 325 ? -18.956 -32.084 -15.140 1.00   25.06  ? 325  GLU A OE2 1 
ATOM   2506 N  N   . GLY A  1 326 ? -18.820 -38.233 -12.455 1.00   23.08  ? 326  GLY A N   1 
ATOM   2507 C  CA  . GLY A  1 326 ? -18.363 -39.610 -12.579 1.00   22.79  ? 326  GLY A CA  1 
ATOM   2508 C  C   . GLY A  1 326 ? -19.401 -40.724 -12.618 1.00   29.24  ? 326  GLY A C   1 
ATOM   2509 O  O   . GLY A  1 326 ? -19.071 -41.858 -12.952 1.00   37.63  ? 326  GLY A O   1 
ATOM   2510 N  N   . THR A  1 327 ? -20.650 -40.422 -12.288 1.00   17.55  ? 327  THR A N   1 
ATOM   2511 C  CA  . THR A  1 327 ? -21.645 -41.475 -12.101 1.00   26.22  ? 327  THR A CA  1 
ATOM   2512 C  C   . THR A  1 327 ? -21.925 -42.253 -13.387 1.00   30.38  ? 327  THR A C   1 
ATOM   2513 O  O   . THR A  1 327 ? -22.025 -43.481 -13.383 1.00   26.71  ? 327  THR A O   1 
ATOM   2514 C  CB  . THR A  1 327 ? -22.951 -40.914 -11.545 1.00   19.48  ? 327  THR A CB  1 
ATOM   2515 O  OG1 . THR A  1 327 ? -23.311 -39.746 -12.285 1.00   45.62  ? 327  THR A OG1 1 
ATOM   2516 C  CG2 . THR A  1 327 ? -22.788 -40.548 -10.086 1.00   20.71  ? 327  THR A CG2 1 
ATOM   2517 N  N   . ALA A  1 328 ? -22.027 -41.511 -14.482 1.00   37.32  ? 328  ALA A N   1 
ATOM   2518 C  CA  . ALA A  1 328 ? -22.308 -42.045 -15.804 1.00   33.46  ? 328  ALA A CA  1 
ATOM   2519 C  C   . ALA A  1 328 ? -21.439 -43.256 -16.156 1.00   33.03  ? 328  ALA A C   1 
ATOM   2520 O  O   . ALA A  1 328 ? -21.906 -44.211 -16.770 1.00   35.07  ? 328  ALA A O   1 
ATOM   2521 C  CB  . ALA A  1 328 ? -22.117 -40.936 -16.833 1.00   32.28  ? 328  ALA A CB  1 
ATOM   2522 N  N   . PHE A  1 329 ? -20.178 -43.222 -15.740 1.00   29.19  ? 329  PHE A N   1 
ATOM   2523 C  CA  . PHE A  1 329 ? -19.218 -44.228 -16.176 1.00   31.67  ? 329  PHE A CA  1 
ATOM   2524 C  C   . PHE A  1 329 ? -19.208 -45.483 -15.305 1.00   32.74  ? 329  PHE A C   1 
ATOM   2525 O  O   . PHE A  1 329 ? -18.686 -46.519 -15.721 1.00   24.94  ? 329  PHE A O   1 
ATOM   2526 C  CB  . PHE A  1 329 ? -17.823 -43.606 -16.292 1.00   27.10  ? 329  PHE A CB  1 
ATOM   2527 C  CG  . PHE A  1 329 ? -17.795 -42.385 -17.171 1.00   32.76  ? 329  PHE A CG  1 
ATOM   2528 C  CD1 . PHE A  1 329 ? -18.084 -41.125 -16.644 1.00   20.42  ? 329  PHE A CD1 1 
ATOM   2529 C  CD2 . PHE A  1 329 ? -17.513 -42.497 -18.531 1.00   34.31  ? 329  PHE A CD2 1 
ATOM   2530 C  CE1 . PHE A  1 329 ? -18.083 -39.998 -17.453 1.00   21.08  ? 329  PHE A CE1 1 
ATOM   2531 C  CE2 . PHE A  1 329 ? -17.496 -41.374 -19.351 1.00   28.50  ? 329  PHE A CE2 1 
ATOM   2532 C  CZ  . PHE A  1 329 ? -17.791 -40.122 -18.814 1.00   27.89  ? 329  PHE A CZ  1 
ATOM   2533 N  N   . LEU A  1 330 ? -19.792 -45.399 -14.112 1.00   32.59  ? 330  LEU A N   1 
ATOM   2534 C  CA  . LEU A  1 330 ? -19.818 -46.553 -13.210 1.00   31.78  ? 330  LEU A CA  1 
ATOM   2535 C  C   . LEU A  1 330 ? -20.664 -47.731 -13.722 1.00   35.71  ? 330  LEU A C   1 
ATOM   2536 O  O   . LEU A  1 330 ? -20.411 -48.870 -13.348 1.00   39.90  ? 330  LEU A O   1 
ATOM   2537 C  CB  . LEU A  1 330 ? -20.260 -46.148 -11.804 1.00   28.98  ? 330  LEU A CB  1 
ATOM   2538 C  CG  . LEU A  1 330 ? -19.515 -44.965 -11.169 1.00   32.83  ? 330  LEU A CG  1 
ATOM   2539 C  CD1 . LEU A  1 330 ? -19.954 -44.779 -9.723  1.00   33.18  ? 330  LEU A CD1 1 
ATOM   2540 C  CD2 . LEU A  1 330 ? -17.985 -45.099 -11.261 1.00   27.43  ? 330  LEU A CD2 1 
ATOM   2541 N  N   . VAL A  1 331 ? -21.651 -47.478 -14.581 1.00   34.18  ? 331  VAL A N   1 
ATOM   2542 C  CA  . VAL A  1 331 ? -22.475 -48.583 -15.096 1.00   35.92  ? 331  VAL A CA  1 
ATOM   2543 C  C   . VAL A  1 331 ? -21.976 -49.192 -16.410 1.00   37.04  ? 331  VAL A C   1 
ATOM   2544 O  O   . VAL A  1 331 ? -22.641 -50.049 -16.990 1.00   38.97  ? 331  VAL A O   1 
ATOM   2545 C  CB  . VAL A  1 331 ? -23.969 -48.210 -15.234 1.00   31.34  ? 331  VAL A CB  1 
ATOM   2546 C  CG1 . VAL A  1 331 ? -24.606 -48.083 -13.855 1.00   26.51  ? 331  VAL A CG1 1 
ATOM   2547 C  CG2 . VAL A  1 331 ? -24.140 -46.925 -16.057 1.00   27.46  ? 331  VAL A CG2 1 
ATOM   2548 N  N   . TYR A  1 332 ? -20.805 -48.754 -16.866 1.00   37.18  ? 332  TYR A N   1 
ATOM   2549 C  CA  . TYR A  1 332 ? -20.155 -49.341 -18.036 1.00   33.76  ? 332  TYR A CA  1 
ATOM   2550 C  C   . TYR A  1 332 ? -18.963 -50.197 -17.644 1.00   38.43  ? 332  TYR A C   1 
ATOM   2551 O  O   . TYR A  1 332 ? -17.975 -50.244 -18.379 1.00   42.44  ? 332  TYR A O   1 
ATOM   2552 C  CB  . TYR A  1 332 ? -19.678 -48.256 -19.010 1.00   23.12  ? 332  TYR A CB  1 
ATOM   2553 C  CG  . TYR A  1 332 ? -20.806 -47.497 -19.660 1.00   32.13  ? 332  TYR A CG  1 
ATOM   2554 C  CD1 . TYR A  1 332 ? -21.408 -46.427 -19.006 1.00   31.09  ? 332  TYR A CD1 1 
ATOM   2555 C  CD2 . TYR A  1 332 ? -21.282 -47.853 -20.925 1.00   27.57  ? 332  TYR A CD2 1 
ATOM   2556 C  CE1 . TYR A  1 332 ? -22.453 -45.732 -19.585 1.00   32.59  ? 332  TYR A CE1 1 
ATOM   2557 C  CE2 . TYR A  1 332 ? -22.324 -47.157 -21.518 1.00   30.42  ? 332  TYR A CE2 1 
ATOM   2558 C  CZ  . TYR A  1 332 ? -22.908 -46.096 -20.836 1.00   32.99  ? 332  TYR A CZ  1 
ATOM   2559 O  OH  . TYR A  1 332 ? -23.945 -45.386 -21.394 1.00   32.18  ? 332  TYR A OH  1 
ATOM   2560 N  N   . GLY A  1 333 ? -19.031 -50.863 -16.494 1.00   40.15  ? 333  GLY A N   1 
ATOM   2561 C  CA  . GLY A  1 333 ? -17.929 -51.724 -16.097 1.00   42.87  ? 333  GLY A CA  1 
ATOM   2562 C  C   . GLY A  1 333 ? -17.830 -52.102 -14.632 1.00   48.21  ? 333  GLY A C   1 
ATOM   2563 O  O   . GLY A  1 333 ? -17.515 -53.245 -14.318 1.00   53.60  ? 333  GLY A O   1 
ATOM   2564 N  N   . ALA A  1 334 ? -18.096 -51.149 -13.740 1.00   43.92  ? 334  ALA A N   1 
ATOM   2565 C  CA  . ALA A  1 334 ? -17.951 -51.355 -12.294 1.00   34.98  ? 334  ALA A CA  1 
ATOM   2566 C  C   . ALA A  1 334 ? -18.896 -52.403 -11.699 1.00   37.54  ? 334  ALA A C   1 
ATOM   2567 O  O   . ALA A  1 334 ? -20.116 -52.264 -11.768 1.00   36.62  ? 334  ALA A O   1 
ATOM   2568 C  CB  . ALA A  1 334 ? -18.106 -50.028 -11.559 1.00   36.06  ? 334  ALA A CB  1 
ATOM   2569 N  N   . PRO A  1 335 ? -18.322 -53.450 -11.088 1.00   44.24  ? 335  PRO A N   1 
ATOM   2570 C  CA  . PRO A  1 335 ? -19.094 -54.539 -10.483 1.00   40.27  ? 335  PRO A CA  1 
ATOM   2571 C  C   . PRO A  1 335 ? -20.041 -54.039 -9.396  1.00   36.54  ? 335  PRO A C   1 
ATOM   2572 O  O   . PRO A  1 335 ? -19.640 -53.191 -8.599  1.00   35.01  ? 335  PRO A O   1 
ATOM   2573 C  CB  . PRO A  1 335 ? -18.014 -55.434 -9.863  1.00   35.17  ? 335  PRO A CB  1 
ATOM   2574 C  CG  . PRO A  1 335 ? -16.826 -54.566 -9.691  1.00   38.72  ? 335  PRO A CG  1 
ATOM   2575 C  CD  . PRO A  1 335 ? -16.875 -53.607 -10.854 1.00   42.96  ? 335  PRO A CD  1 
ATOM   2576 N  N   . GLY A  1 336 ? -21.271 -54.564 -9.371  1.00   41.90  ? 336  GLY A N   1 
ATOM   2577 C  CA  . GLY A  1 336 ? -22.271 -54.180 -8.388  1.00   41.42  ? 336  GLY A CA  1 
ATOM   2578 C  C   . GLY A  1 336 ? -23.075 -52.956 -8.792  1.00   46.38  ? 336  GLY A C   1 
ATOM   2579 O  O   . GLY A  1 336 ? -24.056 -52.602 -8.138  1.00   48.09  ? 336  GLY A O   1 
ATOM   2580 N  N   . PHE A  1 337 ? -22.656 -52.306 -9.873  1.00   49.32  ? 337  PHE A N   1 
ATOM   2581 C  CA  . PHE A  1 337 ? -23.352 -51.125 -10.383 1.00   49.49  ? 337  PHE A CA  1 
ATOM   2582 C  C   . PHE A  1 337 ? -24.365 -51.445 -11.478 1.00   46.07  ? 337  PHE A C   1 
ATOM   2583 O  O   . PHE A  1 337 ? -24.105 -52.254 -12.375 1.00   42.82  ? 337  PHE A O   1 
ATOM   2584 C  CB  . PHE A  1 337 ? -22.351 -50.075 -10.876 1.00   46.04  ? 337  PHE A CB  1 
ATOM   2585 C  CG  . PHE A  1 337 ? -21.750 -49.267 -9.771  1.00   47.47  ? 337  PHE A CG  1 
ATOM   2586 C  CD1 . PHE A  1 337 ? -22.393 -48.133 -9.292  1.00   41.83  ? 337  PHE A CD1 1 
ATOM   2587 C  CD2 . PHE A  1 337 ? -20.563 -49.656 -9.180  1.00   44.82  ? 337  PHE A CD2 1 
ATOM   2588 C  CE1 . PHE A  1 337 ? -21.850 -47.400 -8.259  1.00   40.26  ? 337  PHE A CE1 1 
ATOM   2589 C  CE2 . PHE A  1 337 ? -20.015 -48.917 -8.143  1.00   42.37  ? 337  PHE A CE2 1 
ATOM   2590 C  CZ  . PHE A  1 337 ? -20.657 -47.788 -7.685  1.00   37.48  ? 337  PHE A CZ  1 
ATOM   2591 N  N   . SER A  1 338 ? -25.520 -50.795 -11.393 1.00   38.70  ? 338  SER A N   1 
ATOM   2592 C  CA  . SER A  1 338 ? -26.560 -50.939 -12.401 1.00   32.21  ? 338  SER A CA  1 
ATOM   2593 C  C   . SER A  1 338 ? -27.461 -49.713 -12.413 1.00   34.63  ? 338  SER A C   1 
ATOM   2594 O  O   . SER A  1 338 ? -27.708 -49.104 -11.378 1.00   44.37  ? 338  SER A O   1 
ATOM   2595 C  CB  . SER A  1 338 ? -27.391 -52.200 -12.130 1.00   37.27  ? 338  SER A CB  1 
ATOM   2596 O  OG  . SER A  1 338 ? -28.583 -52.202 -12.897 1.00   37.44  ? 338  SER A OG  1 
ATOM   2597 N  N   . LYS A  1 339 ? -27.968 -49.359 -13.582 1.00   32.94  ? 339  LYS A N   1 
ATOM   2598 C  CA  . LYS A  1 339 ? -28.926 -48.264 -13.664 1.00   37.72  ? 339  LYS A CA  1 
ATOM   2599 C  C   . LYS A  1 339 ? -30.286 -48.705 -13.115 1.00   41.84  ? 339  LYS A C   1 
ATOM   2600 O  O   . LYS A  1 339 ? -31.157 -47.878 -12.848 1.00   40.06  ? 339  LYS A O   1 
ATOM   2601 C  CB  . LYS A  1 339 ? -29.069 -47.764 -15.111 1.00   30.40  ? 339  LYS A CB  1 
ATOM   2602 C  CG  . LYS A  1 339 ? -29.908 -48.665 -16.013 1.00   31.65  ? 339  LYS A CG  1 
ATOM   2603 C  CD  . LYS A  1 339 ? -30.216 -48.011 -17.361 1.00   37.62  ? 339  LYS A CD  1 
ATOM   2604 C  CE  . LYS A  1 339 ? -31.293 -48.794 -18.113 1.00   43.31  ? 339  LYS A CE  1 
ATOM   2605 N  NZ  . LYS A  1 339 ? -32.562 -48.919 -17.325 1.00   43.34  ? 339  LYS A NZ  1 
ATOM   2606 N  N   . ASP A  1 340 ? -30.457 -50.014 -12.940 1.00   43.50  ? 340  ASP A N   1 
ATOM   2607 C  CA  . ASP A  1 340 ? -31.767 -50.572 -12.605 1.00   48.70  ? 340  ASP A CA  1 
ATOM   2608 C  C   . ASP A  1 340 ? -31.983 -50.860 -11.111 1.00   50.90  ? 340  ASP A C   1 
ATOM   2609 O  O   . ASP A  1 340 ? -33.069 -51.282 -10.721 1.00   48.97  ? 340  ASP A O   1 
ATOM   2610 C  CB  . ASP A  1 340 ? -32.039 -51.830 -13.439 1.00   48.90  ? 340  ASP A CB  1 
ATOM   2611 C  CG  . ASP A  1 340 ? -32.059 -51.548 -14.945 1.00   47.98  ? 340  ASP A CG  1 
ATOM   2612 O  OD1 . ASP A  1 340 ? -32.633 -50.509 -15.370 1.00   40.51  ? 340  ASP A OD1 1 
ATOM   2613 O  OD2 . ASP A  1 340 ? -31.489 -52.371 -15.700 1.00   47.30  ? 340  ASP A OD2 1 
ATOM   2614 N  N   . ASN A  1 341 ? -30.949 -50.656 -10.291 1.00   52.93  ? 341  ASN A N   1 
ATOM   2615 C  CA  . ASN A  1 341 ? -31.071 -50.728 -8.822  1.00   49.78  ? 341  ASN A CA  1 
ATOM   2616 C  C   . ASN A  1 341 ? -30.214 -49.669 -8.126  1.00   44.06  ? 341  ASN A C   1 
ATOM   2617 O  O   . ASN A  1 341 ? -29.456 -48.958 -8.783  1.00   39.50  ? 341  ASN A O   1 
ATOM   2618 C  CB  . ASN A  1 341 ? -30.808 -52.144 -8.259  1.00   46.12  ? 341  ASN A CB  1 
ATOM   2619 C  CG  . ASN A  1 341 ? -29.389 -52.667 -8.537  1.00   47.96  ? 341  ASN A CG  1 
ATOM   2620 O  OD1 . ASN A  1 341 ? -28.410 -51.909 -8.560  1.00   48.64  ? 341  ASN A OD1 1 
ATOM   2621 N  ND2 . ASN A  1 341 ? -29.285 -53.989 -8.730  1.00   54.02  ? 341  ASN A ND2 1 
ATOM   2622 N  N   . ASN A  1 342 ? -30.330 -49.552 -6.807  1.00   46.30  ? 342  ASN A N   1 
ATOM   2623 C  CA  . ASN A  1 342 ? -29.664 -48.445 -6.117  1.00   49.77  ? 342  ASN A CA  1 
ATOM   2624 C  C   . ASN A  1 342 ? -28.143 -48.589 -5.977  1.00   44.58  ? 342  ASN A C   1 
ATOM   2625 O  O   . ASN A  1 342 ? -27.488 -47.706 -5.444  1.00   38.41  ? 342  ASN A O   1 
ATOM   2626 C  CB  . ASN A  1 342 ? -30.338 -48.095 -4.775  1.00   57.84  ? 342  ASN A CB  1 
ATOM   2627 C  CG  . ASN A  1 342 ? -30.243 -49.212 -3.750  1.00   68.28  ? 342  ASN A CG  1 
ATOM   2628 O  OD1 . ASN A  1 342 ? -29.487 -50.174 -3.917  1.00   68.65  ? 342  ASN A OD1 1 
ATOM   2629 N  ND2 . ASN A  1 342 ? -31.015 -49.085 -2.670  1.00   73.92  ? 342  ASN A ND2 1 
ATOM   2630 N  N   . SER A  1 343 ? -27.593 -49.698 -6.461  1.00   42.58  ? 343  SER A N   1 
ATOM   2631 C  CA  . SER A  1 343 ? -26.143 -49.854 -6.572  1.00   40.92  ? 343  SER A CA  1 
ATOM   2632 C  C   . SER A  1 343 ? -25.370 -49.734 -5.251  1.00   42.91  ? 343  SER A C   1 
ATOM   2633 O  O   . SER A  1 343 ? -24.232 -49.263 -5.232  1.00   43.00  ? 343  SER A O   1 
ATOM   2634 C  CB  . SER A  1 343 ? -25.579 -48.861 -7.597  1.00   37.06  ? 343  SER A CB  1 
ATOM   2635 O  OG  . SER A  1 343 ? -26.112 -49.083 -8.891  1.00   32.81  ? 343  SER A OG  1 
ATOM   2636 N  N   . ILE A  1 344 ? -25.984 -50.150 -4.149  1.00   41.66  ? 344  ILE A N   1 
ATOM   2637 C  CA  . ILE A  1 344 ? -25.256 -50.236 -2.890  1.00   40.65  ? 344  ILE A CA  1 
ATOM   2638 C  C   . ILE A  1 344 ? -24.152 -51.275 -3.026  1.00   39.88  ? 344  ILE A C   1 
ATOM   2639 O  O   . ILE A  1 344 ? -24.423 -52.472 -3.115  1.00   47.73  ? 344  ILE A O   1 
ATOM   2640 C  CB  . ILE A  1 344 ? -26.169 -50.648 -1.718  1.00   46.29  ? 344  ILE A CB  1 
ATOM   2641 C  CG1 . ILE A  1 344 ? -27.322 -49.655 -1.550  1.00   43.47  ? 344  ILE A CG1 1 
ATOM   2642 C  CG2 . ILE A  1 344 ? -25.360 -50.746 -0.433  1.00   40.09  ? 344  ILE A CG2 1 
ATOM   2643 C  CD1 . ILE A  1 344 ? -26.875 -48.246 -1.221  1.00   39.40  ? 344  ILE A CD1 1 
ATOM   2644 N  N   . ILE A  1 345 ? -22.907 -50.825 -3.058  1.00   37.90  ? 345  ILE A N   1 
ATOM   2645 C  CA  . ILE A  1 345 ? -21.796 -51.749 -3.201  1.00   37.57  ? 345  ILE A CA  1 
ATOM   2646 C  C   . ILE A  1 345 ? -21.012 -51.871 -1.910  1.00   45.19  ? 345  ILE A C   1 
ATOM   2647 O  O   . ILE A  1 345 ? -21.166 -51.053 -1.002  1.00   51.11  ? 345  ILE A O   1 
ATOM   2648 C  CB  . ILE A  1 345 ? -20.854 -51.332 -4.333  1.00   35.94  ? 345  ILE A CB  1 
ATOM   2649 C  CG1 . ILE A  1 345 ? -20.316 -49.914 -4.084  1.00   32.16  ? 345  ILE A CG1 1 
ATOM   2650 C  CG2 . ILE A  1 345 ? -21.568 -51.457 -5.670  1.00   33.50  ? 345  ILE A CG2 1 
ATOM   2651 C  CD1 . ILE A  1 345 ? -19.035 -49.587 -4.841  1.00   30.58  ? 345  ILE A CD1 1 
ATOM   2652 N  N   . THR A  1 346 ? -20.170 -52.898 -1.838  1.00   42.92  ? 346  THR A N   1 
ATOM   2653 C  CA  . THR A  1 346 ? -19.357 -53.159 -0.656  1.00   39.59  ? 346  THR A CA  1 
ATOM   2654 C  C   . THR A  1 346 ? -17.928 -52.633 -0.809  1.00   43.29  ? 346  THR A C   1 
ATOM   2655 O  O   . THR A  1 346 ? -17.541 -52.150 -1.870  1.00   39.61  ? 346  THR A O   1 
ATOM   2656 C  CB  . THR A  1 346 ? -19.282 -54.660 -0.378  1.00   45.03  ? 346  THR A CB  1 
ATOM   2657 O  OG1 . THR A  1 346 ? -18.640 -55.311 -1.484  1.00   42.97  ? 346  THR A OG1 1 
ATOM   2658 C  CG2 . THR A  1 346 ? -20.673 -55.224 -0.198  1.00   43.34  ? 346  THR A CG2 1 
ATOM   2659 N  N   . ARG A  1 347 ? -17.147 -52.731 0.263   1.00   48.73  ? 347  ARG A N   1 
ATOM   2660 C  CA  . ARG A  1 347 ? -15.749 -52.322 0.238   1.00   38.57  ? 347  ARG A CA  1 
ATOM   2661 C  C   . ARG A  1 347 ? -14.970 -53.105 -0.819  1.00   41.84  ? 347  ARG A C   1 
ATOM   2662 O  O   . ARG A  1 347 ? -14.120 -52.551 -1.517  1.00   44.47  ? 347  ARG A O   1 
ATOM   2663 C  CB  . ARG A  1 347 ? -15.129 -52.511 1.620   1.00   39.49  ? 347  ARG A CB  1 
ATOM   2664 C  CG  . ARG A  1 347 ? -13.652 -52.151 1.726   1.00   38.97  ? 347  ARG A CG  1 
ATOM   2665 C  CD  . ARG A  1 347 ? -13.288 -51.978 3.188   1.00   46.08  ? 347  ARG A CD  1 
ATOM   2666 N  NE  . ARG A  1 347 ? -11.856 -51.836 3.424   1.00   54.40  ? 347  ARG A NE  1 
ATOM   2667 C  CZ  . ARG A  1 347 ? -11.195 -50.680 3.401   1.00   52.62  ? 347  ARG A CZ  1 
ATOM   2668 N  NH1 . ARG A  1 347 ? -11.834 -49.535 3.135   1.00   43.35  ? 347  ARG A NH1 1 
ATOM   2669 N  NH2 . ARG A  1 347 ? -9.887  -50.671 3.648   1.00   46.48  ? 347  ARG A NH2 1 
ATOM   2670 N  N   . LYS A  1 348 ? -15.285 -54.389 -0.952  1.00   39.52  ? 348  LYS A N   1 
ATOM   2671 C  CA  . LYS A  1 348 ? -14.631 -55.238 -1.936  1.00   51.23  ? 348  LYS A CA  1 
ATOM   2672 C  C   . LYS A  1 348 ? -15.041 -54.867 -3.360  1.00   47.23  ? 348  LYS A C   1 
ATOM   2673 O  O   . LYS A  1 348 ? -14.244 -54.971 -4.296  1.00   45.58  ? 348  LYS A O   1 
ATOM   2674 C  CB  . LYS A  1 348 ? -14.936 -56.711 -1.653  1.00   61.78  ? 348  LYS A CB  1 
ATOM   2675 C  CG  . LYS A  1 348 ? -14.117 -57.693 -2.469  1.00   68.67  ? 348  LYS A CG  1 
ATOM   2676 C  CD  . LYS A  1 348 ? -14.231 -59.100 -1.899  1.00   76.00  ? 348  LYS A CD  1 
ATOM   2677 C  CE  . LYS A  1 348 ? -13.711 -59.169 -0.467  1.00   75.35  ? 348  LYS A CE  1 
ATOM   2678 N  NZ  . LYS A  1 348 ? -13.924 -60.522 0.129   1.00   70.95  ? 348  LYS A NZ  1 
ATOM   2679 N  N   . GLU A  1 349 ? -16.280 -54.423 -3.532  1.00   45.50  ? 349  GLU A N   1 
ATOM   2680 C  CA  . GLU A  1 349 ? -16.730 -54.012 -4.858  1.00   44.85  ? 349  GLU A CA  1 
ATOM   2681 C  C   . GLU A  1 349 ? -16.122 -52.664 -5.233  1.00   46.21  ? 349  GLU A C   1 
ATOM   2682 O  O   . GLU A  1 349 ? -15.859 -52.387 -6.408  1.00   48.53  ? 349  GLU A O   1 
ATOM   2683 C  CB  . GLU A  1 349 ? -18.259 -54.008 -4.941  1.00   47.20  ? 349  GLU A CB  1 
ATOM   2684 C  CG  . GLU A  1 349 ? -18.843 -55.422 -4.966  1.00   49.77  ? 349  GLU A CG  1 
ATOM   2685 C  CD  . GLU A  1 349 ? -20.338 -55.460 -4.744  1.00   52.29  ? 349  GLU A CD  1 
ATOM   2686 O  OE1 . GLU A  1 349 ? -20.829 -54.762 -3.831  1.00   57.21  ? 349  GLU A OE1 1 
ATOM   2687 O  OE2 . GLU A  1 349 ? -21.019 -56.205 -5.476  1.00   45.81  ? 349  GLU A OE2 1 
ATOM   2688 N  N   . PHE A  1 350 ? -15.872 -51.842 -4.221  1.00   44.45  ? 350  PHE A N   1 
ATOM   2689 C  CA  . PHE A  1 350 ? -15.196 -50.568 -4.418  1.00   42.71  ? 350  PHE A CA  1 
ATOM   2690 C  C   . PHE A  1 350 ? -13.748 -50.797 -4.840  1.00   46.79  ? 350  PHE A C   1 
ATOM   2691 O  O   . PHE A  1 350 ? -13.258 -50.170 -5.787  1.00   49.63  ? 350  PHE A O   1 
ATOM   2692 C  CB  . PHE A  1 350 ? -15.241 -49.750 -3.132  1.00   41.32  ? 350  PHE A CB  1 
ATOM   2693 C  CG  . PHE A  1 350 ? -14.571 -48.408 -3.235  1.00   42.00  ? 350  PHE A CG  1 
ATOM   2694 C  CD1 . PHE A  1 350 ? -13.195 -48.276 -3.006  1.00   43.81  ? 350  PHE A CD1 1 
ATOM   2695 C  CD2 . PHE A  1 350 ? -15.316 -47.266 -3.534  1.00   36.22  ? 350  PHE A CD2 1 
ATOM   2696 C  CE1 . PHE A  1 350 ? -12.577 -47.038 -3.087  1.00   41.18  ? 350  PHE A CE1 1 
ATOM   2697 C  CE2 . PHE A  1 350 ? -14.705 -46.021 -3.607  1.00   34.18  ? 350  PHE A CE2 1 
ATOM   2698 C  CZ  . PHE A  1 350 ? -13.335 -45.905 -3.387  1.00   37.72  ? 350  PHE A CZ  1 
ATOM   2699 N  N   . GLN A  1 351 ? -13.059 -51.686 -4.129  1.00   40.46  ? 351  GLN A N   1 
ATOM   2700 C  CA  . GLN A  1 351 ? -11.674 -51.978 -4.462  1.00   37.73  ? 351  GLN A CA  1 
ATOM   2701 C  C   . GLN A  1 351 ? -11.560 -52.543 -5.882  1.00   42.70  ? 351  GLN A C   1 
ATOM   2702 O  O   . GLN A  1 351 ? -10.712 -52.099 -6.670  1.00   34.95  ? 351  GLN A O   1 
ATOM   2703 C  CB  . GLN A  1 351 ? -11.060 -52.916 -3.421  1.00   36.26  ? 351  GLN A CB  1 
ATOM   2704 C  CG  . GLN A  1 351 ? -10.864 -52.241 -2.067  1.00   35.50  ? 351  GLN A CG  1 
ATOM   2705 C  CD  . GLN A  1 351 ? -10.429 -53.194 -0.968  1.00   37.89  ? 351  GLN A CD  1 
ATOM   2706 O  OE1 . GLN A  1 351 ? -10.805 -54.365 -0.949  1.00   39.54  ? 351  GLN A OE1 1 
ATOM   2707 N  NE2 . GLN A  1 351 ? -9.642  -52.685 -0.036  1.00   60.20  ? 351  GLN A NE2 1 
ATOM   2708 N  N   . GLU A  1 352 ? -12.432 -53.504 -6.205  1.00   45.43  ? 352  GLU A N   1 
ATOM   2709 C  CA  . GLU A  1 352 ? -12.494 -54.072 -7.550  1.00   47.51  ? 352  GLU A CA  1 
ATOM   2710 C  C   . GLU A  1 352 ? -12.790 -52.976 -8.552  1.00   42.63  ? 352  GLU A C   1 
ATOM   2711 O  O   . GLU A  1 352 ? -12.273 -52.988 -9.666  1.00   48.08  ? 352  GLU A O   1 
ATOM   2712 C  CB  . GLU A  1 352 ? -13.563 -55.167 -7.653  1.00   57.29  ? 352  GLU A CB  1 
ATOM   2713 C  CG  . GLU A  1 352 ? -13.142 -56.515 -7.089  1.00   70.29  ? 352  GLU A CG  1 
ATOM   2714 C  CD  . GLU A  1 352 ? -11.796 -56.980 -7.627  1.00   79.59  ? 352  GLU A CD  1 
ATOM   2715 O  OE1 . GLU A  1 352 ? -11.651 -57.092 -8.866  1.00   82.37  ? 352  GLU A OE1 1 
ATOM   2716 O  OE2 . GLU A  1 352 ? -10.879 -57.222 -6.809  1.00   80.51  ? 352  GLU A OE2 1 
ATOM   2717 N  N   . GLY A  1 353 ? -13.623 -52.026 -8.144  1.00   31.30  ? 353  GLY A N   1 
ATOM   2718 C  CA  . GLY A  1 353 ? -13.963 -50.896 -8.991  1.00   32.71  ? 353  GLY A CA  1 
ATOM   2719 C  C   . GLY A  1 353 ? -12.772 -50.027 -9.357  1.00   37.11  ? 353  GLY A C   1 
ATOM   2720 O  O   . GLY A  1 353 ? -12.729 -49.443 -10.442 1.00   37.63  ? 353  GLY A O   1 
ATOM   2721 N  N   . LEU A  1 354 ? -11.797 -49.928 -8.461  1.00   36.48  ? 354  LEU A N   1 
ATOM   2722 C  CA  . LEU A  1 354 ? -10.607 -49.150 -8.777  1.00   36.78  ? 354  LEU A CA  1 
ATOM   2723 C  C   . LEU A  1 354 ? -9.771  -49.869 -9.824  1.00   37.56  ? 354  LEU A C   1 
ATOM   2724 O  O   . LEU A  1 354 ? -9.195  -49.220 -10.706 1.00   32.91  ? 354  LEU A O   1 
ATOM   2725 C  CB  . LEU A  1 354 ? -9.775  -48.860 -7.531  1.00   27.41  ? 354  LEU A CB  1 
ATOM   2726 C  CG  . LEU A  1 354 ? -10.474 -47.960 -6.523  1.00   26.80  ? 354  LEU A CG  1 
ATOM   2727 C  CD1 . LEU A  1 354 ? -9.596  -47.721 -5.306  1.00   27.69  ? 354  LEU A CD1 1 
ATOM   2728 C  CD2 . LEU A  1 354 ? -10.880 -46.646 -7.186  1.00   35.41  ? 354  LEU A CD2 1 
ATOM   2729 N  N   . LYS A  1 355 ? -9.714  -51.200 -9.733  1.00   37.22  ? 355  LYS A N   1 
ATOM   2730 C  CA  . LYS A  1 355 ? -8.992  -51.992 -10.731 1.00   40.22  ? 355  LYS A CA  1 
ATOM   2731 C  C   . LYS A  1 355 ? -9.536  -51.718 -12.139 1.00   39.62  ? 355  LYS A C   1 
ATOM   2732 O  O   . LYS A  1 355 ? -8.766  -51.583 -13.101 1.00   34.95  ? 355  LYS A O   1 
ATOM   2733 C  CB  . LYS A  1 355 ? -9.058  -53.487 -10.427 1.00   35.70  ? 355  LYS A CB  1 
ATOM   2734 C  CG  . LYS A  1 355 ? -8.284  -53.936 -9.205  1.00   41.95  ? 355  LYS A CG  1 
ATOM   2735 C  CD  . LYS A  1 355 ? -7.958  -55.429 -9.316  1.00   60.05  ? 355  LYS A CD  1 
ATOM   2736 C  CE  . LYS A  1 355 ? -7.466  -56.022 -7.996  1.00   69.09  ? 355  LYS A CE  1 
ATOM   2737 N  NZ  . LYS A  1 355 ? -8.584  -56.197 -7.022  1.00   70.67  ? 355  LYS A NZ  1 
ATOM   2738 N  N   . ILE A  1 356 ? -10.860 -51.621 -12.242 1.00   34.69  ? 356  ILE A N   1 
ATOM   2739 C  CA  . ILE A  1 356 ? -11.515 -51.266 -13.495 1.00   36.01  ? 356  ILE A CA  1 
ATOM   2740 C  C   . ILE A  1 356 ? -11.097 -49.880 -13.964 1.00   38.02  ? 356  ILE A C   1 
ATOM   2741 O  O   . ILE A  1 356 ? -10.699 -49.688 -15.110 1.00   46.84  ? 356  ILE A O   1 
ATOM   2742 C  CB  . ILE A  1 356 ? -13.036 -51.225 -13.345 1.00   36.09  ? 356  ILE A CB  1 
ATOM   2743 C  CG1 . ILE A  1 356 ? -13.592 -52.574 -12.843 1.00   41.36  ? 356  ILE A CG1 1 
ATOM   2744 C  CG2 . ILE A  1 356 ? -13.667 -50.780 -14.655 1.00   29.93  ? 356  ILE A CG2 1 
ATOM   2745 C  CD1 . ILE A  1 356 ? -13.485 -53.716 -13.827 1.00   30.59  ? 356  ILE A CD1 1 
ATOM   2746 N  N   . PHE A  1 357 ? -11.198 -48.905 -13.074 1.00   32.70  ? 357  PHE A N   1 
ATOM   2747 C  CA  . PHE A  1 357 ? -10.896 -47.534 -13.440 1.00   22.94  ? 357  PHE A CA  1 
ATOM   2748 C  C   . PHE A  1 357 ? -9.402  -47.159 -13.413 1.00   25.76  ? 357  PHE A C   1 
ATOM   2749 O  O   . PHE A  1 357 ? -8.995  -46.216 -14.080 1.00   22.82  ? 357  PHE A O   1 
ATOM   2750 C  CB  . PHE A  1 357 ? -11.746 -46.579 -12.603 1.00   23.05  ? 357  PHE A CB  1 
ATOM   2751 C  CG  . PHE A  1 357 ? -13.174 -46.479 -13.073 1.00   25.02  ? 357  PHE A CG  1 
ATOM   2752 C  CD1 . PHE A  1 357 ? -13.497 -45.705 -14.186 1.00   23.50  ? 357  PHE A CD1 1 
ATOM   2753 C  CD2 . PHE A  1 357 ? -14.186 -47.166 -12.420 1.00   32.85  ? 357  PHE A CD2 1 
ATOM   2754 C  CE1 . PHE A  1 357 ? -14.801 -45.619 -14.636 1.00   32.94  ? 357  PHE A CE1 1 
ATOM   2755 C  CE2 . PHE A  1 357 ? -15.503 -47.096 -12.866 1.00   35.99  ? 357  PHE A CE2 1 
ATOM   2756 C  CZ  . PHE A  1 357 ? -15.816 -46.323 -13.974 1.00   35.74  ? 357  PHE A CZ  1 
ATOM   2757 N  N   . PHE A  1 358 ? -8.574  -47.896 -12.671 1.00   29.20  ? 358  PHE A N   1 
ATOM   2758 C  CA  . PHE A  1 358 ? -7.137  -47.590 -12.634 1.00   35.28  ? 358  PHE A CA  1 
ATOM   2759 C  C   . PHE A  1 358 ? -6.268  -48.833 -12.838 1.00   43.58  ? 358  PHE A C   1 
ATOM   2760 O  O   . PHE A  1 358 ? -5.461  -49.186 -11.964 1.00   46.43  ? 358  PHE A O   1 
ATOM   2761 C  CB  . PHE A  1 358 ? -6.765  -46.917 -11.315 1.00   24.57  ? 358  PHE A CB  1 
ATOM   2762 C  CG  . PHE A  1 358 ? -7.506  -45.640 -11.057 1.00   35.80  ? 358  PHE A CG  1 
ATOM   2763 C  CD1 . PHE A  1 358 ? -8.775  -45.657 -10.504 1.00   34.12  ? 358  PHE A CD1 1 
ATOM   2764 C  CD2 . PHE A  1 358 ? -6.930  -44.414 -11.359 1.00   35.38  ? 358  PHE A CD2 1 
ATOM   2765 C  CE1 . PHE A  1 358 ? -9.457  -44.480 -10.263 1.00   27.11  ? 358  PHE A CE1 1 
ATOM   2766 C  CE2 . PHE A  1 358 ? -7.603  -43.237 -11.113 1.00   29.62  ? 358  PHE A CE2 1 
ATOM   2767 C  CZ  . PHE A  1 358 ? -8.863  -43.270 -10.561 1.00   27.68  ? 358  PHE A CZ  1 
ATOM   2768 N  N   . PRO A  1 359 ? -6.399  -49.474 -14.011 1.00   45.13  ? 359  PRO A N   1 
ATOM   2769 C  CA  . PRO A  1 359 ? -5.824  -50.802 -14.256 1.00   46.57  ? 359  PRO A CA  1 
ATOM   2770 C  C   . PRO A  1 359 ? -4.306  -50.799 -14.194 1.00   50.02  ? 359  PRO A C   1 
ATOM   2771 O  O   . PRO A  1 359 ? -3.708  -51.731 -13.648 1.00   54.51  ? 359  PRO A O   1 
ATOM   2772 C  CB  . PRO A  1 359 ? -6.269  -51.124 -15.688 1.00   46.08  ? 359  PRO A CB  1 
ATOM   2773 C  CG  . PRO A  1 359 ? -7.260  -50.065 -16.068 1.00   46.21  ? 359  PRO A CG  1 
ATOM   2774 C  CD  . PRO A  1 359 ? -6.915  -48.871 -15.250 1.00   43.43  ? 359  PRO A CD  1 
ATOM   2775 N  N   . GLY A  1 360 ? -3.697  -49.756 -14.747 1.00   50.47  ? 360  GLY A N   1 
ATOM   2776 C  CA  . GLY A  1 360 ? -2.254  -49.694 -14.873 1.00   53.00  ? 360  GLY A CA  1 
ATOM   2777 C  C   . GLY A  1 360 ? -1.509  -49.102 -13.690 1.00   56.26  ? 360  GLY A C   1 
ATOM   2778 O  O   . GLY A  1 360 ? -0.281  -49.012 -13.724 1.00   56.47  ? 360  GLY A O   1 
ATOM   2779 N  N   . VAL A  1 361 ? -2.227  -48.699 -12.644 1.00   53.30  ? 361  VAL A N   1 
ATOM   2780 C  CA  . VAL A  1 361 ? -1.558  -48.096 -11.492 1.00   51.16  ? 361  VAL A CA  1 
ATOM   2781 C  C   . VAL A  1 361 ? -1.203  -49.139 -10.428 1.00   47.45  ? 361  VAL A C   1 
ATOM   2782 O  O   . VAL A  1 361 ? -1.813  -50.208 -10.354 1.00   41.53  ? 361  VAL A O   1 
ATOM   2783 C  CB  . VAL A  1 361 ? -2.363  -46.909 -10.863 1.00   35.09  ? 361  VAL A CB  1 
ATOM   2784 C  CG1 . VAL A  1 361 ? -3.129  -46.133 -11.934 1.00   25.89  ? 361  VAL A CG1 1 
ATOM   2785 C  CG2 . VAL A  1 361 ? -3.281  -47.401 -9.771  1.00   36.31  ? 361  VAL A CG2 1 
ATOM   2786 N  N   . SER A  1 362 ? -0.215  -48.815 -9.601  1.00   40.41  ? 362  SER A N   1 
ATOM   2787 C  CA  . SER A  1 362 ? 0.292   -49.756 -8.610  1.00   39.18  ? 362  SER A CA  1 
ATOM   2788 C  C   . SER A  1 362 ? -0.699  -50.158 -7.514  1.00   35.98  ? 362  SER A C   1 
ATOM   2789 O  O   . SER A  1 362 ? -1.739  -49.535 -7.321  1.00   37.75  ? 362  SER A O   1 
ATOM   2790 C  CB  . SER A  1 362 ? 1.542   -49.174 -7.953  1.00   42.03  ? 362  SER A CB  1 
ATOM   2791 O  OG  . SER A  1 362 ? 1.242   -47.936 -7.343  1.00   33.85  ? 362  SER A OG  1 
ATOM   2792 N  N   . GLU A  1 363 ? -0.346  -51.199 -6.778  1.00   39.62  ? 363  GLU A N   1 
ATOM   2793 C  CA  . GLU A  1 363 ? -1.128  -51.599 -5.623  1.00   44.24  ? 363  GLU A CA  1 
ATOM   2794 C  C   . GLU A  1 363 ? -1.249  -50.416 -4.643  1.00   44.11  ? 363  GLU A C   1 
ATOM   2795 O  O   . GLU A  1 363 ? -2.338  -50.137 -4.121  1.00   41.77  ? 363  GLU A O   1 
ATOM   2796 C  CB  . GLU A  1 363 ? -0.506  -52.848 -4.970  1.00   42.24  ? 363  GLU A CB  1 
ATOM   2797 C  CG  . GLU A  1 363 ? -1.341  -53.466 -3.867  1.00   54.86  ? 363  GLU A CG  1 
ATOM   2798 C  CD  . GLU A  1 363 ? -2.797  -53.679 -4.271  1.00   76.14  ? 363  GLU A CD  1 
ATOM   2799 O  OE1 . GLU A  1 363 ? -3.066  -54.042 -5.445  1.00   79.79  ? 363  GLU A OE1 1 
ATOM   2800 O  OE2 . GLU A  1 363 ? -3.679  -53.478 -3.404  1.00   82.62  ? 363  GLU A OE2 1 
ATOM   2801 N  N   . PHE A  1 364 ? -0.135  -49.709 -4.443  1.00   39.99  ? 364  PHE A N   1 
ATOM   2802 C  CA  . PHE A  1 364 ? -0.063  -48.571 -3.527  1.00   35.68  ? 364  PHE A CA  1 
ATOM   2803 C  C   . PHE A  1 364 ? -0.875  -47.382 -4.024  1.00   37.04  ? 364  PHE A C   1 
ATOM   2804 O  O   . PHE A  1 364 ? -1.456  -46.629 -3.240  1.00   37.41  ? 364  PHE A O   1 
ATOM   2805 C  CB  . PHE A  1 364 ? 1.396   -48.163 -3.327  1.00   39.64  ? 364  PHE A CB  1 
ATOM   2806 C  CG  . PHE A  1 364 ? 1.575   -46.840 -2.651  1.00   36.04  ? 364  PHE A CG  1 
ATOM   2807 C  CD1 . PHE A  1 364 ? 1.456   -46.728 -1.281  1.00   39.94  ? 364  PHE A CD1 1 
ATOM   2808 C  CD2 . PHE A  1 364 ? 1.883   -45.709 -3.385  1.00   54.29  ? 364  PHE A CD2 1 
ATOM   2809 C  CE1 . PHE A  1 364 ? 1.628   -45.513 -0.654  1.00   36.41  ? 364  PHE A CE1 1 
ATOM   2810 C  CE2 . PHE A  1 364 ? 2.050   -44.481 -2.766  1.00   34.11  ? 364  PHE A CE2 1 
ATOM   2811 C  CZ  . PHE A  1 364 ? 1.924   -44.384 -1.398  1.00   35.00  ? 364  PHE A CZ  1 
ATOM   2812 N  N   . GLY A  1 365 ? -0.909  -47.206 -5.335  1.00   40.58  ? 365  GLY A N   1 
ATOM   2813 C  CA  . GLY A  1 365 ? -1.681  -46.129 -5.926  1.00   38.60  ? 365  GLY A CA  1 
ATOM   2814 C  C   . GLY A  1 365 ? -3.173  -46.314 -5.702  1.00   35.79  ? 365  GLY A C   1 
ATOM   2815 O  O   . GLY A  1 365 ? -3.856  -45.383 -5.260  1.00   33.10  ? 365  GLY A O   1 
ATOM   2816 N  N   . LYS A  1 366 ? -3.686  -47.507 -6.005  1.00   32.85  ? 366  LYS A N   1 
ATOM   2817 C  CA  . LYS A  1 366 ? -5.103  -47.799 -5.780  1.00   33.45  ? 366  LYS A CA  1 
ATOM   2818 C  C   . LYS A  1 366 ? -5.428  -47.671 -4.300  1.00   30.04  ? 366  LYS A C   1 
ATOM   2819 O  O   . LYS A  1 366 ? -6.539  -47.321 -3.927  1.00   53.44  ? 366  LYS A O   1 
ATOM   2820 C  CB  . LYS A  1 366 ? -5.487  -49.211 -6.260  1.00   30.47  ? 366  LYS A CB  1 
ATOM   2821 C  CG  . LYS A  1 366 ? -5.276  -49.521 -7.743  1.00   40.24  ? 366  LYS A CG  1 
ATOM   2822 C  CD  . LYS A  1 366 ? -5.732  -50.951 -8.048  1.00   49.17  ? 366  LYS A CD  1 
ATOM   2823 C  CE  . LYS A  1 366 ? -5.142  -51.499 -9.348  1.00   47.90  ? 366  LYS A CE  1 
ATOM   2824 N  NZ  . LYS A  1 366 ? -3.672  -51.680 -9.246  1.00   44.08  ? 366  LYS A NZ  1 
ATOM   2825 N  N   . GLU A  1 367 ? -4.452  -47.956 -3.449  1.00   32.42  ? 367  GLU A N   1 
ATOM   2826 C  CA  . GLU A  1 367 ? -4.724  -47.944 -2.020  1.00   35.88  ? 367  GLU A CA  1 
ATOM   2827 C  C   . GLU A  1 367 ? -4.795  -46.511 -1.514  1.00   36.00  ? 367  GLU A C   1 
ATOM   2828 O  O   . GLU A  1 367 ? -5.629  -46.187 -0.669  1.00   35.85  ? 367  GLU A O   1 
ATOM   2829 C  CB  . GLU A  1 367 ? -3.717  -48.789 -1.235  1.00   34.86  ? 367  GLU A CB  1 
ATOM   2830 C  CG  . GLU A  1 367 ? -4.075  -48.900 0.230   1.00   89.09  ? 367  GLU A CG  1 
ATOM   2831 C  CD  . GLU A  1 367 ? -3.822  -50.280 0.806   1.00   91.65  ? 367  GLU A CD  1 
ATOM   2832 O  OE1 . GLU A  1 367 ? -2.655  -50.746 0.788   1.00   92.08  ? 367  GLU A OE1 1 
ATOM   2833 O  OE2 . GLU A  1 367 ? -4.804  -50.892 1.285   1.00   91.22  ? 367  GLU A OE2 1 
ATOM   2834 N  N   . SER A  1 368 ? -3.943  -45.651 -2.063  1.00   35.67  ? 368  SER A N   1 
ATOM   2835 C  CA  . SER A  1 368 ? -3.919  -44.249 -1.673  1.00   32.45  ? 368  SER A CA  1 
ATOM   2836 C  C   . SER A  1 368 ? -5.249  -43.574 -2.004  1.00   34.45  ? 368  SER A C   1 
ATOM   2837 O  O   . SER A  1 368 ? -5.734  -42.733 -1.250  1.00   37.98  ? 368  SER A O   1 
ATOM   2838 C  CB  . SER A  1 368 ? -2.754  -43.516 -2.347  1.00   31.50  ? 368  SER A CB  1 
ATOM   2839 O  OG  . SER A  1 368 ? -3.080  -43.145 -3.677  1.00   34.64  ? 368  SER A OG  1 
ATOM   2840 N  N   . ILE A  1 369 ? -5.840  -43.944 -3.133  1.00   35.17  ? 369  ILE A N   1 
ATOM   2841 C  CA  . ILE A  1 369 ? -7.176  -43.461 -3.474  1.00   34.07  ? 369  ILE A CA  1 
ATOM   2842 C  C   . ILE A  1 369 ? -8.181  -43.933 -2.421  1.00   35.68  ? 369  ILE A C   1 
ATOM   2843 O  O   . ILE A  1 369 ? -9.018  -43.161 -1.938  1.00   26.00  ? 369  ILE A O   1 
ATOM   2844 C  CB  . ILE A  1 369 ? -7.637  -43.968 -4.864  1.00   28.43  ? 369  ILE A CB  1 
ATOM   2845 C  CG1 . ILE A  1 369 ? -6.622  -43.580 -5.943  1.00   27.38  ? 369  ILE A CG1 1 
ATOM   2846 C  CG2 . ILE A  1 369 ? -9.012  -43.431 -5.201  1.00   23.55  ? 369  ILE A CG2 1 
ATOM   2847 C  CD1 . ILE A  1 369 ? -6.976  -44.086 -7.324  1.00   23.54  ? 369  ILE A CD1 1 
ATOM   2848 N  N   . LEU A  1 370 ? -8.092  -45.210 -2.066  1.00   32.66  ? 370  LEU A N   1 
ATOM   2849 C  CA  . LEU A  1 370 ? -9.024  -45.771 -1.117  1.00   32.69  ? 370  LEU A CA  1 
ATOM   2850 C  C   . LEU A  1 370 ? -8.913  -45.024 0.197   1.00   29.76  ? 370  LEU A C   1 
ATOM   2851 O  O   . LEU A  1 370 ? -9.917  -44.659 0.788   1.00   38.95  ? 370  LEU A O   1 
ATOM   2852 C  CB  . LEU A  1 370 ? -8.772  -47.267 -0.926  1.00   41.14  ? 370  LEU A CB  1 
ATOM   2853 C  CG  . LEU A  1 370 ? -9.560  -47.991 0.170   1.00   32.62  ? 370  LEU A CG  1 
ATOM   2854 C  CD1 . LEU A  1 370 ? -9.965  -49.341 -0.323  1.00   40.44  ? 370  LEU A CD1 1 
ATOM   2855 C  CD2 . LEU A  1 370 ? -8.715  -48.127 1.419   1.00   34.30  ? 370  LEU A CD2 1 
ATOM   2856 N  N   . PHE A  1 371 ? -7.681  -44.778 0.627   1.00   42.13  ? 371  PHE A N   1 
ATOM   2857 C  CA  . PHE A  1 371 ? -7.417  -44.132 1.910   1.00   40.43  ? 371  PHE A CA  1 
ATOM   2858 C  C   . PHE A  1 371 ? -7.975  -42.717 1.975   1.00   40.07  ? 371  PHE A C   1 
ATOM   2859 O  O   . PHE A  1 371 ? -8.488  -42.304 3.014   1.00   44.32  ? 371  PHE A O   1 
ATOM   2860 C  CB  . PHE A  1 371 ? -5.913  -44.123 2.212   1.00   46.00  ? 371  PHE A CB  1 
ATOM   2861 C  CG  . PHE A  1 371 ? -5.547  -43.325 3.436   1.00   54.93  ? 371  PHE A CG  1 
ATOM   2862 C  CD1 . PHE A  1 371 ? -5.561  -43.914 4.693   1.00   55.98  ? 371  PHE A CD1 1 
ATOM   2863 C  CD2 . PHE A  1 371 ? -5.187  -41.981 3.332   1.00   56.27  ? 371  PHE A CD2 1 
ATOM   2864 C  CE1 . PHE A  1 371 ? -5.233  -43.181 5.825   1.00   56.73  ? 371  PHE A CE1 1 
ATOM   2865 C  CE2 . PHE A  1 371 ? -4.854  -41.245 4.462   1.00   57.64  ? 371  PHE A CE2 1 
ATOM   2866 C  CZ  . PHE A  1 371 ? -4.873  -41.847 5.711   1.00   54.78  ? 371  PHE A CZ  1 
ATOM   2867 N  N   . HIS A  1 372 ? -7.885  -41.985 0.866   1.00   38.19  ? 372  HIS A N   1 
ATOM   2868 C  CA  A HIS A  1 372 ? -8.356  -40.595 0.776   0.51   41.33  ? 372  HIS A CA  1 
ATOM   2869 C  CA  B HIS A  1 372 ? -8.355  -40.606 0.862   0.49   41.36  ? 372  HIS A CA  1 
ATOM   2870 C  C   . HIS A  1 372 ? -9.880  -40.464 0.696   1.00   43.42  ? 372  HIS A C   1 
ATOM   2871 O  O   . HIS A  1 372 ? -10.461 -39.505 1.188   1.00   50.62  ? 372  HIS A O   1 
ATOM   2872 C  CB  A HIS A  1 372 ? -7.732  -39.894 -0.440  0.51   25.39  ? 372  HIS A CB  1 
ATOM   2873 C  CB  B HIS A  1 372 ? -7.563  -39.753 -0.142  0.49   39.97  ? 372  HIS A CB  1 
ATOM   2874 C  CG  A HIS A  1 372 ? -8.049  -38.430 -0.528  0.51   41.29  ? 372  HIS A CG  1 
ATOM   2875 C  CG  B HIS A  1 372 ? -6.222  -39.309 0.372   0.49   36.53  ? 372  HIS A CG  1 
ATOM   2876 N  ND1 A HIS A  1 372 ? -7.299  -37.464 0.110   0.51   24.68  ? 372  HIS A ND1 1 
ATOM   2877 N  ND1 B HIS A  1 372 ? -5.088  -40.092 0.281   0.49   32.91  ? 372  HIS A ND1 1 
ATOM   2878 C  CD2 A HIS A  1 372 ? -9.036  -37.769 -1.181  0.51   40.39  ? 372  HIS A CD2 1 
ATOM   2879 C  CD2 B HIS A  1 372 ? -5.839  -38.170 0.999   0.49   26.65  ? 372  HIS A CD2 1 
ATOM   2880 C  CE1 A HIS A  1 372 ? -7.813  -36.274 -0.143  0.51   23.64  ? 372  HIS A CE1 1 
ATOM   2881 C  CE1 B HIS A  1 372 ? -4.067  -39.451 0.820   0.49   28.22  ? 372  HIS A CE1 1 
ATOM   2882 N  NE2 A HIS A  1 372 ? -8.867  -36.431 -0.925  0.51   22.57  ? 372  HIS A NE2 1 
ATOM   2883 N  NE2 B HIS A  1 372 ? -4.495  -38.282 1.262   0.49   36.78  ? 372  HIS A NE2 1 
ATOM   2884 N  N   . TYR A  1 373 ? -10.533 -41.431 0.057   1.00   41.78  ? 373  TYR A N   1 
ATOM   2885 C  CA  . TYR A  1 373 ? -11.972 -41.325 -0.174  1.00   36.23  ? 373  TYR A CA  1 
ATOM   2886 C  C   . TYR A  1 373 ? -12.866 -42.146 0.755   1.00   46.01  ? 373  TYR A C   1 
ATOM   2887 O  O   . TYR A  1 373 ? -14.091 -42.118 0.618   1.00   49.82  ? 373  TYR A O   1 
ATOM   2888 C  CB  . TYR A  1 373 ? -12.304 -41.653 -1.636  1.00   34.49  ? 373  TYR A CB  1 
ATOM   2889 C  CG  . TYR A  1 373 ? -12.065 -40.492 -2.581  1.00   39.66  ? 373  TYR A CG  1 
ATOM   2890 C  CD1 . TYR A  1 373 ? -13.065 -39.545 -2.825  1.00   36.87  ? 373  TYR A CD1 1 
ATOM   2891 C  CD2 . TYR A  1 373 ? -10.835 -40.330 -3.219  1.00   37.06  ? 373  TYR A CD2 1 
ATOM   2892 C  CE1 . TYR A  1 373 ? -12.845 -38.471 -3.682  1.00   35.40  ? 373  TYR A CE1 1 
ATOM   2893 C  CE2 . TYR A  1 373 ? -10.606 -39.263 -4.071  1.00   36.31  ? 373  TYR A CE2 1 
ATOM   2894 C  CZ  . TYR A  1 373 ? -11.612 -38.335 -4.303  1.00   33.69  ? 373  TYR A CZ  1 
ATOM   2895 O  OH  . TYR A  1 373 ? -11.376 -37.277 -5.160  1.00   25.38  ? 373  TYR A OH  1 
ATOM   2896 N  N   . THR A  1 374 ? -12.277 -42.880 1.692   1.00   53.00  ? 374  THR A N   1 
ATOM   2897 C  CA  . THR A  1 374 ? -13.087 -43.752 2.548   1.00   57.38  ? 374  THR A CA  1 
ATOM   2898 C  C   . THR A  1 374 ? -12.892 -43.478 4.022   1.00   58.08  ? 374  THR A C   1 
ATOM   2899 O  O   . THR A  1 374 ? -13.264 -44.293 4.859   1.00   58.91  ? 374  THR A O   1 
ATOM   2900 C  CB  . THR A  1 374 ? -12.848 -45.272 2.293   1.00   53.21  ? 374  THR A CB  1 
ATOM   2901 O  OG1 . THR A  1 374 ? -11.523 -45.641 2.706   1.00   56.40  ? 374  THR A OG1 1 
ATOM   2902 C  CG2 . THR A  1 374 ? -13.062 -45.628 0.822   1.00   49.47  ? 374  THR A CG2 1 
ATOM   2903 N  N   . ASP A  1 375 ? -12.300 -42.338 4.346   1.00   65.12  ? 375  ASP A N   1 
ATOM   2904 C  CA  . ASP A  1 375 ? -12.271 -41.912 5.736   1.00   73.44  ? 375  ASP A CA  1 
ATOM   2905 C  C   . ASP A  1 375 ? -13.534 -41.110 6.033   1.00   77.00  ? 375  ASP A C   1 
ATOM   2906 O  O   . ASP A  1 375 ? -13.583 -39.898 5.810   1.00   70.51  ? 375  ASP A O   1 
ATOM   2907 C  CB  . ASP A  1 375 ? -11.024 -41.094 6.036   1.00   76.74  ? 375  ASP A CB  1 
ATOM   2908 C  CG  . ASP A  1 375 ? -10.696 -41.073 7.507   1.00   86.25  ? 375  ASP A CG  1 
ATOM   2909 O  OD1 . ASP A  1 375 ? -11.622 -40.833 8.314   1.00   87.08  ? 375  ASP A OD1 1 
ATOM   2910 O  OD2 . ASP A  1 375 ? -9.518  -41.317 7.854   1.00   89.82  ? 375  ASP A OD2 1 
ATOM   2911 N  N   . TRP A  1 376 ? -14.561 -41.796 6.527   1.00   84.62  ? 376  TRP A N   1 
ATOM   2912 C  CA  . TRP A  1 376 ? -15.858 -41.159 6.725   1.00   82.87  ? 376  TRP A CA  1 
ATOM   2913 C  C   . TRP A  1 376 ? -16.465 -41.243 8.123   1.00   90.52  ? 376  TRP A C   1 
ATOM   2914 O  O   . TRP A  1 376 ? -15.854 -41.734 9.085   1.00   79.25  ? 376  TRP A O   1 
ATOM   2915 C  CB  . TRP A  1 376 ? -16.883 -41.663 5.704   1.00   73.82  ? 376  TRP A CB  1 
ATOM   2916 C  CG  . TRP A  1 376 ? -16.781 -43.125 5.376   1.00   65.51  ? 376  TRP A CG  1 
ATOM   2917 C  CD1 . TRP A  1 376 ? -16.744 -44.174 6.255   1.00   58.87  ? 376  TRP A CD1 1 
ATOM   2918 C  CD2 . TRP A  1 376 ? -16.734 -43.700 4.064   1.00   59.41  ? 376  TRP A CD2 1 
ATOM   2919 N  NE1 . TRP A  1 376 ? -16.658 -45.364 5.568   1.00   54.41  ? 376  TRP A NE1 1 
ATOM   2920 C  CE2 . TRP A  1 376 ? -16.652 -45.100 4.223   1.00   56.24  ? 376  TRP A CE2 1 
ATOM   2921 C  CE3 . TRP A  1 376 ? -16.740 -43.162 2.767   1.00   45.00  ? 376  TRP A CE3 1 
ATOM   2922 C  CZ2 . TRP A  1 376 ? -16.576 -45.966 3.137   1.00   55.82  ? 376  TRP A CZ2 1 
ATOM   2923 C  CZ3 . TRP A  1 376 ? -16.668 -44.020 1.696   1.00   42.04  ? 376  TRP A CZ3 1 
ATOM   2924 C  CH2 . TRP A  1 376 ? -16.589 -45.408 1.883   1.00   51.41  ? 376  TRP A CH2 1 
ATOM   2925 N  N   . VAL A  1 377 ? -17.704 -40.761 8.184   1.00   105.87 ? 377  VAL A N   1 
ATOM   2926 C  CA  . VAL A  1 377 ? -18.453 -40.578 9.415   1.00   116.72 ? 377  VAL A CA  1 
ATOM   2927 C  C   . VAL A  1 377 ? -19.903 -41.059 9.249   1.00   121.43 ? 377  VAL A C   1 
ATOM   2928 O  O   . VAL A  1 377 ? -20.614 -40.624 8.336   1.00   121.38 ? 377  VAL A O   1 
ATOM   2929 C  CB  . VAL A  1 377 ? -18.434 -39.085 9.819   1.00   117.59 ? 377  VAL A CB  1 
ATOM   2930 C  CG1 . VAL A  1 377 ? -18.450 -38.196 8.573   1.00   111.90 ? 377  VAL A CG1 1 
ATOM   2931 C  CG2 . VAL A  1 377 ? -19.592 -38.756 10.751  1.00   122.16 ? 377  VAL A CG2 1 
ATOM   2932 N  N   . ASP A  1 378 ? -20.316 -41.970 10.128  1.00   123.25 ? 378  ASP A N   1 
ATOM   2933 C  CA  . ASP A  1 378 ? -21.699 -42.469 10.199  1.00   123.89 ? 378  ASP A CA  1 
ATOM   2934 C  C   . ASP A  1 378 ? -22.198 -43.201 8.957   1.00   118.96 ? 378  ASP A C   1 
ATOM   2935 O  O   . ASP A  1 378 ? -22.823 -42.581 8.103   1.00   120.70 ? 378  ASP A O   1 
ATOM   2936 C  CB  . ASP A  1 378 ? -22.690 -41.345 10.557  1.00   126.87 ? 378  ASP A CB  1 
ATOM   2937 C  CG  . ASP A  1 378 ? -24.120 -41.860 10.790  1.00   129.06 ? 378  ASP A CG  1 
ATOM   2938 O  OD1 . ASP A  1 378 ? -24.279 -43.020 11.225  1.00   132.22 ? 378  ASP A OD1 1 
ATOM   2939 O  OD2 . ASP A  1 378 ? -25.090 -41.105 10.548  1.00   126.11 ? 378  ASP A OD2 1 
ATOM   2940 N  N   . ASP A  1 379 ? -21.912 -44.499 8.830   1.00   113.62 ? 379  ASP A N   1 
ATOM   2941 C  CA  . ASP A  1 379 ? -20.871 -45.188 9.601   1.00   110.30 ? 379  ASP A CA  1 
ATOM   2942 C  C   . ASP A  1 379 ? -20.031 -46.184 8.765   1.00   101.27 ? 379  ASP A C   1 
ATOM   2943 O  O   . ASP A  1 379 ? -18.816 -45.986 8.694   1.00   93.63  ? 379  ASP A O   1 
ATOM   2944 C  CB  . ASP A  1 379 ? -21.348 -45.779 10.955  1.00   132.10 ? 379  ASP A CB  1 
ATOM   2945 C  CG  . ASP A  1 379 ? -22.860 -45.702 11.149  1.00   130.46 ? 379  ASP A CG  1 
ATOM   2946 O  OD1 . ASP A  1 379 ? -23.591 -45.537 10.150  1.00   129.95 ? 379  ASP A OD1 1 
ATOM   2947 O  OD2 . ASP A  1 379 ? -23.317 -45.818 12.307  1.00   128.29 ? 379  ASP A OD2 1 
ATOM   2948 N  N   . GLN A  1 380 ? -20.585 -47.227 8.120   1.00   99.31  ? 380  GLN A N   1 
ATOM   2949 C  CA  . GLN A  1 380 ? -21.990 -47.727 8.086   1.00   99.68  ? 380  GLN A CA  1 
ATOM   2950 C  C   . GLN A  1 380 ? -23.162 -46.904 7.487   1.00   80.71  ? 380  GLN A C   1 
ATOM   2951 O  O   . GLN A  1 380 ? -24.324 -47.112 7.854   1.00   76.40  ? 380  GLN A O   1 
ATOM   2952 C  CB  . GLN A  1 380 ? -22.413 -48.434 9.392   1.00   103.64 ? 380  GLN A CB  1 
ATOM   2953 C  CG  . GLN A  1 380 ? -21.701 -49.746 9.695   1.00   101.02 ? 380  GLN A CG  1 
ATOM   2954 C  CD  . GLN A  1 380 ? -22.377 -50.515 10.818  1.00   98.00  ? 380  GLN A CD  1 
ATOM   2955 O  OE1 . GLN A  1 380 ? -22.805 -49.931 11.814  1.00   98.71  ? 380  GLN A OE1 1 
ATOM   2956 N  NE2 . GLN A  1 380 ? -22.487 -51.828 10.656  1.00   96.07  ? 380  GLN A NE2 1 
ATOM   2957 N  N   . ARG A  1 381 ? -22.859 -45.998 6.559   1.00   83.78  ? 381  ARG A N   1 
ATOM   2958 C  CA  . ARG A  1 381 ? -23.859 -45.490 5.616   1.00   74.43  ? 381  ARG A CA  1 
ATOM   2959 C  C   . ARG A  1 381 ? -23.724 -46.389 4.392   1.00   62.99  ? 381  ARG A C   1 
ATOM   2960 O  O   . ARG A  1 381 ? -22.626 -46.528 3.845   1.00   58.81  ? 381  ARG A O   1 
ATOM   2961 C  CB  . ARG A  1 381 ? -23.583 -44.031 5.241   1.00   77.11  ? 381  ARG A CB  1 
ATOM   2962 C  CG  . ARG A  1 381 ? -24.679 -43.049 5.649   1.00   85.49  ? 381  ARG A CG  1 
ATOM   2963 C  CD  . ARG A  1 381 ? -24.249 -41.585 5.477   1.00   89.44  ? 381  ARG A CD  1 
ATOM   2964 N  NE  . ARG A  1 381 ? -24.186 -41.179 4.075   1.00   93.50  ? 381  ARG A NE  1 
ATOM   2965 C  CZ  . ARG A  1 381 ? -25.198 -40.632 3.407   1.00   96.57  ? 381  ARG A CZ  1 
ATOM   2966 N  NH1 . ARG A  1 381 ? -26.364 -40.419 4.010   1.00   97.74  ? 381  ARG A NH1 1 
ATOM   2967 N  NH2 . ARG A  1 381 ? -25.045 -40.297 2.131   1.00   94.81  ? 381  ARG A NH2 1 
ATOM   2968 N  N   . PRO A  1 382 ? -24.825 -47.036 3.979   1.00   59.48  ? 382  PRO A N   1 
ATOM   2969 C  CA  . PRO A  1 382 ? -24.765 -48.087 2.952   1.00   53.58  ? 382  PRO A CA  1 
ATOM   2970 C  C   . PRO A  1 382 ? -24.274 -47.583 1.597   1.00   45.89  ? 382  PRO A C   1 
ATOM   2971 O  O   . PRO A  1 382 ? -23.694 -48.348 0.831   1.00   47.05  ? 382  PRO A O   1 
ATOM   2972 C  CB  . PRO A  1 382 ? -26.221 -48.556 2.843   1.00   56.92  ? 382  PRO A CB  1 
ATOM   2973 C  CG  . PRO A  1 382 ? -26.864 -48.135 4.130   1.00   57.64  ? 382  PRO A CG  1 
ATOM   2974 C  CD  . PRO A  1 382 ? -26.188 -46.851 4.503   1.00   59.98  ? 382  PRO A CD  1 
ATOM   2975 N  N   . GLU A  1 383 ? -24.500 -46.308 1.309   1.00   40.69  ? 383  GLU A N   1 
ATOM   2976 C  CA  . GLU A  1 383 ? -24.148 -45.760 0.007   1.00   46.87  ? 383  GLU A CA  1 
ATOM   2977 C  C   . GLU A  1 383 ? -22.742 -45.170 -0.021  1.00   50.46  ? 383  GLU A C   1 
ATOM   2978 O  O   . GLU A  1 383 ? -22.305 -44.665 -1.048  1.00   51.44  ? 383  GLU A O   1 
ATOM   2979 C  CB  . GLU A  1 383 ? -25.179 -44.713 -0.447  1.00   51.01  ? 383  GLU A CB  1 
ATOM   2980 C  CG  . GLU A  1 383 ? -25.445 -43.597 0.559   1.00   59.78  ? 383  GLU A CG  1 
ATOM   2981 C  CD  . GLU A  1 383 ? -26.445 -43.999 1.643   1.00   74.82  ? 383  GLU A CD  1 
ATOM   2982 O  OE1 . GLU A  1 383 ? -27.501 -44.586 1.305   1.00   80.04  ? 383  GLU A OE1 1 
ATOM   2983 O  OE2 . GLU A  1 383 ? -26.170 -43.731 2.835   1.00   76.70  ? 383  GLU A OE2 1 
ATOM   2984 N  N   . ASN A  1 384 ? -22.042 -45.244 1.106   1.00   54.80  ? 384  ASN A N   1 
ATOM   2985 C  CA  . ASN A  1 384 ? -20.685 -44.701 1.233   1.00   52.08  ? 384  ASN A CA  1 
ATOM   2986 C  C   . ASN A  1 384 ? -19.766 -45.035 0.065   1.00   45.97  ? 384  ASN A C   1 
ATOM   2987 O  O   . ASN A  1 384 ? -19.217 -44.138 -0.581  1.00   40.01  ? 384  ASN A O   1 
ATOM   2988 C  CB  . ASN A  1 384 ? -20.029 -45.191 2.525   1.00   52.70  ? 384  ASN A CB  1 
ATOM   2989 C  CG  . ASN A  1 384 ? -20.410 -44.360 3.722   1.00   53.39  ? 384  ASN A CG  1 
ATOM   2990 O  OD1 . ASN A  1 384 ? -20.876 -43.221 3.585   1.00   49.91  ? 384  ASN A OD1 1 
ATOM   2991 N  ND2 . ASN A  1 384 ? -20.208 -44.919 4.913   1.00   55.32  ? 384  ASN A ND2 1 
ATOM   2992 N  N   . TYR A  1 385 ? -19.607 -46.332 -0.191  1.00   42.04  ? 385  TYR A N   1 
ATOM   2993 C  CA  . TYR A  1 385 ? -18.716 -46.802 -1.236  1.00   41.31  ? 385  TYR A CA  1 
ATOM   2994 C  C   . TYR A  1 385 ? -19.244 -46.451 -2.628  1.00   42.01  ? 385  TYR A C   1 
ATOM   2995 O  O   . TYR A  1 385 ? -18.467 -46.145 -3.537  1.00   40.13  ? 385  TYR A O   1 
ATOM   2996 C  CB  . TYR A  1 385 ? -18.461 -48.311 -1.090  1.00   45.20  ? 385  TYR A CB  1 
ATOM   2997 C  CG  . TYR A  1 385 ? -17.645 -48.668 0.141   1.00   45.80  ? 385  TYR A CG  1 
ATOM   2998 C  CD1 . TYR A  1 385 ? -16.279 -48.369 0.212   1.00   40.50  ? 385  TYR A CD1 1 
ATOM   2999 C  CD2 . TYR A  1 385 ? -18.234 -49.306 1.231   1.00   42.58  ? 385  TYR A CD2 1 
ATOM   3000 C  CE1 . TYR A  1 385 ? -15.530 -48.691 1.336   1.00   36.28  ? 385  TYR A CE1 1 
ATOM   3001 C  CE2 . TYR A  1 385 ? -17.492 -49.635 2.352   1.00   42.82  ? 385  TYR A CE2 1 
ATOM   3002 C  CZ  . TYR A  1 385 ? -16.146 -49.323 2.405   1.00   42.14  ? 385  TYR A CZ  1 
ATOM   3003 O  OH  . TYR A  1 385 ? -15.423 -49.650 3.531   1.00   49.68  ? 385  TYR A OH  1 
ATOM   3004 N  N   . ARG A  1 386 ? -20.566 -46.489 -2.782  1.00   41.80  ? 386  ARG A N   1 
ATOM   3005 C  CA  . ARG A  1 386 ? -21.218 -46.076 -4.021  1.00   32.21  ? 386  ARG A CA  1 
ATOM   3006 C  C   . ARG A  1 386 ? -20.904 -44.618 -4.340  1.00   26.46  ? 386  ARG A C   1 
ATOM   3007 O  O   . ARG A  1 386 ? -20.451 -44.311 -5.442  1.00   37.51  ? 386  ARG A O   1 
ATOM   3008 C  CB  . ARG A  1 386 ? -22.735 -46.268 -3.915  1.00   32.83  ? 386  ARG A CB  1 
ATOM   3009 C  CG  . ARG A  1 386 ? -23.510 -45.982 -5.207  1.00   31.04  ? 386  ARG A CG  1 
ATOM   3010 C  CD  . ARG A  1 386 ? -25.002 -46.003 -4.972  1.00   29.96  ? 386  ARG A CD  1 
ATOM   3011 N  NE  . ARG A  1 386 ? -25.524 -44.741 -4.445  1.00   46.06  ? 386  ARG A NE  1 
ATOM   3012 C  CZ  . ARG A  1 386 ? -26.713 -44.607 -3.853  1.00   46.35  ? 386  ARG A CZ  1 
ATOM   3013 N  NH1 . ARG A  1 386 ? -27.506 -45.659 -3.685  1.00   50.81  ? 386  ARG A NH1 1 
ATOM   3014 N  NH2 . ARG A  1 386 ? -27.111 -43.421 -3.411  1.00   42.48  ? 386  ARG A NH2 1 
ATOM   3015 N  N   . GLU A  1 387 ? -21.144 -43.727 -3.377  1.00   34.37  ? 387  GLU A N   1 
ATOM   3016 C  CA  . GLU A  1 387 ? -20.916 -42.290 -3.580  1.00   38.56  ? 387  GLU A CA  1 
ATOM   3017 C  C   . GLU A  1 387 ? -19.436 -42.035 -3.830  1.00   37.24  ? 387  GLU A C   1 
ATOM   3018 O  O   . GLU A  1 387 ? -19.067 -41.238 -4.700  1.00   35.63  ? 387  GLU A O   1 
ATOM   3019 C  CB  . GLU A  1 387 ? -21.347 -41.452 -2.363  1.00   44.15  ? 387  GLU A CB  1 
ATOM   3020 C  CG  . GLU A  1 387 ? -22.684 -41.782 -1.747  1.00   56.11  ? 387  GLU A CG  1 
ATOM   3021 C  CD  . GLU A  1 387 ? -23.817 -40.920 -2.263  1.00   65.08  ? 387  GLU A CD  1 
ATOM   3022 O  OE1 . GLU A  1 387 ? -24.327 -41.203 -3.368  1.00   67.28  ? 387  GLU A OE1 1 
ATOM   3023 O  OE2 . GLU A  1 387 ? -24.207 -39.970 -1.548  1.00   67.95  ? 387  GLU A OE2 1 
ATOM   3024 N  N   . ALA A  1 388 ? -18.594 -42.716 -3.057  1.00   31.27  ? 388  ALA A N   1 
ATOM   3025 C  CA  . ALA A  1 388 ? -17.159 -42.482 -3.117  1.00   31.34  ? 388  ALA A CA  1 
ATOM   3026 C  C   . ALA A  1 388 ? -16.548 -42.848 -4.464  1.00   30.31  ? 388  ALA A C   1 
ATOM   3027 O  O   . ALA A  1 388 ? -15.685 -42.121 -4.950  1.00   24.13  ? 388  ALA A O   1 
ATOM   3028 C  CB  . ALA A  1 388 ? -16.430 -43.199 -1.975  1.00   25.71  ? 388  ALA A CB  1 
ATOM   3029 N  N   . LEU A  1 389 ? -16.989 -43.949 -5.073  1.00   23.76  ? 389  LEU A N   1 
ATOM   3030 C  CA  . LEU A  1 389 ? -16.390 -44.366 -6.340  1.00   37.68  ? 389  LEU A CA  1 
ATOM   3031 C  C   . LEU A  1 389 ? -16.732 -43.376 -7.444  1.00   33.72  ? 389  LEU A C   1 
ATOM   3032 O  O   . LEU A  1 389 ? -15.850 -42.972 -8.222  1.00   30.99  ? 389  LEU A O   1 
ATOM   3033 C  CB  . LEU A  1 389 ? -16.792 -45.796 -6.731  1.00   39.07  ? 389  LEU A CB  1 
ATOM   3034 C  CG  . LEU A  1 389 ? -16.160 -46.375 -8.004  1.00   33.30  ? 389  LEU A CG  1 
ATOM   3035 C  CD1 . LEU A  1 389 ? -14.637 -46.408 -7.921  1.00   23.82  ? 389  LEU A CD1 1 
ATOM   3036 C  CD2 . LEU A  1 389 ? -16.703 -47.755 -8.278  1.00   30.35  ? 389  LEU A CD2 1 
ATOM   3037 N  N   . GLY A  1 390 ? -18.006 -42.977 -7.487  1.00   27.00  ? 390  GLY A N   1 
ATOM   3038 C  CA  . GLY A  1 390 ? -18.459 -41.900 -8.355  1.00   23.22  ? 390  GLY A CA  1 
ATOM   3039 C  C   . GLY A  1 390 ? -17.662 -40.613 -8.195  1.00   26.69  ? 390  GLY A C   1 
ATOM   3040 O  O   . GLY A  1 390 ? -17.292 -39.977 -9.190  1.00   29.42  ? 390  GLY A O   1 
ATOM   3041 N  N   . ASP A  1 391 ? -17.390 -40.226 -6.948  1.00   25.05  ? 391  ASP A N   1 
ATOM   3042 C  CA  . ASP A  1 391 ? -16.578 -39.033 -6.683  1.00   29.91  ? 391  ASP A CA  1 
ATOM   3043 C  C   . ASP A  1 391 ? -15.125 -39.204 -7.132  1.00   31.00  ? 391  ASP A C   1 
ATOM   3044 O  O   . ASP A  1 391 ? -14.506 -38.244 -7.597  1.00   26.80  ? 391  ASP A O   1 
ATOM   3045 C  CB  . ASP A  1 391 ? -16.620 -38.637 -5.201  1.00   33.87  ? 391  ASP A CB  1 
ATOM   3046 C  CG  . ASP A  1 391 ? -17.906 -37.940 -4.817  1.00   40.51  ? 391  ASP A CG  1 
ATOM   3047 O  OD1 . ASP A  1 391 ? -18.487 -37.230 -5.673  1.00   37.66  ? 391  ASP A OD1 1 
ATOM   3048 O  OD2 . ASP A  1 391 ? -18.329 -38.101 -3.650  1.00   46.88  ? 391  ASP A OD2 1 
ATOM   3049 N  N   . VAL A  1 392 ? -14.590 -40.419 -6.986  1.00   29.50  ? 392  VAL A N   1 
ATOM   3050 C  CA  . VAL A  1 392 ? -13.222 -40.709 -7.412  1.00   27.28  ? 392  VAL A CA  1 
ATOM   3051 C  C   . VAL A  1 392 ? -13.092 -40.449 -8.900  1.00   24.93  ? 392  VAL A C   1 
ATOM   3052 O  O   . VAL A  1 392 ? -12.164 -39.773 -9.336  1.00   19.88  ? 392  VAL A O   1 
ATOM   3053 C  CB  . VAL A  1 392 ? -12.815 -42.181 -7.159  1.00   29.47  ? 392  VAL A CB  1 
ATOM   3054 C  CG1 . VAL A  1 392 ? -11.531 -42.513 -7.910  1.00   31.51  ? 392  VAL A CG1 1 
ATOM   3055 C  CG2 . VAL A  1 392 ? -12.640 -42.455 -5.684  1.00   29.97  ? 392  VAL A CG2 1 
ATOM   3056 N  N   . VAL A  1 393 ? -14.038 -40.984 -9.669  1.00   21.32  ? 393  VAL A N   1 
ATOM   3057 C  CA  . VAL A  1 393 ? -13.991 -40.881 -11.120 1.00   19.41  ? 393  VAL A CA  1 
ATOM   3058 C  C   . VAL A  1 393 ? -14.272 -39.449 -11.561 1.00   25.76  ? 393  VAL A C   1 
ATOM   3059 O  O   . VAL A  1 393 ? -13.624 -38.929 -12.478 1.00   28.78  ? 393  VAL A O   1 
ATOM   3060 C  CB  . VAL A  1 393 ? -14.983 -41.864 -11.802 1.00   23.62  ? 393  VAL A CB  1 
ATOM   3061 C  CG1 . VAL A  1 393 ? -15.169 -41.501 -13.282 1.00   16.65  ? 393  VAL A CG1 1 
ATOM   3062 C  CG2 . VAL A  1 393 ? -14.510 -43.311 -11.636 1.00   18.83  ? 393  VAL A CG2 1 
ATOM   3063 N  N   . GLY A  1 394 ? -15.225 -38.807 -10.891 1.00   22.95  ? 394  GLY A N   1 
ATOM   3064 C  CA  . GLY A  1 394 ? -15.555 -37.426 -11.189 1.00   23.65  ? 394  GLY A CA  1 
ATOM   3065 C  C   . GLY A  1 394 ? -14.387 -36.498 -10.920 1.00   26.75  ? 394  GLY A C   1 
ATOM   3066 O  O   . GLY A  1 394 ? -13.964 -35.753 -11.807 1.00   22.63  ? 394  GLY A O   1 
ATOM   3067 N  N   . ASP A  1 395 ? -13.855 -36.553 -9.701  1.00   29.86  ? 395  ASP A N   1 
ATOM   3068 C  CA  . ASP A  1 395 ? -12.753 -35.674 -9.303  1.00   28.85  ? 395  ASP A CA  1 
ATOM   3069 C  C   . ASP A  1 395 ? -11.500 -35.843 -10.164 1.00   25.50  ? 395  ASP A C   1 
ATOM   3070 O  O   . ASP A  1 395 ? -10.859 -34.867 -10.535 1.00   20.99  ? 395  ASP A O   1 
ATOM   3071 C  CB  . ASP A  1 395 ? -12.412 -35.867 -7.823  1.00   18.74  ? 395  ASP A CB  1 
ATOM   3072 C  CG  . ASP A  1 395 ? -13.570 -35.506 -6.908  1.00   23.20  ? 395  ASP A CG  1 
ATOM   3073 O  OD1 . ASP A  1 395 ? -14.461 -34.729 -7.340  1.00   20.15  ? 395  ASP A OD1 1 
ATOM   3074 O  OD2 . ASP A  1 395 ? -13.591 -36.005 -5.761  1.00   26.89  ? 395  ASP A OD2 1 
ATOM   3075 N  N   . TYR A  1 396 ? -11.170 -37.080 -10.501 1.00   26.12  ? 396  TYR A N   1 
ATOM   3076 C  CA  . TYR A  1 396 ? -9.923  -37.353 -11.206 1.00   28.31  ? 396  TYR A CA  1 
ATOM   3077 C  C   . TYR A  1 396 ? -10.033 -36.981 -12.666 1.00   24.52  ? 396  TYR A C   1 
ATOM   3078 O  O   . TYR A  1 396 ? -9.128  -36.363 -13.214 1.00   20.63  ? 396  TYR A O   1 
ATOM   3079 C  CB  . TYR A  1 396 ? -9.530  -38.829 -11.049 1.00   16.40  ? 396  TYR A CB  1 
ATOM   3080 C  CG  . TYR A  1 396 ? -8.366  -39.308 -11.895 1.00   18.84  ? 396  TYR A CG  1 
ATOM   3081 C  CD1 . TYR A  1 396 ? -7.102  -38.713 -11.801 1.00   23.44  ? 396  TYR A CD1 1 
ATOM   3082 C  CD2 . TYR A  1 396 ? -8.518  -40.383 -12.764 1.00   17.19  ? 396  TYR A CD2 1 
ATOM   3083 C  CE1 . TYR A  1 396 ? -6.023  -39.181 -12.564 1.00   28.83  ? 396  TYR A CE1 1 
ATOM   3084 C  CE2 . TYR A  1 396 ? -7.463  -40.854 -13.528 1.00   24.91  ? 396  TYR A CE2 1 
ATOM   3085 C  CZ  . TYR A  1 396 ? -6.215  -40.259 -13.426 1.00   33.05  ? 396  TYR A CZ  1 
ATOM   3086 O  OH  . TYR A  1 396 ? -5.174  -40.744 -14.192 1.00   32.27  ? 396  TYR A OH  1 
ATOM   3087 N  N   . ASN A  1 397 ? -11.154 -37.343 -13.286 1.00   28.43  ? 397  ASN A N   1 
ATOM   3088 C  CA  . ASN A  1 397 ? -11.311 -37.173 -14.735 1.00   27.16  ? 397  ASN A CA  1 
ATOM   3089 C  C   . ASN A  1 397 ? -11.813 -35.825 -15.218 1.00   19.38  ? 397  ASN A C   1 
ATOM   3090 O  O   . ASN A  1 397 ? -11.624 -35.483 -16.382 1.00   19.67  ? 397  ASN A O   1 
ATOM   3091 C  CB  . ASN A  1 397 ? -12.205 -38.266 -15.324 1.00   19.43  ? 397  ASN A CB  1 
ATOM   3092 C  CG  . ASN A  1 397 ? -11.524 -39.606 -15.354 1.00   21.97  ? 397  ASN A CG  1 
ATOM   3093 O  OD1 . ASN A  1 397 ? -10.586 -39.807 -16.123 1.00   21.04  ? 397  ASN A OD1 1 
ATOM   3094 N  ND2 . ASN A  1 397 ? -11.981 -40.534 -14.510 1.00   23.80  ? 397  ASN A ND2 1 
ATOM   3095 N  N   . PHE A  1 398 ? -12.465 -35.064 -14.352 1.00   18.01  ? 398  PHE A N   1 
ATOM   3096 C  CA  . PHE A  1 398 ? -13.148 -33.865 -14.825 1.00   19.93  ? 398  PHE A CA  1 
ATOM   3097 C  C   . PHE A  1 398 ? -12.955 -32.657 -13.932 1.00   22.04  ? 398  PHE A C   1 
ATOM   3098 O  O   . PHE A  1 398 ? -12.374 -31.650 -14.361 1.00   21.01  ? 398  PHE A O   1 
ATOM   3099 C  CB  . PHE A  1 398 ? -14.638 -34.154 -15.043 1.00   11.88  ? 398  PHE A CB  1 
ATOM   3100 C  CG  . PHE A  1 398 ? -14.890 -35.223 -16.071 1.00   19.26  ? 398  PHE A CG  1 
ATOM   3101 C  CD1 . PHE A  1 398 ? -14.815 -34.931 -17.430 1.00   18.30  ? 398  PHE A CD1 1 
ATOM   3102 C  CD2 . PHE A  1 398 ? -15.166 -36.530 -15.686 1.00   15.85  ? 398  PHE A CD2 1 
ATOM   3103 C  CE1 . PHE A  1 398 ? -15.026 -35.917 -18.383 1.00   23.71  ? 398  PHE A CE1 1 
ATOM   3104 C  CE2 . PHE A  1 398 ? -15.388 -37.532 -16.640 1.00   21.63  ? 398  PHE A CE2 1 
ATOM   3105 C  CZ  . PHE A  1 398 ? -15.319 -37.230 -17.987 1.00   23.64  ? 398  PHE A CZ  1 
ATOM   3106 N  N   . ILE A  1 399 ? -13.438 -32.762 -12.693 1.00   20.79  ? 399  ILE A N   1 
ATOM   3107 C  CA  . ILE A  1 399 ? -13.491 -31.607 -11.806 1.00   22.82  ? 399  ILE A CA  1 
ATOM   3108 C  C   . ILE A  1 399 ? -12.107 -31.027 -11.476 1.00   28.59  ? 399  ILE A C   1 
ATOM   3109 O  O   . ILE A  1 399 ? -11.843 -29.857 -11.760 1.00   33.19  ? 399  ILE A O   1 
ATOM   3110 C  CB  . ILE A  1 399 ? -14.274 -31.906 -10.532 1.00   21.32  ? 399  ILE A CB  1 
ATOM   3111 C  CG1 . ILE A  1 399 ? -15.704 -32.317 -10.887 1.00   21.66  ? 399  ILE A CG1 1 
ATOM   3112 C  CG2 . ILE A  1 399 ? -14.255 -30.690 -9.599  1.00   21.40  ? 399  ILE A CG2 1 
ATOM   3113 C  CD1 . ILE A  1 399 ? -16.550 -32.722 -9.695  1.00   21.79  ? 399  ILE A CD1 1 
ATOM   3114 N  N   . CYS A  1 400 ? -11.223 -31.836 -10.898 1.00   20.12  ? 400  CYS A N   1 
ATOM   3115 C  CA  . CYS A  1 400 ? -9.875  -31.354 -10.609 1.00   18.39  ? 400  CYS A CA  1 
ATOM   3116 C  C   . CYS A  1 400 ? -9.078  -30.800 -11.825 1.00   21.72  ? 400  CYS A C   1 
ATOM   3117 O  O   . CYS A  1 400 ? -8.464  -29.731 -11.721 1.00   21.30  ? 400  CYS A O   1 
ATOM   3118 C  CB  . CYS A  1 400 ? -9.081  -32.390 -9.807  1.00   21.82  ? 400  CYS A CB  1 
ATOM   3119 S  SG  . CYS A  1 400 ? -9.843  -32.756 -8.187  1.00   30.12  ? 400  CYS A SG  1 
ATOM   3120 N  N   . PRO A  1 401 ? -9.101  -31.493 -12.981 1.00   20.90  ? 401  PRO A N   1 
ATOM   3121 C  CA  . PRO A  1 401 ? -8.382  -30.878 -14.106 1.00   24.16  ? 401  PRO A CA  1 
ATOM   3122 C  C   . PRO A  1 401 ? -9.010  -29.558 -14.585 1.00   24.72  ? 401  PRO A C   1 
ATOM   3123 O  O   . PRO A  1 401 ? -8.270  -28.675 -15.031 1.00   28.26  ? 401  PRO A O   1 
ATOM   3124 C  CB  . PRO A  1 401 ? -8.473  -31.942 -15.212 1.00   24.64  ? 401  PRO A CB  1 
ATOM   3125 C  CG  . PRO A  1 401 ? -8.751  -33.214 -14.509 1.00   18.89  ? 401  PRO A CG  1 
ATOM   3126 C  CD  . PRO A  1 401 ? -9.613  -32.830 -13.333 1.00   12.57  ? 401  PRO A CD  1 
ATOM   3127 N  N   . ALA A  1 402 ? -10.333 -29.425 -14.499 1.00   17.22  ? 402  ALA A N   1 
ATOM   3128 C  CA  . ALA A  1 402 ? -11.007 -28.175 -14.887 1.00   16.24  ? 402  ALA A CA  1 
ATOM   3129 C  C   . ALA A  1 402 ? -10.623 -27.019 -13.963 1.00   24.22  ? 402  ALA A C   1 
ATOM   3130 O  O   . ALA A  1 402 ? -10.272 -25.928 -14.424 1.00   29.17  ? 402  ALA A O   1 
ATOM   3131 C  CB  . ALA A  1 402 ? -12.515 -28.357 -14.898 1.00   17.62  ? 402  ALA A CB  1 
ATOM   3132 N  N   . LEU A  1 403 ? -10.707 -27.261 -12.656 1.00   23.76  ? 403  LEU A N   1 
ATOM   3133 C  CA  . LEU A  1 403 ? -10.246 -26.301 -11.657 1.00   23.28  ? 403  LEU A CA  1 
ATOM   3134 C  C   . LEU A  1 403 ? -8.778  -25.935 -11.869 1.00   24.77  ? 403  LEU A C   1 
ATOM   3135 O  O   . LEU A  1 403 ? -8.421  -24.765 -11.864 1.00   25.66  ? 403  LEU A O   1 
ATOM   3136 C  CB  . LEU A  1 403 ? -10.436 -26.860 -10.247 1.00   19.98  ? 403  LEU A CB  1 
ATOM   3137 C  CG  . LEU A  1 403 ? -11.868 -26.872 -9.704  1.00   25.20  ? 403  LEU A CG  1 
ATOM   3138 C  CD1 . LEU A  1 403 ? -11.968 -27.749 -8.469  1.00   21.44  ? 403  LEU A CD1 1 
ATOM   3139 C  CD2 . LEU A  1 403 ? -12.362 -25.461 -9.400  1.00   17.17  ? 403  LEU A CD2 1 
ATOM   3140 N  N   . GLU A  1 404 ? -7.933  -26.942 -12.063 1.00   23.15  ? 404  GLU A N   1 
ATOM   3141 C  CA  . GLU A  1 404 ? -6.501  -26.712 -12.214 1.00   23.31  ? 404  GLU A CA  1 
ATOM   3142 C  C   . GLU A  1 404 ? -6.192  -25.865 -13.449 1.00   27.43  ? 404  GLU A C   1 
ATOM   3143 O  O   . GLU A  1 404 ? -5.407  -24.910 -13.382 1.00   27.61  ? 404  GLU A O   1 
ATOM   3144 C  CB  . GLU A  1 404 ? -5.744  -28.047 -12.268 1.00   18.72  ? 404  GLU A CB  1 
ATOM   3145 C  CG  . GLU A  1 404 ? -4.228  -27.912 -12.212 1.00   31.90  ? 404  GLU A CG  1 
ATOM   3146 C  CD  . GLU A  1 404 ? -3.708  -27.231 -10.919 1.00   66.46  ? 404  GLU A CD  1 
ATOM   3147 O  OE1 . GLU A  1 404 ? -4.486  -27.022 -9.949  1.00   59.45  ? 404  GLU A OE1 1 
ATOM   3148 O  OE2 . GLU A  1 404 ? -2.500  -26.906 -10.880 1.00   67.63  ? 404  GLU A OE2 1 
ATOM   3149 N  N   . PHE A  1 405 ? -6.816  -26.228 -14.568 1.00   23.67  ? 405  PHE A N   1 
ATOM   3150 C  CA  . PHE A  1 405 ? -6.730  -25.456 -15.792 1.00   17.55  ? 405  PHE A CA  1 
ATOM   3151 C  C   . PHE A  1 405 ? -7.070  -23.979 -15.547 1.00   22.82  ? 405  PHE A C   1 
ATOM   3152 O  O   . PHE A  1 405 ? -6.363  -23.076 -15.989 1.00   25.38  ? 405  PHE A O   1 
ATOM   3153 C  CB  . PHE A  1 405 ? -7.682  -26.028 -16.858 1.00   14.09  ? 405  PHE A CB  1 
ATOM   3154 C  CG  . PHE A  1 405 ? -7.775  -25.162 -18.080 1.00   21.25  ? 405  PHE A CG  1 
ATOM   3155 C  CD1 . PHE A  1 405 ? -6.879  -25.327 -19.126 1.00   19.27  ? 405  PHE A CD1 1 
ATOM   3156 C  CD2 . PHE A  1 405 ? -8.714  -24.141 -18.159 1.00   21.87  ? 405  PHE A CD2 1 
ATOM   3157 C  CE1 . PHE A  1 405 ? -6.934  -24.516 -20.237 1.00   22.37  ? 405  PHE A CE1 1 
ATOM   3158 C  CE2 . PHE A  1 405 ? -8.773  -23.328 -19.265 1.00   26.10  ? 405  PHE A CE2 1 
ATOM   3159 C  CZ  . PHE A  1 405 ? -7.882  -23.514 -20.310 1.00   26.01  ? 405  PHE A CZ  1 
ATOM   3160 N  N   . THR A  1 406 ? -8.182  -23.753 -14.858 1.00   19.95  ? 406  THR A N   1 
ATOM   3161 C  CA  . THR A  1 406 ? -8.690  -22.416 -14.610 1.00   15.46  ? 406  THR A CA  1 
ATOM   3162 C  C   . THR A  1 406 ? -7.729  -21.575 -13.753 1.00   22.31  ? 406  THR A C   1 
ATOM   3163 O  O   . THR A  1 406 ? -7.509  -20.397 -14.049 1.00   28.13  ? 406  THR A O   1 
ATOM   3164 C  CB  . THR A  1 406 ? -10.092 -22.478 -13.944 1.00   27.43  ? 406  THR A CB  1 
ATOM   3165 O  OG1 . THR A  1 406 ? -10.977 -23.291 -14.735 1.00   28.75  ? 406  THR A OG1 1 
ATOM   3166 C  CG2 . THR A  1 406 ? -10.685 -21.084 -13.790 1.00   18.29  ? 406  THR A CG2 1 
ATOM   3167 N  N   . LYS A  1 407 ? -7.170  -22.169 -12.696 1.00   17.17  ? 407  LYS A N   1 
ATOM   3168 C  CA  . LYS A  1 407 ? -6.201  -21.462 -11.865 1.00   21.49  ? 407  LYS A CA  1 
ATOM   3169 C  C   . LYS A  1 407 ? -5.041  -21.061 -12.743 1.00   20.81  ? 407  LYS A C   1 
ATOM   3170 O  O   . LYS A  1 407 ? -4.582  -19.921 -12.704 1.00   17.40  ? 407  LYS A O   1 
ATOM   3171 C  CB  . LYS A  1 407 ? -5.656  -22.327 -10.715 1.00   19.98  ? 407  LYS A CB  1 
ATOM   3172 C  CG  . LYS A  1 407 ? -6.692  -22.962 -9.833  1.00   36.57  ? 407  LYS A CG  1 
ATOM   3173 C  CD  . LYS A  1 407 ? -6.065  -23.431 -8.529  1.00   52.99  ? 407  LYS A CD  1 
ATOM   3174 C  CE  . LYS A  1 407 ? -6.884  -24.551 -7.875  1.00   57.21  ? 407  LYS A CE  1 
ATOM   3175 N  NZ  . LYS A  1 407 ? -6.278  -24.984 -6.575  1.00   57.01  ? 407  LYS A NZ  1 
ATOM   3176 N  N   . LYS A  1 408 ? -4.570  -22.006 -13.548 1.00   16.77  ? 408  LYS A N   1 
ATOM   3177 C  CA  . LYS A  1 408 ? -3.347  -21.764 -14.291 1.00   27.54  ? 408  LYS A CA  1 
ATOM   3178 C  C   . LYS A  1 408 ? -3.574  -20.699 -15.345 1.00   21.92  ? 408  LYS A C   1 
ATOM   3179 O  O   . LYS A  1 408 ? -2.793  -19.770 -15.468 1.00   20.81  ? 408  LYS A O   1 
ATOM   3180 C  CB  . LYS A  1 408 ? -2.787  -23.052 -14.891 1.00   28.07  ? 408  LYS A CB  1 
ATOM   3181 C  CG  . LYS A  1 408 ? -2.076  -23.913 -13.863 1.00   45.89  ? 408  LYS A CG  1 
ATOM   3182 C  CD  . LYS A  1 408 ? -1.299  -25.039 -14.525 1.00   62.21  ? 408  LYS A CD  1 
ATOM   3183 C  CE  . LYS A  1 408 ? -0.571  -25.898 -13.499 1.00   69.91  ? 408  LYS A CE  1 
ATOM   3184 N  NZ  . LYS A  1 408 ? 0.386   -26.847 -14.155 1.00   74.65  ? 408  LYS A NZ  1 
ATOM   3185 N  N   . PHE A  1 409 ? -4.667  -20.826 -16.079 1.00   19.39  ? 409  PHE A N   1 
ATOM   3186 C  CA  . PHE A  1 409 ? -5.016  -19.838 -17.076 1.00   22.92  ? 409  PHE A CA  1 
ATOM   3187 C  C   . PHE A  1 409 ? -5.151  -18.449 -16.450 1.00   23.32  ? 409  PHE A C   1 
ATOM   3188 O  O   . PHE A  1 409 ? -4.600  -17.483 -16.960 1.00   25.66  ? 409  PHE A O   1 
ATOM   3189 C  CB  . PHE A  1 409 ? -6.320  -20.239 -17.756 1.00   26.51  ? 409  PHE A CB  1 
ATOM   3190 C  CG  . PHE A  1 409 ? -6.608  -19.480 -19.023 1.00   26.12  ? 409  PHE A CG  1 
ATOM   3191 C  CD1 . PHE A  1 409 ? -7.219  -18.233 -18.979 1.00   26.10  ? 409  PHE A CD1 1 
ATOM   3192 C  CD2 . PHE A  1 409 ? -6.289  -20.025 -20.260 1.00   19.89  ? 409  PHE A CD2 1 
ATOM   3193 C  CE1 . PHE A  1 409 ? -7.499  -17.535 -20.145 1.00   15.83  ? 409  PHE A CE1 1 
ATOM   3194 C  CE2 . PHE A  1 409 ? -6.575  -19.333 -21.429 1.00   21.79  ? 409  PHE A CE2 1 
ATOM   3195 C  CZ  . PHE A  1 409 ? -7.173  -18.079 -21.366 1.00   19.23  ? 409  PHE A CZ  1 
ATOM   3196 N  N   . SER A  1 410 ? -5.878  -18.354 -15.342 1.00   20.33  ? 410  SER A N   1 
ATOM   3197 C  CA  . SER A  1 410 ? -6.149  -17.058 -14.733 1.00   24.87  ? 410  SER A CA  1 
ATOM   3198 C  C   . SER A  1 410 ? -4.883  -16.397 -14.219 1.00   27.15  ? 410  SER A C   1 
ATOM   3199 O  O   . SER A  1 410 ? -4.823  -15.175 -14.100 1.00   28.23  ? 410  SER A O   1 
ATOM   3200 C  CB  . SER A  1 410 ? -7.151  -17.192 -13.589 1.00   25.45  ? 410  SER A CB  1 
ATOM   3201 O  OG  . SER A  1 410 ? -6.610  -18.013 -12.573 1.00   33.94  ? 410  SER A OG  1 
ATOM   3202 N  N   . GLU A  1 411 ? -3.866  -17.202 -13.920 1.00   31.96  ? 411  GLU A N   1 
ATOM   3203 C  CA  . GLU A  1 411 ? -2.633  -16.673 -13.344 1.00   29.35  ? 411  GLU A CA  1 
ATOM   3204 C  C   . GLU A  1 411 ? -1.913  -15.719 -14.285 1.00   30.58  ? 411  GLU A C   1 
ATOM   3205 O  O   . GLU A  1 411 ? -1.031  -14.984 -13.861 1.00   36.30  ? 411  GLU A O   1 
ATOM   3206 C  CB  . GLU A  1 411 ? -1.705  -17.799 -12.887 1.00   28.31  ? 411  GLU A CB  1 
ATOM   3207 C  CG  . GLU A  1 411 ? -1.789  -18.058 -11.377 1.00   40.63  ? 411  GLU A CG  1 
ATOM   3208 C  CD  . GLU A  1 411 ? -1.427  -19.495 -10.978 1.00   55.39  ? 411  GLU A CD  1 
ATOM   3209 O  OE1 . GLU A  1 411 ? -0.787  -20.224 -11.775 1.00   52.01  ? 411  GLU A OE1 1 
ATOM   3210 O  OE2 . GLU A  1 411 ? -1.799  -19.900 -9.854  1.00   63.56  ? 411  GLU A OE2 1 
ATOM   3211 N  N   . TRP A  1 412 ? -2.317  -15.706 -15.551 1.00   27.31  ? 412  TRP A N   1 
ATOM   3212 C  CA  . TRP A  1 412 ? -1.694  -14.844 -16.546 1.00   25.24  ? 412  TRP A CA  1 
ATOM   3213 C  C   . TRP A  1 412 ? -2.526  -13.615 -16.889 1.00   29.56  ? 412  TRP A C   1 
ATOM   3214 O  O   . TRP A  1 412 ? -2.405  -13.054 -17.977 1.00   34.08  ? 412  TRP A O   1 
ATOM   3215 C  CB  . TRP A  1 412 ? -1.349  -15.652 -17.798 1.00   31.39  ? 412  TRP A CB  1 
ATOM   3216 C  CG  . TRP A  1 412 ? -0.306  -16.667 -17.497 1.00   35.46  ? 412  TRP A CG  1 
ATOM   3217 C  CD1 . TRP A  1 412 ? -0.504  -17.941 -17.048 1.00   34.09  ? 412  TRP A CD1 1 
ATOM   3218 C  CD2 . TRP A  1 412 ? 1.111   -16.480 -17.565 1.00   36.98  ? 412  TRP A CD2 1 
ATOM   3219 N  NE1 . TRP A  1 412 ? 0.707   -18.572 -16.850 1.00   33.34  ? 412  TRP A NE1 1 
ATOM   3220 C  CE2 . TRP A  1 412 ? 1.715   -17.694 -17.156 1.00   31.64  ? 412  TRP A CE2 1 
ATOM   3221 C  CE3 . TRP A  1 412 ? 1.931   -15.411 -17.953 1.00   33.51  ? 412  TRP A CE3 1 
ATOM   3222 C  CZ2 . TRP A  1 412 ? 3.097   -17.868 -17.122 1.00   23.51  ? 412  TRP A CZ2 1 
ATOM   3223 C  CZ3 . TRP A  1 412 ? 3.315   -15.585 -17.914 1.00   31.70  ? 412  TRP A CZ3 1 
ATOM   3224 C  CH2 . TRP A  1 412 ? 3.880   -16.804 -17.502 1.00   28.55  ? 412  TRP A CH2 1 
ATOM   3225 N  N   . GLY A  1 413 ? -3.374  -13.197 -15.957 1.00   28.89  ? 413  GLY A N   1 
ATOM   3226 C  CA  . GLY A  1 413 ? -4.019  -11.901 -16.062 1.00   25.23  ? 413  GLY A CA  1 
ATOM   3227 C  C   . GLY A  1 413 ? -5.450  -11.857 -16.557 1.00   33.78  ? 413  GLY A C   1 
ATOM   3228 O  O   . GLY A  1 413 ? -6.161  -10.881 -16.296 1.00   42.84  ? 413  GLY A O   1 
ATOM   3229 N  N   . ASN A  1 414 ? -5.882  -12.899 -17.263 1.00   31.26  ? 414  ASN A N   1 
ATOM   3230 C  CA  . ASN A  1 414 ? -7.223  -12.919 -17.849 1.00   28.37  ? 414  ASN A CA  1 
ATOM   3231 C  C   . ASN A  1 414 ? -8.355  -13.240 -16.886 1.00   23.81  ? 414  ASN A C   1 
ATOM   3232 O  O   . ASN A  1 414 ? -8.216  -14.065 -15.984 1.00   27.56  ? 414  ASN A O   1 
ATOM   3233 C  CB  . ASN A  1 414 ? -7.284  -13.896 -19.020 1.00   38.14  ? 414  ASN A CB  1 
ATOM   3234 C  CG  . ASN A  1 414 ? -6.457  -13.436 -20.206 1.00   40.79  ? 414  ASN A CG  1 
ATOM   3235 O  OD1 . ASN A  1 414 ? -5.518  -14.119 -20.609 1.00   39.15  ? 414  ASN A OD1 1 
ATOM   3236 N  ND2 . ASN A  1 414 ? -6.807  -12.273 -20.775 1.00   35.94  ? 414  ASN A ND2 1 
ATOM   3237 N  N   . ASN A  1 415 ? -9.480  -12.570 -17.089 1.00   18.86  ? 415  ASN A N   1 
ATOM   3238 C  CA  . ASN A  1 415 ? -10.712 -12.902 -16.393 1.00   24.98  ? 415  ASN A CA  1 
ATOM   3239 C  C   . ASN A  1 415 ? -11.184 -14.318 -16.729 1.00   25.94  ? 415  ASN A C   1 
ATOM   3240 O  O   . ASN A  1 415 ? -11.232 -14.734 -17.901 1.00   24.36  ? 415  ASN A O   1 
ATOM   3241 C  CB  . ASN A  1 415 ? -11.812 -11.905 -16.759 1.00   32.05  ? 415  ASN A CB  1 
ATOM   3242 C  CG  . ASN A  1 415 ? -11.703 -10.607 -15.991 1.00   38.08  ? 415  ASN A CG  1 
ATOM   3243 O  OD1 . ASN A  1 415 ? -10.771 -10.417 -15.213 1.00   43.37  ? 415  ASN A OD1 1 
ATOM   3244 N  ND2 . ASN A  1 415 ? -12.655 -9.701  -16.211 1.00   20.73  ? 415  ASN A ND2 1 
ATOM   3245 N  N   . ALA A  1 416 ? -11.539 -15.050 -15.687 1.00   20.41  ? 416  ALA A N   1 
ATOM   3246 C  CA  . ALA A  1 416 ? -12.048 -16.394 -15.829 1.00   15.53  ? 416  ALA A CA  1 
ATOM   3247 C  C   . ALA A  1 416 ? -13.275 -16.497 -14.944 1.00   15.41  ? 416  ALA A C   1 
ATOM   3248 O  O   . ALA A  1 416 ? -13.359 -15.832 -13.914 1.00   18.41  ? 416  ALA A O   1 
ATOM   3249 C  CB  . ALA A  1 416 ? -10.985 -17.399 -15.393 1.00   17.96  ? 416  ALA A CB  1 
ATOM   3250 N  N   . PHE A  1 417 ? -14.229 -17.322 -15.344 1.00   14.63  ? 417  PHE A N   1 
ATOM   3251 C  CA  . PHE A  1 417 ? -15.440 -17.510 -14.560 1.00   14.56  ? 417  PHE A CA  1 
ATOM   3252 C  C   . PHE A  1 417 ? -15.724 -18.992 -14.387 1.00   17.31  ? 417  PHE A C   1 
ATOM   3253 O  O   . PHE A  1 417 ? -15.780 -19.736 -15.373 1.00   21.05  ? 417  PHE A O   1 
ATOM   3254 C  CB  . PHE A  1 417 ? -16.624 -16.799 -15.232 1.00   15.29  ? 417  PHE A CB  1 
ATOM   3255 C  CG  . PHE A  1 417 ? -16.425 -15.321 -15.371 1.00   16.36  ? 417  PHE A CG  1 
ATOM   3256 C  CD1 . PHE A  1 417 ? -15.709 -14.799 -16.448 1.00   18.69  ? 417  PHE A CD1 1 
ATOM   3257 C  CD2 . PHE A  1 417 ? -16.910 -14.453 -14.407 1.00   16.58  ? 417  PHE A CD2 1 
ATOM   3258 C  CE1 . PHE A  1 417 ? -15.484 -13.429 -16.560 1.00   19.32  ? 417  PHE A CE1 1 
ATOM   3259 C  CE2 . PHE A  1 417 ? -16.705 -13.088 -14.519 1.00   18.31  ? 417  PHE A CE2 1 
ATOM   3260 C  CZ  . PHE A  1 417 ? -15.993 -12.573 -15.597 1.00   20.81  ? 417  PHE A CZ  1 
ATOM   3261 N  N   . PHE A  1 418 ? -15.905 -19.419 -13.139 1.00   14.26  ? 418  PHE A N   1 
ATOM   3262 C  CA  . PHE A  1 418 ? -16.151 -20.833 -12.854 1.00   14.94  ? 418  PHE A CA  1 
ATOM   3263 C  C   . PHE A  1 418 ? -17.554 -21.096 -12.313 1.00   20.01  ? 418  PHE A C   1 
ATOM   3264 O  O   . PHE A  1 418 ? -18.050 -20.347 -11.466 1.00   27.19  ? 418  PHE A O   1 
ATOM   3265 C  CB  . PHE A  1 418 ? -15.095 -21.408 -11.900 1.00   13.43  ? 418  PHE A CB  1 
ATOM   3266 C  CG  . PHE A  1 418 ? -14.915 -22.876 -12.048 1.00   15.02  ? 418  PHE A CG  1 
ATOM   3267 C  CD1 . PHE A  1 418 ? -15.807 -23.767 -11.442 1.00   18.42  ? 418  PHE A CD1 1 
ATOM   3268 C  CD2 . PHE A  1 418 ? -13.890 -23.388 -12.844 1.00   17.61  ? 418  PHE A CD2 1 
ATOM   3269 C  CE1 . PHE A  1 418 ? -15.670 -25.150 -11.619 1.00   16.57  ? 418  PHE A CE1 1 
ATOM   3270 C  CE2 . PHE A  1 418 ? -13.736 -24.769 -13.011 1.00   14.03  ? 418  PHE A CE2 1 
ATOM   3271 C  CZ  . PHE A  1 418 ? -14.634 -25.647 -12.403 1.00   13.49  ? 418  PHE A CZ  1 
ATOM   3272 N  N   . TYR A  1 419 ? -18.188 -22.160 -12.805 1.00   20.86  ? 419  TYR A N   1 
ATOM   3273 C  CA  . TYR A  1 419 ? -19.508 -22.568 -12.302 1.00   25.89  ? 419  TYR A CA  1 
ATOM   3274 C  C   . TYR A  1 419 ? -19.507 -24.003 -11.787 1.00   26.92  ? 419  TYR A C   1 
ATOM   3275 O  O   . TYR A  1 419 ? -18.636 -24.806 -12.118 1.00   21.03  ? 419  TYR A O   1 
ATOM   3276 C  CB  . TYR A  1 419 ? -20.630 -22.412 -13.358 1.00   25.74  ? 419  TYR A CB  1 
ATOM   3277 C  CG  . TYR A  1 419 ? -20.556 -23.397 -14.518 1.00   24.58  ? 419  TYR A CG  1 
ATOM   3278 C  CD1 . TYR A  1 419 ? -21.088 -24.686 -14.413 1.00   22.83  ? 419  TYR A CD1 1 
ATOM   3279 C  CD2 . TYR A  1 419 ? -19.952 -23.036 -15.717 1.00   17.62  ? 419  TYR A CD2 1 
ATOM   3280 C  CE1 . TYR A  1 419 ? -21.007 -25.586 -15.467 1.00   22.20  ? 419  TYR A CE1 1 
ATOM   3281 C  CE2 . TYR A  1 419 ? -19.870 -23.926 -16.786 1.00   19.48  ? 419  TYR A CE2 1 
ATOM   3282 C  CZ  . TYR A  1 419 ? -20.394 -25.201 -16.659 1.00   23.24  ? 419  TYR A CZ  1 
ATOM   3283 O  OH  . TYR A  1 419 ? -20.302 -26.082 -17.728 1.00   13.52  ? 419  TYR A OH  1 
ATOM   3284 N  N   . TYR A  1 420 ? -20.520 -24.307 -10.989 1.00   29.75  ? 420  TYR A N   1 
ATOM   3285 C  CA  . TYR A  1 420 ? -20.756 -25.640 -10.474 1.00   25.67  ? 420  TYR A CA  1 
ATOM   3286 C  C   . TYR A  1 420 ? -22.245 -25.902 -10.698 1.00   25.02  ? 420  TYR A C   1 
ATOM   3287 O  O   . TYR A  1 420 ? -23.101 -25.365 -9.986  1.00   20.25  ? 420  TYR A O   1 
ATOM   3288 C  CB  . TYR A  1 420 ? -20.429 -25.675 -8.988  1.00   24.70  ? 420  TYR A CB  1 
ATOM   3289 C  CG  . TYR A  1 420 ? -20.429 -27.054 -8.369  1.00   23.80  ? 420  TYR A CG  1 
ATOM   3290 C  CD1 . TYR A  1 420 ? -19.529 -28.023 -8.796  1.00   22.30  ? 420  TYR A CD1 1 
ATOM   3291 C  CD2 . TYR A  1 420 ? -21.305 -27.378 -7.337  1.00   23.42  ? 420  TYR A CD2 1 
ATOM   3292 C  CE1 . TYR A  1 420 ? -19.501 -29.282 -8.231  1.00   17.80  ? 420  TYR A CE1 1 
ATOM   3293 C  CE2 . TYR A  1 420 ? -21.287 -28.637 -6.758  1.00   27.67  ? 420  TYR A CE2 1 
ATOM   3294 C  CZ  . TYR A  1 420 ? -20.377 -29.589 -7.216  1.00   28.11  ? 420  TYR A CZ  1 
ATOM   3295 O  OH  . TYR A  1 420 ? -20.341 -30.850 -6.663  1.00   31.61  ? 420  TYR A OH  1 
ATOM   3296 N  N   . PHE A  1 421 ? -22.547 -26.682 -11.728 1.00   17.34  ? 421  PHE A N   1 
ATOM   3297 C  CA  . PHE A  1 421 ? -23.919 -27.007 -12.085 1.00   19.05  ? 421  PHE A CA  1 
ATOM   3298 C  C   . PHE A  1 421 ? -24.443 -28.108 -11.152 1.00   26.05  ? 421  PHE A C   1 
ATOM   3299 O  O   . PHE A  1 421 ? -23.896 -29.220 -11.129 1.00   23.59  ? 421  PHE A O   1 
ATOM   3300 C  CB  . PHE A  1 421 ? -23.957 -27.454 -13.556 1.00   22.28  ? 421  PHE A CB  1 
ATOM   3301 C  CG  . PHE A  1 421 ? -25.343 -27.687 -14.092 1.00   25.35  ? 421  PHE A CG  1 
ATOM   3302 C  CD1 . PHE A  1 421 ? -26.150 -26.613 -14.462 1.00   23.70  ? 421  PHE A CD1 1 
ATOM   3303 C  CD2 . PHE A  1 421 ? -25.838 -28.983 -14.235 1.00   20.95  ? 421  PHE A CD2 1 
ATOM   3304 C  CE1 . PHE A  1 421 ? -27.433 -26.829 -14.943 1.00   25.57  ? 421  PHE A CE1 1 
ATOM   3305 C  CE2 . PHE A  1 421 ? -27.107 -29.205 -14.718 1.00   19.59  ? 421  PHE A CE2 1 
ATOM   3306 C  CZ  . PHE A  1 421 ? -27.912 -28.125 -15.070 1.00   26.28  ? 421  PHE A CZ  1 
ATOM   3307 N  N   . GLU A  1 422 ? -25.500 -27.788 -10.397 1.00   28.21  ? 422  GLU A N   1 
ATOM   3308 C  CA  . GLU A  1 422 ? -26.052 -28.655 -9.340  1.00   23.66  ? 422  GLU A CA  1 
ATOM   3309 C  C   . GLU A  1 422 ? -27.469 -29.146 -9.593  1.00   31.29  ? 422  GLU A C   1 
ATOM   3310 O  O   . GLU A  1 422 ? -28.110 -29.645 -8.674  1.00   39.16  ? 422  GLU A O   1 
ATOM   3311 C  CB  . GLU A  1 422 ? -26.103 -27.897 -8.008  1.00   21.01  ? 422  GLU A CB  1 
ATOM   3312 C  CG  . GLU A  1 422 ? -24.785 -27.762 -7.276  1.00   31.42  ? 422  GLU A CG  1 
ATOM   3313 C  CD  . GLU A  1 422 ? -24.921 -26.972 -5.993  1.00   35.83  ? 422  GLU A CD  1 
ATOM   3314 O  OE1 . GLU A  1 422 ? -25.808 -26.094 -5.927  1.00   39.74  ? 422  GLU A OE1 1 
ATOM   3315 O  OE2 . GLU A  1 422 ? -24.139 -27.223 -5.052  1.00   41.85  ? 422  GLU A OE2 1 
ATOM   3316 N  N   . HIS A  1 423 ? -27.992 -28.976 -10.800 1.00   36.55  ? 423  HIS A N   1 
ATOM   3317 C  CA  . HIS A  1 423 ? -29.388 -29.349 -11.042 1.00   34.27  ? 423  HIS A CA  1 
ATOM   3318 C  C   . HIS A  1 423 ? -29.541 -30.672 -11.791 1.00   31.59  ? 423  HIS A C   1 
ATOM   3319 O  O   . HIS A  1 423 ? -29.026 -30.844 -12.892 1.00   34.48  ? 423  HIS A O   1 
ATOM   3320 C  CB  . HIS A  1 423 ? -30.146 -28.242 -11.791 1.00   28.27  ? 423  HIS A CB  1 
ATOM   3321 C  CG  . HIS A  1 423 ? -31.578 -28.584 -12.070 1.00   30.64  ? 423  HIS A CG  1 
ATOM   3322 N  ND1 . HIS A  1 423 ? -32.542 -28.621 -11.082 1.00   23.67  ? 423  HIS A ND1 1 
ATOM   3323 C  CD2 . HIS A  1 423 ? -32.201 -28.942 -13.219 1.00   37.39  ? 423  HIS A CD2 1 
ATOM   3324 C  CE1 . HIS A  1 423 ? -33.700 -28.975 -11.614 1.00   32.80  ? 423  HIS A CE1 1 
ATOM   3325 N  NE2 . HIS A  1 423 ? -33.522 -29.180 -12.909 1.00   34.31  ? 423  HIS A NE2 1 
ATOM   3326 N  N   . ARG A  1 424 ? -30.256 -31.608 -11.189 1.00   31.69  ? 424  ARG A N   1 
ATOM   3327 C  CA  . ARG A  1 424 ? -30.627 -32.824 -11.895 1.00   33.29  ? 424  ARG A CA  1 
ATOM   3328 C  C   . ARG A  1 424 ? -31.955 -32.618 -12.606 1.00   30.50  ? 424  ARG A C   1 
ATOM   3329 O  O   . ARG A  1 424 ? -32.974 -32.366 -11.958 1.00   26.17  ? 424  ARG A O   1 
ATOM   3330 C  CB  . ARG A  1 424 ? -30.750 -33.995 -10.924 1.00   34.84  ? 424  ARG A CB  1 
ATOM   3331 C  CG  . ARG A  1 424 ? -31.462 -35.198 -11.503 1.00   27.32  ? 424  ARG A CG  1 
ATOM   3332 C  CD  . ARG A  1 424 ? -31.595 -36.273 -10.464 1.00   35.38  ? 424  ARG A CD  1 
ATOM   3333 N  NE  . ARG A  1 424 ? -32.411 -37.391 -10.927 1.00   47.46  ? 424  ARG A NE  1 
ATOM   3334 C  CZ  . ARG A  1 424 ? -31.910 -38.498 -11.463 1.00   46.61  ? 424  ARG A CZ  1 
ATOM   3335 N  NH1 . ARG A  1 424 ? -30.586 -38.635 -11.610 1.00   40.71  ? 424  ARG A NH1 1 
ATOM   3336 N  NH2 . ARG A  1 424 ? -32.731 -39.468 -11.846 1.00   37.56  ? 424  ARG A NH2 1 
ATOM   3337 N  N   . SER A  1 425 ? -31.932 -32.726 -13.932 1.00   32.85  ? 425  SER A N   1 
ATOM   3338 C  CA  . SER A  1 425 ? -33.132 -32.572 -14.759 1.00   37.15  ? 425  SER A CA  1 
ATOM   3339 C  C   . SER A  1 425 ? -34.329 -33.380 -14.261 1.00   40.99  ? 425  SER A C   1 
ATOM   3340 O  O   . SER A  1 425 ? -34.174 -34.491 -13.744 1.00   44.48  ? 425  SER A O   1 
ATOM   3341 C  CB  . SER A  1 425 ? -32.829 -32.958 -16.207 1.00   36.24  ? 425  SER A CB  1 
ATOM   3342 O  OG  . SER A  1 425 ? -34.019 -33.019 -16.969 1.00   34.51  ? 425  SER A OG  1 
ATOM   3343 N  N   . SER A  1 426 ? -35.521 -32.812 -14.426 1.00   39.58  ? 426  SER A N   1 
ATOM   3344 C  CA  . SER A  1 426 ? -36.747 -33.449 -13.957 1.00   38.73  ? 426  SER A CA  1 
ATOM   3345 C  C   . SER A  1 426 ? -37.060 -34.654 -14.828 1.00   42.01  ? 426  SER A C   1 
ATOM   3346 O  O   . SER A  1 426 ? -37.767 -35.564 -14.405 1.00   32.82  ? 426  SER A O   1 
ATOM   3347 C  CB  . SER A  1 426 ? -37.919 -32.466 -13.997 1.00   36.83  ? 426  SER A CB  1 
ATOM   3348 O  OG  . SER A  1 426 ? -38.239 -32.112 -15.337 1.00   38.61  ? 426  SER A OG  1 
ATOM   3349 N  N   . LYS A  1 427 ? -36.513 -34.648 -16.041 1.00   46.96  ? 427  LYS A N   1 
ATOM   3350 C  CA  . LYS A  1 427 ? -36.772 -35.690 -17.024 1.00   51.68  ? 427  LYS A CA  1 
ATOM   3351 C  C   . LYS A  1 427 ? -35.642 -36.730 -17.161 1.00   51.48  ? 427  LYS A C   1 
ATOM   3352 O  O   . LYS A  1 427 ? -35.694 -37.572 -18.060 1.00   52.92  ? 427  LYS A O   1 
ATOM   3353 C  CB  . LYS A  1 427 ? -37.017 -35.044 -18.392 1.00   56.69  ? 427  LYS A CB  1 
ATOM   3354 C  CG  . LYS A  1 427 ? -38.045 -33.921 -18.394 1.00   64.71  ? 427  LYS A CG  1 
ATOM   3355 C  CD  . LYS A  1 427 ? -38.142 -33.270 -19.773 1.00   64.29  ? 427  LYS A CD  1 
ATOM   3356 C  CE  . LYS A  1 427 ? -38.331 -34.317 -20.869 1.00   60.47  ? 427  LYS A CE  1 
ATOM   3357 N  NZ  . LYS A  1 427 ? -38.442 -33.710 -22.226 1.00   54.54  ? 427  LYS A NZ  1 
ATOM   3358 N  N   . LEU A  1 428 ? -34.621 -36.665 -16.303 1.00   42.90  ? 428  LEU A N   1 
ATOM   3359 C  CA  . LEU A  1 428 ? -33.470 -37.563 -16.416 1.00   38.82  ? 428  LEU A CA  1 
ATOM   3360 C  C   . LEU A  1 428 ? -33.893 -39.033 -16.408 1.00   41.13  ? 428  LEU A C   1 
ATOM   3361 O  O   . LEU A  1 428 ? -34.516 -39.496 -15.451 1.00   47.69  ? 428  LEU A O   1 
ATOM   3362 C  CB  . LEU A  1 428 ? -32.467 -37.308 -15.285 1.00   43.47  ? 428  LEU A CB  1 
ATOM   3363 C  CG  . LEU A  1 428 ? -31.083 -36.772 -15.673 1.00   44.49  ? 428  LEU A CG  1 
ATOM   3364 C  CD1 . LEU A  1 428 ? -30.205 -36.617 -14.451 1.00   49.64  ? 428  LEU A CD1 1 
ATOM   3365 C  CD2 . LEU A  1 428 ? -30.396 -37.668 -16.669 1.00   44.40  ? 428  LEU A CD2 1 
ATOM   3366 N  N   . PRO A  1 429 ? -33.574 -39.770 -17.486 1.00   33.07  ? 429  PRO A N   1 
ATOM   3367 C  CA  . PRO A  1 429 ? -33.990 -41.176 -17.606 1.00   29.87  ? 429  PRO A CA  1 
ATOM   3368 C  C   . PRO A  1 429 ? -33.141 -42.093 -16.716 1.00   34.06  ? 429  PRO A C   1 
ATOM   3369 O  O   . PRO A  1 429 ? -33.584 -43.175 -16.331 1.00   29.57  ? 429  PRO A O   1 
ATOM   3370 C  CB  . PRO A  1 429 ? -33.735 -41.497 -19.082 1.00   27.61  ? 429  PRO A CB  1 
ATOM   3371 C  CG  . PRO A  1 429 ? -33.372 -40.190 -19.735 1.00   32.66  ? 429  PRO A CG  1 
ATOM   3372 C  CD  . PRO A  1 429 ? -32.841 -39.312 -18.673 1.00   28.56  ? 429  PRO A CD  1 
ATOM   3373 N  N   . TRP A  1 430 ? -31.930 -41.654 -16.387 1.00   29.50  ? 430  TRP A N   1 
ATOM   3374 C  CA  . TRP A  1 430 ? -31.080 -42.409 -15.472 1.00   35.40  ? 430  TRP A CA  1 
ATOM   3375 C  C   . TRP A  1 430 ? -31.639 -42.350 -14.034 1.00   36.13  ? 430  TRP A C   1 
ATOM   3376 O  O   . TRP A  1 430 ? -32.435 -41.467 -13.717 1.00   33.20  ? 430  TRP A O   1 
ATOM   3377 C  CB  . TRP A  1 430 ? -29.650 -41.888 -15.542 1.00   34.97  ? 430  TRP A CB  1 
ATOM   3378 C  CG  . TRP A  1 430 ? -29.014 -41.972 -16.915 1.00   32.54  ? 430  TRP A CG  1 
ATOM   3379 C  CD1 . TRP A  1 430 ? -28.940 -40.976 -17.854 1.00   32.25  ? 430  TRP A CD1 1 
ATOM   3380 C  CD2 . TRP A  1 430 ? -28.339 -43.104 -17.482 1.00   31.24  ? 430  TRP A CD2 1 
ATOM   3381 N  NE1 . TRP A  1 430 ? -28.268 -41.423 -18.974 1.00   25.53  ? 430  TRP A NE1 1 
ATOM   3382 C  CE2 . TRP A  1 430 ? -27.885 -42.723 -18.770 1.00   27.54  ? 430  TRP A CE2 1 
ATOM   3383 C  CE3 . TRP A  1 430 ? -28.081 -44.406 -17.033 1.00   26.50  ? 430  TRP A CE3 1 
ATOM   3384 C  CZ2 . TRP A  1 430 ? -27.192 -43.600 -19.612 1.00   24.87  ? 430  TRP A CZ2 1 
ATOM   3385 C  CZ3 . TRP A  1 430 ? -27.379 -45.267 -17.865 1.00   27.13  ? 430  TRP A CZ3 1 
ATOM   3386 C  CH2 . TRP A  1 430 ? -26.947 -44.859 -19.145 1.00   24.83  ? 430  TRP A CH2 1 
ATOM   3387 N  N   . PRO A  1 431 ? -31.256 -43.306 -13.165 1.00   37.66  ? 431  PRO A N   1 
ATOM   3388 C  CA  . PRO A  1 431 ? -31.847 -43.290 -11.819 1.00   40.30  ? 431  PRO A CA  1 
ATOM   3389 C  C   . PRO A  1 431 ? -31.276 -42.203 -10.901 1.00   43.16  ? 431  PRO A C   1 
ATOM   3390 O  O   . PRO A  1 431 ? -30.205 -41.647 -11.154 1.00   45.51  ? 431  PRO A O   1 
ATOM   3391 C  CB  . PRO A  1 431 ? -31.494 -44.670 -11.266 1.00   30.63  ? 431  PRO A CB  1 
ATOM   3392 C  CG  . PRO A  1 431 ? -30.244 -45.033 -11.968 1.00   29.15  ? 431  PRO A CG  1 
ATOM   3393 C  CD  . PRO A  1 431 ? -30.382 -44.475 -13.362 1.00   28.07  ? 431  PRO A CD  1 
ATOM   3394 N  N   . GLU A  1 432 ? -32.005 -41.949 -9.821  1.00   44.22  ? 432  GLU A N   1 
ATOM   3395 C  CA  . GLU A  1 432 ? -31.716 -40.897 -8.854  1.00   38.35  ? 432  GLU A CA  1 
ATOM   3396 C  C   . GLU A  1 432 ? -30.293 -40.917 -8.286  1.00   35.68  ? 432  GLU A C   1 
ATOM   3397 O  O   . GLU A  1 432 ? -29.673 -39.859 -8.144  1.00   33.12  ? 432  GLU A O   1 
ATOM   3398 C  CB  . GLU A  1 432 ? -32.750 -40.943 -7.714  1.00   39.03  ? 432  GLU A CB  1 
ATOM   3399 C  CG  . GLU A  1 432 ? -34.204 -41.222 -8.183  1.00   62.10  ? 432  GLU A CG  1 
ATOM   3400 C  CD  . GLU A  1 432 ? -34.534 -42.721 -8.351  0.0000 58.85  ? 432  GLU A CD  1 
ATOM   3401 O  OE1 . GLU A  1 432 ? -34.645 -43.435 -7.328  1.00   62.75  ? 432  GLU A OE1 1 
ATOM   3402 O  OE2 . GLU A  1 432 ? -34.707 -43.188 -9.505  1.00   51.66  ? 432  GLU A OE2 1 
ATOM   3403 N  N   . TRP A  1 433 ? -29.768 -42.104 -7.981  1.00   34.98  ? 433  TRP A N   1 
ATOM   3404 C  CA  . TRP A  1 433 ? -28.473 -42.204 -7.295  1.00   34.33  ? 433  TRP A CA  1 
ATOM   3405 C  C   . TRP A  1 433 ? -27.341 -41.685 -8.157  1.00   31.60  ? 433  TRP A C   1 
ATOM   3406 O  O   . TRP A  1 433 ? -26.269 -41.347 -7.648  1.00   29.96  ? 433  TRP A O   1 
ATOM   3407 C  CB  . TRP A  1 433 ? -28.152 -43.637 -6.801  1.00   34.43  ? 433  TRP A CB  1 
ATOM   3408 C  CG  . TRP A  1 433 ? -27.828 -44.660 -7.880  1.00   34.56  ? 433  TRP A CG  1 
ATOM   3409 C  CD1 . TRP A  1 433 ? -28.661 -45.640 -8.351  1.00   41.38  ? 433  TRP A CD1 1 
ATOM   3410 C  CD2 . TRP A  1 433 ? -26.589 -44.815 -8.595  1.00   33.83  ? 433  TRP A CD2 1 
ATOM   3411 N  NE1 . TRP A  1 433 ? -28.025 -46.383 -9.321  1.00   39.65  ? 433  TRP A NE1 1 
ATOM   3412 C  CE2 . TRP A  1 433 ? -26.754 -45.898 -9.491  1.00   36.94  ? 433  TRP A CE2 1 
ATOM   3413 C  CE3 . TRP A  1 433 ? -25.358 -44.140 -8.572  1.00   33.82  ? 433  TRP A CE3 1 
ATOM   3414 C  CZ2 . TRP A  1 433 ? -25.738 -46.320 -10.356 1.00   39.67  ? 433  TRP A CZ2 1 
ATOM   3415 C  CZ3 . TRP A  1 433 ? -24.348 -44.558 -9.435  1.00   36.03  ? 433  TRP A CZ3 1 
ATOM   3416 C  CH2 . TRP A  1 433 ? -24.546 -45.637 -10.317 1.00   37.92  ? 433  TRP A CH2 1 
ATOM   3417 N  N   . MET A  1 434 ? -27.569 -41.635 -9.465  1.00   30.12  ? 434  MET A N   1 
ATOM   3418 C  CA  . MET A  1 434 ? -26.539 -41.135 -10.370 1.00   29.47  ? 434  MET A CA  1 
ATOM   3419 C  C   . MET A  1 434 ? -26.452 -39.617 -10.390 1.00   21.75  ? 434  MET A C   1 
ATOM   3420 O  O   . MET A  1 434 ? -25.527 -39.075 -10.969 1.00   21.68  ? 434  MET A O   1 
ATOM   3421 C  CB  . MET A  1 434 ? -26.723 -41.684 -11.784 1.00   27.84  ? 434  MET A CB  1 
ATOM   3422 C  CG  . MET A  1 434 ? -26.527 -43.198 -11.887 1.00   30.08  ? 434  MET A CG  1 
ATOM   3423 S  SD  . MET A  1 434 ? -26.727 -43.812 -13.579 1.00   28.34  ? 434  MET A SD  1 
ATOM   3424 C  CE  . MET A  1 434 ? -25.249 -43.193 -14.361 1.00   27.54  ? 434  MET A CE  1 
ATOM   3425 N  N   . GLY A  1 435 ? -27.421 -38.941 -9.773  1.00   31.80  ? 435  GLY A N   1 
ATOM   3426 C  CA  . GLY A  1 435 ? -27.353 -37.501 -9.526  1.00   26.86  ? 435  GLY A CA  1 
ATOM   3427 C  C   . GLY A  1 435 ? -27.348 -36.567 -10.731 1.00   32.34  ? 435  GLY A C   1 
ATOM   3428 O  O   . GLY A  1 435 ? -28.041 -36.803 -11.725 1.00   39.17  ? 435  GLY A O   1 
ATOM   3429 N  N   . VAL A  1 436 ? -26.565 -35.491 -10.621 1.00   30.42  ? 436  VAL A N   1 
ATOM   3430 C  CA  . VAL A  1 436 ? -26.435 -34.461 -11.659 1.00   23.11  ? 436  VAL A CA  1 
ATOM   3431 C  C   . VAL A  1 436 ? -25.346 -34.902 -12.626 1.00   25.94  ? 436  VAL A C   1 
ATOM   3432 O  O   . VAL A  1 436 ? -24.165 -34.597 -12.450 1.00   29.42  ? 436  VAL A O   1 
ATOM   3433 C  CB  . VAL A  1 436 ? -26.063 -33.085 -11.043 1.00   41.62  ? 436  VAL A CB  1 
ATOM   3434 C  CG1 . VAL A  1 436 ? -26.116 -31.977 -12.089 1.00   16.86  ? 436  VAL A CG1 1 
ATOM   3435 C  CG2 . VAL A  1 436 ? -26.977 -32.760 -9.876  1.00   19.16  ? 436  VAL A CG2 1 
ATOM   3436 N  N   . MET A  1 437 ? -25.750 -35.636 -13.649 1.00   27.51  ? 437  MET A N   1 
ATOM   3437 C  CA  . MET A  1 437 ? -24.801 -36.391 -14.446 1.00   24.44  ? 437  MET A CA  1 
ATOM   3438 C  C   . MET A  1 437 ? -23.989 -35.558 -15.427 1.00   27.62  ? 437  MET A C   1 
ATOM   3439 O  O   . MET A  1 437 ? -24.430 -34.496 -15.903 1.00   19.32  ? 437  MET A O   1 
ATOM   3440 C  CB  . MET A  1 437 ? -25.521 -37.510 -15.197 1.00   21.04  ? 437  MET A CB  1 
ATOM   3441 C  CG  . MET A  1 437 ? -26.090 -38.589 -14.306 1.00   19.73  ? 437  MET A CG  1 
ATOM   3442 S  SD  . MET A  1 437 ? -26.906 -39.894 -15.250 1.00   33.46  ? 437  MET A SD  1 
ATOM   3443 C  CE  . MET A  1 437 ? -25.733 -40.251 -16.554 1.00   36.06  ? 437  MET A CE  1 
ATOM   3444 N  N   . HIS A  1 438 ? -22.788 -36.067 -15.702 1.00   26.78  ? 438  HIS A N   1 
ATOM   3445 C  CA  . HIS A  1 438 ? -21.989 -35.655 -16.842 1.00   29.23  ? 438  HIS A CA  1 
ATOM   3446 C  C   . HIS A  1 438 ? -22.884 -35.511 -18.080 1.00   27.88  ? 438  HIS A C   1 
ATOM   3447 O  O   . HIS A  1 438 ? -23.619 -36.443 -18.437 1.00   25.13  ? 438  HIS A O   1 
ATOM   3448 C  CB  . HIS A  1 438 ? -20.904 -36.708 -17.093 1.00   28.35  ? 438  HIS A CB  1 
ATOM   3449 C  CG  . HIS A  1 438 ? -20.001 -36.400 -18.248 1.00   23.47  ? 438  HIS A CG  1 
ATOM   3450 N  ND1 . HIS A  1 438 ? -19.007 -35.448 -18.184 1.00   21.78  ? 438  HIS A ND1 1 
ATOM   3451 C  CD2 . HIS A  1 438 ? -19.933 -36.932 -19.491 1.00   23.81  ? 438  HIS A CD2 1 
ATOM   3452 C  CE1 . HIS A  1 438 ? -18.364 -35.406 -19.338 1.00   25.39  ? 438  HIS A CE1 1 
ATOM   3453 N  NE2 . HIS A  1 438 ? -18.906 -36.299 -20.149 1.00   26.98  ? 438  HIS A NE2 1 
ATOM   3454 N  N   . GLY A  1 439 ? -22.838 -34.333 -18.701 1.00   21.25  ? 439  GLY A N   1 
ATOM   3455 C  CA  . GLY A  1 439 ? -23.518 -34.085 -19.961 1.00   18.70  ? 439  GLY A CA  1 
ATOM   3456 C  C   . GLY A  1 439 ? -24.943 -33.548 -19.892 1.00   23.63  ? 439  GLY A C   1 
ATOM   3457 O  O   . GLY A  1 439 ? -25.545 -33.262 -20.927 1.00   27.91  ? 439  GLY A O   1 
ATOM   3458 N  N   . TYR A  1 440 ? -25.495 -33.401 -18.692 1.00   17.89  ? 440  TYR A N   1 
ATOM   3459 C  CA  . TYR A  1 440 ? -26.902 -33.028 -18.584 1.00   17.08  ? 440  TYR A CA  1 
ATOM   3460 C  C   . TYR A  1 440 ? -27.129 -31.570 -18.194 1.00   24.90  ? 440  TYR A C   1 
ATOM   3461 O  O   . TYR A  1 440 ? -28.184 -31.204 -17.663 1.00   24.40  ? 440  TYR A O   1 
ATOM   3462 C  CB  . TYR A  1 440 ? -27.665 -34.015 -17.682 1.00   17.01  ? 440  TYR A CB  1 
ATOM   3463 C  CG  . TYR A  1 440 ? -27.846 -35.352 -18.373 1.00   25.79  ? 440  TYR A CG  1 
ATOM   3464 C  CD1 . TYR A  1 440 ? -26.856 -36.334 -18.310 1.00   24.61  ? 440  TYR A CD1 1 
ATOM   3465 C  CD2 . TYR A  1 440 ? -28.974 -35.608 -19.148 1.00   26.84  ? 440  TYR A CD2 1 
ATOM   3466 C  CE1 . TYR A  1 440 ? -27.008 -37.542 -18.970 1.00   20.50  ? 440  TYR A CE1 1 
ATOM   3467 C  CE2 . TYR A  1 440 ? -29.133 -36.809 -19.813 1.00   25.20  ? 440  TYR A CE2 1 
ATOM   3468 C  CZ  . TYR A  1 440 ? -28.150 -37.776 -19.718 1.00   26.67  ? 440  TYR A CZ  1 
ATOM   3469 O  OH  . TYR A  1 440 ? -28.316 -38.978 -20.375 1.00   32.87  ? 440  TYR A OH  1 
ATOM   3470 N  N   . GLU A  1 441 ? -26.136 -30.733 -18.475 1.00   26.48  ? 441  GLU A N   1 
ATOM   3471 C  CA  . GLU A  1 441 ? -26.328 -29.293 -18.347 1.00   26.68  ? 441  GLU A CA  1 
ATOM   3472 C  C   . GLU A  1 441 ? -26.558 -28.748 -19.742 1.00   23.30  ? 441  GLU A C   1 
ATOM   3473 O  O   . GLU A  1 441 ? -27.030 -27.628 -19.932 1.00   30.97  ? 441  GLU A O   1 
ATOM   3474 C  CB  . GLU A  1 441 ? -25.108 -28.626 -17.696 1.00   24.34  ? 441  GLU A CB  1 
ATOM   3475 C  CG  . GLU A  1 441 ? -23.923 -28.344 -18.628 1.00   25.22  ? 441  GLU A CG  1 
ATOM   3476 C  CD  . GLU A  1 441 ? -23.186 -29.608 -19.075 1.00   33.00  ? 441  GLU A CD  1 
ATOM   3477 O  OE1 . GLU A  1 441 ? -23.569 -30.720 -18.626 1.00   27.39  ? 441  GLU A OE1 1 
ATOM   3478 O  OE2 . GLU A  1 441 ? -22.225 -29.476 -19.878 1.00   31.94  ? 441  GLU A OE2 1 
ATOM   3479 N  N   . ILE A  1 442 ? -26.215 -29.574 -20.719 1.00   19.75  ? 442  ILE A N   1 
ATOM   3480 C  CA  . ILE A  1 442 ? -26.221 -29.176 -22.114 1.00   20.69  ? 442  ILE A CA  1 
ATOM   3481 C  C   . ILE A  1 442 ? -27.612 -28.752 -22.581 1.00   23.94  ? 442  ILE A C   1 
ATOM   3482 O  O   . ILE A  1 442 ? -27.761 -27.751 -23.277 1.00   24.99  ? 442  ILE A O   1 
ATOM   3483 C  CB  . ILE A  1 442 ? -25.675 -30.324 -22.981 1.00   22.55  ? 442  ILE A CB  1 
ATOM   3484 C  CG1 . ILE A  1 442 ? -24.265 -30.700 -22.494 1.00   22.66  ? 442  ILE A CG1 1 
ATOM   3485 C  CG2 . ILE A  1 442 ? -25.697 -29.955 -24.455 1.00   18.21  ? 442  ILE A CG2 1 
ATOM   3486 C  CD1 . ILE A  1 442 ? -23.595 -31.803 -23.299 1.00   16.08  ? 442  ILE A CD1 1 
ATOM   3487 N  N   . GLU A  1 443 ? -28.636 -29.498 -22.179 1.00   21.76  ? 443  GLU A N   1 
ATOM   3488 C  CA  . GLU A  1 443 ? -29.981 -29.178 -22.625 1.00   23.34  ? 443  GLU A CA  1 
ATOM   3489 C  C   . GLU A  1 443 ? -30.402 -27.826 -22.048 1.00   29.08  ? 443  GLU A C   1 
ATOM   3490 O  O   . GLU A  1 443 ? -31.227 -27.113 -22.634 1.00   32.57  ? 443  GLU A O   1 
ATOM   3491 C  CB  . GLU A  1 443 ? -30.975 -30.293 -22.286 1.00   28.45  ? 443  GLU A CB  1 
ATOM   3492 C  CG  . GLU A  1 443 ? -31.133 -30.598 -20.798 1.00   36.81  ? 443  GLU A CG  1 
ATOM   3493 C  CD  . GLU A  1 443 ? -31.655 -32.009 -20.549 1.00   40.83  ? 443  GLU A CD  1 
ATOM   3494 O  OE1 . GLU A  1 443 ? -30.936 -32.976 -20.888 1.00   35.18  ? 443  GLU A OE1 1 
ATOM   3495 O  OE2 . GLU A  1 443 ? -32.791 -32.148 -20.036 1.00   44.71  ? 443  GLU A OE2 1 
ATOM   3496 N  N   . PHE A  1 444 ? -29.800 -27.454 -20.923 1.00   22.09  ? 444  PHE A N   1 
ATOM   3497 C  CA  . PHE A  1 444 ? -30.104 -26.170 -20.313 1.00   22.50  ? 444  PHE A CA  1 
ATOM   3498 C  C   . PHE A  1 444 ? -29.393 -25.027 -21.018 1.00   29.50  ? 444  PHE A C   1 
ATOM   3499 O  O   . PHE A  1 444 ? -29.981 -23.956 -21.222 1.00   35.09  ? 444  PHE A O   1 
ATOM   3500 C  CB  . PHE A  1 444 ? -29.803 -26.192 -18.816 1.00   26.64  ? 444  PHE A CB  1 
ATOM   3501 C  CG  . PHE A  1 444 ? -30.805 -26.983 -18.028 1.00   32.89  ? 444  PHE A CG  1 
ATOM   3502 C  CD1 . PHE A  1 444 ? -30.682 -28.357 -17.902 1.00   35.75  ? 444  PHE A CD1 1 
ATOM   3503 C  CD2 . PHE A  1 444 ? -31.896 -26.362 -17.450 1.00   32.82  ? 444  PHE A CD2 1 
ATOM   3504 C  CE1 . PHE A  1 444 ? -31.623 -29.094 -17.193 1.00   31.62  ? 444  PHE A CE1 1 
ATOM   3505 C  CE2 . PHE A  1 444 ? -32.833 -27.096 -16.742 1.00   36.21  ? 444  PHE A CE2 1 
ATOM   3506 C  CZ  . PHE A  1 444 ? -32.694 -28.464 -16.612 1.00   28.50  ? 444  PHE A CZ  1 
ATOM   3507 N  N   . VAL A  1 445 ? -28.144 -25.262 -21.413 1.00   28.90  ? 445  VAL A N   1 
ATOM   3508 C  CA  . VAL A  1 445 ? -27.368 -24.262 -22.147 1.00   28.26  ? 445  VAL A CA  1 
ATOM   3509 C  C   . VAL A  1 445 ? -28.007 -23.962 -23.506 1.00   31.15  ? 445  VAL A C   1 
ATOM   3510 O  O   . VAL A  1 445 ? -28.061 -22.800 -23.947 1.00   29.99  ? 445  VAL A O   1 
ATOM   3511 C  CB  . VAL A  1 445 ? -25.921 -24.744 -22.387 1.00   23.67  ? 445  VAL A CB  1 
ATOM   3512 C  CG1 . VAL A  1 445 ? -25.219 -23.839 -23.396 1.00   22.64  ? 445  VAL A CG1 1 
ATOM   3513 C  CG2 . VAL A  1 445 ? -25.130 -24.835 -21.059 1.00   15.11  ? 445  VAL A CG2 1 
ATOM   3514 N  N   . PHE A  1 446 ? -28.488 -25.024 -24.159 1.00   25.49  ? 446  PHE A N   1 
ATOM   3515 C  CA  . PHE A  1 446 ? -29.067 -24.927 -25.493 1.00   28.40  ? 446  PHE A CA  1 
ATOM   3516 C  C   . PHE A  1 446 ? -30.545 -24.494 -25.436 1.00   33.18  ? 446  PHE A C   1 
ATOM   3517 O  O   . PHE A  1 446 ? -31.196 -24.278 -26.470 1.00   30.04  ? 446  PHE A O   1 
ATOM   3518 C  CB  . PHE A  1 446 ? -28.881 -26.246 -26.257 1.00   22.49  ? 446  PHE A CB  1 
ATOM   3519 C  CG  . PHE A  1 446 ? -27.584 -26.327 -27.016 1.00   21.58  ? 446  PHE A CG  1 
ATOM   3520 C  CD1 . PHE A  1 446 ? -27.496 -25.841 -28.325 1.00   15.52  ? 446  PHE A CD1 1 
ATOM   3521 C  CD2 . PHE A  1 446 ? -26.448 -26.878 -26.425 1.00   19.67  ? 446  PHE A CD2 1 
ATOM   3522 C  CE1 . PHE A  1 446 ? -26.293 -25.894 -29.038 1.00   15.23  ? 446  PHE A CE1 1 
ATOM   3523 C  CE2 . PHE A  1 446 ? -25.221 -26.935 -27.122 1.00   20.62  ? 446  PHE A CE2 1 
ATOM   3524 C  CZ  . PHE A  1 446 ? -25.143 -26.439 -28.435 1.00   23.44  ? 446  PHE A CZ  1 
ATOM   3525 N  N   . GLY A  1 447 ? -31.065 -24.367 -24.219 1.00   24.20  ? 447  GLY A N   1 
ATOM   3526 C  CA  . GLY A  1 447 ? -32.371 -23.774 -24.020 1.00   25.57  ? 447  GLY A CA  1 
ATOM   3527 C  C   . GLY A  1 447 ? -33.567 -24.669 -24.282 1.00   24.39  ? 447  GLY A C   1 
ATOM   3528 O  O   . GLY A  1 447 ? -34.654 -24.174 -24.613 1.00   26.02  ? 447  GLY A O   1 
ATOM   3529 N  N   . LEU A  1 448 ? -33.386 -25.978 -24.146 1.00   21.72  ? 448  LEU A N   1 
ATOM   3530 C  CA  . LEU A  1 448 ? -34.515 -26.891 -24.341 1.00   31.35  ? 448  LEU A CA  1 
ATOM   3531 C  C   . LEU A  1 448 ? -35.690 -26.625 -23.375 1.00   35.56  ? 448  LEU A C   1 
ATOM   3532 O  O   . LEU A  1 448 ? -36.848 -26.630 -23.798 1.00   34.35  ? 448  LEU A O   1 
ATOM   3533 C  CB  . LEU A  1 448 ? -34.097 -28.377 -24.328 1.00   24.23  ? 448  LEU A CB  1 
ATOM   3534 C  CG  . LEU A  1 448 ? -33.087 -28.920 -25.355 1.00   25.00  ? 448  LEU A CG  1 
ATOM   3535 C  CD1 . LEU A  1 448 ? -33.413 -30.328 -25.795 1.00   21.08  ? 448  LEU A CD1 1 
ATOM   3536 C  CD2 . LEU A  1 448 ? -32.910 -28.024 -26.561 1.00   27.57  ? 448  LEU A CD2 1 
ATOM   3537 N  N   . PRO A  1 449 ? -35.401 -26.382 -22.081 1.00   32.93  ? 449  PRO A N   1 
ATOM   3538 C  CA  . PRO A  1 449 ? -36.508 -26.117 -21.157 1.00   36.21  ? 449  PRO A CA  1 
ATOM   3539 C  C   . PRO A  1 449 ? -37.366 -24.899 -21.496 1.00   41.70  ? 449  PRO A C   1 
ATOM   3540 O  O   . PRO A  1 449 ? -38.425 -24.725 -20.889 1.00   48.55  ? 449  PRO A O   1 
ATOM   3541 C  CB  . PRO A  1 449 ? -35.789 -25.891 -19.832 1.00   34.57  ? 449  PRO A CB  1 
ATOM   3542 C  CG  . PRO A  1 449 ? -34.598 -26.782 -19.937 1.00   31.86  ? 449  PRO A CG  1 
ATOM   3543 C  CD  . PRO A  1 449 ? -34.142 -26.614 -21.350 1.00   26.99  ? 449  PRO A CD  1 
ATOM   3544 N  N   . LEU A  1 450 ? -36.926 -24.069 -22.432 1.00   39.38  ? 450  LEU A N   1 
ATOM   3545 C  CA  . LEU A  1 450 ? -37.706 -22.895 -22.799 1.00   44.40  ? 450  LEU A CA  1 
ATOM   3546 C  C   . LEU A  1 450 ? -38.990 -23.321 -23.502 1.00   45.57  ? 450  LEU A C   1 
ATOM   3547 O  O   . LEU A  1 450 ? -40.028 -22.670 -23.370 1.00   47.25  ? 450  LEU A O   1 
ATOM   3548 C  CB  . LEU A  1 450 ? -36.877 -21.931 -23.650 1.00   25.81  ? 450  LEU A CB  1 
ATOM   3549 C  CG  . LEU A  1 450 ? -35.704 -21.410 -22.826 1.00   24.30  ? 450  LEU A CG  1 
ATOM   3550 C  CD1 . LEU A  1 450 ? -34.801 -20.445 -23.604 1.00   23.29  ? 450  LEU A CD1 1 
ATOM   3551 C  CD2 . LEU A  1 450 ? -36.226 -20.776 -21.537 1.00   25.41  ? 450  LEU A CD2 1 
ATOM   3552 N  N   . GLU A  1 451 ? -38.906 -24.430 -24.229 1.00   46.92  ? 451  GLU A N   1 
ATOM   3553 C  CA  . GLU A  1 451 ? -40.067 -25.047 -24.853 1.00   52.87  ? 451  GLU A CA  1 
ATOM   3554 C  C   . GLU A  1 451 ? -40.960 -25.643 -23.769 1.00   56.10  ? 451  GLU A C   1 
ATOM   3555 O  O   . GLU A  1 451 ? -40.661 -26.710 -23.224 1.00   52.87  ? 451  GLU A O   1 
ATOM   3556 C  CB  . GLU A  1 451 ? -39.616 -26.140 -25.816 1.00   56.32  ? 451  GLU A CB  1 
ATOM   3557 C  CG  . GLU A  1 451 ? -40.745 -26.817 -26.553 1.00   71.06  ? 451  GLU A CG  1 
ATOM   3558 C  CD  . GLU A  1 451 ? -41.224 -26.013 -27.750 1.00   80.76  ? 451  GLU A CD  1 
ATOM   3559 O  OE1 . GLU A  1 451 ? -40.543 -26.070 -28.801 1.00   80.29  ? 451  GLU A OE1 1 
ATOM   3560 O  OE2 . GLU A  1 451 ? -42.276 -25.332 -27.640 1.00   82.98  ? 451  GLU A OE2 1 
ATOM   3561 N  N   . ARG A  1 452 ? -42.051 -24.950 -23.451 1.00   67.12  ? 452  ARG A N   1 
ATOM   3562 C  CA  . ARG A  1 452 ? -42.883 -25.347 -22.317 1.00   80.55  ? 452  ARG A CA  1 
ATOM   3563 C  C   . ARG A  1 452 ? -43.848 -26.497 -22.604 1.00   85.52  ? 452  ARG A C   1 
ATOM   3564 O  O   . ARG A  1 452 ? -44.598 -26.908 -21.725 1.00   87.52  ? 452  ARG A O   1 
ATOM   3565 C  CB  . ARG A  1 452 ? -43.606 -24.146 -21.674 1.00   85.33  ? 452  ARG A CB  1 
ATOM   3566 C  CG  . ARG A  1 452 ? -44.061 -23.049 -22.624 1.00   89.61  ? 452  ARG A CG  1 
ATOM   3567 C  CD  . ARG A  1 452 ? -44.549 -21.820 -21.838 1.00   94.75  ? 452  ARG A CD  1 
ATOM   3568 N  NE  . ARG A  1 452 ? -44.997 -20.730 -22.707 1.00   97.09  ? 452  ARG A NE  1 
ATOM   3569 C  CZ  . ARG A  1 452 ? -46.243 -20.586 -23.159 1.00   92.65  ? 452  ARG A CZ  1 
ATOM   3570 N  NH1 . ARG A  1 452 ? -47.190 -21.460 -22.829 1.00   86.06  ? 452  ARG A NH1 1 
ATOM   3571 N  NH2 . ARG A  1 452 ? -46.544 -19.563 -23.947 1.00   90.49  ? 452  ARG A NH2 1 
ATOM   3572 N  N   . ARG A  1 453 ? -43.814 -27.031 -23.819 1.00   87.60  ? 453  ARG A N   1 
ATOM   3573 C  CA  . ARG A  1 453 ? -44.588 -28.231 -24.121 1.00   93.41  ? 453  ARG A CA  1 
ATOM   3574 C  C   . ARG A  1 453 ? -43.746 -29.492 -23.927 1.00   92.00  ? 453  ARG A C   1 
ATOM   3575 O  O   . ARG A  1 453 ? -44.197 -30.601 -24.209 1.00   91.91  ? 453  ARG A O   1 
ATOM   3576 C  CB  . ARG A  1 453 ? -45.157 -28.177 -25.543 1.00   98.02  ? 453  ARG A CB  1 
ATOM   3577 C  CG  . ARG A  1 453 ? -44.130 -27.901 -26.627 1.00   98.68  ? 453  ARG A CG  1 
ATOM   3578 C  CD  . ARG A  1 453 ? -44.759 -27.941 -28.014 1.00   103.46 ? 453  ARG A CD  1 
ATOM   3579 N  NE  . ARG A  1 453 ? -45.843 -26.970 -28.176 1.00   108.80 ? 453  ARG A NE  1 
ATOM   3580 C  CZ  . ARG A  1 453 ? -45.853 -25.999 -29.087 1.00   110.47 ? 453  ARG A CZ  1 
ATOM   3581 N  NH1 . ARG A  1 453 ? -44.835 -25.860 -29.929 1.00   107.20 ? 453  ARG A NH1 1 
ATOM   3582 N  NH2 . ARG A  1 453 ? -46.885 -25.166 -29.161 1.00   112.57 ? 453  ARG A NH2 1 
ATOM   3583 N  N   . ASP A  1 454 ? -42.529 -29.316 -23.423 1.00   90.58  ? 454  ASP A N   1 
ATOM   3584 C  CA  . ASP A  1 454 ? -41.562 -30.406 -23.372 1.00   90.74  ? 454  ASP A CA  1 
ATOM   3585 C  C   . ASP A  1 454 ? -41.440 -31.056 -21.985 1.00   86.39  ? 454  ASP A C   1 
ATOM   3586 O  O   . ASP A  1 454 ? -40.433 -31.702 -21.688 1.00   88.83  ? 454  ASP A O   1 
ATOM   3587 C  CB  . ASP A  1 454 ? -40.195 -29.911 -23.862 1.00   93.78  ? 454  ASP A CB  1 
ATOM   3588 C  CG  . ASP A  1 454 ? -39.369 -31.011 -24.509 1.00   101.89 ? 454  ASP A CG  1 
ATOM   3589 O  OD1 . ASP A  1 454 ? -39.965 -31.991 -25.009 1.00   106.09 ? 454  ASP A OD1 1 
ATOM   3590 O  OD2 . ASP A  1 454 ? -38.123 -30.893 -24.526 1.00   103.63 ? 454  ASP A OD2 1 
ATOM   3591 N  N   . GLN A  1 455 ? -42.463 -30.882 -21.149 1.00   79.31  ? 455  GLN A N   1 
ATOM   3592 C  CA  . GLN A  1 455 ? -42.526 -31.509 -19.818 1.00   75.05  ? 455  GLN A CA  1 
ATOM   3593 C  C   . GLN A  1 455 ? -41.414 -31.111 -18.821 1.00   63.90  ? 455  GLN A C   1 
ATOM   3594 O  O   . GLN A  1 455 ? -41.127 -31.859 -17.886 1.00   66.11  ? 455  GLN A O   1 
ATOM   3595 C  CB  . GLN A  1 455 ? -42.600 -33.043 -19.929 1.00   81.86  ? 455  GLN A CB  1 
ATOM   3596 C  CG  . GLN A  1 455 ? -43.542 -33.581 -21.011 1.00   90.74  ? 455  GLN A CG  1 
ATOM   3597 C  CD  . GLN A  1 455 ? -45.016 -33.387 -20.683 1.00   97.51  ? 455  GLN A CD  1 
ATOM   3598 O  OE1 . GLN A  1 455 ? -45.535 -33.964 -19.725 1.00   102.64 ? 455  GLN A OE1 1 
ATOM   3599 N  NE2 . GLN A  1 455 ? -45.699 -32.576 -21.486 1.00   95.38  ? 455  GLN A NE2 1 
ATOM   3600 N  N   . TYR A  1 456 ? -40.780 -29.955 -19.007 1.00   49.10  ? 456  TYR A N   1 
ATOM   3601 C  CA  . TYR A  1 456 ? -39.902 -29.434 -17.963 1.00   41.98  ? 456  TYR A CA  1 
ATOM   3602 C  C   . TYR A  1 456 ? -40.740 -28.601 -16.989 1.00   42.92  ? 456  TYR A C   1 
ATOM   3603 O  O   . TYR A  1 456 ? -41.736 -27.981 -17.388 1.00   41.74  ? 456  TYR A O   1 
ATOM   3604 C  CB  . TYR A  1 456 ? -38.779 -28.553 -18.535 1.00   33.69  ? 456  TYR A CB  1 
ATOM   3605 C  CG  . TYR A  1 456 ? -37.694 -29.246 -19.343 1.00   29.73  ? 456  TYR A CG  1 
ATOM   3606 C  CD1 . TYR A  1 456 ? -36.609 -29.863 -18.718 1.00   28.66  ? 456  TYR A CD1 1 
ATOM   3607 C  CD2 . TYR A  1 456 ? -37.726 -29.239 -20.732 1.00   31.56  ? 456  TYR A CD2 1 
ATOM   3608 C  CE1 . TYR A  1 456 ? -35.597 -30.476 -19.460 1.00   28.17  ? 456  TYR A CE1 1 
ATOM   3609 C  CE2 . TYR A  1 456 ? -36.727 -29.843 -21.486 1.00   31.46  ? 456  TYR A CE2 1 
ATOM   3610 C  CZ  . TYR A  1 456 ? -35.663 -30.461 -20.847 1.00   35.09  ? 456  TYR A CZ  1 
ATOM   3611 O  OH  . TYR A  1 456 ? -34.669 -31.055 -21.603 1.00   31.17  ? 456  TYR A OH  1 
ATOM   3612 N  N   . THR A  1 457 ? -40.334 -28.573 -15.721 1.00   41.95  ? 457  THR A N   1 
ATOM   3613 C  CA  . THR A  1 457 ? -40.932 -27.659 -14.746 1.00   43.17  ? 457  THR A CA  1 
ATOM   3614 C  C   . THR A  1 457 ? -40.661 -26.200 -15.116 1.00   38.93  ? 457  THR A C   1 
ATOM   3615 O  O   . THR A  1 457 ? -39.715 -25.908 -15.847 1.00   38.70  ? 457  THR A O   1 
ATOM   3616 C  CB  . THR A  1 457 ? -40.336 -27.862 -13.338 1.00   46.57  ? 457  THR A CB  1 
ATOM   3617 O  OG1 . THR A  1 457 ? -38.984 -27.376 -13.317 1.00   31.88  ? 457  THR A OG1 1 
ATOM   3618 C  CG2 . THR A  1 457 ? -40.370 -29.330 -12.938 1.00   34.68  ? 457  THR A CG2 1 
ATOM   3619 N  N   . LYS A  1 458 ? -41.478 -25.293 -14.582 1.00   39.66  ? 458  LYS A N   1 
ATOM   3620 C  CA  . LYS A  1 458 ? -41.263 -23.846 -14.722 1.00   45.76  ? 458  LYS A CA  1 
ATOM   3621 C  C   . LYS A  1 458 ? -39.906 -23.384 -14.161 1.00   47.01  ? 458  LYS A C   1 
ATOM   3622 O  O   . LYS A  1 458 ? -39.255 -22.499 -14.720 1.00   43.53  ? 458  LYS A O   1 
ATOM   3623 C  CB  . LYS A  1 458 ? -42.392 -23.074 -14.019 1.00   46.38  ? 458  LYS A CB  1 
ATOM   3624 C  CG  . LYS A  1 458 ? -42.353 -21.557 -14.201 1.00   38.42  ? 458  LYS A CG  1 
ATOM   3625 C  CD  . LYS A  1 458 ? -42.821 -21.151 -15.594 0.85   47.44  ? 458  LYS A CD  1 
ATOM   3626 C  CE  . LYS A  1 458 ? -42.733 -19.639 -15.807 0.31   48.43  ? 458  LYS A CE  1 
ATOM   3627 N  NZ  . LYS A  1 458 ? -43.231 -19.200 -17.155 0.77   49.10  ? 458  LYS A NZ  1 
ATOM   3628 N  N   . ALA A  1 459 ? -39.492 -23.983 -13.051 1.00   33.22  ? 459  ALA A N   1 
ATOM   3629 C  CA  . ALA A  1 459 ? -38.254 -23.607 -12.399 1.00   37.17  ? 459  ALA A CA  1 
ATOM   3630 C  C   . ALA A  1 459 ? -37.080 -23.926 -13.307 1.00   34.77  ? 459  ALA A C   1 
ATOM   3631 O  O   . ALA A  1 459 ? -36.039 -23.274 -13.238 1.00   34.24  ? 459  ALA A O   1 
ATOM   3632 C  CB  . ALA A  1 459 ? -38.109 -24.326 -11.064 1.00   32.14  ? 459  ALA A CB  1 
ATOM   3633 N  N   . GLU A  1 460 ? -37.255 -24.934 -14.158 1.00   31.11  ? 460  GLU A N   1 
ATOM   3634 C  CA  . GLU A  1 460 ? -36.218 -25.306 -15.108 1.00   37.28  ? 460  GLU A CA  1 
ATOM   3635 C  C   . GLU A  1 460 ? -36.220 -24.352 -16.291 1.00   36.96  ? 460  GLU A C   1 
ATOM   3636 O  O   . GLU A  1 460 ? -35.166 -24.017 -16.833 1.00   36.86  ? 460  GLU A O   1 
ATOM   3637 C  CB  . GLU A  1 460 ? -36.404 -26.747 -15.568 1.00   37.07  ? 460  GLU A CB  1 
ATOM   3638 C  CG  . GLU A  1 460 ? -35.905 -27.752 -14.549 1.00   38.43  ? 460  GLU A CG  1 
ATOM   3639 C  CD  . GLU A  1 460 ? -36.239 -29.185 -14.917 1.00   37.97  ? 460  GLU A CD  1 
ATOM   3640 O  OE1 . GLU A  1 460 ? -37.275 -29.406 -15.578 1.00   37.37  ? 460  GLU A OE1 1 
ATOM   3641 O  OE2 . GLU A  1 460 ? -35.460 -30.085 -14.539 1.00   39.44  ? 460  GLU A OE2 1 
ATOM   3642 N  N   . GLU A  1 461 ? -37.408 -23.904 -16.680 1.00   38.27  ? 461  GLU A N   1 
ATOM   3643 C  CA  . GLU A  1 461 ? -37.517 -22.910 -17.733 1.00   39.23  ? 461  GLU A CA  1 
ATOM   3644 C  C   . GLU A  1 461 ? -36.763 -21.649 -17.324 1.00   41.31  ? 461  GLU A C   1 
ATOM   3645 O  O   . GLU A  1 461 ? -35.976 -21.103 -18.105 1.00   31.26  ? 461  GLU A O   1 
ATOM   3646 C  CB  . GLU A  1 461 ? -38.972 -22.567 -18.042 1.00   36.49  ? 461  GLU A CB  1 
ATOM   3647 C  CG  . GLU A  1 461 ? -39.084 -21.449 -19.075 1.00   48.10  ? 461  GLU A CG  1 
ATOM   3648 C  CD  . GLU A  1 461 ? -40.506 -20.947 -19.304 1.00   60.31  ? 461  GLU A CD  1 
ATOM   3649 O  OE1 . GLU A  1 461 ? -41.414 -21.312 -18.519 1.00   67.35  ? 461  GLU A OE1 1 
ATOM   3650 O  OE2 . GLU A  1 461 ? -40.704 -20.181 -20.281 1.00   57.38  ? 461  GLU A OE2 1 
ATOM   3651 N  N   . ILE A  1 462 ? -37.005 -21.201 -16.093 1.00   28.15  ? 462  ILE A N   1 
ATOM   3652 C  CA  . ILE A  1 462 ? -36.332 -20.029 -15.565 1.00   27.79  ? 462  ILE A CA  1 
ATOM   3653 C  C   . ILE A  1 462 ? -34.803 -20.202 -15.526 1.00   34.88  ? 462  ILE A C   1 
ATOM   3654 O  O   . ILE A  1 462 ? -34.072 -19.356 -16.044 1.00   39.68  ? 462  ILE A O   1 
ATOM   3655 C  CB  . ILE A  1 462 ? -36.909 -19.615 -14.180 1.00   46.96  ? 462  ILE A CB  1 
ATOM   3656 C  CG1 . ILE A  1 462 ? -38.310 -19.030 -14.357 1.00   48.50  ? 462  ILE A CG1 1 
ATOM   3657 C  CG2 . ILE A  1 462 ? -36.025 -18.576 -13.491 1.00   42.12  ? 462  ILE A CG2 1 
ATOM   3658 C  CD1 . ILE A  1 462 ? -38.392 -17.998 -15.477 1.00   48.22  ? 462  ILE A CD1 1 
ATOM   3659 N  N   . LEU A  1 463 ? -34.330 -21.301 -14.940 1.00   25.56  ? 463  LEU A N   1 
ATOM   3660 C  CA  . LEU A  1 463 ? -32.894 -21.580 -14.846 1.00   30.48  ? 463  LEU A CA  1 
ATOM   3661 C  C   . LEU A  1 463 ? -32.206 -21.589 -16.210 1.00   33.62  ? 463  LEU A C   1 
ATOM   3662 O  O   . LEU A  1 463 ? -31.113 -21.023 -16.374 1.00   37.51  ? 463  LEU A O   1 
ATOM   3663 C  CB  . LEU A  1 463 ? -32.632 -22.912 -14.134 1.00   22.46  ? 463  LEU A CB  1 
ATOM   3664 C  CG  . LEU A  1 463 ? -31.154 -23.336 -14.105 1.00   28.76  ? 463  LEU A CG  1 
ATOM   3665 C  CD1 . LEU A  1 463 ? -30.243 -22.307 -13.389 1.00   20.18  ? 463  LEU A CD1 1 
ATOM   3666 C  CD2 . LEU A  1 463 ? -30.971 -24.726 -13.494 1.00   25.06  ? 463  LEU A CD2 1 
ATOM   3667 N  N   . SER A  1 464 ? -32.853 -22.224 -17.184 1.00   26.56  ? 464  SER A N   1 
ATOM   3668 C  CA  . SER A  1 464 ? -32.299 -22.308 -18.522 1.00   27.19  ? 464  SER A CA  1 
ATOM   3669 C  C   . SER A  1 464 ? -32.188 -20.920 -19.124 1.00   29.33  ? 464  SER A C   1 
ATOM   3670 O  O   . SER A  1 464 ? -31.197 -20.589 -19.766 1.00   34.73  ? 464  SER A O   1 
ATOM   3671 C  CB  . SER A  1 464 ? -33.172 -23.184 -19.413 1.00   24.66  ? 464  SER A CB  1 
ATOM   3672 O  OG  . SER A  1 464 ? -32.468 -23.543 -20.590 1.00   27.55  ? 464  SER A OG  1 
ATOM   3673 N  N   . ARG A  1 465 ? -33.216 -20.115 -18.887 1.00   30.52  ? 465  ARG A N   1 
ATOM   3674 C  CA  . ARG A  1 465 ? -33.313 -18.766 -19.427 1.00   30.54  ? 465  ARG A CA  1 
ATOM   3675 C  C   . ARG A  1 465 ? -32.184 -17.898 -18.898 1.00   35.48  ? 465  ARG A C   1 
ATOM   3676 O  O   . ARG A  1 465 ? -31.664 -17.037 -19.611 1.00   38.42  ? 465  ARG A O   1 
ATOM   3677 C  CB  . ARG A  1 465 ? -34.679 -18.148 -19.071 1.00   27.38  ? 465  ARG A CB  1 
ATOM   3678 C  CG  . ARG A  1 465 ? -34.911 -16.746 -19.639 1.00   32.55  ? 465  ARG A CG  1 
ATOM   3679 C  CD  . ARG A  1 465 ? -35.044 -16.770 -21.162 1.00   40.97  ? 465  ARG A CD  1 
ATOM   3680 N  NE  . ARG A  1 465 ? -34.862 -15.451 -21.775 1.00   45.28  ? 465  ARG A NE  1 
ATOM   3681 C  CZ  . ARG A  1 465 ? -33.685 -14.952 -22.160 1.00   43.82  ? 465  ARG A CZ  1 
ATOM   3682 N  NH1 . ARG A  1 465 ? -32.565 -15.650 -21.989 1.00   35.45  ? 465  ARG A NH1 1 
ATOM   3683 N  NH2 . ARG A  1 465 ? -33.626 -13.745 -22.712 1.00   48.21  ? 465  ARG A NH2 1 
ATOM   3684 N  N   . SER A  1 466 ? -31.814 -18.130 -17.642 1.00   21.65  ? 466  SER A N   1 
ATOM   3685 C  CA  . SER A  1 466 ? -30.735 -17.388 -17.011 1.00   28.32  ? 466  SER A CA  1 
ATOM   3686 C  C   . SER A  1 466 ? -29.367 -17.863 -17.545 1.00   26.14  ? 466  SER A C   1 
ATOM   3687 O  O   . SER A  1 466 ? -28.498 -17.050 -17.856 1.00   30.23  ? 466  SER A O   1 
ATOM   3688 C  CB  . SER A  1 466 ? -30.837 -17.510 -15.490 1.00   21.72  ? 466  SER A CB  1 
ATOM   3689 O  OG  . SER A  1 466 ? -29.554 -17.479 -14.893 1.00   55.02  ? 466  SER A OG  1 
ATOM   3690 N  N   . ILE A  1 467 ? -29.197 -19.180 -17.659 1.00   23.63  ? 467  ILE A N   1 
ATOM   3691 C  CA  . ILE A  1 467 ? -27.986 -19.773 -18.213 1.00   24.83  ? 467  ILE A CA  1 
ATOM   3692 C  C   . ILE A  1 467 ? -27.757 -19.298 -19.639 1.00   25.83  ? 467  ILE A C   1 
ATOM   3693 O  O   . ILE A  1 467 ? -26.664 -18.823 -19.993 1.00   15.57  ? 467  ILE A O   1 
ATOM   3694 C  CB  . ILE A  1 467 ? -28.047 -21.326 -18.159 1.00   26.03  ? 467  ILE A CB  1 
ATOM   3695 C  CG1 . ILE A  1 467 ? -27.667 -21.799 -16.752 1.00   31.09  ? 467  ILE A CG1 1 
ATOM   3696 C  CG2 . ILE A  1 467 ? -27.091 -21.956 -19.165 1.00   18.47  ? 467  ILE A CG2 1 
ATOM   3697 C  CD1 . ILE A  1 467 ? -28.003 -23.244 -16.449 1.00   16.27  ? 467  ILE A CD1 1 
ATOM   3698 N  N   . VAL A  1 468 ? -28.804 -19.414 -20.446 1.00   19.93  ? 468  VAL A N   1 
ATOM   3699 C  CA  . VAL A  1 468 ? -28.770 -18.929 -21.820 1.00   20.73  ? 468  VAL A CA  1 
ATOM   3700 C  C   . VAL A  1 468 ? -28.360 -17.460 -21.853 1.00   25.13  ? 468  VAL A C   1 
ATOM   3701 O  O   . VAL A  1 468 ? -27.532 -17.057 -22.672 1.00   25.59  ? 468  VAL A O   1 
ATOM   3702 C  CB  . VAL A  1 468 ? -30.127 -19.144 -22.551 1.00   20.28  ? 468  VAL A CB  1 
ATOM   3703 C  CG1 . VAL A  1 468 ? -30.194 -18.326 -23.805 1.00   18.65  ? 468  VAL A CG1 1 
ATOM   3704 C  CG2 . VAL A  1 468 ? -30.319 -20.608 -22.884 1.00   17.92  ? 468  VAL A CG2 1 
ATOM   3705 N  N   . LYS A  1 469 ? -28.908 -16.665 -20.944 1.00   18.46  ? 469  LYS A N   1 
ATOM   3706 C  CA  . LYS A  1 469 ? -28.541 -15.255 -20.887 1.00   18.97  ? 469  LYS A CA  1 
ATOM   3707 C  C   . LYS A  1 469 ? -27.071 -15.061 -20.452 1.00   23.34  ? 469  LYS A C   1 
ATOM   3708 O  O   . LYS A  1 469 ? -26.342 -14.244 -21.023 1.00   19.51  ? 469  LYS A O   1 
ATOM   3709 C  CB  . LYS A  1 469 ? -29.501 -14.488 -19.973 1.00   20.59  ? 469  LYS A CB  1 
ATOM   3710 C  CG  . LYS A  1 469 ? -29.129 -13.030 -19.738 1.00   24.43  ? 469  LYS A CG  1 
ATOM   3711 C  CD  . LYS A  1 469 ? -29.041 -12.264 -21.052 1.00   22.10  ? 469  LYS A CD  1 
ATOM   3712 C  CE  . LYS A  1 469 ? -30.415 -11.841 -21.573 1.00   23.22  ? 469  LYS A CE  1 
ATOM   3713 N  NZ  . LYS A  1 469 ? -30.302 -11.221 -22.911 1.00   23.46  ? 469  LYS A NZ  1 
ATOM   3714 N  N   . ARG A  1 470 ? -26.627 -15.806 -19.448 1.00   25.98  ? 470  ARG A N   1 
ATOM   3715 C  CA  . ARG A  1 470 ? -25.240 -15.676 -19.013 1.00   31.94  ? 470  ARG A CA  1 
ATOM   3716 C  C   . ARG A  1 470 ? -24.248 -16.072 -20.123 1.00   29.66  ? 470  ARG A C   1 
ATOM   3717 O  O   . ARG A  1 470 ? -23.314 -15.327 -20.413 1.00   28.91  ? 470  ARG A O   1 
ATOM   3718 C  CB  . ARG A  1 470 ? -24.984 -16.465 -17.728 1.00   25.80  ? 470  ARG A CB  1 
ATOM   3719 C  CG  . ARG A  1 470 ? -25.730 -15.929 -16.519 1.00   19.81  ? 470  ARG A CG  1 
ATOM   3720 C  CD  . ARG A  1 470 ? -25.399 -16.737 -15.269 1.00   24.38  ? 470  ARG A CD  1 
ATOM   3721 N  NE  . ARG A  1 470 ? -26.119 -16.254 -14.097 1.00   26.73  ? 470  ARG A NE  1 
ATOM   3722 C  CZ  . ARG A  1 470 ? -25.675 -15.291 -13.294 1.00   28.45  ? 470  ARG A CZ  1 
ATOM   3723 N  NH1 . ARG A  1 470 ? -24.509 -14.709 -13.537 1.00   29.12  ? 470  ARG A NH1 1 
ATOM   3724 N  NH2 . ARG A  1 470 ? -26.395 -14.904 -12.250 1.00   20.68  ? 470  ARG A NH2 1 
ATOM   3725 N  N   . TRP A  1 471 ? -24.470 -17.227 -20.748 1.00   23.67  ? 471  TRP A N   1 
ATOM   3726 C  CA  . TRP A  1 471 ? -23.631 -17.691 -21.862 1.00   21.84  ? 471  TRP A CA  1 
ATOM   3727 C  C   . TRP A  1 471 ? -23.564 -16.671 -22.990 1.00   22.28  ? 471  TRP A C   1 
ATOM   3728 O  O   . TRP A  1 471 ? -22.501 -16.432 -23.577 1.00   14.57  ? 471  TRP A O   1 
ATOM   3729 C  CB  . TRP A  1 471 ? -24.161 -19.020 -22.424 1.00   13.54  ? 471  TRP A CB  1 
ATOM   3730 C  CG  . TRP A  1 471 ? -23.517 -20.265 -21.854 1.00   16.37  ? 471  TRP A CG  1 
ATOM   3731 C  CD1 . TRP A  1 471 ? -22.966 -21.291 -22.566 1.00   22.98  ? 471  TRP A CD1 1 
ATOM   3732 C  CD2 . TRP A  1 471 ? -23.362 -20.615 -20.467 1.00   17.09  ? 471  TRP A CD2 1 
ATOM   3733 N  NE1 . TRP A  1 471 ? -22.480 -22.262 -21.713 1.00   22.90  ? 471  TRP A NE1 1 
ATOM   3734 C  CE2 . TRP A  1 471 ? -22.706 -21.871 -20.421 1.00   22.46  ? 471  TRP A CE2 1 
ATOM   3735 C  CE3 . TRP A  1 471 ? -23.708 -19.994 -19.264 1.00   15.19  ? 471  TRP A CE3 1 
ATOM   3736 C  CZ2 . TRP A  1 471 ? -22.395 -22.513 -19.222 1.00   11.98  ? 471  TRP A CZ2 1 
ATOM   3737 C  CZ3 . TRP A  1 471 ? -23.392 -20.632 -18.072 1.00   19.55  ? 471  TRP A CZ3 1 
ATOM   3738 C  CH2 . TRP A  1 471 ? -22.741 -21.878 -18.061 1.00   23.44  ? 471  TRP A CH2 1 
ATOM   3739 N  N   . ALA A  1 472 ? -24.707 -16.064 -23.284 1.00   23.83  ? 472  ALA A N   1 
ATOM   3740 C  CA  . ALA A  1 472 ? -24.809 -15.159 -24.411 1.00   26.06  ? 472  ALA A CA  1 
ATOM   3741 C  C   . ALA A  1 472 ? -24.083 -13.856 -24.082 1.00   29.84  ? 472  ALA A C   1 
ATOM   3742 O  O   . ALA A  1 472 ? -23.383 -13.289 -24.927 1.00   36.33  ? 472  ALA A O   1 
ATOM   3743 C  CB  . ALA A  1 472 ? -26.276 -14.913 -24.763 1.00   24.72  ? 472  ALA A CB  1 
ATOM   3744 N  N   . ASN A  1 473 ? -24.235 -13.400 -22.845 1.00   20.23  ? 473  ASN A N   1 
ATOM   3745 C  CA  . ASN A  1 473 ? -23.555 -12.188 -22.412 1.00   21.68  ? 473  ASN A CA  1 
ATOM   3746 C  C   . ASN A  1 473 ? -22.075 -12.418 -22.301 1.00   23.77  ? 473  ASN A C   1 
ATOM   3747 O  O   . ASN A  1 473 ? -21.286 -11.496 -22.519 1.00   29.57  ? 473  ASN A O   1 
ATOM   3748 C  CB  . ASN A  1 473 ? -24.100 -11.664 -21.084 1.00   19.68  ? 473  ASN A CB  1 
ATOM   3749 C  CG  . ASN A  1 473 ? -25.283 -10.755 -21.276 1.00   23.89  ? 473  ASN A CG  1 
ATOM   3750 O  OD1 . ASN A  1 473 ? -25.541 -10.299 -22.388 1.00   23.68  ? 473  ASN A OD1 1 
ATOM   3751 N  ND2 . ASN A  1 473 ? -26.010 -10.477 -20.197 1.00   31.26  ? 473  ASN A ND2 1 
ATOM   3752 N  N   . PHE A  1 474 ? -21.688 -13.642 -21.963 1.00   16.13  ? 474  PHE A N   1 
ATOM   3753 C  CA  . PHE A  1 474 ? -20.271 -13.961 -21.956 1.00   30.22  ? 474  PHE A CA  1 
ATOM   3754 C  C   . PHE A  1 474 ? -19.705 -13.863 -23.362 1.00   24.40  ? 474  PHE A C   1 
ATOM   3755 O  O   . PHE A  1 474 ? -18.641 -13.284 -23.563 1.00   25.33  ? 474  PHE A O   1 
ATOM   3756 C  CB  . PHE A  1 474 ? -19.980 -15.355 -21.413 1.00   28.69  ? 474  PHE A CB  1 
ATOM   3757 C  CG  . PHE A  1 474 ? -18.540 -15.742 -21.536 1.00   24.73  ? 474  PHE A CG  1 
ATOM   3758 C  CD1 . PHE A  1 474 ? -17.595 -15.217 -20.658 1.00   24.14  ? 474  PHE A CD1 1 
ATOM   3759 C  CD2 . PHE A  1 474 ? -18.117 -16.603 -22.548 1.00   19.82  ? 474  PHE A CD2 1 
ATOM   3760 C  CE1 . PHE A  1 474 ? -16.242 -15.561 -20.776 1.00   27.01  ? 474  PHE A CE1 1 
ATOM   3761 C  CE2 . PHE A  1 474 ? -16.768 -16.948 -22.673 1.00   25.13  ? 474  PHE A CE2 1 
ATOM   3762 C  CZ  . PHE A  1 474 ? -15.829 -16.431 -21.784 1.00   14.34  ? 474  PHE A CZ  1 
ATOM   3763 N  N   . ALA A  1 475 ? -20.418 -14.438 -24.325 1.00   17.99  ? 475  ALA A N   1 
ATOM   3764 C  CA  . ALA A  1 475 ? -19.959 -14.437 -25.711 1.00   19.36  ? 475  ALA A CA  1 
ATOM   3765 C  C   . ALA A  1 475 ? -19.919 -13.020 -26.263 1.00   19.82  ? 475  ALA A C   1 
ATOM   3766 O  O   . ALA A  1 475 ? -18.939 -12.628 -26.886 1.00   25.94  ? 475  ALA A O   1 
ATOM   3767 C  CB  . ALA A  1 475 ? -20.842 -15.325 -26.581 1.00   15.52  ? 475  ALA A CB  1 
ATOM   3768 N  N   . LYS A  1 476 ? -20.982 -12.258 -26.025 1.00   20.48  ? 476  LYS A N   1 
ATOM   3769 C  CA  . LYS A  1 476 ? -21.075 -10.889 -26.539 1.00   27.13  ? 476  LYS A CA  1 
ATOM   3770 C  C   . LYS A  1 476 ? -20.106 -9.932  -25.855 1.00   28.23  ? 476  LYS A C   1 
ATOM   3771 O  O   . LYS A  1 476 ? -19.482 -9.105  -26.514 1.00   31.36  ? 476  LYS A O   1 
ATOM   3772 C  CB  . LYS A  1 476 ? -22.498 -10.336 -26.392 1.00   28.89  ? 476  LYS A CB  1 
ATOM   3773 C  CG  . LYS A  1 476 ? -23.544 -10.992 -27.289 1.00   28.43  ? 476  LYS A CG  1 
ATOM   3774 C  CD  . LYS A  1 476 ? -24.950 -10.521 -26.908 1.00   34.73  ? 476  LYS A CD  1 
ATOM   3775 C  CE  . LYS A  1 476 ? -26.009 -11.203 -27.767 1.00   42.82  ? 476  LYS A CE  1 
ATOM   3776 N  NZ  . LYS A  1 476 ? -27.335 -11.350 -27.093 1.00   44.29  ? 476  LYS A NZ  1 
ATOM   3777 N  N   . TYR A  1 477 ? -19.980 -10.036 -24.536 1.00   25.92  ? 477  TYR A N   1 
ATOM   3778 C  CA  . TYR A  1 477 ? -19.289 -8.992  -23.780 1.00   25.02  ? 477  TYR A CA  1 
ATOM   3779 C  C   . TYR A  1 477 ? -18.191 -9.487  -22.860 1.00   23.46  ? 477  TYR A C   1 
ATOM   3780 O  O   . TYR A  1 477 ? -17.657 -8.709  -22.081 1.00   22.99  ? 477  TYR A O   1 
ATOM   3781 C  CB  . TYR A  1 477 ? -20.297 -8.213  -22.936 1.00   28.75  ? 477  TYR A CB  1 
ATOM   3782 C  CG  . TYR A  1 477 ? -21.562 -7.890  -23.690 1.00   31.00  ? 477  TYR A CG  1 
ATOM   3783 C  CD1 . TYR A  1 477 ? -21.510 -7.156  -24.871 1.00   30.85  ? 477  TYR A CD1 1 
ATOM   3784 C  CD2 . TYR A  1 477 ? -22.803 -8.331  -23.240 1.00   24.52  ? 477  TYR A CD2 1 
ATOM   3785 C  CE1 . TYR A  1 477 ? -22.647 -6.856  -25.577 1.00   32.07  ? 477  TYR A CE1 1 
ATOM   3786 C  CE2 . TYR A  1 477 ? -23.957 -8.034  -23.951 1.00   32.44  ? 477  TYR A CE2 1 
ATOM   3787 C  CZ  . TYR A  1 477 ? -23.873 -7.291  -25.119 1.00   31.65  ? 477  TYR A CZ  1 
ATOM   3788 O  OH  . TYR A  1 477 ? -25.004 -6.969  -25.840 1.00   28.29  ? 477  TYR A OH  1 
ATOM   3789 N  N   . GLY A  1 478 ? -17.875 -10.776 -22.923 1.00   24.81  ? 478  GLY A N   1 
ATOM   3790 C  CA  . GLY A  1 478 ? -16.880 -11.350 -22.035 1.00   23.39  ? 478  GLY A CA  1 
ATOM   3791 C  C   . GLY A  1 478 ? -17.224 -11.303 -20.553 1.00   29.31  ? 478  GLY A C   1 
ATOM   3792 O  O   . GLY A  1 478 ? -16.324 -11.323 -19.712 1.00   35.33  ? 478  GLY A O   1 
ATOM   3793 N  N   . ASN A  1 479 ? -18.515 -11.259 -20.225 1.00   24.38  ? 479  ASN A N   1 
ATOM   3794 C  CA  . ASN A  1 479 ? -18.949 -11.146 -18.831 1.00   20.47  ? 479  ASN A CA  1 
ATOM   3795 C  C   . ASN A  1 479 ? -20.300 -11.853 -18.607 1.00   25.66  ? 479  ASN A C   1 
ATOM   3796 O  O   . ASN A  1 479 ? -21.346 -11.350 -19.020 1.00   33.08  ? 479  ASN A O   1 
ATOM   3797 C  CB  . ASN A  1 479 ? -19.033 -9.668  -18.455 1.00   19.66  ? 479  ASN A CB  1 
ATOM   3798 C  CG  . ASN A  1 479 ? -18.783 -9.410  -16.983 1.00   32.73  ? 479  ASN A CG  1 
ATOM   3799 O  OD1 . ASN A  1 479 ? -18.812 -10.318 -16.165 1.00   31.15  ? 479  ASN A OD1 1 
ATOM   3800 N  ND2 . ASN A  1 479 ? -18.550 -8.152  -16.641 1.00   36.97  ? 479  ASN A ND2 1 
ATOM   3801 N  N   . PRO A  1 480 ? -20.281 -13.012 -17.930 1.00   27.32  ? 480  PRO A N   1 
ATOM   3802 C  CA  . PRO A  1 480 ? -21.459 -13.892 -17.906 1.00   31.00  ? 480  PRO A CA  1 
ATOM   3803 C  C   . PRO A  1 480 ? -22.473 -13.481 -16.838 1.00   29.52  ? 480  PRO A C   1 
ATOM   3804 O  O   . PRO A  1 480 ? -22.936 -14.317 -16.055 1.00   30.76  ? 480  PRO A O   1 
ATOM   3805 C  CB  . PRO A  1 480 ? -20.854 -15.267 -17.571 1.00   15.30  ? 480  PRO A CB  1 
ATOM   3806 C  CG  . PRO A  1 480 ? -19.703 -14.908 -16.616 1.00   21.57  ? 480  PRO A CG  1 
ATOM   3807 C  CD  . PRO A  1 480 ? -19.189 -13.525 -17.072 1.00   16.57  ? 480  PRO A CD  1 
ATOM   3808 N  N   . GLN A  1 481 ? -22.813 -12.201 -16.806 1.00   21.42  ? 481  GLN A N   1 
ATOM   3809 C  CA  . GLN A  1 481 ? -23.808 -11.708 -15.850 1.00   29.15  ? 481  GLN A CA  1 
ATOM   3810 C  C   . GLN A  1 481 ? -25.213 -11.821 -16.436 1.00   29.73  ? 481  GLN A C   1 
ATOM   3811 O  O   . GLN A  1 481 ? -25.377 -11.919 -17.658 1.00   31.08  ? 481  GLN A O   1 
ATOM   3812 C  CB  . GLN A  1 481 ? -23.525 -10.248 -15.464 1.00   20.68  ? 481  GLN A CB  1 
ATOM   3813 C  CG  . GLN A  1 481 ? -22.055 -9.956  -15.137 1.00   20.72  ? 481  GLN A CG  1 
ATOM   3814 C  CD  . GLN A  1 481 ? -21.528 -10.807 -13.993 1.00   20.89  ? 481  GLN A CD  1 
ATOM   3815 O  OE1 . GLN A  1 481 ? -22.240 -11.080 -13.020 1.00   20.56  ? 481  GLN A OE1 1 
ATOM   3816 N  NE2 . GLN A  1 481 ? -20.280 -11.243 -14.111 1.00   19.56  ? 481  GLN A NE2 1 
ATOM   3817 N  N   . GLU A  1 482 ? -26.212 -11.838 -15.556 1.00   31.20  ? 482  GLU A N   1 
ATOM   3818 C  CA  . GLU A  1 482 ? -27.603 -11.553 -15.926 1.00   30.57  ? 482  GLU A CA  1 
ATOM   3819 C  C   . GLU A  1 482 ? -27.947 -10.277 -15.202 1.00   31.55  ? 482  GLU A C   1 
ATOM   3820 O  O   . GLU A  1 482 ? -28.137 -10.299 -13.991 1.00   35.98  ? 482  GLU A O   1 
ATOM   3821 C  CB  . GLU A  1 482 ? -28.542 -12.661 -15.449 1.00   31.09  ? 482  GLU A CB  1 
ATOM   3822 C  CG  . GLU A  1 482 ? -29.943 -12.618 -16.048 1.00   36.06  ? 482  GLU A CG  1 
ATOM   3823 C  CD  . GLU A  1 482 ? -30.776 -11.485 -15.500 1.00   43.15  ? 482  GLU A CD  1 
ATOM   3824 O  OE1 . GLU A  1 482 ? -30.998 -11.463 -14.271 1.00   48.58  ? 482  GLU A OE1 1 
ATOM   3825 O  OE2 . GLU A  1 482 ? -31.190 -10.605 -16.291 1.00   39.71  ? 482  GLU A OE2 1 
ATOM   3826 N  N   . THR A  1 483 ? -28.028 -9.164  -15.921 1.00   37.91  ? 483  THR A N   1 
ATOM   3827 C  CA  . THR A  1 483 ? -28.082 -7.851  -15.262 1.00   38.71  ? 483  THR A CA  1 
ATOM   3828 C  C   . THR A  1 483 ? -29.488 -7.329  -14.920 1.00   44.62  ? 483  THR A C   1 
ATOM   3829 O  O   . THR A  1 483 ? -29.627 -6.355  -14.191 1.00   30.57  ? 483  THR A O   1 
ATOM   3830 C  CB  . THR A  1 483 ? -27.362 -6.793  -16.108 1.00   32.35  ? 483  THR A CB  1 
ATOM   3831 O  OG1 . THR A  1 483 ? -28.112 -6.551  -17.308 1.00   37.41  ? 483  THR A OG1 1 
ATOM   3832 C  CG2 . THR A  1 483 ? -25.984 -7.280  -16.490 1.00   32.06  ? 483  THR A CG2 1 
ATOM   3833 N  N   . GLN A  1 484 ? -30.531 -7.967  -15.439 1.00   45.61  ? 484  GLN A N   1 
ATOM   3834 C  CA  . GLN A  1 484 ? -31.856 -7.355  -15.376 1.00   47.24  ? 484  GLN A CA  1 
ATOM   3835 C  C   . GLN A  1 484 ? -32.770 -7.840  -14.256 1.00   44.36  ? 484  GLN A C   1 
ATOM   3836 O  O   . GLN A  1 484 ? -33.650 -7.114  -13.822 1.00   42.08  ? 484  GLN A O   1 
ATOM   3837 C  CB  . GLN A  1 484 ? -32.575 -7.505  -16.716 1.00   48.02  ? 484  GLN A CB  1 
ATOM   3838 C  CG  . GLN A  1 484 ? -31.888 -6.807  -17.870 1.00   48.74  ? 484  GLN A CG  1 
ATOM   3839 C  CD  . GLN A  1 484 ? -32.642 -6.989  -19.174 1.00   58.96  ? 484  GLN A CD  1 
ATOM   3840 O  OE1 . GLN A  1 484 ? -32.907 -8.122  -19.621 1.00   54.34  ? 484  GLN A OE1 1 
ATOM   3841 N  NE2 . GLN A  1 484 ? -33.011 -5.870  -19.788 1.00   64.88  ? 484  GLN A NE2 1 
ATOM   3842 N  N   . ASN A  1 485 ? -32.578 -9.067  -13.798 1.00   48.93  ? 485  ASN A N   1 
ATOM   3843 C  CA  . ASN A  1 485 ? -33.520 -9.654  -12.859 1.00   53.43  ? 485  ASN A CA  1 
ATOM   3844 C  C   . ASN A  1 485 ? -32.911 -9.962  -11.502 1.00   57.56  ? 485  ASN A C   1 
ATOM   3845 O  O   . ASN A  1 485 ? -32.862 -11.131 -11.104 1.00   64.59  ? 485  ASN A O   1 
ATOM   3846 C  CB  . ASN A  1 485 ? -34.132 -10.933 -13.436 1.00   50.90  ? 485  ASN A CB  1 
ATOM   3847 C  CG  . ASN A  1 485 ? -34.881 -10.694 -14.732 1.00   59.34  ? 485  ASN A CG  1 
ATOM   3848 O  OD1 . ASN A  1 485 ? -35.285 -9.567  -15.044 1.00   58.51  ? 485  ASN A OD1 1 
ATOM   3849 N  ND2 . ASN A  1 485 ? -35.072 -11.763 -15.499 1.00   72.67  ? 485  ASN A ND2 1 
ATOM   3850 N  N   . ASN A  1 486 ? -32.458 -8.916  -10.809 1.00   50.98  ? 486  ASN A N   1 
ATOM   3851 C  CA  . ASN A  1 486 ? -31.922 -9.026  -9.448  1.00   60.94  ? 486  ASN A CA  1 
ATOM   3852 C  C   . ASN A  1 486 ? -31.055 -10.270 -9.214  1.00   60.97  ? 486  ASN A C   1 
ATOM   3853 O  O   . ASN A  1 486 ? -31.230 -10.986 -8.228  1.00   67.35  ? 486  ASN A O   1 
ATOM   3854 C  CB  . ASN A  1 486 ? -33.063 -8.983  -8.424  1.00   75.80  ? 486  ASN A CB  1 
ATOM   3855 C  CG  . ASN A  1 486 ? -33.884 -7.689  -8.495  1.00   87.43  ? 486  ASN A CG  1 
ATOM   3856 O  OD1 . ASN A  1 486 ? -33.708 -6.863  -9.397  1.00   89.47  ? 486  ASN A OD1 1 
ATOM   3857 N  ND2 . ASN A  1 486 ? -34.796 -7.520  -7.540  1.00   89.18  ? 486  ASN A ND2 1 
ATOM   3858 N  N   . SER A  1 487 ? -30.136 -10.536 -10.134 1.00   51.21  ? 487  SER A N   1 
ATOM   3859 C  CA  . SER A  1 487 ? -29.369 -11.772 -10.088 1.00   52.02  ? 487  SER A CA  1 
ATOM   3860 C  C   . SER A  1 487 ? -28.095 -11.631 -9.279  1.00   56.81  ? 487  SER A C   1 
ATOM   3861 O  O   . SER A  1 487 ? -27.568 -10.532 -9.095  1.00   55.81  ? 487  SER A O   1 
ATOM   3862 C  CB  . SER A  1 487 ? -29.020 -12.266 -11.497 1.00   54.97  ? 487  SER A CB  1 
ATOM   3863 O  OG  . SER A  1 487 ? -30.147 -12.818 -12.157 1.00   59.97  ? 487  SER A OG  1 
ATOM   3864 N  N   . THR A  1 488 ? -27.612 -12.772 -8.798  1.00   58.52  ? 488  THR A N   1 
ATOM   3865 C  CA  . THR A  1 488 ? -26.337 -12.861 -8.111  1.00   45.12  ? 488  THR A CA  1 
ATOM   3866 C  C   . THR A  1 488 ? -25.238 -12.537 -9.115  1.00   36.10  ? 488  THR A C   1 
ATOM   3867 O  O   . THR A  1 488 ? -25.213 -13.093 -10.207 1.00   32.49  ? 488  THR A O   1 
ATOM   3868 C  CB  . THR A  1 488 ? -26.131 -14.288 -7.551  1.00   36.75  ? 488  THR A CB  1 
ATOM   3869 O  OG1 . THR A  1 488 ? -27.158 -14.583 -6.593  1.00   40.49  ? 488  THR A OG1 1 
ATOM   3870 C  CG2 . THR A  1 488 ? -24.775 -14.424 -6.885  1.00   33.72  ? 488  THR A CG2 1 
ATOM   3871 N  N   . SER A  1 489 ? -24.347 -11.616 -8.774  1.00   38.32  ? 489  SER A N   1 
ATOM   3872 C  CA  . SER A  1 489 ? -23.215 -11.354 -9.655  1.00   36.19  ? 489  SER A CA  1 
ATOM   3873 C  C   . SER A  1 489 ? -22.272 -12.552 -9.678  1.00   38.02  ? 489  SER A C   1 
ATOM   3874 O  O   . SER A  1 489 ? -22.023 -13.200 -8.656  1.00   37.84  ? 489  SER A O   1 
ATOM   3875 C  CB  . SER A  1 489 ? -22.464 -10.091 -9.243  1.00   36.99  ? 489  SER A CB  1 
ATOM   3876 O  OG  . SER A  1 489 ? -23.058 -8.940  -9.821  1.00   47.72  ? 489  SER A OG  1 
ATOM   3877 N  N   . TRP A  1 490 ? -21.765 -12.853 -10.861 1.00   30.46  ? 490  TRP A N   1 
ATOM   3878 C  CA  . TRP A  1 490 ? -20.814 -13.931 -11.022 1.00   23.06  ? 490  TRP A CA  1 
ATOM   3879 C  C   . TRP A  1 490 ? -19.409 -13.305 -11.020 1.00   24.98  ? 490  TRP A C   1 
ATOM   3880 O  O   . TRP A  1 490 ? -19.064 -12.542 -11.927 1.00   24.88  ? 490  TRP A O   1 
ATOM   3881 C  CB  . TRP A  1 490 ? -21.129 -14.669 -12.321 1.00   21.00  ? 490  TRP A CB  1 
ATOM   3882 C  CG  . TRP A  1 490 ? -20.346 -15.919 -12.555 1.00   23.79  ? 490  TRP A CG  1 
ATOM   3883 C  CD1 . TRP A  1 490 ? -19.216 -16.337 -11.892 1.00   21.00  ? 490  TRP A CD1 1 
ATOM   3884 C  CD2 . TRP A  1 490 ? -20.648 -16.932 -13.515 1.00   18.36  ? 490  TRP A CD2 1 
ATOM   3885 N  NE1 . TRP A  1 490 ? -18.797 -17.550 -12.398 1.00   21.42  ? 490  TRP A NE1 1 
ATOM   3886 C  CE2 . TRP A  1 490 ? -19.655 -17.935 -13.394 1.00   23.37  ? 490  TRP A CE2 1 
ATOM   3887 C  CE3 . TRP A  1 490 ? -21.651 -17.085 -14.472 1.00   14.95  ? 490  TRP A CE3 1 
ATOM   3888 C  CZ2 . TRP A  1 490 ? -19.647 -19.079 -14.194 1.00   20.03  ? 490  TRP A CZ2 1 
ATOM   3889 C  CZ3 . TRP A  1 490 ? -21.641 -18.217 -15.273 1.00   20.46  ? 490  TRP A CZ3 1 
ATOM   3890 C  CH2 . TRP A  1 490 ? -20.640 -19.200 -15.132 1.00   18.26  ? 490  TRP A CH2 1 
ATOM   3891 N  N   . PRO A  1 491 ? -18.616 -13.586 -9.971  1.00   23.34  ? 491  PRO A N   1 
ATOM   3892 C  CA  . PRO A  1 491 ? -17.294 -12.980 -9.762  1.00   23.05  ? 491  PRO A CA  1 
ATOM   3893 C  C   . PRO A  1 491 ? -16.222 -13.652 -10.600 1.00   23.72  ? 491  PRO A C   1 
ATOM   3894 O  O   . PRO A  1 491 ? -16.396 -14.826 -10.946 1.00   20.46  ? 491  PRO A O   1 
ATOM   3895 C  CB  . PRO A  1 491 ? -17.020 -13.248 -8.289  1.00   20.53  ? 491  PRO A CB  1 
ATOM   3896 C  CG  . PRO A  1 491 ? -17.785 -14.467 -7.978  1.00   24.33  ? 491  PRO A CG  1 
ATOM   3897 C  CD  . PRO A  1 491 ? -18.992 -14.476 -8.862  1.00   25.05  ? 491  PRO A CD  1 
ATOM   3898 N  N   . VAL A  1 492 ? -15.151 -12.934 -10.944 1.00   19.36  ? 492  VAL A N   1 
ATOM   3899 C  CA  . VAL A  1 492 ? -14.048 -13.597 -11.631 1.00   21.10  ? 492  VAL A CA  1 
ATOM   3900 C  C   . VAL A  1 492 ? -13.380 -14.617 -10.704 1.00   23.17  ? 492  VAL A C   1 
ATOM   3901 O  O   . VAL A  1 492 ? -13.318 -14.452 -9.478  1.00   24.54  ? 492  VAL A O   1 
ATOM   3902 C  CB  . VAL A  1 492 ? -12.993 -12.608 -12.220 1.00   23.72  ? 492  VAL A CB  1 
ATOM   3903 C  CG1 . VAL A  1 492 ? -13.677 -11.441 -12.926 1.00   19.99  ? 492  VAL A CG1 1 
ATOM   3904 C  CG2 . VAL A  1 492 ? -12.064 -12.112 -11.145 1.00   20.50  ? 492  VAL A CG2 1 
ATOM   3905 N  N   . PHE A  1 493 ? -12.902 -15.694 -11.297 1.00   29.56  ? 493  PHE A N   1 
ATOM   3906 C  CA  . PHE A  1 493 ? -12.162 -16.694 -10.559 1.00   28.73  ? 493  PHE A CA  1 
ATOM   3907 C  C   . PHE A  1 493 ? -10.713 -16.244 -10.520 1.00   26.37  ? 493  PHE A C   1 
ATOM   3908 O  O   . PHE A  1 493 ? -10.003 -16.335 -11.512 1.00   34.40  ? 493  PHE A O   1 
ATOM   3909 C  CB  . PHE A  1 493 ? -12.288 -18.030 -11.293 1.00   30.02  ? 493  PHE A CB  1 
ATOM   3910 C  CG  . PHE A  1 493 ? -11.600 -19.190 -10.619 1.00   30.55  ? 493  PHE A CG  1 
ATOM   3911 C  CD1 . PHE A  1 493 ? -10.247 -19.423 -10.813 1.00   29.83  ? 493  PHE A CD1 1 
ATOM   3912 C  CD2 . PHE A  1 493 ? -12.323 -20.082 -9.837  1.00   34.05  ? 493  PHE A CD2 1 
ATOM   3913 C  CE1 . PHE A  1 493 ? -9.623  -20.518 -10.222 1.00   36.54  ? 493  PHE A CE1 1 
ATOM   3914 C  CE2 . PHE A  1 493 ? -11.703 -21.183 -9.242  1.00   29.24  ? 493  PHE A CE2 1 
ATOM   3915 C  CZ  . PHE A  1 493 ? -10.357 -21.397 -9.435  1.00   31.66  ? 493  PHE A CZ  1 
ATOM   3916 N  N   . LYS A  1 494 ? -10.272 -15.729 -9.388  1.00   30.11  ? 494  LYS A N   1 
ATOM   3917 C  CA  . LYS A  1 494 ? -8.846  -15.463 -9.213  1.00   39.72  ? 494  LYS A CA  1 
ATOM   3918 C  C   . LYS A  1 494 ? -8.212  -16.688 -8.569  1.00   33.15  ? 494  LYS A C   1 
ATOM   3919 O  O   . LYS A  1 494 ? -8.903  -17.483 -7.940  1.00   28.08  ? 494  LYS A O   1 
ATOM   3920 C  CB  . LYS A  1 494 ? -8.626  -14.205 -8.363  1.00   43.46  ? 494  LYS A CB  1 
ATOM   3921 C  CG  . LYS A  1 494 ? -8.878  -12.896 -9.120  1.00   46.81  ? 494  LYS A CG  1 
ATOM   3922 C  CD  . LYS A  1 494 ? -9.499  -11.819 -8.226  1.00   58.16  ? 494  LYS A CD  1 
ATOM   3923 C  CE  . LYS A  1 494 ? -8.681  -11.577 -6.949  1.00   69.70  ? 494  LYS A CE  1 
ATOM   3924 N  NZ  . LYS A  1 494 ? -7.293  -11.053 -7.181  1.00   73.51  ? 494  LYS A NZ  1 
ATOM   3925 N  N   . SER A  1 495 ? -6.911  -16.879 -8.739  1.00   39.38  ? 495  SER A N   1 
ATOM   3926 C  CA  . SER A  1 495 ? -6.281  -17.971 -8.006  1.00   46.88  ? 495  SER A CA  1 
ATOM   3927 C  C   . SER A  1 495 ? -6.204  -17.444 -6.593  1.00   52.27  ? 495  SER A C   1 
ATOM   3928 O  O   . SER A  1 495 ? -6.456  -16.254 -6.365  1.00   61.06  ? 495  SER A O   1 
ATOM   3929 C  CB  . SER A  1 495 ? -4.903  -18.341 -8.552  1.00   50.80  ? 495  SER A CB  1 
ATOM   3930 O  OG  . SER A  1 495 ? -3.882  -17.554 -7.964  1.00   60.34  ? 495  SER A OG  1 
ATOM   3931 N  N   . THR A  1 496 ? -5.888  -18.318 -5.646  1.00   44.06  ? 496  THR A N   1 
ATOM   3932 C  CA  . THR A  1 496 ? -5.920  -17.956 -4.221  1.00   48.56  ? 496  THR A CA  1 
ATOM   3933 C  C   . THR A  1 496 ? -7.345  -17.796 -3.653  1.00   41.11  ? 496  THR A C   1 
ATOM   3934 O  O   . THR A  1 496 ? -7.694  -18.500 -2.710  1.00   45.04  ? 496  THR A O   1 
ATOM   3935 C  CB  . THR A  1 496 ? -5.013  -16.724 -3.857  1.00   66.48  ? 496  THR A CB  1 
ATOM   3936 O  OG1 . THR A  1 496 ? -5.629  -15.508 -4.301  1.00   63.52  ? 496  THR A OG1 1 
ATOM   3937 C  CG2 . THR A  1 496 ? -3.606  -16.864 -4.479  1.00   63.93  ? 496  THR A CG2 1 
ATOM   3938 N  N   . GLU A  1 497 ? -8.161  -16.897 -4.209  1.00   34.47  ? 497  GLU A N   1 
ATOM   3939 C  CA  . GLU A  1 497 ? -9.554  -16.754 -3.748  1.00   35.49  ? 497  GLU A CA  1 
ATOM   3940 C  C   . GLU A  1 497 ? -10.488 -17.830 -4.328  1.00   31.59  ? 497  GLU A C   1 
ATOM   3941 O  O   . GLU A  1 497 ? -11.293 -18.411 -3.609  1.00   26.92  ? 497  GLU A O   1 
ATOM   3942 C  CB  . GLU A  1 497 ? -10.105 -15.373 -4.064  1.00   51.77  ? 497  GLU A CB  1 
ATOM   3943 C  CG  . GLU A  1 497 ? -9.526  -14.241 -3.226  1.00   72.50  ? 497  GLU A CG  1 
ATOM   3944 C  CD  . GLU A  1 497 ? -8.358  -13.534 -3.906  1.00   87.60  ? 497  GLU A CD  1 
ATOM   3945 O  OE1 . GLU A  1 497 ? -7.480  -14.224 -4.475  1.00   90.94  ? 497  GLU A OE1 1 
ATOM   3946 O  OE2 . GLU A  1 497 ? -8.325  -12.281 -3.876  1.00   91.45  ? 497  GLU A OE2 1 
ATOM   3947 N  N   . GLN A  1 498 ? -10.377 -18.082 -5.627  1.00   28.20  ? 498  GLN A N   1 
ATOM   3948 C  CA  . GLN A  1 498 ? -11.059 -19.201 -6.258  1.00   24.91  ? 498  GLN A CA  1 
ATOM   3949 C  C   . GLN A  1 498 ? -12.586 -19.218 -6.098  1.00   22.44  ? 498  GLN A C   1 
ATOM   3950 O  O   . GLN A  1 498 ? -13.180 -20.275 -5.883  1.00   23.50  ? 498  GLN A O   1 
ATOM   3951 C  CB  . GLN A  1 498 ? -10.464 -20.510 -5.742  1.00   33.10  ? 498  GLN A CB  1 
ATOM   3952 C  CG  . GLN A  1 498 ? -9.088  -20.815 -6.284  1.00   38.87  ? 498  GLN A CG  1 
ATOM   3953 C  CD  . GLN A  1 498 ? -8.271  -21.699 -5.362  1.00   40.66  ? 498  GLN A CD  1 
ATOM   3954 O  OE1 . GLN A  1 498 ? -7.281  -21.246 -4.787  1.00   49.53  ? 498  GLN A OE1 1 
ATOM   3955 N  NE2 . GLN A  1 498 ? -8.674  -22.960 -5.216  1.00   28.77  ? 498  GLN A NE2 1 
ATOM   3956 N  N   . LYS A  1 499 ? -13.223 -18.059 -6.212  1.00   24.72  ? 499  LYS A N   1 
ATOM   3957 C  CA  . LYS A  1 499 ? -14.676 -17.975 -6.140  1.00   18.36  ? 499  LYS A CA  1 
ATOM   3958 C  C   . LYS A  1 499 ? -15.319 -18.623 -7.354  1.00   21.52  ? 499  LYS A C   1 
ATOM   3959 O  O   . LYS A  1 499 ? -14.798 -18.515 -8.468  1.00   20.12  ? 499  LYS A O   1 
ATOM   3960 C  CB  . LYS A  1 499 ? -15.113 -16.515 -6.049  1.00   20.98  ? 499  LYS A CB  1 
ATOM   3961 C  CG  . LYS A  1 499 ? -14.663 -15.861 -4.768  1.00   20.92  ? 499  LYS A CG  1 
ATOM   3962 C  CD  . LYS A  1 499 ? -15.040 -14.422 -4.727  1.00   30.55  ? 499  LYS A CD  1 
ATOM   3963 C  CE  . LYS A  1 499 ? -14.208 -13.674 -3.702  1.00   23.71  ? 499  LYS A CE  1 
ATOM   3964 N  NZ  . LYS A  1 499 ? -14.847 -12.348 -3.414  1.00   25.17  ? 499  LYS A NZ  1 
ATOM   3965 N  N   . TYR A  1 500 ? -16.435 -19.318 -7.130  1.00   18.28  ? 500  TYR A N   1 
ATOM   3966 C  CA  . TYR A  1 500 ? -17.218 -19.909 -8.220  1.00   21.70  ? 500  TYR A CA  1 
ATOM   3967 C  C   . TYR A  1 500 ? -18.708 -19.731 -7.939  1.00   22.08  ? 500  TYR A C   1 
ATOM   3968 O  O   . TYR A  1 500 ? -19.101 -19.422 -6.815  1.00   24.89  ? 500  TYR A O   1 
ATOM   3969 C  CB  . TYR A  1 500 ? -16.875 -21.385 -8.426  1.00   18.03  ? 500  TYR A CB  1 
ATOM   3970 C  CG  . TYR A  1 500 ? -17.291 -22.320 -7.302  1.00   21.26  ? 500  TYR A CG  1 
ATOM   3971 C  CD1 . TYR A  1 500 ? -16.459 -22.544 -6.197  1.00   22.67  ? 500  TYR A CD1 1 
ATOM   3972 C  CD2 . TYR A  1 500 ? -18.501 -23.008 -7.358  1.00   21.76  ? 500  TYR A CD2 1 
ATOM   3973 C  CE1 . TYR A  1 500 ? -16.843 -23.413 -5.166  1.00   26.73  ? 500  TYR A CE1 1 
ATOM   3974 C  CE2 . TYR A  1 500 ? -18.894 -23.877 -6.335  1.00   25.31  ? 500  TYR A CE2 1 
ATOM   3975 C  CZ  . TYR A  1 500 ? -18.063 -24.076 -5.244  1.00   27.82  ? 500  TYR A CZ  1 
ATOM   3976 O  OH  . TYR A  1 500 ? -18.465 -24.940 -4.241  1.00   20.45  ? 500  TYR A OH  1 
ATOM   3977 N  N   . LEU A  1 501 ? -19.526 -19.921 -8.964  1.00   17.65  ? 501  LEU A N   1 
ATOM   3978 C  CA  . LEU A  1 501 ? -20.967 -19.703 -8.861  1.00   23.47  ? 501  LEU A CA  1 
ATOM   3979 C  C   . LEU A  1 501 ? -21.739 -21.032 -8.978  1.00   27.23  ? 501  LEU A C   1 
ATOM   3980 O  O   . LEU A  1 501 ? -21.500 -21.821 -9.901  1.00   19.33  ? 501  LEU A O   1 
ATOM   3981 C  CB  . LEU A  1 501 ? -21.418 -18.759 -9.978  1.00   18.30  ? 501  LEU A CB  1 
ATOM   3982 C  CG  . LEU A  1 501 ? -22.901 -18.405 -10.022 1.00   25.15  ? 501  LEU A CG  1 
ATOM   3983 C  CD1 . LEU A  1 501 ? -23.176 -17.453 -8.913  1.00   28.95  ? 501  LEU A CD1 1 
ATOM   3984 C  CD2 . LEU A  1 501 ? -23.311 -17.787 -11.347 1.00   25.76  ? 501  LEU A CD2 1 
ATOM   3985 N  N   . THR A  1 502 ? -22.650 -21.294 -8.046  1.00   27.13  ? 502  THR A N   1 
ATOM   3986 C  CA  . THR A  1 502 ? -23.500 -22.476 -8.179  1.00   28.99  ? 502  THR A CA  1 
ATOM   3987 C  C   . THR A  1 502 ? -24.715 -22.179 -9.056  1.00   30.07  ? 502  THR A C   1 
ATOM   3988 O  O   . THR A  1 502 ? -25.283 -21.087 -9.018  1.00   36.05  ? 502  THR A O   1 
ATOM   3989 C  CB  . THR A  1 502 ? -23.932 -23.068 -6.817  1.00   25.77  ? 502  THR A CB  1 
ATOM   3990 O  OG1 . THR A  1 502 ? -24.851 -22.182 -6.145  1.00   28.77  ? 502  THR A OG1 1 
ATOM   3991 C  CG2 . THR A  1 502 ? -22.719 -23.274 -5.954  1.00   24.07  ? 502  THR A CG2 1 
ATOM   3992 N  N   . LEU A  1 503 ? -25.084 -23.154 -9.872  1.00   29.12  ? 503  LEU A N   1 
ATOM   3993 C  CA  . LEU A  1 503 ? -26.247 -23.033 -10.729 1.00   27.59  ? 503  LEU A CA  1 
ATOM   3994 C  C   . LEU A  1 503 ? -27.264 -24.056 -10.280 1.00   31.01  ? 503  LEU A C   1 
ATOM   3995 O  O   . LEU A  1 503 ? -26.989 -25.252 -10.291 1.00   30.57  ? 503  LEU A O   1 
ATOM   3996 C  CB  . LEU A  1 503 ? -25.871 -23.283 -12.195 1.00   22.57  ? 503  LEU A CB  1 
ATOM   3997 C  CG  . LEU A  1 503 ? -24.912 -22.276 -12.850 1.00   27.87  ? 503  LEU A CG  1 
ATOM   3998 C  CD1 . LEU A  1 503 ? -24.493 -22.751 -14.247 1.00   14.45  ? 503  LEU A CD1 1 
ATOM   3999 C  CD2 . LEU A  1 503 ? -25.526 -20.876 -12.906 1.00   16.45  ? 503  LEU A CD2 1 
ATOM   4000 N  N   . ASN A  1 504 ? -28.431 -23.580 -9.860  1.00   39.21  ? 504  ASN A N   1 
ATOM   4001 C  CA  . ASN A  1 504 ? -29.540 -24.459 -9.516  1.00   39.13  ? 504  ASN A CA  1 
ATOM   4002 C  C   . ASN A  1 504 ? -30.864 -23.701 -9.578  1.00   40.67  ? 504  ASN A C   1 
ATOM   4003 O  O   . ASN A  1 504 ? -30.881 -22.477 -9.736  1.00   36.69  ? 504  ASN A O   1 
ATOM   4004 C  CB  . ASN A  1 504 ? -29.336 -25.067 -8.133  1.00   33.21  ? 504  ASN A CB  1 
ATOM   4005 C  CG  . ASN A  1 504 ? -29.255 -24.018 -7.058  1.00   44.79  ? 504  ASN A CG  1 
ATOM   4006 O  OD1 . ASN A  1 504 ? -30.275 -23.608 -6.505  1.00   51.06  ? 504  ASN A OD1 1 
ATOM   4007 N  ND2 . ASN A  1 504 ? -28.040 -23.566 -6.754  1.00   47.85  ? 504  ASN A ND2 1 
ATOM   4008 N  N   . THR A  1 505 ? -31.971 -24.426 -9.444  1.00   44.51  ? 505  THR A N   1 
ATOM   4009 C  CA  . THR A  1 505 ? -33.287 -23.812 -9.589  1.00   48.83  ? 505  THR A CA  1 
ATOM   4010 C  C   . THR A  1 505 ? -33.745 -22.979 -8.392  1.00   58.11  ? 505  THR A C   1 
ATOM   4011 O  O   . THR A  1 505 ? -34.590 -22.100 -8.547  1.00   68.29  ? 505  THR A O   1 
ATOM   4012 C  CB  . THR A  1 505 ? -34.373 -24.845 -9.926  1.00   41.06  ? 505  THR A CB  1 
ATOM   4013 O  OG1 . THR A  1 505 ? -34.384 -25.880 -8.934  1.00   42.37  ? 505  THR A OG1 1 
ATOM   4014 C  CG2 . THR A  1 505 ? -34.124 -25.440 -11.297 1.00   30.05  ? 505  THR A CG2 1 
ATOM   4015 N  N   . GLU A  1 506 ? -33.204 -23.245 -7.209  1.00   57.86  ? 506  GLU A N   1 
ATOM   4016 C  CA  . GLU A  1 506 ? -33.636 -22.505 -6.024  1.00   68.91  ? 506  GLU A CA  1 
ATOM   4017 C  C   . GLU A  1 506 ? -32.782 -21.267 -5.708  1.00   70.74  ? 506  GLU A C   1 
ATOM   4018 O  O   . GLU A  1 506 ? -33.218 -20.134 -5.918  1.00   73.43  ? 506  GLU A O   1 
ATOM   4019 C  CB  . GLU A  1 506 ? -33.783 -23.425 -4.800  1.00   78.80  ? 506  GLU A CB  1 
ATOM   4020 C  CG  . GLU A  1 506 ? -32.580 -24.315 -4.478  1.00   86.52  ? 506  GLU A CG  1 
ATOM   4021 C  CD  . GLU A  1 506 ? -32.736 -25.732 -4.993  1.00   92.71  ? 506  GLU A CD  1 
ATOM   4022 O  OE1 . GLU A  1 506 ? -33.117 -25.904 -6.171  1.00   96.30  ? 506  GLU A OE1 1 
ATOM   4023 O  OE2 . GLU A  1 506 ? -32.484 -26.676 -4.212  1.00   93.18  ? 506  GLU A OE2 1 
ATOM   4024 N  N   . SER A  1 507 ? -31.570 -21.483 -5.211  1.00   70.40  ? 507  SER A N   1 
ATOM   4025 C  CA  . SER A  1 507 ? -30.720 -20.386 -4.774  1.00   70.30  ? 507  SER A CA  1 
ATOM   4026 C  C   . SER A  1 507 ? -29.372 -20.455 -5.457  1.00   60.05  ? 507  SER A C   1 
ATOM   4027 O  O   . SER A  1 507 ? -28.716 -21.497 -5.466  1.00   63.00  ? 507  SER A O   1 
ATOM   4028 C  CB  . SER A  1 507 ? -30.509 -20.449 -3.260  1.00   81.53  ? 507  SER A CB  1 
ATOM   4029 O  OG  . SER A  1 507 ? -29.708 -21.570 -2.909  1.00   86.25  ? 507  SER A OG  1 
ATOM   4030 N  N   . THR A  1 508 ? -28.953 -19.330 -6.014  1.00   48.24  ? 508  THR A N   1 
ATOM   4031 C  CA  . THR A  1 508 ? -27.666 -19.239 -6.682  1.00   38.09  ? 508  THR A CA  1 
ATOM   4032 C  C   . THR A  1 508 ? -26.613 -18.612 -5.757  1.00   38.46  ? 508  THR A C   1 
ATOM   4033 O  O   . THR A  1 508 ? -26.804 -17.507 -5.256  1.00   38.93  ? 508  THR A O   1 
ATOM   4034 C  CB  . THR A  1 508 ? -27.817 -18.470 -7.995  1.00   36.92  ? 508  THR A CB  1 
ATOM   4035 O  OG1 . THR A  1 508 ? -28.042 -19.408 -9.062  1.00   50.97  ? 508  THR A OG1 1 
ATOM   4036 C  CG2 . THR A  1 508 ? -26.588 -17.669 -8.291  1.00   28.46  ? 508  THR A CG2 1 
ATOM   4037 N  N   . ARG A  1 509 ? -25.516 -19.332 -5.511  1.00   35.37  ? 509  ARG A N   1 
ATOM   4038 C  CA  . ARG A  1 509 ? -24.570 -18.933 -4.462  1.00   34.14  ? 509  ARG A CA  1 
ATOM   4039 C  C   . ARG A  1 509 ? -23.123 -18.762 -4.929  1.00   31.44  ? 509  ARG A C   1 
ATOM   4040 O  O   . ARG A  1 509 ? -22.643 -19.487 -5.808  1.00   27.83  ? 509  ARG A O   1 
ATOM   4041 C  CB  . ARG A  1 509 ? -24.604 -19.914 -3.272  1.00   33.57  ? 509  ARG A CB  1 
ATOM   4042 C  CG  . ARG A  1 509 ? -25.949 -20.023 -2.578  1.00   43.55  ? 509  ARG A CG  1 
ATOM   4043 C  CD  . ARG A  1 509 ? -25.844 -19.825 -1.063  1.00   61.80  ? 509  ARG A CD  1 
ATOM   4044 N  NE  . ARG A  1 509 ? -27.110 -19.352 -0.487  1.00   74.41  ? 509  ARG A NE  1 
ATOM   4045 C  CZ  . ARG A  1 509 ? -28.138 -20.142 -0.170  1.00   82.38  ? 509  ARG A CZ  1 
ATOM   4046 N  NH1 . ARG A  1 509 ? -28.065 -21.455 -0.361  1.00   81.08  ? 509  ARG A NH1 1 
ATOM   4047 N  NH2 . ARG A  1 509 ? -29.247 -19.620 0.336   1.00   88.05  ? 509  ARG A NH2 1 
ATOM   4048 N  N   . ILE A  1 510 ? -22.430 -17.797 -4.327  1.00   33.55  ? 510  ILE A N   1 
ATOM   4049 C  CA  . ILE A  1 510 ? -20.993 -17.699 -4.515  1.00   28.90  ? 510  ILE A CA  1 
ATOM   4050 C  C   . ILE A  1 510 ? -20.317 -18.517 -3.440  1.00   24.79  ? 510  ILE A C   1 
ATOM   4051 O  O   . ILE A  1 510 ? -20.536 -18.282 -2.243  1.00   26.28  ? 510  ILE A O   1 
ATOM   4052 C  CB  . ILE A  1 510 ? -20.443 -16.263 -4.404  1.00   30.88  ? 510  ILE A CB  1 
ATOM   4053 C  CG1 . ILE A  1 510 ? -21.293 -15.276 -5.183  1.00   35.14  ? 510  ILE A CG1 1 
ATOM   4054 C  CG2 . ILE A  1 510 ? -19.021 -16.226 -4.933  1.00   28.09  ? 510  ILE A CG2 1 
ATOM   4055 C  CD1 . ILE A  1 510 ? -21.414 -15.639 -6.612  1.00   37.60  ? 510  ILE A CD1 1 
ATOM   4056 N  N   . MET A  1 511 ? -19.485 -19.464 -3.868  1.00   21.05  ? 511  MET A N   1 
ATOM   4057 C  CA  . MET A  1 511 ? -18.694 -20.279 -2.948  1.00   22.89  ? 511  MET A CA  1 
ATOM   4058 C  C   . MET A  1 511 ? -17.218 -20.169 -3.315  1.00   27.02  ? 511  MET A C   1 
ATOM   4059 O  O   . MET A  1 511 ? -16.870 -19.555 -4.334  1.00   27.36  ? 511  MET A O   1 
ATOM   4060 C  CB  . MET A  1 511 ? -19.146 -21.726 -3.026  1.00   27.01  ? 511  MET A CB  1 
ATOM   4061 C  CG  . MET A  1 511 ? -20.624 -21.860 -3.367  1.00   38.86  ? 511  MET A CG  1 
ATOM   4062 S  SD  . MET A  1 511 ? -21.466 -23.079 -2.362  1.00   64.55  ? 511  MET A SD  1 
ATOM   4063 C  CE  . MET A  1 511 ? -20.691 -22.740 -0.796  1.00   23.11  ? 511  MET A CE  1 
ATOM   4064 N  N   . THR A  1 512 ? -16.354 -20.762 -2.496  1.00   20.18  ? 512  THR A N   1 
ATOM   4065 C  CA  . THR A  1 512 ? -14.917 -20.712 -2.739  1.00   29.71  ? 512  THR A CA  1 
ATOM   4066 C  C   . THR A  1 512 ? -14.283 -22.091 -2.663  1.00   28.82  ? 512  THR A C   1 
ATOM   4067 O  O   . THR A  1 512 ? -14.716 -22.935 -1.882  1.00   22.95  ? 512  THR A O   1 
ATOM   4068 C  CB  . THR A  1 512 ? -14.186 -19.805 -1.715  1.00   33.87  ? 512  THR A CB  1 
ATOM   4069 O  OG1 . THR A  1 512 ? -14.503 -20.232 -0.386  1.00   37.32  ? 512  THR A OG1 1 
ATOM   4070 C  CG2 . THR A  1 512 ? -14.591 -18.344 -1.883  1.00   21.70  ? 512  THR A CG2 1 
ATOM   4071 N  N   . LYS A  1 513 ? -13.263 -22.306 -3.491  1.00   31.55  ? 513  LYS A N   1 
ATOM   4072 C  CA  . LYS A  1 513 ? -12.365 -23.454 -3.378  1.00   18.13  ? 513  LYS A CA  1 
ATOM   4073 C  C   . LYS A  1 513 ? -13.045 -24.821 -3.526  1.00   17.66  ? 513  LYS A C   1 
ATOM   4074 O  O   . LYS A  1 513 ? -12.979 -25.667 -2.634  1.00   26.81  ? 513  LYS A O   1 
ATOM   4075 C  CB  . LYS A  1 513 ? -11.567 -23.363 -2.063  1.00   19.52  ? 513  LYS A CB  1 
ATOM   4076 C  CG  . LYS A  1 513 ? -10.627 -22.153 -2.010  1.00   20.07  ? 513  LYS A CG  1 
ATOM   4077 C  CD  . LYS A  1 513 ? -9.882  -22.040 -0.693  1.00   21.64  ? 513  LYS A CD  1 
ATOM   4078 C  CE  . LYS A  1 513 ? -9.034  -20.782 -0.665  1.00   33.41  ? 513  LYS A CE  1 
ATOM   4079 N  NZ  . LYS A  1 513 ? -8.072  -20.731 0.495   1.00   41.96  ? 513  LYS A NZ  1 
ATOM   4080 N  N   . LEU A  1 514 ? -13.691 -25.026 -4.666  1.00   20.94  ? 514  LEU A N   1 
ATOM   4081 C  CA  . LEU A  1 514 ? -14.366 -26.286 -4.978  1.00   23.51  ? 514  LEU A CA  1 
ATOM   4082 C  C   . LEU A  1 514 ? -13.427 -27.499 -4.832  1.00   27.40  ? 514  LEU A C   1 
ATOM   4083 O  O   . LEU A  1 514 ? -12.306 -27.475 -5.342  1.00   25.50  ? 514  LEU A O   1 
ATOM   4084 C  CB  . LEU A  1 514 ? -14.910 -26.221 -6.408  1.00   20.44  ? 514  LEU A CB  1 
ATOM   4085 C  CG  . LEU A  1 514 ? -15.737 -27.400 -6.920  1.00   23.98  ? 514  LEU A CG  1 
ATOM   4086 C  CD1 . LEU A  1 514 ? -16.956 -27.585 -6.029  1.00   17.97  ? 514  LEU A CD1 1 
ATOM   4087 C  CD2 . LEU A  1 514 ? -16.151 -27.198 -8.393  1.00   13.67  ? 514  LEU A CD2 1 
ATOM   4088 N  N   . ARG A  1 515 ? -13.893 -28.542 -4.138  1.00   27.45  ? 515  ARG A N   1 
ATOM   4089 C  CA  . ARG A  1 515 ? -13.135 -29.789 -3.932  1.00   28.93  ? 515  ARG A CA  1 
ATOM   4090 C  C   . ARG A  1 515 ? -11.681 -29.601 -3.530  1.00   29.06  ? 515  ARG A C   1 
ATOM   4091 O  O   . ARG A  1 515 ? -10.810 -30.293 -4.048  1.00   29.28  ? 515  ARG A O   1 
ATOM   4092 C  CB  . ARG A  1 515 ? -13.178 -30.671 -5.181  1.00   31.49  ? 515  ARG A CB  1 
ATOM   4093 C  CG  . ARG A  1 515 ? -14.572 -30.997 -5.666  1.00   41.15  ? 515  ARG A CG  1 
ATOM   4094 C  CD  . ARG A  1 515 ? -15.155 -32.246 -5.001  1.00   39.09  ? 515  ARG A CD  1 
ATOM   4095 N  NE  . ARG A  1 515 ? -16.171 -32.853 -5.858  1.00   40.10  ? 515  ARG A NE  1 
ATOM   4096 C  CZ  . ARG A  1 515 ? -17.424 -32.409 -5.965  1.00   44.98  ? 515  ARG A CZ  1 
ATOM   4097 N  NH1 . ARG A  1 515 ? -17.820 -31.363 -5.254  1.00   47.94  ? 515  ARG A NH1 1 
ATOM   4098 N  NH2 . ARG A  1 515 ? -18.290 -33.010 -6.778  1.00   44.07  ? 515  ARG A NH2 1 
ATOM   4099 N  N   . ALA A  1 516 ? -11.424 -28.673 -2.614  1.00   29.27  ? 516  ALA A N   1 
ATOM   4100 C  CA  . ALA A  1 516 ? -10.053 -28.337 -2.230  1.00   31.06  ? 516  ALA A CA  1 
ATOM   4101 C  C   . ALA A  1 516 ? -9.210  -29.559 -1.812  1.00   33.09  ? 516  ALA A C   1 
ATOM   4102 O  O   . ALA A  1 516 ? -8.143  -29.808 -2.375  1.00   27.96  ? 516  ALA A O   1 
ATOM   4103 C  CB  . ALA A  1 516 ? -10.066 -27.305 -1.135  1.00   20.11  ? 516  ALA A CB  1 
ATOM   4104 N  N   . GLN A  1 517 ? -9.708  -30.311 -0.832  1.00   35.62  ? 517  GLN A N   1 
ATOM   4105 C  CA  . GLN A  1 517 ? -9.016  -31.477 -0.288  1.00   37.93  ? 517  GLN A CA  1 
ATOM   4106 C  C   . GLN A  1 517 ? -8.808  -32.555 -1.366  1.00   32.25  ? 517  GLN A C   1 
ATOM   4107 O  O   . GLN A  1 517 ? -7.690  -33.028 -1.577  1.00   26.23  ? 517  GLN A O   1 
ATOM   4108 C  CB  . GLN A  1 517 ? -9.838  -32.063 0.868   1.00   47.29  ? 517  GLN A CB  1 
ATOM   4109 C  CG  . GLN A  1 517 ? -9.305  -31.855 2.280   1.00   47.38  ? 517  GLN A CG  1 
ATOM   4110 C  CD  . GLN A  1 517 ? -10.100 -32.674 3.293   0.26   54.36  ? 517  GLN A CD  1 
ATOM   4111 O  OE1 . GLN A  1 517 ? -11.325 -32.767 3.195   1.00   58.42  ? 517  GLN A OE1 1 
ATOM   4112 N  NE2 . GLN A  1 517 ? -9.406  -33.293 4.250   1.00   55.88  ? 517  GLN A NE2 1 
ATOM   4113 N  N   . GLN A  1 518 ? -9.897  -32.943 -2.032  1.00   24.39  ? 518  GLN A N   1 
ATOM   4114 C  CA  . GLN A  1 518 ? -9.838  -33.914 -3.109  1.00   19.22  ? 518  GLN A CA  1 
ATOM   4115 C  C   . GLN A  1 518 ? -8.829  -33.529 -4.181  1.00   35.07  ? 518  GLN A C   1 
ATOM   4116 O  O   . GLN A  1 518 ? -8.015  -34.347 -4.603  1.00   38.23  ? 518  GLN A O   1 
ATOM   4117 C  CB  . GLN A  1 518 ? -11.214 -34.067 -3.767  1.00   25.99  ? 518  GLN A CB  1 
ATOM   4118 C  CG  . GLN A  1 518 ? -12.310 -34.611 -2.847  1.00   29.07  ? 518  GLN A CG  1 
ATOM   4119 C  CD  . GLN A  1 518 ? -12.944 -33.531 -1.980  1.00   34.56  ? 518  GLN A CD  1 
ATOM   4120 O  OE1 . GLN A  1 518 ? -12.336 -32.485 -1.714  1.00   35.21  ? 518  GLN A OE1 1 
ATOM   4121 N  NE2 . GLN A  1 518 ? -14.181 -33.774 -1.550  1.00   30.80  ? 518  GLN A NE2 1 
ATOM   4122 N  N   . CYS A  1 519 ? -8.885  -32.281 -4.631  1.00   33.69  ? 519  CYS A N   1 
ATOM   4123 C  CA  . CYS A  1 519 ? -8.061  -31.867 -5.758  1.00   26.93  ? 519  CYS A CA  1 
ATOM   4124 C  C   . CYS A  1 519 ? -6.604  -31.749 -5.364  1.00   32.39  ? 519  CYS A C   1 
ATOM   4125 O  O   . CYS A  1 519 ? -5.711  -31.922 -6.196  1.00   39.15  ? 519  CYS A O   1 
ATOM   4126 C  CB  . CYS A  1 519 ? -8.592  -30.580 -6.382  1.00   19.78  ? 519  CYS A CB  1 
ATOM   4127 S  SG  . CYS A  1 519 ? -10.027 -30.870 -7.434  1.00   50.65  ? 519  CYS A SG  1 
ATOM   4128 N  N   . ARG A  1 520 ? -6.367  -31.483 -4.083  1.00   30.29  ? 520  ARG A N   1 
ATOM   4129 C  CA  . ARG A  1 520 ? -5.014  -31.512 -3.550  1.00   24.13  ? 520  ARG A CA  1 
ATOM   4130 C  C   . ARG A  1 520 ? -4.449  -32.924 -3.696  1.00   26.55  ? 520  ARG A C   1 
ATOM   4131 O  O   . ARG A  1 520 ? -3.286  -33.100 -4.061  1.00   25.76  ? 520  ARG A O   1 
ATOM   4132 C  CB  . ARG A  1 520 ? -4.989  -31.054 -2.092  1.00   27.45  ? 520  ARG A CB  1 
ATOM   4133 C  CG  . ARG A  1 520 ? -3.898  -30.032 -1.781  1.00   35.65  ? 520  ARG A CG  1 
ATOM   4134 C  CD  . ARG A  1 520 ? -4.061  -29.433 -0.378  1.00   54.02  ? 520  ARG A CD  1 
ATOM   4135 N  NE  . ARG A  1 520 ? -4.931  -28.250 -0.349  1.00   61.95  ? 520  ARG A NE  1 
ATOM   4136 C  CZ  . ARG A  1 520 ? -6.067  -28.153 0.344   1.00   61.80  ? 520  ARG A CZ  1 
ATOM   4137 N  NH1 . ARG A  1 520 ? -6.499  -29.169 1.089   1.00   54.15  ? 520  ARG A NH1 1 
ATOM   4138 N  NH2 . ARG A  1 520 ? -6.777  -27.029 0.295   1.00   64.73  ? 520  ARG A NH2 1 
ATOM   4139 N  N   . PHE A  1 521 ? -5.283  -33.932 -3.438  1.00   26.38  ? 521  PHE A N   1 
ATOM   4140 C  CA  . PHE A  1 521 ? -4.854  -35.317 -3.597  1.00   28.11  ? 521  PHE A CA  1 
ATOM   4141 C  C   . PHE A  1 521 ? -4.517  -35.639 -5.053  1.00   28.69  ? 521  PHE A C   1 
ATOM   4142 O  O   . PHE A  1 521 ? -3.484  -36.248 -5.337  1.00   26.47  ? 521  PHE A O   1 
ATOM   4143 C  CB  . PHE A  1 521 ? -5.917  -36.297 -3.077  1.00   26.73  ? 521  PHE A CB  1 
ATOM   4144 C  CG  . PHE A  1 521 ? -5.639  -37.736 -3.438  1.00   26.86  ? 521  PHE A CG  1 
ATOM   4145 C  CD1 . PHE A  1 521 ? -4.681  -38.475 -2.730  1.00   23.88  ? 521  PHE A CD1 1 
ATOM   4146 C  CD2 . PHE A  1 521 ? -6.314  -38.343 -4.490  1.00   21.45  ? 521  PHE A CD2 1 
ATOM   4147 C  CE1 . PHE A  1 521 ? -4.403  -39.789 -3.056  1.00   24.60  ? 521  PHE A CE1 1 
ATOM   4148 C  CE2 . PHE A  1 521 ? -6.043  -39.679 -4.831  1.00   32.35  ? 521  PHE A CE2 1 
ATOM   4149 C  CZ  . PHE A  1 521 ? -5.084  -40.400 -4.113  1.00   30.41  ? 521  PHE A CZ  1 
ATOM   4150 N  N   . TRP A  1 522 ? -5.387  -35.223 -5.969  1.00   25.34  ? 522  TRP A N   1 
ATOM   4151 C  CA  . TRP A  1 522 ? -5.246  -35.605 -7.369  1.00   28.31  ? 522  TRP A CA  1 
ATOM   4152 C  C   . TRP A  1 522 ? -4.097  -34.921 -8.096  1.00   32.77  ? 522  TRP A C   1 
ATOM   4153 O  O   . TRP A  1 522 ? -3.246  -35.584 -8.672  1.00   30.78  ? 522  TRP A O   1 
ATOM   4154 C  CB  . TRP A  1 522 ? -6.548  -35.382 -8.134  1.00   17.30  ? 522  TRP A CB  1 
ATOM   4155 C  CG  . TRP A  1 522 ? -7.581  -36.369 -7.781  1.00   25.89  ? 522  TRP A CG  1 
ATOM   4156 C  CD1 . TRP A  1 522 ? -8.772  -36.131 -7.152  1.00   24.39  ? 522  TRP A CD1 1 
ATOM   4157 C  CD2 . TRP A  1 522 ? -7.524  -37.781 -8.017  1.00   25.13  ? 522  TRP A CD2 1 
ATOM   4158 N  NE1 . TRP A  1 522 ? -9.463  -37.312 -6.990  1.00   22.63  ? 522  TRP A NE1 1 
ATOM   4159 C  CE2 . TRP A  1 522 ? -8.717  -38.337 -7.511  1.00   22.20  ? 522  TRP A CE2 1 
ATOM   4160 C  CE3 . TRP A  1 522 ? -6.578  -38.628 -8.605  1.00   27.37  ? 522  TRP A CE3 1 
ATOM   4161 C  CZ2 . TRP A  1 522 ? -8.984  -39.698 -7.572  1.00   24.69  ? 522  TRP A CZ2 1 
ATOM   4162 C  CZ3 . TRP A  1 522 ? -6.845  -39.988 -8.659  1.00   28.34  ? 522  TRP A CZ3 1 
ATOM   4163 C  CH2 . TRP A  1 522 ? -8.038  -40.506 -8.147  1.00   30.35  ? 522  TRP A CH2 1 
ATOM   4164 N  N   . THR A  1 523 ? -4.071  -33.597 -8.071  1.00   39.44  ? 523  THR A N   1 
ATOM   4165 C  CA  . THR A  1 523 ? -3.145  -32.877 -8.929  1.00   44.83  ? 523  THR A CA  1 
ATOM   4166 C  C   . THR A  1 523 ? -1.759  -32.732 -8.303  1.00   41.12  ? 523  THR A C   1 
ATOM   4167 O  O   . THR A  1 523 ? -0.801  -32.384 -8.987  1.00   39.49  ? 523  THR A O   1 
ATOM   4168 C  CB  . THR A  1 523 ? -3.727  -31.497 -9.360  1.00   47.95  ? 523  THR A CB  1 
ATOM   4169 O  OG1 . THR A  1 523 ? -3.262  -30.464 -8.484  1.00   41.98  ? 523  THR A OG1 1 
ATOM   4170 C  CG2 . THR A  1 523 ? -5.238  -31.542 -9.327  1.00   43.03  ? 523  THR A CG2 1 
ATOM   4171 N  N   . SER A  1 524 ? -1.648  -33.031 -7.012  1.00   44.89  ? 524  SER A N   1 
ATOM   4172 C  CA  . SER A  1 524 ? -0.366  -32.897 -6.316  1.00   48.48  ? 524  SER A CA  1 
ATOM   4173 C  C   . SER A  1 524 ? 0.276   -34.220 -5.881  1.00   54.47  ? 524  SER A C   1 
ATOM   4174 O  O   . SER A  1 524 ? 1.444   -34.462 -6.165  1.00   65.25  ? 524  SER A O   1 
ATOM   4175 C  CB  . SER A  1 524 ? -0.494  -31.953 -5.120  1.00   53.12  ? 524  SER A CB  1 
ATOM   4176 O  OG  . SER A  1 524 ? 0.707   -31.942 -4.374  1.00   60.75  ? 524  SER A OG  1 
ATOM   4177 N  N   . PHE A  1 525 ? -0.478  -35.070 -5.192  1.00   55.39  ? 525  PHE A N   1 
ATOM   4178 C  CA  . PHE A  1 525 ? 0.031   -36.378 -4.763  1.00   57.18  ? 525  PHE A CA  1 
ATOM   4179 C  C   . PHE A  1 525 ? 0.036   -37.411 -5.898  1.00   60.03  ? 525  PHE A C   1 
ATOM   4180 O  O   . PHE A  1 525 ? 1.063   -38.020 -6.193  1.00   62.67  ? 525  PHE A O   1 
ATOM   4181 C  CB  . PHE A  1 525 ? -0.805  -36.907 -3.592  1.00   61.18  ? 525  PHE A CB  1 
ATOM   4182 C  CG  . PHE A  1 525 ? -0.356  -38.243 -3.067  1.00   76.32  ? 525  PHE A CG  1 
ATOM   4183 C  CD1 . PHE A  1 525 ? -0.736  -39.422 -3.691  1.00   80.66  ? 525  PHE A CD1 1 
ATOM   4184 C  CD2 . PHE A  1 525 ? 0.429   -38.322 -1.930  1.00   89.34  ? 525  PHE A CD2 1 
ATOM   4185 C  CE1 . PHE A  1 525 ? -0.321  -40.647 -3.205  1.00   87.95  ? 525  PHE A CE1 1 
ATOM   4186 C  CE2 . PHE A  1 525 ? 0.843   -39.548 -1.437  1.00   95.25  ? 525  PHE A CE2 1 
ATOM   4187 C  CZ  . PHE A  1 525 ? 0.466   -40.709 -2.074  1.00   94.34  ? 525  PHE A CZ  1 
ATOM   4188 N  N   . PHE A  1 526 ? -1.125  -37.604 -6.521  1.00   56.08  ? 526  PHE A N   1 
ATOM   4189 C  CA  . PHE A  1 526 ? -1.352  -38.705 -7.467  1.00   49.80  ? 526  PHE A CA  1 
ATOM   4190 C  C   . PHE A  1 526 ? -0.470  -38.814 -8.746  1.00   47.90  ? 526  PHE A C   1 
ATOM   4191 O  O   . PHE A  1 526 ? -0.138  -39.932 -9.156  1.00   45.94  ? 526  PHE A O   1 
ATOM   4192 C  CB  . PHE A  1 526 ? -2.850  -38.808 -7.825  1.00   39.31  ? 526  PHE A CB  1 
ATOM   4193 C  CG  . PHE A  1 526 ? -3.235  -40.130 -8.433  1.00   34.51  ? 526  PHE A CG  1 
ATOM   4194 C  CD1 . PHE A  1 526 ? -3.455  -41.243 -7.630  1.00   36.35  ? 526  PHE A CD1 1 
ATOM   4195 C  CD2 . PHE A  1 526 ? -3.356  -40.270 -9.806  1.00   27.70  ? 526  PHE A CD2 1 
ATOM   4196 C  CE1 . PHE A  1 526 ? -3.799  -42.473 -8.186  1.00   30.11  ? 526  PHE A CE1 1 
ATOM   4197 C  CE2 . PHE A  1 526 ? -3.700  -41.490 -10.364 1.00   27.10  ? 526  PHE A CE2 1 
ATOM   4198 C  CZ  . PHE A  1 526 ? -3.924  -42.593 -9.550  1.00   29.87  ? 526  PHE A CZ  1 
ATOM   4199 N  N   . PRO A  1 527 ? -0.094  -37.680 -9.385  1.00   44.91  ? 527  PRO A N   1 
ATOM   4200 C  CA  . PRO A  1 527 ? 0.744   -37.797 -10.591 1.00   45.07  ? 527  PRO A CA  1 
ATOM   4201 C  C   . PRO A  1 527 ? 2.099   -38.468 -10.350 1.00   46.77  ? 527  PRO A C   1 
ATOM   4202 O  O   . PRO A  1 527 ? 2.786   -38.810 -11.320 1.00   48.54  ? 527  PRO A O   1 
ATOM   4203 C  CB  . PRO A  1 527 ? 0.970   -36.334 -11.008 1.00   40.63  ? 527  PRO A CB  1 
ATOM   4204 C  CG  . PRO A  1 527 ? -0.175  -35.600 -10.443 1.00   37.90  ? 527  PRO A CG  1 
ATOM   4205 C  CD  . PRO A  1 527 ? -0.459  -36.276 -9.130  1.00   39.85  ? 527  PRO A CD  1 
ATOM   4206 N  N   . LYS A  1 528 ? 2.472   -38.660 -9.087  1.00   47.90  ? 528  LYS A N   1 
ATOM   4207 C  CA  . LYS A  1 528 ? 3.757   -39.263 -8.755  1.00   56.43  ? 528  LYS A CA  1 
ATOM   4208 C  C   . LYS A  1 528 ? 3.740   -40.791 -8.764  1.00   64.69  ? 528  LYS A C   1 
ATOM   4209 O  O   . LYS A  1 528 ? 4.785   -41.413 -8.941  1.00   72.51  ? 528  LYS A O   1 
ATOM   4210 C  CB  . LYS A  1 528 ? 4.252   -38.764 -7.397  1.00   52.80  ? 528  LYS A CB  1 
ATOM   4211 C  CG  . LYS A  1 528 ? 4.313   -37.253 -7.271  1.00   50.20  ? 528  LYS A CG  1 
ATOM   4212 C  CD  . LYS A  1 528 ? 4.679   -36.862 -5.850  1.00   55.50  ? 528  LYS A CD  1 
ATOM   4213 C  CE  . LYS A  1 528 ? 4.412   -35.395 -5.568  1.00   57.56  ? 528  LYS A CE  1 
ATOM   4214 N  NZ  . LYS A  1 528 ? 4.585   -35.113 -4.117  1.00   62.52  ? 528  LYS A NZ  1 
ATOM   4215 N  N   . VAL A  1 529 ? 2.566   -41.390 -8.573  1.00   68.39  ? 529  VAL A N   1 
ATOM   4216 C  CA  . VAL A  1 529 ? 2.455   -42.852 -8.462  1.00   73.22  ? 529  VAL A CA  1 
ATOM   4217 C  C   . VAL A  1 529 ? 2.747   -43.594 -9.778  1.00   73.14  ? 529  VAL A C   1 
ATOM   4218 O  O   . VAL A  1 529 ? 2.548   -43.064 -10.876 1.00   69.90  ? 529  VAL A O   1 
ATOM   4219 C  CB  . VAL A  1 529 ? 1.066   -43.300 -7.904  1.00   59.96  ? 529  VAL A CB  1 
ATOM   4220 C  CG1 . VAL A  1 529 ? 0.757   -42.601 -6.586  1.00   55.82  ? 529  VAL A CG1 1 
ATOM   4221 C  CG2 . VAL A  1 529 ? -0.039  -43.041 -8.921  1.00   56.98  ? 529  VAL A CG2 1 
ATOM   4222 O  OXT . VAL A  1 529 ? 3.192   -44.748 -9.777  1.00   72.02  ? 529  VAL A OXT 1 
HETATM 4223 X  UNK . UNX B  2 .   ? -6.146  -40.802 -24.418 1.00   44.54  ? 705  UNX A UNK 1 
HETATM 4224 X  UNK . UNX C  2 .   ? -4.850  -42.318 -23.244 1.00   41.91  ? 706  UNX A UNK 1 
HETATM 4225 X  UNK . UNX D  2 .   ? -7.277  -44.689 -22.507 1.00   53.89  ? 707  UNX A UNK 1 
HETATM 4226 X  UNK . UNX E  2 .   ? -5.589  -43.645 -22.226 1.00   35.78  ? 709  UNX A UNK 1 
HETATM 4227 X  UNK . UNX F  2 .   ? -7.199  -42.672 -21.929 1.00   45.10  ? 710  UNX A UNK 1 
HETATM 4228 X  UNK . UNX G  2 .   ? -22.044 -38.001 -22.966 1.00   32.82  ? 711  UNX A UNK 1 
HETATM 4229 X  UNK . UNX H  2 .   ? -21.180 -36.382 -24.278 1.00   30.63  ? 712  UNX A UNK 1 
HETATM 4230 C  C1  . NAG I  3 .   ? -32.624 -28.168 -53.898 0.91   76.28  ? 540  NAG A C1  1 
HETATM 4231 C  C2  . NAG I  3 .   ? -32.804 -29.015 -55.158 0.91   83.86  ? 540  NAG A C2  1 
HETATM 4232 C  C3  . NAG I  3 .   ? -33.725 -28.305 -56.151 0.91   85.37  ? 540  NAG A C3  1 
HETATM 4233 C  C4  . NAG I  3 .   ? -35.036 -27.940 -55.460 0.91   88.25  ? 540  NAG A C4  1 
HETATM 4234 C  C5  . NAG I  3 .   ? -34.740 -27.124 -54.200 0.91   87.24  ? 540  NAG A C5  1 
HETATM 4235 C  C6  . NAG I  3 .   ? -36.007 -26.756 -53.435 0.91   89.27  ? 540  NAG A C6  1 
HETATM 4236 C  C7  . NAG I  3 .   ? -30.939 -30.525 -55.540 0.91   88.74  ? 540  NAG A C7  1 
HETATM 4237 C  C8  . NAG I  3 .   ? -29.660 -30.807 -56.277 0.91   87.14  ? 540  NAG A C8  1 
HETATM 4238 N  N2  . NAG I  3 .   ? -31.506 -29.333 -55.737 0.91   87.41  ? 540  NAG A N2  1 
HETATM 4239 O  O3  . NAG I  3 .   ? -33.985 -29.129 -57.266 0.91   82.52  ? 540  NAG A O3  1 
HETATM 4240 O  O4  . NAG I  3 .   ? -35.881 -27.229 -56.345 0.91   87.44  ? 540  NAG A O4  1 
HETATM 4241 O  O5  . NAG I  3 .   ? -33.880 -27.843 -53.334 0.91   80.96  ? 540  NAG A O5  1 
HETATM 4242 O  O6  . NAG I  3 .   ? -36.671 -27.926 -53.000 0.91   92.99  ? 540  NAG A O6  1 
HETATM 4243 O  O7  . NAG I  3 .   ? -31.421 -31.376 -54.789 0.91   89.11  ? 540  NAG A O7  1 
HETATM 4244 C  C1  . FUL J  4 .   ? -38.087 -27.679 -52.864 1.00   99.03  ? 541  FUL A C1  1 
HETATM 4245 C  C2  . FUL J  4 .   ? -38.595 -26.734 -54.011 1.00   113.19 ? 541  FUL A C2  1 
HETATM 4246 O  O2  . FUL J  4 .   ? -38.593 -27.373 -55.294 1.00   110.82 ? 541  FUL A O2  1 
HETATM 4247 C  C3  . FUL J  4 .   ? -39.976 -26.126 -53.704 1.00   112.25 ? 541  FUL A C3  1 
HETATM 4248 O  O3  . FUL J  4 .   ? -40.297 -25.100 -54.652 1.00   112.55 ? 541  FUL A O3  1 
HETATM 4249 C  C4  . FUL J  4 .   ? -39.979 -25.512 -52.295 1.00   105.17 ? 541  FUL A C4  1 
HETATM 4250 O  O4  . FUL J  4 .   ? -38.995 -24.482 -52.199 1.00   95.86  ? 541  FUL A O4  1 
HETATM 4251 C  C5  . FUL J  4 .   ? -39.670 -26.619 -51.291 1.00   102.86 ? 541  FUL A C5  1 
HETATM 4252 C  C6  . FUL J  4 .   ? -39.656 -26.132 -49.848 1.00   98.12  ? 541  FUL A C6  1 
HETATM 4253 O  O5  . FUL J  4 .   ? -38.367 -27.210 -51.547 1.00   103.13 ? 541  FUL A O5  1 
HETATM 4254 C  C1  . NAG K  3 .   ? -19.210 -5.283  -36.887 1.00   68.33  ? 550  NAG A C1  1 
HETATM 4255 C  C2  . NAG K  3 .   ? -18.706 -4.226  -37.891 1.00   70.94  ? 550  NAG A C2  1 
HETATM 4256 C  C3  . NAG K  3 .   ? -17.179 -4.132  -37.923 1.00   70.34  ? 550  NAG A C3  1 
HETATM 4257 C  C4  . NAG K  3 .   ? -16.640 -3.914  -36.512 1.00   69.03  ? 550  NAG A C4  1 
HETATM 4258 C  C5  . NAG K  3 .   ? -17.158 -5.008  -35.577 1.00   68.74  ? 550  NAG A C5  1 
HETATM 4259 C  C6  . NAG K  3 .   ? -16.715 -4.724  -34.138 1.00   65.89  ? 550  NAG A C6  1 
HETATM 4260 C  C7  . NAG K  3 .   ? -20.447 -4.131  -39.591 1.00   63.33  ? 550  NAG A C7  1 
HETATM 4261 C  C8  . NAG K  3 .   ? -20.676 -2.687  -39.945 1.00   61.85  ? 550  NAG A C8  1 
HETATM 4262 N  N2  . NAG K  3 .   ? -19.209 -4.477  -39.234 1.00   68.18  ? 550  NAG A N2  1 
HETATM 4263 O  O3  . NAG K  3 .   ? -16.763 -3.083  -38.776 1.00   68.89  ? 550  NAG A O3  1 
HETATM 4264 O  O4  . NAG K  3 .   ? -15.220 -3.887  -36.509 1.00   63.30  ? 550  NAG A O4  1 
HETATM 4265 O  O5  . NAG K  3 .   ? -18.577 -5.118  -35.619 1.00   67.20  ? 550  NAG A O5  1 
HETATM 4266 O  O6  . NAG K  3 .   ? -16.392 -5.914  -33.440 1.00   58.79  ? 550  NAG A O6  1 
HETATM 4267 O  O7  . NAG K  3 .   ? -21.371 -4.945  -39.633 1.00   56.29  ? 550  NAG A O7  1 
HETATM 4268 C  C1  . NAG L  3 .   ? 2.310   -52.002 -26.816 0.91   79.20  ? 560  NAG A C1  1 
HETATM 4269 C  C2  . NAG L  3 .   ? 1.882   -52.198 -25.353 0.91   86.20  ? 560  NAG A C2  1 
HETATM 4270 C  C3  . NAG L  3 .   ? 2.263   -53.578 -24.804 0.91   88.71  ? 560  NAG A C3  1 
HETATM 4271 C  C4  . NAG L  3 .   ? 1.947   -54.709 -25.778 0.91   95.06  ? 560  NAG A C4  1 
HETATM 4272 C  C5  . NAG L  3 .   ? 2.515   -54.376 -27.159 0.91   92.67  ? 560  NAG A C5  1 
HETATM 4273 C  C6  . NAG L  3 .   ? 1.408   -54.450 -28.197 0.91   93.08  ? 560  NAG A C6  1 
HETATM 4274 C  C7  . NAG L  3 .   ? 1.785   -50.296 -23.796 0.91   90.80  ? 560  NAG A C7  1 
HETATM 4275 C  C8  . NAG L  3 .   ? 2.243   -48.864 -23.843 0.91   91.10  ? 560  NAG A C8  1 
HETATM 4276 N  N2  . NAG L  3 .   ? 2.491   -51.176 -24.512 0.91   90.24  ? 560  NAG A N2  1 
HETATM 4277 O  O3  . NAG L  3 .   ? 1.586   -53.825 -23.592 0.91   85.15  ? 560  NAG A O3  1 
HETATM 4278 O  O4  . NAG L  3 .   ? 2.448   -55.951 -25.279 0.91   104.17 ? 560  NAG A O4  1 
HETATM 4279 O  O5  . NAG L  3 .   ? 3.130   -53.092 -27.212 0.91   87.74  ? 560  NAG A O5  1 
HETATM 4280 O  O6  . NAG L  3 .   ? 0.783   -55.715 -28.185 0.91   96.10  ? 560  NAG A O6  1 
HETATM 4281 O  O7  . NAG L  3 .   ? 0.804   -50.609 -23.118 0.91   90.41  ? 560  NAG A O7  1 
HETATM 4282 C  C1  . NAG M  3 .   ? 1.395   -56.916 -24.982 1.00   109.21 ? 561  NAG A C1  1 
HETATM 4283 C  C2  . NAG M  3 .   ? 1.686   -58.302 -25.556 1.00   105.48 ? 561  NAG A C2  1 
HETATM 4284 C  C3  . NAG M  3 .   ? 0.330   -58.969 -25.709 1.00   107.59 ? 561  NAG A C3  1 
HETATM 4285 C  C4  . NAG M  3 .   ? -0.211  -59.214 -24.303 1.00   109.58 ? 561  NAG A C4  1 
HETATM 4286 C  C5  . NAG M  3 .   ? 0.161   -58.142 -23.246 1.00   118.63 ? 561  NAG A C5  1 
HETATM 4287 C  C6  . NAG M  3 .   ? 0.709   -58.828 -21.988 1.00   118.33 ? 561  NAG A C6  1 
HETATM 4288 C  C7  . NAG M  3 .   ? 3.752   -58.562 -26.723 1.00   95.67  ? 561  NAG A C7  1 
HETATM 4289 C  C8  . NAG M  3 .   ? 4.178   -59.927 -27.177 1.00   96.27  ? 561  NAG A C8  1 
HETATM 4290 N  N2  . NAG M  3 .   ? 2.454   -58.288 -26.785 1.00   98.55  ? 561  NAG A N2  1 
HETATM 4291 O  O3  . NAG M  3 .   ? 0.416   -60.180 -26.431 1.00   106.41 ? 561  NAG A O3  1 
HETATM 4292 O  O4  . NAG M  3 .   ? -1.619  -59.350 -24.384 1.00   108.77 ? 561  NAG A O4  1 
HETATM 4293 O  O5  . NAG M  3 .   ? 1.093   -57.108 -23.608 1.00   114.61 ? 561  NAG A O5  1 
HETATM 4294 O  O6  . NAG M  3 .   ? -0.248  -59.692 -21.409 1.00   116.58 ? 561  NAG A O6  1 
HETATM 4295 O  O7  . NAG M  3 .   ? 4.576   -57.751 -26.303 1.00   94.72  ? 561  NAG A O7  1 
HETATM 4296 C  C1  . FUL N  4 .   ? -0.618  -55.566 -28.496 0.95   97.97  ? 562  FUL A C1  1 
HETATM 4297 C  C2  . FUL N  4 .   ? -1.515  -56.057 -27.331 0.95   99.44  ? 562  FUL A C2  1 
HETATM 4298 O  O2  . FUL N  4 .   ? -1.256  -55.365 -26.116 0.95   101.96 ? 562  FUL A O2  1 
HETATM 4299 C  C3  . FUL N  4 .   ? -3.009  -55.962 -27.717 0.95   96.23  ? 562  FUL A C3  1 
HETATM 4300 O  O3  . FUL N  4 .   ? -3.839  -56.571 -26.718 0.95   93.27  ? 562  FUL A O3  1 
HETATM 4301 C  C4  . FUL N  4 .   ? -3.244  -56.698 -29.031 0.95   94.99  ? 562  FUL A C4  1 
HETATM 4302 O  O4  . FUL N  4 .   ? -2.931  -58.067 -28.856 0.95   99.29  ? 562  FUL A O4  1 
HETATM 4303 C  C5  . FUL N  4 .   ? -2.335  -56.111 -30.111 0.95   90.65  ? 562  FUL A C5  1 
HETATM 4304 C  C6  . FUL N  4 .   ? -2.418  -56.862 -31.421 0.95   87.81  ? 562  FUL A C6  1 
HETATM 4305 O  O5  . FUL N  4 .   ? -0.954  -56.175 -29.722 0.95   94.68  ? 562  FUL A O5  1 
HETATM 4306 C  C1  . NAG O  3 .   ? -27.952 -54.429 -9.065  0.99   24.01  ? 570  NAG A C1  1 
HETATM 4307 C  C2  . NAG O  3 .   ? -27.644 -55.314 -7.872  0.99   26.57  ? 570  NAG A C2  1 
HETATM 4308 C  C3  . NAG O  3 .   ? -26.334 -56.062 -8.037  0.99   31.07  ? 570  NAG A C3  1 
HETATM 4309 C  C4  . NAG O  3 .   ? -26.128 -56.722 -9.401  0.99   43.78  ? 570  NAG A C4  1 
HETATM 4310 C  C5  . NAG O  3 .   ? -26.555 -55.698 -10.449 0.99   42.19  ? 570  NAG A C5  1 
HETATM 4311 C  C6  . NAG O  3 .   ? -26.249 -56.052 -11.923 0.99   46.85  ? 570  NAG A C6  1 
HETATM 4312 C  C7  . NAG O  3 .   ? -28.332 -54.716 -5.626  0.99   49.29  ? 570  NAG A C7  1 
HETATM 4313 C  C8  . NAG O  3 .   ? -27.799 -55.655 -4.572  0.99   55.60  ? 570  NAG A C8  1 
HETATM 4314 N  N2  . NAG O  3 .   ? -27.550 -54.515 -6.675  0.99   42.42  ? 570  NAG A N2  1 
HETATM 4315 O  O3  . NAG O  3 .   ? -26.391 -57.033 -7.040  0.99   37.40  ? 570  NAG A O3  1 
HETATM 4316 O  O4  . NAG O  3 .   ? -24.750 -56.921 -9.622  0.99   59.13  ? 570  NAG A O4  1 
HETATM 4317 O  O5  . NAG O  3 .   ? -27.887 -55.268 -10.204 0.99   38.19  ? 570  NAG A O5  1 
HETATM 4318 O  O6  . NAG O  3 .   ? -26.634 -57.325 -12.424 0.99   51.77  ? 570  NAG A O6  1 
HETATM 4319 O  O7  . NAG O  3 .   ? -29.428 -54.164 -5.517  0.99   40.80  ? 570  NAG A O7  1 
HETATM 4320 C  C1  . NAG P  3 .   ? -24.113 -58.211 -9.440  1.00   66.72  ? 571  NAG A C1  1 
HETATM 4321 C  C2  . NAG P  3 .   ? -24.843 -59.301 -8.648  1.00   74.42  ? 571  NAG A C2  1 
HETATM 4322 C  C3  . NAG P  3 .   ? -24.046 -60.616 -8.609  1.00   75.64  ? 571  NAG A C3  1 
HETATM 4323 C  C4  . NAG P  3 .   ? -23.088 -60.872 -9.779  1.00   78.36  ? 571  NAG A C4  1 
HETATM 4324 C  C5  . NAG P  3 .   ? -22.657 -59.631 -10.558 1.00   76.39  ? 571  NAG A C5  1 
HETATM 4325 C  C6  . NAG P  3 .   ? -22.136 -60.013 -11.943 1.00   78.89  ? 571  NAG A C6  1 
HETATM 4326 C  C7  . NAG P  3 .   ? -24.223 -58.893 -6.263  1.00   75.86  ? 571  NAG A C7  1 
HETATM 4327 C  C8  . NAG P  3 .   ? -23.642 -57.568 -5.868  1.00   71.62  ? 571  NAG A C8  1 
HETATM 4328 N  N2  . NAG P  3 .   ? -25.103 -58.879 -7.278  1.00   77.26  ? 571  NAG A N2  1 
HETATM 4329 O  O3  . NAG P  3 .   ? -24.941 -61.711 -8.501  1.00   66.49  ? 571  NAG A O3  1 
HETATM 4330 O  O4  . NAG P  3 .   ? -21.924 -61.467 -9.249  1.00   80.61  ? 571  NAG A O4  1 
HETATM 4331 O  O5  . NAG P  3 .   ? -23.736 -58.733 -10.695 1.00   70.91  ? 571  NAG A O5  1 
HETATM 4332 O  O6  . NAG P  3 .   ? -21.167 -61.037 -11.843 1.00   81.15  ? 571  NAG A O6  1 
HETATM 4333 O  O7  . NAG P  3 .   ? -23.904 -59.903 -5.628  1.00   75.27  ? 571  NAG A O7  1 
HETATM 4334 C  C1  . FUL Q  4 .   ? -28.065 -57.528 -12.327 0.71   53.90  ? 572  FUL A C1  1 
HETATM 4335 C  C2  . FUL Q  4 .   ? -28.523 -58.851 -12.936 0.71   53.95  ? 572  FUL A C2  1 
HETATM 4336 O  O2  . FUL Q  4 .   ? -27.639 -59.930 -12.630 0.71   53.45  ? 572  FUL A O2  1 
HETATM 4337 C  C3  . FUL Q  4 .   ? -29.932 -59.155 -12.430 0.71   54.41  ? 572  FUL A C3  1 
HETATM 4338 O  O3  . FUL Q  4 .   ? -30.456 -60.273 -13.134 0.71   59.20  ? 572  FUL A O3  1 
HETATM 4339 C  C4  . FUL Q  4 .   ? -30.911 -57.941 -12.629 0.71   34.70  ? 572  FUL A C4  1 
HETATM 4340 O  O4  . FUL Q  4 .   ? -31.433 -57.918 -13.951 0.71   35.22  ? 572  FUL A O4  1 
HETATM 4341 C  C5  . FUL Q  4 .   ? -30.227 -56.567 -12.284 0.71   48.79  ? 572  FUL A C5  1 
HETATM 4342 C  C6  . FUL Q  4 .   ? -30.983 -55.330 -12.789 0.71   47.59  ? 572  FUL A C6  1 
HETATM 4343 O  O5  . FUL Q  4 .   ? -28.879 -56.482 -12.790 0.71   47.18  ? 572  FUL A O5  1 
HETATM 4344 C  C1  . NAG R  3 .   ? -36.413 -11.774 -16.018 0.91   59.66  ? 580  NAG A C1  1 
HETATM 4345 C  C2  . NAG R  3 .   ? -36.222 -13.045 -16.830 0.91   60.57  ? 580  NAG A C2  1 
HETATM 4346 C  C3  . NAG R  3 .   ? -37.535 -13.493 -17.472 0.91   70.47  ? 580  NAG A C3  1 
HETATM 4347 C  C4  . NAG R  3 .   ? -38.726 -13.396 -16.504 0.91   77.97  ? 580  NAG A C4  1 
HETATM 4348 C  C5  . NAG R  3 .   ? -38.682 -12.122 -15.647 0.91   76.96  ? 580  NAG A C5  1 
HETATM 4349 C  C6  . NAG R  3 .   ? -39.779 -12.078 -14.577 0.91   71.46  ? 580  NAG A C6  1 
HETATM 4350 C  C7  . NAG R  3 .   ? -34.081 -13.546 -17.865 0.91   51.86  ? 580  NAG A C7  1 
HETATM 4351 C  C8  . NAG R  3 .   ? -33.167 -13.265 -19.027 0.91   48.63  ? 580  NAG A C8  1 
HETATM 4352 N  N2  . NAG R  3 .   ? -35.207 -12.824 -17.839 0.91   52.61  ? 580  NAG A N2  1 
HETATM 4353 O  O3  . NAG R  3 .   ? -37.385 -14.822 -17.938 0.91   66.06  ? 580  NAG A O3  1 
HETATM 4354 O  O4  . NAG R  3 .   ? -39.939 -13.432 -17.233 0.91   78.40  ? 580  NAG A O4  1 
HETATM 4355 O  O5  . NAG R  3 .   ? -37.407 -12.009 -15.041 0.91   72.88  ? 580  NAG A O5  1 
HETATM 4356 O  O6  . NAG R  3 .   ? -39.814 -10.800 -13.973 0.91   65.95  ? 580  NAG A O6  1 
HETATM 4357 O  O7  . NAG R  3 .   ? -33.782 -14.401 -17.015 0.91   45.87  ? 580  NAG A O7  1 
HETATM 4358 C  C1  . NAG S  3 .   ? 8.590   -46.004 -48.291 1.00   78.26  ? 590  NAG A C1  1 
HETATM 4359 C  C2  . NAG S  3 .   ? 9.767   -45.093 -48.630 1.00   83.60  ? 590  NAG A C2  1 
HETATM 4360 C  C3  . NAG S  3 .   ? 9.273   -43.766 -49.210 1.00   85.67  ? 590  NAG A C3  1 
HETATM 4361 C  C4  . NAG S  3 .   ? 8.254   -44.008 -50.319 1.00   87.63  ? 590  NAG A C4  1 
HETATM 4362 C  C5  . NAG S  3 .   ? 7.126   -44.885 -49.791 1.00   87.93  ? 590  NAG A C5  1 
HETATM 4363 C  C6  . NAG S  3 .   ? 6.003   -45.084 -50.816 1.00   85.81  ? 590  NAG A C6  1 
HETATM 4364 C  C7  . NAG S  3 .   ? 11.467  -45.775 -46.989 1.00   91.46  ? 590  NAG A C7  1 
HETATM 4365 C  C8  . NAG S  3 .   ? 12.092  -45.486 -45.652 1.00   90.94  ? 590  NAG A C8  1 
HETATM 4366 N  N2  . NAG S  3 .   ? 10.577  -44.883 -47.439 1.00   87.73  ? 590  NAG A N2  1 
HETATM 4367 O  O3  . NAG S  3 .   ? 10.347  -43.000 -49.720 1.00   86.06  ? 590  NAG A O3  1 
HETATM 4368 O  O4  . NAG S  3 .   ? 7.736   -42.781 -50.785 1.00   90.68  ? 590  NAG A O4  1 
HETATM 4369 O  O5  . NAG S  3 .   ? 7.667   -46.124 -49.362 1.00   87.66  ? 590  NAG A O5  1 
HETATM 4370 O  O6  . NAG S  3 .   ? 6.456   -45.803 -51.945 1.00   85.60  ? 590  NAG A O6  1 
HETATM 4371 O  O7  . NAG S  3 .   ? 11.778  -46.796 -47.605 1.00   91.91  ? 590  NAG A O7  1 
HETATM 4372 S  S   . SO4 T  5 .   ? -9.393  -9.494  -19.178 0.62   33.06  ? 700  SO4 A S   1 
HETATM 4373 O  O1  . SO4 T  5 .   ? -9.534  -8.732  -20.426 0.62   22.86  ? 700  SO4 A O1  1 
HETATM 4374 O  O2  . SO4 T  5 .   ? -9.305  -10.926 -19.487 0.62   24.30  ? 700  SO4 A O2  1 
HETATM 4375 O  O3  . SO4 T  5 .   ? -10.553 -9.237  -18.328 0.62   29.94  ? 700  SO4 A O3  1 
HETATM 4376 O  O4  . SO4 T  5 .   ? -8.181  -9.077  -18.464 0.62   28.37  ? 700  SO4 A O4  1 
HETATM 4377 S  S   . SO4 U  5 .   ? -21.075 -31.719 -3.069  1.00   93.45  ? 701  SO4 A S   1 
HETATM 4378 O  O1  . SO4 U  5 .   ? -20.736 -33.072 -2.632  1.00   91.72  ? 701  SO4 A O1  1 
HETATM 4379 O  O2  . SO4 U  5 .   ? -21.574 -31.769 -4.440  1.00   88.60  ? 701  SO4 A O2  1 
HETATM 4380 O  O3  . SO4 U  5 .   ? -22.107 -31.157 -2.200  1.00   94.65  ? 701  SO4 A O3  1 
HETATM 4381 O  O4  . SO4 U  5 .   ? -19.885 -30.871 -3.013  1.00   93.09  ? 701  SO4 A O4  1 
HETATM 4382 S  S   . SO4 V  5 .   ? -8.819  -54.464 3.223   1.00   99.67  ? 702  SO4 A S   1 
HETATM 4383 O  O1  . SO4 V  5 .   ? -8.341  -55.600 2.432   1.00   94.72  ? 702  SO4 A O1  1 
HETATM 4384 O  O2  . SO4 V  5 .   ? -10.086 -53.985 2.670   1.00   101.70 ? 702  SO4 A O2  1 
HETATM 4385 O  O3  . SO4 V  5 .   ? -9.031  -54.859 4.619   1.00   93.42  ? 702  SO4 A O3  1 
HETATM 4386 O  O4  . SO4 V  5 .   ? -7.820  -53.400 3.160   1.00   101.58 ? 702  SO4 A O4  1 
HETATM 4387 S  S   . SO4 W  5 .   ? -16.468 -29.437 -1.786  0.73   82.17  ? 703  SO4 A S   1 
HETATM 4388 O  O1  . SO4 W  5 .   ? -16.114 -29.703 -3.173  0.73   86.34  ? 703  SO4 A O1  1 
HETATM 4389 O  O2  . SO4 W  5 .   ? -17.922 -29.365 -1.708  0.73   84.29  ? 703  SO4 A O2  1 
HETATM 4390 O  O3  . SO4 W  5 .   ? -15.980 -30.534 -0.948  0.73   79.80  ? 703  SO4 A O3  1 
HETATM 4391 O  O4  . SO4 W  5 .   ? -15.885 -28.159 -1.372  0.73   75.43  ? 703  SO4 A O4  1 
HETATM 4392 S  S   . SO4 X  5 .   ? -30.296 -15.862 -8.834  0.84   64.11  ? 704  SO4 A S   1 
HETATM 4393 O  O1  . SO4 X  5 .   ? -29.089 -15.949 -9.654  0.84   64.88  ? 704  SO4 A O1  1 
HETATM 4394 O  O2  . SO4 X  5 .   ? -31.359 -15.283 -9.653  0.84   74.92  ? 704  SO4 A O2  1 
HETATM 4395 O  O3  . SO4 X  5 .   ? -30.705 -17.197 -8.400  0.84   65.65  ? 704  SO4 A O3  1 
HETATM 4396 O  O4  . SO4 X  5 .   ? -30.063 -15.015 -7.664  0.84   54.93  ? 704  SO4 A O4  1 
HETATM 4397 CL CL  . CL  Y  6 .   ? -1.133  -29.059 -44.411 1.00   77.60  ? 713  CL  A CL  1 
HETATM 4398 C  C1  . 4OJ Z  7 .   ? -13.545 -40.343 -22.431 1.00   39.33  ? 1530 4OJ A C1  1 
HETATM 4399 C  C2  . 4OJ Z  7 .   ? -13.832 -41.572 -23.025 1.00   41.60  ? 1530 4OJ A C2  1 
HETATM 4400 C  C3  . 4OJ Z  7 .   ? -15.140 -41.919 -23.363 1.00   35.62  ? 1530 4OJ A C3  1 
HETATM 4401 C  C4  . 4OJ Z  7 .   ? -16.170 -41.027 -23.099 1.00   38.56  ? 1530 4OJ A C4  1 
HETATM 4402 C  C5  . 4OJ Z  7 .   ? -15.886 -39.798 -22.506 1.00   43.28  ? 1530 4OJ A C5  1 
HETATM 4403 C  C6  . 4OJ Z  7 .   ? -14.582 -39.454 -22.174 1.00   35.75  ? 1530 4OJ A C6  1 
HETATM 4404 O  O12 . 4OJ Z  7 .   ? -16.871 -38.879 -22.211 1.00   43.62  ? 1530 4OJ A O12 1 
HETATM 4405 P  P13 . 4OJ Z  7 .   ? -17.477 -37.751 -23.137 1.00   46.85  ? 1530 4OJ A P13 1 
HETATM 4406 O  O1P . 4OJ Z  7 .   ? -18.956 -37.851 -23.038 1.00   43.52  ? 1530 4OJ A O1P 1 
HETATM 4407 O  O2P . 4OJ Z  7 .   ? -17.018 -37.867 -24.527 1.00   53.50  ? 1530 4OJ A O2P 1 
HETATM 4408 C  C7  . 4OJ Z  7 .   ? -14.327 -38.103 -21.526 1.00   21.02  ? 1530 4OJ A C7  1 
HETATM 4409 O  O   . HOH AA 8 .   ? -23.018 -21.285 -56.122 1.00   34.09  ? 2001 HOH A O   1 
HETATM 4410 O  O   . HOH AA 8 .   ? -25.487 -34.754 -48.591 1.00   42.24  ? 2002 HOH A O   1 
HETATM 4411 O  O   . HOH AA 8 .   ? -25.322 -31.540 -40.688 1.00   45.84  ? 2003 HOH A O   1 
HETATM 4412 O  O   . HOH AA 8 .   ? -17.455 -32.217 -46.932 1.00   35.81  ? 2004 HOH A O   1 
HETATM 4413 O  O   . HOH AA 8 .   ? -9.909  -33.390 -46.861 1.00   31.28  ? 2005 HOH A O   1 
HETATM 4414 O  O   . HOH AA 8 .   ? -11.822 -40.807 -43.415 1.00   18.05  ? 2006 HOH A O   1 
HETATM 4415 O  O   . HOH AA 8 .   ? -11.534 -44.119 -47.944 1.00   36.32  ? 2007 HOH A O   1 
HETATM 4416 O  O   . HOH AA 8 .   ? -8.244  -35.552 -45.738 1.00   19.88  ? 2008 HOH A O   1 
HETATM 4417 O  O   . HOH AA 8 .   ? -9.578  -39.986 -42.196 1.00   19.60  ? 2009 HOH A O   1 
HETATM 4418 O  O   . HOH AA 8 .   ? -33.830 -35.210 -24.229 1.00   30.26  ? 2010 HOH A O   1 
HETATM 4419 O  O   . HOH AA 8 .   ? -18.817 -29.979 -52.880 1.00   47.65  ? 2011 HOH A O   1 
HETATM 4420 O  O   . HOH AA 8 .   ? -26.645 -36.384 -46.030 1.00   49.81  ? 2012 HOH A O   1 
HETATM 4421 O  O   . HOH AA 8 .   ? -32.375 -33.091 -40.692 1.00   38.17  ? 2013 HOH A O   1 
HETATM 4422 O  O   . HOH AA 8 .   ? -24.611 -34.651 -38.887 1.00   29.09  ? 2014 HOH A O   1 
HETATM 4423 O  O   . HOH AA 8 .   ? -24.359 -35.999 -46.054 1.00   25.60  ? 2015 HOH A O   1 
HETATM 4424 O  O   . HOH AA 8 .   ? -27.401 -38.868 -43.749 1.00   44.24  ? 2016 HOH A O   1 
HETATM 4425 O  O   . HOH AA 8 .   ? -26.104 -41.046 -47.115 1.00   35.70  ? 2017 HOH A O   1 
HETATM 4426 O  O   . HOH AA 8 .   ? -19.766 -36.819 -36.618 1.00   21.97  ? 2018 HOH A O   1 
HETATM 4427 O  O   . HOH AA 8 .   ? -14.477 -40.633 -37.487 1.00   28.45  ? 2019 HOH A O   1 
HETATM 4428 O  O   . HOH AA 8 .   ? -21.475 -43.371 -30.844 1.00   30.06  ? 2020 HOH A O   1 
HETATM 4429 O  O   . HOH AA 8 .   ? -28.414 -48.945 -28.524 1.00   52.90  ? 2021 HOH A O   1 
HETATM 4430 O  O   . HOH AA 8 .   ? -26.752 -48.142 -25.278 1.00   23.08  ? 2022 HOH A O   1 
HETATM 4431 O  O   . HOH AA 8 .   ? -20.684 -49.330 -24.566 1.00   34.36  ? 2023 HOH A O   1 
HETATM 4432 O  O   . HOH AA 8 .   ? -28.940 -46.846 -31.296 1.00   48.08  ? 2024 HOH A O   1 
HETATM 4433 O  O   . HOH AA 8 .   ? -22.527 -38.161 -28.328 1.00   27.95  ? 2025 HOH A O   1 
HETATM 4434 O  O   . HOH AA 8 .   ? -33.760 -36.828 -33.155 1.00   42.34  ? 2026 HOH A O   1 
HETATM 4435 O  O   . HOH AA 8 .   ? -30.108 -41.055 -45.313 1.00   30.06  ? 2027 HOH A O   1 
HETATM 4436 O  O   . HOH AA 8 .   ? -18.052 -43.853 -45.633 1.00   39.69  ? 2028 HOH A O   1 
HETATM 4437 O  O   . HOH AA 8 .   ? -14.165 -39.681 -42.196 1.00   31.39  ? 2029 HOH A O   1 
HETATM 4438 O  O   . HOH AA 8 .   ? -15.857 -45.185 -47.080 1.00   37.25  ? 2030 HOH A O   1 
HETATM 4439 O  O   . HOH AA 8 .   ? -17.225 -34.599 -46.132 1.00   28.62  ? 2031 HOH A O   1 
HETATM 4440 O  O   . HOH AA 8 .   ? -26.972 -8.846  -42.101 1.00   38.22  ? 2032 HOH A O   1 
HETATM 4441 O  O   . HOH AA 8 .   ? -21.067 -8.786  -32.630 1.00   38.13  ? 2033 HOH A O   1 
HETATM 4442 O  O   . HOH AA 8 .   ? -22.498 -8.113  -30.224 1.00   26.40  ? 2034 HOH A O   1 
HETATM 4443 O  O   . HOH AA 8 .   ? 8.643   -27.266 -33.600 1.00   37.51  ? 2035 HOH A O   1 
HETATM 4444 O  O   . HOH AA 8 .   ? -19.814 -29.590 -32.782 1.00   27.03  ? 2036 HOH A O   1 
HETATM 4445 O  O   . HOH AA 8 .   ? -20.800 -32.808 -26.145 1.00   26.93  ? 2037 HOH A O   1 
HETATM 4446 O  O   . HOH AA 8 .   ? -21.696 -35.532 -28.888 1.00   21.68  ? 2038 HOH A O   1 
HETATM 4447 O  O   . HOH AA 8 .   ? -15.757 -36.728 -29.251 1.00   12.81  ? 2039 HOH A O   1 
HETATM 4448 O  O   . HOH AA 8 .   ? -25.566 -28.496 -33.216 1.00   17.28  ? 2040 HOH A O   1 
HETATM 4449 O  O   . HOH AA 8 .   ? -32.618 -35.781 -26.625 1.00   24.97  ? 2041 HOH A O   1 
HETATM 4450 O  O   . HOH AA 8 .   ? -30.439 -23.320 -29.080 1.00   33.46  ? 2042 HOH A O   1 
HETATM 4451 O  O   . HOH AA 8 .   ? -35.561 -14.464 -32.774 1.00   47.47  ? 2043 HOH A O   1 
HETATM 4452 O  O   . HOH AA 8 .   ? -3.776  -41.150 -30.585 1.00   34.68  ? 2044 HOH A O   1 
HETATM 4453 O  O   . HOH AA 8 .   ? -2.532  -43.109 -32.953 1.00   50.89  ? 2045 HOH A O   1 
HETATM 4454 O  O   . HOH AA 8 .   ? -3.829  -37.730 -32.931 1.00   36.89  ? 2046 HOH A O   1 
HETATM 4455 O  O   . HOH AA 8 .   ? 6.834   -39.834 -38.896 1.00   39.64  ? 2047 HOH A O   1 
HETATM 4456 O  O   . HOH AA 8 .   ? 8.298   -38.894 -41.794 1.00   48.94  ? 2048 HOH A O   1 
HETATM 4457 O  O   . HOH AA 8 .   ? -12.707 -12.214 -41.919 1.00   34.97  ? 2049 HOH A O   1 
HETATM 4458 O  O   . HOH AA 8 .   ? -25.265 -12.462 -47.912 1.00   42.82  ? 2050 HOH A O   1 
HETATM 4459 O  O   . HOH AA 8 .   ? -12.122 -13.631 -33.882 1.00   43.85  ? 2051 HOH A O   1 
HETATM 4460 O  O   . HOH AA 8 .   ? -15.064 -16.647 1.446   1.00   31.79  ? 2052 HOH A O   1 
HETATM 4461 O  O   . HOH AA 8 .   ? -17.695 -13.842 -29.362 1.00   19.96  ? 2053 HOH A O   1 
HETATM 4462 O  O   . HOH AA 8 .   ? -21.194 -31.954 -18.651 1.00   15.97  ? 2054 HOH A O   1 
HETATM 4463 O  O   . HOH AA 8 .   ? 0.394   -25.337 -29.618 1.00   32.20  ? 2055 HOH A O   1 
HETATM 4464 O  O   . HOH AA 8 .   ? 0.546   -22.284 -27.396 1.00   20.18  ? 2056 HOH A O   1 
HETATM 4465 O  O   . HOH AA 8 .   ? -14.694 -28.014 -17.787 1.00   29.20  ? 2057 HOH A O   1 
HETATM 4466 O  O   . HOH AA 8 .   ? -20.745 -28.782 -17.353 1.00   16.78  ? 2058 HOH A O   1 
HETATM 4467 O  O   . HOH AA 8 .   ? -11.588 -31.320 -17.510 1.00   29.14  ? 2059 HOH A O   1 
HETATM 4468 O  O   . HOH AA 8 .   ? -3.177  -34.148 -20.201 1.00   37.01  ? 2060 HOH A O   1 
HETATM 4469 O  O   . HOH AA 8 .   ? -4.203  -35.984 -21.258 1.00   49.84  ? 2061 HOH A O   1 
HETATM 4470 O  O   . HOH AA 8 .   ? -6.084  -38.355 -26.390 1.00   50.16  ? 2062 HOH A O   1 
HETATM 4471 O  O   . HOH AA 8 .   ? 2.004   -36.685 -26.955 1.00   77.71  ? 2063 HOH A O   1 
HETATM 4472 O  O   . HOH AA 8 .   ? -7.821  -54.531 -25.083 1.00   56.34  ? 2064 HOH A O   1 
HETATM 4473 O  O   . HOH AA 8 .   ? -8.248  -42.805 -19.806 1.00   27.75  ? 2065 HOH A O   1 
HETATM 4474 O  O   . HOH AA 8 .   ? 7.672   -29.664 -35.673 1.00   28.85  ? 2066 HOH A O   1 
HETATM 4475 O  O   . HOH AA 8 .   ? 9.232   -27.193 -30.442 1.00   40.80  ? 2067 HOH A O   1 
HETATM 4476 O  O   . HOH AA 8 .   ? -0.045  -27.576 -16.454 1.00   54.10  ? 2068 HOH A O   1 
HETATM 4477 O  O   . HOH AA 8 .   ? 0.617   -33.551 -21.305 1.00   41.02  ? 2069 HOH A O   1 
HETATM 4478 O  O   . HOH AA 8 .   ? -21.945 -38.607 -14.410 1.00   10.59  ? 2070 HOH A O   1 
HETATM 4479 O  O   . HOH AA 8 .   ? -20.633 -38.240 -7.748  1.00   28.06  ? 2071 HOH A O   1 
HETATM 4480 O  O   . HOH AA 8 .   ? -18.485 -36.845 -10.331 1.00   46.50  ? 2072 HOH A O   1 
HETATM 4481 O  O   . HOH AA 8 .   ? -24.303 -42.124 -20.101 1.00   47.04  ? 2073 HOH A O   1 
HETATM 4482 O  O   . HOH AA 8 .   ? -17.347 -51.537 -8.518  1.00   41.85  ? 2074 HOH A O   1 
HETATM 4483 O  O   . HOH AA 8 .   ? -25.006 -53.192 -5.739  1.00   33.65  ? 2075 HOH A O   1 
HETATM 4484 O  O   . HOH AA 8 .   ? -33.425 -46.587 -15.516 1.00   61.97  ? 2076 HOH A O   1 
HETATM 4485 O  O   . HOH AA 8 .   ? -21.748 -48.477 -1.375  1.00   42.17  ? 2077 HOH A O   1 
HETATM 4486 O  O   . HOH AA 8 .   ? -15.900 -55.961 1.217   1.00   49.34  ? 2078 HOH A O   1 
HETATM 4487 O  O   . HOH AA 8 .   ? -10.370 -47.269 4.937   1.00   57.27  ? 2079 HOH A O   1 
HETATM 4488 O  O   . HOH AA 8 .   ? -6.380  -45.343 -15.791 1.00   45.98  ? 2080 HOH A O   1 
HETATM 4489 O  O   . HOH AA 8 .   ? 2.245   -53.389 -7.610  1.00   22.40  ? 2081 HOH A O   1 
HETATM 4490 O  O   . HOH AA 8 .   ? -12.062 -39.421 3.494   1.00   46.82  ? 2082 HOH A O   1 
HETATM 4491 O  O   . HOH AA 8 .   ? -2.809  -35.548 0.597   1.00   33.76  ? 2083 HOH A O   1 
HETATM 4492 O  O   . HOH AA 8 .   ? -20.722 -41.675 5.416   1.00   57.13  ? 2084 HOH A O   1 
HETATM 4493 O  O   . HOH AA 8 .   ? -27.399 -40.973 9.275   1.00   54.13  ? 2085 HOH A O   1 
HETATM 4494 O  O   . HOH AA 8 .   ? -16.285 -49.537 6.470   1.00   30.75  ? 2086 HOH A O   1 
HETATM 4495 O  O   . HOH AA 8 .   ? -21.927 -42.613 -7.276  1.00   24.80  ? 2087 HOH A O   1 
HETATM 4496 O  O   . HOH AA 8 .   ? -24.078 -42.582 -5.920  1.00   39.31  ? 2088 HOH A O   1 
HETATM 4497 O  O   . HOH AA 8 .   ? -20.872 -40.196 -6.421  1.00   36.33  ? 2089 HOH A O   1 
HETATM 4498 O  O   . HOH AA 8 .   ? -18.777 -37.305 -8.290  1.00   52.21  ? 2090 HOH A O   1 
HETATM 4499 O  O   . HOH AA 8 .   ? -16.925 -35.582 -7.682  1.00   10.63  ? 2091 HOH A O   1 
HETATM 4500 O  O   . HOH AA 8 .   ? -15.677 -35.130 -4.235  1.00   25.68  ? 2092 HOH A O   1 
HETATM 4501 O  O   . HOH AA 8 .   ? -6.582  -34.958 -12.700 1.00   19.90  ? 2093 HOH A O   1 
HETATM 4502 O  O   . HOH AA 8 .   ? -2.314  -38.589 -13.717 1.00   39.12  ? 2094 HOH A O   1 
HETATM 4503 O  O   . HOH AA 8 .   ? -8.704  -41.853 -17.252 1.00   41.19  ? 2095 HOH A O   1 
HETATM 4504 O  O   . HOH AA 8 .   ? -7.228  -29.266 -9.286  1.00   29.21  ? 2096 HOH A O   1 
HETATM 4505 O  O   . HOH AA 8 .   ? -6.047  -32.516 -12.070 1.00   24.05  ? 2097 HOH A O   1 
HETATM 4506 O  O   . HOH AA 8 .   ? -4.607  -15.187 -18.542 1.00   28.83  ? 2098 HOH A O   1 
HETATM 4507 O  O   . HOH AA 8 .   ? -9.795  -14.252 -13.129 1.00   29.88  ? 2099 HOH A O   1 
HETATM 4508 O  O   . HOH AA 8 .   ? -14.512 -9.821  -18.489 1.00   29.95  ? 2100 HOH A O   1 
HETATM 4509 O  O   . HOH AA 8 .   ? -16.076 -17.779 -10.969 1.00   20.64  ? 2101 HOH A O   1 
HETATM 4510 O  O   . HOH AA 8 .   ? -25.984 -23.983 -3.939  1.00   39.86  ? 2102 HOH A O   1 
HETATM 4511 O  O   . HOH AA 8 .   ? -29.412 -32.009 -15.212 1.00   33.78  ? 2103 HOH A O   1 
HETATM 4512 O  O   . HOH AA 8 .   ? -31.754 -27.287 -8.461  1.00   26.80  ? 2104 HOH A O   1 
HETATM 4513 O  O   . HOH AA 8 .   ? -31.533 -31.373 -8.619  1.00   26.52  ? 2105 HOH A O   1 
HETATM 4514 O  O   . HOH AA 8 .   ? -33.816 -34.857 -19.038 1.00   39.11  ? 2106 HOH A O   1 
HETATM 4515 O  O   . HOH AA 8 .   ? -35.766 -41.924 -14.028 1.00   44.20  ? 2107 HOH A O   1 
HETATM 4516 O  O   . HOH AA 8 .   ? -27.271 -38.849 -5.229  1.00   30.04  ? 2108 HOH A O   1 
HETATM 4517 O  O   . HOH AA 8 .   ? -28.353 -32.380 -21.772 1.00   33.99  ? 2109 HOH A O   1 
HETATM 4518 O  O   . HOH AA 8 .   ? -32.947 -35.442 -21.476 1.00   37.47  ? 2110 HOH A O   1 
HETATM 4519 O  O   . HOH AA 8 .   ? -37.538 -28.523 -25.993 1.00   42.14  ? 2111 HOH A O   1 
HETATM 4520 O  O   . HOH AA 8 .   ? -39.167 -27.863 -30.467 1.00   38.69  ? 2112 HOH A O   1 
HETATM 4521 O  O   . HOH AA 8 .   ? -44.036 -22.535 -28.151 1.00   57.39  ? 2113 HOH A O   1 
HETATM 4522 O  O   . HOH AA 8 .   ? -43.565 -28.506 -19.978 1.00   71.94  ? 2114 HOH A O   1 
HETATM 4523 O  O   . HOH AA 8 .   ? -37.558 -28.461 -11.222 1.00   39.86  ? 2115 HOH A O   1 
HETATM 4524 O  O   . HOH AA 8 .   ? -25.281 -11.555 -12.928 1.00   41.83  ? 2116 HOH A O   1 
HETATM 4525 O  O   . HOH AA 8 .   ? -28.510 -9.006  -18.608 1.00   41.04  ? 2117 HOH A O   1 
HETATM 4526 O  O   . HOH AA 8 .   ? -20.506 -7.376  -29.201 1.00   40.62  ? 2118 HOH A O   1 
HETATM 4527 O  O   . HOH AA 8 .   ? -17.773 -6.849  -19.482 1.00   41.98  ? 2119 HOH A O   1 
HETATM 4528 O  O   . HOH AA 8 .   ? -30.965 -10.047 -18.978 1.00   22.10  ? 2120 HOH A O   1 
HETATM 4529 O  O   . HOH AA 8 .   ? -31.165 -6.633  -11.472 1.00   33.13  ? 2121 HOH A O   1 
HETATM 4530 O  O   . HOH AA 8 .   ? -15.047 -9.842  -9.446  1.00   37.73  ? 2122 HOH A O   1 
HETATM 4531 O  O   . HOH AA 8 .   ? -12.141 -15.601 -7.241  1.00   15.87  ? 2123 HOH A O   1 
HETATM 4532 O  O   . HOH AA 8 .   ? -11.227 -13.231 -5.849  1.00   40.24  ? 2124 HOH A O   1 
HETATM 4533 O  O   . HOH AA 8 .   ? -12.981 -22.966 -6.590  1.00   21.77  ? 2125 HOH A O   1 
HETATM 4534 O  O   . HOH AA 8 .   ? -10.366 -24.175 -6.823  1.00   25.73  ? 2126 HOH A O   1 
HETATM 4535 O  O   . HOH AA 8 .   ? -15.367 -10.908 -6.035  1.00   36.05  ? 2127 HOH A O   1 
HETATM 4536 O  O   . HOH AA 8 .   ? -16.809 -25.022 -1.901  1.00   26.08  ? 2128 HOH A O   1 
HETATM 4537 O  O   . HOH AA 8 .   ? -17.674 -21.791 -0.237  1.00   18.72  ? 2129 HOH A O   1 
HETATM 4538 O  O   . HOH AA 8 .   ? -12.574 -19.105 1.863   1.00   24.01  ? 2130 HOH A O   1 
HETATM 4539 O  O   . HOH AA 8 .   ? -14.840 -22.736 1.117   1.00   38.39  ? 2131 HOH A O   1 
HETATM 4540 O  O   . HOH AA 8 .   ? -6.486  -23.083 -0.866  1.00   46.54  ? 2132 HOH A O   1 
HETATM 4541 O  O   . HOH AA 8 .   ? -10.298 -26.498 -5.666  1.00   31.40  ? 2133 HOH A O   1 
HETATM 4542 O  O   . HOH AA 8 .   ? -17.601 -33.888 -2.990  1.00   38.62  ? 2134 HOH A O   1 
HETATM 4543 O  O   . HOH AA 8 .   ? -12.748 -29.560 -0.011  1.00   51.67  ? 2135 HOH A O   1 
HETATM 4544 O  O   . HOH AA 8 .   ? -15.372 -36.661 -1.899  1.00   28.72  ? 2136 HOH A O   1 
HETATM 4545 O  O   . HOH AA 8 .   ? -3.448  -31.412 -6.205  1.00   104.90 ? 2137 HOH A O   1 
HETATM 4546 O  O   . HOH AA 8 .   ? -9.765  -25.144 1.306   1.00   34.39  ? 2138 HOH A O   1 
HETATM 4547 O  O   . HOH AA 8 .   ? -20.288 -63.777 -14.401 1.00   60.47  ? 2139 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 3   ? 1.2616 1.3497 1.0484 0.0459  -0.3249 0.0374  3   ASP A N   
2    C CA  . ASP A 3   ? 1.3017 1.3667 1.0682 0.0284  -0.3082 0.0285  3   ASP A CA  
3    C C   . ASP A 3   ? 1.3290 1.3490 1.0839 0.0320  -0.2970 0.0330  3   ASP A C   
4    O O   . ASP A 3   ? 1.3945 1.3879 1.1369 0.0458  -0.3036 0.0458  3   ASP A O   
5    C CB  . ASP A 3   ? 1.3381 1.3943 1.0660 0.0181  -0.3114 0.0296  3   ASP A CB  
6    C CG  . ASP A 3   ? 1.3486 1.4052 1.0701 -0.0014 -0.2962 0.0139  3   ASP A CG  
7    O OD1 . ASP A 3   ? 1.3507 1.4030 1.0906 -0.0069 -0.2817 0.0051  3   ASP A OD1 
8    O OD2 . ASP A 3   ? 1.3455 1.4060 1.0437 -0.0102 -0.2989 0.0099  3   ASP A OD2 
9    N N   . ILE A 4   ? 1.2161 1.2271 0.9750 0.0193  -0.2800 0.0224  4   ILE A N   
10   C CA  . ILE A 4   ? 1.0670 1.0408 0.8190 0.0208  -0.2687 0.0248  4   ILE A CA  
11   C C   . ILE A 4   ? 0.9182 0.8663 0.6429 0.0035  -0.2537 0.0203  4   ILE A C   
12   O O   . ILE A 4   ? 0.8336 0.7907 0.5725 -0.0075 -0.2406 0.0081  4   ILE A O   
13   C CB  . ILE A 4   ? 1.0309 1.0201 0.8217 0.0254  -0.2619 0.0169  4   ILE A CB  
14   C CG1 . ILE A 4   ? 0.9743 1.0132 0.7999 0.0252  -0.2673 0.0092  4   ILE A CG1 
15   C CG2 . ILE A 4   ? 1.0465 1.0139 0.8423 0.0439  -0.2662 0.0257  4   ILE A CG2 
16   C CD1 . ILE A 4   ? 0.9124 0.9715 0.7440 0.0061  -0.2572 -0.0042 4   ILE A CD1 
17   N N   . ILE A 5   ? 0.8865 0.8026 0.5726 0.0011  -0.2548 0.0303  5   ILE A N   
18   C CA  . ILE A 5   ? 0.8298 0.7241 0.4885 -0.0156 -0.2403 0.0266  5   ILE A CA  
19   C C   . ILE A 5   ? 0.8712 0.7242 0.5110 -0.0168 -0.2309 0.0339  5   ILE A C   
20   O O   . ILE A 5   ? 0.9503 0.7785 0.5743 -0.0071 -0.2387 0.0474  5   ILE A O   
21   C CB  . ILE A 5   ? 0.8175 0.7107 0.4431 -0.0225 -0.2460 0.0302  5   ILE A CB  
22   C CG1 . ILE A 5   ? 0.8409 0.7746 0.4833 -0.0258 -0.2520 0.0190  5   ILE A CG1 
23   C CG2 . ILE A 5   ? 0.7314 0.5989 0.3261 -0.0385 -0.2303 0.0280  5   ILE A CG2 
24   C CD1 . ILE A 5   ? 0.9115 0.8463 0.5217 -0.0323 -0.2581 0.0208  5   ILE A CD1 
25   N N   . ILE A 6   ? 0.7970 0.6429 0.4392 -0.0289 -0.2137 0.0248  6   ILE A N   
26   C CA  . ILE A 6   ? 0.7952 0.6055 0.4197 -0.0334 -0.2029 0.0299  6   ILE A CA  
27   C C   . ILE A 6   ? 0.8249 0.6215 0.4197 -0.0509 -0.1892 0.0276  6   ILE A C   
28   O O   . ILE A 6   ? 0.8972 0.7133 0.4993 -0.0601 -0.1808 0.0155  6   ILE A O   
29   C CB  . ILE A 6   ? 0.7743 0.5889 0.4282 -0.0325 -0.1931 0.0212  6   ILE A CB  
30   C CG1 . ILE A 6   ? 0.8370 0.6660 0.5212 -0.0149 -0.2053 0.0227  6   ILE A CG1 
31   C CG2 . ILE A 6   ? 0.6420 0.4222 0.2766 -0.0395 -0.1811 0.0251  6   ILE A CG2 
32   C CD1 . ILE A 6   ? 0.6261 0.4310 0.2963 -0.0005 -0.2176 0.0370  6   ILE A CD1 
33   N N   . ALA A 7   ? 0.8242 0.5872 0.3862 -0.0552 -0.1863 0.0390  7   ALA A N   
34   C CA  . ALA A 7   ? 0.8495 0.5996 0.3835 -0.0726 -0.1713 0.0371  7   ALA A CA  
35   C C   . ALA A 7   ? 0.8999 0.6399 0.4413 -0.0816 -0.1531 0.0306  7   ALA A C   
36   O O   . ALA A 7   ? 0.6999 0.4163 0.2381 -0.0789 -0.1521 0.0377  7   ALA A O   
37   C CB  . ALA A 7   ? 0.8177 0.5386 0.3118 -0.0752 -0.1760 0.0526  7   ALA A CB  
38   N N   . THR A 8   ? 0.8517 0.6099 0.4039 -0.0916 -0.1389 0.0167  8   THR A N   
39   C CA  . THR A 8   ? 0.8360 0.5896 0.3968 -0.1004 -0.1206 0.0095  8   THR A CA  
40   C C   . THR A 8   ? 0.9248 0.6694 0.4579 -0.1162 -0.1059 0.0085  8   THR A C   
41   O O   . THR A 8   ? 1.0250 0.7712 0.5361 -0.1201 -0.1095 0.0107  8   THR A O   
42   C CB  . THR A 8   ? 0.7485 0.5313 0.3472 -0.0983 -0.1136 -0.0062 8   THR A CB  
43   O OG1 . THR A 8   ? 0.7394 0.5384 0.3350 -0.1052 -0.1069 -0.0160 8   THR A OG1 
44   C CG2 . THR A 8   ? 0.6745 0.4742 0.3013 -0.0843 -0.1284 -0.0069 8   THR A CG2 
45   N N   . LYS A 9   ? 0.8586 0.5968 0.3942 -0.1256 -0.0890 0.0044  9   LYS A N   
46   C CA  . LYS A 9   ? 0.9575 0.6904 0.4705 -0.1416 -0.0726 0.0023  9   LYS A CA  
47   C C   . LYS A 9   ? 1.0112 0.7661 0.5234 -0.1453 -0.0679 -0.0087 9   LYS A C   
48   O O   . LYS A 9   ? 0.9871 0.7358 0.4704 -0.1556 -0.0624 -0.0065 9   LYS A O   
49   C CB  . LYS A 9   ? 0.9764 0.7102 0.5037 -0.1496 -0.0546 -0.0045 9   LYS A CB  
50   C CG  . LYS A 9   ? 1.0136 0.7255 0.5420 -0.1474 -0.0574 0.0040  9   LYS A CG  
51   C CD  . LYS A 9   ? 1.0295 0.7083 0.5209 -0.1577 -0.0562 0.0182  9   LYS A CD  
52   C CE  . LYS A 9   ? 1.0120 0.6688 0.4848 -0.1466 -0.0768 0.0334  9   LYS A CE  
53   N NZ  . LYS A 9   ? 0.9653 0.6203 0.4607 -0.1297 -0.0904 0.0351  9   LYS A NZ  
54   N N   . ASN A 10  ? 1.0099 0.7891 0.5530 -0.1369 -0.0700 -0.0207 10  ASN A N   
55   C CA  . ASN A 10  ? 1.0320 0.8300 0.5766 -0.1392 -0.0657 -0.0329 10  ASN A CA  
56   C C   . ASN A 10  ? 1.0580 0.8621 0.5924 -0.1337 -0.0828 -0.0303 10  ASN A C   
57   O O   . ASN A 10  ? 1.0996 0.9156 0.6282 -0.1367 -0.0810 -0.0394 10  ASN A O   
58   C CB  . ASN A 10  ? 1.0792 0.8984 0.6624 -0.1340 -0.0573 -0.0481 10  ASN A CB  
59   C CG  . ASN A 10  ? 1.1403 0.9586 0.7363 -0.1388 -0.0404 -0.0521 10  ASN A CG  
60   O OD1 . ASN A 10  ? 1.1719 0.9945 0.7611 -0.1472 -0.0256 -0.0594 10  ASN A OD1 
61   N ND2 . ASN A 10  ? 1.1459 0.9605 0.7611 -0.1333 -0.0426 -0.0478 10  ASN A ND2 
62   N N   . GLY A 11  ? 1.0206 0.8173 0.5534 -0.1251 -0.0997 -0.0184 11  GLY A N   
63   C CA  . GLY A 11  ? 0.9381 0.7427 0.4615 -0.1195 -0.1169 -0.0149 11  GLY A CA  
64   C C   . GLY A 11  ? 0.8521 0.6641 0.3967 -0.1056 -0.1344 -0.0093 11  GLY A C   
65   O O   . GLY A 11  ? 0.7856 0.5960 0.3536 -0.0996 -0.1334 -0.0087 11  GLY A O   
66   N N   . LYS A 12  ? 0.8457 0.6676 0.3824 -0.1004 -0.1505 -0.0056 12  LYS A N   
67   C CA  . LYS A 12  ? 0.8619 0.6968 0.4199 -0.0868 -0.1679 -0.0011 12  LYS A CA  
68   C C   . LYS A 12  ? 0.8596 0.7221 0.4584 -0.0832 -0.1662 -0.0152 12  LYS A C   
69   O O   . LYS A 12  ? 0.8944 0.7704 0.5001 -0.0898 -0.1582 -0.0286 12  LYS A O   
70   C CB  . LYS A 12  ? 0.9227 0.7650 0.4615 -0.0829 -0.1850 0.0057  12  LYS A CB  
71   C CG  . LYS A 12  ? 1.0537 0.8688 0.5576 -0.0809 -0.1927 0.0240  12  LYS A CG  
72   C CD  . LYS A 12  ? 1.1793 1.0066 0.6694 -0.0745 -0.2117 0.0307  12  LYS A CD  
73   C CE  . LYS A 12  ? 1.2762 1.0783 0.7422 -0.0661 -0.2239 0.0510  12  LYS A CE  
74   N NZ  . LYS A 12  ? 1.3255 1.0947 0.7504 -0.0780 -0.2140 0.0600  12  LYS A NZ  
75   N N   . VAL A 13  ? 0.7660 0.6355 0.3916 -0.0728 -0.1732 -0.0122 13  VAL A N   
76   C CA  . VAL A 13  ? 0.7013 0.5983 0.3652 -0.0696 -0.1730 -0.0238 13  VAL A CA  
77   C C   . VAL A 13  ? 0.6787 0.5943 0.3620 -0.0573 -0.1901 -0.0184 13  VAL A C   
78   O O   . VAL A 13  ? 0.6608 0.5634 0.3407 -0.0477 -0.1981 -0.0065 13  VAL A O   
79   C CB  . VAL A 13  ? 0.6508 0.5442 0.3382 -0.0713 -0.1577 -0.0304 13  VAL A CB  
80   C CG1 . VAL A 13  ? 0.6432 0.5204 0.3136 -0.0818 -0.1406 -0.0348 13  VAL A CG1 
81   C CG2 . VAL A 13  ? 0.6038 0.4853 0.3001 -0.0625 -0.1614 -0.0212 13  VAL A CG2 
82   N N   . ARG A 14  ? 0.6906 0.6366 0.3947 -0.0574 -0.1954 -0.0275 14  ARG A N   
83   C CA  . ARG A 14  ? 0.6950 0.6660 0.4223 -0.0469 -0.2100 -0.0243 14  ARG A CA  
84   C C   . ARG A 14  ? 0.7253 0.7160 0.4916 -0.0460 -0.2036 -0.0329 14  ARG A C   
85   O O   . ARG A 14  ? 0.7420 0.7386 0.5203 -0.0548 -0.1918 -0.0449 14  ARG A O   
86   C CB  . ARG A 14  ? 0.6800 0.6753 0.4021 -0.0481 -0.2225 -0.0274 14  ARG A CB  
87   C CG  . ARG A 14  ? 0.7308 0.7636 0.4858 -0.0421 -0.2330 -0.0308 14  ARG A CG  
88   C CD  . ARG A 14  ? 0.8475 0.9053 0.5963 -0.0454 -0.2443 -0.0364 14  ARG A CD  
89   N NE  . ARG A 14  ? 0.9521 0.9990 0.6686 -0.0405 -0.2569 -0.0243 14  ARG A NE  
90   C CZ  . ARG A 14  ? 0.9890 1.0262 0.6742 -0.0480 -0.2576 -0.0268 14  ARG A CZ  
91   N NH1 . ARG A 14  ? 0.9438 0.9802 0.6269 -0.0599 -0.2468 -0.0418 14  ARG A NH1 
92   N NH2 . ARG A 14  ? 1.0514 1.0787 0.7071 -0.0430 -0.2694 -0.0139 14  ARG A NH2 
93   N N   . GLY A 15  ? 0.6933 0.6931 0.4794 -0.0348 -0.2114 -0.0265 15  GLY A N   
94   C CA  . GLY A 15  ? 0.6441 0.6644 0.4663 -0.0342 -0.2058 -0.0333 15  GLY A CA  
95   C C   . GLY A 15  ? 0.6009 0.6599 0.4472 -0.0306 -0.2172 -0.0350 15  GLY A C   
96   O O   . GLY A 15  ? 0.6762 0.7520 0.5146 -0.0329 -0.2266 -0.0364 15  GLY A O   
97   N N   . MET A 16  ? 0.5003 0.5751 0.3764 -0.0253 -0.2162 -0.0351 16  MET A N   
98   C CA  . MET A 16  ? 0.4830 0.5974 0.3855 -0.0234 -0.2251 -0.0362 16  MET A CA  
99   C C   . MET A 16  ? 0.5209 0.6413 0.4486 -0.0105 -0.2272 -0.0309 16  MET A C   
100  O O   . MET A 16  ? 0.5223 0.6217 0.4527 -0.0075 -0.2175 -0.0314 16  MET A O   
101  C CB  . MET A 16  ? 0.4919 0.6302 0.4101 -0.0393 -0.2161 -0.0492 16  MET A CB  
102  C CG  . MET A 16  ? 0.5184 0.6472 0.4506 -0.0457 -0.1990 -0.0554 16  MET A CG  
103  S SD  . MET A 16  ? 0.7289 0.8761 0.6760 -0.0613 -0.1879 -0.0713 16  MET A SD  
104  C CE  . MET A 16  ? 0.6054 0.7403 0.5689 -0.0643 -0.1707 -0.0720 16  MET A CE  
105  N N   . GLN A 17  ? 0.6093 0.7589 0.5562 -0.0021 -0.2397 -0.0266 17  GLN A N   
106  C CA  . GLN A 17  ? 0.5942 0.7520 0.5676 0.0132  -0.2419 -0.0235 17  GLN A CA  
107  C C   . GLN A 17  ? 0.4644 0.6513 0.4701 0.0035  -0.2338 -0.0304 17  GLN A C   
108  O O   . GLN A 17  ? 0.4738 0.6867 0.4883 -0.0110 -0.2358 -0.0330 17  GLN A O   
109  C CB  . GLN A 17  ? 0.7209 0.8924 0.7000 0.0310  -0.2594 -0.0147 17  GLN A CB  
110  C CG  . GLN A 17  ? 0.8983 1.0377 0.8427 0.0409  -0.2686 -0.0049 17  GLN A CG  
111  C CD  . GLN A 17  ? 1.0363 1.1324 0.9655 0.0519  -0.2630 -0.0010 17  GLN A CD  
112  O OE1 . GLN A 17  ? 1.0864 1.1741 1.0267 0.0496  -0.2508 -0.0071 17  GLN A OE1 
113  N NE2 . GLN A 17  ? 1.0925 1.1598 0.9947 0.0628  -0.2723 0.0099  17  GLN A NE2 
114  N N   . LEU A 18  ? 0.4142 0.5941 0.4355 0.0103  -0.2248 -0.0328 18  LEU A N   
115  C CA  . LEU A 18  ? 0.4146 0.6175 0.4644 0.0017  -0.2159 -0.0383 18  LEU A CA  
116  C C   . LEU A 18  ? 0.4301 0.6499 0.5071 0.0211  -0.2195 -0.0379 18  LEU A C   
117  O O   . LEU A 18  ? 0.5544 0.7540 0.6254 0.0386  -0.2207 -0.0359 18  LEU A O   
118  C CB  . LEU A 18  ? 0.4463 0.6267 0.4897 -0.0081 -0.1992 -0.0433 18  LEU A CB  
119  C CG  . LEU A 18  ? 0.4244 0.5819 0.4406 -0.0237 -0.1912 -0.0460 18  LEU A CG  
120  C CD1 . LEU A 18  ? 0.3274 0.4659 0.3433 -0.0299 -0.1752 -0.0500 18  LEU A CD1 
121  C CD2 . LEU A 18  ? 0.3942 0.5718 0.4099 -0.0418 -0.1927 -0.0487 18  LEU A CD2 
122  N N   . THR A 19  ? 0.4424 0.6976 0.5489 0.0184  -0.2210 -0.0402 19  THR A N   
123  C CA  . THR A 19  ? 0.4828 0.7570 0.6172 0.0369  -0.2207 -0.0426 19  THR A CA  
124  C C   . THR A 19  ? 0.4611 0.7376 0.6103 0.0304  -0.2043 -0.0496 19  THR A C   
125  O O   . THR A 19  ? 0.3618 0.6513 0.5204 0.0120  -0.1976 -0.0523 19  THR A O   
126  C CB  . THR A 19  ? 0.4940 0.8082 0.6548 0.0417  -0.2318 -0.0418 19  THR A CB  
127  O OG1 . THR A 19  ? 0.6157 0.9507 0.7898 0.0200  -0.2283 -0.0452 19  THR A OG1 
128  C CG2 . THR A 19  ? 0.4875 0.7988 0.6318 0.0483  -0.2490 -0.0338 19  THR A CG2 
129  N N   . VAL A 20  ? 0.4760 0.7358 0.6243 0.0454  -0.1985 -0.0519 20  VAL A N   
130  C CA  . VAL A 20  ? 0.4544 0.7159 0.6149 0.0419  -0.1835 -0.0585 20  VAL A CA  
131  C C   . VAL A 20  ? 0.4397 0.7171 0.6224 0.0639  -0.1829 -0.0630 20  VAL A C   
132  O O   . VAL A 20  ? 0.5015 0.7603 0.6755 0.0835  -0.1902 -0.0606 20  VAL A O   
133  C CB  . VAL A 20  ? 0.4459 0.6676 0.5816 0.0384  -0.1760 -0.0585 20  VAL A CB  
134  C CG1 . VAL A 20  ? 0.3845 0.6099 0.5320 0.0322  -0.1609 -0.0647 20  VAL A CG1 
135  C CG2 . VAL A 20  ? 0.4171 0.6180 0.5267 0.0207  -0.1768 -0.0544 20  VAL A CG2 
136  N N   . PHE A 21  ? 0.3880 0.6970 0.5973 0.0605  -0.1737 -0.0693 21  PHE A N   
137  C CA  . PHE A 21  ? 0.3605 0.6857 0.5909 0.0797  -0.1690 -0.0760 21  PHE A CA  
138  C C   . PHE A 21  ? 0.3937 0.7211 0.6287 0.1037  -0.1824 -0.0732 21  PHE A C   
139  O O   . PHE A 21  ? 0.4724 0.7765 0.6999 0.1225  -0.1834 -0.0739 21  PHE A O   
140  C CB  . PHE A 21  ? 0.3409 0.6382 0.5600 0.0853  -0.1593 -0.0801 21  PHE A CB  
141  C CG  . PHE A 21  ? 0.2951 0.5861 0.5078 0.0636  -0.1462 -0.0821 21  PHE A CG  
142  C CD1 . PHE A 21  ? 0.2920 0.6088 0.5174 0.0447  -0.1391 -0.0830 21  PHE A CD1 
143  C CD2 . PHE A 21  ? 0.3997 0.6566 0.5927 0.0623  -0.1415 -0.0826 21  PHE A CD2 
144  C CE1 . PHE A 21  ? 0.3391 0.6452 0.5559 0.0256  -0.1275 -0.0830 21  PHE A CE1 
145  C CE2 . PHE A 21  ? 0.4566 0.7066 0.6432 0.0431  -0.1298 -0.0834 21  PHE A CE2 
146  C CZ  . PHE A 21  ? 0.4242 0.6977 0.6218 0.0251  -0.1227 -0.0831 21  PHE A CZ  
147  N N   . GLY A 22  ? 0.4334 0.7853 0.6786 0.1026  -0.1934 -0.0692 22  GLY A N   
148  C CA  . GLY A 22  ? 0.3741 0.7297 0.6241 0.1248  -0.2075 -0.0651 22  GLY A CA  
149  C C   . GLY A 22  ? 0.3980 0.7083 0.6162 0.1365  -0.2173 -0.0569 22  GLY A C   
150  O O   . GLY A 22  ? 0.5531 0.8558 0.7715 0.1584  -0.2268 -0.0533 22  GLY A O   
151  N N   . GLY A 23  ? 0.3712 0.6498 0.5611 0.1217  -0.2147 -0.0536 23  GLY A N   
152  C CA  . GLY A 23  ? 0.4251 0.6586 0.5817 0.1294  -0.2227 -0.0456 23  GLY A CA  
153  C C   . GLY A 23  ? 0.5257 0.7472 0.6572 0.1101  -0.2278 -0.0392 23  GLY A C   
154  O O   . GLY A 23  ? 0.5975 0.8477 0.7389 0.0949  -0.2293 -0.0398 23  GLY A O   
155  N N   . THR A 24  ? 0.5417 0.7199 0.6396 0.1098  -0.2298 -0.0336 24  THR A N   
156  C CA  . THR A 24  ? 0.5278 0.6925 0.5989 0.0921  -0.2330 -0.0287 24  THR A CA  
157  C C   . THR A 24  ? 0.5912 0.7154 0.6354 0.0831  -0.2242 -0.0290 24  THR A C   
158  O O   . THR A 24  ? 0.7244 0.8174 0.7573 0.0953  -0.2235 -0.0272 24  THR A O   
159  C CB  . THR A 24  ? 0.5833 0.7395 0.6357 0.1009  -0.2492 -0.0183 24  THR A CB  
160  O OG1 . THR A 24  ? 0.6259 0.8235 0.7050 0.1073  -0.2582 -0.0181 24  THR A OG1 
161  C CG2 . THR A 24  ? 0.4264 0.5682 0.4484 0.0824  -0.2509 -0.0146 24  THR A CG2 
162  N N   . VAL A 25  ? 0.5332 0.6576 0.5676 0.0614  -0.2172 -0.0315 25  VAL A N   
163  C CA  . VAL A 25  ? 0.5337 0.6217 0.5415 0.0510  -0.2092 -0.0315 25  VAL A CA  
164  C C   . VAL A 25  ? 0.5676 0.6472 0.5496 0.0368  -0.2119 -0.0282 25  VAL A C   
165  O O   . VAL A 25  ? 0.5454 0.6527 0.5360 0.0263  -0.2135 -0.0304 25  VAL A O   
166  C CB  . VAL A 25  ? 0.4271 0.5215 0.4491 0.0383  -0.1936 -0.0398 25  VAL A CB  
167  C CG1 . VAL A 25  ? 0.3913 0.4555 0.3877 0.0234  -0.1847 -0.0400 25  VAL A CG1 
168  C CG2 . VAL A 25  ? 0.3685 0.4631 0.4086 0.0522  -0.1896 -0.0438 25  VAL A CG2 
169  N N   . THR A 26  ? 0.5726 0.6140 0.5221 0.0356  -0.2120 -0.0231 26  THR A N   
170  C CA  . THR A 26  ? 0.5689 0.6010 0.4921 0.0218  -0.2120 -0.0215 26  THR A CA  
171  C C   . THR A 26  ? 0.5074 0.5297 0.4245 0.0042  -0.1961 -0.0286 26  THR A C   
172  O O   . THR A 26  ? 0.3711 0.3678 0.2798 0.0034  -0.1878 -0.0288 26  THR A O   
173  C CB  . THR A 26  ? 0.5796 0.5769 0.4680 0.0287  -0.2203 -0.0110 26  THR A CB  
174  O OG1 . THR A 26  ? 0.6170 0.6197 0.5124 0.0477  -0.2340 -0.0038 26  THR A OG1 
175  C CG2 . THR A 26  ? 0.5944 0.5896 0.4577 0.0160  -0.2217 -0.0098 26  THR A CG2 
176  N N   . ALA A 27  ? 0.4854 0.5281 0.4072 -0.0096 -0.1916 -0.0347 27  ALA A N   
177  C CA  . ALA A 27  ? 0.4575 0.4920 0.3761 -0.0242 -0.1758 -0.0421 27  ALA A CA  
178  C C   . ALA A 27  ? 0.4111 0.4306 0.3019 -0.0327 -0.1741 -0.0432 27  ALA A C   
179  O O   . ALA A 27  ? 0.4305 0.4631 0.3137 -0.0347 -0.1827 -0.0435 27  ALA A O   
180  C CB  . ALA A 27  ? 0.3308 0.3948 0.2750 -0.0335 -0.1690 -0.0497 27  ALA A CB  
181  N N   . PHE A 28  ? 0.4157 0.4089 0.2915 -0.0373 -0.1629 -0.0439 28  PHE A N   
182  C CA  . PHE A 28  ? 0.5144 0.4952 0.3676 -0.0462 -0.1574 -0.0471 28  PHE A CA  
183  C C   . PHE A 28  ? 0.4981 0.4829 0.3658 -0.0546 -0.1416 -0.0573 28  PHE A C   
184  O O   . PHE A 28  ? 0.4851 0.4546 0.3534 -0.0554 -0.1302 -0.0576 28  PHE A O   
185  C CB  . PHE A 28  ? 0.5402 0.4884 0.3637 -0.0451 -0.1563 -0.0395 28  PHE A CB  
186  C CG  . PHE A 28  ? 0.5896 0.5282 0.3937 -0.0363 -0.1722 -0.0283 28  PHE A CG  
187  C CD1 . PHE A 28  ? 0.5574 0.4892 0.3685 -0.0237 -0.1803 -0.0210 28  PHE A CD1 
188  C CD2 . PHE A 28  ? 0.6232 0.5592 0.4023 -0.0393 -0.1792 -0.0251 28  PHE A CD2 
189  C CE1 . PHE A 28  ? 0.5852 0.5065 0.3799 -0.0130 -0.1950 -0.0101 28  PHE A CE1 
190  C CE2 . PHE A 28  ? 0.6805 0.6072 0.4418 -0.0302 -0.1939 -0.0134 28  PHE A CE2 
191  C CZ  . PHE A 28  ? 0.6409 0.5595 0.4106 -0.0164 -0.2017 -0.0055 28  PHE A CZ  
192  N N   . LEU A 29  ? 0.3768 0.3822 0.2572 -0.0598 -0.1415 -0.0656 29  LEU A N   
193  C CA  . LEU A 29  ? 0.3389 0.3465 0.2347 -0.0654 -0.1285 -0.0751 29  LEU A CA  
194  C C   . LEU A 29  ? 0.4190 0.4132 0.2985 -0.0702 -0.1234 -0.0816 29  LEU A C   
195  O O   . LEU A 29  ? 0.4467 0.4440 0.3118 -0.0728 -0.1312 -0.0842 29  LEU A O   
196  C CB  . LEU A 29  ? 0.3286 0.3620 0.2477 -0.0683 -0.1312 -0.0814 29  LEU A CB  
197  C CG  . LEU A 29  ? 0.4430 0.4964 0.3808 -0.0651 -0.1358 -0.0763 29  LEU A CG  
198  C CD1 . LEU A 29  ? 0.3061 0.3828 0.2659 -0.0707 -0.1344 -0.0837 29  LEU A CD1 
199  C CD2 . LEU A 29  ? 0.3228 0.3639 0.2667 -0.0609 -0.1280 -0.0704 29  LEU A CD2 
200  N N   . GLY A 30  ? 0.3870 0.3675 0.2692 -0.0708 -0.1107 -0.0844 30  GLY A N   
201  C CA  . GLY A 30  ? 0.4754 0.4445 0.3459 -0.0743 -0.1050 -0.0914 30  GLY A CA  
202  C C   . GLY A 30  ? 0.5351 0.4894 0.3747 -0.0763 -0.1058 -0.0877 30  GLY A C   
203  O O   . GLY A 30  ? 0.5471 0.5004 0.3692 -0.0802 -0.1102 -0.0916 30  GLY A O   
204  N N   . ILE A 31  ? 0.5077 0.4495 0.3388 -0.0745 -0.1013 -0.0802 31  ILE A N   
205  C CA  . ILE A 31  ? 0.5702 0.4954 0.3710 -0.0783 -0.0992 -0.0765 31  ILE A CA  
206  C C   . ILE A 31  ? 0.6069 0.5248 0.4094 -0.0806 -0.0850 -0.0833 31  ILE A C   
207  O O   . ILE A 31  ? 0.6151 0.5338 0.4376 -0.0771 -0.0772 -0.0841 31  ILE A O   
208  C CB  . ILE A 31  ? 0.6195 0.5312 0.4083 -0.0760 -0.1018 -0.0647 31  ILE A CB  
209  C CG1 . ILE A 31  ? 0.6000 0.5186 0.3902 -0.0705 -0.1174 -0.0573 31  ILE A CG1 
210  C CG2 . ILE A 31  ? 0.6283 0.5205 0.3830 -0.0822 -0.0981 -0.0603 31  ILE A CG2 
211  C CD1 . ILE A 31  ? 0.5867 0.4873 0.3651 -0.0661 -0.1220 -0.0460 31  ILE A CD1 
212  N N   . PRO A 32  ? 0.6277 0.5394 0.4090 -0.0859 -0.0817 -0.0883 32  PRO A N   
213  C CA  . PRO A 32  ? 0.6130 0.5193 0.3958 -0.0874 -0.0684 -0.0955 32  PRO A CA  
214  C C   . PRO A 32  ? 0.6059 0.5022 0.3799 -0.0895 -0.0595 -0.0893 32  PRO A C   
215  O O   . PRO A 32  ? 0.6160 0.5030 0.3682 -0.0931 -0.0632 -0.0801 32  PRO A O   
216  C CB  . PRO A 32  ? 0.6433 0.5462 0.4014 -0.0934 -0.0683 -0.1021 32  PRO A CB  
217  C CG  . PRO A 32  ? 0.5909 0.4920 0.3247 -0.0966 -0.0797 -0.0934 32  PRO A CG  
218  C CD  . PRO A 32  ? 0.5834 0.4935 0.3371 -0.0906 -0.0903 -0.0872 32  PRO A CD  
219  N N   . TYR A 33  ? 0.5315 0.4287 0.3214 -0.0874 -0.0487 -0.0938 33  TYR A N   
220  C CA  . TYR A 33  ? 0.5166 0.4066 0.2990 -0.0910 -0.0395 -0.0890 33  TYR A CA  
221  C C   . TYR A 33  ? 0.5797 0.4701 0.3593 -0.0946 -0.0258 -0.0974 33  TYR A C   
222  O O   . TYR A 33  ? 0.5287 0.4166 0.3050 -0.0989 -0.0163 -0.0953 33  TYR A O   
223  C CB  . TYR A 33  ? 0.5305 0.4231 0.3359 -0.0851 -0.0405 -0.0833 33  TYR A CB  
224  C CG  . TYR A 33  ? 0.5213 0.4239 0.3582 -0.0775 -0.0369 -0.0892 33  TYR A CG  
225  C CD1 . TYR A 33  ? 0.5411 0.4444 0.3851 -0.0776 -0.0264 -0.0927 33  TYR A CD1 
226  C CD2 . TYR A 33  ? 0.3963 0.3072 0.2543 -0.0710 -0.0442 -0.0909 33  TYR A CD2 
227  C CE1 . TYR A 33  ? 0.5074 0.4167 0.3764 -0.0701 -0.0255 -0.0965 33  TYR A CE1 
228  C CE2 . TYR A 33  ? 0.3791 0.2949 0.2614 -0.0647 -0.0422 -0.0945 33  TYR A CE2 
229  C CZ  . TYR A 33  ? 0.4445 0.3578 0.3310 -0.0636 -0.0340 -0.0966 33  TYR A CZ  
230  O OH  . TYR A 33  ? 0.4278 0.3421 0.3340 -0.0572 -0.0344 -0.0983 33  TYR A OH  
231  N N   . ALA A 34  ? 0.5890 0.4828 0.3696 -0.0933 -0.0248 -0.1075 34  ALA A N   
232  C CA  . ALA A 34  ? 0.4898 0.3846 0.2660 -0.0962 -0.0120 -0.1173 34  ALA A CA  
233  C C   . ALA A 34  ? 0.4761 0.3700 0.2419 -0.0966 -0.0136 -0.1273 34  ALA A C   
234  O O   . ALA A 34  ? 0.5416 0.4356 0.3118 -0.0933 -0.0248 -0.1279 34  ALA A O   
235  C CB  . ALA A 34  ? 0.4083 0.3084 0.2122 -0.0890 -0.0066 -0.1210 34  ALA A CB  
236  N N   . GLN A 35  ? 0.5465 0.4405 0.2986 -0.1014 -0.0021 -0.1362 35  GLN A N   
237  C CA  . GLN A 35  ? 0.6863 0.5784 0.4311 -0.1005 -0.0024 -0.1481 35  GLN A CA  
238  C C   . GLN A 35  ? 0.7135 0.6043 0.4852 -0.0903 -0.0071 -0.1533 35  GLN A C   
239  O O   . GLN A 35  ? 0.7701 0.6630 0.5619 -0.0849 -0.0021 -0.1532 35  GLN A O   
240  C CB  . GLN A 35  ? 0.7738 0.6684 0.5055 -0.1054 0.0131  -0.1586 35  GLN A CB  
241  C CG  . GLN A 35  ? 0.9334 0.8291 0.6384 -0.1172 0.0212  -0.1536 35  GLN A CG  
242  C CD  . GLN A 35  ? 1.0866 0.9891 0.7842 -0.1217 0.0383  -0.1655 35  GLN A CD  
243  O OE1 . GLN A 35  ? 1.0737 0.9767 0.7746 -0.1169 0.0414  -0.1788 35  GLN A OE1 
244  N NE2 . GLN A 35  ? 1.1442 1.0516 0.8322 -0.1313 0.0498  -0.1615 35  GLN A NE2 
245  N N   . PRO A 36  ? 0.6294 0.5158 0.4006 -0.0885 -0.0172 -0.1576 36  PRO A N   
246  C CA  . PRO A 36  ? 0.5746 0.4556 0.3676 -0.0806 -0.0220 -0.1622 36  PRO A CA  
247  C C   . PRO A 36  ? 0.5289 0.4052 0.3267 -0.0762 -0.0108 -0.1724 36  PRO A C   
248  O O   . PRO A 36  ? 0.5799 0.4553 0.3610 -0.0793 -0.0020 -0.1826 36  PRO A O   
249  C CB  . PRO A 36  ? 0.6527 0.5293 0.4360 -0.0833 -0.0316 -0.1681 36  PRO A CB  
250  C CG  . PRO A 36  ? 0.5100 0.3931 0.2738 -0.0905 -0.0362 -0.1617 36  PRO A CG  
251  C CD  . PRO A 36  ? 0.5161 0.4016 0.2649 -0.0947 -0.0247 -0.1585 36  PRO A CD  
252  N N   . PRO A 37  ? 0.4645 0.3385 0.2844 -0.0688 -0.0108 -0.1700 37  PRO A N   
253  C CA  . PRO A 37  ? 0.4716 0.3431 0.2977 -0.0638 0.0004  -0.1791 37  PRO A CA  
254  C C   . PRO A 37  ? 0.4968 0.3530 0.3197 -0.0595 -0.0016 -0.1909 37  PRO A C   
255  O O   . PRO A 37  ? 0.5859 0.4318 0.4223 -0.0525 -0.0035 -0.1919 37  PRO A O   
256  C CB  . PRO A 37  ? 0.5181 0.3919 0.3669 -0.0581 -0.0012 -0.1702 37  PRO A CB  
257  C CG  . PRO A 37  ? 0.5494 0.4194 0.4051 -0.0579 -0.0162 -0.1596 37  PRO A CG  
258  C CD  . PRO A 37  ? 0.5422 0.4171 0.3819 -0.0650 -0.0206 -0.1586 37  PRO A CD  
259  N N   . LEU A 38  ? 0.5264 0.3796 0.3293 -0.0643 -0.0011 -0.1998 38  LEU A N   
260  C CA  . LEU A 38  ? 0.5559 0.3929 0.3521 -0.0616 -0.0037 -0.2122 38  LEU A CA  
261  C C   . LEU A 38  ? 0.6654 0.5023 0.4511 -0.0595 0.0109  -0.2272 38  LEU A C   
262  O O   . LEU A 38  ? 0.6242 0.4764 0.4039 -0.0632 0.0226  -0.2282 38  LEU A O   
263  C CB  . LEU A 38  ? 0.6190 0.4540 0.3995 -0.0689 -0.0136 -0.2135 38  LEU A CB  
264  C CG  . LEU A 38  ? 0.6530 0.4943 0.4414 -0.0726 -0.0271 -0.2009 38  LEU A CG  
265  C CD1 . LEU A 38  ? 0.6807 0.5245 0.4492 -0.0808 -0.0332 -0.2049 38  LEU A CD1 
266  C CD2 . LEU A 38  ? 0.6442 0.4751 0.4527 -0.0680 -0.0368 -0.1978 38  LEU A CD2 
267  N N   . GLY A 39  ? 0.6120 0.4313 0.3949 -0.0541 0.0106  -0.2394 39  GLY A N   
268  C CA  . GLY A 39  ? 0.6450 0.4631 0.4177 -0.0509 0.0241  -0.2560 39  GLY A CA  
269  C C   . GLY A 39  ? 0.7019 0.5333 0.4911 -0.0442 0.0384  -0.2583 39  GLY A C   
270  O O   . GLY A 39  ? 0.7514 0.5782 0.5609 -0.0362 0.0368  -0.2541 39  GLY A O   
271  N N   . ARG A 40  ? 0.6924 0.5419 0.4732 -0.0483 0.0524  -0.2649 40  ARG A N   
272  C CA  . ARG A 40  ? 0.7345 0.6033 0.5334 -0.0439 0.0670  -0.2680 40  ARG A CA  
273  C C   . ARG A 40  ? 0.7292 0.6122 0.5450 -0.0470 0.0644  -0.2520 40  ARG A C   
274  O O   . ARG A 40  ? 0.7681 0.6691 0.6019 -0.0443 0.0749  -0.2536 40  ARG A O   
275  C CB  . ARG A 40  ? 0.7607 0.6469 0.5452 -0.0498 0.0831  -0.2791 40  ARG A CB  
276  C CG  . ARG A 40  ? 0.8795 0.7744 0.6407 -0.0651 0.0822  -0.2703 40  ARG A CG  
277  C CD  . ARG A 40  ? 1.0613 0.9562 0.7948 -0.0709 0.0900  -0.2831 40  ARG A CD  
278  N NE  . ARG A 40  ? 1.2232 1.0958 0.9424 -0.0684 0.0787  -0.2893 40  ARG A NE  
279  C CZ  . ARG A 40  ? 1.3018 1.1676 0.9978 -0.0776 0.0685  -0.2845 40  ARG A CZ  
280  N NH1 . ARG A 40  ? 1.3656 1.2431 1.0482 -0.0891 0.0682  -0.2727 40  ARG A NH1 
281  N NH2 . ARG A 40  ? 1.2743 1.1214 0.9603 -0.0756 0.0583  -0.2918 40  ARG A NH2 
282  N N   . LEU A 41  ? 0.6514 0.5275 0.4626 -0.0524 0.0505  -0.2375 41  LEU A N   
283  C CA  . LEU A 41  ? 0.5841 0.4712 0.4091 -0.0552 0.0476  -0.2227 41  LEU A CA  
284  C C   . LEU A 41  ? 0.6068 0.4850 0.4538 -0.0467 0.0383  -0.2151 41  LEU A C   
285  O O   . LEU A 41  ? 0.5087 0.3970 0.3701 -0.0473 0.0375  -0.2048 41  LEU A O   
286  C CB  . LEU A 41  ? 0.5866 0.4750 0.3946 -0.0658 0.0396  -0.2108 41  LEU A CB  
287  C CG  . LEU A 41  ? 0.6135 0.5140 0.4002 -0.0767 0.0503  -0.2131 41  LEU A CG  
288  C CD1 . LEU A 41  ? 0.5568 0.4562 0.3283 -0.0856 0.0409  -0.1992 41  LEU A CD1 
289  C CD2 . LEU A 41  ? 0.5380 0.4571 0.3367 -0.0783 0.0659  -0.2161 41  LEU A CD2 
290  N N   . ARG A 42  ? 0.5223 0.3806 0.3703 -0.0397 0.0317  -0.2200 42  ARG A N   
291  C CA  . ARG A 42  ? 0.5236 0.3707 0.3891 -0.0326 0.0241  -0.2129 42  ARG A CA  
292  C C   . ARG A 42  ? 0.5078 0.3692 0.3966 -0.0252 0.0339  -0.2152 42  ARG A C   
293  O O   . ARG A 42  ? 0.5053 0.3771 0.3991 -0.0205 0.0465  -0.2284 42  ARG A O   
294  C CB  . ARG A 42  ? 0.6079 0.4279 0.4667 -0.0275 0.0174  -0.2195 42  ARG A CB  
295  C CG  . ARG A 42  ? 0.5221 0.3267 0.3945 -0.0218 0.0106  -0.2118 42  ARG A CG  
296  C CD  . ARG A 42  ? 0.5580 0.3327 0.4216 -0.0169 0.0074  -0.2206 42  ARG A CD  
297  N NE  . ARG A 42  ? 0.5835 0.3427 0.4305 -0.0248 -0.0054 -0.2183 42  ARG A NE  
298  C CZ  . ARG A 42  ? 0.6657 0.3980 0.5009 -0.0239 -0.0104 -0.2263 42  ARG A CZ  
299  N NH1 . ARG A 42  ? 0.6477 0.3615 0.4829 -0.0145 -0.0028 -0.2366 42  ARG A NH1 
300  N NH2 . ARG A 42  ? 0.6134 0.3388 0.4393 -0.0317 -0.0233 -0.2250 42  ARG A NH2 
301  N N   . PHE A 43  ? 0.5316 0.3958 0.4357 -0.0241 0.0279  -0.2030 43  PHE A N   
302  C CA  . PHE A 43  ? 0.4986 0.3798 0.4277 -0.0181 0.0344  -0.2033 43  PHE A CA  
303  C C   . PHE A 43  ? 0.5249 0.4342 0.4594 -0.0243 0.0448  -0.2044 43  PHE A C   
304  O O   . PHE A 43  ? 0.4736 0.4003 0.4298 -0.0211 0.0491  -0.2045 43  PHE A O   
305  C CB  . PHE A 43  ? 0.5253 0.4028 0.4691 -0.0051 0.0406  -0.2162 43  PHE A CB  
306  C CG  . PHE A 43  ? 0.5601 0.4062 0.4962 0.0003  0.0323  -0.2164 43  PHE A CG  
307  C CD1 . PHE A 43  ? 0.4671 0.2983 0.4056 -0.0009 0.0212  -0.2032 43  PHE A CD1 
308  C CD2 . PHE A 43  ? 0.5391 0.3701 0.4648 0.0058  0.0368  -0.2303 43  PHE A CD2 
309  C CE1 . PHE A 43  ? 0.4906 0.2918 0.4206 0.0017  0.0151  -0.2032 43  PHE A CE1 
310  C CE2 . PHE A 43  ? 0.5426 0.3415 0.4593 0.0095  0.0298  -0.2308 43  PHE A CE2 
311  C CZ  . PHE A 43  ? 0.5292 0.3128 0.4477 0.0067  0.0191  -0.2170 43  PHE A CZ  
312  N N   . LYS A 44  ? 0.4373 0.3511 0.3518 -0.0338 0.0489  -0.2058 44  LYS A N   
313  C CA  . LYS A 44  ? 0.4855 0.4222 0.4012 -0.0424 0.0588  -0.2050 44  LYS A CA  
314  C C   . LYS A 44  ? 0.4998 0.4361 0.4121 -0.0498 0.0504  -0.1886 44  LYS A C   
315  O O   . LYS A 44  ? 0.4836 0.4039 0.3881 -0.0496 0.0373  -0.1786 44  LYS A O   
316  C CB  . LYS A 44  ? 0.4939 0.4353 0.3873 -0.0509 0.0682  -0.2128 44  LYS A CB  
317  C CG  . LYS A 44  ? 0.6300 0.5728 0.5241 -0.0440 0.0778  -0.2299 44  LYS A CG  
318  C CD  . LYS A 44  ? 0.7360 0.6874 0.6074 -0.0542 0.0887  -0.2369 44  LYS A CD  
319  C CE  . LYS A 44  ? 0.7549 0.7349 0.6380 -0.0595 0.1047  -0.2425 44  LYS A CE  
320  N NZ  . LYS A 44  ? 0.7749 0.7677 0.6878 -0.0458 0.1111  -0.2546 44  LYS A NZ  
321  N N   . LYS A 45  ? 0.4231 0.3779 0.3421 -0.0565 0.0584  -0.1867 45  LYS A N   
322  C CA  . LYS A 45  ? 0.3738 0.3281 0.2842 -0.0654 0.0536  -0.1729 45  LYS A CA  
323  C C   . LYS A 45  ? 0.5986 0.5393 0.4811 -0.0719 0.0476  -0.1672 45  LYS A C   
324  O O   . LYS A 45  ? 0.6912 0.6285 0.5589 -0.0733 0.0514  -0.1757 45  LYS A O   
325  C CB  . LYS A 45  ? 0.3724 0.3467 0.2856 -0.0753 0.0669  -0.1757 45  LYS A CB  
326  C CG  . LYS A 45  ? 0.3521 0.3445 0.2943 -0.0713 0.0712  -0.1795 45  LYS A CG  
327  C CD  . LYS A 45  ? 0.4933 0.5023 0.4328 -0.0852 0.0823  -0.1794 45  LYS A CD  
328  C CE  . LYS A 45  ? 0.5073 0.5373 0.4762 -0.0830 0.0859  -0.1837 45  LYS A CE  
329  N NZ  . LYS A 45  ? 0.5012 0.5395 0.4635 -0.0986 0.0920  -0.1786 45  LYS A NZ  
330  N N   . PRO A 46  ? 0.4153 0.3494 0.2912 -0.0754 0.0380  -0.1536 46  PRO A N   
331  C CA  . PRO A 46  ? 0.3921 0.3159 0.2441 -0.0806 0.0311  -0.1486 46  PRO A CA  
332  C C   . PRO A 46  ? 0.5799 0.5074 0.4082 -0.0934 0.0411  -0.1492 46  PRO A C   
333  O O   . PRO A 46  ? 0.5310 0.4652 0.3596 -0.1006 0.0484  -0.1454 46  PRO A O   
334  C CB  . PRO A 46  ? 0.4186 0.3370 0.2762 -0.0784 0.0185  -0.1347 46  PRO A CB  
335  C CG  . PRO A 46  ? 0.3480 0.2751 0.2233 -0.0778 0.0230  -0.1312 46  PRO A CG  
336  C CD  . PRO A 46  ? 0.3490 0.2855 0.2399 -0.0736 0.0326  -0.1431 46  PRO A CD  
337  N N   . GLN A 47  ? 0.6258 0.5479 0.4321 -0.0973 0.0413  -0.1537 47  GLN A N   
338  C CA  . GLN A 47  ? 0.6032 0.5264 0.3821 -0.1104 0.0499  -0.1532 47  GLN A CA  
339  C C   . GLN A 47  ? 0.6863 0.5977 0.4451 -0.1158 0.0388  -0.1394 47  GLN A C   
340  O O   . GLN A 47  ? 0.6589 0.5635 0.4201 -0.1094 0.0250  -0.1354 47  GLN A O   
341  C CB  . GLN A 47  ? 0.6724 0.5957 0.4357 -0.1117 0.0552  -0.1652 47  GLN A CB  
342  C CG  . GLN A 47  ? 0.8117 0.7438 0.5944 -0.1036 0.0642  -0.1802 47  GLN A CG  
343  C CD  . GLN A 47  ? 0.9251 0.8750 0.7209 -0.1077 0.0798  -0.1850 47  GLN A CD  
344  O OE1 . GLN A 47  ? 0.9990 0.9566 0.8221 -0.1004 0.0805  -0.1863 47  GLN A OE1 
345  N NE2 . GLN A 47  ? 0.9184 0.8763 0.6951 -0.1201 0.0922  -0.1880 47  GLN A NE2 
346  N N   . SER A 48  ? 0.9174 0.8263 0.6560 -0.1281 0.0450  -0.1325 48  SER A N   
347  C CA  . SER A 48  ? 1.0208 0.9155 0.7374 -0.1334 0.0346  -0.1185 48  SER A CA  
348  C C   . SER A 48  ? 0.9542 0.8420 0.6487 -0.1336 0.0254  -0.1185 48  SER A C   
349  O O   . SER A 48  ? 0.8619 0.7546 0.5502 -0.1340 0.0306  -0.1293 48  SER A O   
350  C CB  . SER A 48  ? 1.0716 0.9605 0.7657 -0.1483 0.0440  -0.1115 48  SER A CB  
351  O OG  . SER A 48  ? 1.1308 1.0199 0.7978 -0.1587 0.0525  -0.1155 48  SER A OG  
352  N N   . LEU A 49  ? 1.0120 0.8891 0.6945 -0.1331 0.0115  -0.1070 49  LEU A N   
353  C CA  . LEU A 49  ? 1.0982 0.9723 0.7659 -0.1314 -0.0002 -0.1073 49  LEU A CA  
354  C C   . LEU A 49  ? 1.2005 1.0663 0.8284 -0.1427 0.0009  -0.1034 49  LEU A C   
355  O O   . LEU A 49  ? 1.2247 1.0795 0.8310 -0.1514 0.0029  -0.0926 49  LEU A O   
356  C CB  . LEU A 49  ? 1.0491 0.9207 0.7285 -0.1233 -0.0170 -0.0990 49  LEU A CB  
357  C CG  . LEU A 49  ? 1.0508 0.9260 0.7276 -0.1194 -0.0291 -0.1031 49  LEU A CG  
358  C CD1 . LEU A 49  ? 1.0556 0.9381 0.7448 -0.1163 -0.0230 -0.1183 49  LEU A CD1 
359  C CD2 . LEU A 49  ? 1.0340 0.9128 0.7308 -0.1111 -0.0433 -0.0973 49  LEU A CD2 
360  N N   . THR A 50  ? 1.2196 1.0893 0.8372 -0.1427 -0.0007 -0.1123 50  THR A N   
361  C CA  . THR A 50  ? 1.2336 1.0974 0.8138 -0.1521 -0.0015 -0.1099 50  THR A CA  
362  C C   . THR A 50  ? 1.2241 1.0778 0.7863 -0.1518 -0.0192 -0.0956 50  THR A C   
363  O O   . THR A 50  ? 1.1803 1.0382 0.7567 -0.1432 -0.0332 -0.0955 50  THR A O   
364  C CB  . THR A 50  ? 1.2811 1.1520 0.8581 -0.1503 -0.0010 -0.1246 50  THR A CB  
365  O OG1 . THR A 50  ? 1.2258 1.1012 0.8292 -0.1393 -0.0123 -0.1293 50  THR A OG1 
366  C CG2 . THR A 50  ? 1.3031 1.1818 0.8869 -0.1524 0.0176  -0.1387 50  THR A CG2 
367  N N   . LYS A 51  ? 1.2973 1.1379 0.8287 -0.1611 -0.0185 -0.0834 51  LYS A N   
368  C CA  . LYS A 51  ? 1.3354 1.1641 0.8440 -0.1605 -0.0356 -0.0687 51  LYS A CA  
369  C C   . LYS A 51  ? 1.3203 1.1575 0.8239 -0.1557 -0.0495 -0.0734 51  LYS A C   
370  O O   . LYS A 51  ? 1.3371 1.1831 0.8372 -0.1582 -0.0436 -0.0865 51  LYS A O   
371  C CB  . LYS A 51  ? 1.4029 1.2156 0.8723 -0.1732 -0.0305 -0.0577 51  LYS A CB  
372  C CG  . LYS A 51  ? 1.4240 1.2428 0.8827 -0.1847 -0.0101 -0.0682 51  LYS A CG  
373  C CD  . LYS A 51  ? 1.4172 1.2208 0.8346 -0.1985 -0.0059 -0.0570 51  LYS A CD  
374  C CE  . LYS A 51  ? 1.3222 1.1332 0.7360 -0.2109 0.0170  -0.0661 51  LYS A CE  
375  N NZ  . LYS A 51  ? 1.1809 0.9941 0.6210 -0.2120 0.0283  -0.0671 51  LYS A NZ  
376  N N   . TRP A 52  ? 1.2619 1.0972 0.7659 -0.1488 -0.0680 -0.0635 52  TRP A N   
377  C CA  . TRP A 52  ? 1.2145 1.0600 0.7131 -0.1452 -0.0824 -0.0673 52  TRP A CA  
378  C C   . TRP A 52  ? 1.2777 1.1154 0.7510 -0.1437 -0.1001 -0.0515 52  TRP A C   
379  O O   . TRP A 52  ? 1.2238 1.0513 0.6993 -0.1388 -0.1076 -0.0379 52  TRP A O   
380  C CB  . TRP A 52  ? 1.0596 0.9214 0.5964 -0.1356 -0.0889 -0.0772 52  TRP A CB  
381  C CG  . TRP A 52  ? 0.9936 0.8572 0.5508 -0.1265 -0.1015 -0.0672 52  TRP A CG  
382  C CD1 . TRP A 52  ? 1.0144 0.8825 0.5672 -0.1210 -0.1201 -0.0585 52  TRP A CD1 
383  C CD2 . TRP A 52  ? 0.8983 0.7609 0.4841 -0.1212 -0.0965 -0.0654 52  TRP A CD2 
384  N NE1 . TRP A 52  ? 0.9544 0.8242 0.5315 -0.1125 -0.1263 -0.0518 52  TRP A NE1 
385  C CE2 . TRP A 52  ? 0.8561 0.7217 0.4525 -0.1129 -0.1120 -0.0559 52  TRP A CE2 
386  C CE3 . TRP A 52  ? 0.8583 0.7192 0.4620 -0.1222 -0.0807 -0.0712 52  TRP A CE3 
387  C CZ2 . TRP A 52  ? 0.7989 0.6642 0.4214 -0.1064 -0.1116 -0.0523 52  TRP A CZ2 
388  C CZ3 . TRP A 52  ? 0.8387 0.6997 0.4682 -0.1158 -0.0810 -0.0671 52  TRP A CZ3 
389  C CH2 . TRP A 52  ? 0.7757 0.6382 0.4136 -0.1083 -0.0960 -0.0580 52  TRP A CH2 
390  N N   . SER A 53  ? 1.3599 1.2019 0.8089 -0.1471 -0.1070 -0.0537 53  SER A N   
391  C CA  . SER A 53  ? 1.3805 1.2207 0.8094 -0.1432 -0.1266 -0.0408 53  SER A CA  
392  C C   . SER A 53  ? 1.3735 1.2342 0.8318 -0.1328 -0.1421 -0.0462 53  SER A C   
393  O O   . SER A 53  ? 1.3582 1.2310 0.8486 -0.1303 -0.1364 -0.0592 53  SER A O   
394  C CB  . SER A 53  ? 1.4348 1.2727 0.8244 -0.1519 -0.1273 -0.0416 53  SER A CB  
395  O OG  . SER A 53  ? 1.4976 1.3369 0.8695 -0.1468 -0.1479 -0.0299 53  SER A OG  
396  N N   . ASP A 54  ? 1.3642 1.2295 0.8119 -0.1269 -0.1614 -0.0360 54  ASP A N   
397  C CA  . ASP A 54  ? 1.3501 1.2374 0.8269 -0.1169 -0.1771 -0.0391 54  ASP A CA  
398  C C   . ASP A 54  ? 1.2306 1.1194 0.7432 -0.1089 -0.1752 -0.0365 54  ASP A C   
399  O O   . ASP A 54  ? 1.1719 1.0425 0.6836 -0.1101 -0.1645 -0.0304 54  ASP A O   
400  C CB  . ASP A 54  ? 1.3917 1.2984 0.8815 -0.1201 -0.1767 -0.0581 54  ASP A CB  
401  C CG  . ASP A 54  ? 1.4561 1.3679 0.9143 -0.1247 -0.1865 -0.0600 54  ASP A CG  
402  O OD1 . ASP A 54  ? 1.4854 1.3911 0.9162 -0.1229 -0.1977 -0.0454 54  ASP A OD1 
403  O OD2 . ASP A 54  ? 1.4567 1.3773 0.9165 -0.1299 -0.1837 -0.0761 54  ASP A OD2 
404  N N   . ILE A 55  ? 1.1670 1.0781 0.7107 -0.1013 -0.1855 -0.0416 55  ILE A N   
405  C CA  . ILE A 55  ? 1.0710 0.9855 0.6477 -0.0934 -0.1850 -0.0388 55  ILE A CA  
406  C C   . ILE A 55  ? 1.0297 0.9586 0.6411 -0.0950 -0.1753 -0.0549 55  ILE A C   
407  O O   . ILE A 55  ? 1.0003 0.9428 0.6167 -0.0988 -0.1765 -0.0675 55  ILE A O   
408  C CB  . ILE A 55  ? 0.9874 0.9160 0.5747 -0.0815 -0.2048 -0.0283 55  ILE A CB  
409  C CG1 . ILE A 55  ? 1.0236 0.9848 0.6447 -0.0785 -0.2120 -0.0401 55  ILE A CG1 
410  C CG2 . ILE A 55  ? 0.8406 0.7631 0.3926 -0.0799 -0.2186 -0.0162 55  ILE A CG2 
411  C CD1 . ILE A 55  ? 0.9639 0.9339 0.6227 -0.0727 -0.2082 -0.0417 55  ILE A CD1 
412  N N   . TRP A 56  ? 1.0287 0.9521 0.6625 -0.0922 -0.1661 -0.0542 56  TRP A N   
413  C CA  . TRP A 56  ? 0.9414 0.8772 0.6095 -0.0922 -0.1578 -0.0671 56  TRP A CA  
414  C C   . TRP A 56  ? 0.8818 0.8379 0.5811 -0.0844 -0.1680 -0.0655 56  TRP A C   
415  O O   . TRP A 56  ? 0.7963 0.7485 0.5029 -0.0776 -0.1712 -0.0553 56  TRP A O   
416  C CB  . TRP A 56  ? 0.8383 0.7592 0.5144 -0.0941 -0.1404 -0.0688 56  TRP A CB  
417  C CG  . TRP A 56  ? 0.7327 0.6646 0.4421 -0.0932 -0.1327 -0.0807 56  TRP A CG  
418  C CD1 . TRP A 56  ? 0.6348 0.5803 0.3761 -0.0877 -0.1357 -0.0812 56  TRP A CD1 
419  C CD2 . TRP A 56  ? 0.8010 0.7299 0.5144 -0.0976 -0.1209 -0.0934 56  TRP A CD2 
420  N NE1 . TRP A 56  ? 0.6974 0.6470 0.4611 -0.0889 -0.1266 -0.0925 56  TRP A NE1 
421  C CE2 . TRP A 56  ? 0.7877 0.7264 0.5353 -0.0940 -0.1182 -0.1000 56  TRP A CE2 
422  C CE3 . TRP A 56  ? 0.8542 0.7728 0.5451 -0.1038 -0.1123 -0.0997 56  TRP A CE3 
423  C CZ2 . TRP A 56  ? 0.7963 0.7320 0.5557 -0.0954 -0.1090 -0.1115 56  TRP A CZ2 
424  C CZ3 . TRP A 56  ? 0.8530 0.7708 0.5569 -0.1047 -0.1026 -0.1125 56  TRP A CZ3 
425  C CH2 . TRP A 56  ? 0.8367 0.7615 0.5742 -0.1001 -0.1019 -0.1178 56  TRP A CH2 
426  N N   . ASN A 57  ? 0.8905 0.8674 0.6079 -0.0856 -0.1727 -0.0763 57  ASN A N   
427  C CA  . ASN A 57  ? 0.8596 0.8599 0.6084 -0.0801 -0.1805 -0.0769 57  ASN A CA  
428  C C   . ASN A 57  ? 0.7678 0.7670 0.5456 -0.0793 -0.1680 -0.0807 57  ASN A C   
429  O O   . ASN A 57  ? 0.8100 0.8095 0.6014 -0.0836 -0.1594 -0.0919 57  ASN A O   
430  C CB  . ASN A 57  ? 1.0138 1.0357 0.7709 -0.0833 -0.1895 -0.0879 57  ASN A CB  
431  C CG  . ASN A 57  ? 1.2107 1.2423 0.9456 -0.0816 -0.2059 -0.0828 57  ASN A CG  
432  O OD1 . ASN A 57  ? 1.2026 1.2329 0.9264 -0.0747 -0.2142 -0.0690 57  ASN A OD1 
433  N ND2 . ASN A 57  ? 1.4045 1.4444 1.1325 -0.0872 -0.2115 -0.0935 57  ASN A ND2 
434  N N   . ALA A 58  ? 0.7155 0.7113 0.5017 -0.0730 -0.1679 -0.0709 58  ALA A N   
435  C CA  . ALA A 58  ? 0.6319 0.6277 0.4444 -0.0717 -0.1569 -0.0732 58  ALA A CA  
436  C C   . ALA A 58  ? 0.5905 0.6131 0.4324 -0.0681 -0.1636 -0.0741 58  ALA A C   
437  O O   . ALA A 58  ? 0.4773 0.5023 0.3304 -0.0618 -0.1655 -0.0664 58  ALA A O   
438  C CB  . ALA A 58  ? 0.5944 0.5687 0.3979 -0.0676 -0.1519 -0.0631 58  ALA A CB  
439  N N   . THR A 59  ? 0.5256 0.5674 0.3799 -0.0724 -0.1670 -0.0842 59  THR A N   
440  C CA  . THR A 59  ? 0.5297 0.6016 0.4096 -0.0704 -0.1747 -0.0856 59  THR A CA  
441  C C   . THR A 59  ? 0.5998 0.6803 0.5065 -0.0751 -0.1668 -0.0967 59  THR A C   
442  O O   . THR A 59  ? 0.6370 0.7402 0.5663 -0.0743 -0.1704 -0.0976 59  THR A O   
443  C CB  . THR A 59  ? 0.5539 0.6462 0.4262 -0.0693 -0.1911 -0.0861 59  THR A CB  
444  O OG1 . THR A 59  ? 0.6371 0.7205 0.4949 -0.0759 -0.1915 -0.0962 59  THR A OG1 
445  C CG2 . THR A 59  ? 0.4992 0.5835 0.3487 -0.0618 -0.2009 -0.0717 59  THR A CG2 
446  N N   . LYS A 60  ? 0.7091 0.7680 0.6134 -0.0791 -0.1553 -0.1026 60  LYS A N   
447  C CA  . LYS A 60  ? 0.6851 0.7419 0.6126 -0.0820 -0.1470 -0.1087 60  LYS A CA  
448  C C   . LYS A 60  ? 0.4940 0.5291 0.4202 -0.0814 -0.1327 -0.1079 60  LYS A C   
449  O O   . LYS A 60  ? 0.4315 0.4500 0.3375 -0.0806 -0.1287 -0.1057 60  LYS A O   
450  C CB  . LYS A 60  ? 0.7416 0.7958 0.6705 -0.0882 -0.1524 -0.1182 60  LYS A CB  
451  C CG  . LYS A 60  ? 0.8822 0.9181 0.7861 -0.0920 -0.1518 -0.1239 60  LYS A CG  
452  C CD  . LYS A 60  ? 0.9749 1.0044 0.8812 -0.0997 -0.1554 -0.1339 60  LYS A CD  
453  C CE  . LYS A 60  ? 1.0336 1.0459 0.9132 -0.1034 -0.1537 -0.1395 60  LYS A CE  
454  N NZ  . LYS A 60  ? 1.0058 0.9988 0.8753 -0.1001 -0.1401 -0.1373 60  LYS A NZ  
455  N N   . TYR A 61  ? 0.4317 0.4656 0.3786 -0.0811 -0.1243 -0.1074 61  TYR A N   
456  C CA  . TYR A 61  ? 0.4590 0.4744 0.4071 -0.0795 -0.1115 -0.1066 61  TYR A CA  
457  C C   . TYR A 61  ? 0.3367 0.3340 0.2732 -0.0821 -0.1092 -0.1136 61  TYR A C   
458  O O   . TYR A 61  ? 0.5346 0.5310 0.4708 -0.0869 -0.1147 -0.1200 61  TYR A O   
459  C CB  . TYR A 61  ? 0.3742 0.3913 0.3446 -0.0791 -0.1048 -0.1048 61  TYR A CB  
460  C CG  . TYR A 61  ? 0.4350 0.4670 0.4164 -0.0762 -0.1031 -0.0982 61  TYR A CG  
461  C CD1 . TYR A 61  ? 0.3832 0.4101 0.3587 -0.0728 -0.0966 -0.0919 61  TYR A CD1 
462  C CD2 . TYR A 61  ? 0.3623 0.4117 0.3602 -0.0773 -0.1084 -0.0983 61  TYR A CD2 
463  C CE1 . TYR A 61  ? 0.2972 0.3355 0.2803 -0.0716 -0.0958 -0.0855 61  TYR A CE1 
464  C CE2 . TYR A 61  ? 0.2634 0.3280 0.2708 -0.0752 -0.1061 -0.0930 61  TYR A CE2 
465  C CZ  . TYR A 61  ? 0.2988 0.3578 0.2967 -0.0737 -0.0996 -0.0857 61  TYR A CZ  
466  O OH  . TYR A 61  ? 0.3791 0.4502 0.3825 -0.0742 -0.0994 -0.0779 61  TYR A OH  
467  N N   . ALA A 62  ? 0.3339 0.3168 0.2608 -0.0793 -0.1014 -0.1129 62  ALA A N   
468  C CA  . ALA A 62  ? 0.3683 0.3349 0.2831 -0.0810 -0.0986 -0.1197 62  ALA A CA  
469  C C   . ALA A 62  ? 0.3661 0.3230 0.2962 -0.0809 -0.0933 -0.1231 62  ALA A C   
470  O O   . ALA A 62  ? 0.3638 0.3255 0.3121 -0.0803 -0.0909 -0.1188 62  ALA A O   
471  C CB  . ALA A 62  ? 0.3556 0.3110 0.2531 -0.0782 -0.0921 -0.1169 62  ALA A CB  
472  N N   . ASN A 63  ? 0.4039 0.3459 0.3234 -0.0822 -0.0920 -0.1305 63  ASN A N   
473  C CA  . ASN A 63  ? 0.4520 0.3797 0.3799 -0.0823 -0.0872 -0.1332 63  ASN A CA  
474  C C   . ASN A 63  ? 0.4565 0.3820 0.3975 -0.0762 -0.0792 -0.1259 63  ASN A C   
475  O O   . ASN A 63  ? 0.4702 0.3966 0.4069 -0.0711 -0.0750 -0.1220 63  ASN A O   
476  C CB  . ASN A 63  ? 0.5497 0.4609 0.4603 -0.0825 -0.0860 -0.1425 63  ASN A CB  
477  C CG  . ASN A 63  ? 0.6255 0.5369 0.5219 -0.0894 -0.0939 -0.1513 63  ASN A CG  
478  O OD1 . ASN A 63  ? 0.6736 0.5957 0.5766 -0.0946 -0.1011 -0.1509 63  ASN A OD1 
479  N ND2 . ASN A 63  ? 0.5996 0.5000 0.4757 -0.0897 -0.0919 -0.1588 63  ASN A ND2 
480  N N   . SER A 64  ? 0.4903 0.4131 0.4465 -0.0775 -0.0775 -0.1241 64  SER A N   
481  C CA  . SER A 64  ? 0.4330 0.3520 0.4003 -0.0720 -0.0705 -0.1185 64  SER A CA  
482  C C   . SER A 64  ? 0.5157 0.4160 0.4759 -0.0679 -0.0685 -0.1233 64  SER A C   
483  O O   . SER A 64  ? 0.6229 0.5117 0.5739 -0.0710 -0.0715 -0.1318 64  SER A O   
484  C CB  . SER A 64  ? 0.3220 0.2446 0.3054 -0.0760 -0.0693 -0.1154 64  SER A CB  
485  O OG  . SER A 64  ? 0.3514 0.2905 0.3405 -0.0788 -0.0717 -0.1107 64  SER A OG  
486  N N   . CYS A 65  ? 0.3225 0.2186 0.2854 -0.0609 -0.0643 -0.1181 65  CYS A N   
487  C CA  . CYS A 65  ? 0.4412 0.3163 0.3924 -0.0561 -0.0637 -0.1208 65  CYS A CA  
488  C C   . CYS A 65  ? 0.4673 0.3288 0.4257 -0.0564 -0.0657 -0.1235 65  CYS A C   
489  O O   . CYS A 65  ? 0.4107 0.2839 0.3914 -0.0588 -0.0632 -0.1216 65  CYS A O   
490  C CB  . CYS A 65  ? 0.3941 0.2649 0.3393 -0.0505 -0.0599 -0.1124 65  CYS A CB  
491  S SG  . CYS A 65  ? 0.5298 0.4135 0.4665 -0.0501 -0.0557 -0.1127 65  CYS A SG  
492  N N   . CYS A 66  ? 0.4562 0.2955 0.3972 -0.0552 -0.0666 -0.1305 66  CYS A N   
493  C CA  . CYS A 66  ? 0.4784 0.2981 0.4208 -0.0545 -0.0692 -0.1333 66  CYS A CA  
494  C C   . CYS A 66  ? 0.5285 0.3354 0.4674 -0.0528 -0.0698 -0.1191 66  CYS A C   
495  O O   . CYS A 66  ? 0.5482 0.3422 0.4542 -0.0590 -0.0554 -0.1079 66  CYS A O   
496  C CB  . CYS A 66  ? 0.4415 0.2331 0.3548 -0.0523 -0.0662 -0.1410 66  CYS A CB  
497  S SG  . CYS A 66  ? 0.7574 0.5540 0.6651 -0.0565 -0.0679 -0.1578 66  CYS A SG  
498  N N   . GLN A 67  ? 0.5418 0.3913 0.5489 -0.0577 -0.0517 -0.1384 67  GLN A N   
499  C CA  . GLN A 67  ? 0.5006 0.3356 0.4733 -0.0831 -0.0139 -0.1279 67  GLN A CA  
500  C C   . GLN A 67  ? 0.5189 0.3445 0.5105 -0.0843 -0.0207 -0.1316 67  GLN A C   
501  O O   . GLN A 67  ? 0.4822 0.3125 0.4888 -0.0849 -0.0336 -0.1380 67  GLN A O   
502  C CB  . GLN A 67  ? 0.4182 0.2764 0.4024 -0.0804 -0.0187 -0.1187 67  GLN A CB  
503  C CG  . GLN A 67  ? 0.4722 0.3491 0.4807 -0.0780 -0.0351 -0.1195 67  GLN A CG  
504  C CD  . GLN A 67  ? 0.5320 0.4266 0.5414 -0.0766 -0.0361 -0.1100 67  GLN A CD  
505  O OE1 . GLN A 67  ? 0.5140 0.4090 0.5238 -0.0802 -0.0345 -0.1022 67  GLN A OE1 
506  N NE2 . GLN A 67  ? 0.2894 0.1957 0.2994 -0.0692 -0.0421 -0.1103 67  GLN A NE2 
507  N N   . ASN A 68  ? 0.4826 0.2846 0.4629 -0.0846 -0.0172 -0.1239 68  ASN A N   
508  C CA  . ASN A 68  ? 0.4403 0.2279 0.4317 -0.0886 -0.0222 -0.1234 68  ASN A CA  
509  C C   . ASN A 68  ? 0.4826 0.2878 0.4856 -0.0932 -0.0292 -0.1147 68  ASN A C   
510  O O   . ASN A 68  ? 0.5813 0.4028 0.5838 -0.0902 -0.0287 -0.1070 68  ASN A O   
511  C CB  . ASN A 68  ? 0.4854 0.2386 0.4662 -0.0837 -0.0207 -0.1202 68  ASN A CB  
512  C CG  . ASN A 68  ? 0.6354 0.3627 0.6031 -0.0793 -0.0158 -0.1306 68  ASN A CG  
513  O OD1 . ASN A 68  ? 0.7110 0.4328 0.6832 -0.0846 -0.0149 -0.1406 68  ASN A OD1 
514  N ND2 . ASN A 68  ? 0.4843 0.1966 0.4390 -0.0680 -0.0148 -0.1295 68  ASN A ND2 
515  N N   . ILE A 69  ? 0.5004 0.3002 0.5107 -0.1014 -0.0357 -0.1159 69  ILE A N   
516  C CA  . ILE A 69  ? 0.5285 0.3429 0.5457 -0.1080 -0.0416 -0.1081 69  ILE A CA  
517  C C   . ILE A 69  ? 0.5750 0.3718 0.5927 -0.1135 -0.0414 -0.0997 69  ILE A C   
518  O O   . ILE A 69  ? 0.6568 0.4245 0.6706 -0.1169 -0.0413 -0.1016 69  ILE A O   
519  C CB  . ILE A 69  ? 0.6378 0.4596 0.6592 -0.1164 -0.0499 -0.1136 69  ILE A CB  
520  C CG1 . ILE A 69  ? 0.6750 0.5208 0.6960 -0.1111 -0.0534 -0.1162 69  ILE A CG1 
521  C CG2 . ILE A 69  ? 0.6556 0.4813 0.6827 -0.1278 -0.0543 -0.1067 69  ILE A CG2 
522  C CD1 . ILE A 69  ? 0.7345 0.5761 0.7503 -0.1033 -0.0518 -0.1253 69  ILE A CD1 
523  N N   . ASP A 70  ? 0.5205 0.3317 0.5412 -0.1146 -0.0425 -0.0901 70  ASP A N   
524  C CA  . ASP A 70  ? 0.6043 0.4025 0.6221 -0.1213 -0.0451 -0.0789 70  ASP A CA  
525  C C   . ASP A 70  ? 0.5784 0.3672 0.5981 -0.1348 -0.0490 -0.0799 70  ASP A C   
526  O O   . ASP A 70  ? 0.5502 0.3600 0.5771 -0.1414 -0.0521 -0.0814 70  ASP A O   
527  C CB  . ASP A 70  ? 0.5043 0.3258 0.5252 -0.1207 -0.0458 -0.0695 70  ASP A CB  
528  C CG  . ASP A 70  ? 0.6545 0.4636 0.6701 -0.1282 -0.0482 -0.0571 70  ASP A CG  
529  O OD1 . ASP A 70  ? 0.7114 0.4907 0.7194 -0.1320 -0.0494 -0.0540 70  ASP A OD1 
530  O OD2 . ASP A 70  ? 0.6564 0.4847 0.6747 -0.1306 -0.0487 -0.0502 70  ASP A OD2 
531  N N   . GLN A 71  ? 0.5477 0.3037 0.5603 -0.1388 -0.0493 -0.0790 71  GLN A N   
532  C CA  . GLN A 71  ? 0.6438 0.3864 0.6560 -0.1533 -0.0526 -0.0791 71  GLN A CA  
533  C C   . GLN A 71  ? 0.6316 0.3559 0.6357 -0.1620 -0.0538 -0.0652 71  GLN A C   
534  O O   . GLN A 71  ? 0.6722 0.3730 0.6716 -0.1730 -0.0554 -0.0642 71  GLN A O   
535  C CB  . GLN A 71  ? 0.7520 0.4668 0.7612 -0.1536 -0.0525 -0.0901 71  GLN A CB  
536  C CG  . GLN A 71  ? 0.8734 0.5989 0.8871 -0.1444 -0.0507 -0.1043 71  GLN A CG  
537  C CD  . GLN A 71  ? 0.9913 0.6842 1.0000 -0.1408 -0.0484 -0.1142 71  GLN A CD  
538  O OE1 . GLN A 71  ? 1.0690 0.7368 1.0747 -0.1498 -0.0508 -0.1163 71  GLN A OE1 
539  N NE2 . GLN A 71  ? 1.0105 0.7026 1.0170 -0.1279 -0.0429 -0.1203 71  GLN A NE2 
540  N N   . SER A 72  ? 0.6870 0.4209 0.6883 -0.1580 -0.0532 -0.0545 72  SER A N   
541  C CA  . SER A 72  ? 0.6999 0.4167 0.6914 -0.1665 -0.0549 -0.0403 72  SER A CA  
542  C C   . SER A 72  ? 0.6569 0.3916 0.6513 -0.1835 -0.0552 -0.0356 72  SER A C   
543  O O   . SER A 72  ? 0.6291 0.3447 0.6150 -0.1966 -0.0560 -0.0275 72  SER A O   
544  C CB  . SER A 72  ? 0.7453 0.4645 0.7313 -0.1564 -0.0554 -0.0306 72  SER A CB  
545  O OG  . SER A 72  ? 0.7683 0.4735 0.7525 -0.1407 -0.0554 -0.0351 72  SER A OG  
546  N N   . PHE A 73  ? 0.6135 0.3845 0.6196 -0.1834 -0.0546 -0.0406 73  PHE A N   
547  C CA  . PHE A 73  ? 0.6383 0.4300 0.6490 -0.1985 -0.0547 -0.0370 73  PHE A CA  
548  C C   . PHE A 73  ? 0.6891 0.5025 0.7122 -0.2017 -0.0569 -0.0482 73  PHE A C   
549  O O   . PHE A 73  ? 0.7207 0.5665 0.7538 -0.1984 -0.0573 -0.0502 73  PHE A O   
550  C CB  . PHE A 73  ? 0.6449 0.4620 0.6571 -0.1967 -0.0527 -0.0288 73  PHE A CB  
551  C CG  . PHE A 73  ? 0.6701 0.4683 0.6696 -0.1918 -0.0522 -0.0182 73  PHE A CG  
552  C CD1 . PHE A 73  ? 0.6734 0.4486 0.6593 -0.2041 -0.0524 -0.0068 73  PHE A CD1 
553  C CD2 . PHE A 73  ? 0.5346 0.3368 0.5343 -0.1755 -0.0523 -0.0191 73  PHE A CD2 
554  C CE1 . PHE A 73  ? 0.5182 0.2749 0.4909 -0.1993 -0.0539 0.0040  73  PHE A CE1 
555  C CE2 . PHE A 73  ? 0.5120 0.2970 0.4999 -0.1712 -0.0537 -0.0091 73  PHE A CE2 
556  C CZ  . PHE A 73  ? 0.5300 0.2918 0.5041 -0.1827 -0.0551 0.0028  73  PHE A CZ  
557  N N   . PRO A 74  ? 0.7723 0.5664 0.7940 -0.2082 -0.0591 -0.0555 74  PRO A N   
558  C CA  . PRO A 74  ? 0.7084 0.5209 0.7398 -0.2121 -0.0630 -0.0662 74  PRO A CA  
559  C C   . PRO A 74  ? 0.6218 0.4629 0.6610 -0.2259 -0.0640 -0.0626 74  PRO A C   
560  O O   . PRO A 74  ? 0.5327 0.3661 0.5676 -0.2416 -0.0623 -0.0555 74  PRO A O   
561  C CB  . PRO A 74  ? 0.5512 0.3314 0.5765 -0.2200 -0.0649 -0.0727 74  PRO A CB  
562  C CG  . PRO A 74  ? 0.6480 0.3935 0.6621 -0.2137 -0.0618 -0.0674 74  PRO A CG  
563  C CD  . PRO A 74  ? 0.5551 0.3082 0.5654 -0.2129 -0.0590 -0.0538 74  PRO A CD  
564  N N   . GLY A 75  ? 0.4775 0.3510 0.5276 -0.2201 -0.0666 -0.0672 75  GLY A N   
565  C CA  . GLY A 75  ? 0.5848 0.4886 0.6447 -0.2317 -0.0679 -0.0654 75  GLY A CA  
566  C C   . GLY A 75  ? 0.4503 0.3773 0.5143 -0.2289 -0.0638 -0.0569 75  GLY A C   
567  O O   . GLY A 75  ? 0.5161 0.4726 0.5903 -0.2360 -0.0641 -0.0561 75  GLY A O   
568  N N   . PHE A 76  ? 0.4944 0.4086 0.5506 -0.2186 -0.0599 -0.0510 76  PHE A N   
569  C CA  . PHE A 76  ? 0.4178 0.3500 0.4752 -0.2156 -0.0558 -0.0431 76  PHE A CA  
570  C C   . PHE A 76  ? 0.4079 0.3590 0.4724 -0.1975 -0.0573 -0.0472 76  PHE A C   
571  O O   . PHE A 76  ? 0.3691 0.3061 0.4294 -0.1839 -0.0580 -0.0508 76  PHE A O   
572  C CB  . PHE A 76  ? 0.5115 0.4168 0.5540 -0.2163 -0.0520 -0.0336 76  PHE A CB  
573  C CG  . PHE A 76  ? 0.5090 0.4290 0.5495 -0.2125 -0.0482 -0.0258 76  PHE A CG  
574  C CD1 . PHE A 76  ? 0.4505 0.3973 0.4962 -0.2234 -0.0448 -0.0217 76  PHE A CD1 
575  C CD2 . PHE A 76  ? 0.5810 0.4888 0.6143 -0.1987 -0.0477 -0.0230 76  PHE A CD2 
576  C CE1 . PHE A 76  ? 0.4229 0.3834 0.4658 -0.2203 -0.0408 -0.0155 76  PHE A CE1 
577  C CE2 . PHE A 76  ? 0.3828 0.3034 0.4131 -0.1961 -0.0447 -0.0162 76  PHE A CE2 
578  C CZ  . PHE A 76  ? 0.4019 0.3483 0.4364 -0.2069 -0.0412 -0.0126 76  PHE A CZ  
579  N N   . HIS A 77  ? 0.4164 0.3994 0.4917 -0.1976 -0.0573 -0.0468 77  HIS A N   
580  C CA  . HIS A 77  ? 0.4355 0.4359 0.5179 -0.1817 -0.0599 -0.0508 77  HIS A CA  
581  C C   . HIS A 77  ? 0.4547 0.4451 0.5298 -0.1688 -0.0564 -0.0472 77  HIS A C   
582  O O   . HIS A 77  ? 0.4132 0.4040 0.4892 -0.1545 -0.0584 -0.0514 77  HIS A O   
583  C CB  . HIS A 77  ? 0.3206 0.3564 0.4163 -0.1847 -0.0606 -0.0507 77  HIS A CB  
584  C CG  . HIS A 77  ? 0.5278 0.5786 0.6301 -0.1692 -0.0650 -0.0546 77  HIS A CG  
585  N ND1 . HIS A 77  ? 0.5375 0.6066 0.6444 -0.1623 -0.0625 -0.0516 77  HIS A ND1 
586  C CD2 . HIS A 77  ? 0.5471 0.5952 0.6500 -0.1597 -0.0717 -0.0609 77  HIS A CD2 
587  C CE1 . HIS A 77  ? 0.5593 0.6346 0.6695 -0.1493 -0.0681 -0.0553 77  HIS A CE1 
588  N NE2 . HIS A 77  ? 0.5831 0.6462 0.6904 -0.1477 -0.0738 -0.0606 77  HIS A NE2 
589  N N   . GLY A 78  ? 0.5031 0.4847 0.5700 -0.1751 -0.0515 -0.0390 78  GLY A N   
590  C CA  . GLY A 78  ? 0.3082 0.2818 0.3676 -0.1652 -0.0488 -0.0347 78  GLY A CA  
591  C C   . GLY A 78  ? 0.4197 0.3714 0.4733 -0.1531 -0.0500 -0.0387 78  GLY A C   
592  O O   . GLY A 78  ? 0.2832 0.2372 0.3360 -0.1407 -0.0492 -0.0394 78  GLY A O   
593  N N   . SER A 79  ? 0.3669 0.2982 0.4167 -0.1572 -0.0516 -0.0419 79  SER A N   
594  C CA  . SER A 79  ? 0.3246 0.2364 0.3693 -0.1468 -0.0515 -0.0468 79  SER A CA  
595  C C   . SER A 79  ? 0.4331 0.3526 0.4843 -0.1409 -0.0542 -0.0575 79  SER A C   
596  O O   . SER A 79  ? 0.4701 0.3870 0.5198 -0.1294 -0.0530 -0.0625 79  SER A O   
597  C CB  . SER A 79  ? 0.3570 0.2368 0.3911 -0.1534 -0.0512 -0.0438 79  SER A CB  
598  O OG  . SER A 79  ? 0.4966 0.3707 0.5327 -0.1651 -0.0533 -0.0473 79  SER A OG  
599  N N   . GLU A 80  ? 0.4022 0.3319 0.4597 -0.1498 -0.0581 -0.0607 80  GLU A N   
600  C CA  . GLU A 80  ? 0.4359 0.3696 0.4963 -0.1463 -0.0625 -0.0702 80  GLU A CA  
601  C C   . GLU A 80  ? 0.4182 0.3738 0.4832 -0.1360 -0.0651 -0.0724 80  GLU A C   
602  O O   . GLU A 80  ? 0.3956 0.3509 0.4575 -0.1301 -0.0680 -0.0789 80  GLU A O   
603  C CB  . GLU A 80  ? 0.4769 0.4108 0.5402 -0.1604 -0.0669 -0.0733 80  GLU A CB  
604  C CG  . GLU A 80  ? 0.5330 0.4374 0.5889 -0.1686 -0.0654 -0.0743 80  GLU A CG  
605  C CD  . GLU A 80  ? 0.6024 0.5058 0.6602 -0.1831 -0.0701 -0.0789 80  GLU A CD  
606  O OE1 . GLU A 80  ? 0.6494 0.5748 0.7152 -0.1921 -0.0723 -0.0766 80  GLU A OE1 
607  O OE2 . GLU A 80  ? 0.5907 0.4719 0.6423 -0.1860 -0.0715 -0.0852 80  GLU A OE2 
608  N N   . MET A 81  ? 0.4555 0.4288 0.5269 -0.1336 -0.0641 -0.0669 81  MET A N   
609  C CA  . MET A 81  ? 0.4183 0.4084 0.4934 -0.1226 -0.0664 -0.0681 81  MET A CA  
610  C C   . MET A 81  ? 0.4239 0.4042 0.4897 -0.1102 -0.0626 -0.0697 81  MET A C   
611  O O   . MET A 81  ? 0.4709 0.4604 0.5350 -0.1011 -0.0639 -0.0709 81  MET A O   
612  C CB  . MET A 81  ? 0.3552 0.3623 0.4366 -0.1232 -0.0651 -0.0615 81  MET A CB  
613  C CG  . MET A 81  ? 0.3850 0.3823 0.4603 -0.1219 -0.0585 -0.0556 81  MET A CG  
614  S SD  . MET A 81  ? 0.5967 0.6150 0.6769 -0.1217 -0.0566 -0.0494 81  MET A SD  
615  C CE  . MET A 81  ? 0.9459 0.9722 1.0290 -0.1058 -0.0608 -0.0533 81  MET A CE  
616  N N   . TRP A 82  ? 0.4241 0.3858 0.4831 -0.1102 -0.0574 -0.0691 82  TRP A N   
617  C CA  . TRP A 82  ? 0.4439 0.3980 0.4939 -0.1001 -0.0527 -0.0704 82  TRP A CA  
618  C C   . TRP A 82  ? 0.3596 0.3011 0.4029 -0.0999 -0.0531 -0.0772 82  TRP A C   
619  O O   . TRP A 82  ? 0.3446 0.2836 0.3811 -0.0925 -0.0497 -0.0794 82  TRP A O   
620  C CB  . TRP A 82  ? 0.2424 0.1856 0.2886 -0.0986 -0.0472 -0.0655 82  TRP A CB  
621  C CG  . TRP A 82  ? 0.3234 0.2785 0.3755 -0.0994 -0.0471 -0.0594 82  TRP A CG  
622  C CD1 . TRP A 82  ? 0.2953 0.2467 0.3475 -0.1086 -0.0477 -0.0528 82  TRP A CD1 
623  C CD2 . TRP A 82  ? 0.2983 0.2692 0.3524 -0.0915 -0.0464 -0.0576 82  TRP A CD2 
624  N NE1 . TRP A 82  ? 0.2290 0.1946 0.2839 -0.1076 -0.0474 -0.0479 82  TRP A NE1 
625  C CE2 . TRP A 82  ? 0.3213 0.2983 0.3795 -0.0969 -0.0472 -0.0518 82  TRP A CE2 
626  C CE3 . TRP A 82  ? 0.2621 0.2405 0.3125 -0.0824 -0.0451 -0.0597 82  TRP A CE3 
627  C CZ2 . TRP A 82  ? 0.2876 0.2781 0.3490 -0.0918 -0.0473 -0.0498 82  TRP A CZ2 
628  C CZ3 . TRP A 82  ? 0.2590 0.2496 0.3124 -0.0767 -0.0447 -0.0573 82  TRP A CZ3 
629  C CH2 . TRP A 82  ? 0.2309 0.2269 0.2905 -0.0804 -0.0464 -0.0526 82  TRP A CH2 
630  N N   . ASN A 83  ? 0.4172 0.3511 0.4625 -0.1088 -0.0571 -0.0809 83  ASN A N   
631  C CA  . ASN A 83  ? 0.4060 0.3278 0.4455 -0.1093 -0.0587 -0.0887 83  ASN A CA  
632  C C   . ASN A 83  ? 0.3977 0.3325 0.4344 -0.1047 -0.0633 -0.0928 83  ASN A C   
633  O O   . ASN A 83  ? 0.3774 0.3295 0.4189 -0.1052 -0.0679 -0.0906 83  ASN A O   
634  C CB  . ASN A 83  ? 0.4654 0.3750 0.5072 -0.1216 -0.0625 -0.0920 83  ASN A CB  
635  C CG  . ASN A 83  ? 0.4927 0.3803 0.5332 -0.1257 -0.0579 -0.0892 83  ASN A CG  
636  O OD1 . ASN A 83  ? 0.5618 0.4398 0.5974 -0.1182 -0.0522 -0.0874 83  ASN A OD1 
637  N ND2 . ASN A 83  ? 0.4651 0.3440 0.5071 -0.1376 -0.0601 -0.0873 83  ASN A ND2 
638  N N   . PRO A 84  ? 0.4543 0.3802 0.4830 -0.1001 -0.0624 -0.0987 84  PRO A N   
639  C CA  . PRO A 84  ? 0.4234 0.3575 0.4460 -0.0965 -0.0673 -0.1026 84  PRO A CA  
640  C C   . PRO A 84  ? 0.4029 0.3461 0.4276 -0.1044 -0.0764 -0.1054 84  PRO A C   
641  O O   . PRO A 84  ? 0.3816 0.3167 0.4087 -0.1138 -0.0794 -0.1088 84  PRO A O   
642  C CB  . PRO A 84  ? 0.4112 0.3287 0.4256 -0.0943 -0.0660 -0.1101 84  PRO A CB  
643  C CG  . PRO A 84  ? 0.4134 0.3191 0.4307 -0.0919 -0.0577 -0.1085 84  PRO A CG  
644  C CD  . PRO A 84  ? 0.4493 0.3557 0.4740 -0.0985 -0.0568 -0.1023 84  PRO A CD  
645  N N   . ASN A 85  ? 0.4341 0.3936 0.4578 -0.1010 -0.0809 -0.1042 85  ASN A N   
646  C CA  . ASN A 85  ? 0.3123 0.2841 0.3388 -0.1075 -0.0905 -0.1068 85  ASN A CA  
647  C C   . ASN A 85  ? 0.3445 0.3174 0.3587 -0.1059 -0.0963 -0.1130 85  ASN A C   
648  O O   . ASN A 85  ? 0.3625 0.3496 0.3778 -0.1084 -0.1049 -0.1146 85  ASN A O   
649  C CB  . ASN A 85  ? 0.2945 0.2866 0.3320 -0.1051 -0.0928 -0.1005 85  ASN A CB  
650  C CG  . ASN A 85  ? 0.3895 0.3893 0.4227 -0.0937 -0.0899 -0.0973 85  ASN A CG  
651  O OD1 . ASN A 85  ? 0.3834 0.3733 0.4079 -0.0883 -0.0830 -0.0972 85  ASN A OD1 
652  N ND2 . ASN A 85  ? 0.3220 0.3396 0.3619 -0.0905 -0.0952 -0.0947 85  ASN A ND2 
653  N N   . THR A 86  ? 0.3418 0.3006 0.3442 -0.1015 -0.0921 -0.1164 86  THR A N   
654  C CA  . THR A 86  ? 0.4143 0.3697 0.4022 -0.1021 -0.0973 -0.1236 86  THR A CA  
655  C C   . THR A 86  ? 0.4197 0.3530 0.3994 -0.1035 -0.0941 -0.1306 86  THR A C   
656  O O   . THR A 86  ? 0.4416 0.3639 0.4265 -0.1005 -0.0870 -0.1285 86  THR A O   
657  C CB  . THR A 86  ? 0.3911 0.3539 0.3690 -0.0938 -0.0964 -0.1212 86  THR A CB  
658  O OG1 . THR A 86  ? 0.4040 0.3554 0.3785 -0.0873 -0.0876 -0.1192 86  THR A OG1 
659  C CG2 . THR A 86  ? 0.3182 0.3009 0.3049 -0.0904 -0.0983 -0.1146 86  THR A CG2 
660  N N   . ASP A 87  ? 0.4573 0.3849 0.4242 -0.1077 -0.0999 -0.1393 87  ASP A N   
661  C CA  . ASP A 87  ? 0.5775 0.4841 0.5335 -0.1077 -0.0977 -0.1479 87  ASP A CA  
662  C C   . ASP A 87  ? 0.5579 0.4552 0.5126 -0.0977 -0.0892 -0.1449 87  ASP A C   
663  O O   . ASP A 87  ? 0.5454 0.4515 0.4971 -0.0912 -0.0866 -0.1395 87  ASP A O   
664  C CB  . ASP A 87  ? 0.6511 0.5570 0.5877 -0.1095 -0.1036 -0.1563 87  ASP A CB  
665  C CG  . ASP A 87  ? 0.6911 0.5985 0.6254 -0.1205 -0.1128 -0.1637 87  ASP A CG  
666  O OD1 . ASP A 87  ? 0.7121 0.6078 0.6534 -0.1271 -0.1127 -0.1677 87  ASP A OD1 
667  O OD2 . ASP A 87  ? 0.8175 0.7377 0.7427 -0.1227 -0.1203 -0.1657 87  ASP A OD2 
668  N N   . LEU A 88  ? 0.5302 0.4096 0.4875 -0.0964 -0.0854 -0.1487 88  LEU A N   
669  C CA  . LEU A 88  ? 0.4865 0.3560 0.4419 -0.0864 -0.0792 -0.1474 88  LEU A CA  
670  C C   . LEU A 88  ? 0.5601 0.4179 0.4948 -0.0840 -0.0805 -0.1564 88  LEU A C   
671  O O   . LEU A 88  ? 0.5207 0.3713 0.4455 -0.0902 -0.0849 -0.1660 88  LEU A O   
672  C CB  . LEU A 88  ? 0.4330 0.2888 0.4006 -0.0851 -0.0754 -0.1480 88  LEU A CB  
673  C CG  . LEU A 88  ? 0.4680 0.3329 0.4530 -0.0906 -0.0725 -0.1409 88  LEU A CG  
674  C CD1 . LEU A 88  ? 0.4163 0.2679 0.4119 -0.0890 -0.0656 -0.1417 88  LEU A CD1 
675  C CD2 . LEU A 88  ? 0.3632 0.2481 0.3535 -0.0871 -0.0699 -0.1305 88  LEU A CD2 
676  N N   . SER A 89  ? 0.6105 0.4658 0.5370 -0.0759 -0.0761 -0.1540 89  SER A N   
677  C CA  . SER A 89  ? 0.4474 0.2947 0.3518 -0.0747 -0.0752 -0.1626 89  SER A CA  
678  C C   . SER A 89  ? 0.5548 0.3989 0.4532 -0.0665 -0.0685 -0.1586 89  SER A C   
679  O O   . SER A 89  ? 0.6517 0.5055 0.5609 -0.0633 -0.0664 -0.1482 89  SER A O   
680  C CB  . SER A 89  ? 0.4495 0.3118 0.3438 -0.0804 -0.0794 -0.1640 89  SER A CB  
681  O OG  . SER A 89  ? 0.4731 0.3293 0.3446 -0.0802 -0.0780 -0.1729 89  SER A OG  
682  N N   . GLU A 90  ? 0.5866 0.4172 0.4671 -0.0637 -0.0644 -0.1677 90  GLU A N   
683  C CA  . GLU A 90  ? 0.5643 0.3942 0.4370 -0.0587 -0.0559 -0.1665 90  GLU A CA  
684  C C   . GLU A 90  ? 0.5919 0.4400 0.4578 -0.0620 -0.0539 -0.1632 90  GLU A C   
685  O O   . GLU A 90  ? 0.4275 0.2830 0.2947 -0.0598 -0.0474 -0.1571 90  GLU A O   
686  C CB  . GLU A 90  ? 0.5490 0.3622 0.4046 -0.0560 -0.0485 -0.1799 90  GLU A CB  
687  C CG  . GLU A 90  ? 0.4988 0.2918 0.3585 -0.0503 -0.0464 -0.1810 90  GLU A CG  
688  C CD  . GLU A 90  ? 0.7268 0.5076 0.5719 -0.0458 -0.0357 -0.1953 90  GLU A CD  
689  O OE1 . GLU A 90  ? 0.7718 0.5440 0.6038 -0.0478 -0.0362 -0.2076 90  GLU A OE1 
690  O OE2 . GLU A 90  ? 0.7111 0.4956 0.5611 -0.0405 -0.0252 -0.1946 90  GLU A OE2 
691  N N   . ASP A 91  ? 0.5601 0.4150 0.4172 -0.0683 -0.0587 -0.1664 91  ASP A N   
692  C CA  . ASP A 91  ? 0.6086 0.4787 0.4563 -0.0723 -0.0581 -0.1610 91  ASP A CA  
693  C C   . ASP A 91  ? 0.5650 0.4479 0.4321 -0.0713 -0.0638 -0.1498 91  ASP A C   
694  O O   . ASP A 91  ? 0.6151 0.5054 0.4878 -0.0750 -0.0716 -0.1491 91  ASP A O   
695  C CB  . ASP A 91  ? 0.4788 0.3500 0.3064 -0.0795 -0.0621 -0.1683 91  ASP A CB  
696  C CG  . ASP A 91  ? 0.6531 0.5375 0.4673 -0.0840 -0.0640 -0.1613 91  ASP A CG  
697  O OD1 . ASP A 91  ? 0.5006 0.3918 0.3200 -0.0819 -0.0611 -0.1515 91  ASP A OD1 
698  O OD2 . ASP A 91  ? 0.7284 0.6146 0.5247 -0.0900 -0.0691 -0.1655 91  ASP A OD2 
699  N N   . CYS A 92  ? 0.4477 0.3342 0.3247 -0.0667 -0.0593 -0.1418 92  CYS A N   
700  C CA  . CYS A 92  ? 0.4665 0.3640 0.3636 -0.0646 -0.0632 -0.1325 92  CYS A CA  
701  C C   . CYS A 92  ? 0.4672 0.3728 0.3646 -0.0629 -0.0587 -0.1239 92  CYS A C   
702  O O   . CYS A 92  ? 0.3953 0.3102 0.3083 -0.0608 -0.0606 -0.1170 92  CYS A O   
703  C CB  . CYS A 92  ? 0.4498 0.3413 0.3656 -0.0610 -0.0628 -0.1295 92  CYS A CB  
704  S SG  . CYS A 92  ? 0.4619 0.3408 0.3764 -0.0542 -0.0557 -0.1272 92  CYS A SG  
705  N N   . LEU A 93  ? 0.4524 0.3545 0.3320 -0.0646 -0.0517 -0.1249 93  LEU A N   
706  C CA  . LEU A 93  ? 0.4811 0.3882 0.3593 -0.0646 -0.0472 -0.1170 93  LEU A CA  
707  C C   . LEU A 93  ? 0.5671 0.4806 0.4341 -0.0690 -0.0523 -0.1111 93  LEU A C   
708  O O   . LEU A 93  ? 0.6732 0.5832 0.5159 -0.0747 -0.0509 -0.1111 93  LEU A O   
709  C CB  . LEU A 93  ? 0.3574 0.2595 0.2217 -0.0668 -0.0364 -0.1202 93  LEU A CB  
710  C CG  . LEU A 93  ? 0.4447 0.3403 0.3178 -0.0622 -0.0312 -0.1266 93  LEU A CG  
711  C CD1 . LEU A 93  ? 0.4645 0.3611 0.3277 -0.0650 -0.0181 -0.1313 93  LEU A CD1 
712  C CD2 . LEU A 93  ? 0.3800 0.2754 0.2753 -0.0558 -0.0353 -0.1203 93  LEU A CD2 
713  N N   . TYR A 94  ? 0.4649 0.3871 0.3478 -0.0667 -0.0583 -0.1061 94  TYR A N   
714  C CA  . TYR A 94  ? 0.4201 0.3479 0.2935 -0.0696 -0.0649 -0.1000 94  TYR A CA  
715  C C   . TYR A 94  ? 0.5027 0.4364 0.3918 -0.0659 -0.0649 -0.0925 94  TYR A C   
716  O O   . TYR A 94  ? 0.4492 0.3855 0.3586 -0.0616 -0.0602 -0.0928 94  TYR A O   
717  C CB  . TYR A 94  ? 0.4059 0.3413 0.2804 -0.0720 -0.0740 -0.1039 94  TYR A CB  
718  C CG  . TYR A 94  ? 0.5550 0.4843 0.4126 -0.0761 -0.0751 -0.1122 94  TYR A CG  
719  C CD1 . TYR A 94  ? 0.5145 0.4378 0.3806 -0.0750 -0.0722 -0.1207 94  TYR A CD1 
720  C CD2 . TYR A 94  ? 0.3983 0.3262 0.2295 -0.0812 -0.0799 -0.1112 94  TYR A CD2 
721  C CE1 . TYR A 94  ? 0.4731 0.3894 0.3223 -0.0790 -0.0728 -0.1293 94  TYR A CE1 
722  C CE2 . TYR A 94  ? 0.4255 0.3482 0.2399 -0.0854 -0.0802 -0.1195 94  TYR A CE2 
723  C CZ  . TYR A 94  ? 0.5370 0.4541 0.3608 -0.0843 -0.0762 -0.1292 94  TYR A CZ  
724  O OH  . TYR A 94  ? 0.6211 0.5320 0.4271 -0.0886 -0.0764 -0.1385 94  TYR A OH  
725  N N   . LEU A 95  ? 0.5570 0.4916 0.4349 -0.0674 -0.0711 -0.0854 95  LEU A N   
726  C CA  . LEU A 95  ? 0.5245 0.4632 0.4144 -0.0640 -0.0723 -0.0787 95  LEU A CA  
727  C C   . LEU A 95  ? 0.4597 0.4050 0.3449 -0.0638 -0.0843 -0.0738 95  LEU A C   
728  O O   . LEU A 95  ? 0.4603 0.4068 0.3307 -0.0664 -0.0924 -0.0745 95  LEU A O   
729  C CB  . LEU A 95  ? 0.2975 0.2236 0.1779 -0.0636 -0.0669 -0.0731 95  LEU A CB  
730  C CG  . LEU A 95  ? 0.5349 0.4448 0.3829 -0.0685 -0.0696 -0.0681 95  LEU A CG  
731  C CD1 . LEU A 95  ? 0.4139 0.3181 0.2476 -0.0672 -0.0827 -0.0597 95  LEU A CD1 
732  C CD2 . LEU A 95  ? 0.5683 0.4666 0.4093 -0.0710 -0.0598 -0.0659 95  LEU A CD2 
733  N N   . ASN A 96  ? 0.4327 0.3828 0.3303 -0.0601 -0.0862 -0.0690 96  ASN A N   
734  C CA  . ASN A 96  ? 0.4467 0.4051 0.3444 -0.0577 -0.0987 -0.0645 96  ASN A CA  
735  C C   . ASN A 96  ? 0.4550 0.4002 0.3446 -0.0521 -0.1041 -0.0561 96  ASN A C   
736  O O   . ASN A 96  ? 0.3852 0.3207 0.2782 -0.0509 -0.0960 -0.0549 96  ASN A O   
737  C CB  . ASN A 96  ? 0.4406 0.4199 0.3636 -0.0581 -0.0977 -0.0681 96  ASN A CB  
738  C CG  . ASN A 96  ? 0.4420 0.4272 0.3748 -0.0628 -0.0903 -0.0770 96  ASN A CG  
739  O OD1 . ASN A 96  ? 0.4001 0.3893 0.3270 -0.0659 -0.0954 -0.0819 96  ASN A OD1 
740  N ND2 . ASN A 96  ? 0.2519 0.2360 0.1993 -0.0622 -0.0797 -0.0791 96  ASN A ND2 
741  N N   . VAL A 97  ? 0.4440 0.3885 0.3230 -0.0476 -0.1187 -0.0506 97  VAL A N   
742  C CA  . VAL A 97  ? 0.4782 0.4079 0.3502 -0.0393 -0.1270 -0.0433 97  VAL A CA  
743  C C   . VAL A 97  ? 0.5529 0.5008 0.4400 -0.0300 -0.1408 -0.0413 97  VAL A C   
744  O O   . VAL A 97  ? 0.4777 0.4407 0.3638 -0.0297 -0.1499 -0.0408 97  VAL A O   
745  C CB  . VAL A 97  ? 0.4692 0.3718 0.3067 -0.0396 -0.1326 -0.0361 97  VAL A CB  
746  C CG1 . VAL A 97  ? 0.4078 0.2883 0.2362 -0.0309 -0.1396 -0.0292 97  VAL A CG1 
747  C CG2 . VAL A 97  ? 0.3658 0.2569 0.1892 -0.0501 -0.1183 -0.0391 97  VAL A CG2 
748  N N   . TRP A 98  ? 0.5079 0.4575 0.4111 -0.0222 -0.1418 -0.0410 98  TRP A N   
749  C CA  . TRP A 98  ? 0.4319 0.3998 0.3516 -0.0105 -0.1544 -0.0395 98  TRP A CA  
750  C C   . TRP A 98  ? 0.5024 0.4457 0.4086 0.0029  -0.1640 -0.0334 98  TRP A C   
751  O O   . TRP A 98  ? 0.4770 0.4003 0.3784 0.0030  -0.1580 -0.0343 98  TRP A O   
752  C CB  . TRP A 98  ? 0.3776 0.3697 0.3284 -0.0109 -0.1475 -0.0453 98  TRP A CB  
753  C CG  . TRP A 98  ? 0.4160 0.4317 0.3797 -0.0230 -0.1400 -0.0499 98  TRP A CG  
754  C CD1 . TRP A 98  ? 0.3876 0.4312 0.3642 -0.0246 -0.1465 -0.0510 98  TRP A CD1 
755  C CD2 . TRP A 98  ? 0.4410 0.4540 0.4057 -0.0350 -0.1246 -0.0540 98  TRP A CD2 
756  N NE1 . TRP A 98  ? 0.3642 0.4192 0.3467 -0.0385 -0.1366 -0.0557 98  TRP A NE1 
757  C CE2 . TRP A 98  ? 0.3648 0.4007 0.3404 -0.0436 -0.1232 -0.0577 98  TRP A CE2 
758  C CE3 . TRP A 98  ? 0.4578 0.4521 0.4157 -0.0387 -0.1120 -0.0549 98  TRP A CE3 
759  C CZ2 . TRP A 98  ? 0.4251 0.4619 0.4036 -0.0540 -0.1105 -0.0626 98  TRP A CZ2 
760  C CZ3 . TRP A 98  ? 0.4128 0.4119 0.3764 -0.0476 -0.0993 -0.0592 98  TRP A CZ3 
761  C CH2 . TRP A 98  ? 0.4518 0.4699 0.4249 -0.0545 -0.0990 -0.0632 98  TRP A CH2 
762  N N   . ILE A 99  ? 0.3624 0.3058 0.2613 0.0141  -0.1786 -0.0269 99  ILE A N   
763  C CA  . ILE A 99  ? 0.6266 0.5442 0.5121 0.0294  -0.1881 -0.0195 99  ILE A CA  
764  C C   . ILE A 99  ? 0.6235 0.5651 0.5343 0.0478  -0.1987 -0.0190 99  ILE A C   
765  O O   . ILE A 99  ? 0.4792 0.4524 0.4054 0.0477  -0.2033 -0.0201 99  ILE A O   
766  C CB  . ILE A 99  ? 0.6318 0.5165 0.4776 0.0272  -0.1936 -0.0089 99  ILE A CB  
767  C CG1 . ILE A 99  ? 0.6846 0.5869 0.5283 0.0304  -0.2043 -0.0044 99  ILE A CG1 
768  C CG2 . ILE A 99  ? 0.5877 0.4557 0.4115 0.0079  -0.1804 -0.0111 99  ILE A CG2 
769  C CD1 . ILE A 99  ? 0.8367 0.7082 0.6413 0.0283  -0.2093 0.0066  99  ILE A CD1 
770  N N   . PRO A 100 ? 0.6596 0.5881 0.5764 0.0637  -0.2014 -0.0181 100 PRO A N   
771  C CA  . PRO A 100 ? 0.5878 0.5418 0.5323 0.0824  -0.2084 -0.0193 100 PRO A CA  
772  C C   . PRO A 100 ? 0.5601 0.5095 0.4911 0.0918  -0.2212 -0.0093 100 PRO A C   
773  O O   . PRO A 100 ? 0.5481 0.4642 0.4447 0.0874  -0.2245 -0.0003 100 PRO A O   
774  C CB  . PRO A 100 ? 0.5378 0.4707 0.4865 0.0965  -0.2049 -0.0208 100 PRO A CB  
775  C CG  . PRO A 100 ? 0.6227 0.5123 0.5397 0.0839  -0.1939 -0.0161 100 PRO A CG  
776  C CD  . PRO A 100 ? 0.6574 0.5541 0.5641 0.0621  -0.1883 -0.0180 100 PRO A CD  
777  N N   . ALA A 101 ? 0.5676 0.5519 0.5248 0.1029  -0.2278 -0.0109 101 ALA A N   
778  C CA  . ALA A 101 ? 0.5825 0.5644 0.5307 0.1152  -0.2412 -0.0013 101 ALA A CA  
779  C C   . ALA A 101 ? 0.6171 0.5986 0.5832 0.1393  -0.2448 -0.0013 101 ALA A C   
780  O O   . ALA A 101 ? 0.5876 0.6009 0.5880 0.1458  -0.2398 -0.0108 101 ALA A O   
781  C CB  . ALA A 101 ? 0.5382 0.5614 0.5001 0.1082  -0.2473 -0.0023 101 ALA A CB  
782  N N   . PRO A 102 ? 0.7216 0.6666 0.6641 0.1517  -0.2524 0.0092  102 PRO A N   
783  C CA  . PRO A 102 ? 0.7135 0.6223 0.6142 0.1428  -0.2575 0.0213  102 PRO A CA  
784  C C   . PRO A 102 ? 0.6295 0.4963 0.5007 0.1288  -0.2473 0.0225  102 PRO A C   
785  O O   . PRO A 102 ? 0.6174 0.4718 0.4967 0.1316  -0.2385 0.0166  102 PRO A O   
786  C CB  . PRO A 102 ? 0.7856 0.6714 0.6761 0.1627  -0.2680 0.0318  102 PRO A CB  
787  C CG  . PRO A 102 ? 0.7661 0.6570 0.6847 0.1804  -0.2632 0.0239  102 PRO A CG  
788  C CD  . PRO A 102 ? 0.7400 0.6810 0.6967 0.1757  -0.2566 0.0102  102 PRO A CD  
789  N N   . LYS A 103 ? 0.6135 0.4612 0.4512 0.1133  -0.2482 0.0299  103 LYS A N   
790  C CA  . LYS A 103 ? 0.6221 0.4313 0.4276 0.0972  -0.2385 0.0326  103 LYS A CA  
791  C C   . LYS A 103 ? 0.6709 0.4422 0.4694 0.1049  -0.2326 0.0342  103 LYS A C   
792  O O   . LYS A 103 ? 0.7196 0.4668 0.5095 0.1186  -0.2378 0.0417  103 LYS A O   
793  C CB  . LYS A 103 ? 0.7575 0.5435 0.5237 0.0870  -0.2427 0.0442  103 LYS A CB  
794  C CG  . LYS A 103 ? 0.9187 0.6737 0.6520 0.0661  -0.2307 0.0459  103 LYS A CG  
795  C CD  . LYS A 103 ? 1.0175 0.7584 0.7150 0.0549  -0.2336 0.0555  103 LYS A CD  
796  C CE  . LYS A 103 ? 1.0365 0.7462 0.7006 0.0341  -0.2199 0.0575  103 LYS A CE  
797  N NZ  . LYS A 103 ? 1.0402 0.7037 0.6826 0.0355  -0.2153 0.0661  103 LYS A NZ  
798  N N   . PRO A 104 ? 0.6030 0.3693 0.4060 0.0956  -0.2213 0.0267  104 PRO A N   
799  C CA  . PRO A 104 ? 0.6187 0.3508 0.4173 0.1012  -0.2138 0.0267  104 PRO A CA  
800  C C   . PRO A 104 ? 0.6674 0.3499 0.4236 0.0906  -0.2099 0.0383  104 PRO A C   
801  O O   . PRO A 104 ? 0.6247 0.3026 0.3558 0.0776  -0.2119 0.0451  104 PRO A O   
802  C CB  . PRO A 104 ? 0.5223 0.2737 0.3408 0.0870  -0.1968 0.0140  104 PRO A CB  
803  C CG  . PRO A 104 ? 0.6074 0.3788 0.4193 0.0684  -0.1946 0.0125  104 PRO A CG  
804  C CD  . PRO A 104 ? 0.5200 0.3103 0.3305 0.0779  -0.2140 0.0180  104 PRO A CD  
805  N N   . LYS A 105 ? 0.7731 0.4212 0.5224 0.0942  -0.2028 0.0393  105 LYS A N   
806  C CA  . LYS A 105 ? 0.8812 0.4843 0.5927 0.0815  -0.1970 0.0493  105 LYS A CA  
807  C C   . LYS A 105 ? 0.9685 0.5571 0.6659 0.0584  -0.1814 0.0464  105 LYS A C   
808  O O   . LYS A 105 ? 1.0751 0.6502 0.7432 0.0404  -0.1773 0.0531  105 LYS A O   
809  C CB  . LYS A 105 ? 0.8502 0.4251 0.5608 0.0948  -0.1966 0.0514  105 LYS A CB  
810  C CG  . LYS A 105 ? 0.8598 0.4381 0.5739 0.1153  -0.2117 0.0583  105 LYS A CG  
811  C CD  . LYS A 105 ? 0.9497 0.5074 0.6281 0.1067  -0.2184 0.0728  105 LYS A CD  
812  C CE  . LYS A 105 ? 0.9303 0.4745 0.6047 0.1262  -0.2313 0.0822  105 LYS A CE  
813  N NZ  . LYS A 105 ? 0.8350 0.4203 0.5452 0.1483  -0.2430 0.0770  105 LYS A NZ  
814  N N   . ASN A 106 ? 0.8978 0.4936 0.6183 0.0581  -0.1711 0.0353  106 ASN A N   
815  C CA  . ASN A 106 ? 0.9112 0.5020 0.6276 0.0356  -0.1523 0.0293  106 ASN A CA  
816  C C   . ASN A 106 ? 0.8762 0.5082 0.6311 0.0340  -0.1423 0.0135  106 ASN A C   
817  O O   . ASN A 106 ? 0.8391 0.4648 0.6045 0.0316  -0.1322 0.0060  106 ASN A O   
818  C CB  . ASN A 106 ? 1.0249 0.5796 0.7273 0.0318  -0.1441 0.0312  106 ASN A CB  
819  C CG  . ASN A 106 ? 1.1429 0.6793 0.8183 0.0066  -0.1313 0.0353  106 ASN A CG  
820  O OD1 . ASN A 106 ? 1.0428 0.5860 0.7057 -0.0076 -0.1290 0.0374  106 ASN A OD1 
821  N ND2 . ASN A 106 ? 1.3974 0.9118 1.0638 0.0009  -0.1229 0.0364  106 ASN A ND2 
822  N N   . ALA A 107 ? 0.7742 0.4470 0.5481 0.0343  -0.1456 0.0088  107 ALA A N   
823  C CA  . ALA A 107 ? 0.5695 0.2818 0.3801 0.0361  -0.1395 -0.0043 107 ALA A CA  
824  C C   . ALA A 107 ? 0.5332 0.2562 0.3499 0.0171  -0.1235 -0.0121 107 ALA A C   
825  O O   . ALA A 107 ? 0.4567 0.1779 0.2578 0.0017  -0.1186 -0.0101 107 ALA A O   
826  C CB  . ALA A 107 ? 0.4876 0.2377 0.3158 0.0427  -0.1498 -0.0060 107 ALA A CB  
827  N N   . THR A 108 ? 0.4157 0.1516 0.2555 0.0191  -0.1157 -0.0216 108 THR A N   
828  C CA  . THR A 108 ? 0.4479 0.2005 0.2990 0.0042  -0.1028 -0.0295 108 THR A CA  
829  C C   . THR A 108 ? 0.4875 0.2728 0.3508 -0.0011 -0.1041 -0.0323 108 THR A C   
830  O O   . THR A 108 ? 0.4632 0.2690 0.3392 0.0086  -0.1134 -0.0324 108 THR A O   
831  C CB  . THR A 108 ? 0.4332 0.1962 0.3062 0.0092  -0.0966 -0.0387 108 THR A CB  
832  O OG1 . THR A 108 ? 0.5035 0.2328 0.3623 0.0102  -0.0935 -0.0376 108 THR A OG1 
833  C CG2 . THR A 108 ? 0.4370 0.2251 0.3252 -0.0040 -0.0849 -0.0451 108 THR A CG2 
834  N N   . VAL A 109 ? 0.4319 0.2220 0.2919 -0.0166 -0.0948 -0.0351 109 VAL A N   
835  C CA  . VAL A 109 ? 0.4542 0.2679 0.3209 -0.0227 -0.0956 -0.0379 109 VAL A CA  
836  C C   . VAL A 109 ? 0.4332 0.2790 0.3289 -0.0265 -0.0819 -0.0428 109 VAL A C   
837  O O   . VAL A 109 ? 0.4184 0.2678 0.3201 -0.0317 -0.0688 -0.0432 109 VAL A O   
838  C CB  . VAL A 109 ? 0.4404 0.2422 0.2831 -0.0343 -0.0922 -0.0337 109 VAL A CB  
839  C CG1 . VAL A 109 ? 0.3551 0.1849 0.2089 -0.0380 -0.0900 -0.0361 109 VAL A CG1 
840  C CG2 . VAL A 109 ? 0.4172 0.1916 0.2316 -0.0299 -0.1019 -0.0239 109 VAL A CG2 
841  N N   . LEU A 110 ? 0.3971 0.2675 0.3106 -0.0238 -0.0852 -0.0460 110 LEU A N   
842  C CA  . LEU A 110 ? 0.4194 0.3169 0.3558 -0.0278 -0.0727 -0.0490 110 LEU A CA  
843  C C   . LEU A 110 ? 0.4465 0.3567 0.3844 -0.0343 -0.0676 -0.0493 110 LEU A C   
844  O O   . LEU A 110 ? 0.4899 0.4049 0.4248 -0.0340 -0.0756 -0.0493 110 LEU A O   
845  C CB  . LEU A 110 ? 0.3585 0.2735 0.3135 -0.0219 -0.0775 -0.0525 110 LEU A CB  
846  C CG  . LEU A 110 ? 0.4579 0.3644 0.4164 -0.0143 -0.0799 -0.0556 110 LEU A CG  
847  C CD1 . LEU A 110 ? 0.4696 0.3979 0.4483 -0.0085 -0.0846 -0.0612 110 LEU A CD1 
848  C CD2 . LEU A 110 ? 0.5687 0.4744 0.5285 -0.0202 -0.0652 -0.0548 110 LEU A CD2 
849  N N   . ILE A 111 ? 0.4321 0.3492 0.3762 -0.0391 -0.0550 -0.0509 111 ILE A N   
850  C CA  . ILE A 111 ? 0.4140 0.3416 0.3619 -0.0428 -0.0504 -0.0536 111 ILE A CA  
851  C C   . ILE A 111 ? 0.3219 0.2682 0.2893 -0.0431 -0.0428 -0.0568 111 ILE A C   
852  O O   . ILE A 111 ? 0.3519 0.3033 0.3290 -0.0428 -0.0353 -0.0579 111 ILE A O   
853  C CB  . ILE A 111 ? 0.3921 0.3116 0.3315 -0.0462 -0.0450 -0.0543 111 ILE A CB  
854  C CG1 . ILE A 111 ? 0.3566 0.2520 0.2685 -0.0490 -0.0513 -0.0493 111 ILE A CG1 
855  C CG2 . ILE A 111 ? 0.2229 0.1514 0.1671 -0.0477 -0.0422 -0.0588 111 ILE A CG2 
856  C CD1 . ILE A 111 ? 0.3548 0.2409 0.2516 -0.0560 -0.0454 -0.0492 111 ILE A CD1 
857  N N   . TRP A 112 ? 0.2674 0.2226 0.2384 -0.0446 -0.0456 -0.0578 112 TRP A N   
858  C CA  . TRP A 112 ? 0.2412 0.2080 0.2237 -0.0467 -0.0393 -0.0586 112 TRP A CA  
859  C C   . TRP A 112 ? 0.2666 0.2340 0.2532 -0.0466 -0.0340 -0.0611 112 TRP A C   
860  O O   . TRP A 112 ? 0.2833 0.2486 0.2668 -0.0464 -0.0369 -0.0649 112 TRP A O   
861  C CB  . TRP A 112 ? 0.2981 0.2726 0.2825 -0.0491 -0.0457 -0.0583 112 TRP A CB  
862  C CG  . TRP A 112 ? 0.3576 0.3387 0.3489 -0.0519 -0.0406 -0.0566 112 TRP A CG  
863  C CD1 . TRP A 112 ? 0.3628 0.3458 0.3564 -0.0548 -0.0404 -0.0593 112 TRP A CD1 
864  C CD2 . TRP A 112 ? 0.3382 0.3205 0.3330 -0.0522 -0.0382 -0.0526 112 TRP A CD2 
865  N NE1 . TRP A 112 ? 0.2882 0.2724 0.2866 -0.0572 -0.0380 -0.0572 112 TRP A NE1 
866  C CE2 . TRP A 112 ? 0.2610 0.2454 0.2597 -0.0557 -0.0370 -0.0527 112 TRP A CE2 
867  C CE3 . TRP A 112 ? 0.2618 0.2430 0.2568 -0.0500 -0.0377 -0.0500 112 TRP A CE3 
868  C CZ2 . TRP A 112 ? 0.1702 0.1563 0.1726 -0.0572 -0.0354 -0.0498 112 TRP A CZ2 
869  C CZ3 . TRP A 112 ? 0.2024 0.1861 0.2007 -0.0513 -0.0363 -0.0469 112 TRP A CZ3 
870  C CH2 . TRP A 112 ? 0.1858 0.1722 0.1874 -0.0550 -0.0353 -0.0464 112 TRP A CH2 
871  N N   . ILE A 113 ? 0.2697 0.2374 0.2604 -0.0471 -0.0286 -0.0591 113 ILE A N   
872  C CA  . ILE A 113 ? 0.2297 0.1956 0.2224 -0.0481 -0.0250 -0.0615 113 ILE A CA  
873  C C   . ILE A 113 ? 0.3306 0.2920 0.3186 -0.0527 -0.0253 -0.0566 113 ILE A C   
874  O O   . ILE A 113 ? 0.4318 0.3913 0.4196 -0.0522 -0.0258 -0.0519 113 ILE A O   
875  C CB  . ILE A 113 ? 0.2922 0.2590 0.2925 -0.0436 -0.0216 -0.0636 113 ILE A CB  
876  C CG1 . ILE A 113 ? 0.3307 0.2860 0.3282 -0.0356 -0.0341 -0.0626 113 ILE A CG1 
877  C CG2 . ILE A 113 ? 0.2039 0.1291 0.1685 -0.0448 -0.0381 -0.0487 113 ILE A CG2 
878  C CD1 . ILE A 113 ? 0.1697 0.1119 0.1568 -0.0356 -0.0365 -0.0581 113 ILE A CD1 
879  N N   . TYR A 114 ? 0.3010 0.2629 0.2914 -0.0549 -0.0267 -0.0601 114 TYR A N   
880  C CA  . TYR A 114 ? 0.2571 0.2178 0.2511 -0.0577 -0.0282 -0.0586 114 TYR A CA  
881  C C   . TYR A 114 ? 0.3707 0.3200 0.3616 -0.0580 -0.0267 -0.0568 114 TYR A C   
882  O O   . TYR A 114 ? 0.3087 0.2475 0.2911 -0.0569 -0.0259 -0.0567 114 TYR A O   
883  C CB  . TYR A 114 ? 0.2167 0.1807 0.2156 -0.0604 -0.0308 -0.0643 114 TYR A CB  
884  C CG  . TYR A 114 ? 0.2712 0.2298 0.2680 -0.0600 -0.0294 -0.0708 114 TYR A CG  
885  C CD1 . TYR A 114 ? 0.2752 0.2201 0.2645 -0.0629 -0.0255 -0.0714 114 TYR A CD1 
886  C CD2 . TYR A 114 ? 0.1932 0.1569 0.1927 -0.0561 -0.0346 -0.0759 114 TYR A CD2 
887  C CE1 . TYR A 114 ? 0.2158 0.1549 0.2000 -0.0638 -0.0228 -0.0777 114 TYR A CE1 
888  C CE2 . TYR A 114 ? 0.2042 0.1611 0.2046 -0.0518 -0.0390 -0.0823 114 TYR A CE2 
889  C CZ  . TYR A 114 ? 0.3214 0.2704 0.3267 -0.0496 -0.0375 -0.0857 114 TYR A CZ  
890  O OH  . TYR A 114 ? 0.2325 0.1589 0.2239 -0.0437 -0.0510 -0.0860 114 TYR A OH  
891  N N   . GLY A 115 ? 0.1755 0.1262 0.1736 -0.0592 -0.0278 -0.0556 115 GLY A N   
892  C CA  . GLY A 115 ? 0.2966 0.2365 0.2953 -0.0592 -0.0277 -0.0557 115 GLY A CA  
893  C C   . GLY A 115 ? 0.3536 0.2840 0.3523 -0.0628 -0.0277 -0.0603 115 GLY A C   
894  O O   . GLY A 115 ? 0.2911 0.2246 0.2892 -0.0651 -0.0276 -0.0641 115 GLY A O   
895  N N   . GLY A 116 ? 0.3439 0.2617 0.3441 -0.0630 -0.0283 -0.0606 116 GLY A N   
896  C CA  . GLY A 116 ? 0.2840 0.1873 0.2824 -0.0658 -0.0280 -0.0653 116 GLY A CA  
897  C C   . GLY A 116 ? 0.3873 0.2715 0.3824 -0.0616 -0.0288 -0.0669 116 GLY A C   
898  O O   . GLY A 116 ? 0.4305 0.2985 0.4210 -0.0615 -0.0282 -0.0723 116 GLY A O   
899  N N   . GLY A 117 ? 0.4150 0.3020 0.4153 -0.0556 -0.0321 -0.0624 117 GLY A N   
900  C CA  . GLY A 117 ? 0.4198 0.2935 0.4253 -0.0472 -0.0368 -0.0638 117 GLY A CA  
901  C C   . GLY A 117 ? 0.4032 0.2720 0.4056 -0.0418 -0.0345 -0.0715 117 GLY A C   
902  O O   . GLY A 117 ? 0.4666 0.3226 0.4752 -0.0341 -0.0372 -0.0762 117 GLY A O   
903  N N   . PHE A 118 ? 0.3881 0.2660 0.3809 -0.0453 -0.0301 -0.0728 118 PHE A N   
904  C CA  . PHE A 118 ? 0.4017 0.2744 0.3880 -0.0420 -0.0282 -0.0801 118 PHE A CA  
905  C C   . PHE A 118 ? 0.4132 0.2669 0.3911 -0.0438 -0.0270 -0.0865 118 PHE A C   
906  O O   . PHE A 118 ? 0.3873 0.2342 0.3606 -0.0395 -0.0256 -0.0944 118 PHE A O   
907  C CB  . PHE A 118 ? 0.3755 0.2544 0.3769 -0.0315 -0.0290 -0.0855 118 PHE A CB  
908  C CG  . PHE A 118 ? 0.3458 0.2430 0.3537 -0.0312 -0.0292 -0.0811 118 PHE A CG  
909  C CD1 . PHE A 118 ? 0.2935 0.1986 0.2916 -0.0350 -0.0265 -0.0794 118 PHE A CD1 
910  C CD2 . PHE A 118 ? 0.3393 0.2429 0.3616 -0.0273 -0.0334 -0.0783 118 PHE A CD2 
911  C CE1 . PHE A 118 ? 0.2833 0.2022 0.2859 -0.0353 -0.0263 -0.0753 118 PHE A CE1 
912  C CE2 . PHE A 118 ? 0.2418 0.1611 0.2683 -0.0281 -0.0332 -0.0750 118 PHE A CE2 
913  C CZ  . PHE A 118 ? 0.2388 0.1653 0.2551 -0.0323 -0.0288 -0.0736 118 PHE A CZ  
914  N N   . GLN A 119 ? 0.4001 0.2465 0.3773 -0.0504 -0.0269 -0.0844 119 GLN A N   
915  C CA  . GLN A 119 ? 0.4732 0.3001 0.4438 -0.0533 -0.0254 -0.0908 119 GLN A CA  
916  C C   . GLN A 119 ? 0.5946 0.4326 0.5605 -0.0635 -0.0227 -0.0892 119 GLN A C   
917  O O   . GLN A 119 ? 0.7115 0.5400 0.6695 -0.0674 -0.0206 -0.0952 119 GLN A O   
918  C CB  . GLN A 119 ? 0.3288 0.1403 0.3099 -0.0502 -0.0286 -0.0895 119 GLN A CB  
919  C CG  . GLN A 119 ? 0.6337 0.4426 0.6276 -0.0373 -0.0340 -0.0876 119 GLN A CG  
920  C CD  . GLN A 119 ? 0.7192 0.5262 0.7158 -0.0263 -0.0324 -0.0970 119 GLN A CD  
921  O OE1 . GLN A 119 ? 0.6913 0.5148 0.6985 -0.0193 -0.0333 -0.0978 119 GLN A OE1 
922  N NE2 . GLN A 119 ? 0.7206 0.5089 0.7090 -0.0249 -0.0292 -0.1057 119 GLN A NE2 
923  N N   . THR A 120 ? 0.5405 0.3998 0.5149 -0.0670 -0.0230 -0.0834 120 THR A N   
924  C CA  . THR A 120 ? 0.5234 0.3982 0.5060 -0.0734 -0.0231 -0.0860 120 THR A CA  
925  C C   . THR A 120 ? 0.4641 0.3614 0.4504 -0.0724 -0.0241 -0.0822 120 THR A C   
926  O O   . THR A 120 ? 0.4001 0.2985 0.3794 -0.0685 -0.0240 -0.0766 120 THR A O   
927  C CB  . THR A 120 ? 0.4712 0.3446 0.4678 -0.0774 -0.0264 -0.0853 120 THR A CB  
928  O OG1 . THR A 120 ? 0.3440 0.2246 0.3456 -0.0761 -0.0283 -0.0771 120 THR A OG1 
929  C CG2 . THR A 120 ? 0.3134 0.1609 0.3071 -0.0784 -0.0254 -0.0888 120 THR A CG2 
930  N N   . GLY A 121 ? 0.4209 0.3345 0.4207 -0.0739 -0.0279 -0.0858 121 GLY A N   
931  C CA  . GLY A 121 ? 0.3411 0.2731 0.3460 -0.0711 -0.0309 -0.0828 121 GLY A CA  
932  C C   . GLY A 121 ? 0.3247 0.2654 0.3334 -0.0675 -0.0368 -0.0887 121 GLY A C   
933  O O   . GLY A 121 ? 0.3770 0.3112 0.3854 -0.0646 -0.0393 -0.0955 121 GLY A O   
934  N N   . THR A 122 ? 0.2972 0.2497 0.3075 -0.0668 -0.0417 -0.0857 122 THR A N   
935  C CA  . THR A 122 ? 0.4157 0.3726 0.4220 -0.0650 -0.0488 -0.0889 122 THR A CA  
936  C C   . THR A 122 ? 0.4405 0.4109 0.4464 -0.0648 -0.0499 -0.0840 122 THR A C   
937  O O   . THR A 122 ? 0.4389 0.4163 0.4508 -0.0668 -0.0487 -0.0800 122 THR A O   
938  C CB  . THR A 122 ? 0.3714 0.3246 0.3771 -0.0700 -0.0564 -0.0946 122 THR A CB  
939  O OG1 . THR A 122 ? 0.3807 0.3365 0.3766 -0.0694 -0.0623 -0.0978 122 THR A OG1 
940  C CG2 . THR A 122 ? 0.2474 0.2092 0.2616 -0.0756 -0.0598 -0.0924 122 THR A CG2 
941  N N   . SER A 123 ? 0.3749 0.3478 0.3727 -0.0623 -0.0526 -0.0847 123 SER A N   
942  C CA  . SER A 123 ? 0.3718 0.3551 0.3668 -0.0617 -0.0535 -0.0804 123 SER A CA  
943  C C   . SER A 123 ? 0.3447 0.3419 0.3438 -0.0652 -0.0600 -0.0812 123 SER A C   
944  O O   . SER A 123 ? 0.3383 0.3457 0.3373 -0.0657 -0.0617 -0.0770 123 SER A O   
945  C CB  . SER A 123 ? 0.2964 0.2756 0.2797 -0.0587 -0.0553 -0.0810 123 SER A CB  
946  O OG  . SER A 123 ? 0.4028 0.3787 0.3783 -0.0602 -0.0611 -0.0868 123 SER A OG  
947  N N   . SER A 124 ? 0.2707 0.2668 0.2729 -0.0681 -0.0653 -0.0866 124 SER A N   
948  C CA  . SER A 124 ? 0.2328 0.2429 0.2402 -0.0710 -0.0736 -0.0892 124 SER A CA  
949  C C   . SER A 124 ? 0.2777 0.2956 0.3013 -0.0729 -0.0748 -0.0877 124 SER A C   
950  O O   . SER A 124 ? 0.3068 0.3340 0.3380 -0.0753 -0.0838 -0.0897 124 SER A O   
951  C CB  . SER A 124 ? 0.2843 0.2875 0.2856 -0.0743 -0.0809 -0.0958 124 SER A CB  
952  O OG  . SER A 124 ? 0.2981 0.2849 0.3003 -0.0774 -0.0784 -0.0985 124 SER A OG  
953  N N   . LEU A 125 ? 0.3272 0.3398 0.3556 -0.0722 -0.0678 -0.0837 125 LEU A N   
954  C CA  . LEU A 125 ? 0.2763 0.2935 0.3194 -0.0740 -0.0704 -0.0810 125 LEU A CA  
955  C C   . LEU A 125 ? 0.2829 0.3175 0.3348 -0.0704 -0.0756 -0.0791 125 LEU A C   
956  O O   . LEU A 125 ? 0.3924 0.4398 0.4328 -0.0706 -0.0687 -0.0781 125 LEU A O   
957  C CB  . LEU A 125 ? 0.2808 0.2883 0.3249 -0.0741 -0.0624 -0.0770 125 LEU A CB  
958  C CG  . LEU A 125 ? 0.3879 0.3774 0.4263 -0.0776 -0.0585 -0.0784 125 LEU A CG  
959  C CD1 . LEU A 125 ? 0.2075 0.1903 0.2469 -0.0774 -0.0518 -0.0738 125 LEU A CD1 
960  C CD2 . LEU A 125 ? 0.2346 0.2177 0.2757 -0.0854 -0.0644 -0.0824 125 LEU A CD2 
961  N N   . HIS A 126 ? 0.3035 0.3395 0.3667 -0.0752 -0.0860 -0.0748 126 HIS A N   
962  C CA  . HIS A 126 ? 0.2300 0.2759 0.2988 -0.0768 -0.0963 -0.0658 126 HIS A CA  
963  C C   . HIS A 126 ? 0.3619 0.4028 0.4235 -0.0750 -0.0939 -0.0542 126 HIS A C   
964  O O   . HIS A 126 ? 0.3713 0.4273 0.4222 -0.0803 -0.0952 -0.0464 126 HIS A O   
965  C CB  . HIS A 126 ? 0.3052 0.3646 0.3872 -0.0892 -0.0984 -0.0660 126 HIS A CB  
966  C CG  . HIS A 126 ? 0.6130 0.6982 0.7068 -0.0938 -0.1043 -0.0613 126 HIS A CG  
967  N ND1 . HIS A 126 ? 0.7049 0.8073 0.8139 -0.1017 -0.1003 -0.0605 126 HIS A ND1 
968  C CD2 . HIS A 126 ? 0.7263 0.8287 0.8212 -0.0918 -0.1127 -0.0588 126 HIS A CD2 
969  C CE1 . HIS A 126 ? 0.7639 0.8956 0.8854 -0.1021 -0.1041 -0.0594 126 HIS A CE1 
970  N NE2 . HIS A 126 ? 0.7789 0.9122 0.8940 -0.0960 -0.1130 -0.0586 126 HIS A NE2 
971  N N   . VAL A 127 ? 0.2485 0.2816 0.3138 -0.0715 -0.0844 -0.0569 127 VAL A N   
972  C CA  . VAL A 127 ? 0.3338 0.3626 0.3880 -0.0724 -0.0817 -0.0461 127 VAL A CA  
973  C C   . VAL A 127 ? 0.3414 0.3742 0.3623 -0.0791 -0.0675 -0.0438 127 VAL A C   
974  O O   . VAL A 127 ? 0.3271 0.3603 0.3517 -0.0733 -0.0653 -0.0445 127 VAL A O   
975  C CB  . VAL A 127 ? 0.3454 0.3725 0.4116 -0.0705 -0.0729 -0.0509 127 VAL A CB  
976  C CG1 . VAL A 127 ? 0.2931 0.3358 0.3720 -0.0817 -0.0728 -0.0518 127 VAL A CG1 
977  C CG2 . VAL A 127 ? 0.1739 0.1937 0.2391 -0.0674 -0.0619 -0.0608 127 VAL A CG2 
978  N N   . TYR A 128 ? 0.3492 0.3885 0.3668 -0.0774 -0.0611 -0.0552 128 TYR A N   
979  C CA  . TYR A 128 ? 0.3471 0.3767 0.3592 -0.0694 -0.0622 -0.0569 128 TYR A CA  
980  C C   . TYR A 128 ? 0.3355 0.3731 0.3470 -0.0668 -0.0738 -0.0585 128 TYR A C   
981  O O   . TYR A 128 ? 0.2926 0.3208 0.2956 -0.0622 -0.0760 -0.0609 128 TYR A O   
982  C CB  . TYR A 128 ? 0.3008 0.3172 0.3083 -0.0667 -0.0544 -0.0618 128 TYR A CB  
983  C CG  . TYR A 128 ? 0.3648 0.3741 0.3772 -0.0666 -0.0461 -0.0626 128 TYR A CG  
984  C CD1 . TYR A 128 ? 0.3063 0.3167 0.3213 -0.0672 -0.0429 -0.0582 128 TYR A CD1 
985  C CD2 . TYR A 128 ? 0.2924 0.2915 0.3064 -0.0659 -0.0450 -0.0674 128 TYR A CD2 
986  C CE1 . TYR A 128 ? 0.2072 0.2099 0.2286 -0.0661 -0.0389 -0.0596 128 TYR A CE1 
987  C CE2 . TYR A 128 ? 0.2138 0.2033 0.2310 -0.0662 -0.0413 -0.0669 128 TYR A CE2 
988  C CZ  . TYR A 128 ? 0.2313 0.2225 0.2524 -0.0662 -0.0387 -0.0629 128 TYR A CZ  
989  O OH  . TYR A 128 ? 0.2227 0.2033 0.2453 -0.0670 -0.0363 -0.0620 128 TYR A OH  
990  N N   . ASP A 129 ? 0.2644 0.3193 0.2849 -0.0696 -0.0825 -0.0564 129 ASP A N   
991  C CA  . ASP A 129 ? 0.2998 0.3672 0.3223 -0.0653 -0.0953 -0.0581 129 ASP A CA  
992  C C   . ASP A 129 ? 0.3859 0.4495 0.4130 -0.0506 -0.1002 -0.0576 129 ASP A C   
993  O O   . ASP A 129 ? 0.3651 0.4388 0.4069 -0.0454 -0.1004 -0.0576 129 ASP A O   
994  C CB  . ASP A 129 ? 0.3652 0.4537 0.4015 -0.0701 -0.1032 -0.0551 129 ASP A CB  
995  C CG  . ASP A 129 ? 0.3779 0.4809 0.4140 -0.0676 -0.1154 -0.0565 129 ASP A CG  
996  O OD1 . ASP A 129 ? 0.4184 0.5132 0.4441 -0.0585 -0.1194 -0.0584 129 ASP A OD1 
997  O OD2 . ASP A 129 ? 0.3972 0.5149 0.4438 -0.0731 -0.1223 -0.0540 129 ASP A OD2 
998  N N   . GLY A 130 ? 0.3554 0.4035 0.3689 -0.0438 -0.1045 -0.0578 130 GLY A N   
999  C CA  . GLY A 130 ? 0.3180 0.3548 0.3301 -0.0308 -0.1100 -0.0571 130 GLY A CA  
1000 C C   . GLY A 130 ? 0.3547 0.4046 0.3751 -0.0180 -0.1248 -0.0569 130 GLY A C   
1001 O O   . GLY A 130 ? 0.2944 0.3318 0.3115 -0.0053 -0.1312 -0.0566 130 GLY A O   
1002 N N   . LYS A 131 ? 0.3454 0.4204 0.3765 -0.0206 -0.1306 -0.0568 131 LYS A N   
1003 C CA  . LYS A 131 ? 0.4167 0.5082 0.4578 -0.0067 -0.1443 -0.0559 131 LYS A CA  
1004 C C   . LYS A 131 ? 0.4134 0.5184 0.4761 0.0072  -0.1448 -0.0593 131 LYS A C   
1005 O O   . LYS A 131 ? 0.4289 0.5332 0.4938 0.0246  -0.1549 -0.0585 131 LYS A O   
1006 C CB  . LYS A 131 ? 0.4184 0.5366 0.4675 -0.0138 -0.1502 -0.0549 131 LYS A CB  
1007 C CG  . LYS A 131 ? 0.3885 0.5302 0.4571 -0.0258 -0.1430 -0.0567 131 LYS A CG  
1008 C CD  . LYS A 131 ? 0.3168 0.4819 0.3922 -0.0334 -0.1515 -0.0550 131 LYS A CD  
1009 C CE  . LYS A 131 ? 0.3574 0.5384 0.4503 -0.0466 -0.1463 -0.0554 131 LYS A CE  
1010 N NZ  . LYS A 131 ? 0.4136 0.6092 0.5112 -0.0570 -0.1561 -0.0537 131 LYS A NZ  
1011 N N   . PHE A 132 ? 0.3062 0.4220 0.3829 0.0005  -0.1335 -0.0629 132 PHE A N   
1012 C CA  . PHE A 132 ? 0.3098 0.4419 0.4072 0.0126  -0.1317 -0.0681 132 PHE A CA  
1013 C C   . PHE A 132 ? 0.3541 0.4603 0.4417 0.0255  -0.1338 -0.0702 132 PHE A C   
1014 O O   . PHE A 132 ? 0.4777 0.5892 0.5748 0.0438  -0.1406 -0.0727 132 PHE A O   
1015 C CB  . PHE A 132 ? 0.3681 0.5173 0.4794 0.0005  -0.1187 -0.0708 132 PHE A CB  
1016 C CG  . PHE A 132 ? 0.4173 0.5876 0.5369 -0.0133 -0.1180 -0.0680 132 PHE A CG  
1017 C CD1 . PHE A 132 ? 0.4033 0.6043 0.5417 -0.0074 -0.1252 -0.0691 132 PHE A CD1 
1018 C CD2 . PHE A 132 ? 0.3625 0.5197 0.4705 -0.0314 -0.1113 -0.0639 132 PHE A CD2 
1019 C CE1 . PHE A 132 ? 0.4196 0.6381 0.5658 -0.0212 -0.1259 -0.0667 132 PHE A CE1 
1020 C CE2 . PHE A 132 ? 0.4003 0.5712 0.5148 -0.0439 -0.1130 -0.0613 132 PHE A CE2 
1021 C CZ  . PHE A 132 ? 0.4269 0.6286 0.5608 -0.0397 -0.1204 -0.0630 132 PHE A CZ  
1022 N N   . LEU A 133 ? 0.3486 0.4256 0.4167 0.0162  -0.1277 -0.0687 133 LEU A N   
1023 C CA  . LEU A 133 ? 0.2801 0.3262 0.3332 0.0240  -0.1260 -0.0683 133 LEU A CA  
1024 C C   . LEU A 133 ? 0.3274 0.3523 0.3642 0.0375  -0.1369 -0.0623 133 LEU A C   
1025 O O   . LEU A 133 ? 0.4182 0.4263 0.4511 0.0507  -0.1362 -0.0616 133 LEU A O   
1026 C CB  . LEU A 133 ? 0.3321 0.3537 0.3674 0.0094  -0.1169 -0.0670 133 LEU A CB  
1027 C CG  . LEU A 133 ? 0.3970 0.4283 0.4430 0.0000  -0.1038 -0.0704 133 LEU A CG  
1028 C CD1 . LEU A 133 ? 0.4111 0.4276 0.4425 -0.0144 -0.0921 -0.0645 133 LEU A CD1 
1029 C CD2 . LEU A 133 ? 0.3340 0.3560 0.3808 0.0077  -0.0973 -0.0736 133 LEU A CD2 
1030 N N   . ALA A 134 ? 0.2847 0.3085 0.3102 0.0338  -0.1473 -0.0581 134 ALA A N   
1031 C CA  . ALA A 134 ? 0.3965 0.3992 0.4030 0.0452  -0.1589 -0.0507 134 ALA A CA  
1032 C C   . ALA A 134 ? 0.4867 0.5087 0.5128 0.0659  -0.1684 -0.0514 134 ALA A C   
1033 O O   . ALA A 134 ? 0.4696 0.4684 0.4866 0.0811  -0.1715 -0.0476 134 ALA A O   
1034 C CB  . ALA A 134 ? 0.2906 0.2926 0.2807 0.0355  -0.1672 -0.0465 134 ALA A CB  
1035 N N   . ARG A 135 ? 0.4574 0.5211 0.5107 0.0656  -0.1706 -0.0563 135 ARG A N   
1036 C CA  . ARG A 135 ? 0.4557 0.5444 0.5318 0.0838  -0.1759 -0.0579 135 ARG A CA  
1037 C C   . ARG A 135 ? 0.4938 0.5784 0.5823 0.1004  -0.1718 -0.0639 135 ARG A C   
1038 O O   . ARG A 135 ? 0.4583 0.5308 0.5457 0.1206  -0.1782 -0.0616 135 ARG A O   
1039 C CB  . ARG A 135 ? 0.4281 0.5621 0.5307 0.0741  -0.1710 -0.0619 135 ARG A CB  
1040 C CG  . ARG A 135 ? 0.3857 0.5517 0.5154 0.0909  -0.1741 -0.0650 135 ARG A CG  
1041 C CD  . ARG A 135 ? 0.4809 0.6448 0.6038 0.1032  -0.1891 -0.0573 135 ARG A CD  
1042 N NE  . ARG A 135 ? 0.5238 0.7194 0.6740 0.1194  -0.1920 -0.0603 135 ARG A NE  
1043 C CZ  . ARG A 135 ? 0.5021 0.6898 0.6594 0.1409  -0.1919 -0.0632 135 ARG A CZ  
1044 N NH1 . ARG A 135 ? 0.5438 0.6914 0.6823 0.1483  -0.1895 -0.0630 135 ARG A NH1 
1045 N NH2 . ARG A 135 ? 0.4385 0.6577 0.6217 0.1546  -0.1937 -0.0665 135 ARG A NH2 
1046 N N   . VAL A 136 ? 0.5005 0.5909 0.5969 0.0891  -0.1560 -0.0703 136 VAL A N   
1047 C CA  . VAL A 136 ? 0.2573 0.3535 0.3687 0.0998  -0.1460 -0.0779 136 VAL A CA  
1048 C C   . VAL A 136 ? 0.3979 0.4473 0.4854 0.1049  -0.1401 -0.0758 136 VAL A C   
1049 O O   . VAL A 136 ? 0.3756 0.4184 0.4690 0.1218  -0.1383 -0.0803 136 VAL A O   
1050 C CB  . VAL A 136 ? 0.3257 0.4504 0.4541 0.0839  -0.1322 -0.0851 136 VAL A CB  
1051 C CG1 . VAL A 136 ? 0.2796 0.4073 0.4178 0.0920  -0.1199 -0.0933 136 VAL A CG1 
1052 C CG2 . VAL A 136 ? 0.2657 0.4367 0.4188 0.0783  -0.1360 -0.0875 136 VAL A CG2 
1053 N N   . GLU A 137 ? 0.4579 0.4753 0.5190 0.0902  -0.1368 -0.0699 137 GLU A N   
1054 C CA  . GLU A 137 ? 0.4608 0.4356 0.4994 0.0906  -0.1302 -0.0683 137 GLU A CA  
1055 C C   . GLU A 137 ? 0.5064 0.4413 0.5150 0.0923  -0.1388 -0.0579 137 GLU A C   
1056 O O   . GLU A 137 ? 0.5580 0.4550 0.5460 0.0913  -0.1341 -0.0557 137 GLU A O   
1057 C CB  . GLU A 137 ? 0.3500 0.3210 0.3834 0.0712  -0.1163 -0.0713 137 GLU A CB  
1058 C CG  . GLU A 137 ? 0.3523 0.3534 0.4085 0.0699  -0.1064 -0.0806 137 GLU A CG  
1059 C CD  . GLU A 137 ? 0.5081 0.5009 0.5685 0.0845  -0.1012 -0.0878 137 GLU A CD  
1060 O OE1 . GLU A 137 ? 0.4511 0.4097 0.4957 0.0954  -0.1050 -0.0854 137 GLU A OE1 
1061 O OE2 . GLU A 137 ? 0.5976 0.6171 0.6758 0.0843  -0.0927 -0.0961 137 GLU A OE2 
1062 N N   . ARG A 138 ? 0.3466 0.2905 0.3517 0.0929  -0.1514 -0.0516 138 ARG A N   
1063 C CA  . ARG A 138 ? 0.3806 0.2901 0.3556 0.0943  -0.1610 -0.0406 138 ARG A CA  
1064 C C   . ARG A 138 ? 0.4587 0.3367 0.4059 0.0753  -0.1518 -0.0367 138 ARG A C   
1065 O O   . ARG A 138 ? 0.6029 0.4450 0.5218 0.0750  -0.1554 -0.0281 138 ARG A O   
1066 C CB  . ARG A 138 ? 0.5147 0.3992 0.4832 0.1166  -0.1697 -0.0365 138 ARG A CB  
1067 C CG  . ARG A 138 ? 0.6222 0.5377 0.6137 0.1369  -0.1843 -0.0372 138 ARG A CG  
1068 C CD  . ARG A 138 ? 0.8462 0.7321 0.8290 0.1615  -0.1951 -0.0318 138 ARG A CD  
1069 N NE  . ARG A 138 ? 0.9787 0.8220 0.9238 0.1583  -0.2026 -0.0177 138 ARG A NE  
1070 C CZ  . ARG A 138 ? 1.0234 0.8743 0.9580 0.1561  -0.2137 -0.0089 138 ARG A CZ  
1071 N NH1 . ARG A 138 ? 0.9385 0.8376 0.8981 0.1558  -0.2186 -0.0128 138 ARG A NH1 
1072 N NH2 . ARG A 138 ? 1.0563 0.8667 0.9546 0.1521  -0.2186 0.0036  138 ARG A NH2 
1073 N N   . VAL A 139 ? 0.3282 0.2203 0.2835 0.0595  -0.1399 -0.0428 139 VAL A N   
1074 C CA  . VAL A 139 ? 0.3812 0.2533 0.3153 0.0415  -0.1321 -0.0402 139 VAL A CA  
1075 C C   . VAL A 139 ? 0.4096 0.2939 0.3367 0.0322  -0.1383 -0.0374 139 VAL A C   
1076 O O   . VAL A 139 ? 0.4532 0.3665 0.3966 0.0361  -0.1465 -0.0393 139 VAL A O   
1077 C CB  . VAL A 139 ? 0.4080 0.2901 0.3541 0.0297  -0.1179 -0.0479 139 VAL A CB  
1078 C CG1 . VAL A 139 ? 0.3007 0.1704 0.2509 0.0368  -0.1112 -0.0520 139 VAL A CG1 
1079 C CG2 . VAL A 139 ? 0.2675 0.1888 0.2388 0.0260  -0.1174 -0.0537 139 VAL A CG2 
1080 N N   . ILE A 140 ? 0.4141 0.2773 0.3169 0.0191  -0.1341 -0.0337 140 ILE A N   
1081 C CA  . ILE A 140 ? 0.3854 0.2581 0.2792 0.0084  -0.1375 -0.0332 140 ILE A CA  
1082 C C   . ILE A 140 ? 0.4502 0.3363 0.3551 -0.0057 -0.1257 -0.0410 140 ILE A C   
1083 O O   . ILE A 140 ? 0.5914 0.4649 0.4933 -0.0122 -0.1143 -0.0429 140 ILE A O   
1084 C CB  . ILE A 140 ? 0.4191 0.2616 0.2780 0.0029  -0.1395 -0.0251 140 ILE A CB  
1085 C CG1 . ILE A 140 ? 0.3949 0.2296 0.2418 0.0165  -0.1559 -0.0162 140 ILE A CG1 
1086 C CG2 . ILE A 140 ? 0.3578 0.2057 0.2054 -0.0129 -0.1354 -0.0282 140 ILE A CG2 
1087 C CD1 . ILE A 140 ? 0.4368 0.2333 0.2463 0.0138  -0.1577 -0.0056 140 ILE A CD1 
1088 N N   . VAL A 141 ? 0.4090 0.3217 0.3288 -0.0100 -0.1270 -0.0447 141 VAL A N   
1089 C CA  . VAL A 141 ? 0.3839 0.3120 0.3182 -0.0207 -0.1102 -0.0481 141 VAL A CA  
1090 C C   . VAL A 141 ? 0.3896 0.3169 0.3117 -0.0301 -0.1044 -0.0475 141 VAL A C   
1091 O O   . VAL A 141 ? 0.4270 0.3605 0.3427 -0.0306 -0.1128 -0.0467 141 VAL A O   
1092 C CB  . VAL A 141 ? 0.4102 0.3683 0.3709 -0.0200 -0.1094 -0.0518 141 VAL A CB  
1093 C CG1 . VAL A 141 ? 0.2166 0.1841 0.1872 -0.0297 -0.0931 -0.0537 141 VAL A CG1 
1094 C CG2 . VAL A 141 ? 0.4476 0.4114 0.4225 -0.0087 -0.1164 -0.0544 141 VAL A CG2 
1095 N N   . VAL A 142 ? 0.3567 0.2786 0.2771 -0.0366 -0.0903 -0.0488 142 VAL A N   
1096 C CA  . VAL A 142 ? 0.3881 0.3118 0.3016 -0.0437 -0.0835 -0.0511 142 VAL A CA  
1097 C C   . VAL A 142 ? 0.3837 0.3240 0.3180 -0.0465 -0.0706 -0.0563 142 VAL A C   
1098 O O   . VAL A 142 ? 0.3302 0.2739 0.2770 -0.0451 -0.0633 -0.0564 142 VAL A O   
1099 C CB  . VAL A 142 ? 0.4514 0.3541 0.3432 -0.0473 -0.0793 -0.0487 142 VAL A CB  
1100 C CG1 . VAL A 142 ? 0.4248 0.3320 0.3131 -0.0533 -0.0713 -0.0532 142 VAL A CG1 
1101 C CG2 . VAL A 142 ? 0.4596 0.3397 0.3236 -0.0455 -0.0929 -0.0421 142 VAL A CG2 
1102 N N   . SER A 143 ? 0.3133 0.2624 0.2501 -0.0501 -0.0690 -0.0609 143 SER A N   
1103 C CA  . SER A 143 ? 0.3490 0.3075 0.3019 -0.0515 -0.0589 -0.0662 143 SER A CA  
1104 C C   . SER A 143 ? 0.3585 0.3137 0.3047 -0.0536 -0.0582 -0.0716 143 SER A C   
1105 O O   . SER A 143 ? 0.3665 0.3192 0.2985 -0.0560 -0.0653 -0.0719 143 SER A O   
1106 C CB  . SER A 143 ? 0.2037 0.1768 0.1711 -0.0533 -0.0589 -0.0671 143 SER A CB  
1107 O OG  . SER A 143 ? 0.2565 0.2366 0.2211 -0.0561 -0.0666 -0.0695 143 SER A OG  
1108 N N   . MET A 144 ? 0.3211 0.2754 0.2765 -0.0518 -0.0512 -0.0758 144 MET A N   
1109 C CA  . MET A 144 ? 0.3302 0.2780 0.2778 -0.0527 -0.0518 -0.0812 144 MET A CA  
1110 C C   . MET A 144 ? 0.3402 0.2906 0.3031 -0.0500 -0.0497 -0.0843 144 MET A C   
1111 O O   . MET A 144 ? 0.3582 0.3122 0.3349 -0.0482 -0.0462 -0.0813 144 MET A O   
1112 C CB  . MET A 144 ? 0.2817 0.2185 0.2174 -0.0527 -0.0474 -0.0803 144 MET A CB  
1113 C CG  . MET A 144 ? 0.2965 0.2323 0.2466 -0.0479 -0.0433 -0.0813 144 MET A CG  
1114 S SD  . MET A 144 ? 0.3105 0.2546 0.2789 -0.0433 -0.0404 -0.0744 144 MET A SD  
1115 C CE  . MET A 144 ? 0.6870 0.6232 0.6380 -0.0479 -0.0389 -0.0712 144 MET A CE  
1116 N N   . ASN A 145 ? 0.3060 0.2503 0.2608 -0.0518 -0.0528 -0.0900 145 ASN A N   
1117 C CA  . ASN A 145 ? 0.3164 0.2531 0.2771 -0.0503 -0.0524 -0.0928 145 ASN A CA  
1118 C C   . ASN A 145 ? 0.3977 0.3215 0.3492 -0.0475 -0.0497 -0.0939 145 ASN A C   
1119 O O   . ASN A 145 ? 0.3637 0.2840 0.2997 -0.0499 -0.0477 -0.0973 145 ASN A O   
1120 C CB  . ASN A 145 ? 0.3211 0.2556 0.2762 -0.0544 -0.0570 -0.0993 145 ASN A CB  
1121 C CG  . ASN A 145 ? 0.3031 0.2486 0.2689 -0.0581 -0.0597 -0.0982 145 ASN A CG  
1122 O OD1 . ASN A 145 ? 0.3359 0.2892 0.3141 -0.0576 -0.0564 -0.0932 145 ASN A OD1 
1123 N ND2 . ASN A 145 ? 0.3407 0.2874 0.3000 -0.0626 -0.0656 -0.1033 145 ASN A ND2 
1124 N N   . TYR A 146 ? 0.2542 0.1693 0.2105 -0.0446 -0.0491 -0.0911 146 TYR A N   
1125 C CA  . TYR A 146 ? 0.4424 0.3455 0.3869 -0.0439 -0.0448 -0.0933 146 TYR A CA  
1126 C C   . TYR A 146 ? 0.3867 0.2750 0.3273 -0.0438 -0.0450 -0.0950 146 TYR A C   
1127 O O   . TYR A 146 ? 0.2771 0.1620 0.2228 -0.0447 -0.0490 -0.0896 146 TYR A O   
1128 C CB  . TYR A 146 ? 0.2497 0.1559 0.1981 -0.0425 -0.0410 -0.0870 146 TYR A CB  
1129 C CG  . TYR A 146 ? 0.5337 0.4375 0.4884 -0.0420 -0.0424 -0.0779 146 TYR A CG  
1130 C CD1 . TYR A 146 ? 0.4787 0.3920 0.4442 -0.0406 -0.0465 -0.0715 146 TYR A CD1 
1131 C CD2 . TYR A 146 ? 0.2455 0.1397 0.1959 -0.0436 -0.0375 -0.0782 146 TYR A CD2 
1132 C CE1 . TYR A 146 ? 0.2219 0.1284 0.1789 -0.0463 -0.0439 -0.0612 146 TYR A CE1 
1133 C CE2 . TYR A 146 ? 0.3574 0.2517 0.3107 -0.0467 -0.0348 -0.0718 146 TYR A CE2 
1134 C CZ  . TYR A 146 ? 0.3579 0.2597 0.3124 -0.0502 -0.0354 -0.0637 146 TYR A CZ  
1135 O OH  . TYR A 146 ? 0.2160 0.1248 0.1787 -0.0536 -0.0295 -0.0621 146 TYR A OH  
1136 N N   . ARG A 147 ? 0.3445 0.2237 0.2748 -0.0439 -0.0393 -0.1041 147 ARG A N   
1137 C CA  . ARG A 147 ? 0.3161 0.1795 0.2417 -0.0434 -0.0376 -0.1092 147 ARG A CA  
1138 C C   . ARG A 147 ? 0.3965 0.2552 0.3280 -0.0432 -0.0341 -0.1030 147 ARG A C   
1139 O O   . ARG A 147 ? 0.5065 0.3741 0.4457 -0.0419 -0.0302 -0.1009 147 ARG A O   
1140 C CB  . ARG A 147 ? 0.3360 0.1963 0.2547 -0.0419 -0.0288 -0.1233 147 ARG A CB  
1141 C CG  . ARG A 147 ? 0.3545 0.2147 0.2615 -0.0444 -0.0300 -0.1315 147 ARG A CG  
1142 C CD  . ARG A 147 ? 0.3995 0.2634 0.3004 -0.0436 -0.0173 -0.1437 147 ARG A CD  
1143 N NE  . ARG A 147 ? 0.4210 0.3021 0.3227 -0.0467 -0.0097 -0.1421 147 ARG A NE  
1144 C CZ  . ARG A 147 ? 0.4963 0.3864 0.3952 -0.0480 0.0030  -0.1515 147 ARG A CZ  
1145 N NH1 . ARG A 147 ? 0.5091 0.3939 0.4064 -0.0443 0.0093  -0.1640 147 ARG A NH1 
1146 N NH2 . ARG A 147 ? 0.4809 0.3850 0.3785 -0.0534 0.0097  -0.1488 147 ARG A NH2 
1147 N N   . VAL A 148 ? 0.3561 0.2013 0.2844 -0.0456 -0.0348 -0.1018 148 VAL A N   
1148 C CA  . VAL A 148 ? 0.3828 0.2247 0.3193 -0.0464 -0.0295 -0.0993 148 VAL A CA  
1149 C C   . VAL A 148 ? 0.3421 0.1651 0.2783 -0.0430 -0.0258 -0.1101 148 VAL A C   
1150 O O   . VAL A 148 ? 0.4215 0.2341 0.3476 -0.0415 -0.0264 -0.1186 148 VAL A O   
1151 C CB  . VAL A 148 ? 0.3966 0.2438 0.3338 -0.0547 -0.0296 -0.0886 148 VAL A CB  
1152 C CG1 . VAL A 148 ? 0.3322 0.1972 0.2734 -0.0555 -0.0320 -0.0805 148 VAL A CG1 
1153 C CG2 . VAL A 148 ? 0.3244 0.1626 0.2511 -0.0622 -0.0320 -0.0897 148 VAL A CG2 
1154 N N   . GLY A 149 ? 0.3409 0.1595 0.2901 -0.0397 -0.0233 -0.1103 149 GLY A N   
1155 C CA  . GLY A 149 ? 0.3655 0.1673 0.3203 -0.0321 -0.0210 -0.1194 149 GLY A CA  
1156 C C   . GLY A 149 ? 0.4680 0.2740 0.4282 -0.0214 -0.0169 -0.1317 149 GLY A C   
1157 O O   . GLY A 149 ? 0.4467 0.2735 0.4134 -0.0192 -0.0146 -0.1331 149 GLY A O   
1158 N N   . ALA A 150 ? 0.4516 0.2388 0.4099 -0.0152 -0.0144 -0.1417 150 ALA A N   
1159 C CA  . ALA A 150 ? 0.4424 0.2359 0.4075 -0.0045 -0.0082 -0.1556 150 ALA A CA  
1160 C C   . ALA A 150 ? 0.4897 0.2952 0.4414 -0.0099 -0.0053 -0.1601 150 ALA A C   
1161 O O   . ALA A 150 ? 0.4901 0.3164 0.4525 -0.0051 0.0014  -0.1675 150 ALA A O   
1162 C CB  . ALA A 150 ? 0.4553 0.2231 0.4170 0.0029  -0.0059 -0.1656 150 ALA A CB  
1163 N N   . LEU A 151 ? 0.4967 0.2909 0.4264 -0.0201 -0.0109 -0.1560 151 LEU A N   
1164 C CA  . LEU A 151 ? 0.5340 0.3393 0.4523 -0.0239 -0.0105 -0.1601 151 LEU A CA  
1165 C C   . LEU A 151 ? 0.5578 0.3898 0.4856 -0.0257 -0.0082 -0.1543 151 LEU A C   
1166 O O   . LEU A 151 ? 0.5545 0.3995 0.4772 -0.0278 -0.0038 -0.1594 151 LEU A O   
1167 C CB  . LEU A 151 ? 0.5678 0.3602 0.4672 -0.0324 -0.0213 -0.1558 151 LEU A CB  
1168 C CG  . LEU A 151 ? 0.6413 0.4079 0.5280 -0.0325 -0.0237 -0.1638 151 LEU A CG  
1169 C CD1 . LEU A 151 ? 0.6695 0.4352 0.5513 -0.0405 -0.0361 -0.1557 151 LEU A CD1 
1170 C CD2 . LEU A 151 ? 0.5100 0.2753 0.3894 -0.0273 -0.0167 -0.1807 151 LEU A CD2 
1171 N N   . GLY A 152 ? 0.5609 0.4003 0.5015 -0.0257 -0.0104 -0.1440 152 GLY A N   
1172 C CA  . GLY A 152 ? 0.5123 0.3736 0.4611 -0.0279 -0.0089 -0.1379 152 GLY A CA  
1173 C C   . GLY A 152 ? 0.4967 0.3745 0.4684 -0.0215 -0.0029 -0.1410 152 GLY A C   
1174 O O   . GLY A 152 ? 0.5435 0.4401 0.5219 -0.0239 0.0005  -0.1393 152 GLY A O   
1175 N N   . PHE A 153 ? 0.4613 0.3323 0.4465 -0.0131 -0.0024 -0.1460 153 PHE A N   
1176 C CA  . PHE A 153 ? 0.4123 0.3009 0.4234 -0.0053 0.0000  -0.1493 153 PHE A CA  
1177 C C   . PHE A 153 ? 0.5043 0.3924 0.5318 0.0079  0.0043  -0.1629 153 PHE A C   
1178 O O   . PHE A 153 ? 0.3287 0.2304 0.3804 0.0170  0.0036  -0.1660 153 PHE A O   
1179 C CB  . PHE A 153 ? 0.3287 0.2162 0.3475 -0.0061 -0.0081 -0.1368 153 PHE A CB  
1180 C CG  . PHE A 153 ? 0.2839 0.1789 0.2923 -0.0163 -0.0107 -0.1247 153 PHE A CG  
1181 C CD1 . PHE A 153 ? 0.2735 0.1894 0.2923 -0.0177 -0.0081 -0.1239 153 PHE A CD1 
1182 C CD2 . PHE A 153 ? 0.3108 0.1920 0.2994 -0.0244 -0.0157 -0.1147 153 PHE A CD2 
1183 C CE1 . PHE A 153 ? 0.2504 0.1701 0.2586 -0.0255 -0.0107 -0.1125 153 PHE A CE1 
1184 C CE2 . PHE A 153 ? 0.2796 0.1677 0.2601 -0.0312 -0.0187 -0.1039 153 PHE A CE2 
1185 C CZ  . PHE A 153 ? 0.2464 0.1521 0.2360 -0.0310 -0.0164 -0.1024 153 PHE A CZ  
1186 N N   . LEU A 154 ? 0.4994 0.3719 0.5140 0.0099  0.0079  -0.1713 154 LEU A N   
1187 C CA  . LEU A 154 ? 0.5903 0.4628 0.6186 0.0235  0.0134  -0.1854 154 LEU A CA  
1188 C C   . LEU A 154 ? 0.6195 0.5261 0.6687 0.0276  0.0223  -0.1949 154 LEU A C   
1189 O O   . LEU A 154 ? 0.5774 0.4998 0.6183 0.0180  0.0292  -0.1970 154 LEU A O   
1190 C CB  . LEU A 154 ? 0.6241 0.4781 0.6317 0.0227  0.0179  -0.1945 154 LEU A CB  
1191 C CG  . LEU A 154 ? 0.5656 0.4147 0.5833 0.0375  0.0242  -0.2095 154 LEU A CG  
1192 C CD1 . LEU A 154 ? 0.5192 0.3347 0.5333 0.0443  0.0173  -0.2066 154 LEU A CD1 
1193 C CD2 . LEU A 154 ? 0.5756 0.4252 0.5762 0.0344  0.0334  -0.2218 154 LEU A CD2 
1194 N N   . ALA A 155 ? 0.5981 0.5167 0.6744 0.0414  0.0217  -0.2004 155 ALA A N   
1195 C CA  . ALA A 155 ? 0.5991 0.5541 0.6977 0.0441  0.0297  -0.2092 155 ALA A CA  
1196 C C   . ALA A 155 ? 0.5977 0.5655 0.7167 0.0603  0.0362  -0.2240 155 ALA A C   
1197 O O   . ALA A 155 ? 0.5336 0.4937 0.6688 0.0759  0.0295  -0.2241 155 ALA A O   
1198 C CB  . ALA A 155 ? 0.5820 0.5533 0.6984 0.0430  0.0227  -0.2012 155 ALA A CB  
1199 N N   . LEU A 156 ? 0.6376 0.6244 0.7541 0.0564  0.0493  -0.2355 156 LEU A N   
1200 C CA  . LEU A 156 ? 0.7327 0.7433 0.8715 0.0695  0.0581  -0.2499 156 LEU A CA  
1201 C C   . LEU A 156 ? 0.8308 0.8824 0.9833 0.0597  0.0670  -0.2535 156 LEU A C   
1202 O O   . LEU A 156 ? 0.8729 0.9374 1.0133 0.0486  0.0792  -0.2600 156 LEU A O   
1203 C CB  . LEU A 156 ? 0.7216 0.7193 0.8427 0.0711  0.0675  -0.2612 156 LEU A CB  
1204 C CG  . LEU A 156 ? 0.7549 0.7453 0.8908 0.0922  0.0682  -0.2714 156 LEU A CG  
1205 C CD1 . LEU A 156 ? 0.7616 0.7317 0.9095 0.1049  0.0535  -0.2615 156 LEU A CD1 
1206 C CD2 . LEU A 156 ? 0.7607 0.7233 0.8704 0.0922  0.0737  -0.2793 156 LEU A CD2 
1207 N N   . PRO A 157 ? 0.8240 0.8953 1.0000 0.0626  0.0605  -0.2488 157 PRO A N   
1208 C CA  . PRO A 157 ? 0.7926 0.8966 0.9769 0.0490  0.0664  -0.2485 157 PRO A CA  
1209 C C   . PRO A 157 ? 0.7116 0.8502 0.9052 0.0451  0.0822  -0.2615 157 PRO A C   
1210 O O   . PRO A 157 ? 0.6627 0.8168 0.8763 0.0598  0.0857  -0.2715 157 PRO A O   
1211 C CB  . PRO A 157 ? 0.8243 0.9420 1.0358 0.0587  0.0550  -0.2434 157 PRO A CB  
1212 C CG  . PRO A 157 ? 0.8725 0.9748 1.0963 0.0806  0.0465  -0.2446 157 PRO A CG  
1213 C CD  . PRO A 157 ? 0.8653 0.9287 1.0613 0.0800  0.0472  -0.2440 157 PRO A CD  
1214 N N   . GLY A 158 ? 0.6230 0.7718 0.8003 0.0249  0.0917  -0.2605 158 GLY A N   
1215 C CA  . GLY A 158 ? 0.5411 0.7186 0.7201 0.0166  0.1077  -0.2711 158 GLY A CA  
1216 C C   . GLY A 158 ? 0.5997 0.7567 0.7477 0.0098  0.1155  -0.2741 158 GLY A C   
1217 O O   . GLY A 158 ? 0.5924 0.7489 0.7172 -0.0090 0.1227  -0.2706 158 GLY A O   
1218 N N   . ASN A 159 ? 0.6956 0.8340 0.8421 0.0254  0.1134  -0.2802 159 ASN A N   
1219 C CA  . ASN A 159 ? 0.6975 0.8121 0.8145 0.0224  0.1184  -0.2841 159 ASN A CA  
1220 C C   . ASN A 159 ? 0.7026 0.7899 0.7854 0.0065  0.1133  -0.2715 159 ASN A C   
1221 O O   . ASN A 159 ? 0.7511 0.8111 0.8268 0.0098  0.0999  -0.2610 159 ASN A O   
1222 C CB  . ASN A 159 ? 0.7202 0.8096 0.8410 0.0426  0.1116  -0.2887 159 ASN A CB  
1223 C CG  . ASN A 159 ? 0.7205 0.7877 0.8137 0.0415  0.1174  -0.2959 159 ASN A CG  
1224 O OD1 . ASN A 159 ? 0.6421 0.7019 0.7070 0.0254  0.1211  -0.2926 159 ASN A OD1 
1225 N ND2 . ASN A 159 ? 0.7959 0.8511 0.8961 0.0592  0.1177  -0.3059 159 ASN A ND2 
1226 N N   . PRO A 160 ? 0.6550 0.7494 0.7158 -0.0105 0.1234  -0.2718 160 PRO A N   
1227 C CA  . PRO A 160 ? 0.5995 0.6714 0.6282 -0.0257 0.1180  -0.2587 160 PRO A CA  
1228 C C   . PRO A 160 ? 0.5629 0.5999 0.5665 -0.0218 0.1101  -0.2564 160 PRO A C   
1229 O O   . PRO A 160 ? 0.5408 0.5590 0.5208 -0.0315 0.1025  -0.2446 160 PRO A O   
1230 C CB  . PRO A 160 ? 0.5269 0.6175 0.5403 -0.0433 0.1321  -0.2613 160 PRO A CB  
1231 C CG  . PRO A 160 ? 0.5137 0.6296 0.5438 -0.0364 0.1453  -0.2779 160 PRO A CG  
1232 C CD  . PRO A 160 ? 0.5705 0.6967 0.6367 -0.0170 0.1399  -0.2833 160 PRO A CD  
1233 N N   . GLU A 161 ? 0.6467 0.6749 0.6555 -0.0076 0.1110  -0.2675 161 GLU A N   
1234 C CA  . GLU A 161 ? 0.6827 0.6763 0.6679 -0.0046 0.1026  -0.2659 161 GLU A CA  
1235 C C   . GLU A 161 ? 0.6580 0.6277 0.6453 -0.0006 0.0860  -0.2523 161 GLU A C   
1236 O O   . GLU A 161 ? 0.6700 0.6129 0.6353 -0.0041 0.0766  -0.2456 161 GLU A O   
1237 C CB  . GLU A 161 ? 0.7096 0.6969 0.6977 0.0092  0.1085  -0.2820 161 GLU A CB  
1238 C CG  . GLU A 161 ? 0.7571 0.7684 0.7419 0.0057  0.1257  -0.2966 161 GLU A CG  
1239 C CD  . GLU A 161 ? 0.8524 0.8597 0.8031 -0.0119 0.1296  -0.2937 161 GLU A CD  
1240 O OE1 . GLU A 161 ? 0.9079 0.8888 0.8353 -0.0175 0.1183  -0.2843 161 GLU A OE1 
1241 O OE2 . GLU A 161 ? 0.8890 0.9204 0.8362 -0.0206 0.1435  -0.3005 161 GLU A OE2 
1242 N N   . ALA A 162 ? 0.6579 0.6394 0.6722 0.0060  0.0824  -0.2484 162 ALA A N   
1243 C CA  . ALA A 162 ? 0.6488 0.6115 0.6669 0.0090  0.0678  -0.2351 162 ALA A CA  
1244 C C   . ALA A 162 ? 0.5515 0.5382 0.5976 0.0113  0.0670  -0.2317 162 ALA A C   
1245 O O   . ALA A 162 ? 0.5104 0.5003 0.5804 0.0252  0.0634  -0.2349 162 ALA A O   
1246 C CB  . ALA A 162 ? 0.6535 0.5902 0.6736 0.0227  0.0614  -0.2385 162 ALA A CB  
1247 N N   . PRO A 163 ? 0.5016 0.5041 0.5439 -0.0022 0.0697  -0.2253 163 PRO A N   
1248 C CA  . PRO A 163 ? 0.3475 0.3781 0.4144 -0.0033 0.0721  -0.2254 163 PRO A CA  
1249 C C   . PRO A 163 ? 0.4298 0.4521 0.5062 -0.0008 0.0589  -0.2131 163 PRO A C   
1250 O O   . PRO A 163 ? 0.4971 0.5414 0.5959 0.0006  0.0589  -0.2144 163 PRO A O   
1251 C CB  . PRO A 163 ? 0.3439 0.3870 0.3942 -0.0214 0.0808  -0.2227 163 PRO A CB  
1252 C CG  . PRO A 163 ? 0.4235 0.4377 0.4420 -0.0287 0.0737  -0.2117 163 PRO A CG  
1253 C CD  . PRO A 163 ? 0.5398 0.5331 0.5524 -0.0176 0.0700  -0.2173 163 PRO A CD  
1254 N N   . GLY A 164 ? 0.3758 0.3682 0.4350 -0.0010 0.0478  -0.2018 164 GLY A N   
1255 C CA  . GLY A 164 ? 0.3224 0.3060 0.3863 -0.0007 0.0358  -0.1888 164 GLY A CA  
1256 C C   . GLY A 164 ? 0.3520 0.3324 0.3973 -0.0149 0.0331  -0.1756 164 GLY A C   
1257 O O   . GLY A 164 ? 0.4498 0.4404 0.4843 -0.0249 0.0412  -0.1773 164 GLY A O   
1258 N N   . ASN A 165 ? 0.3636 0.3292 0.4041 -0.0155 0.0218  -0.1619 165 ASN A N   
1259 C CA  . ASN A 165 ? 0.2596 0.2237 0.2868 -0.0257 0.0179  -0.1483 165 ASN A CA  
1260 C C   . ASN A 165 ? 0.3098 0.2628 0.3103 -0.0340 0.0182  -0.1430 165 ASN A C   
1261 O O   . ASN A 165 ? 0.2972 0.2506 0.2880 -0.0409 0.0157  -0.1333 165 ASN A O   
1262 C CB  . ASN A 165 ? 0.2437 0.2311 0.2847 -0.0305 0.0232  -0.1503 165 ASN A CB  
1263 C CG  . ASN A 165 ? 0.3864 0.3842 0.4529 -0.0228 0.0181  -0.1522 165 ASN A CG  
1264 O OD1 . ASN A 165 ? 0.3401 0.3240 0.4090 -0.0163 0.0085  -0.1457 165 ASN A OD1 
1265 N ND2 . ASN A 165 ? 0.3302 0.3535 0.4155 -0.0244 0.0244  -0.1617 165 ASN A ND2 
1266 N N   . MET A 166 ? 0.3361 0.2787 0.3253 -0.0324 0.0201  -0.1498 166 MET A N   
1267 C CA  . MET A 166 ? 0.3670 0.3001 0.3321 -0.0393 0.0187  -0.1465 166 MET A CA  
1268 C C   . MET A 166 ? 0.4272 0.3491 0.3815 -0.0424 0.0066  -0.1312 166 MET A C   
1269 O O   . MET A 166 ? 0.3445 0.2685 0.2872 -0.0485 0.0059  -0.1262 166 MET A O   
1270 C CB  . MET A 166 ? 0.3659 0.2862 0.3213 -0.0358 0.0195  -0.1557 166 MET A CB  
1271 C CG  . MET A 166 ? 0.4464 0.3789 0.4115 -0.0316 0.0322  -0.1719 166 MET A CG  
1272 S SD  . MET A 166 ? 0.5619 0.4969 0.5555 -0.0176 0.0323  -0.1792 166 MET A SD  
1273 C CE  . MET A 166 ? 0.3898 0.2924 0.3702 -0.0119 0.0237  -0.1787 166 MET A CE  
1274 N N   . GLY A 167 ? 0.3887 0.2998 0.3475 -0.0382 -0.0022 -0.1243 167 GLY A N   
1275 C CA  . GLY A 167 ? 0.4001 0.3047 0.3530 -0.0403 -0.0127 -0.1109 167 GLY A CA  
1276 C C   . GLY A 167 ? 0.4476 0.3633 0.4052 -0.0426 -0.0128 -0.1031 167 GLY A C   
1277 O O   . GLY A 167 ? 0.4685 0.3826 0.4197 -0.0444 -0.0192 -0.0956 167 GLY A O   
1278 N N   . LEU A 168 ? 0.3778 0.3058 0.3488 -0.0420 -0.0062 -0.1060 168 LEU A N   
1279 C CA  . LEU A 168 ? 0.3824 0.3198 0.3563 -0.0454 -0.0052 -0.1001 168 LEU A CA  
1280 C C   . LEU A 168 ? 0.4717 0.4125 0.4334 -0.0523 0.0008  -0.1028 168 LEU A C   
1281 O O   . LEU A 168 ? 0.4137 0.3537 0.3696 -0.0556 -0.0015 -0.0955 168 LEU A O   
1282 C CB  . LEU A 168 ? 0.2937 0.2453 0.2863 -0.0441 -0.0001 -0.1042 168 LEU A CB  
1283 C CG  . LEU A 168 ? 0.3493 0.2975 0.3517 -0.0388 -0.0071 -0.0987 168 LEU A CG  
1284 C CD1 . LEU A 168 ? 0.2032 0.1667 0.2287 -0.0348 -0.0032 -0.1079 168 LEU A CD1 
1285 C CD2 . LEU A 168 ? 0.1965 0.1409 0.1924 -0.0406 -0.0137 -0.0854 168 LEU A CD2 
1286 N N   . PHE A 169 ? 0.2568 0.2002 0.2131 -0.0549 0.0091  -0.1135 169 PHE A N   
1287 C CA  . PHE A 169 ? 0.3275 0.2726 0.2673 -0.0639 0.0162  -0.1158 169 PHE A CA  
1288 C C   . PHE A 169 ? 0.4053 0.3379 0.3277 -0.0647 0.0078  -0.1097 169 PHE A C   
1289 O O   . PHE A 169 ? 0.4423 0.3724 0.3496 -0.0719 0.0092  -0.1058 169 PHE A O   
1290 C CB  . PHE A 169 ? 0.3458 0.3000 0.2845 -0.0673 0.0289  -0.1299 169 PHE A CB  
1291 C CG  . PHE A 169 ? 0.3789 0.3524 0.3337 -0.0709 0.0401  -0.1376 169 PHE A CG  
1292 C CD1 . PHE A 169 ? 0.3455 0.3252 0.2951 -0.0816 0.0456  -0.1337 169 PHE A CD1 
1293 C CD2 . PHE A 169 ? 0.3463 0.3323 0.3219 -0.0639 0.0451  -0.1496 169 PHE A CD2 
1294 C CE1 . PHE A 169 ? 0.2948 0.2951 0.2603 -0.0869 0.0561  -0.1422 169 PHE A CE1 
1295 C CE2 . PHE A 169 ? 0.3875 0.3964 0.3820 -0.0668 0.0548  -0.1587 169 PHE A CE2 
1296 C CZ  . PHE A 169 ? 0.3028 0.3203 0.2924 -0.0793 0.0606  -0.1554 169 PHE A CZ  
1297 N N   . ASP A 170 ? 0.3994 0.3239 0.3238 -0.0582 -0.0011 -0.1092 170 ASP A N   
1298 C CA  . ASP A 170 ? 0.3904 0.3080 0.3047 -0.0583 -0.0104 -0.1047 170 ASP A CA  
1299 C C   . ASP A 170 ? 0.4180 0.3374 0.3360 -0.0581 -0.0160 -0.0947 170 ASP A C   
1300 O O   . ASP A 170 ? 0.3523 0.2698 0.2566 -0.0631 -0.0168 -0.0918 170 ASP A O   
1301 C CB  . ASP A 170 ? 0.2961 0.2063 0.2160 -0.0524 -0.0192 -0.1057 170 ASP A CB  
1302 C CG  . ASP A 170 ? 0.4073 0.3121 0.3205 -0.0523 -0.0142 -0.1167 170 ASP A CG  
1303 O OD1 . ASP A 170 ? 0.5059 0.4134 0.4057 -0.0574 -0.0065 -0.1236 170 ASP A OD1 
1304 O OD2 . ASP A 170 ? 0.3979 0.2944 0.3174 -0.0478 -0.0177 -0.1185 170 ASP A OD2 
1305 N N   . GLN A 171 ? 0.3654 0.2873 0.2997 -0.0528 -0.0196 -0.0895 171 GLN A N   
1306 C CA  . GLN A 171 ? 0.3429 0.2675 0.2828 -0.0517 -0.0236 -0.0817 171 GLN A CA  
1307 C C   . GLN A 171 ? 0.4495 0.3738 0.3772 -0.0594 -0.0160 -0.0808 171 GLN A C   
1308 O O   . GLN A 171 ? 0.5149 0.4351 0.4338 -0.0619 -0.0186 -0.0761 171 GLN A O   
1309 C CB  . GLN A 171 ? 0.2845 0.2112 0.2397 -0.0465 -0.0266 -0.0770 171 GLN A CB  
1310 C CG  . GLN A 171 ? 0.3102 0.2311 0.2700 -0.0423 -0.0329 -0.0755 171 GLN A CG  
1311 C CD  . GLN A 171 ? 0.3692 0.2906 0.3354 -0.0415 -0.0321 -0.0695 171 GLN A CD  
1312 O OE1 . GLN A 171 ? 0.3230 0.2496 0.2935 -0.0420 -0.0302 -0.0672 171 GLN A OE1 
1313 N NE2 . GLN A 171 ? 0.3119 0.2279 0.2772 -0.0420 -0.0325 -0.0680 171 GLN A NE2 
1314 N N   . GLN A 172 ? 0.4531 0.3810 0.3788 -0.0645 -0.0061 -0.0857 172 GLN A N   
1315 C CA  . GLN A 172 ? 0.4514 0.3785 0.3653 -0.0744 0.0022  -0.0848 172 GLN A CA  
1316 C C   . GLN A 172 ? 0.4235 0.3403 0.3103 -0.0833 0.0043  -0.0842 172 GLN A C   
1317 O O   . GLN A 172 ? 0.3857 0.2926 0.2565 -0.0904 0.0049  -0.0783 172 GLN A O   
1318 C CB  . GLN A 172 ? 0.4143 0.3528 0.3356 -0.0795 0.0139  -0.0925 172 GLN A CB  
1319 C CG  . GLN A 172 ? 0.3839 0.3219 0.2932 -0.0921 0.0229  -0.0915 172 GLN A CG  
1320 C CD  . GLN A 172 ? 0.3877 0.3425 0.3077 -0.0987 0.0356  -0.1015 172 GLN A CD  
1321 O OE1 . GLN A 172 ? 0.3942 0.3551 0.3068 -0.1056 0.0456  -0.1106 172 GLN A OE1 
1322 N NE2 . GLN A 172 ? 0.4662 0.4312 0.4049 -0.0968 0.0355  -0.1012 172 GLN A NE2 
1323 N N   . LEU A 173 ? 0.4687 0.3852 0.3476 -0.0834 0.0049  -0.0900 173 LEU A N   
1324 C CA  . LEU A 173 ? 0.5146 0.4211 0.3653 -0.0917 0.0053  -0.0890 173 LEU A CA  
1325 C C   . LEU A 173 ? 0.5531 0.4500 0.3964 -0.0886 -0.0070 -0.0804 173 LEU A C   
1326 O O   . LEU A 173 ? 0.6185 0.5024 0.4350 -0.0962 -0.0088 -0.0753 173 LEU A O   
1327 C CB  . LEU A 173 ? 0.5575 0.4671 0.4031 -0.0911 0.0078  -0.0982 173 LEU A CB  
1328 C CG  . LEU A 173 ? 0.6133 0.5142 0.4273 -0.1006 0.0095  -0.0982 173 LEU A CG  
1329 C CD1 . LEU A 173 ? 0.3926 0.2889 0.1860 -0.1146 0.0206  -0.0959 173 LEU A CD1 
1330 C CD2 . LEU A 173 ? 0.5737 0.4790 0.3854 -0.0990 0.0124  -0.1089 173 LEU A CD2 
1331 N N   . ALA A 174 ? 0.4905 0.3937 0.3563 -0.0780 -0.0155 -0.0788 174 ALA A N   
1332 C CA  . ALA A 174 ? 0.4330 0.3319 0.2962 -0.0749 -0.0261 -0.0726 174 ALA A CA  
1333 C C   . ALA A 174 ? 0.4422 0.3321 0.3004 -0.0767 -0.0271 -0.0648 174 ALA A C   
1334 O O   . ALA A 174 ? 0.4369 0.3130 0.2748 -0.0794 -0.0339 -0.0586 174 ALA A O   
1335 C CB  . ALA A 174 ? 0.3733 0.2840 0.2619 -0.0654 -0.0327 -0.0748 174 ALA A CB  
1336 N N   . LEU A 175 ? 0.4571 0.3525 0.3317 -0.0749 -0.0217 -0.0649 175 LEU A N   
1337 C CA  . LEU A 175 ? 0.4485 0.3337 0.3173 -0.0776 -0.0213 -0.0588 175 LEU A CA  
1338 C C   . LEU A 175 ? 0.4975 0.3624 0.3318 -0.0903 -0.0176 -0.0550 175 LEU A C   
1339 O O   . LEU A 175 ? 0.4965 0.3412 0.3119 -0.0933 -0.0227 -0.0477 175 LEU A O   
1340 C CB  . LEU A 175 ? 0.3853 0.2817 0.2755 -0.0754 -0.0151 -0.0608 175 LEU A CB  
1341 C CG  . LEU A 175 ? 0.4081 0.3212 0.3276 -0.0646 -0.0184 -0.0638 175 LEU A CG  
1342 C CD1 . LEU A 175 ? 0.3854 0.3054 0.3192 -0.0636 -0.0146 -0.0636 175 LEU A CD1 
1343 C CD2 . LEU A 175 ? 0.4366 0.3525 0.3655 -0.0572 -0.0267 -0.0616 175 LEU A CD2 
1344 N N   . GLN A 176 ? 0.4124 0.2807 0.2369 -0.0981 -0.0089 -0.0602 176 GLN A N   
1345 C CA  . GLN A 176 ? 0.4333 0.2843 0.2224 -0.1124 -0.0037 -0.0577 176 GLN A CA  
1346 C C   . GLN A 176 ? 0.4874 0.3201 0.2484 -0.1130 -0.0151 -0.0511 176 GLN A C   
1347 O O   . GLN A 176 ? 0.4984 0.3062 0.2277 -0.1214 -0.0178 -0.0431 176 GLN A O   
1348 C CB  . GLN A 176 ? 0.5227 0.3866 0.3108 -0.1191 0.0084  -0.0669 176 GLN A CB  
1349 C CG  . GLN A 176 ? 0.7895 0.6392 0.5409 -0.1358 0.0164  -0.0653 176 GLN A CG  
1350 C CD  . GLN A 176 ? 1.0168 0.8583 0.7586 -0.1492 0.0263  -0.0628 176 GLN A CD  
1351 O OE1 . GLN A 176 ? 1.0480 0.8813 0.7971 -0.1465 0.0219  -0.0572 176 GLN A OE1 
1352 N NE2 . GLN A 176 ? 1.1136 0.9585 0.8398 -0.1644 0.0403  -0.0677 176 GLN A NE2 
1353 N N   . TRP A 177 ? 0.4759 0.3201 0.2472 -0.1045 -0.0225 -0.0544 177 TRP A N   
1354 C CA  . TRP A 177 ? 0.4459 0.2784 0.1948 -0.1037 -0.0350 -0.0490 177 TRP A CA  
1355 C C   . TRP A 177 ? 0.4807 0.2951 0.2215 -0.0993 -0.0471 -0.0394 177 TRP A C   
1356 O O   . TRP A 177 ? 0.4657 0.2572 0.1736 -0.1029 -0.0558 -0.0309 177 TRP A O   
1357 C CB  . TRP A 177 ? 0.4341 0.2857 0.2025 -0.0952 -0.0406 -0.0554 177 TRP A CB  
1358 C CG  . TRP A 177 ? 0.5371 0.3822 0.2845 -0.0947 -0.0536 -0.0511 177 TRP A CG  
1359 C CD1 . TRP A 177 ? 0.4887 0.3324 0.2139 -0.1005 -0.0538 -0.0529 177 TRP A CD1 
1360 C CD2 . TRP A 177 ? 0.5466 0.3881 0.2946 -0.0875 -0.0688 -0.0444 177 TRP A CD2 
1361 N NE1 . TRP A 177 ? 0.5074 0.3475 0.2195 -0.0973 -0.0688 -0.0472 177 TRP A NE1 
1362 C CE2 . TRP A 177 ? 0.5626 0.4020 0.2892 -0.0889 -0.0785 -0.0420 177 TRP A CE2 
1363 C CE3 . TRP A 177 ? 0.5494 0.3906 0.3143 -0.0795 -0.0754 -0.0409 177 TRP A CE3 
1364 C CZ2 . TRP A 177 ? 0.6352 0.4744 0.3591 -0.0817 -0.0952 -0.0357 177 TRP A CZ2 
1365 C CZ3 . TRP A 177 ? 0.6458 0.4854 0.4070 -0.0725 -0.0916 -0.0354 177 TRP A CZ3 
1366 C CH2 . TRP A 177 ? 0.6851 0.5248 0.4270 -0.0732 -0.1016 -0.0326 177 TRP A CH2 
1367 N N   . VAL A 178 ? 0.4339 0.2579 0.2038 -0.0907 -0.0481 -0.0407 178 VAL A N   
1368 C CA  . VAL A 178 ? 0.4485 0.2552 0.2132 -0.0854 -0.0585 -0.0336 178 VAL A CA  
1369 C C   . VAL A 178 ? 0.5632 0.3388 0.2968 -0.0951 -0.0560 -0.0268 178 VAL A C   
1370 O O   . VAL A 178 ? 0.6663 0.4138 0.3717 -0.0940 -0.0683 -0.0188 178 VAL A O   
1371 C CB  . VAL A 178 ? 0.4124 0.2374 0.2147 -0.0756 -0.0570 -0.0373 178 VAL A CB  
1372 C CG1 . VAL A 178 ? 0.4070 0.2127 0.2032 -0.0697 -0.0671 -0.0316 178 VAL A CG1 
1373 C CG2 . VAL A 178 ? 0.3722 0.2233 0.2000 -0.0684 -0.0600 -0.0429 178 VAL A CG2 
1374 N N   . GLN A 179 ? 0.6055 0.3853 0.3428 -0.1044 -0.0408 -0.0300 179 GLN A N   
1375 C CA  . GLN A 179 ? 0.6286 0.3795 0.3359 -0.1174 -0.0358 -0.0243 179 GLN A CA  
1376 C C   . GLN A 179 ? 0.7157 0.4364 0.3733 -0.1270 -0.0422 -0.0162 179 GLN A C   
1377 O O   . GLN A 179 ? 0.7647 0.4542 0.3976 -0.1281 -0.0484 -0.0052 179 GLN A O   
1378 C CB  . GLN A 179 ? 0.5609 0.3290 0.2817 -0.1275 -0.0176 -0.0305 179 GLN A CB  
1379 C CG  . GLN A 179 ? 0.6082 0.3965 0.3673 -0.1197 -0.0130 -0.0343 179 GLN A CG  
1380 C CD  . GLN A 179 ? 0.6361 0.4025 0.3906 -0.1163 -0.0191 -0.0276 179 GLN A CD  
1381 O OE1 . GLN A 179 ? 0.7714 0.5130 0.5016 -0.1274 -0.0156 -0.0222 179 GLN A OE1 
1382 N NE2 . GLN A 179 ? 0.5628 0.3380 0.3404 -0.1014 -0.0277 -0.0281 179 GLN A NE2 
1383 N N   . LYS A 180 ? 0.7208 0.4559 0.3719 -0.1299 -0.0395 -0.0188 180 LYS A N   
1384 C CA  . LYS A 180 ? 0.8107 0.5251 0.4193 -0.1377 -0.0437 -0.0099 180 LYS A CA  
1385 C C   . LYS A 180 ? 0.8535 0.5611 0.4523 -0.1249 -0.0636 -0.0019 180 LYS A C   
1386 O O   . LYS A 180 ? 0.9161 0.6044 0.4822 -0.1279 -0.0699 0.0089  180 LYS A O   
1387 C CB  . LYS A 180 ? 0.7932 0.5280 0.4011 -0.1470 -0.0303 -0.0174 180 LYS A CB  
1388 C CG  . LYS A 180 ? 0.8535 0.5997 0.4717 -0.1593 -0.0106 -0.0254 180 LYS A CG  
1389 C CD  . LYS A 180 ? 0.9366 0.7031 0.5541 -0.1661 0.0011  -0.0339 180 LYS A CD  
1390 C CE  . LYS A 180 ? 0.9432 0.7330 0.5858 -0.1720 0.0190  -0.0457 180 LYS A CE  
1391 N NZ  . LYS A 180 ? 0.9969 0.8079 0.6426 -0.1748 0.0290  -0.0560 180 LYS A NZ  
1392 N N   . ASN A 181 ? 0.6938 0.4203 0.3239 -0.1104 -0.0731 -0.0068 181 ASN A N   
1393 C CA  . ASN A 181 ? 0.6732 0.4025 0.2995 -0.0991 -0.0908 -0.0015 181 ASN A CA  
1394 C C   . ASN A 181 ? 0.5895 0.3131 0.2271 -0.0835 -0.1073 0.0033  181 ASN A C   
1395 O O   . ASN A 181 ? 0.5772 0.2968 0.2055 -0.0739 -0.1229 0.0115  181 ASN A O   
1396 C CB  . ASN A 181 ? 0.6825 0.4451 0.3319 -0.0970 -0.0889 -0.0117 181 ASN A CB  
1397 C CG  . ASN A 181 ? 0.6709 0.4384 0.3053 -0.1094 -0.0759 -0.0162 181 ASN A CG  
1398 O OD1 . ASN A 181 ? 0.7326 0.4876 0.3357 -0.1149 -0.0794 -0.0094 181 ASN A OD1 
1399 N ND2 . ASN A 181 ? 0.5957 0.3822 0.2534 -0.1130 -0.0610 -0.0278 181 ASN A ND2 
1400 N N   . ILE A 182 ? 0.5159 0.2421 0.1770 -0.0798 -0.1035 -0.0022 182 ILE A N   
1401 C CA  . ILE A 182 ? 0.5006 0.2327 0.1864 -0.0627 -0.1151 -0.0004 182 ILE A CA  
1402 C C   . ILE A 182 ? 0.6327 0.3357 0.3002 -0.0520 -0.1268 0.0137  182 ILE A C   
1403 O O   . ILE A 182 ? 0.6120 0.3218 0.2948 -0.0355 -0.1403 0.0161  182 ILE A O   
1404 C CB  . ILE A 182 ? 0.4854 0.2314 0.2067 -0.0605 -0.1053 -0.0097 182 ILE A CB  
1405 C CG1 . ILE A 182 ? 0.5338 0.3056 0.2870 -0.0472 -0.1149 -0.0147 182 ILE A CG1 
1406 C CG2 . ILE A 182 ? 0.5487 0.2690 0.2652 -0.0600 -0.0999 -0.0042 182 ILE A CG2 
1407 C CD1 . ILE A 182 ? 0.4367 0.2350 0.1985 -0.0488 -0.1185 -0.0197 182 ILE A CD1 
1408 N N   . ALA A 183 ? 0.6769 0.3477 0.3121 -0.0613 -0.1215 0.0230  183 ALA A N   
1409 C CA  . ALA A 183 ? 0.7257 0.3623 0.3400 -0.0515 -0.1326 0.0374  183 ALA A CA  
1410 C C   . ALA A 183 ? 0.6940 0.3303 0.2901 -0.0416 -0.1520 0.0465  183 ALA A C   
1411 O O   . ALA A 183 ? 0.6742 0.2972 0.2707 -0.0249 -0.1658 0.0551  183 ALA A O   
1412 C CB  . ALA A 183 ? 0.6519 0.2515 0.2327 -0.0667 -0.1220 0.0459  183 ALA A CB  
1413 N N   . ALA A 184 ? 0.6388 0.2959 0.2286 -0.0510 -0.1502 0.0421  184 ALA A N   
1414 C CA  . ALA A 184 ? 0.6896 0.3588 0.2765 -0.0429 -0.1636 0.0470  184 ALA A CA  
1415 C C   . ALA A 184 ? 0.7272 0.4273 0.3500 -0.0253 -0.1768 0.0416  184 ALA A C   
1416 O O   . ALA A 184 ? 0.7974 0.5059 0.4222 -0.0137 -0.1907 0.0473  184 ALA A O   
1417 C CB  . ALA A 184 ? 0.6599 0.3450 0.2347 -0.0580 -0.1555 0.0420  184 ALA A CB  
1418 N N   . PHE A 185 ? 0.6885 0.4079 0.3406 -0.0245 -0.1715 0.0301  185 PHE A N   
1419 C CA  . PHE A 185 ? 0.6302 0.3811 0.3204 -0.0101 -0.1806 0.0234  185 PHE A CA  
1420 C C   . PHE A 185 ? 0.6812 0.4181 0.3839 0.0060  -0.1862 0.0266  185 PHE A C   
1421 O O   . PHE A 185 ? 0.6479 0.4116 0.3862 0.0170  -0.1891 0.0192  185 PHE A O   
1422 C CB  . PHE A 185 ? 0.5646 0.3457 0.2826 -0.0193 -0.1692 0.0084  185 PHE A CB  
1423 C CG  . PHE A 185 ? 0.6085 0.4078 0.3232 -0.0319 -0.1623 0.0030  185 PHE A CG  
1424 C CD1 . PHE A 185 ? 0.6283 0.4127 0.3191 -0.0470 -0.1491 0.0024  185 PHE A CD1 
1425 C CD2 . PHE A 185 ? 0.6359 0.4684 0.3724 -0.0288 -0.1681 -0.0025 185 PHE A CD2 
1426 C CE1 . PHE A 185 ? 0.6533 0.4546 0.3420 -0.0566 -0.1425 -0.0039 185 PHE A CE1 
1427 C CE2 . PHE A 185 ? 0.6270 0.4740 0.3592 -0.0397 -0.1620 -0.0084 185 PHE A CE2 
1428 C CZ  . PHE A 185 ? 0.6323 0.4632 0.3408 -0.0525 -0.1495 -0.0094 185 PHE A CZ  
1429 N N   . GLY A 186 ? 0.7000 0.3979 0.3792 0.0061  -0.1827 0.0361  186 GLY A N   
1430 C CA  . GLY A 186 ? 0.7016 0.3838 0.3952 0.0210  -0.1835 0.0378  186 GLY A CA  
1431 C C   . GLY A 186 ? 0.7176 0.4057 0.4350 0.0144  -0.1657 0.0266  186 GLY A C   
1432 O O   . GLY A 186 ? 0.7481 0.4343 0.4861 0.0270  -0.1653 0.0233  186 GLY A O   
1433 N N   . GLY A 187 ? 0.6328 0.3287 0.3473 -0.0048 -0.1511 0.0201  187 GLY A N   
1434 C CA  . GLY A 187 ? 0.5448 0.2495 0.2816 -0.0118 -0.1354 0.0096  187 GLY A CA  
1435 C C   . GLY A 187 ? 0.5519 0.2227 0.2682 -0.0227 -0.1240 0.0135  187 GLY A C   
1436 O O   . GLY A 187 ? 0.6460 0.2899 0.3283 -0.0312 -0.1243 0.0232  187 GLY A O   
1437 N N   . ASN A 188 ? 0.6083 0.2812 0.3444 -0.0238 -0.1140 0.0059  188 ASN A N   
1438 C CA  . ASN A 188 ? 0.6494 0.2951 0.3708 -0.0366 -0.1021 0.0070  188 ASN A CA  
1439 C C   . ASN A 188 ? 0.6293 0.2960 0.3610 -0.0541 -0.0866 -0.0024 188 ASN A C   
1440 O O   . ASN A 188 ? 0.5080 0.1972 0.2681 -0.0530 -0.0809 -0.0125 188 ASN A O   
1441 C CB  . ASN A 188 ? 0.6426 0.2747 0.3776 -0.0259 -0.1022 0.0041  188 ASN A CB  
1442 C CG  . ASN A 188 ? 0.6553 0.2663 0.3782 -0.0385 -0.0901 0.0054  188 ASN A CG  
1443 O OD1 . ASN A 188 ? 0.6860 0.2880 0.3878 -0.0549 -0.0826 0.0099  188 ASN A OD1 
1444 N ND2 . ASN A 188 ? 0.5571 0.1710 0.2977 -0.0305 -0.0865 0.0009  188 ASN A ND2 
1445 N N   . PRO A 189 ? 0.6501 0.3098 0.3583 -0.0700 -0.0798 0.0009  189 PRO A N   
1446 C CA  . PRO A 189 ? 0.6381 0.3202 0.3569 -0.0849 -0.0651 -0.0083 189 PRO A CA  
1447 C C   . PRO A 189 ? 0.6687 0.3664 0.4121 -0.0861 -0.0518 -0.0115 189 PRO A C   
1448 O O   . PRO A 189 ? 0.5619 0.2940 0.3317 -0.0891 -0.0408 -0.0186 189 PRO A O   
1449 C CB  . PRO A 189 ? 0.5150 0.1805 0.1990 -0.1005 -0.0600 -0.0020 189 PRO A CB  
1450 C CG  . PRO A 189 ? 0.5573 0.1829 0.2120 -0.0974 -0.0682 0.0118  189 PRO A CG  
1451 C CD  . PRO A 189 ? 0.6268 0.2537 0.2956 -0.0753 -0.0840 0.0140  189 PRO A CD  
1452 N N   . LYS A 190 ? 0.6279 0.3009 0.3630 -0.0826 -0.0541 -0.0065 190 LYS A N   
1453 C CA  . LYS A 190 ? 0.5953 0.2825 0.3522 -0.0837 -0.0439 -0.0110 190 LYS A CA  
1454 C C   . LYS A 190 ? 0.5745 0.2853 0.3652 -0.0698 -0.0461 -0.0181 190 LYS A C   
1455 O O   . LYS A 190 ? 0.5932 0.3175 0.4031 -0.0701 -0.0390 -0.0228 190 LYS A O   
1456 C CB  . LYS A 190 ? 0.6410 0.2940 0.3753 -0.0877 -0.0436 -0.0043 190 LYS A CB  
1457 C CG  . LYS A 190 ? 0.8102 0.4453 0.5134 -0.1054 -0.0373 0.0019  190 LYS A CG  
1458 C CD  . LYS A 190 ? 0.9527 0.5535 0.6336 -0.1091 -0.0377 0.0090  190 LYS A CD  
1459 C CE  . LYS A 190 ? 1.0963 0.6808 0.7449 -0.1281 -0.0309 0.0152  190 LYS A CE  
1460 N NZ  . LYS A 190 ? 1.1873 0.7380 0.8140 -0.1327 -0.0312 0.0224  190 LYS A NZ  
1461 N N   . SER A 191 ? 0.4761 0.1925 0.2732 -0.0588 -0.0561 -0.0194 191 SER A N   
1462 C CA  . SER A 191 ? 0.3937 0.1332 0.2205 -0.0474 -0.0573 -0.0263 191 SER A CA  
1463 C C   . SER A 191 ? 0.3963 0.1647 0.2401 -0.0447 -0.0595 -0.0306 191 SER A C   
1464 O O   . SER A 191 ? 0.5146 0.2813 0.3591 -0.0352 -0.0712 -0.0314 191 SER A O   
1465 C CB  . SER A 191 ? 0.4340 0.1495 0.2550 -0.0330 -0.0684 -0.0248 191 SER A CB  
1466 O OG  . SER A 191 ? 0.3789 0.1167 0.2271 -0.0244 -0.0665 -0.0327 191 SER A OG  
1467 N N   . VAL A 192 ? 0.3607 0.1563 0.2202 -0.0522 -0.0488 -0.0340 192 VAL A N   
1468 C CA  . VAL A 192 ? 0.3677 0.1912 0.2445 -0.0506 -0.0483 -0.0379 192 VAL A CA  
1469 C C   . VAL A 192 ? 0.3565 0.2098 0.2644 -0.0479 -0.0404 -0.0437 192 VAL A C   
1470 O O   . VAL A 192 ? 0.4368 0.2976 0.3533 -0.0519 -0.0327 -0.0455 192 VAL A O   
1471 C CB  . VAL A 192 ? 0.4028 0.2293 0.2692 -0.0597 -0.0435 -0.0372 192 VAL A CB  
1472 C CG1 . VAL A 192 ? 0.2756 0.1290 0.1612 -0.0567 -0.0427 -0.0418 192 VAL A CG1 
1473 C CG2 . VAL A 192 ? 0.3431 0.1373 0.1727 -0.0647 -0.0513 -0.0309 192 VAL A CG2 
1474 N N   . THR A 193 ? 0.3047 0.1738 0.2276 -0.0417 -0.0437 -0.0465 193 THR A N   
1475 C CA  . THR A 193 ? 0.3144 0.2086 0.2615 -0.0404 -0.0366 -0.0511 193 THR A CA  
1476 C C   . THR A 193 ? 0.3098 0.2238 0.2687 -0.0407 -0.0349 -0.0529 193 THR A C   
1477 O O   . THR A 193 ? 0.3284 0.2434 0.2842 -0.0389 -0.0407 -0.0520 193 THR A O   
1478 C CB  . THR A 193 ? 0.2874 0.1822 0.2396 -0.0349 -0.0397 -0.0527 193 THR A CB  
1479 O OG1 . THR A 193 ? 0.3672 0.2431 0.3106 -0.0334 -0.0403 -0.0526 193 THR A OG1 
1480 C CG2 . THR A 193 ? 0.1870 0.1047 0.1563 -0.0363 -0.0324 -0.0558 193 THR A CG2 
1481 N N   . LEU A 194 ? 0.2849 0.2128 0.2576 -0.0416 -0.0291 -0.0557 194 LEU A N   
1482 C CA  . LEU A 194 ? 0.2900 0.2334 0.2744 -0.0399 -0.0276 -0.0572 194 LEU A CA  
1483 C C   . LEU A 194 ? 0.3352 0.2894 0.3256 -0.0396 -0.0238 -0.0557 194 LEU A C   
1484 O O   . LEU A 194 ? 0.2463 0.2015 0.2388 -0.0395 -0.0212 -0.0552 194 LEU A O   
1485 C CB  . LEU A 194 ? 0.2393 0.1837 0.2287 -0.0385 -0.0284 -0.0567 194 LEU A CB  
1486 C CG  . LEU A 194 ? 0.2913 0.2237 0.2663 -0.0442 -0.0275 -0.0569 194 LEU A CG  
1487 C CD1 . LEU A 194 ? 0.1780 0.1123 0.1537 -0.0460 -0.0258 -0.0571 194 LEU A CD1 
1488 C CD2 . LEU A 194 ? 0.2969 0.2211 0.2557 -0.0477 -0.0286 -0.0566 194 LEU A CD2 
1489 N N   . PHE A 195 ? 0.2867 0.2449 0.2746 -0.0414 -0.0250 -0.0542 195 PHE A N   
1490 C CA  . PHE A 195 ? 0.2598 0.2215 0.2466 -0.0433 -0.0249 -0.0502 195 PHE A CA  
1491 C C   . PHE A 195 ? 0.3322 0.2969 0.3202 -0.0452 -0.0256 -0.0493 195 PHE A C   
1492 O O   . PHE A 195 ? 0.3257 0.2914 0.3144 -0.0453 -0.0267 -0.0523 195 PHE A O   
1493 C CB  . PHE A 195 ? 0.2810 0.2427 0.2677 -0.0422 -0.0304 -0.0503 195 PHE A CB  
1494 C CG  . PHE A 195 ? 0.2617 0.2251 0.2501 -0.0404 -0.0389 -0.0517 195 PHE A CG  
1495 C CD1 . PHE A 195 ? 0.3202 0.2783 0.3035 -0.0398 -0.0424 -0.0530 195 PHE A CD1 
1496 C CD2 . PHE A 195 ? 0.2035 0.1755 0.1993 -0.0390 -0.0446 -0.0517 195 PHE A CD2 
1497 C CE1 . PHE A 195 ? 0.3145 0.2748 0.2974 -0.0380 -0.0522 -0.0533 195 PHE A CE1 
1498 C CE2 . PHE A 195 ? 0.3039 0.2819 0.3039 -0.0371 -0.0532 -0.0533 195 PHE A CE2 
1499 C CZ  . PHE A 195 ? 0.2673 0.2391 0.2600 -0.0365 -0.0576 -0.0537 195 PHE A CZ  
1500 N N   . GLY A 196 ? 0.3297 0.2948 0.3184 -0.0463 -0.0261 -0.0459 196 GLY A N   
1501 C CA  . GLY A 196 ? 0.2368 0.2020 0.2273 -0.0481 -0.0266 -0.0458 196 GLY A CA  
1502 C C   . GLY A 196 ? 0.2866 0.2546 0.2816 -0.0489 -0.0276 -0.0435 196 GLY A C   
1503 O O   . GLY A 196 ? 0.2923 0.2622 0.2879 -0.0480 -0.0278 -0.0417 196 GLY A O   
1504 N N   . GLU A 197 ? 0.2834 0.2515 0.2816 -0.0511 -0.0278 -0.0446 197 GLU A N   
1505 C CA  . GLU A 197 ? 0.2534 0.2249 0.2572 -0.0528 -0.0279 -0.0438 197 GLU A CA  
1506 C C   . GLU A 197 ? 0.2860 0.2497 0.2916 -0.0534 -0.0280 -0.0452 197 GLU A C   
1507 O O   . GLU A 197 ? 0.3257 0.2828 0.3287 -0.0541 -0.0279 -0.0475 197 GLU A O   
1508 C CB  . GLU A 197 ? 0.2300 0.2105 0.2388 -0.0559 -0.0286 -0.0445 197 GLU A CB  
1509 C CG  . GLU A 197 ? 0.2412 0.2284 0.2597 -0.0575 -0.0280 -0.0454 197 GLU A CG  
1510 C CD  . GLU A 197 ? 0.3574 0.3371 0.3814 -0.0600 -0.0296 -0.0467 197 GLU A CD  
1511 O OE1 . GLU A 197 ? 0.4070 0.3787 0.4266 -0.0608 -0.0297 -0.0482 197 GLU A OE1 
1512 O OE2 . GLU A 197 ? 0.2947 0.2732 0.3250 -0.0628 -0.0321 -0.0453 197 GLU A OE2 
1513 N N   . SER A 198 ? 0.2452 0.2085 0.2545 -0.0534 -0.0287 -0.0443 198 SER A N   
1514 C CA  . SER A 198 ? 0.2729 0.2256 0.2836 -0.0535 -0.0304 -0.0453 198 SER A CA  
1515 C C   . SER A 198 ? 0.2280 0.1743 0.2346 -0.0500 -0.0301 -0.0472 198 SER A C   
1516 O O   . SER A 198 ? 0.2933 0.2437 0.2988 -0.0478 -0.0298 -0.0467 198 SER A O   
1517 C CB  . SER A 198 ? 0.1667 0.1122 0.1812 -0.0574 -0.0324 -0.0456 198 SER A CB  
1518 O OG  . SER A 198 ? 0.5299 0.4556 0.5453 -0.0571 -0.0376 -0.0450 198 SER A OG  
1519 N N   . ALA A 199 ? 0.2299 0.1659 0.2344 -0.0499 -0.0301 -0.0503 199 ALA A N   
1520 C CA  . ALA A 199 ? 0.3274 0.2579 0.3287 -0.0467 -0.0296 -0.0538 199 ALA A CA  
1521 C C   . ALA A 199 ? 0.3606 0.2956 0.3543 -0.0478 -0.0280 -0.0531 199 ALA A C   
1522 O O   . ALA A 199 ? 0.2918 0.2259 0.2839 -0.0452 -0.0279 -0.0548 199 ALA A O   
1523 C CB  . ALA A 199 ? 0.2375 0.1548 0.2364 -0.0468 -0.0298 -0.0585 199 ALA A CB  
1524 N N   . GLY A 200 ? 0.3470 0.2881 0.3391 -0.0500 -0.0273 -0.0506 200 GLY A N   
1525 C CA  . GLY A 200 ? 0.3077 0.2522 0.2943 -0.0496 -0.0268 -0.0489 200 GLY A CA  
1526 C C   . GLY A 200 ? 0.2769 0.2251 0.2650 -0.0474 -0.0270 -0.0465 200 GLY A C   
1527 O O   . GLY A 200 ? 0.2842 0.2288 0.2680 -0.0458 -0.0278 -0.0463 200 GLY A O   
1528 N N   . ALA A 201 ? 0.2534 0.2078 0.2475 -0.0475 -0.0271 -0.0449 201 ALA A N   
1529 C CA  . ALA A 201 ? 0.2763 0.2344 0.2715 -0.0462 -0.0275 -0.0432 201 ALA A CA  
1530 C C   . ALA A 201 ? 0.3558 0.3119 0.3534 -0.0451 -0.0285 -0.0453 201 ALA A C   
1531 O O   . ALA A 201 ? 0.2843 0.2410 0.2811 -0.0445 -0.0288 -0.0455 201 ALA A O   
1532 C CB  . ALA A 201 ? 0.1795 0.1444 0.1791 -0.0473 -0.0278 -0.0417 201 ALA A CB  
1533 N N   . ALA A 202 ? 0.2539 0.2082 0.2566 -0.0442 -0.0291 -0.0478 202 ALA A N   
1534 C CA  . ALA A 202 ? 0.2855 0.2419 0.2965 -0.0409 -0.0299 -0.0524 202 ALA A CA  
1535 C C   . ALA A 202 ? 0.2999 0.2535 0.3065 -0.0408 -0.0277 -0.0555 202 ALA A C   
1536 O O   . ALA A 202 ? 0.3222 0.2832 0.3367 -0.0398 -0.0262 -0.0602 202 ALA A O   
1537 C CB  . ALA A 202 ? 0.1550 0.1086 0.1783 -0.0369 -0.0334 -0.0570 202 ALA A CB  
1538 N N   . SER A 203 ? 0.2376 0.1827 0.2339 -0.0423 -0.0275 -0.0545 203 SER A N   
1539 C CA  . SER A 203 ? 0.1882 0.1302 0.1798 -0.0420 -0.0267 -0.0576 203 SER A CA  
1540 C C   . SER A 203 ? 0.2874 0.2328 0.2782 -0.0428 -0.0270 -0.0555 203 SER A C   
1541 O O   . SER A 203 ? 0.2742 0.2241 0.2681 -0.0434 -0.0239 -0.0596 203 SER A O   
1542 C CB  . SER A 203 ? 0.2324 0.1652 0.2143 -0.0430 -0.0286 -0.0576 203 SER A CB  
1543 O OG  . SER A 203 ? 0.3464 0.2737 0.3285 -0.0428 -0.0277 -0.0614 203 SER A OG  
1544 N N   . VAL A 204 ? 0.2684 0.2131 0.2562 -0.0429 -0.0291 -0.0500 204 VAL A N   
1545 C CA  . VAL A 204 ? 0.3208 0.2661 0.3086 -0.0422 -0.0300 -0.0487 204 VAL A CA  
1546 C C   . VAL A 204 ? 0.3224 0.2744 0.3167 -0.0441 -0.0276 -0.0513 204 VAL A C   
1547 O O   . VAL A 204 ? 0.2552 0.2091 0.2506 -0.0459 -0.0248 -0.0541 204 VAL A O   
1548 C CB  . VAL A 204 ? 0.3780 0.3229 0.3627 -0.0413 -0.0314 -0.0434 204 VAL A CB  
1549 C CG1 . VAL A 204 ? 0.2738 0.2194 0.2616 -0.0400 -0.0322 -0.0439 204 VAL A CG1 
1550 C CG2 . VAL A 204 ? 0.3579 0.2977 0.3361 -0.0403 -0.0338 -0.0414 204 VAL A CG2 
1551 N N   . SER A 205 ? 0.3508 0.3088 0.3502 -0.0442 -0.0276 -0.0505 205 SER A N   
1552 C CA  . SER A 205 ? 0.3397 0.3073 0.3475 -0.0453 -0.0263 -0.0530 205 SER A CA  
1553 C C   . SER A 205 ? 0.2852 0.2606 0.3009 -0.0468 -0.0215 -0.0606 205 SER A C   
1554 O O   . SER A 205 ? 0.2316 0.2154 0.2525 -0.0504 -0.0184 -0.0641 205 SER A O   
1555 C CB  . SER A 205 ? 0.3205 0.2941 0.3343 -0.0445 -0.0286 -0.0522 205 SER A CB  
1556 O OG  . SER A 205 ? 0.3046 0.2794 0.3260 -0.0419 -0.0284 -0.0566 205 SER A OG  
1557 N N   . LEU A 206 ? 0.2521 0.2263 0.2696 -0.0452 -0.0197 -0.0652 206 LEU A N   
1558 C CA  . LEU A 206 ? 0.2313 0.2161 0.2582 -0.0473 -0.0128 -0.0759 206 LEU A CA  
1559 C C   . LEU A 206 ? 0.2908 0.2730 0.3079 -0.0531 -0.0076 -0.0765 206 LEU A C   
1560 O O   . LEU A 206 ? 0.2852 0.2798 0.3088 -0.0589 0.0001  -0.0843 206 LEU A O   
1561 C CB  . LEU A 206 ? 0.2463 0.2297 0.2784 -0.0433 -0.0120 -0.0826 206 LEU A CB  
1562 C CG  . LEU A 206 ? 0.2627 0.2516 0.3115 -0.0372 -0.0162 -0.0868 206 LEU A CG  
1563 C CD1 . LEU A 206 ? 0.2446 0.2236 0.2937 -0.0324 -0.0170 -0.0911 206 LEU A CD1 
1564 C CD2 . LEU A 206 ? 0.1661 0.1764 0.2378 -0.0363 -0.0142 -0.0981 206 LEU A CD2 
1565 N N   . HIS A 207 ? 0.1927 0.1605 0.1955 -0.0523 -0.0115 -0.0693 207 HIS A N   
1566 C CA  . HIS A 207 ? 0.2373 0.2007 0.2303 -0.0578 -0.0075 -0.0695 207 HIS A CA  
1567 C C   . HIS A 207 ? 0.3407 0.3075 0.3350 -0.0627 -0.0052 -0.0683 207 HIS A C   
1568 O O   . HIS A 207 ? 0.4010 0.3676 0.3887 -0.0713 0.0018  -0.0709 207 HIS A O   
1569 C CB  . HIS A 207 ? 0.1786 0.1288 0.1613 -0.0541 -0.0139 -0.0641 207 HIS A CB  
1570 C CG  . HIS A 207 ? 0.2565 0.2030 0.2345 -0.0525 -0.0146 -0.0668 207 HIS A CG  
1571 N ND1 . HIS A 207 ? 0.2143 0.1614 0.1841 -0.0586 -0.0070 -0.0731 207 HIS A ND1 
1572 C CD2 . HIS A 207 ? 0.3216 0.2631 0.2999 -0.0468 -0.0215 -0.0644 207 HIS A CD2 
1573 C CE1 . HIS A 207 ? 0.2100 0.1528 0.1763 -0.0555 -0.0100 -0.0750 207 HIS A CE1 
1574 N NE2 . HIS A 207 ? 0.2796 0.2187 0.2514 -0.0484 -0.0190 -0.0698 207 HIS A NE2 
1575 N N   . LEU A 208 ? 0.2311 0.1995 0.2316 -0.0587 -0.0107 -0.0643 208 LEU A N   
1576 C CA  . LEU A 208 ? 0.2589 0.2315 0.2619 -0.0630 -0.0093 -0.0643 208 LEU A CA  
1577 C C   . LEU A 208 ? 0.3571 0.3470 0.3702 -0.0703 -0.0015 -0.0725 208 LEU A C   
1578 O O   . LEU A 208 ? 0.3687 0.3621 0.3810 -0.0777 0.0025  -0.0741 208 LEU A O   
1579 C CB  . LEU A 208 ? 0.2550 0.2271 0.2616 -0.0577 -0.0164 -0.0596 208 LEU A CB  
1580 C CG  . LEU A 208 ? 0.3730 0.3335 0.3726 -0.0538 -0.0208 -0.0554 208 LEU A CG  
1581 C CD1 . LEU A 208 ? 0.3938 0.3573 0.3963 -0.0515 -0.0247 -0.0532 208 LEU A CD1 
1582 C CD2 . LEU A 208 ? 0.3278 0.2798 0.3208 -0.0573 -0.0186 -0.0559 208 LEU A CD2 
1583 N N   . LEU A 209 ? 0.3015 0.3035 0.3258 -0.0682 0.0007  -0.0790 209 LEU A N   
1584 C CA  . LEU A 209 ? 0.2581 0.2823 0.2978 -0.0739 0.0076  -0.0897 209 LEU A CA  
1585 C C   . LEU A 209 ? 0.2797 0.3099 0.3171 -0.0816 0.0185  -0.0982 209 LEU A C   
1586 O O   . LEU A 209 ? 0.3341 0.3839 0.3819 -0.0895 0.0266  -0.1077 209 LEU A O   
1587 C CB  . LEU A 209 ? 0.2582 0.2975 0.3180 -0.0666 0.0034  -0.0955 209 LEU A CB  
1588 C CG  . LEU A 209 ? 0.2374 0.2728 0.2987 -0.0604 -0.0066 -0.0881 209 LEU A CG  
1589 C CD1 . LEU A 209 ? 0.2278 0.2831 0.3120 -0.0554 -0.0105 -0.0961 209 LEU A CD1 
1590 C CD2 . LEU A 209 ? 0.1582 0.1892 0.2111 -0.0649 -0.0085 -0.0817 209 LEU A CD2 
1591 N N   . SER A 210 ? 0.1851 0.2002 0.2087 -0.0800 0.0188  -0.0956 210 SER A N   
1592 C CA  . SER A 210 ? 0.3281 0.3483 0.3470 -0.0876 0.0294  -0.1045 210 SER A CA  
1593 C C   . SER A 210 ? 0.4133 0.4252 0.4131 -0.1007 0.0365  -0.1016 210 SER A C   
1594 O O   . SER A 210 ? 0.4474 0.4380 0.4290 -0.1001 0.0317  -0.0918 210 SER A O   
1595 C CB  . SER A 210 ? 0.3089 0.3162 0.3194 -0.0807 0.0262  -0.1036 210 SER A CB  
1596 O OG  . SER A 210 ? 0.3363 0.3520 0.3451 -0.0868 0.0368  -0.1151 210 SER A OG  
1597 N N   . PRO A 211 ? 0.5754 0.6049 0.5798 -0.1132 0.0482  -0.1111 211 PRO A N   
1598 C CA  . PRO A 211 ? 0.6041 0.6245 0.5879 -0.1285 0.0562  -0.1082 211 PRO A CA  
1599 C C   . PRO A 211 ? 0.5390 0.5373 0.4959 -0.1329 0.0580  -0.1036 211 PRO A C   
1600 O O   . PRO A 211 ? 0.6227 0.6003 0.5574 -0.1400 0.0574  -0.0950 211 PRO A O   
1601 C CB  . PRO A 211 ? 0.5607 0.6100 0.5573 -0.1409 0.0698  -0.1224 211 PRO A CB  
1602 C CG  . PRO A 211 ? 0.5982 0.6716 0.6262 -0.1299 0.0646  -0.1295 211 PRO A CG  
1603 C CD  . PRO A 211 ? 0.6004 0.6612 0.6310 -0.1139 0.0544  -0.1257 211 PRO A CD  
1604 N N   . GLY A 212 ? 0.4359 0.4369 0.3938 -0.1280 0.0590  -0.1093 212 GLY A N   
1605 C CA  . GLY A 212 ? 0.2803 0.2612 0.2125 -0.1306 0.0587  -0.1049 212 GLY A CA  
1606 C C   . GLY A 212 ? 0.3838 0.3415 0.3061 -0.1199 0.0443  -0.0916 212 GLY A C   
1607 O O   . GLY A 212 ? 0.3431 0.2824 0.2420 -0.1231 0.0423  -0.0864 212 GLY A O   
1608 N N   . SER A 213 ? 0.3691 0.3291 0.3090 -0.1077 0.0344  -0.0869 213 SER A N   
1609 C CA  . SER A 213 ? 0.3871 0.3305 0.3217 -0.0980 0.0221  -0.0767 213 SER A CA  
1610 C C   . SER A 213 ? 0.4186 0.3509 0.3467 -0.1013 0.0199  -0.0700 213 SER A C   
1611 O O   . SER A 213 ? 0.5526 0.4698 0.4728 -0.0961 0.0121  -0.0634 213 SER A O   
1612 C CB  . SER A 213 ? 0.3067 0.2570 0.2610 -0.0832 0.0124  -0.0757 213 SER A CB  
1613 O OG  . SER A 213 ? 0.3746 0.3275 0.3300 -0.0794 0.0123  -0.0805 213 SER A OG  
1614 N N   . HIS A 214 ? 0.2969 0.2371 0.2289 -0.1100 0.0269  -0.0728 214 HIS A N   
1615 C CA  A HIS A 214 ? 0.3664 0.2968 0.2946 -0.1126 0.0246  -0.0676 214 HIS A CA  
1616 C CA  B HIS A 214 ? 0.3696 0.2998 0.2984 -0.1115 0.0239  -0.0674 214 HIS A CA  
1617 C C   . HIS A 214 ? 0.4289 0.3320 0.3319 -0.1163 0.0220  -0.0603 214 HIS A C   
1618 O O   . HIS A 214 ? 0.4650 0.3565 0.3682 -0.1096 0.0146  -0.0555 214 HIS A O   
1619 C CB  A HIS A 214 ? 0.3355 0.2778 0.2664 -0.1258 0.0346  -0.0729 214 HIS A CB  
1620 C CB  B HIS A 214 ? 0.3545 0.2984 0.2906 -0.1218 0.0318  -0.0723 214 HIS A CB  
1621 C CG  A HIS A 214 ? 0.3590 0.2904 0.2851 -0.1296 0.0327  -0.0686 214 HIS A CG  
1622 C CG  B HIS A 214 ? 0.3747 0.3415 0.3367 -0.1142 0.0292  -0.0772 214 HIS A CG  
1623 N ND1 A HIS A 214 ? 0.4318 0.3387 0.3330 -0.1392 0.0348  -0.0634 214 HIS A ND1 
1624 N ND1 B HIS A 214 ? 0.3011 0.2840 0.2744 -0.1207 0.0333  -0.0819 214 HIS A ND1 
1625 C CD2 A HIS A 214 ? 0.3595 0.2994 0.3007 -0.1259 0.0288  -0.0693 214 HIS A CD2 
1626 C CD2 B HIS A 214 ? 0.2214 0.1961 0.1982 -0.1013 0.0221  -0.0775 214 HIS A CD2 
1627 C CE1 A HIS A 214 ? 0.4216 0.3226 0.3247 -0.1405 0.0325  -0.0617 214 HIS A CE1 
1628 C CE1 B HIS A 214 ? 0.2487 0.2486 0.2425 -0.1117 0.0286  -0.0851 214 HIS A CE1 
1629 N NE2 A HIS A 214 ? 0.2929 0.2145 0.2201 -0.1329 0.0290  -0.0655 214 HIS A NE2 
1630 N NE2 B HIS A 214 ? 0.3172 0.3110 0.3124 -0.1003 0.0221  -0.0822 214 HIS A NE2 
1631 N N   . SER A 215 ? 0.3974 0.2892 0.2770 -0.1278 0.0285  -0.0601 215 SER A N   
1632 C CA  . SER A 215 ? 0.4163 0.2776 0.2658 -0.1338 0.0259  -0.0523 215 SER A CA  
1633 C C   . SER A 215 ? 0.4612 0.3098 0.3022 -0.1240 0.0159  -0.0481 215 SER A C   
1634 O O   . SER A 215 ? 0.5293 0.3500 0.3434 -0.1276 0.0114  -0.0412 215 SER A O   
1635 C CB  . SER A 215 ? 0.4361 0.2868 0.2574 -0.1537 0.0371  -0.0528 215 SER A CB  
1636 O OG  . SER A 215 ? 0.5777 0.4256 0.3842 -0.1563 0.0384  -0.0542 215 SER A OG  
1637 N N   . LEU A 216 ? 0.3945 0.2622 0.2573 -0.1120 0.0116  -0.0521 216 LEU A N   
1638 C CA  . LEU A 216 ? 0.3324 0.1941 0.1898 -0.1040 0.0030  -0.0501 216 LEU A CA  
1639 C C   . LEU A 216 ? 0.3467 0.2083 0.2186 -0.0903 -0.0075 -0.0473 216 LEU A C   
1640 O O   . LEU A 216 ? 0.3936 0.2520 0.2626 -0.0840 -0.0151 -0.0460 216 LEU A O   
1641 C CB  . LEU A 216 ? 0.3981 0.2792 0.2683 -0.1003 0.0052  -0.0569 216 LEU A CB  
1642 C CG  . LEU A 216 ? 0.4302 0.3066 0.2779 -0.1113 0.0121  -0.0601 216 LEU A CG  
1643 C CD1 . LEU A 216 ? 0.3491 0.2141 0.1738 -0.1291 0.0227  -0.0592 216 LEU A CD1 
1644 C CD2 . LEU A 216 ? 0.3594 0.2578 0.2263 -0.1072 0.0167  -0.0692 216 LEU A CD2 
1645 N N   . PHE A 217 ? 0.2816 0.1483 0.1688 -0.0867 -0.0075 -0.0472 217 PHE A N   
1646 C CA  . PHE A 217 ? 0.3001 0.1679 0.2005 -0.0756 -0.0151 -0.0462 217 PHE A CA  
1647 C C   . PHE A 217 ? 0.3290 0.1929 0.2346 -0.0759 -0.0139 -0.0458 217 PHE A C   
1648 O O   . PHE A 217 ? 0.5023 0.3646 0.4035 -0.0846 -0.0077 -0.0461 217 PHE A O   
1649 C CB  . PHE A 217 ? 0.2586 0.1497 0.1848 -0.0651 -0.0184 -0.0501 217 PHE A CB  
1650 C CG  . PHE A 217 ? 0.2509 0.1599 0.1969 -0.0631 -0.0157 -0.0533 217 PHE A CG  
1651 C CD1 . PHE A 217 ? 0.2866 0.2025 0.2320 -0.0687 -0.0101 -0.0559 217 PHE A CD1 
1652 C CD2 . PHE A 217 ? 0.2776 0.1951 0.2402 -0.0562 -0.0192 -0.0537 217 PHE A CD2 
1653 C CE1 . PHE A 217 ? 0.3353 0.2653 0.2957 -0.0672 -0.0087 -0.0582 217 PHE A CE1 
1654 C CE2 . PHE A 217 ? 0.2865 0.2156 0.2608 -0.0550 -0.0191 -0.0546 217 PHE A CE2 
1655 C CZ  . PHE A 217 ? 0.3421 0.2771 0.3151 -0.0605 -0.0141 -0.0566 217 PHE A CZ  
1656 N N   . THR A 218 ? 0.3394 0.2022 0.2536 -0.0674 -0.0192 -0.0459 218 THR A N   
1657 C CA  . THR A 218 ? 0.4108 0.2667 0.3273 -0.0673 -0.0186 -0.0464 218 THR A CA  
1658 C C   . THR A 218 ? 0.3708 0.2497 0.3135 -0.0602 -0.0194 -0.0513 218 THR A C   
1659 O O   . THR A 218 ? 0.2729 0.1581 0.2226 -0.0630 -0.0173 -0.0530 218 THR A O   
1660 C CB  . THR A 218 ? 0.5261 0.3572 0.4273 -0.0632 -0.0243 -0.0434 218 THR A CB  
1661 O OG1 . THR A 218 ? 0.5679 0.3752 0.4416 -0.0677 -0.0273 -0.0375 218 THR A OG1 
1662 C CG2 . THR A 218 ? 0.4776 0.2947 0.3759 -0.0646 -0.0228 -0.0441 218 THR A CG2 
1663 N N   . ARG A 219 ? 0.2373 0.1272 0.1913 -0.0522 -0.0228 -0.0530 219 ARG A N   
1664 C CA  . ARG A 219 ? 0.2656 0.1735 0.2394 -0.0461 -0.0240 -0.0569 219 ARG A CA  
1665 C C   . ARG A 219 ? 0.2982 0.2233 0.2841 -0.0416 -0.0255 -0.0573 219 ARG A C   
1666 O O   . ARG A 219 ? 0.3189 0.2436 0.3007 -0.0425 -0.0256 -0.0565 219 ARG A O   
1667 C CB  . ARG A 219 ? 0.3156 0.2163 0.2875 -0.0429 -0.0242 -0.0594 219 ARG A CB  
1668 C CG  . ARG A 219 ? 0.4449 0.3354 0.4141 -0.0447 -0.0234 -0.0613 219 ARG A CG  
1669 C CD  . ARG A 219 ? 0.4409 0.3219 0.4064 -0.0405 -0.0234 -0.0647 219 ARG A CD  
1670 N NE  . ARG A 219 ? 0.4879 0.3429 0.4339 -0.0377 -0.0277 -0.0604 219 ARG A NE  
1671 C CZ  . ARG A 219 ? 0.4925 0.3208 0.4222 -0.0393 -0.0291 -0.0576 219 ARG A CZ  
1672 N NH1 . ARG A 219 ? 0.2887 0.1146 0.2194 -0.0457 -0.0251 -0.0590 219 ARG A NH1 
1673 N NH2 . ARG A 219 ? 0.4185 0.2209 0.3296 -0.0339 -0.0362 -0.0529 219 ARG A NH2 
1674 N N   . ALA A 220 ? 0.2115 0.1478 0.2064 -0.0375 -0.0268 -0.0566 220 ALA A N   
1675 C CA  . ALA A 220 ? 0.2448 0.1901 0.2448 -0.0341 -0.0299 -0.0534 220 ALA A CA  
1676 C C   . ALA A 220 ? 0.3071 0.2479 0.2994 -0.0310 -0.0366 -0.0465 220 ALA A C   
1677 O O   . ALA A 220 ? 0.3374 0.2708 0.3164 -0.0354 -0.0357 -0.0440 220 ALA A O   
1678 C CB  . ALA A 220 ? 0.1879 0.1302 0.1816 -0.0387 -0.0311 -0.0500 220 ALA A CB  
1679 N N   . ILE A 221 ? 0.2452 0.1914 0.2175 -0.0456 -0.0206 -0.0443 221 ILE A N   
1680 C CA  . ILE A 221 ? 0.2200 0.1716 0.1976 -0.0435 -0.0248 -0.0436 221 ILE A CA  
1681 C C   . ILE A 221 ? 0.2517 0.2086 0.2343 -0.0437 -0.0268 -0.0410 221 ILE A C   
1682 O O   . ILE A 221 ? 0.1986 0.1560 0.1813 -0.0445 -0.0255 -0.0415 221 ILE A O   
1683 C CB  . ILE A 221 ? 0.2349 0.1902 0.2163 -0.0420 -0.0255 -0.0472 221 ILE A CB  
1684 C CG1 . ILE A 221 ? 0.2732 0.2202 0.2531 -0.0396 -0.0266 -0.0529 221 ILE A CG1 
1685 C CG2 . ILE A 221 ? 0.2016 0.1646 0.1887 -0.0418 -0.0299 -0.0465 221 ILE A CG2 
1686 C CD1 . ILE A 221 ? 0.1625 0.1086 0.1476 -0.0332 -0.0351 -0.0564 221 ILE A CD1 
1687 N N   . LEU A 222 ? 0.2425 0.2034 0.2292 -0.0436 -0.0289 -0.0398 222 LEU A N   
1688 C CA  . LEU A 222 ? 0.2581 0.2234 0.2492 -0.0448 -0.0289 -0.0388 222 LEU A CA  
1689 C C   . LEU A 222 ? 0.2811 0.2529 0.2753 -0.0466 -0.0297 -0.0377 222 LEU A C   
1690 O O   . LEU A 222 ? 0.2162 0.1903 0.2105 -0.0472 -0.0317 -0.0364 222 LEU A O   
1691 C CB  . LEU A 222 ? 0.2876 0.2535 0.2811 -0.0450 -0.0301 -0.0390 222 LEU A CB  
1692 C CG  . LEU A 222 ? 0.2962 0.2580 0.2899 -0.0442 -0.0304 -0.0407 222 LEU A CG  
1693 C CD1 . LEU A 222 ? 0.2582 0.2141 0.2486 -0.0427 -0.0312 -0.0413 222 LEU A CD1 
1694 C CD2 . LEU A 222 ? 0.2723 0.2398 0.2719 -0.0456 -0.0317 -0.0424 222 LEU A CD2 
1695 N N   . GLN A 223 ? 0.2704 0.2447 0.2667 -0.0479 -0.0291 -0.0381 223 GLN A N   
1696 C CA  . GLN A 223 ? 0.2436 0.2243 0.2424 -0.0511 -0.0296 -0.0368 223 GLN A CA  
1697 C C   . GLN A 223 ? 0.2550 0.2399 0.2616 -0.0525 -0.0269 -0.0399 223 GLN A C   
1698 O O   . GLN A 223 ? 0.2903 0.2699 0.2988 -0.0522 -0.0273 -0.0410 223 GLN A O   
1699 C CB  . GLN A 223 ? 0.2376 0.2205 0.2374 -0.0521 -0.0316 -0.0367 223 GLN A CB  
1700 C CG  . GLN A 223 ? 0.2034 0.1857 0.2030 -0.0491 -0.0346 -0.0382 223 GLN A CG  
1701 C CD  . GLN A 223 ? 0.2864 0.2734 0.2901 -0.0496 -0.0373 -0.0410 223 GLN A CD  
1702 O OE1 . GLN A 223 ? 0.2920 0.2783 0.2964 -0.0466 -0.0389 -0.0453 223 GLN A OE1 
1703 N NE2 . GLN A 223 ? 0.3625 0.3543 0.3692 -0.0536 -0.0389 -0.0390 223 GLN A NE2 
1704 N N   . SER A 224 ? 0.2529 0.2445 0.2669 -0.0526 -0.0272 -0.0420 224 SER A N   
1705 C CA  . SER A 224 ? 0.3326 0.3184 0.3528 -0.0542 -0.0326 -0.0418 224 SER A CA  
1706 C C   . SER A 224 ? 0.2983 0.2738 0.3151 -0.0530 -0.0337 -0.0414 224 SER A C   
1707 O O   . SER A 224 ? 0.2253 0.1915 0.2433 -0.0531 -0.0357 -0.0407 224 SER A O   
1708 C CB  . SER A 224 ? 0.1707 0.1538 0.1961 -0.0581 -0.0353 -0.0411 224 SER A CB  
1709 O OG  . SER A 224 ? 0.2328 0.2251 0.2639 -0.0588 -0.0366 -0.0414 224 SER A OG  
1710 N N   . GLY A 225 ? 0.2144 0.1905 0.2279 -0.0511 -0.0330 -0.0417 225 GLY A N   
1711 C CA  . GLY A 225 ? 0.2094 0.1781 0.2247 -0.0477 -0.0351 -0.0426 225 GLY A CA  
1712 C C   . GLY A 225 ? 0.2948 0.2666 0.3088 -0.0462 -0.0344 -0.0436 225 GLY A C   
1713 O O   . GLY A 225 ? 0.3623 0.3355 0.3687 -0.0477 -0.0316 -0.0418 225 GLY A O   
1714 N N   . SER A 226 ? 0.2551 0.2270 0.2790 -0.0425 -0.0389 -0.0467 226 SER A N   
1715 C CA  . SER A 226 ? 0.2932 0.2707 0.3203 -0.0414 -0.0380 -0.0497 226 SER A CA  
1716 C C   . SER A 226 ? 0.3372 0.3163 0.3803 -0.0358 -0.0420 -0.0566 226 SER A C   
1717 O O   . SER A 226 ? 0.3557 0.3286 0.4068 -0.0321 -0.0483 -0.0576 226 SER A O   
1718 C CB  . SER A 226 ? 0.2666 0.2530 0.2927 -0.0441 -0.0394 -0.0483 226 SER A CB  
1719 O OG  . SER A 226 ? 0.2432 0.2342 0.2756 -0.0437 -0.0459 -0.0479 226 SER A OG  
1720 N N   . PHE A 227 ? 0.3121 0.2984 0.3609 -0.0352 -0.0389 -0.0621 227 PHE A N   
1721 C CA  . PHE A 227 ? 0.2657 0.2565 0.3323 -0.0294 -0.0409 -0.0721 227 PHE A CA  
1722 C C   . PHE A 227 ? 0.2970 0.2965 0.3832 -0.0239 -0.0514 -0.0763 227 PHE A C   
1723 O O   . PHE A 227 ? 0.3866 0.3857 0.4899 -0.0164 -0.0569 -0.0848 227 PHE A O   
1724 C CB  . PHE A 227 ? 0.2895 0.2910 0.3597 -0.0317 -0.0338 -0.0787 227 PHE A CB  
1725 C CG  . PHE A 227 ? 0.3179 0.3359 0.3950 -0.0349 -0.0339 -0.0801 227 PHE A CG  
1726 C CD1 . PHE A 227 ? 0.3193 0.3559 0.4193 -0.0308 -0.0395 -0.0883 227 PHE A CD1 
1727 C CD2 . PHE A 227 ? 0.3160 0.3305 0.3773 -0.0414 -0.0301 -0.0732 227 PHE A CD2 
1728 C CE1 . PHE A 227 ? 0.4161 0.4695 0.5206 -0.0348 -0.0398 -0.0884 227 PHE A CE1 
1729 C CE2 . PHE A 227 ? 0.4062 0.4330 0.4719 -0.0452 -0.0303 -0.0742 227 PHE A CE2 
1730 C CZ  . PHE A 227 ? 0.4652 0.5123 0.5512 -0.0429 -0.0344 -0.0813 227 PHE A CZ  
1731 N N   . ASN A 228 ? 0.3037 0.3112 0.3874 -0.0269 -0.0553 -0.0709 228 ASN A N   
1732 C CA  . ASN A 228 ? 0.1473 0.1659 0.2476 -0.0218 -0.0680 -0.0726 228 ASN A CA  
1733 C C   . ASN A 228 ? 0.1577 0.1592 0.2557 -0.0187 -0.0796 -0.0663 228 ASN A C   
1734 O O   . ASN A 228 ? 0.3565 0.3627 0.4593 -0.0131 -0.0895 -0.0609 228 ASN A O   
1735 C CB  . ASN A 228 ? 0.1434 0.1776 0.2383 -0.0274 -0.0676 -0.0687 228 ASN A CB  
1736 C CG  . ASN A 228 ? 0.2642 0.2879 0.3358 -0.0352 -0.0623 -0.0600 228 ASN A CG  
1737 O OD1 . ASN A 228 ? 0.2312 0.2414 0.2906 -0.0374 -0.0551 -0.0573 228 ASN A OD1 
1738 N ND2 . ASN A 228 ? 0.1436 0.1758 0.2098 -0.0390 -0.0660 -0.0564 228 ASN A ND2 
1739 N N   . ALA A 229 ? 0.1880 0.1697 0.2719 -0.0215 -0.0744 -0.0620 229 ALA A N   
1740 C CA  . ALA A 229 ? 0.2312 0.1920 0.3110 -0.0206 -0.0838 -0.0556 229 ALA A CA  
1741 C C   . ALA A 229 ? 0.3056 0.2564 0.3962 -0.0078 -0.0876 -0.0574 229 ALA A C   
1742 O O   . ALA A 229 ? 0.2663 0.2212 0.3670 -0.0029 -0.0820 -0.0678 229 ALA A O   
1743 C CB  . ALA A 229 ? 0.2367 0.1857 0.2994 -0.0267 -0.0736 -0.0506 229 ALA A CB  
1744 N N   . PRO A 230 ? 0.2927 0.2295 0.3803 -0.0021 -0.0969 -0.0475 230 PRO A N   
1745 C CA  . PRO A 230 ? 0.3599 0.2887 0.4601 0.0130  -0.1018 -0.0497 230 PRO A CA  
1746 C C   . PRO A 230 ? 0.4007 0.3077 0.5005 0.0155  -0.0961 -0.0575 230 PRO A C   
1747 O O   . PRO A 230 ? 0.4319 0.3381 0.5451 0.0283  -0.0960 -0.0653 230 PRO A O   
1748 C CB  . PRO A 230 ? 0.2516 0.1658 0.3440 0.0172  -0.1139 -0.0350 230 PRO A CB  
1749 C CG  . PRO A 230 ? 0.3986 0.3045 0.4710 0.0017  -0.1127 -0.0260 230 PRO A CG  
1750 C CD  . PRO A 230 ? 0.3231 0.2497 0.3952 -0.0089 -0.1029 -0.0342 230 PRO A CD  
1751 N N   . TRP A 231 ? 0.2366 0.1287 0.3219 0.0033  -0.0914 -0.0567 231 TRP A N   
1752 C CA  . TRP A 231 ? 0.3017 0.1755 0.3830 0.0028  -0.0856 -0.0640 231 TRP A CA  
1753 C C   . TRP A 231 ? 0.2422 0.1372 0.3254 0.0007  -0.0726 -0.0743 231 TRP A C   
1754 O O   . TRP A 231 ? 0.3505 0.2394 0.4280 0.0012  -0.0650 -0.0790 231 TRP A O   
1755 C CB  . TRP A 231 ? 0.2520 0.1139 0.3134 -0.0093 -0.0821 -0.0535 231 TRP A CB  
1756 C CG  . TRP A 231 ? 0.2930 0.1735 0.3459 -0.0208 -0.0774 -0.0480 231 TRP A CG  
1757 C CD1 . TRP A 231 ? 0.3100 0.1909 0.3580 -0.0268 -0.0838 -0.0388 231 TRP A CD1 
1758 C CD2 . TRP A 231 ? 0.2333 0.1332 0.2802 -0.0263 -0.0651 -0.0511 231 TRP A CD2 
1759 N NE1 . TRP A 231 ? 0.2898 0.1912 0.3312 -0.0343 -0.0747 -0.0378 231 TRP A NE1 
1760 C CE2 . TRP A 231 ? 0.3090 0.2206 0.3496 -0.0334 -0.0637 -0.0447 231 TRP A CE2 
1761 C CE3 . TRP A 231 ? 0.2741 0.1802 0.3183 -0.0259 -0.0557 -0.0579 231 TRP A CE3 
1762 C CZ2 . TRP A 231 ? 0.3254 0.2531 0.3588 -0.0380 -0.0533 -0.0454 231 TRP A CZ2 
1763 C CZ3 . TRP A 231 ? 0.3396 0.2599 0.3741 -0.0322 -0.0471 -0.0563 231 TRP A CZ3 
1764 C CH2 . TRP A 231 ? 0.2182 0.1484 0.2482 -0.0373 -0.0461 -0.0503 231 TRP A CH2 
1765 N N   . ALA A 232 ? 0.2078 0.1260 0.2968 -0.0024 -0.0703 -0.0772 232 ALA A N   
1766 C CA  . ALA A 232 ? 0.2494 0.1839 0.3327 -0.0078 -0.0577 -0.0815 232 ALA A CA  
1767 C C   . ALA A 232 ? 0.2916 0.2353 0.3884 -0.0010 -0.0526 -0.0955 232 ALA A C   
1768 O O   . ALA A 232 ? 0.3436 0.2884 0.4303 -0.0048 -0.0430 -0.0983 232 ALA A O   
1769 C CB  . ALA A 232 ? 0.1751 0.1274 0.2537 -0.0151 -0.0549 -0.0764 232 ALA A CB  
1770 N N   . VAL A 233 ? 0.3276 0.2803 0.4466 0.0093  -0.0586 -0.1043 233 VAL A N   
1771 C CA  . VAL A 233 ? 0.3666 0.3356 0.4994 0.0160  -0.0506 -0.1176 233 VAL A CA  
1772 C C   . VAL A 233 ? 0.3853 0.3495 0.5339 0.0336  -0.0548 -0.1218 233 VAL A C   
1773 O O   . VAL A 233 ? 0.4218 0.3920 0.5817 0.0429  -0.0643 -0.1151 233 VAL A O   
1774 C CB  . VAL A 233 ? 0.4460 0.4479 0.5896 0.0115  -0.0466 -0.1201 233 VAL A CB  
1775 C CG1 . VAL A 233 ? 0.1876 0.2105 0.3483 0.0182  -0.0378 -0.1339 233 VAL A CG1 
1776 C CG2 . VAL A 233 ? 0.2219 0.2243 0.3479 -0.0051 -0.0412 -0.1165 233 VAL A CG2 
1777 N N   . THR A 234 ? 0.4176 0.3695 0.5654 0.0387  -0.0483 -0.1332 234 THR A N   
1778 C CA  . THR A 234 ? 0.4581 0.4054 0.6217 0.0572  -0.0498 -0.1409 234 THR A CA  
1779 C C   . THR A 234 ? 0.5163 0.5014 0.7057 0.0667  -0.0443 -0.1517 234 THR A C   
1780 O O   . THR A 234 ? 0.4715 0.4798 0.6616 0.0571  -0.0332 -0.1594 234 THR A O   
1781 C CB  . THR A 234 ? 0.4630 0.3931 0.6094 0.0544  -0.0411 -0.1439 234 THR A CB  
1782 O OG1 . THR A 234 ? 0.5329 0.4359 0.6544 0.0433  -0.0442 -0.1314 234 THR A OG1 
1783 C CG2 . THR A 234 ? 0.5118 0.4353 0.6707 0.0723  -0.0421 -0.1504 234 THR A CG2 
1784 N N   . SER A 235 ? 0.5844 0.5764 0.7948 0.0852  -0.0521 -0.1519 235 SER A N   
1785 C CA  . SER A 235 ? 0.6357 0.6676 0.8746 0.0957  -0.0473 -0.1630 235 SER A CA  
1786 C C   . SER A 235 ? 0.6603 0.6946 0.9011 0.1002  -0.0342 -0.1778 235 SER A C   
1787 O O   . SER A 235 ? 0.6582 0.6606 0.8797 0.0997  -0.0323 -0.1769 235 SER A O   
1788 C CB  . SER A 235 ? 0.6738 0.7145 0.9343 0.1149  -0.0616 -0.1569 235 SER A CB  
1789 O OG  . SER A 235 ? 0.7092 0.7220 0.9651 0.1286  -0.0651 -0.1556 235 SER A OG  
1790 N N   . LEU A 236 ? 0.5840 0.6580 0.8450 0.1020  -0.0249 -0.1891 236 LEU A N   
1791 C CA  . LEU A 236 ? 0.5836 0.6642 0.8451 0.1048  -0.0117 -0.2018 236 LEU A CA  
1792 C C   . LEU A 236 ? 0.5810 0.6417 0.8468 0.1243  -0.0175 -0.2016 236 LEU A C   
1793 O O   . LEU A 236 ? 0.5223 0.5631 0.7747 0.1256  -0.0102 -0.2076 236 LEU A O   
1794 C CB  . LEU A 236 ? 0.6656 0.7950 0.9490 0.1019  -0.0013 -0.2124 236 LEU A CB  
1795 C CG  . LEU A 236 ? 0.7372 0.8830 1.0125 0.0803  0.0069  -0.2131 236 LEU A CG  
1796 C CD1 . LEU A 236 ? 0.6967 0.8895 0.9906 0.0734  0.0181  -0.2222 236 LEU A CD1 
1797 C CD2 . LEU A 236 ? 0.6834 0.7991 0.9260 0.0661  0.0153  -0.2136 236 LEU A CD2 
1798 N N   . TYR A 237 ? 0.6496 0.7147 0.9323 0.1391  -0.0310 -0.1939 237 TYR A N   
1799 C CA  . TYR A 237 ? 0.7209 0.7654 1.0074 0.1586  -0.0373 -0.1923 237 TYR A CA  
1800 C C   . TYR A 237 ? 0.7419 0.7338 1.0006 0.1566  -0.0415 -0.1846 237 TYR A C   
1801 O O   . TYR A 237 ? 0.8312 0.8015 1.0842 0.1661  -0.0380 -0.1896 237 TYR A O   
1802 C CB  . TYR A 237 ? 0.7690 0.8271 1.0756 0.1740  -0.0523 -0.1829 237 TYR A CB  
1803 C CG  . TYR A 237 ? 0.9150 0.9428 1.2205 0.1936  -0.0603 -0.1783 237 TYR A CG  
1804 C CD1 . TYR A 237 ? 0.9705 1.0084 1.2906 0.2091  -0.0532 -0.1899 237 TYR A CD1 
1805 C CD2 . TYR A 237 ? 0.9979 0.9857 1.2863 0.1958  -0.0741 -0.1622 237 TYR A CD2 
1806 C CE1 . TYR A 237 ? 1.0652 1.0730 1.3839 0.2276  -0.0599 -0.1861 237 TYR A CE1 
1807 C CE2 . TYR A 237 ? 1.0836 1.0407 1.3689 0.2125  -0.0807 -0.1574 237 TYR A CE2 
1808 C CZ  . TYR A 237 ? 1.1057 1.0723 1.4065 0.2290  -0.0736 -0.1696 237 TYR A CZ  
1809 O OH  . TYR A 237 ? 1.1439 1.0784 1.4420 0.2466  -0.0797 -0.1653 237 TYR A OH  
1810 N N   . GLU A 238 ? 0.6285 0.5998 0.8695 0.1437  -0.0486 -0.1727 238 GLU A N   
1811 C CA  . GLU A 238 ? 0.6915 0.6155 0.9065 0.1400  -0.0524 -0.1644 238 GLU A CA  
1812 C C   . GLU A 238 ? 0.6337 0.5430 0.8245 0.1231  -0.0406 -0.1698 238 GLU A C   
1813 O O   . GLU A 238 ? 0.7006 0.5748 0.8712 0.1207  -0.0406 -0.1667 238 GLU A O   
1814 C CB  . GLU A 238 ? 0.8210 0.7229 1.0270 0.1378  -0.0678 -0.1462 238 GLU A CB  
1815 C CG  . GLU A 238 ? 0.9935 0.9064 1.1943 0.1217  -0.0703 -0.1398 238 GLU A CG  
1816 C CD  . GLU A 238 ? 1.1456 1.0347 1.3354 0.1197  -0.0852 -0.1216 238 GLU A CD  
1817 O OE1 . GLU A 238 ? 1.2240 1.0871 1.4088 0.1298  -0.0931 -0.1134 238 GLU A OE1 
1818 O OE2 . GLU A 238 ? 1.1314 1.0268 1.3164 0.1076  -0.0885 -0.1153 238 GLU A OE2 
1819 N N   . ALA A 239 ? 0.5499 0.4860 0.7415 0.1110  -0.0304 -0.1775 239 ALA A N   
1820 C CA  . ALA A 239 ? 0.5686 0.4944 0.7372 0.0972  -0.0189 -0.1830 239 ALA A CA  
1821 C C   . ALA A 239 ? 0.6157 0.5388 0.7866 0.1082  -0.0101 -0.1961 239 ALA A C   
1822 O O   . ALA A 239 ? 0.6277 0.5253 0.7766 0.1032  -0.0052 -0.1985 239 ALA A O   
1823 C CB  . ALA A 239 ? 0.3343 0.2885 0.5018 0.0822  -0.0103 -0.1870 239 ALA A CB  
1824 N N   . ARG A 240 ? 0.6538 0.6046 0.8515 0.1231  -0.0079 -0.2048 240 ARG A N   
1825 C CA  . ARG A 240 ? 0.6820 0.6338 0.8858 0.1362  0.0004  -0.2178 240 ARG A CA  
1826 C C   . ARG A 240 ? 0.6044 0.5133 0.7971 0.1474  -0.0061 -0.2137 240 ARG A C   
1827 O O   . ARG A 240 ? 0.6409 0.5288 0.8171 0.1469  0.0017  -0.2215 240 ARG A O   
1828 C CB  . ARG A 240 ? 0.8541 0.8468 1.0915 0.1508  0.0020  -0.2255 240 ARG A CB  
1829 C CG  . ARG A 240 ? 1.0827 1.0801 1.3300 0.1664  0.0109  -0.2395 240 ARG A CG  
1830 C CD  . ARG A 240 ? 1.2256 1.2219 1.4538 0.1547  0.0267  -0.2515 240 ARG A CD  
1831 N NE  . ARG A 240 ? 1.2274 1.2617 1.4596 0.1391  0.0366  -0.2564 240 ARG A NE  
1832 C CZ  . ARG A 240 ? 1.1812 1.2546 1.4323 0.1419  0.0479  -0.2687 240 ARG A CZ  
1833 N NH1 . ARG A 240 ? 1.1812 1.2628 1.4507 0.1614  0.0505  -0.2780 240 ARG A NH1 
1834 N NH2 . ARG A 240 ? 1.1352 1.2391 1.3863 0.1248  0.0570  -0.2713 240 ARG A NH2 
1835 N N   . ASN A 241 ? 0.5542 0.4489 0.7540 0.1566  -0.0202 -0.2013 241 ASN A N   
1836 C CA  . ASN A 241 ? 0.7269 0.5795 0.9165 0.1672  -0.0265 -0.1962 241 ASN A CA  
1837 C C   . ASN A 241 ? 0.7282 0.5442 0.8848 0.1500  -0.0236 -0.1928 241 ASN A C   
1838 O O   . ASN A 241 ? 0.7366 0.5216 0.8794 0.1538  -0.0198 -0.1977 241 ASN A O   
1839 C CB  . ASN A 241 ? 0.8764 0.7195 1.0753 0.1770  -0.0431 -0.1805 241 ASN A CB  
1840 C CG  . ASN A 241 ? 1.0793 0.8952 1.2825 0.1977  -0.0483 -0.1793 241 ASN A CG  
1841 O OD1 . ASN A 241 ? 0.9972 0.8340 1.2233 0.2163  -0.0466 -0.1876 241 ASN A OD1 
1842 N ND2 . ASN A 241 ? 1.3600 1.1300 1.5415 0.1939  -0.0544 -0.1686 241 ASN A ND2 
1843 N N   . ARG A 242 ? 0.6523 0.4740 0.7967 0.1307  -0.0248 -0.1851 242 ARG A N   
1844 C CA  . ARG A 242 ? 0.6751 0.4678 0.7892 0.1126  -0.0231 -0.1798 242 ARG A CA  
1845 C C   . ARG A 242 ? 0.6262 0.4159 0.7234 0.1057  -0.0102 -0.1930 242 ARG A C   
1846 O O   . ARG A 242 ? 0.5901 0.3468 0.6661 0.1014  -0.0083 -0.1943 242 ARG A O   
1847 C CB  . ARG A 242 ? 0.6112 0.4138 0.7185 0.0956  -0.0282 -0.1675 242 ARG A CB  
1848 C CG  . ARG A 242 ? 0.6271 0.4199 0.7411 0.0994  -0.0419 -0.1526 242 ARG A CG  
1849 C CD  . ARG A 242 ? 0.6667 0.4758 0.7789 0.0855  -0.0461 -0.1428 242 ARG A CD  
1850 N NE  . ARG A 242 ? 0.6940 0.5025 0.8174 0.0923  -0.0592 -0.1309 242 ARG A NE  
1851 C CZ  . ARG A 242 ? 0.6433 0.4597 0.7642 0.0818  -0.0652 -0.1205 242 ARG A CZ  
1852 N NH1 . ARG A 242 ? 0.5668 0.3928 0.6752 0.0644  -0.0589 -0.1201 242 ARG A NH1 
1853 N NH2 . ARG A 242 ? 0.6215 0.4356 0.7506 0.0888  -0.0778 -0.1098 242 ARG A NH2 
1854 N N   . THR A 243 ? 0.5257 0.3493 0.6314 0.1038  -0.0015 -0.2027 243 THR A N   
1855 C CA  . THR A 243 ? 0.5288 0.3527 0.6196 0.0991  0.0106  -0.2158 243 THR A CA  
1856 C C   . THR A 243 ? 0.6110 0.4133 0.7020 0.1149  0.0146  -0.2270 243 THR A C   
1857 O O   . THR A 243 ? 0.6359 0.4130 0.7033 0.1095  0.0195  -0.2329 243 THR A O   
1858 C CB  . THR A 243 ? 0.5454 0.4119 0.6494 0.0967  0.0201  -0.2248 243 THR A CB  
1859 O OG1 . THR A 243 ? 0.4416 0.3237 0.5419 0.0812  0.0172  -0.2148 243 THR A OG1 
1860 C CG2 . THR A 243 ? 0.5894 0.4555 0.6762 0.0922  0.0325  -0.2382 243 THR A CG2 
1861 N N   . LEU A 244 ? 0.5858 0.3970 0.7029 0.1347  0.0119  -0.2297 244 LEU A N   
1862 C CA  . LEU A 244 ? 0.6528 0.4434 0.7722 0.1520  0.0156  -0.2400 244 LEU A CA  
1863 C C   . LEU A 244 ? 0.7420 0.4818 0.8411 0.1508  0.0089  -0.2323 244 LEU A C   
1864 O O   . LEU A 244 ? 0.7309 0.4422 0.8130 0.1525  0.0150  -0.2415 244 LEU A O   
1865 C CB  . LEU A 244 ? 0.6769 0.4905 0.8303 0.1744  0.0126  -0.2427 244 LEU A CB  
1866 C CG  . LEU A 244 ? 0.6735 0.5400 0.8509 0.1768  0.0205  -0.2521 244 LEU A CG  
1867 C CD1 . LEU A 244 ? 0.6799 0.5678 0.8910 0.1993  0.0151  -0.2527 244 LEU A CD1 
1868 C CD2 . LEU A 244 ? 0.6512 0.5268 0.8188 0.1735  0.0366  -0.2694 244 LEU A CD2 
1869 N N   . ASN A 245 ? 0.7567 0.4852 0.8570 0.1470  -0.0033 -0.2156 245 ASN A N   
1870 C CA  . ASN A 245 ? 0.7587 0.4411 0.8407 0.1431  -0.0093 -0.2065 245 ASN A CA  
1871 C C   . ASN A 245 ? 0.8080 0.4686 0.8584 0.1223  -0.0035 -0.2088 245 ASN A C   
1872 O O   . ASN A 245 ? 0.8852 0.5078 0.9188 0.1213  -0.0012 -0.2123 245 ASN A O   
1873 C CB  . ASN A 245 ? 0.7344 0.4140 0.8224 0.1401  -0.0229 -0.1876 245 ASN A CB  
1874 C CG  . ASN A 245 ? 0.7938 0.4805 0.9073 0.1625  -0.0314 -0.1836 245 ASN A CG  
1875 O OD1 . ASN A 245 ? 0.9127 0.5950 1.0373 0.1813  -0.0278 -0.1936 245 ASN A OD1 
1876 N ND2 . ASN A 245 ? 0.7204 0.4181 0.8427 0.1612  -0.0429 -0.1689 245 ASN A ND2 
1877 N N   . LEU A 246 ? 0.7062 0.3905 0.7484 0.1057  -0.0013 -0.2068 246 LEU A N   
1878 C CA  . LEU A 246 ? 0.7091 0.3792 0.7218 0.0869  0.0037  -0.2096 246 LEU A CA  
1879 C C   . LEU A 246 ? 0.7719 0.4293 0.7730 0.0933  0.0136  -0.2274 246 LEU A C   
1880 O O   . LEU A 246 ? 0.8263 0.4520 0.8022 0.0840  0.0155  -0.2309 246 LEU A O   
1881 C CB  . LEU A 246 ? 0.6291 0.3306 0.6372 0.0717  0.0043  -0.2051 246 LEU A CB  
1882 C CG  . LEU A 246 ? 0.6469 0.3335 0.6232 0.0523  0.0061  -0.2051 246 LEU A CG  
1883 C CD1 . LEU A 246 ? 0.6043 0.2630 0.5673 0.0393  0.0000  -0.1931 246 LEU A CD1 
1884 C CD2 . LEU A 246 ? 0.5597 0.2773 0.5319 0.0412  0.0072  -0.2025 246 LEU A CD2 
1885 N N   . ALA A 247 ? 0.7554 0.4386 0.7754 0.1087  0.0201  -0.2393 247 ALA A N   
1886 C CA  . ALA A 247 ? 0.7085 0.3840 0.7202 0.1169  0.0305  -0.2576 247 ALA A CA  
1887 C C   . ALA A 247 ? 0.7615 0.3947 0.7687 0.1293  0.0306  -0.2626 247 ALA A C   
1888 O O   . ALA A 247 ? 0.9306 0.5376 0.9149 0.1266  0.0366  -0.2739 247 ALA A O   
1889 C CB  . ALA A 247 ? 0.7031 0.4207 0.7402 0.1302  0.0384  -0.2687 247 ALA A CB  
1890 N N   . LYS A 248 ? 0.7668 0.3921 0.7947 0.1433  0.0234  -0.2544 248 LYS A N   
1891 C CA  . LYS A 248 ? 1.0256 0.6084 1.0501 0.1558  0.0232  -0.2579 248 LYS A CA  
1892 C C   . LYS A 248 ? 1.0352 0.5750 1.0297 0.1363  0.0212  -0.2520 248 LYS A C   
1893 O O   . LYS A 248 ? 1.0487 0.5541 1.0243 0.1358  0.0274  -0.2629 248 LYS A O   
1894 C CB  . LYS A 248 ? 1.0724 0.6547 1.1243 0.1748  0.0137  -0.2477 248 LYS A CB  
1895 C CG  . LYS A 248 ? 1.1407 0.7730 1.2252 0.1884  0.0113  -0.2469 248 LYS A CG  
1896 C CD  . LYS A 248 ? 1.2074 0.8607 1.3107 0.2092  0.0211  -0.2649 248 LYS A CD  
1897 C CE  . LYS A 248 ? 1.3182 0.9318 1.4210 0.2281  0.0224  -0.2716 248 LYS A CE  
1898 N NZ  . LYS A 248 ? 0.8877 0.5263 1.0156 0.2523  0.0301  -0.2870 248 LYS A NZ  
1899 N N   . LEU A 249 ? 0.9919 0.5358 0.9828 0.1196  0.0132  -0.2356 249 LEU A N   
1900 C CA  . LEU A 249 ? 0.9398 0.4510 0.9075 0.0988  0.0113  -0.2286 249 LEU A CA  
1901 C C   . LEU A 249 ? 0.9462 0.4465 0.8838 0.0830  0.0191  -0.2404 249 LEU A C   
1902 O O   . LEU A 249 ? 0.9841 0.4486 0.9024 0.0713  0.0216  -0.2433 249 LEU A O   
1903 C CB  . LEU A 249 ? 0.7955 0.3255 0.7671 0.0837  0.0029  -0.2106 249 LEU A CB  
1904 C CG  . LEU A 249 ? 0.8187 0.3460 0.8113 0.0950  -0.0075 -0.1962 249 LEU A CG  
1905 C CD1 . LEU A 249 ? 0.8118 0.3737 0.8146 0.0875  -0.0149 -0.1823 249 LEU A CD1 
1906 C CD2 . LEU A 249 ? 0.8093 0.2943 0.7925 0.0873  -0.0105 -0.1892 249 LEU A CD2 
1907 N N   . THR A 250 ? 0.8979 0.4302 0.8322 0.0823  0.0225  -0.2472 250 THR A N   
1908 C CA  . THR A 250 ? 0.9087 0.4360 0.8127 0.0675  0.0260  -0.2559 250 THR A CA  
1909 C C   . THR A 250 ? 1.0079 0.5237 0.9044 0.0816  0.0346  -0.2761 250 THR A C   
1910 O O   . THR A 250 ? 1.0969 0.6081 0.9678 0.0737  0.0368  -0.2863 250 THR A O   
1911 C CB  . THR A 250 ? 0.8377 0.4071 0.7427 0.0583  0.0233  -0.2504 250 THR A CB  
1912 O OG1 . THR A 250 ? 0.9511 0.5128 0.8249 0.0402  0.0205  -0.2517 250 THR A OG1 
1913 C CG2 . THR A 250 ? 0.7712 0.3744 0.6942 0.0737  0.0300  -0.2614 250 THR A CG2 
1914 N N   . GLY A 251 ? 0.9381 0.4500 0.8574 0.1038  0.0384  -0.2817 251 GLY A N   
1915 C CA  . GLY A 251 ? 0.9415 0.4454 0.8583 0.1198  0.0479  -0.3014 251 GLY A CA  
1916 C C   . GLY A 251 ? 0.9518 0.4990 0.8742 0.1238  0.0546  -0.3124 251 GLY A C   
1917 O O   . GLY A 251 ? 0.9441 0.4854 0.8524 0.1283  0.0628  -0.3296 251 GLY A O   
1918 N N   . CYS A 252 ? 0.9326 0.5233 0.8758 0.1216  0.0521  -0.3031 252 CYS A N   
1919 C CA  . CYS A 252 ? 0.9956 0.6299 0.9458 0.1219  0.0600  -0.3123 252 CYS A CA  
1920 C C   . CYS A 252 ? 1.0378 0.7090 1.0258 0.1412  0.0655  -0.3169 252 CYS A C   
1921 O O   . CYS A 252 ? 1.0278 0.7405 1.0267 0.1396  0.0726  -0.3224 252 CYS A O   
1922 C CB  . CYS A 252 ? 0.9236 0.5826 0.8658 0.1015  0.0548  -0.3004 252 CYS A CB  
1923 S SG  . CYS A 252 ? 1.0883 0.7216 0.9866 0.0793  0.0496  -0.3003 252 CYS A SG  
1924 N N   . SER A 253 ? 1.0563 0.7132 1.0644 0.1588  0.0620  -0.3143 253 SER A N   
1925 C CA  . SER A 253 ? 1.0267 0.7186 1.0722 0.1790  0.0651  -0.3185 253 SER A CA  
1926 C C   . SER A 253 ? 1.0845 0.7985 1.1336 0.1880  0.0799  -0.3392 253 SER A C   
1927 O O   . SER A 253 ? 0.8963 0.5824 0.9323 0.1970  0.0863  -0.3527 253 SER A O   
1928 C CB  . SER A 253 ? 1.0161 0.6818 1.0781 0.1987  0.0584  -0.3140 253 SER A CB  
1929 O OG  . SER A 253 ? 0.9938 0.6329 1.0469 0.1882  0.0459  -0.2956 253 SER A OG  
1930 N N   . ARG A 254 ? 1.1068 0.8707 1.1723 0.1841  0.0861  -0.3419 254 ARG A N   
1931 C CA  . ARG A 254 ? 1.1308 0.9248 1.2054 0.1922  0.1012  -0.3608 254 ARG A CA  
1932 C C   . ARG A 254 ? 1.1703 1.0112 1.2870 0.2062  0.1031  -0.3612 254 ARG A C   
1933 O O   . ARG A 254 ? 1.1745 1.0198 1.3112 0.2114  0.0916  -0.3476 254 ARG A O   
1934 C CB  . ARG A 254 ? 1.0487 0.8610 1.1002 0.1709  0.1091  -0.3651 254 ARG A CB  
1935 C CG  . ARG A 254 ? 1.0625 0.8501 1.0830 0.1687  0.1179  -0.3810 254 ARG A CG  
1936 C CD  . ARG A 254 ? 1.0069 0.7365 1.0061 0.1736  0.1102  -0.3801 254 ARG A CD  
1937 N NE  . ARG A 254 ? 0.9833 0.6848 0.9416 0.1575  0.1099  -0.3845 254 ARG A NE  
1938 C CZ  . ARG A 254 ? 1.0145 0.6707 0.9473 0.1485  0.0991  -0.3764 254 ARG A CZ  
1939 N NH1 . ARG A 254 ? 0.9341 0.5675 0.8778 0.1535  0.0894  -0.3632 254 ARG A NH1 
1940 N NH2 . ARG A 254 ? 1.0152 0.6505 0.9121 0.1339  0.0976  -0.3813 254 ARG A NH2 
1941 N N   . GLU A 255 ? 1.2153 1.0923 1.3446 0.2115  0.1175  -0.3770 255 GLU A N   
1942 C CA  . GLU A 255 ? 1.2297 1.1555 1.3994 0.2241  0.1209  -0.3799 255 GLU A CA  
1943 C C   . GLU A 255 ? 1.1007 1.0722 1.2739 0.2041  0.1272  -0.3779 255 GLU A C   
1944 O O   . GLU A 255 ? 1.0067 1.0114 1.2054 0.2030  0.1225  -0.3695 255 GLU A O   
1945 C CB  . GLU A 255 ? 1.3531 1.2890 1.5376 0.2452  0.1336  -0.3998 255 GLU A CB  
1946 C CG  . GLU A 255 ? 1.4808 1.4126 1.6383 0.2373  0.1495  -0.4172 255 GLU A CG  
1947 C CD  . GLU A 255 ? 1.5887 1.4607 1.7074 0.2345  0.1463  -0.4192 255 GLU A CD  
1948 O OE1 . GLU A 255 ? 1.6160 1.4478 1.7287 0.2383  0.1328  -0.4073 255 GLU A OE1 
1949 O OE2 . GLU A 255 ? 1.6367 1.5018 1.7299 0.2274  0.1573  -0.4329 255 GLU A OE2 
1950 N N   . ASN A 256 ? 1.0796 1.0507 1.2252 0.1879  0.1377  -0.3854 256 ASN A N   
1951 C CA  . ASN A 256 ? 1.0585 1.0632 1.1985 0.1657  0.1438  -0.3821 256 ASN A CA  
1952 C C   . ASN A 256 ? 1.0069 0.9898 1.1286 0.1488  0.1301  -0.3630 256 ASN A C   
1953 O O   . ASN A 256 ? 0.9765 0.9195 1.0669 0.1416  0.1247  -0.3594 256 ASN A O   
1954 C CB  . ASN A 256 ? 1.1923 1.1977 1.3053 0.1556  0.1584  -0.3960 256 ASN A CB  
1955 C CG  . ASN A 256 ? 1.3138 1.3580 1.4232 0.1344  0.1680  -0.3948 256 ASN A CG  
1956 O OD1 . ASN A 256 ? 1.2930 1.3404 1.3962 0.1180  0.1608  -0.3800 256 ASN A OD1 
1957 N ND2 . ASN A 256 ? 1.5278 1.6005 1.6397 0.1343  0.1849  -0.4105 256 ASN A ND2 
1958 N N   . GLU A 257 ? 0.9135 0.9229 1.0547 0.1426  0.1243  -0.3514 257 GLU A N   
1959 C CA  . GLU A 257 ? 0.8699 0.8614 0.9974 0.1283  0.1114  -0.3333 257 GLU A CA  
1960 C C   . GLU A 257 ? 0.8793 0.8554 0.9697 0.1069  0.1136  -0.3301 257 GLU A C   
1961 O O   . GLU A 257 ? 0.8656 0.8090 0.9351 0.0993  0.1026  -0.3187 257 GLU A O   
1962 C CB  . GLU A 257 ? 0.8422 0.8696 0.9948 0.1230  0.1078  -0.3242 257 GLU A CB  
1963 C CG  . GLU A 257 ? 0.8337 0.8609 1.0146 0.1403  0.0956  -0.3173 257 GLU A CG  
1964 C CD  . GLU A 257 ? 0.8088 0.8723 1.0125 0.1339  0.0919  -0.3094 257 GLU A CD  
1965 O OE1 . GLU A 257 ? 0.7329 0.8093 0.9242 0.1135  0.0958  -0.3049 257 GLU A OE1 
1966 O OE2 . GLU A 257 ? 0.8268 0.9050 1.0598 0.1495  0.0847  -0.3075 257 GLU A OE2 
1967 N N   . THR A 258 ? 0.8731 0.8739 0.9554 0.0968  0.1275  -0.3396 258 THR A N   
1968 C CA  . THR A 258 ? 0.8044 0.7933 0.8512 0.0770  0.1295  -0.3364 258 THR A CA  
1969 C C   . THR A 258 ? 0.7879 0.7342 0.8063 0.0804  0.1257  -0.3412 258 THR A C   
1970 O O   . THR A 258 ? 0.7053 0.6284 0.6954 0.0670  0.1182  -0.3326 258 THR A O   
1971 C CB  . THR A 258 ? 0.7872 0.8105 0.8298 0.0658  0.1459  -0.3460 258 THR A CB  
1972 O OG1 . THR A 258 ? 0.8416 0.8774 0.8966 0.0805  0.1580  -0.3642 258 THR A OG1 
1973 C CG2 . THR A 258 ? 0.7426 0.8039 0.8067 0.0567  0.1486  -0.3389 258 THR A CG2 
1974 N N   . GLU A 259 ? 0.8697 0.8059 0.8962 0.0986  0.1303  -0.3549 259 GLU A N   
1975 C CA  . GLU A 259 ? 0.9533 0.8461 0.9539 0.1033  0.1270  -0.3611 259 GLU A CA  
1976 C C   . GLU A 259 ? 0.8683 0.7222 0.8616 0.1035  0.1101  -0.3466 259 GLU A C   
1977 O O   . GLU A 259 ? 0.9143 0.7326 0.8778 0.0966  0.1039  -0.3453 259 GLU A O   
1978 C CB  . GLU A 259 ? 1.0686 0.9587 1.0815 0.1243  0.1365  -0.3794 259 GLU A CB  
1979 C CG  . GLU A 259 ? 1.1705 1.0886 1.1796 0.1229  0.1543  -0.3970 259 GLU A CG  
1980 C CD  . GLU A 259 ? 1.2904 1.2051 1.3132 0.1457  0.1636  -0.4154 259 GLU A CD  
1981 O OE1 . GLU A 259 ? 1.3286 1.2017 1.3436 0.1581  0.1568  -0.4174 259 GLU A OE1 
1982 O OE2 . GLU A 259 ? 1.3113 1.2646 1.3527 0.1511  0.1780  -0.4277 259 GLU A OE2 
1983 N N   . ILE A 260 ? 0.7486 0.6100 0.7686 0.1109  0.1026  -0.3359 260 ILE A N   
1984 C CA  . ILE A 260 ? 0.7845 0.6127 0.7981 0.1089  0.0873  -0.3206 260 ILE A CA  
1985 C C   . ILE A 260 ? 0.7674 0.5897 0.7562 0.0869  0.0802  -0.3077 260 ILE A C   
1986 O O   . ILE A 260 ? 0.7823 0.5696 0.7481 0.0800  0.0710  -0.3011 260 ILE A O   
1987 C CB  . ILE A 260 ? 0.7655 0.6075 0.8125 0.1199  0.0802  -0.3107 260 ILE A CB  
1988 C CG1 . ILE A 260 ? 0.7790 0.6224 0.8503 0.1440  0.0843  -0.3219 260 ILE A CG1 
1989 C CG2 . ILE A 260 ? 0.7701 0.5802 0.8080 0.1143  0.0652  -0.2936 260 ILE A CG2 
1990 C CD1 . ILE A 260 ? 0.7855 0.6455 0.8907 0.1566  0.0762  -0.3129 260 ILE A CD1 
1991 N N   . ILE A 261 ? 0.7468 0.6037 0.7403 0.0756  0.0846  -0.3042 261 ILE A N   
1992 C CA  . ILE A 261 ? 0.7229 0.5778 0.6951 0.0563  0.0783  -0.2918 261 ILE A CA  
1993 C C   . ILE A 261 ? 0.7995 0.6345 0.7378 0.0474  0.0791  -0.2982 261 ILE A C   
1994 O O   . ILE A 261 ? 0.8545 0.6672 0.7718 0.0371  0.0681  -0.2885 261 ILE A O   
1995 C CB  . ILE A 261 ? 0.6816 0.5762 0.6647 0.0463  0.0845  -0.2877 261 ILE A CB  
1996 C CG1 . ILE A 261 ? 0.6396 0.5573 0.6578 0.0554  0.0835  -0.2838 261 ILE A CG1 
1997 C CG2 . ILE A 261 ? 0.5547 0.4438 0.5172 0.0286  0.0762  -0.2730 261 ILE A CG2 
1998 C CD1 . ILE A 261 ? 0.6486 0.5461 0.6723 0.0573  0.0687  -0.2688 261 ILE A CD1 
1999 N N   . LYS A 262 ? 0.6721 0.5169 0.6057 0.0515  0.0918  -0.3149 262 LYS A N   
2000 C CA  . LYS A 262 ? 0.7593 0.5870 0.6607 0.0440  0.0931  -0.3234 262 LYS A CA  
2001 C C   . LYS A 262 ? 0.7876 0.5707 0.6725 0.0481  0.0824  -0.3240 262 LYS A C   
2002 O O   . LYS A 262 ? 0.7728 0.5366 0.6306 0.0373  0.0747  -0.3224 262 LYS A O   
2003 C CB  . LYS A 262 ? 0.7369 0.5825 0.6381 0.0499  0.1099  -0.3429 262 LYS A CB  
2004 C CG  . LYS A 262 ? 0.9359 0.7704 0.8029 0.0400  0.1123  -0.3517 262 LYS A CG  
2005 C CD  . LYS A 262 ? 0.9953 0.8466 0.8615 0.0465  0.1299  -0.3720 262 LYS A CD  
2006 C CE  . LYS A 262 ? 1.0461 0.8668 0.9080 0.0627  0.1313  -0.3875 262 LYS A CE  
2007 N NZ  . LYS A 262 ? 1.0352 0.8756 0.9030 0.0726  0.1496  -0.4077 262 LYS A NZ  
2008 N N   . CYS A 263 ? 0.7920 0.5590 0.6938 0.0636  0.0817  -0.3262 263 CYS A N   
2009 C CA  . CYS A 263 ? 0.8411 0.5624 0.7278 0.0669  0.0724  -0.3258 263 CYS A CA  
2010 C C   . CYS A 263 ? 0.8408 0.5473 0.7187 0.0535  0.0572  -0.3065 263 CYS A C   
2011 O O   . CYS A 263 ? 0.7734 0.4517 0.6260 0.0442  0.0480  -0.3048 263 CYS A O   
2012 C CB  . CYS A 263 ? 0.8956 0.6042 0.8045 0.0869  0.0756  -0.3305 263 CYS A CB  
2013 S SG  . CYS A 263 ? 1.0324 0.6809 0.9232 0.0894  0.0655  -0.3274 263 CYS A SG  
2014 N N   . LEU A 264 ? 0.7730 0.5006 0.6728 0.0525  0.0543  -0.2927 264 LEU A N   
2015 C CA  . LEU A 264 ? 0.6983 0.4177 0.5930 0.0403  0.0414  -0.2742 264 LEU A CA  
2016 C C   . LEU A 264 ? 0.6887 0.4140 0.5610 0.0236  0.0353  -0.2693 264 LEU A C   
2017 O O   . LEU A 264 ? 0.6643 0.3744 0.5250 0.0134  0.0231  -0.2577 264 LEU A O   
2018 C CB  . LEU A 264 ? 0.6689 0.4144 0.5922 0.0434  0.0409  -0.2627 264 LEU A CB  
2019 C CG  . LEU A 264 ? 0.6922 0.4272 0.6383 0.0586  0.0402  -0.2616 264 LEU A CG  
2020 C CD1 . LEU A 264 ? 0.6033 0.3733 0.5802 0.0635  0.0408  -0.2549 264 LEU A CD1 
2021 C CD2 . LEU A 264 ? 0.6553 0.3538 0.5897 0.0532  0.0298  -0.2503 264 LEU A CD2 
2022 N N   . ARG A 265 ? 0.6860 0.4347 0.5533 0.0208  0.0438  -0.2783 265 ARG A N   
2023 C CA  . ARG A 265 ? 0.7398 0.4955 0.5870 0.0064  0.0384  -0.2747 265 ARG A CA  
2024 C C   . ARG A 265 ? 0.7869 0.5140 0.6083 0.0022  0.0307  -0.2825 265 ARG A C   
2025 O O   . ARG A 265 ? 0.8176 0.5464 0.6256 -0.0093 0.0211  -0.2770 265 ARG A O   
2026 C CB  . ARG A 265 ? 0.8431 0.6313 0.6905 0.0032  0.0513  -0.2816 265 ARG A CB  
2027 C CG  . ARG A 265 ? 0.8242 0.6440 0.6932 0.0018  0.0567  -0.2724 265 ARG A CG  
2028 C CD  . ARG A 265 ? 0.9217 0.7702 0.7875 -0.0027 0.0713  -0.2814 265 ARG A CD  
2029 N NE  . ARG A 265 ? 0.9984 0.8768 0.8883 -0.0016 0.0796  -0.2779 265 ARG A NE  
2030 C CZ  . ARG A 265 ? 1.1050 0.9990 0.9971 -0.0119 0.0769  -0.2646 265 ARG A CZ  
2031 N NH1 . ARG A 265 ? 1.1925 1.0759 1.0655 -0.0224 0.0663  -0.2532 265 ARG A NH1 
2032 N NH2 . ARG A 265 ? 1.0327 0.9529 0.9467 -0.0113 0.0844  -0.2630 265 ARG A NH2 
2033 N N   . ASN A 266 ? 0.8401 0.5421 0.6560 0.0118  0.0344  -0.2959 266 ASN A N   
2034 C CA  . ASN A 266 ? 0.8891 0.5621 0.6805 0.0076  0.0263  -0.3047 266 ASN A CA  
2035 C C   . ASN A 266 ? 0.8712 0.5084 0.6593 0.0070  0.0135  -0.2972 266 ASN A C   
2036 O O   . ASN A 266 ? 1.1018 0.7060 0.8756 0.0104  0.0111  -0.3077 266 ASN A O   
2037 C CB  . ASN A 266 ? 1.0056 0.6700 0.7866 0.0167  0.0383  -0.3264 266 ASN A CB  
2038 C CG  . ASN A 266 ? 1.0983 0.7987 0.8815 0.0161  0.0528  -0.3342 266 ASN A CG  
2039 O OD1 . ASN A 266 ? 1.1452 0.8574 0.9414 0.0277  0.0672  -0.3444 266 ASN A OD1 
2040 N ND2 . ASN A 266 ? 1.0973 0.8165 0.8687 0.0023  0.0494  -0.3292 266 ASN A ND2 
2041 N N   . LYS A 267 ? 0.8334 0.4765 0.6337 0.0020  0.0061  -0.2791 267 LYS A N   
2042 C CA  . LYS A 267 ? 0.8888 0.5050 0.6881 -0.0023 -0.0047 -0.2683 267 LYS A CA  
2043 C C   . LYS A 267 ? 0.9187 0.5500 0.7199 -0.0164 -0.0198 -0.2542 267 LYS A C   
2044 O O   . LYS A 267 ? 0.9349 0.5951 0.7420 -0.0205 -0.0203 -0.2484 267 LYS A O   
2045 C CB  . LYS A 267 ? 0.9011 0.5146 0.7187 0.0049  0.0020  -0.2586 267 LYS A CB  
2046 C CG  . LYS A 267 ? 0.9758 0.5765 0.8014 0.0219  0.0154  -0.2722 267 LYS A CG  
2047 C CD  . LYS A 267 ? 1.0322 0.5907 0.8407 0.0238  0.0145  -0.2812 267 LYS A CD  
2048 C CE  . LYS A 267 ? 1.1104 0.6591 0.9231 0.0425  0.0280  -0.2999 267 LYS A CE  
2049 N NZ  . LYS A 267 ? 1.1878 0.6936 0.9823 0.0446  0.0279  -0.3098 267 LYS A NZ  
2050 N N   . ASP A 268 ? 0.9900 0.6029 0.7884 -0.0229 -0.0322 -0.2498 268 ASP A N   
2051 C CA  . ASP A 268 ? 1.0483 0.6799 0.8591 -0.0336 -0.0469 -0.2368 268 ASP A CA  
2052 C C   . ASP A 268 ? 0.9613 0.6020 0.7836 -0.0344 -0.0446 -0.2178 268 ASP A C   
2053 O O   . ASP A 268 ? 1.0208 0.6415 0.8406 -0.0308 -0.0350 -0.2137 268 ASP A O   
2054 C CB  . ASP A 268 ? 1.1758 0.7911 0.9919 -0.0387 -0.0611 -0.2396 268 ASP A CB  
2055 C CG  . ASP A 268 ? 1.2838 0.8939 1.0901 -0.0411 -0.0636 -0.2592 268 ASP A CG  
2056 O OD1 . ASP A 268 ? 1.2980 0.9304 1.0992 -0.0457 -0.0615 -0.2646 268 ASP A OD1 
2057 O OD2 . ASP A 268 ? 1.3623 0.9441 1.1633 -0.0389 -0.0671 -0.2693 268 ASP A OD2 
2058 N N   . PRO A 269 ? 0.8017 0.4732 0.6374 -0.0397 -0.0505 -0.2076 269 PRO A N   
2059 C CA  . PRO A 269 ? 0.7380 0.4195 0.5839 -0.0414 -0.0492 -0.1898 269 PRO A CA  
2060 C C   . PRO A 269 ? 0.8555 0.5128 0.6981 -0.0462 -0.0511 -0.1795 269 PRO A C   
2061 O O   . PRO A 269 ? 0.9178 0.5717 0.7610 -0.0490 -0.0360 -0.1709 269 PRO A O   
2062 C CB  . PRO A 269 ? 0.7145 0.4296 0.5768 -0.0467 -0.0590 -0.1836 269 PRO A CB  
2063 C CG  . PRO A 269 ? 0.7070 0.4312 0.5596 -0.0476 -0.0566 -0.1979 269 PRO A CG  
2064 C CD  . PRO A 269 ? 0.7539 0.4507 0.5929 -0.0452 -0.0558 -0.2129 269 PRO A CD  
2065 N N   . GLN A 270 ? 0.8619 0.5109 0.7129 -0.0473 -0.0669 -0.1851 270 GLN A N   
2066 C CA  A GLN A 270 ? 0.8098 0.4351 0.6588 -0.0514 -0.0720 -0.1765 270 GLN A CA  
2067 C CA  B GLN A 270 ? 0.8147 0.4407 0.6652 -0.0510 -0.0727 -0.1771 270 GLN A CA  
2068 C C   . GLN A 270 ? 0.8017 0.3937 0.6233 -0.0670 -0.0188 -0.1810 270 GLN A C   
2069 O O   . GLN A 270 ? 0.6922 0.3032 0.5567 -0.0720 0.0012  -0.1827 270 GLN A O   
2070 C CB  A GLN A 270 ? 0.8054 0.4886 0.7568 -0.0502 -0.0793 -0.2098 270 GLN A CB  
2071 C CB  B GLN A 270 ? 0.8100 0.4888 0.7558 -0.0495 -0.0806 -0.2098 270 GLN A CB  
2072 C CG  A GLN A 270 ? 0.8042 0.5206 0.7779 -0.0676 -0.0717 -0.2076 270 GLN A CG  
2073 C CG  B GLN A 270 ? 0.8395 0.5463 0.7934 -0.0646 -0.0784 -0.2096 270 GLN A CG  
2074 C CD  A GLN A 270 ? 0.7105 0.4528 0.7082 -0.0741 -0.0560 -0.1963 270 GLN A CD  
2075 C CD  B GLN A 270 ? 0.8867 0.5888 0.8031 -0.0644 -0.0830 -0.2119 270 GLN A CD  
2076 O OE1 A GLN A 270 ? 0.6534 0.3852 0.6571 -0.0839 -0.0350 -0.1940 270 GLN A OE1 
2077 O OE1 B GLN A 270 ? 0.8911 0.5692 0.7777 -0.0577 -0.0822 -0.2195 270 GLN A OE1 
2078 N NE2 A GLN A 270 ? 0.6655 0.4267 0.6557 -0.0720 -0.0633 -0.1855 270 GLN A NE2 
2079 N NE2 B GLN A 270 ? 0.8487 0.5760 0.7681 -0.0737 -0.0828 -0.2077 270 GLN A NE2 
2080 N N   . GLU A 271 ? 0.7975 0.3710 0.6089 -0.0507 -0.0256 -0.1943 271 GLU A N   
2081 C CA  . GLU A 271 ? 0.8668 0.4238 0.6908 -0.0409 -0.0075 -0.2045 271 GLU A CA  
2082 C C   . GLU A 271 ? 0.9049 0.4845 0.7549 -0.0293 -0.0033 -0.1998 271 GLU A C   
2083 O O   . GLU A 271 ? 0.9481 0.5182 0.8181 -0.0208 0.0024  -0.2001 271 GLU A O   
2084 C CB  . GLU A 271 ? 1.0655 0.6043 0.8741 -0.0269 -0.0100 -0.2219 271 GLU A CB  
2085 C CG  . GLU A 271 ? 1.2277 0.7497 1.0507 -0.0105 0.0038  -0.2326 271 GLU A CG  
2086 C CD  . GLU A 271 ? 1.3640 0.8547 1.1689 -0.0031 0.0066  -0.2499 271 GLU A CD  
2087 O OE1 . GLU A 271 ? 1.4253 0.9074 1.2063 -0.0108 -0.0041 -0.2545 271 GLU A OE1 
2088 O OE2 . GLU A 271 ? 1.3653 0.8404 1.1821 0.0129  0.0164  -0.2595 271 GLU A OE2 
2089 N N   . ILE A 272 ? 0.8772 0.4861 0.7284 -0.0276 -0.0093 -0.1954 272 ILE A N   
2090 C CA  . ILE A 272 ? 0.7545 0.3865 0.6280 -0.0187 -0.0063 -0.1908 272 ILE A CA  
2091 C C   . ILE A 272 ? 0.7870 0.4306 0.6744 -0.0284 -0.0077 -0.1752 272 ILE A C   
2092 O O   . ILE A 272 ? 0.8779 0.5243 0.7853 -0.0197 -0.0065 -0.1719 272 ILE A O   
2093 C CB  . ILE A 272 ? 0.6726 0.3326 0.5451 -0.0152 -0.0084 -0.1937 272 ILE A CB  
2094 C CG1 . ILE A 272 ? 0.6728 0.3267 0.5392 -0.0035 -0.0022 -0.2126 272 ILE A CG1 
2095 C CG2 . ILE A 272 ? 0.6667 0.3525 0.5612 -0.0098 -0.0061 -0.1870 272 ILE A CG2 
2096 C CD1 . ILE A 272 ? 0.6338 0.3178 0.5001 -0.0035 -0.0010 -0.2172 272 ILE A CD1 
2097 N N   . LEU A 273 ? 0.6664 0.3178 0.5449 -0.0452 -0.0109 -0.1666 273 LEU A N   
2098 C CA  . LEU A 273 ? 0.6721 0.3405 0.5703 -0.0550 -0.0089 -0.1556 273 LEU A CA  
2099 C C   . LEU A 273 ? 0.7399 0.3893 0.6572 -0.0531 -0.0061 -0.1573 273 LEU A C   
2100 O O   . LEU A 273 ? 0.6868 0.3407 0.6207 -0.0496 -0.0097 -0.1487 273 LEU A O   
2101 C CB  . LEU A 273 ? 0.5460 0.2349 0.4427 -0.0732 -0.0074 -0.1519 273 LEU A CB  
2102 C CG  . LEU A 273 ? 0.7320 0.4343 0.6070 -0.0716 -0.0198 -0.1419 273 LEU A CG  
2103 C CD1 . LEU A 273 ? 0.7905 0.4975 0.6497 -0.0836 -0.0308 -0.1335 273 LEU A CD1 
2104 C CD2 . LEU A 273 ? 0.5037 0.2293 0.3989 -0.0659 -0.0182 -0.1345 273 LEU A CD2 
2105 N N   . LEU A 274 ? 0.7783 0.4022 0.6905 -0.0544 -0.0022 -0.1675 274 LEU A N   
2106 C CA  . LEU A 274 ? 0.8259 0.4270 0.7546 -0.0533 -0.0029 -0.1677 274 LEU A CA  
2107 C C   . LEU A 274 ? 0.8367 0.4137 0.7684 -0.0334 -0.0049 -0.1669 274 LEU A C   
2108 O O   . LEU A 274 ? 0.8156 0.3727 0.7584 -0.0299 -0.0087 -0.1612 274 LEU A O   
2109 C CB  . LEU A 274 ? 0.9351 0.5203 0.8651 -0.0628 0.0011  -0.1800 274 LEU A CB  
2110 C CG  . LEU A 274 ? 0.9769 0.5981 0.9256 -0.0793 -0.0012 -0.1832 274 LEU A CG  
2111 C CD1 . LEU A 274 ? 0.9888 0.5995 0.9552 -0.0862 -0.0060 -0.1960 274 LEU A CD1 
2112 C CD2 . LEU A 274 ? 0.7413 0.3880 0.7057 -0.0838 -0.0091 -0.1690 274 LEU A CD2 
2113 N N   . ASN A 275 ? 0.8600 0.4410 0.7848 -0.0192 -0.0036 -0.1726 275 ASN A N   
2114 C CA  . ASN A 275 ? 0.8463 0.4187 0.7851 0.0030  -0.0060 -0.1732 275 ASN A CA  
2115 C C   . ASN A 275 ? 0.8075 0.4109 0.7644 0.0109  -0.0128 -0.1620 275 ASN A C   
2116 O O   . ASN A 275 ? 0.8184 0.4196 0.7922 0.0274  -0.0178 -0.1584 275 ASN A O   
2117 C CB  . ASN A 275 ? 0.8339 0.3986 0.7659 0.0174  -0.0004 -0.1888 275 ASN A CB  
2118 C CG  . ASN A 275 ? 0.8448 0.3718 0.7601 0.0135  0.0058  -0.2007 275 ASN A CG  
2119 O OD1 . ASN A 275 ? 0.8794 0.4046 0.7767 0.0126  0.0098  -0.2121 275 ASN A OD1 
2120 N ND2 . ASN A 275 ? 0.7822 0.2825 0.7050 0.0114  0.0045  -0.1967 275 ASN A ND2 
2121 N N   . GLU A 276 ? 0.7293 0.3607 0.6822 -0.0007 -0.0132 -0.1568 276 GLU A N   
2122 C CA  . GLU A 276 ? 0.6954 0.3573 0.6641 0.0041  -0.0184 -0.1475 276 GLU A CA  
2123 C C   . GLU A 276 ? 0.6935 0.3503 0.6779 0.0103  -0.0268 -0.1355 276 GLU A C   
2124 O O   . GLU A 276 ? 0.6509 0.3231 0.6520 0.0233  -0.0317 -0.1324 276 GLU A O   
2125 C CB  . GLU A 276 ? 0.6964 0.3816 0.6562 -0.0125 -0.0180 -0.1412 276 GLU A CB  
2126 C CG  . GLU A 276 ? 0.7483 0.4522 0.6989 -0.0126 -0.0147 -0.1479 276 GLU A CG  
2127 C CD  . GLU A 276 ? 0.7874 0.5135 0.7306 -0.0262 -0.0163 -0.1390 276 GLU A CD  
2128 O OE1 . GLU A 276 ? 0.7349 0.4696 0.6855 -0.0332 -0.0190 -0.1284 276 GLU A OE1 
2129 O OE2 . GLU A 276 ? 0.8615 0.5966 0.7918 -0.0287 -0.0159 -0.1428 276 GLU A OE2 
2130 N N   . ALA A 277 ? 0.7568 0.3922 0.7360 0.0005  -0.0288 -0.1291 277 ALA A N   
2131 C CA  . ALA A 277 ? 0.7250 0.3533 0.7130 0.0026  -0.0380 -0.1151 277 ALA A CA  
2132 C C   . ALA A 277 ? 0.8160 0.4232 0.8136 0.0226  -0.0438 -0.1142 277 ALA A C   
2133 O O   . ALA A 277 ? 0.8431 0.4487 0.8481 0.0283  -0.0533 -0.1019 277 ALA A O   
2134 C CB  . ALA A 277 ? 0.6360 0.2492 0.6161 -0.0151 -0.0380 -0.1090 277 ALA A CB  
2135 N N   . PHE A 278 ? 0.9167 0.5079 0.9133 0.0337  -0.0385 -0.1270 278 PHE A N   
2136 C CA  . PHE A 278 ? 1.0061 0.5747 1.0118 0.0537  -0.0432 -0.1271 278 PHE A CA  
2137 C C   . PHE A 278 ? 0.9924 0.5835 1.0157 0.0745  -0.0430 -0.1354 278 PHE A C   
2138 O O   . PHE A 278 ? 1.0393 0.6160 1.0723 0.0936  -0.0453 -0.1387 278 PHE A O   
2139 C CB  . PHE A 278 ? 1.1176 0.6481 1.1122 0.0534  -0.0372 -0.1361 278 PHE A CB  
2140 C CG  . PHE A 278 ? 1.0967 0.6089 1.0775 0.0311  -0.0355 -0.1318 278 PHE A CG  
2141 C CD1 . PHE A 278 ? 1.1301 0.6182 1.1100 0.0274  -0.0431 -0.1184 278 PHE A CD1 
2142 C CD2 . PHE A 278 ? 1.0997 0.6208 1.0693 0.0137  -0.0267 -0.1410 278 PHE A CD2 
2143 C CE1 . PHE A 278 ? 1.1576 0.6332 1.1287 0.0065  -0.0415 -0.1153 278 PHE A CE1 
2144 C CE2 . PHE A 278 ? 1.1365 0.6472 1.0998 -0.0065 -0.0255 -0.1386 278 PHE A CE2 
2145 C CZ  . PHE A 278 ? 1.1522 0.6413 1.1178 -0.0101 -0.0328 -0.1262 278 PHE A CZ  
2146 N N   . VAL A 279 ? 0.9392 0.5668 0.9682 0.0711  -0.0401 -0.1391 279 VAL A N   
2147 C CA  . VAL A 279 ? 0.9301 0.5852 0.9797 0.0889  -0.0391 -0.1477 279 VAL A CA  
2148 C C   . VAL A 279 ? 0.8686 0.5361 0.9376 0.1010  -0.0509 -0.1366 279 VAL A C   
2149 O O   . VAL A 279 ? 0.8409 0.5354 0.9311 0.1156  -0.0517 -0.1421 279 VAL A O   
2150 C CB  . VAL A 279 ? 0.8478 0.5376 0.8972 0.0804  -0.0314 -0.1557 279 VAL A CB  
2151 C CG1 . VAL A 279 ? 0.8708 0.5474 0.8975 0.0687  -0.0215 -0.1656 279 VAL A CG1 
2152 C CG2 . VAL A 279 ? 0.7863 0.4968 0.8355 0.0666  -0.0363 -0.1437 279 VAL A CG2 
2153 N N   . VAL A 280 ? 0.8307 0.4791 0.8920 0.0941  -0.0599 -0.1210 280 VAL A N   
2154 C CA  . VAL A 280 ? 0.8845 0.5402 0.9582 0.1029  -0.0726 -0.1080 280 VAL A CA  
2155 C C   . VAL A 280 ? 1.0367 0.6528 1.1022 0.1085  -0.0803 -0.0971 280 VAL A C   
2156 O O   . VAL A 280 ? 1.1454 0.7315 1.1932 0.0970  -0.0764 -0.0959 280 VAL A O   
2157 C CB  . VAL A 280 ? 0.8071 0.4824 0.8765 0.0860  -0.0763 -0.0977 280 VAL A CB  
2158 C CG1 . VAL A 280 ? 0.8292 0.4801 0.8854 0.0772  -0.0854 -0.0800 280 VAL A CG1 
2159 C CG2 . VAL A 280 ? 0.7075 0.4201 0.7980 0.0948  -0.0804 -0.0991 280 VAL A CG2 
2160 N N   . PRO A 281 ? 1.1016 0.7176 1.1798 0.1258  -0.0913 -0.0889 281 PRO A N   
2161 C CA  . PRO A 281 ? 1.1669 0.7435 1.2365 0.1329  -0.0989 -0.0778 281 PRO A CA  
2162 C C   . PRO A 281 ? 1.1815 0.7389 1.2318 0.1145  -0.1056 -0.0596 281 PRO A C   
2163 O O   . PRO A 281 ? 1.1659 0.6856 1.2013 0.1099  -0.1066 -0.0529 281 PRO A O   
2164 C CB  . PRO A 281 ? 1.1731 0.7639 1.2632 0.1570  -0.1091 -0.0741 281 PRO A CB  
2165 C CG  . PRO A 281 ? 1.1791 0.8155 1.2838 0.1546  -0.1108 -0.0757 281 PRO A CG  
2166 C CD  . PRO A 281 ? 1.1475 0.8006 1.2487 0.1395  -0.0972 -0.0896 281 PRO A CD  
2167 N N   . TYR A 282 ? 1.1501 0.7335 1.2009 0.1038  -0.1095 -0.0523 282 TYR A N   
2168 C CA  . TYR A 282 ? 1.1721 0.7432 1.2050 0.0850  -0.1143 -0.0361 282 TYR A CA  
2169 C C   . TYR A 282 ? 1.0513 0.6544 1.0841 0.0685  -0.1106 -0.0371 282 TYR A C   
2170 O O   . TYR A 282 ? 1.1037 0.7383 1.1513 0.0750  -0.1127 -0.0408 282 TYR A O   
2171 C CB  . TYR A 282 ? 1.2802 0.8396 1.3108 0.0941  -0.1288 -0.0181 282 TYR A CB  
2172 C CG  . TYR A 282 ? 1.3442 0.9327 1.3956 0.1136  -0.1369 -0.0189 282 TYR A CG  
2173 C CD1 . TYR A 282 ? 1.3052 0.9296 1.3651 0.1083  -0.1390 -0.0186 282 TYR A CD1 
2174 C CD2 . TYR A 282 ? 1.3963 0.9778 1.4602 0.1374  -0.1424 -0.0201 282 TYR A CD2 
2175 C CE1 . TYR A 282 ? 1.2819 0.9357 1.3623 0.1248  -0.1461 -0.0200 282 TYR A CE1 
2176 C CE2 . TYR A 282 ? 1.4048 1.0185 1.4902 0.1547  -0.1495 -0.0212 282 TYR A CE2 
2177 C CZ  . TYR A 282 ? 1.3310 0.9816 1.4246 0.1477  -0.1513 -0.0213 282 TYR A CZ  
2178 O OH  . TYR A 282 ? 1.2958 0.9813 1.4117 0.1633  -0.1580 -0.0230 282 TYR A OH  
2179 N N   . GLY A 283 ? 0.9021 0.4983 0.9195 0.0472  -0.1047 -0.0346 283 GLY A N   
2180 C CA  . GLY A 283 ? 0.7618 0.3879 0.7789 0.0320  -0.0999 -0.0362 283 GLY A CA  
2181 C C   . GLY A 283 ? 0.7307 0.3578 0.7367 0.0173  -0.1056 -0.0203 283 GLY A C   
2182 O O   . GLY A 283 ? 0.7867 0.3887 0.7814 0.0151  -0.1122 -0.0071 283 GLY A O   
2183 N N   . THR A 284 ? 0.5726 0.2292 0.5810 0.0070  -0.1025 -0.0214 284 THR A N   
2184 C CA  . THR A 284 ? 0.5717 0.2337 0.5698 -0.0082 -0.1057 -0.0083 284 THR A CA  
2185 C C   . THR A 284 ? 0.6218 0.3035 0.6171 -0.0249 -0.0946 -0.0147 284 THR A C   
2186 O O   . THR A 284 ? 0.6200 0.3139 0.6214 -0.0230 -0.0863 -0.0279 284 THR A O   
2187 C CB  . THR A 284 ? 0.6094 0.2905 0.6149 -0.0022 -0.1143 -0.0024 284 THR A CB  
2188 O OG1 . THR A 284 ? 0.7280 0.4407 0.7451 -0.0030 -0.1080 -0.0139 284 THR A OG1 
2189 C CG2 . THR A 284 ? 0.4846 0.1555 0.4993 0.0188  -0.1245 -0.0004 284 THR A CG2 
2190 N N   . PRO A 285 ? 0.6055 0.2919 0.5911 -0.0410 -0.0940 -0.0052 285 PRO A N   
2191 C CA  . PRO A 285 ? 0.5282 0.2384 0.5144 -0.0545 -0.0840 -0.0113 285 PRO A CA  
2192 C C   . PRO A 285 ? 0.5831 0.3254 0.5797 -0.0500 -0.0802 -0.0195 285 PRO A C   
2193 O O   . PRO A 285 ? 0.5669 0.3295 0.5652 -0.0571 -0.0715 -0.0263 285 PRO A O   
2194 C CB  . PRO A 285 ? 0.4661 0.1791 0.4428 -0.0690 -0.0859 0.0014  285 PRO A CB  
2195 C CG  . PRO A 285 ? 0.5795 0.2593 0.5453 -0.0674 -0.0942 0.0134  285 PRO A CG  
2196 C CD  . PRO A 285 ? 0.6174 0.2867 0.5903 -0.0477 -0.1016 0.0114  285 PRO A CD  
2197 N N   . LEU A 286 ? 0.5450 0.2916 0.5489 -0.0381 -0.0870 -0.0187 286 LEU A N   
2198 C CA  . LEU A 286 ? 0.4718 0.2467 0.4862 -0.0335 -0.0838 -0.0266 286 LEU A CA  
2199 C C   . LEU A 286 ? 0.4280 0.2024 0.4531 -0.0191 -0.0830 -0.0378 286 LEU A C   
2200 O O   . LEU A 286 ? 0.4132 0.2070 0.4491 -0.0127 -0.0834 -0.0430 286 LEU A O   
2201 C CB  . LEU A 286 ? 0.4468 0.2324 0.4639 -0.0331 -0.0918 -0.0188 286 LEU A CB  
2202 C CG  . LEU A 286 ? 0.4152 0.2105 0.4225 -0.0480 -0.0900 -0.0100 286 LEU A CG  
2203 C CD1 . LEU A 286 ? 0.4563 0.2364 0.4560 -0.0496 -0.1016 0.0039  286 LEU A CD1 
2204 C CD2 . LEU A 286 ? 0.3828 0.2101 0.3958 -0.0503 -0.0834 -0.0158 286 LEU A CD2 
2205 N N   . SER A 287 ? 0.4714 0.2242 0.4941 -0.0142 -0.0813 -0.0423 287 SER A N   
2206 C CA  . SER A 287 ? 0.4331 0.1863 0.4659 -0.0002 -0.0790 -0.0542 287 SER A CA  
2207 C C   . SER A 287 ? 0.4544 0.2305 0.4876 -0.0047 -0.0682 -0.0649 287 SER A C   
2208 O O   . SER A 287 ? 0.5993 0.3773 0.6215 -0.0167 -0.0608 -0.0659 287 SER A O   
2209 C CB  . SER A 287 ? 0.4629 0.1861 0.4910 0.0057  -0.0784 -0.0571 287 SER A CB  
2210 O OG  . SER A 287 ? 0.5783 0.2792 0.6064 0.0138  -0.0891 -0.0469 287 SER A OG  
2211 N N   . VAL A 288 ? 0.3576 0.1519 0.4038 0.0048  -0.0676 -0.0725 288 VAL A N   
2212 C CA  . VAL A 288 ? 0.3646 0.1775 0.4092 0.0015  -0.0576 -0.0820 288 VAL A CA  
2213 C C   . VAL A 288 ? 0.4194 0.2278 0.4725 0.0146  -0.0548 -0.0943 288 VAL A C   
2214 O O   . VAL A 288 ? 0.5200 0.3432 0.5908 0.0259  -0.0568 -0.1002 288 VAL A O   
2215 C CB  . VAL A 288 ? 0.2874 0.1282 0.3390 -0.0008 -0.0569 -0.0813 288 VAL A CB  
2216 C CG1 . VAL A 288 ? 0.4153 0.2718 0.4637 -0.0031 -0.0471 -0.0900 288 VAL A CG1 
2217 C CG2 . VAL A 288 ? 0.2733 0.1196 0.3154 -0.0128 -0.0579 -0.0703 288 VAL A CG2 
2218 N N   . ASN A 289 ? 0.4384 0.2273 0.4801 0.0130  -0.0499 -0.0990 289 ASN A N   
2219 C CA  . ASN A 289 ? 0.5630 0.3433 0.6116 0.0266  -0.0471 -0.1107 289 ASN A CA  
2220 C C   . ASN A 289 ? 0.5450 0.3487 0.5983 0.0286  -0.0388 -0.1225 289 ASN A C   
2221 O O   . ASN A 289 ? 0.4668 0.2805 0.5369 0.0424  -0.0375 -0.1319 289 ASN A O   
2222 C CB  . ASN A 289 ? 0.6505 0.4001 0.6841 0.0238  -0.0442 -0.1130 289 ASN A CB  
2223 C CG  . ASN A 289 ? 0.7802 0.5039 0.8131 0.0260  -0.0526 -0.1028 289 ASN A CG  
2224 O OD1 . ASN A 289 ? 0.8330 0.5590 0.8783 0.0355  -0.0616 -0.0959 289 ASN A OD1 
2225 N ND2 . ASN A 289 ? 0.7648 0.4636 0.7828 0.0165  -0.0499 -0.1015 289 ASN A ND2 
2226 N N   . PHE A 290 ? 0.4959 0.3095 0.5346 0.0149  -0.0332 -0.1213 290 PHE A N   
2227 C CA  . PHE A 290 ? 0.4659 0.3009 0.5059 0.0146  -0.0258 -0.1300 290 PHE A CA  
2228 C C   . PHE A 290 ? 0.4848 0.3401 0.5216 0.0042  -0.0257 -0.1222 290 PHE A C   
2229 O O   . PHE A 290 ? 0.5725 0.4242 0.5906 -0.0077 -0.0248 -0.1155 290 PHE A O   
2230 C CB  . PHE A 290 ? 0.3626 0.1853 0.3836 0.0101  -0.0191 -0.1377 290 PHE A CB  
2231 C CG  . PHE A 290 ? 0.3994 0.2041 0.4240 0.0219  -0.0170 -0.1483 290 PHE A CG  
2232 C CD1 . PHE A 290 ? 0.4500 0.2695 0.4916 0.0351  -0.0120 -0.1607 290 PHE A CD1 
2233 C CD2 . PHE A 290 ? 0.4246 0.1983 0.4359 0.0195  -0.0189 -0.1464 290 PHE A CD2 
2234 C CE1 . PHE A 290 ? 0.5773 0.3805 0.6224 0.0477  -0.0095 -0.1707 290 PHE A CE1 
2235 C CE2 . PHE A 290 ? 0.4593 0.2133 0.4725 0.0310  -0.0166 -0.1562 290 PHE A CE2 
2236 C CZ  . PHE A 290 ? 0.6295 0.3978 0.6593 0.0461  -0.0121 -0.1681 290 PHE A CZ  
2237 N N   . GLY A 291 ? 0.4171 0.2937 0.4725 0.0092  -0.0269 -0.1235 291 GLY A N   
2238 C CA  . GLY A 291 ? 0.3632 0.2579 0.4161 0.0003  -0.0263 -0.1167 291 GLY A CA  
2239 C C   . GLY A 291 ? 0.3804 0.2999 0.4476 0.0028  -0.0208 -0.1257 291 GLY A C   
2240 O O   . GLY A 291 ? 0.4158 0.3417 0.4926 0.0099  -0.0152 -0.1384 291 GLY A O   
2241 N N   . PRO A 292 ? 0.3835 0.3180 0.4515 -0.0037 -0.0211 -0.1198 292 PRO A N   
2242 C CA  . PRO A 292 ? 0.4264 0.3847 0.5058 -0.0049 -0.0144 -0.1284 292 PRO A CA  
2243 C C   . PRO A 292 ? 0.4402 0.4140 0.5484 0.0072  -0.0144 -0.1426 292 PRO A C   
2244 O O   . PRO A 292 ? 0.4378 0.4059 0.5597 0.0170  -0.0235 -0.1418 292 PRO A O   
2245 C CB  . PRO A 292 ? 0.3343 0.3007 0.4096 -0.0128 -0.0173 -0.1174 292 PRO A CB  
2246 C CG  . PRO A 292 ? 0.2911 0.2388 0.3455 -0.0177 -0.0218 -0.1033 292 PRO A CG  
2247 C CD  . PRO A 292 ? 0.2463 0.1767 0.3025 -0.0115 -0.0260 -0.1052 292 PRO A CD  
2248 N N   . THR A 293 ? 0.4137 0.4073 0.5308 0.0073  -0.0042 -0.1555 293 THR A N   
2249 C CA  . THR A 293 ? 0.3947 0.4118 0.5418 0.0191  -0.0026 -0.1698 293 THR A CA  
2250 C C   . THR A 293 ? 0.3486 0.3957 0.5032 0.0094  0.0069  -0.1777 293 THR A C   
2251 O O   . THR A 293 ? 0.3972 0.4421 0.5316 -0.0058 0.0122  -0.1713 293 THR A O   
2252 C CB  . THR A 293 ? 0.3528 0.3698 0.5082 0.0318  0.0029  -0.1808 293 THR A CB  
2253 O OG1 . THR A 293 ? 0.3026 0.3151 0.4372 0.0223  0.0137  -0.1837 293 THR A OG1 
2254 C CG2 . THR A 293 ? 0.4407 0.4294 0.5942 0.0436  -0.0074 -0.1748 293 THR A CG2 
2255 N N   . VAL A 294 ? 0.2264 0.3039 0.4080 0.0178  0.0081  -0.1836 294 VAL A N   
2256 C CA  . VAL A 294 ? 0.2679 0.3784 0.4576 0.0072  0.0184  -0.1888 294 VAL A CA  
2257 C C   . VAL A 294 ? 0.2448 0.3654 0.4345 0.0073  0.0340  -0.2046 294 VAL A C   
2258 O O   . VAL A 294 ? 0.2937 0.4353 0.5071 0.0207  0.0384  -0.2165 294 VAL A O   
2259 C CB  . VAL A 294 ? 0.3900 0.5340 0.6101 0.0146  0.0126  -0.1884 294 VAL A CB  
2260 C CG1 . VAL A 294 ? 0.2671 0.4441 0.4936 -0.0008 0.0229  -0.1927 294 VAL A CG1 
2261 C CG2 . VAL A 294 ? 0.1802 0.3109 0.3978 0.0166  -0.0038 -0.1731 294 VAL A CG2 
2262 N N   . ASP A 295 ? 0.3344 0.4402 0.4964 -0.0073 0.0419  -0.2039 295 ASP A N   
2263 C CA  . ASP A 295 ? 0.3556 0.4663 0.5090 -0.0102 0.0545  -0.2115 295 ASP A CA  
2264 C C   . ASP A 295 ? 0.3228 0.4699 0.4863 -0.0208 0.0694  -0.2214 295 ASP A C   
2265 O O   . ASP A 295 ? 0.3482 0.5055 0.5095 -0.0221 0.0803  -0.2293 295 ASP A O   
2266 C CB  . ASP A 295 ? 0.3435 0.4232 0.4610 -0.0207 0.0542  -0.2009 295 ASP A CB  
2267 C CG  . ASP A 295 ? 0.3685 0.4437 0.4668 -0.0379 0.0544  -0.1897 295 ASP A CG  
2268 O OD1 . ASP A 295 ? 0.3805 0.4691 0.4906 -0.0422 0.0520  -0.1886 295 ASP A OD1 
2269 O OD2 . ASP A 295 ? 0.4137 0.4709 0.4843 -0.0465 0.0560  -0.1817 295 ASP A OD2 
2270 N N   . GLY A 296 ? 0.3185 0.4849 0.4917 -0.0297 0.0696  -0.2195 296 GLY A N   
2271 C CA  . GLY A 296 ? 0.2811 0.4801 0.4602 -0.0445 0.0837  -0.2255 296 GLY A CA  
2272 C C   . GLY A 296 ? 0.4244 0.6056 0.5674 -0.0651 0.0930  -0.2212 296 GLY A C   
2273 O O   . GLY A 296 ? 0.4356 0.6359 0.5753 -0.0789 0.1059  -0.2251 296 GLY A O   
2274 N N   . ASP A 297 ? 0.5021 0.6452 0.6176 -0.0673 0.0837  -0.2091 297 ASP A N   
2275 C CA  . ASP A 297 ? 0.4516 0.5741 0.5324 -0.0834 0.0881  -0.1994 297 ASP A CA  
2276 C C   . ASP A 297 ? 0.3986 0.4940 0.4619 -0.0877 0.0754  -0.1807 297 ASP A C   
2277 O O   . ASP A 297 ? 0.4083 0.5055 0.4649 -0.1008 0.0771  -0.1747 297 ASP A O   
2278 C CB  . ASP A 297 ? 0.3724 0.4778 0.4361 -0.0780 0.0897  -0.1994 297 ASP A CB  
2279 C CG  . ASP A 297 ? 0.4556 0.5476 0.4858 -0.0942 0.0967  -0.1927 297 ASP A CG  
2280 O OD1 . ASP A 297 ? 0.4948 0.5803 0.5107 -0.1079 0.0968  -0.1835 297 ASP A OD1 
2281 O OD2 . ASP A 297 ? 0.4365 0.5226 0.4534 -0.0930 0.1014  -0.1965 297 ASP A OD2 
2282 N N   . PHE A 298 ? 0.3614 0.4322 0.4176 -0.0760 0.0629  -0.1702 298 PHE A N   
2283 C CA  . PHE A 298 ? 0.2660 0.3152 0.3092 -0.0757 0.0507  -0.1516 298 PHE A CA  
2284 C C   . PHE A 298 ? 0.3368 0.3988 0.4011 -0.0729 0.0447  -0.1505 298 PHE A C   
2285 O O   . PHE A 298 ? 0.3760 0.4306 0.4316 -0.0776 0.0403  -0.1381 298 PHE A O   
2286 C CB  . PHE A 298 ? 0.2651 0.2911 0.2997 -0.0641 0.0397  -0.1432 298 PHE A CB  
2287 C CG  . PHE A 298 ? 0.2428 0.2494 0.2635 -0.0632 0.0283  -0.1253 298 PHE A CG  
2288 C CD1 . PHE A 298 ? 0.1974 0.2042 0.2297 -0.0573 0.0195  -0.1187 298 PHE A CD1 
2289 C CD2 . PHE A 298 ? 0.2721 0.2617 0.2686 -0.0676 0.0262  -0.1162 298 PHE A CD2 
2290 C CE1 . PHE A 298 ? 0.3527 0.3440 0.3726 -0.0559 0.0102  -0.1036 298 PHE A CE1 
2291 C CE2 . PHE A 298 ? 0.3251 0.3003 0.3128 -0.0647 0.0156  -0.1022 298 PHE A CE2 
2292 C CZ  . PHE A 298 ? 0.3136 0.2899 0.3129 -0.0589 0.0082  -0.0961 298 PHE A CZ  
2293 N N   . LEU A 299 ? 0.3398 0.4198 0.4312 -0.0634 0.0436  -0.1638 299 LEU A N   
2294 C CA  . LEU A 299 ? 0.2799 0.3763 0.3952 -0.0596 0.0361  -0.1656 299 LEU A CA  
2295 C C   . LEU A 299 ? 0.3646 0.4984 0.5070 -0.0588 0.0448  -0.1803 299 LEU A C   
2296 O O   . LEU A 299 ? 0.3343 0.4775 0.4894 -0.0470 0.0495  -0.1909 299 LEU A O   
2297 C CB  . LEU A 299 ? 0.2690 0.3531 0.3938 -0.0437 0.0236  -0.1634 299 LEU A CB  
2298 C CG  . LEU A 299 ? 0.4408 0.5080 0.5565 -0.0418 0.0113  -0.1453 299 LEU A CG  
2299 C CD1 . LEU A 299 ? 0.4517 0.5081 0.5779 -0.0279 0.0007  -0.1462 299 LEU A CD1 
2300 C CD2 . LEU A 299 ? 0.4727 0.5581 0.5981 -0.0476 0.0091  -0.1421 299 LEU A CD2 
2301 N N   . THR A 300 ? 0.3597 0.5156 0.5116 -0.0699 0.0472  -0.1793 300 THR A N   
2302 C CA  . THR A 300 ? 0.3091 0.5054 0.4860 -0.0720 0.0574  -0.1908 300 THR A CA  
2303 C C   . THR A 300 ? 0.2381 0.4633 0.4495 -0.0592 0.0480  -0.1930 300 THR A C   
2304 O O   . THR A 300 ? 0.3751 0.6368 0.6108 -0.0580 0.0545  -0.2026 300 THR A O   
2305 C CB  . THR A 300 ? 0.3354 0.5423 0.5024 -0.0954 0.0674  -0.1899 300 THR A CB  
2306 O OG1 . THR A 300 ? 0.3540 0.5504 0.5129 -0.0959 0.0570  -0.1760 300 THR A OG1 
2307 C CG2 . THR A 300 ? 0.3611 0.5363 0.4908 -0.1083 0.0744  -0.1850 300 THR A CG2 
2308 N N   . ASP A 301 ? 0.1943 0.4027 0.4054 -0.0498 0.0323  -0.1831 301 ASP A N   
2309 C CA  . ASP A 301 ? 0.2585 0.4903 0.4979 -0.0374 0.0207  -0.1826 301 ASP A CA  
2310 C C   . ASP A 301 ? 0.2498 0.4508 0.4786 -0.0264 0.0052  -0.1709 301 ASP A C   
2311 O O   . ASP A 301 ? 0.2334 0.4006 0.4359 -0.0309 0.0046  -0.1640 301 ASP A O   
2312 C CB  . ASP A 301 ? 0.3014 0.5452 0.5358 -0.0493 0.0199  -0.1761 301 ASP A CB  
2313 C CG  . ASP A 301 ? 0.2897 0.5620 0.5495 -0.0375 0.0111  -0.1767 301 ASP A CG  
2314 O OD1 . ASP A 301 ? 0.1553 0.4339 0.4353 -0.0185 0.0026  -0.1793 301 ASP A OD1 
2315 O OD2 . ASP A 301 ? 0.2953 0.5817 0.5536 -0.0471 0.0120  -0.1738 301 ASP A OD2 
2316 N N   . MET A 302 ? 0.2865 0.5000 0.5353 -0.0124 -0.0074 -0.1681 302 MET A N   
2317 C CA  . MET A 302 ? 0.3047 0.4901 0.5415 -0.0048 -0.0217 -0.1556 302 MET A CA  
2318 C C   . MET A 302 ? 0.3216 0.4925 0.5362 -0.0211 -0.0247 -0.1460 302 MET A C   
2319 O O   . MET A 302 ? 0.4119 0.5943 0.6218 -0.0296 -0.0228 -0.1417 302 MET A O   
2320 C CB  . MET A 302 ? 0.2820 0.4848 0.5424 0.0119  -0.0353 -0.1533 302 MET A CB  
2321 C CG  . MET A 302 ? 0.3206 0.5419 0.6072 0.0299  -0.0323 -0.1645 302 MET A CG  
2322 S SD  . MET A 302 ? 0.8067 1.0420 1.1188 0.0531  -0.0513 -0.1593 302 MET A SD  
2323 C CE  . MET A 302 ? 0.8940 1.0754 1.1758 0.0570  -0.0629 -0.1430 302 MET A CE  
2324 N N   . PRO A 303 ? 0.3036 0.4396 0.4940 -0.0228 -0.0269 -0.1382 303 PRO A N   
2325 C CA  . PRO A 303 ? 0.2623 0.3770 0.4224 -0.0341 -0.0246 -0.1250 303 PRO A CA  
2326 C C   . PRO A 303 ? 0.2599 0.3774 0.4164 -0.0341 -0.0337 -0.1145 303 PRO A C   
2327 O O   . PRO A 303 ? 0.2994 0.4070 0.4358 -0.0431 -0.0305 -0.1059 303 PRO A O   
2328 C CB  . PRO A 303 ? 0.2081 0.2904 0.3478 -0.0321 -0.0250 -0.1187 303 PRO A CB  
2329 C CG  . PRO A 303 ? 0.2588 0.3396 0.4164 -0.0197 -0.0326 -0.1264 303 PRO A CG  
2330 C CD  . PRO A 303 ? 0.2311 0.3405 0.4139 -0.0116 -0.0289 -0.1366 303 PRO A CD  
2331 N N   . ASP A 304 ? 0.2120 0.3418 0.3871 -0.0237 -0.0458 -0.1152 304 ASP A N   
2332 C CA  . ASP A 304 ? 0.3166 0.4520 0.4871 -0.0248 -0.0542 -0.1061 304 ASP A CA  
2333 C C   . ASP A 304 ? 0.2833 0.4412 0.4581 -0.0329 -0.0492 -0.1084 304 ASP A C   
2334 O O   . ASP A 304 ? 0.2353 0.3893 0.3955 -0.0409 -0.0507 -0.1009 304 ASP A O   
2335 C CB  . ASP A 304 ? 0.5184 0.6614 0.7060 -0.0106 -0.0696 -0.1041 304 ASP A CB  
2336 C CG  . ASP A 304 ? 0.7474 0.9101 0.9659 0.0037  -0.0718 -0.1149 304 ASP A CG  
2337 O OD1 . ASP A 304 ? 0.8754 1.0290 1.0941 0.0047  -0.0619 -0.1220 304 ASP A OD1 
2338 O OD2 . ASP A 304 ? 0.7873 0.9694 1.0232 0.0151  -0.0810 -0.1136 304 ASP A OD2 
2339 N N   . ILE A 305 ? 0.2572 0.4382 0.4521 -0.0314 -0.0429 -0.1194 305 ILE A N   
2340 C CA  . ILE A 305 ? 0.2460 0.4483 0.4454 -0.0407 -0.0371 -0.1224 305 ILE A CA  
2341 C C   . ILE A 305 ? 0.2420 0.4254 0.4165 -0.0560 -0.0262 -0.1192 305 ILE A C   
2342 O O   . ILE A 305 ? 0.2311 0.4143 0.3962 -0.0649 -0.0266 -0.1146 305 ILE A O   
2343 C CB  . ILE A 305 ? 0.2319 0.4664 0.4598 -0.0349 -0.0322 -0.1351 305 ILE A CB  
2344 C CG1 . ILE A 305 ? 0.2793 0.5286 0.5313 -0.0156 -0.0446 -0.1363 305 ILE A CG1 
2345 C CG2 . ILE A 305 ? 0.1558 0.4137 0.3885 -0.0459 -0.0269 -0.1378 305 ILE A CG2 
2346 C CD1 . ILE A 305 ? 0.1537 0.4286 0.4336 -0.0042 -0.0393 -0.1490 305 ILE A CD1 
2347 N N   . LEU A 306 ? 0.1942 0.3604 0.3581 -0.0582 -0.0176 -0.1213 306 LEU A N   
2348 C CA  . LEU A 306 ? 0.2109 0.3566 0.3506 -0.0699 -0.0087 -0.1166 306 LEU A CA  
2349 C C   . LEU A 306 ? 0.3117 0.4336 0.4296 -0.0721 -0.0147 -0.1040 306 LEU A C   
2350 O O   . LEU A 306 ? 0.2714 0.3874 0.3781 -0.0810 -0.0118 -0.1010 306 LEU A O   
2351 C CB  . LEU A 306 ? 0.1519 0.2811 0.2819 -0.0695 -0.0013 -0.1187 306 LEU A CB  
2352 C CG  . LEU A 306 ? 0.2171 0.3676 0.3662 -0.0686 0.0069  -0.1334 306 LEU A CG  
2353 C CD1 . LEU A 306 ? 0.2411 0.3706 0.3752 -0.0694 0.0131  -0.1341 306 LEU A CD1 
2354 C CD2 . LEU A 306 ? 0.1619 0.3355 0.3178 -0.0795 0.0166  -0.1404 306 LEU A CD2 
2355 N N   . LEU A 307 ? 0.2768 0.3856 0.3900 -0.0640 -0.0227 -0.0978 307 LEU A N   
2356 C CA  . LEU A 307 ? 0.2668 0.3571 0.3624 -0.0648 -0.0285 -0.0874 307 LEU A CA  
2357 C C   . LEU A 307 ? 0.3403 0.4447 0.4405 -0.0692 -0.0335 -0.0872 307 LEU A C   
2358 O O   . LEU A 307 ? 0.3510 0.4446 0.4382 -0.0756 -0.0323 -0.0840 307 LEU A O   
2359 C CB  . LEU A 307 ? 0.2989 0.3797 0.3922 -0.0565 -0.0358 -0.0826 307 LEU A CB  
2360 C CG  . LEU A 307 ? 0.3580 0.4242 0.4349 -0.0575 -0.0414 -0.0733 307 LEU A CG  
2361 C CD1 . LEU A 307 ? 0.3538 0.4011 0.4125 -0.0622 -0.0366 -0.0688 307 LEU A CD1 
2362 C CD2 . LEU A 307 ? 0.3051 0.3609 0.3777 -0.0516 -0.0458 -0.0689 307 LEU A CD2 
2363 N N   . GLU A 308 ? 0.3457 0.4742 0.4653 -0.0648 -0.0400 -0.0912 308 GLU A N   
2364 C CA  . GLU A 308 ? 0.3032 0.4476 0.4281 -0.0681 -0.0469 -0.0905 308 GLU A CA  
2365 C C   . GLU A 308 ? 0.3094 0.4607 0.4339 -0.0791 -0.0401 -0.0947 308 GLU A C   
2366 O O   . GLU A 308 ? 0.2853 0.4367 0.4041 -0.0851 -0.0436 -0.0930 308 GLU A O   
2367 C CB  . GLU A 308 ? 0.2441 0.4169 0.3934 -0.0594 -0.0555 -0.0941 308 GLU A CB  
2368 C CG  . GLU A 308 ? 0.2697 0.4634 0.4270 -0.0623 -0.0637 -0.0933 308 GLU A CG  
2369 C CD  . GLU A 308 ? 0.3598 0.5390 0.4992 -0.0647 -0.0721 -0.0849 308 GLU A CD  
2370 O OE1 . GLU A 308 ? 0.5172 0.6758 0.6429 -0.0611 -0.0736 -0.0792 308 GLU A OE1 
2371 O OE2 . GLU A 308 ? 0.3629 0.5523 0.5023 -0.0704 -0.0772 -0.0847 308 GLU A OE2 
2372 N N   . LEU A 309 ? 0.2880 0.4440 0.4175 -0.0824 -0.0300 -0.1009 309 LEU A N   
2373 C CA  . LEU A 309 ? 0.2848 0.4516 0.4164 -0.0939 -0.0228 -0.1060 309 LEU A CA  
2374 C C   . LEU A 309 ? 0.3624 0.5031 0.4727 -0.1019 -0.0141 -0.1034 309 LEU A C   
2375 O O   . LEU A 309 ? 0.3971 0.5435 0.5069 -0.1125 -0.0060 -0.1078 309 LEU A O   
2376 C CB  . LEU A 309 ? 0.1785 0.3764 0.3336 -0.0935 -0.0175 -0.1161 309 LEU A CB  
2377 C CG  . LEU A 309 ? 0.2425 0.4719 0.4228 -0.0851 -0.0273 -0.1192 309 LEU A CG  
2378 C CD1 . LEU A 309 ? 0.1787 0.4404 0.3834 -0.0841 -0.0206 -0.1302 309 LEU A CD1 
2379 C CD2 . LEU A 309 ? 0.1853 0.4215 0.3640 -0.0905 -0.0358 -0.1155 309 LEU A CD2 
2380 N N   . GLY A 310 ? 0.3783 0.4912 0.4714 -0.0968 -0.0161 -0.0959 310 GLY A N   
2381 C CA  . GLY A 310 ? 0.3534 0.4405 0.4266 -0.1017 -0.0110 -0.0919 310 GLY A CA  
2382 C C   . GLY A 310 ? 0.3558 0.4377 0.4243 -0.1055 -0.0011 -0.0941 310 GLY A C   
2383 O O   . GLY A 310 ? 0.3205 0.3872 0.3752 -0.1128 0.0041  -0.0925 310 GLY A O   
2384 N N   . GLN A 311 ? 0.3677 0.4619 0.4473 -0.1007 0.0013  -0.0984 311 GLN A N   
2385 C CA  . GLN A 311 ? 0.3996 0.4908 0.4742 -0.1053 0.0114  -0.1019 311 GLN A CA  
2386 C C   . GLN A 311 ? 0.3995 0.4669 0.4604 -0.0979 0.0098  -0.0956 311 GLN A C   
2387 O O   . GLN A 311 ? 0.3930 0.4651 0.4615 -0.0910 0.0095  -0.0986 311 GLN A O   
2388 C CB  . GLN A 311 ? 0.3602 0.4814 0.4563 -0.1055 0.0166  -0.1133 311 GLN A CB  
2389 C CG  . GLN A 311 ? 0.4641 0.6119 0.5753 -0.1122 0.0172  -0.1192 311 GLN A CG  
2390 C CD  . GLN A 311 ? 0.5510 0.6948 0.6499 -0.1277 0.0263  -0.1200 311 GLN A CD  
2391 O OE1 . GLN A 311 ? 0.6108 0.7510 0.7014 -0.1347 0.0365  -0.1231 311 GLN A OE1 
2392 N NE2 . GLN A 311 ? 0.4875 0.6308 0.5838 -0.1341 0.0226  -0.1175 311 GLN A NE2 
2393 N N   . PHE A 312 ? 0.3763 0.4192 0.4186 -0.0989 0.0083  -0.0877 312 PHE A N   
2394 C CA  . PHE A 312 ? 0.3560 0.3776 0.3854 -0.0921 0.0059  -0.0813 312 PHE A CA  
2395 C C   . PHE A 312 ? 0.3493 0.3492 0.3610 -0.0963 0.0069  -0.0761 312 PHE A C   
2396 O O   . PHE A 312 ? 0.4092 0.4075 0.4173 -0.1044 0.0092  -0.0770 312 PHE A O   
2397 C CB  . PHE A 312 ? 0.2613 0.2778 0.2931 -0.0807 -0.0038 -0.0760 312 PHE A CB  
2398 C CG  . PHE A 312 ? 0.2584 0.2769 0.2923 -0.0803 -0.0097 -0.0740 312 PHE A CG  
2399 C CD1 . PHE A 312 ? 0.3633 0.3653 0.3859 -0.0800 -0.0126 -0.0694 312 PHE A CD1 
2400 C CD2 . PHE A 312 ? 0.3108 0.3489 0.3590 -0.0801 -0.0126 -0.0778 312 PHE A CD2 
2401 C CE1 . PHE A 312 ? 0.4096 0.4138 0.4333 -0.0804 -0.0171 -0.0694 312 PHE A CE1 
2402 C CE2 . PHE A 312 ? 0.3515 0.3916 0.3999 -0.0807 -0.0185 -0.0761 312 PHE A CE2 
2403 C CZ  . PHE A 312 ? 0.3864 0.4089 0.4218 -0.0812 -0.0202 -0.0721 312 PHE A CZ  
2404 N N   . LYS A 313 ? 0.2952 0.2786 0.2965 -0.0908 0.0047  -0.0713 313 LYS A N   
2405 C CA  . LYS A 313 ? 0.3496 0.3122 0.3358 -0.0925 0.0040  -0.0668 313 LYS A CA  
2406 C C   . LYS A 313 ? 0.3808 0.3373 0.3685 -0.0880 -0.0026 -0.0645 313 LYS A C   
2407 O O   . LYS A 313 ? 0.4464 0.4059 0.4400 -0.0793 -0.0087 -0.0630 313 LYS A O   
2408 C CB  . LYS A 313 ? 0.3101 0.2605 0.2884 -0.0859 0.0013  -0.0632 313 LYS A CB  
2409 C CG  . LYS A 313 ? 0.3501 0.2795 0.3141 -0.0866 -0.0003 -0.0593 313 LYS A CG  
2410 C CD  . LYS A 313 ? 0.4654 0.3864 0.4237 -0.0799 -0.0039 -0.0567 313 LYS A CD  
2411 C CE  . LYS A 313 ? 0.4401 0.3389 0.3811 -0.0824 -0.0043 -0.0534 313 LYS A CE  
2412 N NZ  . LYS A 313 ? 0.4784 0.3641 0.3995 -0.0966 0.0033  -0.0524 313 LYS A NZ  
2413 N N   . LYS A 314 ? 0.3159 0.2633 0.2960 -0.0959 0.0000  -0.0652 314 LYS A N   
2414 C CA  . LYS A 314 ? 0.3390 0.2787 0.3181 -0.0936 -0.0045 -0.0651 314 LYS A CA  
2415 C C   . LYS A 314 ? 0.3718 0.2921 0.3418 -0.0873 -0.0078 -0.0623 314 LYS A C   
2416 O O   . LYS A 314 ? 0.4335 0.3371 0.3918 -0.0916 -0.0054 -0.0607 314 LYS A O   
2417 C CB  . LYS A 314 ? 0.2885 0.2259 0.2638 -0.1054 -0.0006 -0.0681 314 LYS A CB  
2418 C CG  . LYS A 314 ? 0.3039 0.2640 0.2905 -0.1125 0.0026  -0.0726 314 LYS A CG  
2419 C CD  . LYS A 314 ? 0.3693 0.3453 0.3691 -0.1039 -0.0039 -0.0733 314 LYS A CD  
2420 C CE  . LYS A 314 ? 0.3674 0.3675 0.3804 -0.1101 -0.0020 -0.0783 314 LYS A CE  
2421 N NZ  . LYS A 314 ? 0.4745 0.4846 0.4899 -0.1169 0.0064  -0.0815 314 LYS A NZ  
2422 N N   . THR A 315 ? 0.2975 0.2199 0.2726 -0.0775 -0.0133 -0.0619 315 THR A N   
2423 C CA  . THR A 315 ? 0.2898 0.1989 0.2607 -0.0703 -0.0166 -0.0609 315 THR A CA  
2424 C C   . THR A 315 ? 0.3229 0.2387 0.3009 -0.0618 -0.0218 -0.0620 315 THR A C   
2425 O O   . THR A 315 ? 0.3261 0.2538 0.3090 -0.0623 -0.0229 -0.0624 315 THR A O   
2426 C CB  . THR A 315 ? 0.2838 0.1903 0.2520 -0.0676 -0.0162 -0.0579 315 THR A CB  
2427 O OG1 . THR A 315 ? 0.3103 0.2058 0.2760 -0.0611 -0.0190 -0.0579 315 THR A OG1 
2428 C CG2 . THR A 315 ? 0.2147 0.1371 0.1920 -0.0630 -0.0179 -0.0571 315 THR A CG2 
2429 N N   . GLN A 316 ? 0.2998 0.2088 0.2782 -0.0546 -0.0246 -0.0629 316 GLN A N   
2430 C CA  . GLN A 316 ? 0.2867 0.2015 0.2697 -0.0478 -0.0291 -0.0643 316 GLN A CA  
2431 C C   . GLN A 316 ? 0.2969 0.2229 0.2839 -0.0435 -0.0306 -0.0596 316 GLN A C   
2432 O O   . GLN A 316 ? 0.3749 0.3018 0.3639 -0.0425 -0.0295 -0.0583 316 GLN A O   
2433 C CB  . GLN A 316 ? 0.3388 0.2462 0.3223 -0.0419 -0.0287 -0.0680 316 GLN A CB  
2434 C CG  . GLN A 316 ? 0.3077 0.1993 0.2853 -0.0458 -0.0274 -0.0729 316 GLN A CG  
2435 C CD  . GLN A 316 ? 0.3522 0.2284 0.3212 -0.0519 -0.0237 -0.0703 316 GLN A CD  
2436 O OE1 . GLN A 316 ? 0.3777 0.2482 0.3414 -0.0512 -0.0223 -0.0669 316 GLN A OE1 
2437 N NE2 . GLN A 316 ? 0.2715 0.1376 0.2326 -0.0599 -0.0218 -0.0705 316 GLN A NE2 
2438 N N   . ILE A 317 ? 0.3578 0.2706 0.3346 -0.0320 -0.0321 -0.0842 317 ILE A N   
2439 C CA  . ILE A 317 ? 0.3540 0.2797 0.3400 -0.0276 -0.0317 -0.0811 317 ILE A CA  
2440 C C   . ILE A 317 ? 0.3352 0.2709 0.3263 -0.0203 -0.0345 -0.0822 317 ILE A C   
2441 O O   . ILE A 317 ? 0.2451 0.1817 0.2355 -0.0179 -0.0369 -0.0857 317 ILE A O   
2442 C CB  . ILE A 317 ? 0.2563 0.1926 0.2533 -0.0285 -0.0307 -0.0803 317 ILE A CB  
2443 C CG1 . ILE A 317 ? 0.2774 0.2214 0.2811 -0.0273 -0.0334 -0.0835 317 ILE A CG1 
2444 C CG2 . ILE A 317 ? 0.2753 0.2038 0.2695 -0.0343 -0.0282 -0.0796 317 ILE A CG2 
2445 C CD1 . ILE A 317 ? 0.3484 0.3038 0.3648 -0.0278 -0.0328 -0.0835 317 ILE A CD1 
2446 N N   . LEU A 318 ? 0.2745 0.2163 0.2693 -0.0175 -0.0344 -0.0795 318 LEU A N   
2447 C CA  . LEU A 318 ? 0.2624 0.2145 0.2624 -0.0117 -0.0367 -0.0801 318 LEU A CA  
2448 C C   . LEU A 318 ? 0.2740 0.2359 0.2817 -0.0124 -0.0356 -0.0771 318 LEU A C   
2449 O O   . LEU A 318 ? 0.2368 0.1962 0.2441 -0.0151 -0.0342 -0.0740 318 LEU A O   
2450 C CB  . LEU A 318 ? 0.2509 0.1996 0.2474 -0.0085 -0.0386 -0.0803 318 LEU A CB  
2451 C CG  . LEU A 318 ? 0.2750 0.2327 0.2751 -0.0019 -0.0414 -0.0828 318 LEU A CG  
2452 C CD1 . LEU A 318 ? 0.3359 0.2878 0.3324 0.0016  -0.0441 -0.0839 318 LEU A CD1 
2453 C CD2 . LEU A 318 ? 0.2403 0.2104 0.2481 -0.0025 -0.0409 -0.0804 318 LEU A CD2 
2454 N N   . VAL A 319 ? 0.2339 0.2049 0.2466 -0.0105 -0.0365 -0.0784 319 VAL A N   
2455 C CA  . VAL A 319 ? 0.1495 0.1272 0.1682 -0.0117 -0.0359 -0.0760 319 VAL A CA  
2456 C C   . VAL A 319 ? 0.2983 0.2842 0.3177 -0.0094 -0.0376 -0.0766 319 VAL A C   
2457 O O   . VAL A 319 ? 0.3741 0.3624 0.3903 -0.0062 -0.0389 -0.0802 319 VAL A O   
2458 C CB  . VAL A 319 ? 0.2547 0.2341 0.2775 -0.0133 -0.0357 -0.0772 319 VAL A CB  
2459 C CG1 . VAL A 319 ? 0.1639 0.1476 0.1923 -0.0142 -0.0354 -0.0748 319 VAL A CG1 
2460 C CG2 . VAL A 319 ? 0.1570 0.1286 0.1780 -0.0166 -0.0339 -0.0780 319 VAL A CG2 
2461 N N   . GLY A 320 ? 0.1645 0.1535 0.1862 -0.0115 -0.0376 -0.0734 320 GLY A N   
2462 C CA  . GLY A 320 ? 0.1375 0.1342 0.1584 -0.0116 -0.0392 -0.0735 320 GLY A CA  
2463 C C   . GLY A 320 ? 0.3215 0.3187 0.3436 -0.0165 -0.0401 -0.0691 320 GLY A C   
2464 O O   . GLY A 320 ? 0.3044 0.2954 0.3279 -0.0186 -0.0392 -0.0665 320 GLY A O   
2465 N N   . VAL A 321 ? 0.2204 0.2248 0.2403 -0.0189 -0.0423 -0.0683 321 VAL A N   
2466 C CA  . VAL A 321 ? 0.2713 0.2763 0.2911 -0.0256 -0.0446 -0.0632 321 VAL A CA  
2467 C C   . VAL A 321 ? 0.2536 0.2727 0.2770 -0.0284 -0.0487 -0.0639 321 VAL A C   
2468 O O   . VAL A 321 ? 0.3472 0.3781 0.3731 -0.0229 -0.0489 -0.0708 321 VAL A O   
2469 C CB  . VAL A 321 ? 0.2616 0.2658 0.2802 -0.0268 -0.0463 -0.0625 321 VAL A CB  
2470 C CG1 . VAL A 321 ? 0.1365 0.1335 0.1594 -0.0229 -0.0441 -0.0644 321 VAL A CG1 
2471 C CG2 . VAL A 321 ? 0.1411 0.1545 0.1569 -0.0242 -0.0488 -0.0667 321 VAL A CG2 
2472 N N   . ASN A 322 ? 0.2121 0.2340 0.2388 -0.0363 -0.0522 -0.0588 322 ASN A N   
2473 C CA  . ASN A 322 ? 0.1399 0.1822 0.1768 -0.0408 -0.0573 -0.0584 322 ASN A CA  
2474 C C   . ASN A 322 ? 0.2809 0.3335 0.3185 -0.0438 -0.0614 -0.0581 322 ASN A C   
2475 O O   . ASN A 322 ? 0.2788 0.3179 0.3097 -0.0449 -0.0620 -0.0561 322 ASN A O   
2476 C CB  . ASN A 322 ? 0.1810 0.2212 0.2217 -0.0506 -0.0597 -0.0505 322 ASN A CB  
2477 C CG  . ASN A 322 ? 0.2978 0.3297 0.3356 -0.0482 -0.0569 -0.0510 322 ASN A CG  
2478 O OD1 . ASN A 322 ? 0.4105 0.4417 0.4476 -0.0394 -0.0544 -0.0569 322 ASN A OD1 
2479 N ND2 . ASN A 322 ? 0.2509 0.2780 0.2863 -0.0562 -0.0568 -0.0464 322 ASN A ND2 
2480 N N   . LYS A 323 ? 0.2352 0.3178 0.2810 -0.0454 -0.0626 -0.0604 323 LYS A N   
2481 C CA  . LYS A 323 ? 0.2053 0.3030 0.2455 -0.0480 -0.0637 -0.0579 323 LYS A CA  
2482 C C   . LYS A 323 ? 0.3108 0.3962 0.3512 -0.0583 -0.0690 -0.0465 323 LYS A C   
2483 O O   . LYS A 323 ? 0.4509 0.5308 0.4811 -0.0574 -0.0714 -0.0433 323 LYS A O   
2484 C CB  . LYS A 323 ? 0.2013 0.3282 0.2415 -0.0457 -0.0550 -0.0516 323 LYS A CB  
2485 C CG  . LYS A 323 ? 0.1956 0.3322 0.2235 -0.0475 -0.0519 -0.0418 323 LYS A CG  
2486 C CD  . LYS A 323 ? 0.3303 0.4987 0.3597 -0.0453 -0.0408 -0.0354 323 LYS A CD  
2487 C CE  . LYS A 323 ? 0.5052 0.6831 0.5229 -0.0516 -0.0372 -0.0213 323 LYS A CE  
2488 N NZ  . LYS A 323 ? 0.5942 0.8043 0.6087 -0.0467 -0.0239 -0.0170 323 LYS A NZ  
2489 N N   . ASP A 324 ? 0.1853 0.2641 0.2357 -0.0680 -0.0722 -0.0406 324 ASP A N   
2490 C CA  . ASP A 324 ? 0.2647 0.3270 0.3135 -0.0770 -0.0773 -0.0302 324 ASP A CA  
2491 C C   . ASP A 324 ? 0.2350 0.2710 0.2844 -0.0725 -0.0739 -0.0352 324 ASP A C   
2492 O O   . ASP A 324 ? 0.3004 0.3270 0.3519 -0.0793 -0.0750 -0.0281 324 ASP A O   
2493 C CB  . ASP A 324 ? 0.3049 0.3837 0.3586 -0.0895 -0.0759 -0.0143 324 ASP A CB  
2494 C CG  . ASP A 324 ? 0.3338 0.4401 0.3815 -0.0861 -0.0674 -0.0081 324 ASP A CG  
2495 O OD1 . ASP A 324 ? 0.3668 0.4681 0.4006 -0.0839 -0.0679 -0.0043 324 ASP A OD1 
2496 O OD2 . ASP A 324 ? 0.3655 0.4985 0.4219 -0.0851 -0.0601 -0.0071 324 ASP A OD2 
2497 N N   . GLU A 325 ? 0.2278 0.2541 0.2697 -0.0638 -0.0681 -0.0440 325 GLU A N   
2498 C CA  . GLU A 325 ? 0.2761 0.2818 0.3127 -0.0611 -0.0629 -0.0451 325 GLU A CA  
2499 C C   . GLU A 325 ? 0.3430 0.3305 0.3801 -0.0644 -0.0683 -0.0394 325 GLU A C   
2500 O O   . GLU A 325 ? 0.4119 0.3876 0.4473 -0.0657 -0.0660 -0.0386 325 GLU A O   
2501 C CB  . GLU A 325 ? 0.2951 0.2928 0.3239 -0.0530 -0.0584 -0.0489 325 GLU A CB  
2502 C CG  . GLU A 325 ? 0.3177 0.3207 0.3417 -0.0486 -0.0546 -0.0508 325 GLU A CG  
2503 C CD  . GLU A 325 ? 0.3317 0.3275 0.3515 -0.0482 -0.0494 -0.0500 325 GLU A CD  
2504 O OE1 . GLU A 325 ? 0.2731 0.2614 0.2939 -0.0511 -0.0487 -0.0494 325 GLU A OE1 
2505 O OE2 . GLU A 325 ? 0.3119 0.3088 0.3315 -0.0426 -0.0482 -0.0522 325 GLU A OE2 
2506 N N   . GLY A 326 ? 0.2858 0.2688 0.3223 -0.0663 -0.0766 -0.0345 326 GLY A N   
2507 C CA  . GLY A 326 ? 0.2908 0.2511 0.3239 -0.0689 -0.0833 -0.0281 326 GLY A CA  
2508 C C   . GLY A 326 ? 0.3756 0.3279 0.4075 -0.0808 -0.0887 -0.0166 326 GLY A C   
2509 O O   . GLY A 326 ? 0.4910 0.4207 0.5179 -0.0824 -0.0935 -0.0123 326 GLY A O   
2510 N N   . THR A 327 ? 0.2196 0.1909 0.2564 -0.0894 -0.0881 -0.0110 327 THR A N   
2511 C CA  . THR A 327 ? 0.3307 0.2986 0.3670 -0.1035 -0.0931 0.0031  327 THR A CA  
2512 C C   . THR A 327 ? 0.3905 0.3393 0.4243 -0.1037 -0.0924 0.0021  327 THR A C   
2513 O O   . THR A 327 ? 0.3524 0.2825 0.3801 -0.1110 -0.0987 0.0110  327 THR A O   
2514 C CB  . THR A 327 ? 0.2319 0.2310 0.2773 -0.1127 -0.0906 0.0098  327 THR A CB  
2515 O OG1 . THR A 327 ? 0.5557 0.5688 0.6087 -0.1039 -0.0837 -0.0018 327 THR A OG1 
2516 C CG2 . THR A 327 ? 0.2414 0.2607 0.2848 -0.1173 -0.0930 0.0159  327 THR A CG2 
2517 N N   . ALA A 328 ? 0.4761 0.4294 0.5127 -0.0958 -0.0852 -0.0087 328 ALA A N   
2518 C CA  . ALA A 328 ? 0.4331 0.3722 0.4659 -0.0955 -0.0841 -0.0112 328 ALA A CA  
2519 C C   . ALA A 328 ? 0.4405 0.3513 0.4631 -0.0938 -0.0883 -0.0103 328 ALA A C   
2520 O O   . ALA A 328 ? 0.4729 0.3691 0.4905 -0.0993 -0.0923 -0.0064 328 ALA A O   
2521 C CB  . ALA A 328 ? 0.4154 0.3619 0.4492 -0.0859 -0.0753 -0.0231 328 ALA A CB  
2522 N N   . PHE A 329 ? 0.3954 0.2984 0.4153 -0.0860 -0.0883 -0.0139 329 PHE A N   
2523 C CA  . PHE A 329 ? 0.4380 0.3155 0.4500 -0.0814 -0.0914 -0.0154 329 PHE A CA  
2524 C C   . PHE A 329 ? 0.4596 0.3183 0.4659 -0.0887 -0.1028 -0.0040 329 PHE A C   
2525 O O   . PHE A 329 ? 0.3715 0.2061 0.3702 -0.0864 -0.1068 -0.0040 329 PHE A O   
2526 C CB  . PHE A 329 ? 0.3793 0.2577 0.3928 -0.0691 -0.0862 -0.0249 329 PHE A CB  
2527 C CG  . PHE A 329 ? 0.4448 0.3394 0.4608 -0.0639 -0.0746 -0.0340 329 PHE A CG  
2528 C CD1 . PHE A 329 ? 0.2792 0.1959 0.3009 -0.0633 -0.0704 -0.0360 329 PHE A CD1 
2529 C CD2 . PHE A 329 ? 0.4689 0.3552 0.4796 -0.0606 -0.0680 -0.0399 329 PHE A CD2 
2530 C CE1 . PHE A 329 ? 0.2841 0.2121 0.3049 -0.0596 -0.0606 -0.0425 329 PHE A CE1 
2531 C CE2 . PHE A 329 ? 0.3921 0.2881 0.4025 -0.0573 -0.0615 -0.0451 329 PHE A CE2 
2532 C CZ  . PHE A 329 ? 0.3762 0.2919 0.3915 -0.0568 -0.0583 -0.0457 329 PHE A CZ  
2533 N N   . LEU A 330 ? 0.4532 0.3229 0.4622 -0.0982 -0.1077 0.0063  330 LEU A N   
2534 C CA  . LEU A 330 ? 0.4514 0.3033 0.4529 -0.1074 -0.1184 0.0199  330 LEU A CA  
2535 C C   . LEU A 330 ? 0.5085 0.3447 0.5034 -0.1172 -0.1224 0.0275  330 LEU A C   
2536 O O   . LEU A 330 ? 0.5726 0.3850 0.5581 -0.1211 -0.1307 0.0356  330 LEU A O   
2537 C CB  . LEU A 330 ? 0.4088 0.2793 0.4132 -0.1177 -0.1214 0.0309  330 LEU A CB  
2538 C CG  . LEU A 330 ? 0.4499 0.3380 0.4596 -0.1095 -0.1193 0.0232  330 LEU A CG  
2539 C CD1 . LEU A 330 ? 0.4488 0.3545 0.4572 -0.1221 -0.1237 0.0359  330 LEU A CD1 
2540 C CD2 . LEU A 330 ? 0.3885 0.2575 0.3960 -0.0954 -0.1233 0.0146  330 LEU A CD2 
2541 N N   . VAL A 331 ? 0.4839 0.3317 0.4831 -0.1210 -0.1176 0.0248  331 VAL A N   
2542 C CA  . VAL A 331 ? 0.5126 0.3460 0.5060 -0.1310 -0.1228 0.0313  331 VAL A CA  
2543 C C   . VAL A 331 ? 0.5376 0.3474 0.5223 -0.1231 -0.1226 0.0212  331 VAL A C   
2544 O O   . VAL A 331 ? 0.5682 0.3651 0.5472 -0.1307 -0.1273 0.0244  331 VAL A O   
2545 C CB  . VAL A 331 ? 0.4436 0.3008 0.4465 -0.1423 -0.1208 0.0366  331 VAL A CB  
2546 C CG1 . VAL A 331 ? 0.3736 0.2511 0.3828 -0.1546 -0.1220 0.0510  331 VAL A CG1 
2547 C CG2 . VAL A 331 ? 0.3848 0.2621 0.3966 -0.1333 -0.1121 0.0243  331 VAL A CG2 
2548 N N   . TYR A 332 ? 0.5410 0.3466 0.5250 -0.1087 -0.1172 0.0095  332 TYR A N   
2549 C CA  . TYR A 332 ? 0.5076 0.2919 0.4830 -0.1009 -0.1155 0.0003  332 TYR A CA  
2550 C C   . TYR A 332 ? 0.5775 0.3369 0.5457 -0.0937 -0.1203 0.0001  332 TYR A C   
2551 O O   . TYR A 332 ? 0.6324 0.3820 0.5981 -0.0824 -0.1154 -0.0101 332 TYR A O   
2552 C CB  . TYR A 332 ? 0.3667 0.1650 0.3467 -0.0903 -0.1042 -0.0128 332 TYR A CB  
2553 C CG  . TYR A 332 ? 0.4727 0.2902 0.4579 -0.0953 -0.1002 -0.0140 332 TYR A CG  
2554 C CD1 . TYR A 332 ? 0.4472 0.2911 0.4432 -0.0978 -0.0974 -0.0114 332 TYR A CD1 
2555 C CD2 . TYR A 332 ? 0.4204 0.2282 0.3990 -0.0974 -0.1007 -0.0177 332 TYR A CD2 
2556 C CE1 . TYR A 332 ? 0.4587 0.3194 0.4603 -0.1013 -0.0948 -0.0126 332 TYR A CE1 
2557 C CE2 . TYR A 332 ? 0.4506 0.2725 0.4326 -0.1021 -0.1013 -0.0172 332 TYR A CE2 
2558 C CZ  . TYR A 332 ? 0.4697 0.3192 0.4645 -0.1035 -0.0973 -0.0150 332 TYR A CZ  
2559 O OH  . TYR A 332 ? 0.4531 0.3168 0.4527 -0.1073 -0.0981 -0.0147 332 TYR A OH  
2560 N N   . GLY A 333 ? 0.6036 0.3531 0.5687 -0.1002 -0.1295 0.0118  333 GLY A N   
2561 C CA  . GLY A 333 ? 0.6491 0.3726 0.6071 -0.0925 -0.1355 0.0124  333 GLY A CA  
2562 C C   . GLY A 333 ? 0.7195 0.4369 0.6754 -0.0977 -0.1451 0.0257  333 GLY A C   
2563 O O   . GLY A 333 ? 0.8002 0.4903 0.7459 -0.0979 -0.1532 0.0316  333 GLY A O   
2564 N N   . ALA A 334 ? 0.6544 0.3959 0.6186 -0.1021 -0.1440 0.0307  334 ALA A N   
2565 C CA  . ALA A 334 ? 0.5434 0.2811 0.5045 -0.1077 -0.1525 0.0442  334 ALA A CA  
2566 C C   . ALA A 334 ? 0.5831 0.3091 0.5342 -0.1243 -0.1593 0.0610  334 ALA A C   
2567 O O   . ALA A 334 ? 0.5646 0.3078 0.5190 -0.1379 -0.1562 0.0669  334 ALA A O   
2568 C CB  . ALA A 334 ? 0.5437 0.3115 0.5148 -0.1101 -0.1487 0.0450  334 ALA A CB  
2569 N N   . PRO A 335 ? 0.6810 0.3790 0.6207 -0.1227 -0.1685 0.0692  335 PRO A N   
2570 C CA  . PRO A 335 ? 0.6392 0.3232 0.5677 -0.1381 -0.1750 0.0856  335 PRO A CA  
2571 C C   . PRO A 335 ? 0.5824 0.2925 0.5135 -0.1547 -0.1730 0.1012  335 PRO A C   
2572 O O   . PRO A 335 ? 0.5570 0.2820 0.4911 -0.1520 -0.1717 0.1039  335 PRO A O   
2573 C CB  . PRO A 335 ? 0.5889 0.2414 0.5058 -0.1285 -0.1842 0.0902  335 PRO A CB  
2574 C CG  . PRO A 335 ? 0.6291 0.2883 0.5539 -0.1115 -0.1834 0.0810  335 PRO A CG  
2575 C CD  . PRO A 335 ? 0.6715 0.3514 0.6095 -0.1055 -0.1732 0.0638  335 PRO A CD  
2576 N N   . GLY A 336 ? 0.6487 0.3649 0.5785 -0.1718 -0.1725 0.1115  336 GLY A N   
2577 C CA  . GLY A 336 ? 0.6318 0.3767 0.5653 -0.1885 -0.1683 0.1271  336 GLY A CA  
2578 C C   . GLY A 336 ? 0.6758 0.4598 0.6265 -0.1915 -0.1582 0.1209  336 GLY A C   
2579 O O   . GLY A 336 ? 0.6855 0.4990 0.6426 -0.2051 -0.1524 0.1324  336 GLY A O   
2580 N N   . PHE A 337 ? 0.7100 0.4957 0.6684 -0.1780 -0.1549 0.1026  337 PHE A N   
2581 C CA  . PHE A 337 ? 0.6955 0.5153 0.6695 -0.1778 -0.1456 0.0947  337 PHE A CA  
2582 C C   . PHE A 337 ? 0.6497 0.4721 0.6288 -0.1831 -0.1445 0.0911  337 PHE A C   
2583 O O   . PHE A 337 ? 0.6202 0.4155 0.5914 -0.1788 -0.1492 0.0848  337 PHE A O   
2584 C CB  . PHE A 337 ? 0.6488 0.4724 0.6281 -0.1600 -0.1414 0.0774  337 PHE A CB  
2585 C CG  . PHE A 337 ? 0.6621 0.4989 0.6427 -0.1582 -0.1408 0.0803  337 PHE A CG  
2586 C CD1 . PHE A 337 ? 0.5746 0.4486 0.5660 -0.1636 -0.1332 0.0816  337 PHE A CD1 
2587 C CD2 . PHE A 337 ? 0.6399 0.4525 0.6106 -0.1510 -0.1485 0.0821  337 PHE A CD2 
2588 C CE1 . PHE A 337 ? 0.5505 0.4378 0.5415 -0.1634 -0.1333 0.0838  337 PHE A CE1 
2589 C CE2 . PHE A 337 ? 0.6054 0.4286 0.5759 -0.1505 -0.1498 0.0854  337 PHE A CE2 
2590 C CZ  . PHE A 337 ? 0.5264 0.3927 0.5050 -0.1514 -0.1389 0.0840  337 PHE A CZ  
2591 N N   . SER A 338 ? 0.5407 0.3966 0.5333 -0.1921 -0.1384 0.0953  338 SER A N   
2592 C CA  . SER A 338 ? 0.4539 0.3162 0.4537 -0.1973 -0.1380 0.0925  338 SER A CA  
2593 C C   . SER A 338 ? 0.4648 0.3679 0.4829 -0.1986 -0.1293 0.0908  338 SER A C   
2594 O O   . SER A 338 ? 0.5766 0.5071 0.6021 -0.2032 -0.1238 0.0986  338 SER A O   
2595 C CB  . SER A 338 ? 0.5229 0.3751 0.5182 -0.2145 -0.1448 0.1072  338 SER A CB  
2596 O OG  . SER A 338 ? 0.5168 0.3830 0.5227 -0.2225 -0.1448 0.1071  338 SER A OG  
2597 N N   . LYS A 339 ? 0.4397 0.3473 0.4644 -0.1946 -0.1281 0.0809  339 LYS A N   
2598 C CA  . LYS A 339 ? 0.4819 0.4267 0.5248 -0.1956 -0.1211 0.0795  339 LYS A CA  
2599 C C   . LYS A 339 ? 0.5225 0.4903 0.5769 -0.2135 -0.1217 0.0955  339 LYS A C   
2600 O O   . LYS A 339 ? 0.4819 0.4864 0.5538 -0.2161 -0.1151 0.0981  339 LYS A O   
2601 C CB  . LYS A 339 ? 0.3897 0.3305 0.4349 -0.1861 -0.1206 0.0651  339 LYS A CB  
2602 C CG  . LYS A 339 ? 0.4102 0.3386 0.4538 -0.1957 -0.1281 0.0681  339 LYS A CG  
2603 C CD  . LYS A 339 ? 0.4839 0.4146 0.5309 -0.1880 -0.1273 0.0558  339 LYS A CD  
2604 C CE  . LYS A 339 ? 0.5570 0.4827 0.6057 -0.2006 -0.1358 0.0610  339 LYS A CE  
2605 N NZ  . LYS A 339 ? 0.5418 0.4967 0.6081 -0.2166 -0.1367 0.0757  339 LYS A NZ  
2606 N N   . ASP A 340 ? 0.5536 0.5005 0.5988 -0.2255 -0.1292 0.1060  340 ASP A N   
2607 C CA  . ASP A 340 ? 0.6096 0.5751 0.6655 -0.2435 -0.1306 0.1207  340 ASP A CA  
2608 C C   . ASP A 340 ? 0.6314 0.6142 0.6884 -0.2553 -0.1262 0.1382  340 ASP A C   
2609 O O   . ASP A 340 ? 0.5969 0.5996 0.6643 -0.2705 -0.1252 0.1514  340 ASP A O   
2610 C CB  . ASP A 340 ? 0.6258 0.5600 0.6722 -0.2519 -0.1418 0.1220  340 ASP A CB  
2611 C CG  . ASP A 340 ? 0.6184 0.5408 0.6640 -0.2427 -0.1451 0.1068  340 ASP A CG  
2612 O OD1 . ASP A 340 ? 0.5095 0.4592 0.5705 -0.2382 -0.1400 0.1010  340 ASP A OD1 
2613 O OD2 . ASP A 340 ? 0.6276 0.5132 0.6564 -0.2397 -0.1526 0.1008  340 ASP A OD2 
2614 N N   . ASN A 341 ? 0.6634 0.6387 0.7091 -0.2487 -0.1237 0.1387  341 ASN A N   
2615 C CA  . ASN A 341 ? 0.6174 0.6122 0.6617 -0.2581 -0.1175 0.1549  341 ASN A CA  
2616 C C   . ASN A 341 ? 0.5415 0.5496 0.5831 -0.2470 -0.1103 0.1504  341 ASN A C   
2617 O O   . ASN A 341 ? 0.4870 0.4859 0.5280 -0.2324 -0.1112 0.1344  341 ASN A O   
2618 C CB  . ASN A 341 ? 0.5877 0.5507 0.6141 -0.2691 -0.1255 0.1681  341 ASN A CB  
2619 C CG  . ASN A 341 ? 0.6334 0.5497 0.6390 -0.2578 -0.1349 0.1598  341 ASN A CG  
2620 O OD1 . ASN A 341 ? 0.6444 0.5571 0.6467 -0.2435 -0.1331 0.1492  341 ASN A OD1 
2621 N ND2 . ASN A 341 ? 0.7265 0.6073 0.7188 -0.2642 -0.1450 0.1646  341 ASN A ND2 
2622 N N   . ASN A 342 ? 0.5634 0.5936 0.6023 -0.2540 -0.1026 0.1644  342 ASN A N   
2623 C CA  . ASN A 342 ? 0.6016 0.6509 0.6387 -0.2450 -0.0947 0.1607  342 ASN A CA  
2624 C C   . ASN A 342 ? 0.5548 0.5668 0.5722 -0.2362 -0.1029 0.1555  342 ASN A C   
2625 O O   . ASN A 342 ? 0.4735 0.4976 0.4881 -0.2296 -0.0984 0.1520  342 ASN A O   
2626 C CB  . ASN A 342 ? 0.6889 0.7804 0.7283 -0.2531 -0.0805 0.1763  342 ASN A CB  
2627 C CG  . ASN A 342 ? 0.8334 0.9080 0.8530 -0.2647 -0.0822 0.1951  342 ASN A CG  
2628 O OD1 . ASN A 342 ? 0.8585 0.8883 0.8616 -0.2653 -0.0948 0.1963  342 ASN A OD1 
2629 N ND2 . ASN A 342 ? 0.8926 1.0030 0.9130 -0.2721 -0.0687 0.2092  342 ASN A ND2 
2630 N N   . SER A 343 ? 0.5484 0.5163 0.5531 -0.2356 -0.1150 0.1545  343 SER A N   
2631 C CA  . SER A 343 ? 0.5447 0.4755 0.5346 -0.2236 -0.1237 0.1464  343 SER A CA  
2632 C C   . SER A 343 ? 0.5760 0.5042 0.5501 -0.2241 -0.1231 0.1577  343 SER A C   
2633 O O   . SER A 343 ? 0.5836 0.4985 0.5517 -0.2101 -0.1266 0.1476  343 SER A O   
2634 C CB  . SER A 343 ? 0.4923 0.4240 0.4918 -0.2076 -0.1230 0.1246  343 SER A CB  
2635 O OG  . SER A 343 ? 0.4380 0.3633 0.4452 -0.2047 -0.1243 0.1147  343 SER A OG  
2636 N N   . ILE A 344 ? 0.5582 0.5007 0.5239 -0.2365 -0.1177 0.1771  344 ILE A N   
2637 C CA  . ILE A 344 ? 0.5558 0.4902 0.4984 -0.2339 -0.1176 0.1892  344 ILE A CA  
2638 C C   . ILE A 344 ? 0.5693 0.4509 0.4951 -0.2274 -0.1333 0.1894  344 ILE A C   
2639 O O   . ILE A 344 ? 0.6779 0.5371 0.5983 -0.2338 -0.1396 0.1956  344 ILE A O   
2640 C CB  . ILE A 344 ? 0.6229 0.5797 0.5562 -0.2481 -0.1082 0.2104  344 ILE A CB  
2641 C CG1 . ILE A 344 ? 0.5624 0.5750 0.5143 -0.2533 -0.0911 0.2108  344 ILE A CG1 
2642 C CG2 . ILE A 344 ? 0.5576 0.5039 0.4616 -0.2408 -0.1088 0.2205  344 ILE A CG2 
2643 C CD1 . ILE A 344 ? 0.5016 0.5424 0.4530 -0.2317 -0.0815 0.1942  344 ILE A CD1 
2644 N N   . ILE A 345 ? 0.5503 0.4192 0.4706 -0.2065 -0.1380 0.1754  345 ILE A N   
2645 C CA  . ILE A 345 ? 0.5665 0.3873 0.4736 -0.1983 -0.1528 0.1756  345 ILE A CA  
2646 C C   . ILE A 345 ? 0.6719 0.4881 0.5571 -0.1882 -0.1558 0.1843  345 ILE A C   
2647 O O   . ILE A 345 ? 0.7372 0.5876 0.6171 -0.1841 -0.1461 0.1854  345 ILE A O   
2648 C CB  . ILE A 345 ? 0.5464 0.3534 0.4659 -0.1805 -0.1576 0.1522  345 ILE A CB  
2649 C CG1 . ILE A 345 ? 0.4843 0.3263 0.4113 -0.1623 -0.1492 0.1359  345 ILE A CG1 
2650 C CG2 . ILE A 345 ? 0.5108 0.3158 0.4463 -0.1882 -0.1567 0.1427  345 ILE A CG2 
2651 C CD1 . ILE A 345 ? 0.4670 0.2935 0.4016 -0.1423 -0.1548 0.1161  345 ILE A CD1 
2652 N N   . THR A 346 ? 0.6623 0.4346 0.5338 -0.1833 -0.1700 0.1903  346 THR A N   
2653 C CA  . THR A 346 ? 0.6310 0.3929 0.4804 -0.1733 -0.1765 0.1999  346 THR A CA  
2654 C C   . THR A 346 ? 0.6772 0.4356 0.5321 -0.1474 -0.1831 0.1817  346 THR A C   
2655 O O   . THR A 346 ? 0.6233 0.3837 0.4981 -0.1378 -0.1822 0.1622  346 THR A O   
2656 C CB  . THR A 346 ? 0.7166 0.4418 0.5524 -0.1785 -0.1859 0.2119  346 THR A CB  
2657 O OG1 . THR A 346 ? 0.6978 0.3908 0.5440 -0.1685 -0.1949 0.1977  346 THR A OG1 
2658 C CG2 . THR A 346 ? 0.6910 0.4285 0.5270 -0.2010 -0.1774 0.2243  346 THR A CG2 
2659 N N   . ARG A 347 ? 0.7537 0.5073 0.5907 -0.1369 -0.1902 0.1887  347 ARG A N   
2660 C CA  . ARG A 347 ? 0.6236 0.3750 0.4669 -0.1135 -0.1985 0.1740  347 ARG A CA  
2661 C C   . ARG A 347 ? 0.6737 0.3872 0.5287 -0.1037 -0.2093 0.1660  347 ARG A C   
2662 O O   . ARG A 347 ? 0.6987 0.4184 0.5725 -0.0876 -0.2098 0.1468  347 ARG A O   
2663 C CB  . ARG A 347 ? 0.6444 0.3924 0.4636 -0.1064 -0.2073 0.1867  347 ARG A CB  
2664 C CG  . ARG A 347 ? 0.6356 0.3830 0.4620 -0.0829 -0.2183 0.1739  347 ARG A CG  
2665 C CD  . ARG A 347 ? 0.7310 0.4875 0.5323 -0.0787 -0.2244 0.1849  347 ARG A CD  
2666 N NE  . ARG A 347 ? 0.8357 0.5886 0.6426 -0.0577 -0.2389 0.1768  347 ARG A NE  
2667 C CZ  . ARG A 347 ? 0.7985 0.5810 0.6198 -0.0457 -0.2374 0.1587  347 ARG A CZ  
2668 N NH1 . ARG A 347 ? 0.6674 0.4825 0.4974 -0.0514 -0.2218 0.1461  347 ARG A NH1 
2669 N NH2 . ARG A 347 ? 0.7196 0.4988 0.5477 -0.0281 -0.2522 0.1536  347 ARG A NH2 
2670 N N   . LYS A 348 ? 0.6604 0.3364 0.5046 -0.1136 -0.2163 0.1793  348 LYS A N   
2671 C CA  . LYS A 348 ? 0.8154 0.4608 0.6704 -0.1029 -0.2222 0.1670  348 LYS A CA  
2672 C C   . LYS A 348 ? 0.7571 0.4060 0.6312 -0.1064 -0.2149 0.1507  348 LYS A C   
2673 O O   . LYS A 348 ? 0.7362 0.3725 0.6230 -0.0914 -0.2169 0.1342  348 LYS A O   
2674 C CB  . LYS A 348 ? 0.9634 0.5800 0.8039 -0.1110 -0.2266 0.1785  348 LYS A CB  
2675 C CG  . LYS A 348 ? 1.0599 0.6436 0.9057 -0.0968 -0.2336 0.1674  348 LYS A CG  
2676 C CD  . LYS A 348 ? 1.1689 0.7227 0.9962 -0.1020 -0.2405 0.1812  348 LYS A CD  
2677 C CE  . LYS A 348 ? 1.1655 0.7204 0.9769 -0.0964 -0.2472 0.1957  348 LYS A CE  
2678 N NZ  . LYS A 348 ? 1.1263 0.6514 0.9182 -0.1035 -0.2534 0.2107  348 LYS A NZ  
2679 N N   . GLU A 349 ? 0.7275 0.3969 0.6043 -0.1255 -0.2052 0.1546  349 GLU A N   
2680 C CA  . GLU A 349 ? 0.7106 0.3881 0.6052 -0.1286 -0.1979 0.1383  349 GLU A CA  
2681 C C   . GLU A 349 ? 0.7146 0.4161 0.6252 -0.1153 -0.1929 0.1215  349 GLU A C   
2682 O O   . GLU A 349 ? 0.7408 0.4378 0.6651 -0.1089 -0.1906 0.1046  349 GLU A O   
2683 C CB  . GLU A 349 ? 0.7332 0.4308 0.6293 -0.1513 -0.1891 0.1462  349 GLU A CB  
2684 C CG  . GLU A 349 ? 0.7763 0.4524 0.6624 -0.1618 -0.1928 0.1553  349 GLU A CG  
2685 C CD  . GLU A 349 ? 0.7996 0.4994 0.6876 -0.1842 -0.1852 0.1670  349 GLU A CD  
2686 O OE1 . GLU A 349 ? 0.8529 0.5813 0.7394 -0.1930 -0.1783 0.1785  349 GLU A OE1 
2687 O OE2 . GLU A 349 ? 0.7197 0.4105 0.6103 -0.1923 -0.1858 0.1650  349 GLU A OE2 
2688 N N   . PHE A 350 ? 0.6821 0.4160 0.5908 -0.1089 -0.1888 0.1227  350 PHE A N   
2689 C CA  . PHE A 350 ? 0.6447 0.4092 0.5689 -0.0938 -0.1827 0.1038  350 PHE A CA  
2690 C C   . PHE A 350 ? 0.7000 0.4453 0.6325 -0.0733 -0.1912 0.0925  350 PHE A C   
2691 O O   . PHE A 350 ? 0.7276 0.4806 0.6774 -0.0639 -0.1867 0.0744  350 PHE A O   
2692 C CB  . PHE A 350 ? 0.6189 0.4166 0.5345 -0.0922 -0.1785 0.1087  350 PHE A CB  
2693 C CG  . PHE A 350 ? 0.6130 0.4404 0.5423 -0.0784 -0.1735 0.0901  350 PHE A CG  
2694 C CD1 . PHE A 350 ? 0.6356 0.4597 0.5694 -0.0607 -0.1821 0.0827  350 PHE A CD1 
2695 C CD2 . PHE A 350 ? 0.5264 0.3853 0.4647 -0.0833 -0.1608 0.0806  350 PHE A CD2 
2696 C CE1 . PHE A 350 ? 0.5891 0.4399 0.5357 -0.0503 -0.1782 0.0664  350 PHE A CE1 
2697 C CE2 . PHE A 350 ? 0.4891 0.3716 0.4378 -0.0716 -0.1570 0.0641  350 PHE A CE2 
2698 C CZ  . PHE A 350 ? 0.5341 0.4124 0.4868 -0.0562 -0.1656 0.0571  350 PHE A CZ  
2699 N N   . GLN A 351 ? 0.6319 0.3531 0.5524 -0.0660 -0.2033 0.1037  351 GLN A N   
2700 C CA  . GLN A 351 ? 0.5993 0.3043 0.5300 -0.0452 -0.2119 0.0944  351 GLN A CA  
2701 C C   . GLN A 351 ? 0.6689 0.3448 0.6087 -0.0422 -0.2112 0.0835  351 GLN A C   
2702 O O   . GLN A 351 ? 0.5627 0.2449 0.5204 -0.0276 -0.2081 0.0663  351 GLN A O   
2703 C CB  . GLN A 351 ? 0.5936 0.2755 0.5084 -0.0381 -0.2265 0.1104  351 GLN A CB  
2704 C CG  . GLN A 351 ? 0.5773 0.2886 0.4830 -0.0363 -0.2284 0.1173  351 GLN A CG  
2705 C CD  . GLN A 351 ? 0.6226 0.3098 0.5075 -0.0321 -0.2436 0.1361  351 GLN A CD  
2706 O OE1 . GLN A 351 ? 0.6582 0.3139 0.5300 -0.0396 -0.2469 0.1476  351 GLN A OE1 
2707 N NE2 . GLN A 351 ? 0.8992 0.6060 0.7820 -0.0209 -0.2504 0.1363  351 GLN A NE2 
2708 N N   . GLU A 352 ? 0.7164 0.3663 0.6435 -0.0566 -0.2119 0.0921  352 GLU A N   
2709 C CA  . GLU A 352 ? 0.7450 0.3828 0.6775 -0.0546 -0.2056 0.0781  352 GLU A CA  
2710 C C   . GLU A 352 ? 0.6705 0.3315 0.6177 -0.0563 -0.1944 0.0623  352 GLU A C   
2711 O O   . GLU A 352 ? 0.7369 0.3969 0.6930 -0.0455 -0.1881 0.0464  352 GLU A O   
2712 C CB  . GLU A 352 ? 0.8795 0.5004 0.7968 -0.0715 -0.2055 0.0884  352 GLU A CB  
2713 C CG  . GLU A 352 ? 1.0592 0.6495 0.9622 -0.0671 -0.2151 0.0987  352 GLU A CG  
2714 C CD  . GLU A 352 ? 1.1801 0.7540 1.0899 -0.0438 -0.2177 0.0861  352 GLU A CD  
2715 O OE1 . GLU A 352 ? 1.2146 0.7844 1.1308 -0.0381 -0.2107 0.0712  352 GLU A OE1 
2716 O OE2 . GLU A 352 ? 1.1942 0.7618 1.1030 -0.0308 -0.2261 0.0916  352 GLU A OE2 
2717 N N   . GLY A 353 ? 0.5190 0.2024 0.4678 -0.0700 -0.1907 0.0672  353 GLY A N   
2718 C CA  . GLY A 353 ? 0.5238 0.2329 0.4864 -0.0720 -0.1798 0.0523  353 GLY A CA  
2719 C C   . GLY A 353 ? 0.5696 0.2921 0.5483 -0.0537 -0.1769 0.0353  353 GLY A C   
2720 O O   . GLY A 353 ? 0.5686 0.3040 0.5573 -0.0499 -0.1669 0.0202  353 GLY A O   
2721 N N   . LEU A 354 ? 0.5575 0.2895 0.5390 -0.0405 -0.1818 0.0375  354 LEU A N   
2722 C CA  . LEU A 354 ? 0.5492 0.2992 0.5490 -0.0233 -0.1788 0.0219  354 LEU A CA  
2723 C C   . LEU A 354 ? 0.5665 0.2875 0.5730 -0.0103 -0.1806 0.0123  354 LEU A C   
2724 O O   . LEU A 354 ? 0.4985 0.2322 0.5199 -0.0019 -0.1723 -0.0035 354 LEU A O   
2725 C CB  . LEU A 354 ? 0.4234 0.1924 0.4255 -0.0133 -0.1855 0.0269  354 LEU A CB  
2726 C CG  . LEU A 354 ? 0.4080 0.2080 0.4023 -0.0235 -0.1820 0.0328  354 LEU A CG  
2727 C CD1 . LEU A 354 ? 0.4148 0.2296 0.4078 -0.0135 -0.1906 0.0372  354 LEU A CD1 
2728 C CD2 . LEU A 354 ? 0.5042 0.3315 0.5097 -0.0277 -0.1695 0.0186  354 LEU A CD2 
2729 N N   . LYS A 355 ? 0.5761 0.2678 0.5703 -0.0084 -0.1872 0.0212  355 LYS A N   
2730 C CA  . LYS A 355 ? 0.6174 0.2964 0.6145 0.0042  -0.1820 0.0113  355 LYS A CA  
2731 C C   . LYS A 355 ? 0.6074 0.2938 0.6042 -0.0017 -0.1672 -0.0006 355 LYS A C   
2732 O O   . LYS A 355 ? 0.5436 0.2349 0.5494 0.0099  -0.1580 -0.0137 355 LYS A O   
2733 C CB  . LYS A 355 ? 0.5762 0.2236 0.5568 0.0042  -0.1897 0.0224  355 LYS A CB  
2734 C CG  . LYS A 355 ? 0.6582 0.2976 0.6381 0.0145  -0.2031 0.0334  355 LYS A CG  
2735 C CD  . LYS A 355 ? 0.9017 0.5097 0.8700 0.0211  -0.2073 0.0376  355 LYS A CD  
2736 C CE  . LYS A 355 ? 1.0218 0.6197 0.9835 0.0273  -0.2211 0.0523  355 LYS A CE  
2737 N NZ  . LYS A 355 ? 1.0506 0.6422 0.9922 0.0075  -0.2271 0.0708  355 LYS A NZ  
2738 N N   . ILE A 356 ? 0.5475 0.2368 0.5337 -0.0195 -0.1644 0.0053  356 ILE A N   
2739 C CA  . ILE A 356 ? 0.5610 0.2611 0.5462 -0.0255 -0.1513 -0.0036 356 ILE A CA  
2740 C C   . ILE A 356 ? 0.5716 0.3010 0.5719 -0.0200 -0.1412 -0.0160 356 ILE A C   
2741 O O   . ILE A 356 ? 0.6810 0.4147 0.6841 -0.0136 -0.1301 -0.0271 356 ILE A O   
2742 C CB  . ILE A 356 ? 0.5630 0.2688 0.5393 -0.0448 -0.1511 0.0058  356 ILE A CB  
2743 C CG1 . ILE A 356 ? 0.6439 0.3227 0.6049 -0.0539 -0.1608 0.0197  356 ILE A CG1 
2744 C CG2 . ILE A 356 ? 0.4805 0.1994 0.4573 -0.0485 -0.1384 -0.0034 356 ILE A CG2 
2745 C CD1 . ILE A 356 ? 0.5192 0.1725 0.4704 -0.0502 -0.1593 0.0151  356 ILE A CD1 
2746 N N   . PHE A 357 ? 0.4951 0.2439 0.5034 -0.0233 -0.1447 -0.0136 357 PHE A N   
2747 C CA  . PHE A 357 ? 0.3575 0.1352 0.3790 -0.0197 -0.1351 -0.0248 357 PHE A CA  
2748 C C   . PHE A 357 ? 0.3853 0.1698 0.4236 -0.0036 -0.1359 -0.0346 357 PHE A C   
2749 O O   . PHE A 357 ? 0.3378 0.1431 0.3862 0.0002  -0.1253 -0.0449 357 PHE A O   
2750 C CB  . PHE A 357 ? 0.3517 0.1501 0.3739 -0.0310 -0.1365 -0.0200 357 PHE A CB  
2751 C CG  . PHE A 357 ? 0.3771 0.1831 0.3907 -0.0444 -0.1288 -0.0156 357 PHE A CG  
2752 C CD1 . PHE A 357 ? 0.3513 0.1743 0.3674 -0.0436 -0.1146 -0.0243 357 PHE A CD1 
2753 C CD2 . PHE A 357 ? 0.4829 0.2789 0.4864 -0.0578 -0.1360 -0.0018 357 PHE A CD2 
2754 C CE1 . PHE A 357 ? 0.4704 0.3002 0.4810 -0.0540 -0.1092 -0.0207 357 PHE A CE1 
2755 C CE2 . PHE A 357 ? 0.5208 0.3264 0.5203 -0.0694 -0.1297 0.0019  357 PHE A CE2 
2756 C CZ  . PHE A 357 ? 0.5106 0.3329 0.5145 -0.0666 -0.1170 -0.0081 357 PHE A CZ  
2757 N N   . PHE A 358 ? 0.4331 0.2012 0.4751 0.0064  -0.1481 -0.0304 358 PHE A N   
2758 C CA  . PHE A 358 ? 0.4999 0.2781 0.5622 0.0233  -0.1493 -0.0393 358 PHE A CA  
2759 C C   . PHE A 358 ? 0.6119 0.3695 0.6744 0.0373  -0.1523 -0.0382 358 PHE A C   
2760 O O   . PHE A 358 ? 0.6459 0.4009 0.7172 0.0489  -0.1637 -0.0333 358 PHE A O   
2761 C CB  . PHE A 358 ? 0.3546 0.1525 0.4265 0.0255  -0.1590 -0.0351 358 PHE A CB  
2762 C CG  . PHE A 358 ? 0.4879 0.3143 0.5581 0.0128  -0.1528 -0.0370 358 PHE A CG  
2763 C CD1 . PHE A 358 ? 0.4727 0.2982 0.5255 -0.0020 -0.1539 -0.0266 358 PHE A CD1 
2764 C CD2 . PHE A 358 ? 0.4679 0.3220 0.5544 0.0160  -0.1456 -0.0492 358 PHE A CD2 
2765 C CE1 . PHE A 358 ? 0.3755 0.2272 0.4272 -0.0112 -0.1477 -0.0291 358 PHE A CE1 
2766 C CE2 . PHE A 358 ? 0.3885 0.2650 0.4718 0.0058  -0.1406 -0.0514 358 PHE A CE2 
2767 C CZ  . PHE A 358 ? 0.3702 0.2456 0.4361 -0.0067 -0.1416 -0.0418 358 PHE A CZ  
2768 N N   . PRO A 359 ? 0.6393 0.3839 0.6917 0.0372  -0.1416 -0.0426 359 PRO A N   
2769 C CA  . PRO A 359 ? 0.6680 0.3871 0.7143 0.0481  -0.1435 -0.0410 359 PRO A CA  
2770 C C   . PRO A 359 ? 0.7009 0.4306 0.7690 0.0681  -0.1435 -0.0475 359 PRO A C   
2771 O O   . PRO A 359 ? 0.7625 0.4775 0.8312 0.0792  -0.1523 -0.0418 359 PRO A O   
2772 C CB  . PRO A 359 ? 0.6700 0.3784 0.7025 0.0432  -0.1294 -0.0476 359 PRO A CB  
2773 C CG  . PRO A 359 ? 0.6664 0.3940 0.6955 0.0281  -0.1219 -0.0493 359 PRO A CG  
2774 C CD  . PRO A 359 ? 0.6159 0.3710 0.6632 0.0294  -0.1259 -0.0506 359 PRO A CD  
2775 N N   . GLY A 360 ? 0.6915 0.4482 0.7778 0.0721  -0.1334 -0.0587 360 GLY A N   
2776 C CA  . GLY A 360 ? 0.7105 0.4828 0.8206 0.0900  -0.1304 -0.0657 360 GLY A CA  
2777 C C   . GLY A 360 ? 0.7353 0.5327 0.8697 0.0973  -0.1424 -0.0632 360 GLY A C   
2778 O O   . GLY A 360 ? 0.7237 0.5403 0.8818 0.1115  -0.1404 -0.0680 360 GLY A O   
2779 N N   . VAL A 361 ? 0.6992 0.4982 0.8279 0.0877  -0.1545 -0.0549 361 VAL A N   
2780 C CA  . VAL A 361 ? 0.6572 0.4811 0.8057 0.0942  -0.1668 -0.0515 361 VAL A CA  
2781 C C   . VAL A 361 ? 0.6166 0.4272 0.7593 0.1026  -0.1821 -0.0381 361 VAL A C   
2782 O O   . VAL A 361 ? 0.5602 0.3382 0.6797 0.0992  -0.1858 -0.0294 361 VAL A O   
2783 C CB  . VAL A 361 ? 0.4491 0.2912 0.5930 0.0793  -0.1693 -0.0497 361 VAL A CB  
2784 C CG1 . VAL A 361 ? 0.3341 0.1778 0.4719 0.0667  -0.1542 -0.0599 361 VAL A CG1 
2785 C CG2 . VAL A 361 ? 0.4779 0.3053 0.5965 0.0692  -0.1804 -0.0338 361 VAL A CG2 
2786 N N   . SER A 362 ? 0.5118 0.3491 0.6744 0.1119  -0.1908 -0.0362 362 SER A N   
2787 C CA  . SER A 362 ? 0.5008 0.3291 0.6586 0.1207  -0.2044 -0.0240 362 SER A CA  
2788 C C   . SER A 362 ? 0.4771 0.2842 0.6059 0.1101  -0.2178 -0.0077 362 SER A C   
2789 O O   . SER A 362 ? 0.5042 0.3108 0.6194 0.0961  -0.2182 -0.0047 362 SER A O   
2790 C CB  . SER A 362 ? 0.5154 0.3816 0.6998 0.1297  -0.2100 -0.0257 362 SER A CB  
2791 O OG  . SER A 362 ? 0.4026 0.2947 0.5889 0.1186  -0.2136 -0.0264 362 SER A OG  
2792 N N   . GLU A 363 ? 0.5318 0.3227 0.6510 0.1172  -0.2283 0.0037  363 GLU A N   
2793 C CA  . GLU A 363 ? 0.6052 0.3791 0.6965 0.1072  -0.2406 0.0208  363 GLU A CA  
2794 C C   . GLU A 363 ? 0.5930 0.3985 0.6844 0.0995  -0.2467 0.0236  363 GLU A C   
2795 O O   . GLU A 363 ? 0.5729 0.3729 0.6415 0.0849  -0.2491 0.0325  363 GLU A O   
2796 C CB  . GLU A 363 ? 0.5887 0.3437 0.6727 0.1181  -0.2508 0.0315  363 GLU A CB  
2797 C CG  . GLU A 363 ? 0.7672 0.4988 0.8186 0.1070  -0.2616 0.0503  363 GLU A CG  
2798 C CD  . GLU A 363 ? 1.0534 0.7589 1.0808 0.0887  -0.2559 0.0552  363 GLU A CD  
2799 O OE1 . GLU A 363 ? 1.1045 0.7931 1.1341 0.0881  -0.2458 0.0463  363 GLU A OE1 
2800 O OE2 . GLU A 363 ? 1.1433 0.8473 1.1487 0.0742  -0.2606 0.0681  363 GLU A OE2 
2801 N N   . PHE A 364 ? 0.5210 0.3610 0.6375 0.1080  -0.2475 0.0156  364 PHE A N   
2802 C CA  . PHE A 364 ? 0.4560 0.3276 0.5722 0.1007  -0.2519 0.0156  364 PHE A CA  
2803 C C   . PHE A 364 ? 0.4681 0.3546 0.5844 0.0881  -0.2426 0.0066  364 PHE A C   
2804 O O   . PHE A 364 ? 0.4740 0.3734 0.5739 0.0767  -0.2446 0.0099  364 PHE A O   
2805 C CB  . PHE A 364 ? 0.4861 0.3892 0.6308 0.1116  -0.2538 0.0086  364 PHE A CB  
2806 C CG  . PHE A 364 ? 0.4287 0.3648 0.5759 0.1027  -0.2545 0.0042  364 PHE A CG  
2807 C CD1 . PHE A 364 ? 0.4845 0.4237 0.6095 0.0975  -0.2650 0.0145  364 PHE A CD1 
2808 C CD2 . PHE A 364 ? 0.6439 0.6059 0.8131 0.0992  -0.2435 -0.0104 364 PHE A CD2 
2809 C CE1 . PHE A 364 ? 0.4311 0.3974 0.5548 0.0893  -0.2644 0.0095  364 PHE A CE1 
2810 C CE2 . PHE A 364 ? 0.3798 0.3681 0.5480 0.0900  -0.2429 -0.0146 364 PHE A CE2 
2811 C CZ  . PHE A 364 ? 0.3983 0.3881 0.5433 0.0853  -0.2533 -0.0051 364 PHE A CZ  
2812 N N   . GLY A 365 ? 0.5081 0.3927 0.6412 0.0905  -0.2311 -0.0053 365 GLY A N   
2813 C CA  . GLY A 365 ? 0.4794 0.3772 0.6099 0.0764  -0.2168 -0.0151 365 GLY A CA  
2814 C C   . GLY A 365 ? 0.4609 0.3397 0.5592 0.0601  -0.2125 -0.0063 365 GLY A C   
2815 O O   . GLY A 365 ? 0.4252 0.3206 0.5119 0.0478  -0.2084 -0.0071 365 GLY A O   
2816 N N   . LYS A 366 ? 0.4399 0.2840 0.5240 0.0598  -0.2135 0.0019  366 LYS A N   
2817 C CA  . LYS A 366 ? 0.4627 0.2895 0.5187 0.0431  -0.2103 0.0121  366 LYS A CA  
2818 C C   . LYS A 366 ? 0.4233 0.2589 0.4593 0.0369  -0.2195 0.0258  366 LYS A C   
2819 O O   . LYS A 366 ? 0.7243 0.5645 0.7417 0.0221  -0.2137 0.0311  366 LYS A O   
2820 C CB  . LYS A 366 ? 0.4430 0.2277 0.4868 0.0435  -0.2130 0.0201  366 LYS A CB  
2821 C CG  . LYS A 366 ? 0.5683 0.3362 0.6244 0.0496  -0.2041 0.0072  366 LYS A CG  
2822 C CD  . LYS A 366 ? 0.7029 0.4243 0.7411 0.0484  -0.2093 0.0162  366 LYS A CD  
2823 C CE  . LYS A 366 ? 0.6871 0.3983 0.7346 0.0584  -0.1990 0.0025  366 LYS A CE  
2824 N NZ  . LYS A 366 ? 0.6276 0.3512 0.6959 0.0791  -0.2016 -0.0028 366 LYS A NZ  
2825 N N   . GLU A 367 ? 0.4511 0.2900 0.4907 0.0488  -0.2339 0.0315  367 GLU A N   
2826 C CA  . GLU A 367 ? 0.5015 0.3444 0.5173 0.0436  -0.2439 0.0455  367 GLU A CA  
2827 C C   . GLU A 367 ? 0.4914 0.3693 0.5072 0.0377  -0.2397 0.0372  367 GLU A C   
2828 O O   . GLU A 367 ? 0.4960 0.3791 0.4869 0.0266  -0.2381 0.0447  367 GLU A O   
2829 C CB  . GLU A 367 ? 0.4923 0.3242 0.5080 0.0576  -0.2617 0.0556  367 GLU A CB  
2830 C CG  . GLU A 367 ? 1.1892 1.0213 1.1746 0.0502  -0.2686 0.0705  367 GLU A CG  
2831 C CD  . GLU A 367 ? 1.2362 1.0389 1.2071 0.0551  -0.2779 0.0857  367 GLU A CD  
2832 O OE1 . GLU A 367 ? 1.2359 1.0383 1.2245 0.0701  -0.2842 0.0824  367 GLU A OE1 
2833 O OE2 . GLU A 367 ? 1.2476 1.0288 1.1896 0.0433  -0.2782 0.1011  367 GLU A OE2 
2834 N N   . SER A 368 ? 0.4704 0.3714 0.5135 0.0447  -0.2371 0.0214  368 SER A N   
2835 C CA  . SER A 368 ? 0.4193 0.3501 0.4633 0.0394  -0.2341 0.0119  368 SER A CA  
2836 C C   . SER A 368 ? 0.4484 0.3824 0.4781 0.0248  -0.2181 0.0082  368 SER A C   
2837 O O   . SER A 368 ? 0.4937 0.4424 0.5070 0.0178  -0.2164 0.0077  368 SER A O   
2838 C CB  . SER A 368 ? 0.3892 0.3414 0.4661 0.0469  -0.2294 -0.0040 368 SER A CB  
2839 O OG  . SER A 368 ? 0.4237 0.3765 0.5159 0.0443  -0.2173 -0.0154 368 SER A OG  
2840 N N   . ILE A 369 ? 0.4603 0.3803 0.4957 0.0209  -0.2068 0.0054  369 ILE A N   
2841 C CA  . ILE A 369 ? 0.4498 0.3719 0.4729 0.0074  -0.1932 0.0041  369 ILE A CA  
2842 C C   . ILE A 369 ? 0.4823 0.3974 0.4761 -0.0019 -0.1950 0.0204  369 ILE A C   
2843 O O   . ILE A 369 ? 0.3592 0.2896 0.3391 -0.0102 -0.1878 0.0203  369 ILE A O   
2844 C CB  . ILE A 369 ? 0.3812 0.2856 0.4134 0.0045  -0.1836 0.0000  369 ILE A CB  
2845 C CG1 . ILE A 369 ? 0.3570 0.2672 0.4162 0.0140  -0.1801 -0.0153 369 ILE A CG1 
2846 C CG2 . ILE A 369 ? 0.3209 0.2307 0.3431 -0.0092 -0.1713 -0.0010 369 ILE A CG2 
2847 C CD1 . ILE A 369 ? 0.3131 0.2035 0.3777 0.0125  -0.1713 -0.0204 369 ILE A CD1 
2848 N N   . LEU A 370 ? 0.4553 0.3465 0.4392 -0.0001 -0.2041 0.0348  370 LEU A N   
2849 C CA  . LEU A 370 ? 0.4680 0.3502 0.4238 -0.0103 -0.2054 0.0522  370 LEU A CA  
2850 C C   . LEU A 370 ? 0.4300 0.3325 0.3684 -0.0099 -0.2096 0.0547  370 LEU A C   
2851 O O   . LEU A 370 ? 0.5497 0.4620 0.4683 -0.0200 -0.2017 0.0601  370 LEU A O   
2852 C CB  . LEU A 370 ? 0.5887 0.4383 0.5361 -0.0074 -0.2168 0.0675  370 LEU A CB  
2853 C CG  . LEU A 370 ? 0.4955 0.3322 0.4117 -0.0178 -0.2205 0.0887  370 LEU A CG  
2854 C CD1 . LEU A 370 ? 0.6079 0.4090 0.5194 -0.0232 -0.2231 0.1004  370 LEU A CD1 
2855 C CD2 . LEU A 370 ? 0.5213 0.3585 0.4233 -0.0088 -0.2357 0.0971  370 LEU A CD2 
2856 N N   . PHE A 371 ? 0.5817 0.4911 0.5279 0.0020  -0.2220 0.0499  371 PHE A N   
2857 C CA  . PHE A 371 ? 0.5613 0.4862 0.4887 0.0033  -0.2296 0.0518  371 PHE A CA  
2858 C C   . PHE A 371 ? 0.5499 0.4992 0.4732 -0.0024 -0.2179 0.0391  371 PHE A C   
2859 O O   . PHE A 371 ? 0.6102 0.5675 0.5064 -0.0070 -0.2168 0.0439  371 PHE A O   
2860 C CB  . PHE A 371 ? 0.6249 0.5548 0.5680 0.0168  -0.2434 0.0471  371 PHE A CB  
2861 C CG  . PHE A 371 ? 0.7373 0.6851 0.6647 0.0173  -0.2453 0.0446  371 PHE A CG  
2862 C CD1 . PHE A 371 ? 0.7630 0.7019 0.6622 0.0173  -0.2538 0.0593  371 PHE A CD1 
2863 C CD2 . PHE A 371 ? 0.7424 0.7138 0.6816 0.0174  -0.2383 0.0279  371 PHE A CD2 
2864 C CE1 . PHE A 371 ? 0.7731 0.7269 0.6556 0.0179  -0.2564 0.0566  371 PHE A CE1 
2865 C CE2 . PHE A 371 ? 0.7608 0.7456 0.6837 0.0175  -0.2410 0.0255  371 PHE A CE2 
2866 C CZ  . PHE A 371 ? 0.7369 0.7134 0.6313 0.0181  -0.2506 0.0394  371 PHE A CZ  
2867 N N   . HIS A 372 ? 0.5144 0.4738 0.4626 -0.0018 -0.2088 0.0232  372 HIS A N   
2868 C CA  A HIS A 372 ? 0.5480 0.5275 0.4949 -0.0059 -0.1981 0.0098  372 HIS A CA  
2869 C CA  B HIS A 372 ? 0.5489 0.5285 0.4941 -0.0059 -0.1986 0.0105  372 HIS A CA  
2870 C C   . HIS A 372 ? 0.5786 0.5605 0.5108 -0.0164 -0.1825 0.0141  372 HIS A C   
2871 O O   . HIS A 372 ? 0.6695 0.6663 0.5877 -0.0191 -0.1754 0.0090  372 HIS A O   
2872 C CB  A HIS A 372 ? 0.3331 0.3204 0.3112 -0.0021 -0.1928 -0.0071 372 HIS A CB  
2873 C CB  B HIS A 372 ? 0.5178 0.5080 0.4930 -0.0011 -0.1939 -0.0073 372 HIS A CB  
2874 C CG  A HIS A 372 ? 0.5288 0.5337 0.5064 -0.0051 -0.1794 -0.0205 372 HIS A CG  
2875 C CG  B HIS A 372 ? 0.4675 0.4680 0.4524 0.0063  -0.1992 -0.0128 372 HIS A CG  
2876 N ND1 A HIS A 372 ? 0.3145 0.3324 0.2909 -0.0021 -0.1790 -0.0279 372 HIS A ND1 
2877 N ND1 B HIS A 372 ? 0.4178 0.4127 0.4199 0.0147  -0.2097 -0.0095 372 HIS A ND1 
2878 C CD2 A HIS A 372 ? 0.5158 0.5255 0.4935 -0.0109 -0.1666 -0.0271 372 HIS A CD2 
2879 C CD2 B HIS A 372 ? 0.3390 0.3549 0.3188 0.0060  -0.1962 -0.0208 372 HIS A CD2 
2880 C CE1 A HIS A 372 ? 0.2988 0.3262 0.2732 -0.0058 -0.1665 -0.0379 372 HIS A CE1 
2881 C CE1 B HIS A 372 ? 0.3516 0.3605 0.3602 0.0183  -0.2130 -0.0148 372 HIS A CE1 
2882 N NE2 A HIS A 372 ? 0.2862 0.3096 0.2617 -0.0102 -0.1585 -0.0378 372 HIS A NE2 
2883 N NE2 B HIS A 372 ? 0.4609 0.4813 0.4554 0.0124  -0.2053 -0.0216 372 HIS A NE2 
2884 N N   . TYR A 373 ? 0.5612 0.5286 0.4975 -0.0222 -0.1774 0.0231  373 TYR A N   
2885 C CA  . TYR A 373 ? 0.4915 0.4644 0.4206 -0.0329 -0.1630 0.0270  373 TYR A CA  
2886 C C   . TYR A 373 ? 0.6254 0.5931 0.5296 -0.0417 -0.1615 0.0464  373 TYR A C   
2887 O O   . TYR A 373 ? 0.6723 0.6479 0.5728 -0.0515 -0.1494 0.0513  373 TYR A O   
2888 C CB  . TYR A 373 ? 0.4655 0.4288 0.4163 -0.0366 -0.1565 0.0224  373 TYR A CB  
2889 C CG  . TYR A 373 ? 0.5205 0.4961 0.4903 -0.0328 -0.1502 0.0036  373 TYR A CG  
2890 C CD1 . TYR A 373 ? 0.4802 0.4719 0.4489 -0.0378 -0.1381 -0.0027 373 TYR A CD1 
2891 C CD2 . TYR A 373 ? 0.4825 0.4542 0.4715 -0.0240 -0.1560 -0.0073 373 TYR A CD2 
2892 C CE1 . TYR A 373 ? 0.4538 0.4536 0.4375 -0.0345 -0.1331 -0.0189 373 TYR A CE1 
2893 C CE2 . TYR A 373 ? 0.4643 0.4462 0.4689 -0.0220 -0.1498 -0.0232 373 TYR A CE2 
2894 C CZ  . TYR A 373 ? 0.4285 0.4224 0.4290 -0.0275 -0.1389 -0.0288 373 TYR A CZ  
2895 O OH  . TYR A 373 ? 0.3166 0.3176 0.3301 -0.0250 -0.1296 -0.0424 373 TYR A OH  
2896 N N   . THR A 374 ? 0.7235 0.6789 0.6113 -0.0387 -0.1737 0.0584  374 THR A N   
2897 C CA  . THR A 374 ? 0.7902 0.7375 0.6527 -0.0483 -0.1724 0.0788  374 THR A CA  
2898 C C   . THR A 374 ? 0.8067 0.7612 0.6388 -0.0458 -0.1775 0.0853  374 THR A C   
2899 O O   . THR A 374 ? 0.8287 0.7728 0.6367 -0.0520 -0.1798 0.1038  374 THR A O   
2900 C CB  . THR A 374 ? 0.7474 0.6635 0.6110 -0.0508 -0.1823 0.0936  374 THR A CB  
2901 O OG1 . THR A 374 ? 0.7925 0.6953 0.6551 -0.0384 -0.1995 0.0944  374 THR A OG1 
2902 C CG2 . THR A 374 ? 0.6952 0.5999 0.5846 -0.0537 -0.1779 0.0871  374 THR A CG2 
2903 N N   . ASP A 375 ? 0.8910 0.8612 0.7221 -0.0373 -0.1798 0.0705  375 ASP A N   
2904 C CA  . ASP A 375 ? 1.0049 0.9828 0.8028 -0.0356 -0.1829 0.0744  375 ASP A CA  
2905 C C   . ASP A 375 ? 1.0477 1.0465 0.8316 -0.0417 -0.1639 0.0718  375 ASP A C   
2906 O O   . ASP A 375 ? 0.9581 0.9728 0.7482 -0.0372 -0.1575 0.0546  375 ASP A O   
2907 C CB  . ASP A 375 ? 1.0440 1.0270 0.8447 -0.0244 -0.1964 0.0600  375 ASP A CB  
2908 C CG  . ASP A 375 ? 1.1773 1.1584 0.9413 -0.0219 -0.2070 0.0677  375 ASP A CG  
2909 O OD1 . ASP A 375 ? 1.1955 1.1839 0.9291 -0.0273 -0.1961 0.0737  375 ASP A OD1 
2910 O OD2 . ASP A 375 ? 1.2217 1.1973 0.9937 -0.0132 -0.2195 0.0662  375 ASP A OD2 
2911 N N   . TRP A 376 ? 1.1504 1.1489 0.9159 -0.0518 -0.1547 0.0894  376 TRP A N   
2912 C CA  . TRP A 376 ? 1.1234 1.1449 0.8805 -0.0576 -0.1348 0.0886  376 TRP A CA  
2913 C C   . TRP A 376 ? 1.2311 1.2598 0.9483 -0.0615 -0.1280 0.1020  376 TRP A C   
2914 O O   . TRP A 376 ? 1.1023 1.1167 0.7922 -0.0598 -0.1401 0.1122  376 TRP A O   
2915 C CB  . TRP A 376 ? 0.9994 1.0245 0.7810 -0.0684 -0.1231 0.0944  376 TRP A CB  
2916 C CG  . TRP A 376 ? 0.9005 0.9008 0.6877 -0.0769 -0.1317 0.1114  376 TRP A CG  
2917 C CD1 . TRP A 376 ? 0.8303 0.8139 0.5926 -0.0829 -0.1383 0.1320  376 TRP A CD1 
2918 C CD2 . TRP A 376 ? 0.8180 0.8044 0.6351 -0.0804 -0.1347 0.1092  376 TRP A CD2 
2919 N NE1 . TRP A 376 ? 0.7776 0.7362 0.5535 -0.0896 -0.1459 0.1425  376 TRP A NE1 
2920 C CE2 . TRP A 376 ? 0.7895 0.7493 0.5983 -0.0880 -0.1436 0.1282  376 TRP A CE2 
2921 C CE3 . TRP A 376 ? 0.6238 0.6151 0.4711 -0.0777 -0.1310 0.0930  376 TRP A CE3 
2922 C CZ2 . TRP A 376 ? 0.7846 0.7221 0.6140 -0.0923 -0.1490 0.1302  376 TRP A CZ2 
2923 C CZ3 . TRP A 376 ? 0.5865 0.5574 0.4532 -0.0823 -0.1358 0.0953  376 TRP A CZ3 
2924 C CH2 . TRP A 376 ? 0.7173 0.6612 0.5749 -0.0893 -0.1447 0.1131  376 TRP A CH2 
2925 N N   . VAL A 377 ? 1.4185 1.4704 1.1335 -0.0663 -0.1080 0.1020  377 VAL A N   
2926 C CA  . VAL A 377 ? 1.5631 1.6293 1.2424 -0.0687 -0.0957 0.1111  377 VAL A CA  
2927 C C   . VAL A 377 ? 1.6141 1.6984 1.3013 -0.0822 -0.0763 0.1257  377 VAL A C   
2928 O O   . VAL A 377 ? 1.5977 1.6995 1.3145 -0.0837 -0.0652 0.1176  377 VAL A O   
2929 C CB  . VAL A 377 ? 1.5730 1.6559 1.2392 -0.0564 -0.0889 0.0904  377 VAL A CB  
2930 C CG1 . VAL A 377 ? 1.4856 1.5775 1.1887 -0.0508 -0.0857 0.0702  377 VAL A CG1 
2931 C CG2 . VAL A 377 ? 1.6326 1.7380 1.2711 -0.0584 -0.0683 0.0967  377 VAL A CG2 
2932 N N   . ASP A 378 ? 1.6472 1.7272 1.3084 -0.0926 -0.0732 0.1482  378 ASP A N   
2933 C CA  . ASP A 378 ? 1.6477 1.7475 1.3122 -0.1075 -0.0544 0.1653  378 ASP A CA  
2934 C C   . ASP A 378 ? 1.5730 1.6700 1.2768 -0.1200 -0.0545 0.1714  378 ASP A C   
2935 O O   . ASP A 378 ? 1.5782 1.6962 1.3115 -0.1191 -0.0446 0.1598  378 ASP A O   
2936 C CB  . ASP A 378 ? 1.6744 1.8117 1.3345 -0.1022 -0.0316 0.1558  378 ASP A CB  
2937 C CG  . ASP A 378 ? 1.6924 1.8558 1.3556 -0.1177 -0.0109 0.1752  378 ASP A CG  
2938 O OD1 . ASP A 378 ? 1.7412 1.8920 1.3906 -0.1324 -0.0132 0.1986  378 ASP A OD1 
2939 O OD2 . ASP A 378 ? 1.6381 1.8353 1.3181 -0.1152 0.0076  0.1676  378 ASP A OD2 
2940 N N   . ASP A 379 ? 1.5151 1.5837 1.2180 -0.1310 -0.0668 0.1888  379 ASP A N   
2941 C CA  . ASP A 379 ? 1.4936 1.5304 1.1669 -0.1279 -0.0844 0.1986  379 ASP A CA  
2942 C C   . ASP A 379 ? 1.3854 1.3857 1.0767 -0.1292 -0.1046 0.2017  379 ASP A C   
2943 O O   . ASP A 379 ? 1.2943 1.2777 0.9854 -0.1153 -0.1207 0.1902  379 ASP A O   
2944 C CB  . ASP A 379 ? 1.7834 1.8202 1.4156 -0.1379 -0.0779 0.2221  379 ASP A CB  
2945 C CG  . ASP A 379 ? 1.7503 1.8211 1.3854 -0.1516 -0.0529 0.2329  379 ASP A CG  
2946 O OD1 . ASP A 379 ? 1.7256 1.8144 1.3975 -0.1572 -0.0441 0.2273  379 ASP A OD1 
2947 O OD2 . ASP A 379 ? 1.7293 1.8080 1.3372 -0.1535 -0.0413 0.2428  379 ASP A OD2 
2948 N N   . GLN A 380 ? 1.3599 1.3467 1.0669 -0.1446 -0.1049 0.2158  380 GLN A N   
2949 C CA  . GLN A 380 ? 1.3574 1.3602 1.0697 -0.1650 -0.0891 0.2330  380 GLN A CA  
2950 C C   . GLN A 380 ? 1.0944 1.1380 0.8343 -0.1694 -0.0694 0.2237  380 GLN A C   
2951 O O   . GLN A 380 ? 1.0327 1.0994 0.7708 -0.1842 -0.0537 0.2386  380 GLN A O   
2952 C CB  . GLN A 380 ? 1.4213 1.4206 1.0958 -0.1771 -0.0844 0.2588  380 GLN A CB  
2953 C CG  . GLN A 380 ? 1.4070 1.3618 1.0695 -0.1786 -0.1017 0.2711  380 GLN A CG  
2954 C CD  . GLN A 380 ? 1.3764 1.3303 1.0169 -0.1896 -0.0919 0.2899  380 GLN A CD  
2955 O OE1 . GLN A 380 ? 1.3841 1.3630 1.0034 -0.1872 -0.0774 0.2911  380 GLN A OE1 
2956 N NE2 . GLN A 380 ? 1.3604 1.2846 1.0052 -0.2013 -0.0995 0.3037  380 GLN A NE2 
2957 N N   . ARG A 381 ? 1.1216 1.1742 0.8875 -0.1569 -0.0705 0.2001  381 ARG A N   
2958 C CA  . ARG A 381 ? 0.9829 1.0633 0.7819 -0.1619 -0.0580 0.1921  381 ARG A CA  
2959 C C   . ARG A 381 ? 0.8390 0.8918 0.6623 -0.1711 -0.0705 0.1940  381 ARG A C   
2960 O O   . ARG A 381 ? 0.7945 0.8185 0.6215 -0.1610 -0.0858 0.1834  381 ARG A O   
2961 C CB  . ARG A 381 ? 1.0063 1.1065 0.8173 -0.1436 -0.0536 0.1660  381 ARG A CB  
2962 C CG  . ARG A 381 ? 1.0972 1.2409 0.9100 -0.1416 -0.0323 0.1623  381 ARG A CG  
2963 C CD  . ARG A 381 ? 1.1422 1.2979 0.9581 -0.1215 -0.0301 0.1367  381 ARG A CD  
2964 N NE  . ARG A 381 ? 1.1829 1.3368 1.0329 -0.1183 -0.0346 0.1214  381 ARG A NE  
2965 C CZ  . ARG A 381 ? 1.2043 1.3855 1.0796 -0.1199 -0.0231 0.1163  381 ARG A CZ  
2966 N NH1 . ARG A 381 ? 1.2080 1.4236 1.0820 -0.1242 -0.0054 0.1249  381 ARG A NH1 
2967 N NH2 . ARG A 381 ? 1.1750 1.3500 1.0772 -0.1169 -0.0292 0.1029  381 ARG A NH2 
2968 N N   . PRO A 382 ? 0.7867 0.8476 0.6255 -0.1905 -0.0644 0.2079  382 PRO A N   
2969 C CA  . PRO A 382 ? 0.7175 0.7463 0.5721 -0.2023 -0.0774 0.2130  382 PRO A CA  
2970 C C   . PRO A 382 ? 0.6143 0.6348 0.4946 -0.1914 -0.0846 0.1904  382 PRO A C   
2971 O O   . PRO A 382 ? 0.6394 0.6236 0.5245 -0.1927 -0.0987 0.1891  382 PRO A O   
2972 C CB  . PRO A 382 ? 0.7475 0.7987 0.6164 -0.2256 -0.0664 0.2300  382 PRO A CB  
2973 C CG  . PRO A 382 ? 0.7508 0.8374 0.6019 -0.2274 -0.0489 0.2410  382 PRO A CG  
2974 C CD  . PRO A 382 ? 0.7786 0.8798 0.6204 -0.2031 -0.0450 0.2202  382 PRO A CD  
2975 N N   . GLU A 383 ? 0.5330 0.5851 0.4277 -0.1802 -0.0747 0.1729  383 GLU A N   
2976 C CA  . GLU A 383 ? 0.6054 0.6520 0.5235 -0.1713 -0.0799 0.1526  383 GLU A CA  
2977 C C   . GLU A 383 ? 0.6586 0.6891 0.5694 -0.1508 -0.0884 0.1350  383 GLU A C   
2978 O O   . GLU A 383 ? 0.6673 0.6923 0.5949 -0.1424 -0.0921 0.1178  383 GLU A O   
2979 C CB  . GLU A 383 ? 0.6371 0.7239 0.5772 -0.1709 -0.0662 0.1434  383 GLU A CB  
2980 C CG  . GLU A 383 ? 0.7401 0.8619 0.6694 -0.1599 -0.0518 0.1387  383 GLU A CG  
2981 C CD  . GLU A 383 ? 0.9262 1.0724 0.8442 -0.1726 -0.0389 0.1594  383 GLU A CD  
2982 O OE1 . GLU A 383 ? 0.9823 1.1416 0.9173 -0.1904 -0.0344 0.1727  383 GLU A OE1 
2983 O OE2 . GLU A 383 ? 0.9569 1.1093 0.8482 -0.1655 -0.0334 0.1625  383 GLU A OE2 
2984 N N   . ASN A 384 ? 0.7243 0.7479 0.6100 -0.1438 -0.0917 0.1399  384 ASN A N   
2985 C CA  . ASN A 384 ? 0.6961 0.7075 0.5751 -0.1254 -0.1009 0.1250  384 ASN A CA  
2986 C C   . ASN A 384 ? 0.6226 0.6057 0.5184 -0.1194 -0.1134 0.1140  384 ASN A C   
2987 O O   . ASN A 384 ? 0.5407 0.5294 0.4501 -0.1078 -0.1136 0.0949  384 ASN A O   
2988 C CB  . ASN A 384 ? 0.7185 0.7165 0.5673 -0.1224 -0.1082 0.1370  384 ASN A CB  
2989 C CG  . ASN A 384 ? 0.7250 0.7511 0.5524 -0.1187 -0.0970 0.1379  384 ASN A CG  
2990 O OD1 . ASN A 384 ? 0.6689 0.7228 0.5048 -0.1131 -0.0854 0.1246  384 ASN A OD1 
2991 N ND2 . ASN A 384 ? 0.7625 0.7795 0.5598 -0.1210 -0.1006 0.1534  384 ASN A ND2 
2992 N N   . TYR A 385 ? 0.5840 0.5358 0.4775 -0.1275 -0.1233 0.1262  385 TYR A N   
2993 C CA  . TYR A 385 ? 0.5806 0.5023 0.4868 -0.1208 -0.1347 0.1170  385 TYR A CA  
2994 C C   . TYR A 385 ? 0.5800 0.5065 0.5098 -0.1246 -0.1297 0.1048  385 TYR A C   
2995 O O   . TYR A 385 ? 0.5554 0.4717 0.4978 -0.1141 -0.1337 0.0889  385 TYR A O   
2996 C CB  . TYR A 385 ? 0.6465 0.5299 0.5407 -0.1276 -0.1467 0.1336  385 TYR A CB  
2997 C CG  . TYR A 385 ? 0.6655 0.5380 0.5367 -0.1199 -0.1554 0.1436  385 TYR A CG  
2998 C CD1 . TYR A 385 ? 0.6002 0.4654 0.4733 -0.1012 -0.1651 0.1319  385 TYR A CD1 
2999 C CD2 . TYR A 385 ? 0.6333 0.5035 0.4811 -0.1319 -0.1545 0.1654  385 TYR A CD2 
3000 C CE1 . TYR A 385 ? 0.5567 0.4125 0.4091 -0.0940 -0.1752 0.1413  385 TYR A CE1 
3001 C CE2 . TYR A 385 ? 0.6483 0.5067 0.4722 -0.1248 -0.1637 0.1751  385 TYR A CE2 
3002 C CZ  . TYR A 385 ? 0.6412 0.4924 0.4676 -0.1056 -0.1749 0.1629  385 TYR A CZ  
3003 O OH  . TYR A 385 ? 0.7482 0.5885 0.5509 -0.0986 -0.1859 0.1731  385 TYR A OH  
3004 N N   . ARG A 386 ? 0.5698 0.5132 0.5054 -0.1399 -0.1211 0.1127  386 ARG A N   
3005 C CA  . ARG A 386 ? 0.4383 0.3905 0.3951 -0.1444 -0.1168 0.1024  386 ARG A CA  
3006 C C   . ARG A 386 ? 0.3542 0.3298 0.3213 -0.1299 -0.1103 0.0824  386 ARG A C   
3007 O O   . ARG A 386 ? 0.4936 0.4587 0.4729 -0.1237 -0.1132 0.0679  386 ARG A O   
3008 C CB  . ARG A 386 ? 0.4367 0.4112 0.3997 -0.1630 -0.1085 0.1160  386 ARG A CB  
3009 C CG  . ARG A 386 ? 0.4040 0.3863 0.3890 -0.1698 -0.1067 0.1079  386 ARG A CG  
3010 C CD  . ARG A 386 ? 0.3765 0.3903 0.3716 -0.1866 -0.0978 0.1211  386 ARG A CD  
3011 N NE  . ARG A 386 ? 0.5638 0.6212 0.5650 -0.1784 -0.0838 0.1154  386 ARG A NE  
3012 C CZ  . ARG A 386 ? 0.5535 0.6465 0.5611 -0.1884 -0.0724 0.1274  386 ARG A CZ  
3013 N NH1 . ARG A 386 ? 0.6097 0.7014 0.6194 -0.2092 -0.0734 0.1470  386 ARG A NH1 
3014 N NH2 . ARG A 386 ? 0.4907 0.6206 0.5027 -0.1777 -0.0596 0.1200  386 ARG A NH2 
3015 N N   . GLU A 387 ? 0.4469 0.4520 0.4070 -0.1247 -0.1013 0.0818  387 GLU A N   
3016 C CA  . GLU A 387 ? 0.4907 0.5164 0.4580 -0.1115 -0.0952 0.0634  387 GLU A CA  
3017 C C   . GLU A 387 ? 0.4807 0.4873 0.4471 -0.0974 -0.1041 0.0499  387 GLU A C   
3018 O O   . GLU A 387 ? 0.4556 0.4635 0.4346 -0.0899 -0.1034 0.0339  387 GLU A O   
3019 C CB  . GLU A 387 ? 0.5558 0.6115 0.5101 -0.1071 -0.0849 0.0650  387 GLU A CB  
3020 C CG  . GLU A 387 ? 0.7006 0.7791 0.6522 -0.1200 -0.0746 0.0814  387 GLU A CG  
3021 C CD  . GLU A 387 ? 0.7977 0.9072 0.7678 -0.1211 -0.0630 0.0754  387 GLU A CD  
3022 O OE1 . GLU A 387 ? 0.8201 0.9263 0.8099 -0.1293 -0.0654 0.0750  387 GLU A OE1 
3023 O OE2 . GLU A 387 ? 0.8272 0.9637 0.7911 -0.1132 -0.0521 0.0711  387 GLU A OE2 
3024 N N   . ALA A 388 ? 0.4154 0.4052 0.3675 -0.0940 -0.1127 0.0574  388 ALA A N   
3025 C CA  . ALA A 388 ? 0.4202 0.3972 0.3733 -0.0803 -0.1215 0.0461  388 ALA A CA  
3026 C C   . ALA A 388 ? 0.4090 0.3640 0.3789 -0.0774 -0.1268 0.0370  388 ALA A C   
3027 O O   . ALA A 388 ? 0.3267 0.2835 0.3066 -0.0669 -0.1278 0.0219  388 ALA A O   
3028 C CB  . ALA A 388 ? 0.3593 0.3236 0.2938 -0.0770 -0.1311 0.0576  388 ALA A CB  
3029 N N   . LEU A 389 ? 0.3323 0.2662 0.3042 -0.0870 -0.1298 0.0457  389 LEU A N   
3030 C CA  . LEU A 389 ? 0.5128 0.4224 0.4965 -0.0832 -0.1345 0.0365  389 LEU A CA  
3031 C C   . LEU A 389 ? 0.4536 0.3760 0.4515 -0.0827 -0.1269 0.0216  389 LEU A C   
3032 O O   . LEU A 389 ? 0.4180 0.3340 0.4253 -0.0731 -0.1276 0.0076  389 LEU A O   
3033 C CB  . LEU A 389 ? 0.5422 0.4213 0.5209 -0.0938 -0.1407 0.0487  389 LEU A CB  
3034 C CG  . LEU A 389 ? 0.4769 0.3255 0.4629 -0.0890 -0.1459 0.0393  389 LEU A CG  
3035 C CD1 . LEU A 389 ? 0.3591 0.1975 0.3485 -0.0713 -0.1516 0.0312  389 LEU A CD1 
3036 C CD2 . LEU A 389 ? 0.4531 0.2697 0.4304 -0.1011 -0.1526 0.0519  389 LEU A CD2 
3037 N N   . GLY A 390 ? 0.3614 0.3031 0.3612 -0.0929 -0.1195 0.0252  390 GLY A N   
3038 C CA  . GLY A 390 ? 0.3045 0.2620 0.3159 -0.0918 -0.1125 0.0125  390 GLY A CA  
3039 C C   . GLY A 390 ? 0.3426 0.3146 0.3568 -0.0786 -0.1092 -0.0020 390 GLY A C   
3040 O O   . GLY A 390 ? 0.3752 0.3441 0.3985 -0.0736 -0.1075 -0.0153 390 GLY A O   
3041 N N   . ASP A 391 ? 0.3203 0.3065 0.3249 -0.0735 -0.1086 0.0008  391 ASP A N   
3042 C CA  . ASP A 391 ? 0.3779 0.3754 0.3831 -0.0621 -0.1076 -0.0126 391 ASP A CA  
3043 C C   . ASP A 391 ? 0.3949 0.3756 0.4073 -0.0536 -0.1148 -0.0209 391 ASP A C   
3044 O O   . ASP A 391 ? 0.3373 0.3231 0.3577 -0.0470 -0.1126 -0.0343 391 ASP A O   
3045 C CB  . ASP A 391 ? 0.4278 0.4417 0.4174 -0.0591 -0.1066 -0.0078 391 ASP A CB  
3046 C CG  . ASP A 391 ? 0.5054 0.5432 0.4906 -0.0627 -0.0961 -0.0059 391 ASP A CG  
3047 O OD1 . ASP A 391 ? 0.4629 0.5087 0.4594 -0.0630 -0.0902 -0.0142 391 ASP A OD1 
3048 O OD2 . ASP A 391 ? 0.5875 0.6364 0.5574 -0.0645 -0.0934 0.0040  391 ASP A OD2 
3049 N N   . VAL A 392 ? 0.3832 0.3445 0.3932 -0.0535 -0.1226 -0.0123 392 VAL A N   
3050 C CA  . VAL A 392 ? 0.3567 0.3037 0.3761 -0.0440 -0.1291 -0.0191 392 VAL A CA  
3051 C C   . VAL A 392 ? 0.3253 0.2644 0.3575 -0.0429 -0.1233 -0.0307 392 VAL A C   
3052 O O   . VAL A 392 ? 0.2562 0.2016 0.2974 -0.0334 -0.1171 -0.0404 392 VAL A O   
3053 C CB  . VAL A 392 ? 0.3940 0.3172 0.4085 -0.0431 -0.1382 -0.0074 392 VAL A CB  
3054 C CG1 . VAL A 392 ? 0.4201 0.3287 0.4484 -0.0323 -0.1425 -0.0161 392 VAL A CG1 
3055 C CG2 . VAL A 392 ? 0.4034 0.3319 0.4035 -0.0418 -0.1449 0.0042  392 VAL A CG2 
3056 N N   . VAL A 393 ? 0.2837 0.2125 0.3137 -0.0506 -0.1186 -0.0263 393 VAL A N   
3057 C CA  . VAL A 393 ? 0.2599 0.1829 0.2947 -0.0464 -0.1066 -0.0330 393 VAL A CA  
3058 C C   . VAL A 393 ? 0.3325 0.2771 0.3693 -0.0438 -0.0928 -0.0408 393 VAL A C   
3059 O O   . VAL A 393 ? 0.3695 0.3147 0.4094 -0.0374 -0.0841 -0.0473 393 VAL A O   
3060 C CB  . VAL A 393 ? 0.3204 0.2276 0.3494 -0.0551 -0.1061 -0.0257 393 VAL A CB  
3061 C CG1 . VAL A 393 ? 0.2313 0.1402 0.2611 -0.0517 -0.0928 -0.0327 393 VAL A CG1 
3062 C CG2 . VAL A 393 ? 0.2708 0.1491 0.2955 -0.0560 -0.1181 -0.0186 393 VAL A CG2 
3063 N N   . GLY A 394 ? 0.2923 0.2538 0.3260 -0.0493 -0.0917 -0.0389 394 GLY A N   
3064 C CA  . GLY A 394 ? 0.2955 0.2740 0.3291 -0.0468 -0.0807 -0.0455 394 GLY A CA  
3065 C C   . GLY A 394 ? 0.3326 0.3166 0.3671 -0.0385 -0.0781 -0.0518 394 GLY A C   
3066 O O   . GLY A 394 ? 0.2806 0.2636 0.3154 -0.0347 -0.0693 -0.0552 394 GLY A O   
3067 N N   . ASP A 395 ? 0.3706 0.3597 0.4041 -0.0365 -0.0870 -0.0515 395 ASP A N   
3068 C CA  . ASP A 395 ? 0.3553 0.3508 0.3902 -0.0296 -0.0860 -0.0568 395 ASP A CA  
3069 C C   . ASP A 395 ? 0.3123 0.2990 0.3575 -0.0237 -0.0840 -0.0600 395 ASP A C   
3070 O O   . ASP A 395 ? 0.2527 0.2440 0.3008 -0.0203 -0.0775 -0.0639 395 ASP A O   
3071 C CB  . ASP A 395 ? 0.2268 0.2289 0.2563 -0.0285 -0.0978 -0.0550 395 ASP A CB  
3072 C CG  . ASP A 395 ? 0.2833 0.2981 0.3003 -0.0331 -0.0996 -0.0530 395 ASP A CG  
3073 O OD1 . ASP A 395 ? 0.2427 0.2644 0.2585 -0.0353 -0.0907 -0.0559 395 ASP A OD1 
3074 O OD2 . ASP A 395 ? 0.3325 0.3498 0.3392 -0.0341 -0.1109 -0.0474 395 ASP A OD2 
3075 N N   . TYR A 396 ? 0.3228 0.2959 0.3738 -0.0226 -0.0906 -0.0579 396 TYR A N   
3076 C CA  . TYR A 396 ? 0.3484 0.3152 0.4120 -0.0156 -0.0911 -0.0624 396 TYR A CA  
3077 C C   . TYR A 396 ? 0.3015 0.2654 0.3645 -0.0157 -0.0784 -0.0645 396 TYR A C   
3078 O O   . TYR A 396 ? 0.2480 0.2171 0.3188 -0.0115 -0.0736 -0.0691 396 TYR A O   
3079 C CB  . TYR A 396 ? 0.2015 0.1511 0.2705 -0.0132 -0.1044 -0.0599 396 TYR A CB  
3080 C CG  . TYR A 396 ? 0.2302 0.1715 0.3142 -0.0051 -0.1055 -0.0659 396 TYR A CG  
3081 C CD1 . TYR A 396 ? 0.2786 0.2331 0.3789 0.0019  -0.1067 -0.0731 396 TYR A CD1 
3082 C CD2 . TYR A 396 ? 0.2167 0.1376 0.2987 -0.0045 -0.1052 -0.0647 396 TYR A CD2 
3083 C CE1 . TYR A 396 ? 0.3424 0.2921 0.4608 0.0097  -0.1080 -0.0803 396 TYR A CE1 
3084 C CE2 . TYR A 396 ? 0.3129 0.2263 0.4074 0.0041  -0.1049 -0.0712 396 TYR A CE2 
3085 C CZ  . TYR A 396 ? 0.4041 0.3327 0.5189 0.0115  -0.1064 -0.0796 396 TYR A CZ  
3086 O OH  . TYR A 396 ? 0.3909 0.3142 0.5209 0.0206  -0.1048 -0.0868 396 TYR A OH  
3087 N N   . ASN A 397 ? 0.3567 0.3134 0.4101 -0.0214 -0.0738 -0.0605 397 ASN A N   
3088 C CA  . ASN A 397 ? 0.3439 0.2955 0.3925 -0.0222 -0.0636 -0.0612 397 ASN A CA  
3089 C C   . ASN A 397 ? 0.2450 0.2056 0.2857 -0.0246 -0.0540 -0.0606 397 ASN A C   
3090 O O   . ASN A 397 ? 0.2500 0.2070 0.2904 -0.0230 -0.0491 -0.0624 397 ASN A O   
3091 C CB  . ASN A 397 ? 0.2531 0.1907 0.2943 -0.0272 -0.0641 -0.0574 397 ASN A CB  
3092 C CG  . ASN A 397 ? 0.2893 0.2100 0.3353 -0.0235 -0.0722 -0.0578 397 ASN A CG  
3093 O OD1 . ASN A 397 ? 0.2780 0.1930 0.3283 -0.0180 -0.0695 -0.0623 397 ASN A OD1 
3094 N ND2 . ASN A 397 ? 0.3161 0.2272 0.3609 -0.0269 -0.0829 -0.0524 397 ASN A ND2 
3095 N N   . PHE A 398 ? 0.2255 0.1959 0.2628 -0.0269 -0.0545 -0.0593 398 PHE A N   
3096 C CA  . PHE A 398 ? 0.2495 0.2244 0.2833 -0.0269 -0.0496 -0.0597 398 PHE A CA  
3097 C C   . PHE A 398 ? 0.2729 0.2575 0.3071 -0.0245 -0.0498 -0.0619 398 PHE A C   
3098 O O   . PHE A 398 ? 0.2579 0.2442 0.2960 -0.0205 -0.0470 -0.0650 398 PHE A O   
3099 C CB  . PHE A 398 ? 0.1500 0.1241 0.1773 -0.0330 -0.0492 -0.0563 398 PHE A CB  
3100 C CG  . PHE A 398 ? 0.2478 0.2106 0.2735 -0.0357 -0.0488 -0.0549 398 PHE A CG  
3101 C CD1 . PHE A 398 ? 0.2384 0.1945 0.2625 -0.0338 -0.0454 -0.0565 398 PHE A CD1 
3102 C CD2 . PHE A 398 ? 0.2064 0.1643 0.2315 -0.0405 -0.0523 -0.0524 398 PHE A CD2 
3103 C CE1 . PHE A 398 ? 0.3121 0.2564 0.3323 -0.0365 -0.0453 -0.0560 398 PHE A CE1 
3104 C CE2 . PHE A 398 ? 0.2847 0.2294 0.3077 -0.0425 -0.0525 -0.0516 398 PHE A CE2 
3105 C CZ  . PHE A 398 ? 0.3134 0.2515 0.3334 -0.0405 -0.0489 -0.0538 398 PHE A CZ  
3106 N N   . ILE A 399 ? 0.2567 0.2477 0.2857 -0.0278 -0.0534 -0.0602 399 ILE A N   
3107 C CA  . ILE A 399 ? 0.2810 0.2795 0.3064 -0.0260 -0.0538 -0.0626 399 ILE A CA  
3108 C C   . ILE A 399 ? 0.3517 0.3519 0.3827 -0.0215 -0.0553 -0.0665 399 ILE A C   
3109 O O   . ILE A 399 ? 0.4091 0.4099 0.4419 -0.0184 -0.0525 -0.0700 399 ILE A O   
3110 C CB  . ILE A 399 ? 0.2603 0.2676 0.2821 -0.0285 -0.0602 -0.0630 399 ILE A CB  
3111 C CG1 . ILE A 399 ? 0.2641 0.2740 0.2849 -0.0336 -0.0598 -0.0601 399 ILE A CG1 
3112 C CG2 . ILE A 399 ? 0.2613 0.2750 0.2770 -0.0252 -0.0608 -0.0672 399 ILE A CG2 
3113 C CD1 . ILE A 399 ? 0.2619 0.2850 0.2809 -0.0373 -0.0672 -0.0598 399 ILE A CD1 
3114 N N   . CYS A 400 ? 0.2422 0.2437 0.2785 -0.0207 -0.0612 -0.0671 400 CYS A N   
3115 C CA  . CYS A 400 ? 0.2170 0.2216 0.2602 -0.0175 -0.0637 -0.0706 400 CYS A CA  
3116 C C   . CYS A 400 ? 0.2568 0.2591 0.3092 -0.0152 -0.0581 -0.0731 400 CYS A C   
3117 O O   . CYS A 400 ? 0.2494 0.2552 0.3046 -0.0143 -0.0577 -0.0766 400 CYS A O   
3118 C CB  . CYS A 400 ? 0.2569 0.2641 0.3082 -0.0151 -0.0741 -0.0718 400 CYS A CB  
3119 S SG  . CYS A 400 ? 0.3642 0.3771 0.4031 -0.0173 -0.0835 -0.0696 400 CYS A SG  
3120 N N   . PRO A 401 ? 0.2469 0.2435 0.3038 -0.0145 -0.0547 -0.0722 401 PRO A N   
3121 C CA  . PRO A 401 ? 0.2853 0.2822 0.3503 -0.0129 -0.0498 -0.0755 401 PRO A CA  
3122 C C   . PRO A 401 ? 0.2943 0.2911 0.3539 -0.0137 -0.0452 -0.0760 401 PRO A C   
3123 O O   . PRO A 401 ? 0.3367 0.3357 0.4013 -0.0139 -0.0429 -0.0790 401 PRO A O   
3124 C CB  . PRO A 401 ? 0.2934 0.2828 0.3601 -0.0127 -0.0473 -0.0744 401 PRO A CB  
3125 C CG  . PRO A 401 ? 0.2229 0.2081 0.2866 -0.0134 -0.0527 -0.0715 401 PRO A CG  
3126 C CD  . PRO A 401 ? 0.1446 0.1339 0.1991 -0.0161 -0.0555 -0.0689 401 PRO A CD  
3127 N N   . ALA A 402 ? 0.2034 0.1977 0.2534 -0.0148 -0.0443 -0.0732 402 ALA A N   
3128 C CA  . ALA A 402 ? 0.1927 0.1865 0.2378 -0.0148 -0.0412 -0.0738 402 ALA A CA  
3129 C C   . ALA A 402 ? 0.2930 0.2904 0.3368 -0.0142 -0.0433 -0.0771 402 ALA A C   
3130 O O   . ALA A 402 ? 0.3561 0.3518 0.4003 -0.0146 -0.0415 -0.0793 402 ALA A O   
3131 C CB  . ALA A 402 ? 0.2134 0.2054 0.2508 -0.0158 -0.0408 -0.0709 402 ALA A CB  
3132 N N   . LEU A 403 ? 0.2875 0.2881 0.3272 -0.0141 -0.0476 -0.0774 403 LEU A N   
3133 C CA  . LEU A 403 ? 0.2819 0.2847 0.3181 -0.0141 -0.0510 -0.0810 403 LEU A CA  
3134 C C   . LEU A 403 ? 0.2974 0.3014 0.3425 -0.0152 -0.0524 -0.0838 403 LEU A C   
3135 O O   . LEU A 403 ? 0.3098 0.3118 0.3532 -0.0166 -0.0526 -0.0868 403 LEU A O   
3136 C CB  . LEU A 403 ? 0.2414 0.2476 0.2701 -0.0149 -0.0562 -0.0805 403 LEU A CB  
3137 C CG  . LEU A 403 ? 0.3110 0.3181 0.3285 -0.0151 -0.0555 -0.0793 403 LEU A CG  
3138 C CD1 . LEU A 403 ? 0.2646 0.2760 0.2741 -0.0177 -0.0608 -0.0771 403 LEU A CD1 
3139 C CD2 . LEU A 403 ? 0.2124 0.2178 0.2223 -0.0128 -0.0543 -0.0836 403 LEU A CD2 
3140 N N   . GLU A 404 ? 0.2726 0.2795 0.3273 -0.0151 -0.0537 -0.0832 404 GLU A N   
3141 C CA  . GLU A 404 ? 0.2696 0.2804 0.3356 -0.0165 -0.0555 -0.0864 404 GLU A CA  
3142 C C   . GLU A 404 ? 0.3213 0.3296 0.3913 -0.0184 -0.0498 -0.0880 404 GLU A C   
3143 O O   . GLU A 404 ? 0.3224 0.3316 0.3949 -0.0219 -0.0511 -0.0911 404 GLU A O   
3144 C CB  . GLU A 404 ? 0.2064 0.2212 0.2836 -0.0150 -0.0581 -0.0858 404 GLU A CB  
3145 C CG  . GLU A 404 ? 0.3661 0.3883 0.4576 -0.0164 -0.0615 -0.0894 404 GLU A CG  
3146 C CD  . GLU A 404 ? 0.8031 0.8302 0.8917 -0.0192 -0.0695 -0.0908 404 GLU A CD  
3147 O OE1 . GLU A 404 ? 0.7201 0.7443 0.7943 -0.0192 -0.0726 -0.0895 404 GLU A OE1 
3148 O OE2 . GLU A 404 ? 0.8116 0.8460 0.9122 -0.0220 -0.0729 -0.0935 404 GLU A OE2 
3149 N N   . PHE A 405 ? 0.2753 0.2796 0.3442 -0.0174 -0.0441 -0.0858 405 PHE A N   
3150 C CA  . PHE A 405 ? 0.1994 0.1996 0.2678 -0.0200 -0.0388 -0.0864 405 PHE A CA  
3151 C C   . PHE A 405 ? 0.2709 0.2661 0.3300 -0.0224 -0.0396 -0.0875 405 PHE A C   
3152 O O   . PHE A 405 ? 0.3039 0.2963 0.3640 -0.0268 -0.0387 -0.0897 405 PHE A O   
3153 C CB  . PHE A 405 ? 0.1591 0.1539 0.2223 -0.0190 -0.0343 -0.0831 405 PHE A CB  
3154 C CG  . PHE A 405 ? 0.2538 0.2419 0.3117 -0.0222 -0.0298 -0.0831 405 PHE A CG  
3155 C CD1 . PHE A 405 ? 0.2273 0.2144 0.2906 -0.0248 -0.0256 -0.0850 405 PHE A CD1 
3156 C CD2 . PHE A 405 ? 0.2675 0.2493 0.3143 -0.0228 -0.0301 -0.0817 405 PHE A CD2 
3157 C CE1 . PHE A 405 ? 0.2719 0.2506 0.3275 -0.0287 -0.0218 -0.0849 405 PHE A CE1 
3158 C CE2 . PHE A 405 ? 0.3265 0.2993 0.3661 -0.0263 -0.0271 -0.0814 405 PHE A CE2 
3159 C CZ  . PHE A 405 ? 0.3250 0.2956 0.3678 -0.0295 -0.0232 -0.0827 405 PHE A CZ  
3160 N N   . THR A 406 ? 0.2385 0.2316 0.2881 -0.0200 -0.0415 -0.0861 406 THR A N   
3161 C CA  . THR A 406 ? 0.1871 0.1738 0.2267 -0.0210 -0.0425 -0.0876 406 THR A CA  
3162 C C   . THR A 406 ? 0.2743 0.2603 0.3131 -0.0244 -0.0472 -0.0917 406 THR A C   
3163 O O   . THR A 406 ? 0.3526 0.3304 0.3857 -0.0283 -0.0474 -0.0937 406 THR A O   
3164 C CB  . THR A 406 ? 0.3413 0.3280 0.3727 -0.0170 -0.0434 -0.0865 406 THR A CB  
3165 O OG1 . THR A 406 ? 0.3575 0.3449 0.3900 -0.0154 -0.0401 -0.0827 406 THR A OG1 
3166 C CG2 . THR A 406 ? 0.2315 0.2106 0.2527 -0.0168 -0.0442 -0.0890 406 THR A CG2 
3167 N N   . LYS A 407 ? 0.2056 0.1984 0.2484 -0.0238 -0.0519 -0.0929 407 LYS A N   
3168 C CA  . LYS A 407 ? 0.2607 0.2533 0.3027 -0.0282 -0.0579 -0.0967 407 LYS A CA  
3169 C C   . LYS A 407 ? 0.2488 0.2416 0.3004 -0.0340 -0.0566 -0.0980 407 LYS A C   
3170 O O   . LYS A 407 ? 0.2094 0.1956 0.2562 -0.0400 -0.0590 -0.1006 407 LYS A O   
3171 C CB  . LYS A 407 ? 0.2374 0.2385 0.2833 -0.0273 -0.0641 -0.0971 407 LYS A CB  
3172 C CG  . LYS A 407 ? 0.4503 0.4524 0.4868 -0.0228 -0.0653 -0.0954 407 LYS A CG  
3173 C CD  . LYS A 407 ? 0.6570 0.6647 0.6918 -0.0240 -0.0735 -0.0963 407 LYS A CD  
3174 C CE  . LYS A 407 ? 0.7114 0.7222 0.7400 -0.0208 -0.0743 -0.0929 407 LYS A CE  
3175 N NZ  . LYS A 407 ? 0.7086 0.7247 0.7329 -0.0226 -0.0833 -0.0931 407 LYS A NZ  
3176 N N   . LYS A 408 ? 0.1911 0.1905 0.2554 -0.0330 -0.0528 -0.0965 408 LYS A N   
3177 C CA  . LYS A 408 ? 0.3227 0.3253 0.3986 -0.0389 -0.0515 -0.0983 408 LYS A CA  
3178 C C   . LYS A 408 ? 0.2578 0.2493 0.3257 -0.0436 -0.0470 -0.0981 408 LYS A C   
3179 O O   . LYS A 408 ? 0.2448 0.2329 0.3131 -0.0514 -0.0490 -0.1000 408 LYS A O   
3180 C CB  . LYS A 408 ? 0.3210 0.3330 0.4124 -0.0361 -0.0481 -0.0981 408 LYS A CB  
3181 C CG  . LYS A 408 ? 0.5395 0.5623 0.6417 -0.0342 -0.0549 -0.0989 408 LYS A CG  
3182 C CD  . LYS A 408 ? 0.7375 0.7691 0.8573 -0.0322 -0.0521 -0.0999 408 LYS A CD  
3183 C CE  . LYS A 408 ? 0.8273 0.8700 0.9591 -0.0299 -0.0605 -0.1004 408 LYS A CE  
3184 N NZ  . LYS A 408 ? 0.8735 0.9288 1.0343 -0.0262 -0.0593 -0.1068 408 LYS A NZ  
3185 N N   . PHE A 409 ? 0.2307 0.2158 0.2901 -0.0396 -0.0419 -0.0952 409 PHE A N   
3186 C CA  . PHE A 409 ? 0.2833 0.2556 0.3320 -0.0436 -0.0388 -0.0943 409 PHE A CA  
3187 C C   . PHE A 409 ? 0.2965 0.2574 0.3323 -0.0478 -0.0437 -0.0962 409 PHE A C   
3188 O O   . PHE A 409 ? 0.3309 0.2820 0.3620 -0.0555 -0.0443 -0.0971 409 PHE A O   
3189 C CB  . PHE A 409 ? 0.3329 0.3008 0.3737 -0.0383 -0.0348 -0.0907 409 PHE A CB  
3190 C CG  . PHE A 409 ? 0.3361 0.2904 0.3659 -0.0422 -0.0316 -0.0891 409 PHE A CG  
3191 C CD1 . PHE A 409 ? 0.3457 0.2858 0.3604 -0.0442 -0.0341 -0.0892 409 PHE A CD1 
3192 C CD2 . PHE A 409 ? 0.2564 0.2102 0.2894 -0.0437 -0.0265 -0.0881 409 PHE A CD2 
3193 C CE1 . PHE A 409 ? 0.2250 0.1495 0.2270 -0.0478 -0.0325 -0.0874 409 PHE A CE1 
3194 C CE2 . PHE A 409 ? 0.2895 0.2286 0.3099 -0.0473 -0.0248 -0.0865 409 PHE A CE2 
3195 C CZ  . PHE A 409 ? 0.2674 0.1912 0.2721 -0.0493 -0.0286 -0.0857 409 PHE A CZ  
3196 N N   . SER A 410 ? 0.2607 0.2218 0.2900 -0.0432 -0.0473 -0.0971 410 SER A N   
3197 C CA  . SER A 410 ? 0.3272 0.2758 0.3422 -0.0461 -0.0512 -0.1001 410 SER A CA  
3198 C C   . SER A 410 ? 0.3561 0.3029 0.3726 -0.0551 -0.0568 -0.1036 410 SER A C   
3199 O O   . SER A 410 ? 0.3786 0.3112 0.3826 -0.0612 -0.0593 -0.1064 410 SER A O   
3200 C CB  . SER A 410 ? 0.3358 0.2868 0.3445 -0.0388 -0.0536 -0.1014 410 SER A CB  
3201 O OG  . SER A 410 ? 0.4368 0.3996 0.4532 -0.0374 -0.0575 -0.1022 410 SER A OG  
3202 N N   . GLU A 411 ? 0.4071 0.3681 0.4392 -0.0566 -0.0590 -0.1038 411 GLU A N   
3203 C CA  . GLU A 411 ? 0.3720 0.3348 0.4085 -0.0661 -0.0658 -0.1068 411 GLU A CA  
3204 C C   . GLU A 411 ? 0.3910 0.3443 0.4265 -0.0773 -0.0652 -0.1068 411 GLU A C   
3205 O O   . GLU A 411 ? 0.4643 0.4153 0.4997 -0.0877 -0.0715 -0.1091 411 GLU A O   
3206 C CB  . GLU A 411 ? 0.3460 0.3280 0.4017 -0.0650 -0.0687 -0.1067 411 GLU A CB  
3207 C CG  . GLU A 411 ? 0.5018 0.4885 0.5532 -0.0621 -0.0763 -0.1087 411 GLU A CG  
3208 C CD  . GLU A 411 ? 0.6784 0.6816 0.7446 -0.0564 -0.0778 -0.1069 411 GLU A CD  
3209 O OE1 . GLU A 411 ? 0.6266 0.6396 0.7100 -0.0562 -0.0742 -0.1055 411 GLU A OE1 
3210 O OE2 . GLU A 411 ? 0.7834 0.7887 0.8429 -0.0521 -0.0827 -0.1073 411 GLU A OE2 
3211 N N   . TRP A 412 ? 0.3526 0.2992 0.3858 -0.0761 -0.0585 -0.1039 412 TRP A N   
3212 C CA  . TRP A 412 ? 0.3310 0.2664 0.3617 -0.0868 -0.0581 -0.1028 412 TRP A CA  
3213 C C   . TRP A 412 ? 0.4023 0.3125 0.4085 -0.0894 -0.0585 -0.1027 412 TRP A C   
3214 O O   . TRP A 412 ? 0.4659 0.3627 0.4664 -0.0948 -0.0577 -0.1002 412 TRP A O   
3215 C CB  . TRP A 412 ? 0.4008 0.3456 0.4463 -0.0854 -0.0507 -0.1004 412 TRP A CB  
3216 C CG  . TRP A 412 ? 0.4366 0.4045 0.5063 -0.0855 -0.0502 -0.1018 412 TRP A CG  
3217 C CD1 . TRP A 412 ? 0.4111 0.3935 0.4908 -0.0757 -0.0484 -0.1022 412 TRP A CD1 
3218 C CD2 . TRP A 412 ? 0.4460 0.4251 0.5338 -0.0965 -0.0528 -0.1025 412 TRP A CD2 
3219 N NE1 . TRP A 412 ? 0.3880 0.3888 0.4899 -0.0788 -0.0497 -0.1037 412 TRP A NE1 
3220 C CE2 . TRP A 412 ? 0.3640 0.3654 0.4728 -0.0916 -0.0521 -0.1037 412 TRP A CE2 
3221 C CE3 . TRP A 412 ? 0.4035 0.3766 0.4931 -0.1106 -0.0561 -0.1016 412 TRP A CE3 
3222 C CZ2 . TRP A 412 ? 0.2466 0.2671 0.3796 -0.0998 -0.0541 -0.1041 412 TRP A CZ2 
3223 C CZ3 . TRP A 412 ? 0.3655 0.3589 0.4802 -0.1200 -0.0578 -0.1014 412 TRP A CZ3 
3224 C CH2 . TRP A 412 ? 0.3099 0.3281 0.4467 -0.1143 -0.0566 -0.1026 412 TRP A CH2 
3225 N N   . GLY A 413 ? 0.4004 0.3042 0.3930 -0.0851 -0.0597 -0.1058 413 GLY A N   
3226 C CA  . GLY A 413 ? 0.3681 0.2507 0.3399 -0.0885 -0.0583 -0.1084 413 GLY A CA  
3227 C C   . GLY A 413 ? 0.4816 0.3578 0.4440 -0.0790 -0.0520 -0.1073 413 GLY A C   
3228 O O   . GLY A 413 ? 0.6029 0.4693 0.5556 -0.0777 -0.0497 -0.1123 413 GLY A O   
3229 N N   . ASN A 414 ? 0.4447 0.3292 0.4140 -0.0721 -0.0491 -0.1023 414 ASN A N   
3230 C CA  . ASN A 414 ? 0.4121 0.2920 0.3739 -0.0648 -0.0440 -0.1006 414 ASN A CA  
3231 C C   . ASN A 414 ? 0.3501 0.2399 0.3149 -0.0534 -0.0445 -0.1025 414 ASN A C   
3232 O O   . ASN A 414 ? 0.3893 0.2939 0.3640 -0.0488 -0.0472 -0.1025 414 ASN A O   
3233 C CB  . ASN A 414 ? 0.5322 0.4171 0.4999 -0.0621 -0.0412 -0.0947 414 ASN A CB  
3234 C CG  . ASN A 414 ? 0.5706 0.4440 0.5351 -0.0691 -0.0423 -0.0913 414 ASN A CG  
3235 O OD1 . ASN A 414 ? 0.5420 0.4242 0.5212 -0.0719 -0.0432 -0.0912 414 ASN A OD1 
3236 N ND2 . ASN A 414 ? 0.5208 0.3760 0.4687 -0.0722 -0.0413 -0.0897 414 ASN A ND2 
3237 N N   . ASN A 415 ? 0.2927 0.1744 0.2495 -0.0489 -0.0425 -0.1042 415 ASN A N   
3238 C CA  . ASN A 415 ? 0.3666 0.2567 0.3259 -0.0374 -0.0441 -0.1046 415 ASN A CA  
3239 C C   . ASN A 415 ? 0.3702 0.2757 0.3399 -0.0321 -0.0422 -0.0989 415 ASN A C   
3240 O O   . ASN A 415 ? 0.3501 0.2546 0.3208 -0.0342 -0.0388 -0.0948 415 ASN A O   
3241 C CB  . ASN A 415 ? 0.4626 0.3411 0.4139 -0.0327 -0.0437 -0.1073 415 ASN A CB  
3242 C CG  . ASN A 415 ? 0.5462 0.4117 0.4887 -0.0329 -0.0473 -0.1146 415 ASN A CG  
3243 O OD1 . ASN A 415 ? 0.6139 0.4786 0.5553 -0.0384 -0.0497 -0.1180 415 ASN A OD1 
3244 N ND2 . ASN A 415 ? 0.3325 0.1867 0.2684 -0.0264 -0.0488 -0.1173 415 ASN A ND2 
3245 N N   . ALA A 416 ? 0.2936 0.2123 0.2698 -0.0258 -0.0444 -0.0993 416 ALA A N   
3246 C CA  . ALA A 416 ? 0.2235 0.1567 0.2099 -0.0214 -0.0426 -0.0949 416 ALA A CA  
3247 C C   . ALA A 416 ? 0.2203 0.1595 0.2055 -0.0133 -0.0442 -0.0967 416 ALA A C   
3248 O O   . ALA A 416 ? 0.2617 0.1976 0.2401 -0.0110 -0.0470 -0.1016 416 ALA A O   
3249 C CB  . ALA A 416 ? 0.2471 0.1914 0.2439 -0.0236 -0.0431 -0.0938 416 ALA A CB  
3250 N N   . PHE A 417 ? 0.2060 0.1533 0.1965 -0.0095 -0.0426 -0.0933 417 PHE A N   
3251 C CA  . PHE A 417 ? 0.2028 0.1575 0.1928 -0.0027 -0.0437 -0.0952 417 PHE A CA  
3252 C C   . PHE A 417 ? 0.2302 0.1985 0.2291 -0.0023 -0.0424 -0.0915 417 PHE A C   
3253 O O   . PHE A 417 ? 0.2751 0.2451 0.2796 -0.0047 -0.0405 -0.0871 417 PHE A O   
3254 C CB  . PHE A 417 ? 0.2154 0.1643 0.2014 0.0017  -0.0439 -0.0960 417 PHE A CB  
3255 C CG  . PHE A 417 ? 0.2377 0.1706 0.2134 0.0017  -0.0454 -0.1000 417 PHE A CG  
3256 C CD1 . PHE A 417 ? 0.2723 0.1931 0.2446 -0.0047 -0.0443 -0.0982 417 PHE A CD1 
3257 C CD2 . PHE A 417 ? 0.2446 0.1731 0.2121 0.0079  -0.0475 -0.1062 417 PHE A CD2 
3258 C CE1 . PHE A 417 ? 0.2892 0.1936 0.2513 -0.0060 -0.0455 -0.1023 417 PHE A CE1 
3259 C CE2 . PHE A 417 ? 0.2758 0.1871 0.2329 0.0079  -0.0493 -0.1104 417 PHE A CE2 
3260 C CZ  . PHE A 417 ? 0.3122 0.2113 0.2671 0.0006  -0.0485 -0.1083 417 PHE A CZ  
3261 N N   . PHE A 418 ? 0.1894 0.1653 0.1870 0.0000  -0.0434 -0.0937 418 PHE A N   
3262 C CA  . PHE A 418 ? 0.1926 0.1792 0.1960 -0.0009 -0.0426 -0.0904 418 PHE A CA  
3263 C C   . PHE A 418 ? 0.2550 0.2496 0.2558 0.0030  -0.0422 -0.0920 418 PHE A C   
3264 O O   . PHE A 418 ? 0.3486 0.3433 0.3411 0.0077  -0.0427 -0.0971 418 PHE A O   
3265 C CB  . PHE A 418 ? 0.1724 0.1621 0.1758 -0.0033 -0.0443 -0.0907 418 PHE A CB  
3266 C CG  . PHE A 418 ? 0.1883 0.1840 0.1984 -0.0061 -0.0437 -0.0861 418 PHE A CG  
3267 C CD1 . PHE A 418 ? 0.2299 0.2324 0.2375 -0.0061 -0.0439 -0.0847 418 PHE A CD1 
3268 C CD2 . PHE A 418 ? 0.2192 0.2128 0.2369 -0.0090 -0.0429 -0.0833 418 PHE A CD2 
3269 C CE1 . PHE A 418 ? 0.2042 0.2091 0.2162 -0.0098 -0.0442 -0.0800 418 PHE A CE1 
3270 C CE2 . PHE A 418 ? 0.1712 0.1680 0.1938 -0.0109 -0.0426 -0.0795 418 PHE A CE2 
3271 C CZ  . PHE A 418 ? 0.1641 0.1651 0.1833 -0.0116 -0.0436 -0.0776 418 PHE A CZ  
3272 N N   . TYR A 419 ? 0.2619 0.2625 0.2684 0.0009  -0.0412 -0.0880 419 TYR A N   
3273 C CA  . TYR A 419 ? 0.3219 0.3336 0.3280 0.0032  -0.0414 -0.0901 419 TYR A CA  
3274 C C   . TYR A 419 ? 0.3303 0.3521 0.3405 -0.0009 -0.0429 -0.0884 419 TYR A C   
3275 O O   . TYR A 419 ? 0.2583 0.2725 0.2684 -0.0071 -0.0424 -0.0814 419 TYR A O   
3276 C CB  . TYR A 419 ? 0.3169 0.3315 0.3298 0.0053  -0.0421 -0.0909 419 TYR A CB  
3277 C CG  . TYR A 419 ? 0.3028 0.3120 0.3191 -0.0024 -0.0414 -0.0824 419 TYR A CG  
3278 C CD1 . TYR A 419 ? 0.2752 0.2944 0.2981 -0.0065 -0.0434 -0.0809 419 TYR A CD1 
3279 C CD2 . TYR A 419 ? 0.2180 0.2163 0.2352 -0.0032 -0.0408 -0.0802 419 TYR A CD2 
3280 C CE1 . TYR A 419 ? 0.2702 0.2810 0.2923 -0.0137 -0.0431 -0.0727 419 TYR A CE1 
3281 C CE2 . TYR A 419 ? 0.2423 0.2364 0.2617 -0.0081 -0.0406 -0.0752 419 TYR A CE2 
3282 C CZ  . TYR A 419 ? 0.2874 0.2867 0.3090 -0.0128 -0.0417 -0.0718 419 TYR A CZ  
3283 O OH  . TYR A 419 ? 0.1665 0.1593 0.1879 -0.0177 -0.0418 -0.0674 419 TYR A OH  
3284 N N   . TYR A 420 ? 0.3588 0.3999 0.3718 0.0027  -0.0446 -0.0955 420 TYR A N   
3285 C CA  . TYR A 420 ? 0.3016 0.3561 0.3179 -0.0029 -0.0470 -0.0936 420 TYR A CA  
3286 C C   . TYR A 420 ? 0.2819 0.3600 0.3089 -0.0027 -0.0481 -0.0972 420 TYR A C   
3287 O O   . TYR A 420 ? 0.2139 0.3156 0.2398 0.0048  -0.0473 -0.1067 420 TYR A O   
3288 C CB  . TYR A 420 ? 0.2896 0.3534 0.2953 -0.0001 -0.0481 -0.0984 420 TYR A CB  
3289 C CG  . TYR A 420 ? 0.2740 0.3501 0.2801 -0.0073 -0.0517 -0.0941 420 TYR A CG  
3290 C CD1 . TYR A 420 ? 0.2593 0.3196 0.2685 -0.0149 -0.0545 -0.0851 420 TYR A CD1 
3291 C CD2 . TYR A 420 ? 0.2608 0.3671 0.2619 -0.0064 -0.0520 -0.0981 420 TYR A CD2 
3292 C CE1 . TYR A 420 ? 0.1992 0.2681 0.2088 -0.0217 -0.0595 -0.0802 420 TYR A CE1 
3293 C CE2 . TYR A 420 ? 0.3122 0.4264 0.3126 -0.0143 -0.0531 -0.0866 420 TYR A CE2 
3294 C CZ  . TYR A 420 ? 0.3214 0.4194 0.3272 -0.0227 -0.0606 -0.0824 420 TYR A CZ  
3295 O OH  . TYR A 420 ? 0.3654 0.4661 0.3694 -0.0300 -0.0623 -0.0696 420 TYR A OH  
3296 N N   . PHE A 421 ? 0.1832 0.2565 0.2192 -0.0106 -0.0498 -0.0890 421 PHE A N   
3297 C CA  . PHE A 421 ? 0.1922 0.2887 0.2428 -0.0136 -0.0521 -0.0883 421 PHE A CA  
3298 C C   . PHE A 421 ? 0.2682 0.3944 0.3271 -0.0214 -0.0533 -0.0834 421 PHE A C   
3299 O O   . PHE A 421 ? 0.2419 0.3560 0.2986 -0.0307 -0.0555 -0.0747 421 PHE A O   
3300 C CB  . PHE A 421 ? 0.2394 0.3149 0.2922 -0.0203 -0.0537 -0.0788 421 PHE A CB  
3301 C CG  . PHE A 421 ? 0.2664 0.3617 0.3350 -0.0240 -0.0572 -0.0755 421 PHE A CG  
3302 C CD1 . PHE A 421 ? 0.2392 0.3461 0.3152 -0.0153 -0.0583 -0.0827 421 PHE A CD1 
3303 C CD2 . PHE A 421 ? 0.2056 0.3078 0.2827 -0.0361 -0.0604 -0.0641 421 PHE A CD2 
3304 C CE1 . PHE A 421 ? 0.2497 0.3785 0.3434 -0.0182 -0.0619 -0.0773 421 PHE A CE1 
3305 C CE2 . PHE A 421 ? 0.1765 0.2978 0.2699 -0.0407 -0.0638 -0.0582 421 PHE A CE2 
3306 C CZ  . PHE A 421 ? 0.2533 0.3895 0.3559 -0.0316 -0.0642 -0.0642 421 PHE A CZ  
3307 N N   . GLU A 422 ? 0.2851 0.4391 0.3478 -0.0151 -0.0458 -0.0800 422 GLU A N   
3308 C CA  . GLU A 422 ? 0.2192 0.3966 0.2833 -0.0200 -0.0395 -0.0677 422 GLU A CA  
3309 C C   . GLU A 422 ? 0.2992 0.5053 0.3842 -0.0259 -0.0363 -0.0560 422 GLU A C   
3310 O O   . GLU A 422 ? 0.3898 0.6206 0.4773 -0.0287 -0.0286 -0.0458 422 GLU A O   
3311 C CB  . GLU A 422 ? 0.1863 0.3767 0.2353 -0.0075 -0.0306 -0.0727 422 GLU A CB  
3312 C CG  . GLU A 422 ? 0.3324 0.5019 0.3595 -0.0051 -0.0336 -0.0797 422 GLU A CG  
3313 C CD  . GLU A 422 ? 0.3907 0.5712 0.3994 0.0074  -0.0256 -0.0855 422 GLU A CD  
3314 O OE1 . GLU A 422 ? 0.4342 0.6300 0.4458 0.0188  -0.0184 -0.0904 422 GLU A OE1 
3315 O OE2 . GLU A 422 ? 0.4756 0.6484 0.4660 0.0067  -0.0270 -0.0856 422 GLU A OE2 
3316 N N   . HIS A 423 ? 0.3615 0.5660 0.4614 -0.0281 -0.0420 -0.0568 423 HIS A N   
3317 C CA  . HIS A 423 ? 0.3147 0.5501 0.4375 -0.0335 -0.0402 -0.0458 423 HIS A CA  
3318 C C   . HIS A 423 ? 0.2797 0.5077 0.4128 -0.0528 -0.0489 -0.0346 423 HIS A C   
3319 O O   . HIS A 423 ? 0.3272 0.5262 0.4567 -0.0575 -0.0586 -0.0386 423 HIS A O   
3320 C CB  . HIS A 423 ? 0.2314 0.4765 0.3663 -0.0220 -0.0414 -0.0526 423 HIS A CB  
3321 C CG  . HIS A 423 ? 0.2406 0.5208 0.4028 -0.0272 -0.0410 -0.0413 423 HIS A CG  
3322 N ND1 . HIS A 423 ? 0.1346 0.4554 0.3095 -0.0236 -0.0292 -0.0333 423 HIS A ND1 
3323 C CD2 . HIS A 423 ? 0.3200 0.6013 0.4993 -0.0364 -0.0511 -0.0360 423 HIS A CD2 
3324 C CE1 . HIS A 423 ? 0.2317 0.5804 0.4342 -0.0309 -0.0321 -0.0234 423 HIS A CE1 
3325 N NE2 . HIS A 423 ? 0.2611 0.5794 0.4632 -0.0383 -0.0457 -0.0243 423 HIS A NE2 
3326 N N   . ARG A 424 ? 0.2698 0.5210 0.4131 -0.0639 -0.0451 -0.0202 424 ARG A N   
3327 C CA  . ARG A 424 ? 0.2899 0.5321 0.4428 -0.0817 -0.0533 -0.0088 424 ARG A CA  
3328 C C   . ARG A 424 ? 0.2419 0.5008 0.4159 -0.0812 -0.0545 -0.0043 424 ARG A C   
3329 O O   . ARG A 424 ? 0.1680 0.4677 0.3587 -0.0789 -0.0461 0.0023  424 ARG A O   
3330 C CB  . ARG A 424 ? 0.3058 0.5598 0.4581 -0.0955 -0.0495 0.0060  424 ARG A CB  
3331 C CG  . ARG A 424 ? 0.2122 0.4539 0.3719 -0.1095 -0.0545 0.0179  424 ARG A CG  
3332 C CD  . ARG A 424 ? 0.3113 0.5642 0.4686 -0.1234 -0.0504 0.0335  424 ARG A CD  
3333 N NE  . ARG A 424 ? 0.4647 0.7095 0.6290 -0.1368 -0.0546 0.0448  424 ARG A NE  
3334 C CZ  . ARG A 424 ? 0.4714 0.6773 0.6224 -0.1451 -0.0631 0.0468  424 ARG A CZ  
3335 N NH1 . ARG A 424 ? 0.4143 0.5863 0.5463 -0.1404 -0.0676 0.0387  424 ARG A NH1 
3336 N NH2 . ARG A 424 ? 0.3562 0.5581 0.5129 -0.1569 -0.0669 0.0564  424 ARG A NH2 
3337 N N   . SER A 425 ? 0.2826 0.5105 0.4552 -0.0821 -0.0644 -0.0086 425 SER A N   
3338 C CA  . SER A 425 ? 0.3268 0.5667 0.5178 -0.0824 -0.0685 -0.0061 425 SER A CA  
3339 C C   . SER A 425 ? 0.3594 0.6295 0.5684 -0.0933 -0.0643 0.0081  425 SER A C   
3340 O O   . SER A 425 ? 0.4075 0.6723 0.6103 -0.1056 -0.0626 0.0171  425 SER A O   
3341 C CB  . SER A 425 ? 0.3319 0.5333 0.5120 -0.0849 -0.0779 -0.0134 425 SER A CB  
3342 O OG  . SER A 425 ? 0.3005 0.5153 0.4956 -0.0880 -0.0825 -0.0104 425 SER A OG  
3343 N N   . SER A 426 ? 0.3237 0.6248 0.5552 -0.0885 -0.0631 0.0107  426 SER A N   
3344 C CA  . SER A 426 ? 0.2953 0.6291 0.5471 -0.0979 -0.0583 0.0241  426 SER A CA  
3345 C C   . SER A 426 ? 0.3454 0.6560 0.5949 -0.1137 -0.0682 0.0289  426 SER A C   
3346 O O   . SER A 426 ? 0.2209 0.5466 0.4795 -0.1266 -0.0659 0.0414  426 SER A O   
3347 C CB  . SER A 426 ? 0.2499 0.6220 0.5276 -0.0864 -0.0547 0.0240  426 SER A CB  
3348 O OG  . SER A 426 ? 0.2759 0.6324 0.5589 -0.0836 -0.0675 0.0173  426 SER A OG  
3349 N N   . LYS A 427 ? 0.4252 0.6992 0.6600 -0.1121 -0.0783 0.0187  427 LYS A N   
3350 C CA  . LYS A 427 ? 0.4951 0.7455 0.7230 -0.1241 -0.0872 0.0210  427 LYS A CA  
3351 C C   . LYS A 427 ? 0.5156 0.7243 0.7162 -0.1307 -0.0890 0.0201  427 LYS A C   
3352 O O   . LYS A 427 ? 0.5453 0.7296 0.7357 -0.1383 -0.0960 0.0207  427 LYS A O   
3353 C CB  . LYS A 427 ? 0.5625 0.8023 0.7892 -0.1174 -0.0959 0.0111  427 LYS A CB  
3354 C CG  . LYS A 427 ? 0.6428 0.9201 0.8959 -0.1078 -0.0963 0.0102  427 LYS A CG  
3355 C CD  . LYS A 427 ? 0.6443 0.9076 0.8908 -0.1014 -0.1061 0.0005  427 LYS A CD  
3356 C CE  . LYS A 427 ? 0.6085 0.8471 0.8420 -0.1143 -0.1147 0.0030  427 LYS A CE  
3357 N NZ  . LYS A 427 ? 0.5409 0.7667 0.7646 -0.1093 -0.1235 -0.0041 427 LYS A NZ  
3358 N N   . LEU A 428 ? 0.4133 0.6143 0.6022 -0.1269 -0.0830 0.0187  428 LEU A N   
3359 C CA  . LEU A 428 ? 0.3826 0.5452 0.5473 -0.1303 -0.0847 0.0170  428 LEU A CA  
3360 C C   . LEU A 428 ? 0.4159 0.5687 0.5782 -0.1460 -0.0888 0.0291  428 LEU A C   
3361 O O   . LEU A 428 ? 0.4874 0.6636 0.6610 -0.1558 -0.0857 0.0421  428 LEU A O   
3362 C CB  . LEU A 428 ? 0.4438 0.6072 0.6005 -0.1257 -0.0784 0.0162  428 LEU A CB  
3363 C CG  . LEU A 428 ? 0.4724 0.6072 0.6107 -0.1138 -0.0782 0.0021  428 LEU A CG  
3364 C CD1 . LEU A 428 ? 0.5384 0.6774 0.6703 -0.1116 -0.0738 0.0031  428 LEU A CD1 
3365 C CD2 . LEU A 428 ? 0.4904 0.5867 0.6100 -0.1153 -0.0818 -0.0017 428 LEU A CD2 
3366 N N   . PRO A 429 ? 0.3302 0.4493 0.4769 -0.1483 -0.0954 0.0254  429 PRO A N   
3367 C CA  . PRO A 429 ? 0.2953 0.4015 0.4383 -0.1628 -0.1015 0.0361  429 PRO A CA  
3368 C C   . PRO A 429 ? 0.3586 0.4475 0.4880 -0.1677 -0.1000 0.0426  429 PRO A C   
3369 O O   . PRO A 429 ? 0.3022 0.3893 0.4321 -0.1812 -0.1036 0.0548  429 PRO A O   
3370 C CB  . PRO A 429 ? 0.2821 0.3570 0.4099 -0.1602 -0.1082 0.0278  429 PRO A CB  
3371 C CG  . PRO A 429 ? 0.3461 0.4226 0.4722 -0.1458 -0.1051 0.0146  429 PRO A CG  
3372 C CD  . PRO A 429 ? 0.2870 0.3800 0.4182 -0.1375 -0.0970 0.0118  429 PRO A CD  
3373 N N   . TRP A 430 ? 0.3090 0.3855 0.4266 -0.1570 -0.0956 0.0347  430 TRP A N   
3374 C CA  . TRP A 430 ? 0.3924 0.4545 0.4982 -0.1606 -0.0951 0.0408  430 TRP A CA  
3375 C C   . TRP A 430 ? 0.3865 0.4818 0.5046 -0.1694 -0.0901 0.0542  430 TRP A C   
3376 O O   . TRP A 430 ? 0.3316 0.4624 0.4674 -0.1678 -0.0847 0.0553  430 TRP A O   
3377 C CB  . TRP A 430 ? 0.3980 0.4409 0.4900 -0.1466 -0.0920 0.0285  430 TRP A CB  
3378 C CG  . TRP A 430 ? 0.3811 0.3950 0.4602 -0.1376 -0.0938 0.0165  430 TRP A CG  
3379 C CD1 . TRP A 430 ? 0.3767 0.3924 0.4562 -0.1272 -0.0908 0.0047  430 TRP A CD1 
3380 C CD2 . TRP A 430 ? 0.3809 0.3620 0.4440 -0.1384 -0.0980 0.0162  430 TRP A CD2 
3381 N NE1 . TRP A 430 ? 0.3058 0.2937 0.3704 -0.1223 -0.0917 -0.0021 430 TRP A NE1 
3382 C CE2 . TRP A 430 ? 0.3414 0.3085 0.3966 -0.1283 -0.0961 0.0042  430 TRP A CE2 
3383 C CE3 . TRP A 430 ? 0.3301 0.2923 0.3844 -0.1467 -0.1034 0.0253  430 TRP A CE3 
3384 C CZ2 . TRP A 430 ? 0.3223 0.2603 0.3624 -0.1260 -0.0984 0.0007  430 TRP A CZ2 
3385 C CZ3 . TRP A 430 ? 0.3536 0.2843 0.3928 -0.1434 -0.1069 0.0208  430 TRP A CZ3 
3386 C CH2 . TRP A 430 ? 0.3300 0.2504 0.3630 -0.1329 -0.1039 0.0084  430 TRP A CH2 
3387 N N   . PRO A 431 ? 0.4124 0.4975 0.5209 -0.1786 -0.0915 0.0653  431 PRO A N   
3388 C CA  . PRO A 431 ? 0.4312 0.5504 0.5496 -0.1882 -0.0851 0.0798  431 PRO A CA  
3389 C C   . PRO A 431 ? 0.4596 0.6012 0.5789 -0.1794 -0.0769 0.0759  431 PRO A C   
3390 O O   . PRO A 431 ? 0.4986 0.6226 0.6081 -0.1675 -0.0782 0.0631  431 PRO A O   
3391 C CB  . PRO A 431 ? 0.3215 0.4169 0.4253 -0.2005 -0.0904 0.0925  431 PRO A CB  
3392 C CG  . PRO A 431 ? 0.3236 0.3755 0.4086 -0.1914 -0.0974 0.0813  431 PRO A CG  
3393 C CD  . PRO A 431 ? 0.3110 0.3558 0.3999 -0.1811 -0.0986 0.0665  431 PRO A CD  
3394 N N   . GLU A 432 ? 0.4560 0.6378 0.5866 -0.1854 -0.0678 0.0874  432 GLU A N   
3395 C CA  . GLU A 432 ? 0.3704 0.5835 0.5031 -0.1777 -0.0579 0.0852  432 GLU A CA  
3396 C C   . GLU A 432 ? 0.3501 0.5424 0.4631 -0.1748 -0.0608 0.0816  432 GLU A C   
3397 O O   . GLU A 432 ? 0.3160 0.5162 0.4263 -0.1616 -0.0579 0.0691  432 GLU A O   
3398 C CB  . GLU A 432 ? 0.3603 0.6185 0.5041 -0.1858 -0.0453 0.1010  432 GLU A CB  
3399 C CG  . GLU A 432 ? 0.6393 0.9165 0.8037 -0.1923 -0.0443 0.1077  432 GLU A CG  
3400 C CD  . GLU A 432 ? 0.6079 0.8610 0.7671 -0.2097 -0.0525 0.1207  432 GLU A CD  
3401 O OE1 . GLU A 432 ? 0.6571 0.9174 0.8096 -0.2211 -0.0478 0.1360  432 GLU A OE1 
3402 O OE2 . GLU A 432 ? 0.5251 0.7522 0.6856 -0.2118 -0.0634 0.1156  432 GLU A OE2 
3403 N N   . TRP A 433 ? 0.3560 0.5192 0.4539 -0.1853 -0.0673 0.0915  433 TRP A N   
3404 C CA  . TRP A 433 ? 0.3614 0.5039 0.4390 -0.1805 -0.0701 0.0896  433 TRP A CA  
3405 C C   . TRP A 433 ? 0.3384 0.4522 0.4101 -0.1659 -0.0773 0.0702  433 TRP A C   
3406 O O   . TRP A 433 ? 0.3269 0.4283 0.3830 -0.1524 -0.0767 0.0624  433 TRP A O   
3407 C CB  . TRP A 433 ? 0.3772 0.4912 0.4397 -0.1946 -0.0769 0.1056  433 TRP A CB  
3408 C CG  . TRP A 433 ? 0.3956 0.4648 0.4526 -0.1968 -0.0895 0.1026  433 TRP A CG  
3409 C CD1 . TRP A 433 ? 0.4845 0.5437 0.5439 -0.2060 -0.0928 0.1106  433 TRP A CD1 
3410 C CD2 . TRP A 433 ? 0.4033 0.4329 0.4491 -0.1851 -0.0982 0.0891  433 TRP A CD2 
3411 N NE1 . TRP A 433 ? 0.4802 0.4970 0.5291 -0.2008 -0.1026 0.1026  433 TRP A NE1 
3412 C CE2 . TRP A 433 ? 0.4545 0.4534 0.4954 -0.1872 -0.1049 0.0897  433 TRP A CE2 
3413 C CE3 . TRP A 433 ? 0.4086 0.4280 0.4484 -0.1722 -0.1005 0.0759  433 TRP A CE3 
3414 C CZ2 . TRP A 433 ? 0.5054 0.4664 0.5356 -0.1761 -0.1114 0.0781  433 TRP A CZ2 
3415 C CZ3 . TRP A 433 ? 0.4523 0.4335 0.4833 -0.1609 -0.1070 0.0647  433 TRP A CZ3 
3416 C CH2 . TRP A 433 ? 0.4869 0.4407 0.5132 -0.1627 -0.1114 0.0662  433 TRP A CH2 
3417 N N   . MET A 434 ? 0.3225 0.4210 0.4011 -0.1616 -0.0810 0.0607  434 MET A N   
3418 C CA  . MET A 434 ? 0.3254 0.3972 0.3973 -0.1460 -0.0842 0.0425  434 MET A CA  
3419 C C   . MET A 434 ? 0.2178 0.3122 0.2964 -0.1334 -0.0786 0.0292  434 MET A C   
3420 O O   . MET A 434 ? 0.2253 0.3007 0.2977 -0.1205 -0.0796 0.0148  434 MET A O   
3421 C CB  . MET A 434 ? 0.3139 0.3591 0.3848 -0.1432 -0.0874 0.0369  434 MET A CB  
3422 C CG  . MET A 434 ? 0.3560 0.3712 0.4158 -0.1520 -0.0945 0.0463  434 MET A CG  
3423 S SD  . MET A 434 ? 0.3443 0.3323 0.4002 -0.1483 -0.0979 0.0384  434 MET A SD  
3424 C CE  . MET A 434 ? 0.3440 0.3116 0.3908 -0.1292 -0.0949 0.0200  434 MET A CE  
3425 N N   . GLY A 435 ? 0.3271 0.4629 0.4183 -0.1363 -0.0717 0.0342  435 GLY A N   
3426 C CA  . GLY A 435 ? 0.2570 0.4138 0.3496 -0.1206 -0.0644 0.0220  435 GLY A CA  
3427 C C   . GLY A 435 ? 0.3264 0.4761 0.4261 -0.1110 -0.0668 0.0073  435 GLY A C   
3428 O O   . GLY A 435 ? 0.4129 0.5545 0.5209 -0.1123 -0.0685 0.0077  435 GLY A O   
3429 N N   . VAL A 436 ? 0.3060 0.4524 0.3975 -0.0970 -0.0649 -0.0065 436 VAL A N   
3430 C CA  . VAL A 436 ? 0.2158 0.3521 0.3102 -0.0861 -0.0662 -0.0204 436 VAL A CA  
3431 C C   . VAL A 436 ? 0.2691 0.3630 0.3535 -0.0812 -0.0699 -0.0280 436 VAL A C   
3432 O O   . VAL A 436 ? 0.3215 0.4004 0.3958 -0.0736 -0.0699 -0.0363 436 VAL A O   
3433 C CB  . VAL A 436 ? 0.4486 0.5968 0.5360 -0.0711 -0.0601 -0.0322 436 VAL A CB  
3434 C CG1 . VAL A 436 ? 0.1366 0.2766 0.2273 -0.0621 -0.0619 -0.0438 436 VAL A CG1 
3435 C CG2 . VAL A 436 ? 0.1516 0.3346 0.2419 -0.0668 -0.0495 -0.0259 436 VAL A CG2 
3436 N N   . MET A 437 ? 0.2929 0.3730 0.3793 -0.0852 -0.0704 -0.0259 437 MET A N   
3437 C CA  . MET A 437 ? 0.2685 0.3183 0.3418 -0.0834 -0.0693 -0.0296 437 MET A CA  
3438 C C   . MET A 437 ? 0.3164 0.3548 0.3784 -0.0741 -0.0625 -0.0412 437 MET A C   
3439 O O   . MET A 437 ? 0.2087 0.2563 0.2693 -0.0714 -0.0598 -0.0446 437 MET A O   
3440 C CB  . MET A 437 ? 0.2287 0.2680 0.3027 -0.0921 -0.0723 -0.0217 437 MET A CB  
3441 C CG  . MET A 437 ? 0.2091 0.2541 0.2866 -0.1053 -0.0769 -0.0066 437 MET A CG  
3442 S SD  . MET A 437 ? 0.3884 0.4180 0.4647 -0.1155 -0.0817 0.0014  437 MET A SD  
3443 C CE  . MET A 437 ? 0.4383 0.4334 0.4983 -0.1058 -0.0805 -0.0095 437 MET A CE  
3444 N N   . HIS A 438 ? 0.3166 0.3343 0.3666 -0.0714 -0.0599 -0.0424 438 HIS A N   
3445 C CA  . HIS A 438 ? 0.3571 0.3597 0.3938 -0.0665 -0.0531 -0.0463 438 HIS A CA  
3446 C C   . HIS A 438 ? 0.3402 0.3411 0.3779 -0.0680 -0.0536 -0.0465 438 HIS A C   
3447 O O   . HIS A 438 ? 0.3044 0.3024 0.3479 -0.0729 -0.0578 -0.0435 438 HIS A O   
3448 C CB  . HIS A 438 ? 0.3542 0.3371 0.3857 -0.0647 -0.0532 -0.0456 438 HIS A CB  
3449 C CG  . HIS A 438 ? 0.3007 0.2672 0.3240 -0.0587 -0.0509 -0.0480 438 HIS A CG  
3450 N ND1 . HIS A 438 ? 0.2810 0.2462 0.3002 -0.0522 -0.0479 -0.0501 438 HIS A ND1 
3451 C CD2 . HIS A 438 ? 0.3111 0.2630 0.3305 -0.0584 -0.0517 -0.0485 438 HIS A CD2 
3452 C CE1 . HIS A 438 ? 0.3322 0.2852 0.3473 -0.0485 -0.0461 -0.0521 438 HIS A CE1 
3453 N NE2 . HIS A 438 ? 0.3555 0.3003 0.3693 -0.0523 -0.0479 -0.0516 438 HIS A NE2 
3454 N N   . GLY A 439 ? 0.2590 0.2581 0.2901 -0.0641 -0.0519 -0.0481 439 GLY A N   
3455 C CA  . GLY A 439 ? 0.2285 0.2229 0.2593 -0.0643 -0.0540 -0.0487 439 GLY A CA  
3456 C C   . GLY A 439 ? 0.2811 0.2957 0.3211 -0.0680 -0.0569 -0.0480 439 GLY A C   
3457 O O   . GLY A 439 ? 0.3364 0.3476 0.3764 -0.0679 -0.0600 -0.0483 439 GLY A O   
3458 N N   . TYR A 440 ? 0.1978 0.2342 0.2477 -0.0701 -0.0579 -0.0463 440 TYR A N   
3459 C CA  . TYR A 440 ? 0.1743 0.2341 0.2405 -0.0725 -0.0635 -0.0446 440 TYR A CA  
3460 C C   . TYR A 440 ? 0.2705 0.3393 0.3361 -0.0680 -0.0671 -0.0413 440 TYR A C   
3461 O O   . TYR A 440 ? 0.2495 0.3437 0.3337 -0.0681 -0.0725 -0.0370 440 TYR A O   
3462 C CB  . TYR A 440 ? 0.1602 0.2370 0.2491 -0.0778 -0.0684 -0.0413 440 TYR A CB  
3463 C CG  . TYR A 440 ? 0.2786 0.3371 0.3643 -0.0848 -0.0714 -0.0355 440 TYR A CG  
3464 C CD1 . TYR A 440 ? 0.2750 0.3112 0.3488 -0.0858 -0.0698 -0.0342 440 TYR A CD1 
3465 C CD2 . TYR A 440 ? 0.2879 0.3511 0.3809 -0.0902 -0.0767 -0.0315 440 TYR A CD2 
3466 C CE1 . TYR A 440 ? 0.2305 0.2491 0.2991 -0.0919 -0.0736 -0.0292 440 TYR A CE1 
3467 C CE2 . TYR A 440 ? 0.2751 0.3203 0.3620 -0.0973 -0.0806 -0.0265 440 TYR A CE2 
3468 C CZ  . TYR A 440 ? 0.3055 0.3281 0.3798 -0.0980 -0.0789 -0.0255 440 TYR A CZ  
3469 O OH  . TYR A 440 ? 0.3924 0.3966 0.4600 -0.1047 -0.0838 -0.0208 440 TYR A OH  
3470 N N   . GLU A 441 ? 0.3026 0.3495 0.3542 -0.0597 -0.0644 -0.0451 441 GLU A N   
3471 C CA  . GLU A 441 ? 0.3020 0.3525 0.3592 -0.0482 -0.0658 -0.0509 441 GLU A CA  
3472 C C   . GLU A 441 ? 0.2657 0.3038 0.3158 -0.0468 -0.0664 -0.0522 441 GLU A C   
3473 O O   . GLU A 441 ? 0.3592 0.4018 0.4156 -0.0386 -0.0693 -0.0573 441 GLU A O   
3474 C CB  . GLU A 441 ? 0.2792 0.3180 0.3275 -0.0392 -0.0600 -0.0570 441 GLU A CB  
3475 C CG  . GLU A 441 ? 0.3049 0.3181 0.3354 -0.0374 -0.0538 -0.0563 441 GLU A CG  
3476 C CD  . GLU A 441 ? 0.4089 0.4111 0.4339 -0.0432 -0.0519 -0.0533 441 GLU A CD  
3477 O OE1 . GLU A 441 ? 0.3344 0.3445 0.3618 -0.0515 -0.0536 -0.0493 441 GLU A OE1 
3478 O OE2 . GLU A 441 ? 0.4021 0.3899 0.4215 -0.0395 -0.0487 -0.0552 441 GLU A OE2 
3479 N N   . ILE A 442 ? 0.2293 0.2535 0.2675 -0.0536 -0.0630 -0.0496 442 ILE A N   
3480 C CA  . ILE A 442 ? 0.2480 0.2579 0.2800 -0.0512 -0.0639 -0.0521 442 ILE A CA  
3481 C C   . ILE A 442 ? 0.2811 0.3055 0.3231 -0.0525 -0.0716 -0.0512 442 ILE A C   
3482 O O   . ILE A 442 ? 0.2977 0.3148 0.3371 -0.0465 -0.0744 -0.0539 442 ILE A O   
3483 C CB  . ILE A 442 ? 0.2786 0.2734 0.3046 -0.0549 -0.0624 -0.0523 442 ILE A CB  
3484 C CG1 . ILE A 442 ? 0.2858 0.2698 0.3055 -0.0523 -0.0563 -0.0530 442 ILE A CG1 
3485 C CG2 . ILE A 442 ? 0.2309 0.2111 0.2499 -0.0527 -0.0649 -0.0539 442 ILE A CG2 
3486 C CD1 . ILE A 442 ? 0.2090 0.1784 0.2234 -0.0541 -0.0551 -0.0534 442 ILE A CD1 
3487 N N   . GLU A 443 ? 0.2409 0.2875 0.2982 -0.0592 -0.0768 -0.0477 443 GLU A N   
3488 C CA  . GLU A 443 ? 0.2499 0.3146 0.3223 -0.0597 -0.0861 -0.0459 443 GLU A CA  
3489 C C   . GLU A 443 ? 0.3135 0.3923 0.3992 -0.0486 -0.0906 -0.0481 443 GLU A C   
3490 O O   . GLU A 443 ? 0.3521 0.4386 0.4466 -0.0437 -0.0981 -0.0488 443 GLU A O   
3491 C CB  . GLU A 443 ? 0.3002 0.3901 0.3905 -0.0687 -0.0890 -0.0420 443 GLU A CB  
3492 C CG  . GLU A 443 ? 0.3920 0.5086 0.4979 -0.0706 -0.0862 -0.0394 443 GLU A CG  
3493 C CD  . GLU A 443 ? 0.4357 0.5593 0.5563 -0.0781 -0.0868 -0.0381 443 GLU A CD  
3494 O OE1 . GLU A 443 ? 0.3778 0.4746 0.4842 -0.0820 -0.0844 -0.0382 443 GLU A OE1 
3495 O OE2 . GLU A 443 ? 0.4665 0.6190 0.6134 -0.0798 -0.0905 -0.0336 443 GLU A OE2 
3496 N N   . PHE A 444 ? 0.2234 0.3049 0.3110 -0.0421 -0.0859 -0.0518 444 PHE A N   
3497 C CA  . PHE A 444 ? 0.2194 0.3155 0.3198 -0.0273 -0.0872 -0.0604 444 PHE A CA  
3498 C C   . PHE A 444 ? 0.3233 0.3910 0.4068 -0.0180 -0.0866 -0.0689 444 PHE A C   
3499 O O   . PHE A 444 ? 0.3893 0.4635 0.4804 -0.0068 -0.0924 -0.0752 444 PHE A O   
3500 C CB  . PHE A 444 ? 0.2631 0.3776 0.3714 -0.0226 -0.0810 -0.0646 444 PHE A CB  
3501 C CG  . PHE A 444 ? 0.3218 0.4742 0.4536 -0.0283 -0.0810 -0.0557 444 PHE A CG  
3502 C CD1 . PHE A 444 ? 0.3597 0.5087 0.4897 -0.0437 -0.0813 -0.0447 444 PHE A CD1 
3503 C CD2 . PHE A 444 ? 0.2998 0.4920 0.4554 -0.0178 -0.0796 -0.0569 444 PHE A CD2 
3504 C CE1 . PHE A 444 ? 0.2886 0.4703 0.4426 -0.0502 -0.0815 -0.0348 444 PHE A CE1 
3505 C CE2 . PHE A 444 ? 0.3228 0.5520 0.5009 -0.0236 -0.0762 -0.0461 444 PHE A CE2 
3506 C CZ  . PHE A 444 ? 0.2273 0.4501 0.4053 -0.0407 -0.0774 -0.0353 444 PHE A CZ  
3507 N N   . VAL A 445 ? 0.3325 0.3714 0.3943 -0.0221 -0.0793 -0.0675 445 VAL A N   
3508 C CA  . VAL A 445 ? 0.3378 0.3522 0.3838 -0.0162 -0.0762 -0.0710 445 VAL A CA  
3509 C C   . VAL A 445 ? 0.3781 0.3842 0.4210 -0.0171 -0.0835 -0.0693 445 VAL A C   
3510 O O   . VAL A 445 ? 0.3680 0.3641 0.4073 -0.0085 -0.0873 -0.0739 445 VAL A O   
3511 C CB  . VAL A 445 ? 0.2923 0.2874 0.3197 -0.0224 -0.0650 -0.0659 445 VAL A CB  
3512 C CG1 . VAL A 445 ? 0.2894 0.2656 0.3050 -0.0191 -0.0627 -0.0670 445 VAL A CG1 
3513 C CG2 . VAL A 445 ? 0.1820 0.1816 0.2106 -0.0200 -0.0593 -0.0675 445 VAL A CG2 
3514 N N   . PHE A 446 ? 0.3053 0.3146 0.3484 -0.0274 -0.0860 -0.0628 446 PHE A N   
3515 C CA  . PHE A 446 ? 0.3464 0.3476 0.3851 -0.0294 -0.0932 -0.0609 446 PHE A CA  
3516 C C   . PHE A 446 ? 0.3927 0.4160 0.4519 -0.0250 -0.1070 -0.0610 446 PHE A C   
3517 O O   . PHE A 446 ? 0.3548 0.3736 0.4128 -0.0252 -0.1161 -0.0591 446 PHE A O   
3518 C CB  . PHE A 446 ? 0.2766 0.2716 0.3063 -0.0407 -0.0893 -0.0563 446 PHE A CB  
3519 C CG  . PHE A 446 ? 0.2790 0.2495 0.2916 -0.0400 -0.0819 -0.0576 446 PHE A CG  
3520 C CD1 . PHE A 446 ? 0.2117 0.1650 0.2129 -0.0382 -0.0856 -0.0579 446 PHE A CD1 
3521 C CD2 . PHE A 446 ? 0.2573 0.2234 0.2666 -0.0405 -0.0732 -0.0580 446 PHE A CD2 
3522 C CE1 . PHE A 446 ? 0.2187 0.1537 0.2064 -0.0377 -0.0798 -0.0585 446 PHE A CE1 
3523 C CE2 . PHE A 446 ? 0.2790 0.2279 0.2765 -0.0393 -0.0676 -0.0589 446 PHE A CE2 
3524 C CZ  . PHE A 446 ? 0.3229 0.2576 0.3100 -0.0383 -0.0704 -0.0593 446 PHE A CZ  
3525 N N   . GLY A 447 ? 0.2630 0.3137 0.3426 -0.0200 -0.1080 -0.0625 447 GLY A N   
3526 C CA  . GLY A 447 ? 0.2625 0.3429 0.3663 -0.0115 -0.1177 -0.0624 447 GLY A CA  
3527 C C   . GLY A 447 ? 0.2326 0.3403 0.3539 -0.0215 -0.1235 -0.0515 447 GLY A C   
3528 O O   . GLY A 447 ? 0.2410 0.3687 0.3790 -0.0154 -0.1325 -0.0486 447 GLY A O   
3529 N N   . LEU A 448 ? 0.1994 0.3090 0.3168 -0.0360 -0.1184 -0.0457 448 LEU A N   
3530 C CA  . LEU A 448 ? 0.3070 0.4437 0.4407 -0.0461 -0.1231 -0.0376 448 LEU A CA  
3531 C C   . LEU A 448 ? 0.3325 0.5186 0.5002 -0.0409 -0.1245 -0.0313 448 LEU A C   
3532 O O   . LEU A 448 ? 0.3027 0.5142 0.4881 -0.0413 -0.1316 -0.0265 448 LEU A O   
3533 C CB  . LEU A 448 ? 0.2232 0.3506 0.3470 -0.0599 -0.1169 -0.0366 448 LEU A CB  
3534 C CG  . LEU A 448 ? 0.2563 0.3419 0.3517 -0.0641 -0.1134 -0.0405 448 LEU A CG  
3535 C CD1 . LEU A 448 ? 0.2079 0.2895 0.3036 -0.0746 -0.1150 -0.0382 448 LEU A CD1 
3536 C CD2 . LEU A 448 ? 0.3016 0.3634 0.3824 -0.0582 -0.1187 -0.0431 448 LEU A CD2 
3537 N N   . PRO A 449 ? 0.2908 0.4915 0.4689 -0.0344 -0.1169 -0.0316 449 PRO A N   
3538 C CA  . PRO A 449 ? 0.3051 0.5525 0.5180 -0.0268 -0.1152 -0.0243 449 PRO A CA  
3539 C C   . PRO A 449 ? 0.3641 0.6273 0.5930 -0.0093 -0.1203 -0.0266 449 PRO A C   
3540 O O   . PRO A 449 ? 0.4274 0.7300 0.6873 -0.0022 -0.1176 -0.0195 449 PRO A O   
3541 C CB  . PRO A 449 ? 0.2837 0.5331 0.4967 -0.0180 -0.1035 -0.0318 449 PRO A CB  
3542 C CG  . PRO A 449 ? 0.2695 0.4850 0.4560 -0.0320 -0.1019 -0.0328 449 PRO A CG  
3543 C CD  . PRO A 449 ? 0.2283 0.4073 0.3899 -0.0353 -0.1082 -0.0372 449 PRO A CD  
3544 N N   . LEU A 450 ? 0.3519 0.5831 0.5611 -0.0016 -0.1270 -0.0358 450 LEU A N   
3545 C CA  . LEU A 450 ? 0.4078 0.6499 0.6292 0.0161  -0.1332 -0.0379 450 LEU A CA  
3546 C C   . LEU A 450 ? 0.4070 0.6763 0.6480 0.0084  -0.1425 -0.0248 450 LEU A C   
3547 O O   . LEU A 450 ? 0.4098 0.7096 0.6758 0.0215  -0.1446 -0.0203 450 LEU A O   
3548 C CB  . LEU A 450 ? 0.1966 0.3938 0.3901 0.0246  -0.1396 -0.0498 450 LEU A CB  
3549 C CG  . LEU A 450 ? 0.1892 0.3671 0.3668 0.0334  -0.1305 -0.0632 450 LEU A CG  
3550 C CD1 . LEU A 450 ? 0.2010 0.3335 0.3506 0.0403  -0.1366 -0.0741 450 LEU A CD1 
3551 C CD2 . LEU A 450 ? 0.1848 0.3980 0.3825 0.0521  -0.1208 -0.0670 450 LEU A CD2 
3552 N N   . GLU A 451 ? 0.4319 0.6908 0.6600 -0.0115 -0.1468 -0.0207 451 GLU A N   
3553 C CA  . GLU A 451 ? 0.4931 0.7796 0.7362 -0.0201 -0.1543 -0.0141 451 GLU A CA  
3554 C C   . GLU A 451 ? 0.5059 0.8456 0.7799 -0.0219 -0.1459 -0.0094 451 GLU A C   
3555 O O   . GLU A 451 ? 0.4667 0.8028 0.7394 -0.0322 -0.1386 -0.0158 451 GLU A O   
3556 C CB  . GLU A 451 ? 0.5563 0.8085 0.7750 -0.0375 -0.1582 -0.0181 451 GLU A CB  
3557 C CG  . GLU A 451 ? 0.7330 1.0014 0.9657 -0.0459 -0.1681 -0.0150 451 GLU A CG  
3558 C CD  . GLU A 451 ? 0.8607 1.1190 1.0889 -0.0395 -0.1820 -0.0132 451 GLU A CD  
3559 O OE1 . GLU A 451 ? 0.8796 1.0929 1.0781 -0.0444 -0.1871 -0.0162 451 GLU A OE1 
3560 O OE2 . GLU A 451 ? 0.8677 1.1631 1.1221 -0.0285 -0.1874 -0.0089 451 GLU A OE2 
3561 N N   . ARG A 452 ? 0.6240 1.0007 0.9257 -0.0091 -0.1454 -0.0014 452 ARG A N   
3562 C CA  . ARG A 452 ? 0.7734 1.1647 1.1224 0.0006  -0.1412 -0.0196 452 ARG A CA  
3563 C C   . ARG A 452 ? 0.8204 1.2393 1.1896 -0.0166 -0.1465 -0.0139 452 ARG A C   
3564 O O   . ARG A 452 ? 0.8232 1.2726 1.2295 -0.0199 -0.1411 -0.0065 452 ARG A O   
3565 C CB  . ARG A 452 ? 0.8136 1.2273 1.2014 0.0134  -0.1393 0.0100  452 ARG A CB  
3566 C CG  . ARG A 452 ? 0.8665 1.2914 1.2468 0.0254  -0.1475 0.0179  452 ARG A CG  
3567 C CD  . ARG A 452 ? 0.9157 1.3637 1.3206 0.0537  -0.1387 0.0110  452 ARG A CD  
3568 N NE  . ARG A 452 ? 0.9471 1.3933 1.3485 0.0698  -0.1486 0.0110  452 ARG A NE  
3569 C CZ  . ARG A 452 ? 0.8700 1.3458 1.3046 0.0725  -0.1580 0.0227  452 ARG A CZ  
3570 N NH1 . ARG A 452 ? 0.7673 1.2633 1.2392 0.0606  -0.1588 0.0266  452 ARG A NH1 
3571 N NH2 . ARG A 452 ? 0.8473 1.3172 1.2736 0.0886  -0.1669 0.0209  452 ARG A NH2 
3572 N N   . ARG A 453 ? 0.8578 1.2649 1.2057 -0.0300 -0.1573 -0.0126 453 ARG A N   
3573 C CA  . ARG A 453 ? 0.9248 1.3378 1.2867 -0.0486 -0.1629 -0.0055 453 ARG A CA  
3574 C C   . ARG A 453 ? 0.9250 1.3059 1.2645 -0.0673 -0.1573 -0.0030 453 ARG A C   
3575 O O   . ARG A 453 ? 0.9239 1.3016 1.2666 -0.0843 -0.1615 0.0039  453 ARG A O   
3576 C CB  . ARG A 453 ? 0.9877 1.3944 1.3422 -0.0528 -0.1790 -0.0030 453 ARG A CB  
3577 C CG  . ARG A 453 ? 1.0262 1.3858 1.3376 -0.0544 -0.1845 -0.0053 453 ARG A CG  
3578 C CD  . ARG A 453 ? 1.0917 1.4412 1.3980 -0.0597 -0.2012 -0.0017 453 ARG A CD  
3579 N NE  . ARG A 453 ? 1.1379 1.5255 1.4706 -0.0450 -0.2092 0.0006  453 ARG A NE  
3580 C CZ  . ARG A 453 ? 1.1677 1.5424 1.4872 -0.0350 -0.2194 0.0020  453 ARG A CZ  
3581 N NH1 . ARG A 453 ? 1.1565 1.4789 1.4377 -0.0389 -0.2225 0.0000  453 ARG A NH1 
3582 N NH2 . ARG A 453 ? 1.1732 1.5853 1.5187 -0.0204 -0.2263 0.0053  453 ARG A NH2 
3583 N N   . ASP A 454 ? 0.9223 1.2799 1.2393 -0.0634 -0.1481 -0.0084 454 ASP A N   
3584 C CA  . ASP A 454 ? 0.9450 1.2668 1.2359 -0.0778 -0.1436 -0.0076 454 ASP A CA  
3585 C C   . ASP A 454 ? 0.8814 1.2155 1.1855 -0.0829 -0.1316 -0.0023 454 ASP A C   
3586 O O   . ASP A 454 ? 0.9291 1.2352 1.2110 -0.0894 -0.1261 -0.0030 454 ASP A O   
3587 C CB  . ASP A 454 ? 1.0089 1.2921 1.2623 -0.0729 -0.1418 -0.0152 454 ASP A CB  
3588 C CG  . ASP A 454 ? 1.1363 1.3753 1.3599 -0.0865 -0.1422 -0.0151 454 ASP A CG  
3589 O OD1 . ASP A 454 ? 1.1897 1.4245 1.4169 -0.0988 -0.1487 -0.0095 454 ASP A OD1 
3590 O OD2 . ASP A 454 ? 1.1772 1.3859 1.3744 -0.0841 -0.1361 -0.0203 454 ASP A OD2 
3591 N N   . GLN A 455 ? 0.7661 1.1423 1.1052 -0.0796 -0.1269 0.0047  455 GLN A N   
3592 C CA  . GLN A 455 ? 0.7022 1.0962 1.0530 -0.0862 -0.1139 0.0142  455 GLN A CA  
3593 C C   . GLN A 455 ? 0.5692 0.9529 0.9059 -0.0778 -0.1022 0.0110  455 GLN A C   
3594 O O   . GLN A 455 ? 0.5977 0.9839 0.9302 -0.0866 -0.0927 0.0183  455 GLN A O   
3595 C CB  . GLN A 455 ? 0.7962 1.1759 1.1383 -0.1082 -0.1160 0.0230  455 GLN A CB  
3596 C CG  . GLN A 455 ? 0.9052 1.2870 1.2554 -0.1191 -0.1292 0.0266  455 GLN A CG  
3597 C CD  . GLN A 455 ? 0.9607 1.3930 1.3512 -0.1191 -0.1289 0.0348  455 GLN A CD  
3598 O OE1 . GLN A 455 ? 1.0110 1.4695 1.4193 -0.1275 -0.1198 0.0456  455 GLN A OE1 
3599 N NE2 . GLN A 455 ? 0.9242 1.3711 1.3288 -0.1095 -0.1387 0.0301  455 GLN A NE2 
3600 N N   . TYR A 456 ? 0.3886 0.7603 0.7166 -0.0615 -0.1037 0.0012  456 TYR A N   
3601 C CA  . TYR A 456 ? 0.3022 0.6717 0.6210 -0.0523 -0.0925 0.0005  456 TYR A CA  
3602 C C   . TYR A 456 ? 0.2911 0.7056 0.6341 -0.0379 -0.0803 0.0058  456 TYR A C   
3603 O O   . TYR A 456 ? 0.2613 0.6975 0.6271 -0.0290 -0.0844 0.0066  456 TYR A O   
3604 C CB  . TYR A 456 ? 0.2166 0.5505 0.5129 -0.0423 -0.0990 -0.0093 456 TYR A CB  
3605 C CG  . TYR A 456 ? 0.1917 0.4820 0.4559 -0.0521 -0.1046 -0.0191 456 TYR A CG  
3606 C CD1 . TYR A 456 ? 0.1910 0.4611 0.4369 -0.0585 -0.0983 -0.0192 456 TYR A CD1 
3607 C CD2 . TYR A 456 ? 0.2267 0.5031 0.4693 -0.0555 -0.1116 -0.0252 456 TYR A CD2 
3608 C CE1 . TYR A 456 ? 0.2077 0.4420 0.4206 -0.0659 -0.0989 -0.0270 456 TYR A CE1 
3609 C CE2 . TYR A 456 ? 0.2490 0.4886 0.4580 -0.0659 -0.1123 -0.0275 456 TYR A CE2 
3610 C CZ  . TYR A 456 ? 0.3067 0.5254 0.5012 -0.0701 -0.1049 -0.0293 456 TYR A CZ  
3611 O OH  . TYR A 456 ? 0.2807 0.4589 0.4448 -0.0766 -0.1040 -0.0313 456 TYR A OH  
3612 N N   . THR A 457 ? 0.2765 0.7051 0.6123 -0.0340 -0.0645 0.0076  457 THR A N   
3613 C CA  . THR A 457 ? 0.2749 0.7416 0.6236 -0.0157 -0.0494 0.0076  457 THR A CA  
3614 C C   . THR A 457 ? 0.2269 0.6842 0.5679 0.0067  -0.0517 -0.0034 457 THR A C   
3615 O O   . THR A 457 ? 0.2434 0.6644 0.5628 0.0069  -0.0618 -0.0108 457 THR A O   
3616 C CB  . THR A 457 ? 0.3199 0.7969 0.6528 -0.0143 -0.0323 0.0079  457 THR A CB  
3617 O OG1 . THR A 457 ? 0.1539 0.6000 0.4574 -0.0074 -0.0337 -0.0038 457 THR A OG1 
3618 C CG2 . THR A 457 ? 0.1687 0.6473 0.5017 -0.0371 -0.0305 0.0196  457 THR A CG2 
3619 N N   . LYS A 458 ? 0.2210 0.7089 0.5770 0.0258  -0.0416 -0.0049 458 LYS A N   
3620 C CA  . LYS A 458 ? 0.3052 0.7833 0.6501 0.0501  -0.0410 -0.0168 458 LYS A CA  
3621 C C   . LYS A 458 ? 0.3417 0.7929 0.6514 0.0585  -0.0350 -0.0304 458 LYS A C   
3622 O O   . LYS A 458 ? 0.3137 0.7352 0.6049 0.0696  -0.0422 -0.0420 458 LYS A O   
3623 C CB  . LYS A 458 ? 0.2940 0.8090 0.6592 0.0696  -0.0281 -0.0164 458 LYS A CB  
3624 C CG  . LYS A 458 ? 0.2010 0.7030 0.5557 0.0961  -0.0283 -0.0286 458 LYS A CG  
3625 C CD  . LYS A 458 ? 0.3142 0.8059 0.6822 0.0973  -0.0468 -0.0259 458 LYS A CD  
3626 C CE  . LYS A 458 ? 0.3378 0.8109 0.6915 0.1233  -0.0480 -0.0379 458 LYS A CE  
3627 N NZ  . LYS A 458 ? 0.3456 0.8094 0.7104 0.1255  -0.0662 -0.0339 458 LYS A NZ  
3628 N N   . ALA A 459 ? 0.1671 0.6279 0.4673 0.0527  -0.0225 -0.0292 459 ALA A N   
3629 C CA  . ALA A 459 ? 0.2345 0.6737 0.5040 0.0602  -0.0169 -0.0421 459 ALA A CA  
3630 C C   . ALA A 459 ? 0.2235 0.6222 0.4754 0.0479  -0.0316 -0.0473 459 ALA A C   
3631 O O   . ALA A 459 ? 0.2335 0.6053 0.4621 0.0570  -0.0329 -0.0615 459 ALA A O   
3632 C CB  . ALA A 459 ? 0.1659 0.6255 0.4297 0.0540  -0.0018 -0.0370 459 ALA A CB  
3633 N N   . GLU A 460 ? 0.1762 0.5677 0.4382 0.0270  -0.0427 -0.0362 460 GLU A N   
3634 C CA  . GLU A 460 ? 0.2744 0.6240 0.5179 0.0146  -0.0560 -0.0400 460 GLU A CA  
3635 C C   . GLU A 460 ? 0.2798 0.6063 0.5183 0.0240  -0.0677 -0.0471 460 GLU A C   
3636 O O   . GLU A 460 ? 0.2988 0.5877 0.5141 0.0242  -0.0739 -0.0572 460 GLU A O   
3637 C CB  . GLU A 460 ? 0.2714 0.6148 0.5224 -0.0098 -0.0632 -0.0261 460 GLU A CB  
3638 C CG  . GLU A 460 ? 0.2894 0.6372 0.5334 -0.0214 -0.0546 -0.0214 460 GLU A CG  
3639 C CD  . GLU A 460 ? 0.2837 0.6236 0.5354 -0.0430 -0.0609 -0.0090 460 GLU A CD  
3640 O OE1 . GLU A 460 ? 0.2662 0.6160 0.5378 -0.0474 -0.0673 -0.0033 460 GLU A OE1 
3641 O OE2 . GLU A 460 ? 0.3131 0.6355 0.5499 -0.0545 -0.0598 -0.0069 460 GLU A OE2 
3642 N N   . GLU A 461 ? 0.2818 0.6304 0.5419 0.0317  -0.0704 -0.0414 461 GLU A N   
3643 C CA  . GLU A 461 ? 0.3020 0.6314 0.5571 0.0426  -0.0813 -0.0473 461 GLU A CA  
3644 C C   . GLU A 461 ? 0.3416 0.6521 0.5760 0.0637  -0.0765 -0.0646 461 GLU A C   
3645 O O   . GLU A 461 ? 0.2336 0.5064 0.4476 0.0657  -0.0858 -0.0737 461 GLU A O   
3646 C CB  . GLU A 461 ? 0.2473 0.6078 0.5314 0.0501  -0.0841 -0.0381 461 GLU A CB  
3647 C CG  . GLU A 461 ? 0.4037 0.7437 0.6803 0.0636  -0.0955 -0.0442 461 GLU A CG  
3648 C CD  . GLU A 461 ? 0.5382 0.9096 0.8439 0.0747  -0.0981 -0.0360 461 GLU A CD  
3649 O OE1 . GLU A 461 ? 0.6049 1.0158 0.9383 0.0751  -0.0885 -0.0278 461 GLU A OE1 
3650 O OE2 . GLU A 461 ? 0.5081 0.8633 0.8090 0.0831  -0.1099 -0.0381 461 GLU A OE2 
3651 N N   . ILE A 462 ? 0.1660 0.5000 0.4035 0.0785  -0.0619 -0.0686 462 ILE A N   
3652 C CA  . ILE A 462 ? 0.1754 0.4894 0.3910 0.0986  -0.0567 -0.0847 462 ILE A CA  
3653 C C   . ILE A 462 ? 0.2861 0.5640 0.4751 0.0905  -0.0596 -0.0946 462 ILE A C   
3654 O O   . ILE A 462 ? 0.3677 0.6055 0.5344 0.0963  -0.0658 -0.1044 462 ILE A O   
3655 C CB  . ILE A 462 ? 0.4076 0.7505 0.6264 0.1145  -0.0389 -0.0861 462 ILE A CB  
3656 C CG1 . ILE A 462 ? 0.4112 0.7791 0.6524 0.1276  -0.0371 -0.0798 462 ILE A CG1 
3657 C CG2 . ILE A 462 ? 0.3661 0.6802 0.5542 0.1310  -0.0332 -0.1027 462 ILE A CG2 
3658 C CD1 . ILE A 462 ? 0.4185 0.7590 0.6544 0.1387  -0.0507 -0.0853 462 ILE A CD1 
3659 N N   . LEU A 463 ? 0.1672 0.4506 0.3533 0.0740  -0.0541 -0.0889 463 LEU A N   
3660 C CA  . LEU A 463 ? 0.2517 0.4964 0.4100 0.0632  -0.0550 -0.0947 463 LEU A CA  
3661 C C   . LEU A 463 ? 0.3081 0.5142 0.4553 0.0531  -0.0688 -0.0968 463 LEU A C   
3662 O O   . LEU A 463 ? 0.3777 0.5467 0.5009 0.0545  -0.0705 -0.1065 463 LEU A O   
3663 C CB  . LEU A 463 ? 0.1447 0.4032 0.3053 0.0464  -0.0492 -0.0856 463 LEU A CB  
3664 C CG  . LEU A 463 ? 0.2452 0.4665 0.3812 0.0350  -0.0517 -0.0902 463 LEU A CG  
3665 C CD1 . LEU A 463 ? 0.1525 0.3509 0.2633 0.0480  -0.0466 -0.1039 463 LEU A CD1 
3666 C CD2 . LEU A 463 ? 0.1932 0.4266 0.3325 0.0186  -0.0480 -0.0797 463 LEU A CD2 
3667 N N   . SER A 464 ? 0.2099 0.4253 0.3741 0.0424  -0.0785 -0.0877 464 SER A N   
3668 C CA  . SER A 464 ? 0.2353 0.4127 0.3851 0.0321  -0.0898 -0.0880 464 SER A CA  
3669 C C   . SER A 464 ? 0.2734 0.4287 0.4123 0.0476  -0.0961 -0.0982 464 SER A C   
3670 O O   . SER A 464 ? 0.3623 0.4786 0.4787 0.0437  -0.1004 -0.1044 464 SER A O   
3671 C CB  . SER A 464 ? 0.1967 0.3815 0.3586 0.0181  -0.0959 -0.0731 464 SER A CB  
3672 O OG  . SER A 464 ? 0.2541 0.3986 0.3940 0.0057  -0.1015 -0.0712 464 SER A OG  
3673 N N   . ARG A 465 ? 0.2758 0.4546 0.4294 0.0652  -0.0951 -0.0984 465 ARG A N   
3674 C CA  . ARG A 465 ? 0.2867 0.4437 0.4299 0.0818  -0.1009 -0.1058 465 ARG A CA  
3675 C C   . ARG A 465 ? 0.3702 0.4928 0.4849 0.0891  -0.0947 -0.1182 465 ARG A C   
3676 O O   . ARG A 465 ? 0.4263 0.5119 0.5215 0.0927  -0.1014 -0.1243 465 ARG A O   
3677 C CB  . ARG A 465 ? 0.2260 0.4203 0.3938 0.1018  -0.0991 -0.1036 465 ARG A CB  
3678 C CG  . ARG A 465 ? 0.3023 0.4738 0.4605 0.1213  -0.1065 -0.1103 465 ARG A CG  
3679 C CD  . ARG A 465 ? 0.4176 0.5671 0.5720 0.1123  -0.1230 -0.1047 465 ARG A CD  
3680 N NE  . ARG A 465 ? 0.4902 0.6041 0.6260 0.1277  -0.1316 -0.1120 465 ARG A NE  
3681 C CZ  . ARG A 465 ? 0.4990 0.5640 0.6020 0.1224  -0.1332 -0.1191 465 ARG A CZ  
3682 N NH1 . ARG A 465 ? 0.4030 0.4525 0.4916 0.1044  -0.1273 -0.1210 465 ARG A NH1 
3683 N NH2 . ARG A 465 ? 0.5714 0.6034 0.6570 0.1352  -0.1407 -0.1238 465 ARG A NH2 
3684 N N   . SER A 466 ? 0.1922 0.3268 0.3037 0.0902  -0.0826 -0.1214 466 SER A N   
3685 C CA  . SER A 466 ? 0.2954 0.4001 0.3807 0.0954  -0.0776 -0.1332 466 SER A CA  
3686 C C   . SER A 466 ? 0.2847 0.3560 0.3525 0.0767  -0.0815 -0.1345 466 SER A C   
3687 O O   . SER A 466 ? 0.3547 0.3913 0.4027 0.0768  -0.0831 -0.1388 466 SER A O   
3688 C CB  . SER A 466 ? 0.2032 0.3326 0.2894 0.1028  -0.0644 -0.1358 466 SER A CB  
3689 O OG  . SER A 466 ? 0.6410 0.7453 0.7042 0.0966  -0.0613 -0.1432 466 SER A OG  
3690 N N   . ILE A 467 ? 0.2458 0.3293 0.3228 0.0598  -0.0813 -0.1263 467 ILE A N   
3691 C CA  . ILE A 467 ? 0.2750 0.3298 0.3387 0.0434  -0.0801 -0.1212 467 ILE A CA  
3692 C C   . ILE A 467 ? 0.3007 0.3263 0.3544 0.0400  -0.0834 -0.1137 467 ILE A C   
3693 O O   . ILE A 467 ? 0.1847 0.1851 0.2219 0.0350  -0.0767 -0.1064 467 ILE A O   
3694 C CB  . ILE A 467 ? 0.2816 0.3518 0.3556 0.0278  -0.0776 -0.1104 467 ILE A CB  
3695 C CG1 . ILE A 467 ? 0.3397 0.4272 0.4145 0.0273  -0.0710 -0.1136 467 ILE A CG1 
3696 C CG2 . ILE A 467 ? 0.2010 0.2405 0.2603 0.0140  -0.0729 -0.0973 467 ILE A CG2 
3697 C CD1 . ILE A 467 ? 0.1405 0.2497 0.2281 0.0146  -0.0695 -0.1028 467 ILE A CD1 
3698 N N   . VAL A 468 ? 0.2193 0.2541 0.2840 0.0411  -0.0940 -0.1134 468 VAL A N   
3699 C CA  . VAL A 468 ? 0.2417 0.2505 0.2953 0.0394  -0.0992 -0.1080 468 VAL A CA  
3700 C C   . VAL A 468 ? 0.3097 0.2964 0.3486 0.0507  -0.0993 -0.1129 468 VAL A C   
3701 O O   . VAL A 468 ? 0.3293 0.2914 0.3515 0.0432  -0.0948 -0.1040 468 VAL A O   
3702 C CB  . VAL A 468 ? 0.2249 0.2512 0.2946 0.0411  -0.1129 -0.1059 468 VAL A CB  
3703 C CG1 . VAL A 468 ? 0.2182 0.2165 0.2740 0.0444  -0.1215 -0.1046 468 VAL A CG1 
3704 C CG2 . VAL A 468 ? 0.1892 0.2262 0.2655 0.0239  -0.1099 -0.0934 468 VAL A CG2 
3705 N N   . LYS A 469 ? 0.2201 0.2179 0.2636 0.0677  -0.1025 -0.1258 469 LYS A N   
3706 C CA  . LYS A 469 ? 0.2393 0.2149 0.2666 0.0765  -0.1008 -0.1261 469 LYS A CA  
3707 C C   . LYS A 469 ? 0.3044 0.2656 0.3168 0.0632  -0.0872 -0.1168 469 LYS A C   
3708 O O   . LYS A 469 ? 0.2687 0.2070 0.2658 0.0575  -0.0844 -0.1105 469 LYS A O   
3709 C CB  . LYS A 469 ? 0.2529 0.2433 0.2860 0.0993  -0.1026 -0.1391 469 LYS A CB  
3710 C CG  . LYS A 469 ? 0.3157 0.2829 0.3295 0.1051  -0.0997 -0.1370 469 LYS A CG  
3711 C CD  . LYS A 469 ? 0.3000 0.2383 0.3015 0.1029  -0.1083 -0.1313 469 LYS A CD  
3712 C CE  . LYS A 469 ? 0.3098 0.2524 0.3202 0.1228  -0.1209 -0.1378 469 LYS A CE  
3713 N NZ  . LYS A 469 ? 0.3278 0.2400 0.3235 0.1191  -0.1312 -0.1318 469 LYS A NZ  
3714 N N   . ARG A 470 ? 0.3313 0.3073 0.3485 0.0582  -0.0794 -0.1169 470 ARG A N   
3715 C CA  . ARG A 470 ? 0.4149 0.3789 0.4199 0.0466  -0.0688 -0.1093 470 ARG A CA  
3716 C C   . ARG A 470 ? 0.3935 0.3430 0.3905 0.0306  -0.0631 -0.0976 470 ARG A C   
3717 O O   . ARG A 470 ? 0.3930 0.3267 0.3788 0.0255  -0.0593 -0.0946 470 ARG A O   
3718 C CB  . ARG A 470 ? 0.3294 0.3108 0.3400 0.0454  -0.0636 -0.1116 470 ARG A CB  
3719 C CG  . ARG A 470 ? 0.2485 0.2437 0.2605 0.0608  -0.0648 -0.1231 470 ARG A CG  
3720 C CD  . ARG A 470 ? 0.3002 0.3118 0.3144 0.0583  -0.0591 -0.1249 470 ARG A CD  
3721 N NE  . ARG A 470 ? 0.3258 0.3522 0.3374 0.0733  -0.0571 -0.1350 470 ARG A NE  
3722 C CZ  . ARG A 470 ? 0.3574 0.3699 0.3536 0.0768  -0.0538 -0.1359 470 ARG A CZ  
3723 N NH1 . ARG A 470 ? 0.3784 0.3650 0.3631 0.0660  -0.0529 -0.1291 470 ARG A NH1 
3724 N NH2 . ARG A 470 ? 0.2561 0.2817 0.2479 0.0911  -0.0501 -0.1437 470 ARG A NH2 
3725 N N   . TRP A 471 ? 0.3131 0.2696 0.3168 0.0243  -0.0638 -0.0935 471 TRP A N   
3726 C CA  . TRP A 471 ? 0.2961 0.2416 0.2923 0.0127  -0.0593 -0.0851 471 TRP A CA  
3727 C C   . TRP A 471 ? 0.3110 0.2385 0.2970 0.0133  -0.0625 -0.0845 471 TRP A C   
3728 O O   . TRP A 471 ? 0.2198 0.1359 0.1980 0.0073  -0.0590 -0.0820 471 TRP A O   
3729 C CB  . TRP A 471 ? 0.1863 0.1399 0.1884 0.0069  -0.0606 -0.0812 471 TRP A CB  
3730 C CG  . TRP A 471 ? 0.2177 0.1800 0.2244 0.0010  -0.0556 -0.0783 471 TRP A CG  
3731 C CD1 . TRP A 471 ? 0.3033 0.2620 0.3079 -0.0064 -0.0533 -0.0736 471 TRP A CD1 
3732 C CD2 . TRP A 471 ? 0.2209 0.1952 0.2331 0.0026  -0.0528 -0.0804 471 TRP A CD2 
3733 N NE1 . TRP A 471 ? 0.2980 0.2650 0.3073 -0.0091 -0.0499 -0.0723 471 TRP A NE1 
3734 C CE2 . TRP A 471 ? 0.2875 0.2643 0.3015 -0.0041 -0.0497 -0.0761 471 TRP A CE2 
3735 C CE3 . TRP A 471 ? 0.1924 0.1760 0.2089 0.0110  -0.0540 -0.0876 471 TRP A CE3 
3736 C CZ2 . TRP A 471 ? 0.1503 0.1368 0.1682 -0.0047 -0.0472 -0.0765 471 TRP A CZ2 
3737 C CZ3 . TRP A 471 ? 0.2424 0.2373 0.2629 0.0105  -0.0513 -0.0891 471 TRP A CZ3 
3738 C CH2 . TRP A 471 ? 0.2922 0.2869 0.3114 0.0012  -0.0474 -0.0817 471 TRP A CH2 
3739 N N   . ALA A 472 ? 0.3311 0.2562 0.3180 0.0219  -0.0708 -0.0880 472 ALA A N   
3740 C CA  . ALA A 472 ? 0.3692 0.2758 0.3452 0.0229  -0.0755 -0.0866 472 ALA A CA  
3741 C C   . ALA A 472 ? 0.4251 0.3177 0.3909 0.0246  -0.0723 -0.0885 472 ALA A C   
3742 O O   . ALA A 472 ? 0.5165 0.3925 0.4714 0.0198  -0.0719 -0.0860 472 ALA A O   
3743 C CB  . ALA A 472 ? 0.3501 0.2566 0.3324 0.0368  -0.0926 -0.0923 472 ALA A CB  
3744 N N   . ASN A 473 ? 0.3005 0.1990 0.2693 0.0318  -0.0714 -0.0937 473 ASN A N   
3745 C CA  . ASN A 473 ? 0.3268 0.2110 0.2858 0.0335  -0.0699 -0.0963 473 ASN A CA  
3746 C C   . ASN A 473 ? 0.3549 0.2367 0.3116 0.0224  -0.0634 -0.0938 473 ASN A C   
3747 O O   . ASN A 473 ? 0.4368 0.3026 0.3839 0.0190  -0.0626 -0.0944 473 ASN A O   
3748 C CB  . ASN A 473 ? 0.2990 0.1891 0.2597 0.0446  -0.0705 -0.1034 473 ASN A CB  
3749 C CG  . ASN A 473 ? 0.3558 0.2379 0.3140 0.0618  -0.0823 -0.1099 473 ASN A CG  
3750 O OD1 . ASN A 473 ? 0.3604 0.2274 0.3121 0.0629  -0.0889 -0.1074 473 ASN A OD1 
3751 N ND2 . ASN A 473 ? 0.4446 0.3366 0.4065 0.0764  -0.0848 -0.1184 473 ASN A ND2 
3752 N N   . PHE A 474 ? 0.2501 0.1473 0.2154 0.0169  -0.0589 -0.0914 474 PHE A N   
3753 C CA  . PHE A 474 ? 0.4295 0.3253 0.3935 0.0071  -0.0528 -0.0893 474 PHE A CA  
3754 C C   . PHE A 474 ? 0.3621 0.2458 0.3193 -0.0006 -0.0510 -0.0860 474 PHE A C   
3755 O O   . PHE A 474 ? 0.3789 0.2528 0.3306 -0.0068 -0.0473 -0.0869 474 PHE A O   
3756 C CB  . PHE A 474 ? 0.4012 0.3140 0.3750 0.0037  -0.0493 -0.0869 474 PHE A CB  
3757 C CG  . PHE A 474 ? 0.3520 0.2630 0.3245 -0.0052 -0.0437 -0.0848 474 PHE A CG  
3758 C CD1 . PHE A 474 ? 0.3460 0.2547 0.3166 -0.0070 -0.0422 -0.0876 474 PHE A CD1 
3759 C CD2 . PHE A 474 ? 0.2901 0.2008 0.2623 -0.0118 -0.0404 -0.0809 474 PHE A CD2 
3760 C CE1 . PHE A 474 ? 0.3829 0.2904 0.3530 -0.0151 -0.0379 -0.0862 474 PHE A CE1 
3761 C CE2 . PHE A 474 ? 0.3584 0.2674 0.3290 -0.0192 -0.0351 -0.0799 474 PHE A CE2 
3762 C CZ  . PHE A 474 ? 0.2222 0.1301 0.1925 -0.0207 -0.0343 -0.0824 474 PHE A CZ  
3763 N N   . ALA A 475 ? 0.2804 0.1650 0.2381 -0.0004 -0.0535 -0.0829 475 ALA A N   
3764 C CA  . ALA A 475 ? 0.3041 0.1775 0.2542 -0.0072 -0.0518 -0.0803 475 ALA A CA  
3765 C C   . ALA A 475 ? 0.3202 0.1740 0.2588 -0.0056 -0.0554 -0.0815 475 ALA A C   
3766 O O   . ALA A 475 ? 0.4030 0.2468 0.3358 -0.0127 -0.0513 -0.0814 475 ALA A O   
3767 C CB  . ALA A 475 ? 0.2539 0.1308 0.2051 -0.0067 -0.0555 -0.0771 475 ALA A CB  
3768 N N   . LYS A 476 ? 0.3315 0.1795 0.2673 0.0039  -0.0632 -0.0830 476 LYS A N   
3769 C CA  . LYS A 476 ? 0.4273 0.2534 0.3501 0.0069  -0.0684 -0.0837 476 LYS A CA  
3770 C C   . LYS A 476 ? 0.4455 0.2627 0.3644 0.0043  -0.0650 -0.0871 476 LYS A C   
3771 O O   . LYS A 476 ? 0.4946 0.2939 0.4030 -0.0005 -0.0651 -0.0865 476 LYS A O   
3772 C CB  . LYS A 476 ? 0.4512 0.2736 0.3727 0.0197  -0.0780 -0.0856 476 LYS A CB  
3773 C CG  . LYS A 476 ? 0.4438 0.2694 0.3668 0.0223  -0.0843 -0.0826 476 LYS A CG  
3774 C CD  . LYS A 476 ? 0.5231 0.3479 0.4488 0.0381  -0.0967 -0.0871 476 LYS A CD  
3775 C CE  . LYS A 476 ? 0.6246 0.4499 0.5523 0.0431  -0.1100 -0.0858 476 LYS A CE  
3776 N NZ  . LYS A 476 ? 0.6347 0.4721 0.5761 0.0601  -0.1235 -0.0937 476 LYS A NZ  
3777 N N   . TYR A 477 ? 0.4099 0.2385 0.3363 0.0070  -0.0626 -0.0909 477 TYR A N   
3778 C CA  . TYR A 477 ? 0.4040 0.2218 0.3250 0.0063  -0.0619 -0.0952 477 TYR A CA  
3779 C C   . TYR A 477 ? 0.3778 0.2075 0.3062 -0.0009 -0.0552 -0.0972 477 TYR A C   
3780 O O   . TYR A 477 ? 0.3756 0.1978 0.3001 -0.0015 -0.0554 -0.1014 477 TYR A O   
3781 C CB  . TYR A 477 ? 0.4538 0.2671 0.3715 0.0193  -0.0681 -0.0998 477 TYR A CB  
3782 C CG  . TYR A 477 ? 0.4863 0.2919 0.3996 0.0289  -0.0756 -0.0986 477 TYR A CG  
3783 C CD1 . TYR A 477 ? 0.4958 0.2799 0.3966 0.0269  -0.0800 -0.0954 477 TYR A CD1 
3784 C CD2 . TYR A 477 ? 0.3968 0.2166 0.3183 0.0397  -0.0787 -0.1007 477 TYR A CD2 
3785 C CE1 . TYR A 477 ? 0.5158 0.2915 0.4115 0.0358  -0.0882 -0.0941 477 TYR A CE1 
3786 C CE2 . TYR A 477 ? 0.5000 0.3136 0.4189 0.0488  -0.0862 -0.1003 477 TYR A CE2 
3787 C CZ  . TYR A 477 ? 0.5021 0.2929 0.4077 0.0470  -0.0915 -0.0968 477 TYR A CZ  
3788 O OH  . TYR A 477 ? 0.4654 0.2446 0.3648 0.0592  -0.1054 -0.0970 477 TYR A OH  
3789 N N   . GLY A 478 ? 0.3862 0.2328 0.3237 -0.0059 -0.0501 -0.0942 478 GLY A N   
3790 C CA  . GLY A 478 ? 0.3626 0.2201 0.3061 -0.0116 -0.0450 -0.0954 478 GLY A CA  
3791 C C   . GLY A 478 ? 0.4343 0.2993 0.3800 -0.0044 -0.0477 -0.0988 478 GLY A C   
3792 O O   . GLY A 478 ? 0.5094 0.3770 0.4560 -0.0086 -0.0458 -0.1009 478 GLY A O   
3793 N N   . ASN A 479 ? 0.3702 0.2392 0.3170 0.0063  -0.0521 -0.0999 479 ASN A N   
3794 C CA  . ASN A 479 ? 0.3180 0.1940 0.2658 0.0141  -0.0537 -0.1047 479 ASN A CA  
3795 C C   . ASN A 479 ? 0.3761 0.2674 0.3315 0.0231  -0.0554 -0.1046 479 ASN A C   
3796 O O   . ASN A 479 ? 0.4723 0.3589 0.4255 0.0311  -0.0593 -0.1061 479 ASN A O   
3797 C CB  . ASN A 479 ? 0.3177 0.1753 0.2539 0.0193  -0.0572 -0.1105 479 ASN A CB  
3798 C CG  . ASN A 479 ? 0.4837 0.3433 0.4166 0.0225  -0.0572 -0.1163 479 ASN A CG  
3799 O OD1 . ASN A 479 ? 0.4560 0.3322 0.3954 0.0232  -0.0551 -0.1162 479 ASN A OD1 
3800 N ND2 . ASN A 479 ? 0.5475 0.3885 0.4688 0.0244  -0.0599 -0.1217 479 ASN A ND2 
3801 N N   . PRO A 480 ? 0.3880 0.2974 0.3525 0.0220  -0.0529 -0.1033 480 PRO A N   
3802 C CA  . PRO A 480 ? 0.4264 0.3516 0.3999 0.0272  -0.0536 -0.1026 480 PRO A CA  
3803 C C   . PRO A 480 ? 0.4059 0.3376 0.3780 0.0386  -0.0542 -0.1093 480 PRO A C   
3804 O O   . PRO A 480 ? 0.4136 0.3626 0.3925 0.0414  -0.0526 -0.1110 480 PRO A O   
3805 C CB  . PRO A 480 ? 0.2201 0.1593 0.2020 0.0202  -0.0501 -0.0986 480 PRO A CB  
3806 C CG  . PRO A 480 ? 0.3025 0.2377 0.2795 0.0174  -0.0484 -0.1009 480 PRO A CG  
3807 C CD  . PRO A 480 ? 0.2494 0.1646 0.2157 0.0161  -0.0499 -0.1030 480 PRO A CD  
3808 N N   . GLN A 481 ? 0.3110 0.2289 0.2740 0.0462  -0.0567 -0.1139 481 GLN A N   
3809 C CA  . GLN A 481 ? 0.4076 0.3313 0.3687 0.0613  -0.0584 -0.1224 481 GLN A CA  
3810 C C   . GLN A 481 ? 0.4082 0.3426 0.3788 0.0751  -0.0658 -0.1268 481 GLN A C   
3811 O O   . GLN A 481 ? 0.4263 0.3548 0.4000 0.0718  -0.0703 -0.1227 481 GLN A O   
3812 C CB  . GLN A 481 ? 0.3126 0.2148 0.2584 0.0651  -0.0581 -0.1266 481 GLN A CB  
3813 C CG  . GLN A 481 ? 0.3194 0.2097 0.2580 0.0543  -0.0574 -0.1258 481 GLN A CG  
3814 C CD  . GLN A 481 ? 0.3161 0.2204 0.2572 0.0505  -0.0538 -0.1264 481 GLN A CD  
3815 O OE1 . GLN A 481 ? 0.3082 0.2244 0.2488 0.0584  -0.0511 -0.1304 481 GLN A OE1 
3816 N NE2 . GLN A 481 ? 0.2989 0.2021 0.2423 0.0387  -0.0532 -0.1224 481 GLN A NE2 
3817 N N   . GLU A 482 ? 0.4196 0.3715 0.3945 0.0908  -0.0664 -0.1355 482 GLU A N   
3818 C CA  . GLU A 482 ? 0.4056 0.3679 0.3881 0.1086  -0.0723 -0.1419 482 GLU A CA  
3819 C C   . GLU A 482 ? 0.4260 0.3773 0.3954 0.1226  -0.0704 -0.1476 482 GLU A C   
3820 O O   . GLU A 482 ? 0.4789 0.4424 0.4456 0.1296  -0.0637 -0.1524 482 GLU A O   
3821 C CB  . GLU A 482 ? 0.3938 0.3927 0.3946 0.1167  -0.0703 -0.1471 482 GLU A CB  
3822 C CG  . GLU A 482 ? 0.4455 0.4625 0.4621 0.1331  -0.0755 -0.1513 482 GLU A CG  
3823 C CD  . GLU A 482 ? 0.5365 0.5547 0.5482 0.1526  -0.0724 -0.1551 482 GLU A CD  
3824 O OE1 . GLU A 482 ? 0.6006 0.6348 0.6103 0.1597  -0.0624 -0.1580 482 GLU A OE1 
3825 O OE2 . GLU A 482 ? 0.4998 0.5011 0.5080 0.1607  -0.0798 -0.1549 482 GLU A OE2 
3826 N N   . THR A 483 ? 0.5179 0.4449 0.4777 0.1267  -0.0760 -0.1471 483 THR A N   
3827 C CA  . THR A 483 ? 0.5394 0.4481 0.4834 0.1369  -0.0742 -0.1521 483 THR A CA  
3828 C C   . THR A 483 ? 0.6089 0.5298 0.5566 0.1611  -0.0745 -0.1592 483 THR A C   
3829 O O   . THR A 483 ? 0.4392 0.3481 0.3742 0.1714  -0.0714 -0.1644 483 THR A O   
3830 C CB  . THR A 483 ? 0.4749 0.3494 0.4048 0.1288  -0.0789 -0.1481 483 THR A CB  
3831 O OG1 . THR A 483 ? 0.5398 0.4087 0.4731 0.1363  -0.0881 -0.1466 483 THR A OG1 
3832 C CG2 . THR A 483 ? 0.4738 0.3413 0.4029 0.1056  -0.0754 -0.1400 483 THR A CG2 
3833 N N   . GLN A 484 ? 0.6070 0.5528 0.5733 0.1704  -0.0773 -0.1593 484 GLN A N   
3834 C CA  . GLN A 484 ? 0.6213 0.5789 0.5948 0.1931  -0.0772 -0.1632 484 GLN A CA  
3835 C C   . GLN A 484 ? 0.5671 0.5635 0.5548 0.2065  -0.0655 -0.1662 484 GLN A C   
3836 O O   . GLN A 484 ? 0.5356 0.5387 0.5246 0.2249  -0.0612 -0.1693 484 GLN A O   
3837 C CB  . GLN A 484 ? 0.6251 0.5867 0.6128 0.1975  -0.0878 -0.1596 484 GLN A CB  
3838 C CG  . GLN A 484 ? 0.6531 0.5750 0.6239 0.1881  -0.0990 -0.1561 484 GLN A CG  
3839 C CD  . GLN A 484 ? 0.7775 0.7021 0.7605 0.1931  -0.1107 -0.1527 484 GLN A CD  
3840 O OE1 . GLN A 484 ? 0.7052 0.6525 0.7070 0.1879  -0.1134 -0.1502 484 GLN A OE1 
3841 N NE2 . GLN A 484 ? 0.8641 0.7647 0.8365 0.2033  -0.1186 -0.1523 484 GLN A NE2 
3842 N N   . ASN A 485 ? 0.6125 0.6353 0.6113 0.1971  -0.0595 -0.1644 485 ASN A N   
3843 C CA  . ASN A 485 ? 0.6498 0.7149 0.6654 0.2079  -0.0474 -0.1644 485 ASN A CA  
3844 C C   . ASN A 485 ? 0.7056 0.7739 0.7075 0.2027  -0.0371 -0.1671 485 ASN A C   
3845 O O   . ASN A 485 ? 0.7817 0.8776 0.7948 0.1948  -0.0314 -0.1642 485 ASN A O   
3846 C CB  . ASN A 485 ? 0.5947 0.6984 0.6410 0.2032  -0.0479 -0.1578 485 ASN A CB  
3847 C CG  . ASN A 485 ? 0.6954 0.8007 0.7584 0.2090  -0.0587 -0.1536 485 ASN A CG  
3848 O OD1 . ASN A 485 ? 0.6936 0.7805 0.7492 0.2220  -0.0629 -0.1556 485 ASN A OD1 
3849 N ND2 . ASN A 485 ? 0.8495 0.9763 0.9353 0.1990  -0.0640 -0.1471 485 ASN A ND2 
3850 N N   . ASN A 486 ? 0.6397 0.6797 0.6175 0.2068  -0.0354 -0.1724 486 ASN A N   
3851 C CA  . ASN A 486 ? 0.7714 0.8106 0.7333 0.2038  -0.0266 -0.1757 486 ASN A CA  
3852 C C   . ASN A 486 ? 0.7680 0.8166 0.7319 0.1853  -0.0260 -0.1719 486 ASN A C   
3853 O O   . ASN A 486 ? 0.8402 0.9133 0.8054 0.1862  -0.0164 -0.1718 486 ASN A O   
3854 C CB  . ASN A 486 ? 0.9475 1.0175 0.9151 0.2221  -0.0132 -0.1783 486 ASN A CB  
3855 C CG  . ASN A 486 ? 1.0996 1.1588 1.0637 0.2421  -0.0127 -0.1830 486 ASN A CG  
3856 O OD1 . ASN A 486 ? 1.1366 1.1673 1.0956 0.2430  -0.0233 -0.1839 486 ASN A OD1 
3857 N ND2 . ASN A 486 ? 1.1129 1.1955 1.0799 0.2584  0.0001  -0.1857 486 ASN A ND2 
3858 N N   . SER A 487 ? 0.6507 0.6802 0.6149 0.1688  -0.0356 -0.1680 487 SER A N   
3859 C CA  . SER A 487 ? 0.6560 0.6951 0.6256 0.1520  -0.0358 -0.1639 487 SER A CA  
3860 C C   . SER A 487 ? 0.7304 0.7472 0.6809 0.1399  -0.0350 -0.1637 487 SER A C   
3861 O O   . SER A 487 ? 0.7329 0.7209 0.6669 0.1397  -0.0369 -0.1658 487 SER A O   
3862 C CB  . SER A 487 ? 0.6915 0.7240 0.6733 0.1397  -0.0452 -0.1589 487 SER A CB  
3863 O OG  . SER A 487 ? 0.7378 0.7987 0.7419 0.1480  -0.0461 -0.1588 487 SER A OG  
3864 N N   . THR A 488 ? 0.7459 0.7776 0.6998 0.1297  -0.0322 -0.1610 488 THR A N   
3865 C CA  . THR A 488 ? 0.5868 0.6010 0.5265 0.1167  -0.0326 -0.1592 488 THR A CA  
3866 C C   . THR A 488 ? 0.4816 0.4687 0.4215 0.1013  -0.0397 -0.1531 488 THR A C   
3867 O O   . THR A 488 ? 0.4299 0.4208 0.3837 0.0943  -0.0434 -0.1479 488 THR A O   
3868 C CB  . THR A 488 ? 0.4709 0.5088 0.4167 0.1096  -0.0292 -0.1567 488 THR A CB  
3869 O OG1 . THR A 488 ? 0.5090 0.5757 0.4538 0.1231  -0.0197 -0.1606 488 THR A OG1 
3870 C CG2 . THR A 488 ? 0.4429 0.4629 0.3754 0.0965  -0.0308 -0.1542 488 THR A CG2 
3871 N N   . SER A 489 ? 0.5235 0.4845 0.4479 0.0959  -0.0405 -0.1537 489 SER A N   
3872 C CA  . SER A 489 ? 0.5032 0.4438 0.4282 0.0801  -0.0440 -0.1468 489 SER A CA  
3873 C C   . SER A 489 ? 0.5211 0.4698 0.4537 0.0653  -0.0433 -0.1394 489 SER A C   
3874 O O   . SER A 489 ? 0.5167 0.4754 0.4458 0.0645  -0.0414 -0.1410 489 SER A O   
3875 C CB  . SER A 489 ? 0.5276 0.4422 0.4357 0.0772  -0.0444 -0.1502 489 SER A CB  
3876 O OG  . SER A 489 ? 0.6698 0.5697 0.5735 0.0862  -0.0468 -0.1536 489 SER A OG  
3877 N N   . TRP A 490 ? 0.4238 0.3679 0.3656 0.0544  -0.0446 -0.1314 490 TRP A N   
3878 C CA  . TRP A 490 ? 0.3252 0.2760 0.2751 0.0428  -0.0449 -0.1250 490 TRP A CA  
3879 C C   . TRP A 490 ? 0.3567 0.2917 0.3008 0.0351  -0.0479 -0.1251 490 TRP A C   
3880 O O   . TRP A 490 ? 0.3603 0.2816 0.3035 0.0323  -0.0500 -0.1241 490 TRP A O   
3881 C CB  . TRP A 490 ? 0.2922 0.2498 0.2558 0.0386  -0.0454 -0.1183 490 TRP A CB  
3882 C CG  . TRP A 490 ? 0.3216 0.2875 0.2946 0.0289  -0.0449 -0.1118 490 TRP A CG  
3883 C CD1 . TRP A 490 ? 0.2867 0.2528 0.2584 0.0231  -0.0449 -0.1108 490 TRP A CD1 
3884 C CD2 . TRP A 490 ? 0.2463 0.2204 0.2308 0.0247  -0.0445 -0.1059 490 TRP A CD2 
3885 N NE1 . TRP A 490 ? 0.2858 0.2599 0.2681 0.0165  -0.0441 -0.1045 490 TRP A NE1 
3886 C CE2 . TRP A 490 ? 0.3068 0.2850 0.2962 0.0171  -0.0436 -0.1014 490 TRP A CE2 
3887 C CE3 . TRP A 490 ? 0.2001 0.1774 0.1904 0.0267  -0.0453 -0.1044 490 TRP A CE3 
3888 C CZ2 . TRP A 490 ? 0.2595 0.2434 0.2581 0.0119  -0.0428 -0.0955 490 TRP A CZ2 
3889 C CZ3 . TRP A 490 ? 0.2651 0.2480 0.2642 0.0202  -0.0452 -0.0985 490 TRP A CZ3 
3890 C CH2 . TRP A 490 ? 0.2352 0.2207 0.2378 0.0130  -0.0435 -0.0941 490 TRP A CH2 
3891 N N   . PRO A 491 ? 0.3372 0.2737 0.2761 0.0315  -0.0482 -0.1269 491 PRO A N   
3892 C CA  . PRO A 491 ? 0.3400 0.2631 0.2728 0.0243  -0.0514 -0.1285 491 PRO A CA  
3893 C C   . PRO A 491 ? 0.3435 0.2695 0.2880 0.0139  -0.0519 -0.1216 491 PRO A C   
3894 O O   . PRO A 491 ? 0.2939 0.2338 0.2497 0.0126  -0.0499 -0.1160 491 PRO A O   
3895 C CB  . PRO A 491 ? 0.3100 0.2369 0.2331 0.0253  -0.0519 -0.1329 491 PRO A CB  
3896 C CG  . PRO A 491 ? 0.3499 0.2954 0.2790 0.0284  -0.0485 -0.1297 491 PRO A CG  
3897 C CD  . PRO A 491 ? 0.3548 0.3057 0.2914 0.0343  -0.0457 -0.1280 491 PRO A CD  
3898 N N   . VAL A 492 ? 0.2936 0.2068 0.2352 0.0068  -0.0539 -0.1224 492 VAL A N   
3899 C CA  . VAL A 492 ? 0.3109 0.2283 0.2627 -0.0024 -0.0533 -0.1168 492 VAL A CA  
3900 C C   . VAL A 492 ? 0.3315 0.2610 0.2877 -0.0047 -0.0547 -0.1159 492 VAL A C   
3901 O O   . VAL A 492 ? 0.3520 0.2809 0.2993 -0.0028 -0.0573 -0.1208 492 VAL A O   
3902 C CB  . VAL A 492 ? 0.3505 0.2525 0.2981 -0.0111 -0.0544 -0.1183 492 VAL A CB  
3903 C CG1 . VAL A 492 ? 0.3110 0.1978 0.2509 -0.0082 -0.0541 -0.1207 492 VAL A CG1 
3904 C CG2 . VAL A 492 ? 0.3142 0.2104 0.2543 -0.0155 -0.0586 -0.1240 492 VAL A CG2 
3905 N N   . PHE A 493 ? 0.4049 0.3446 0.3737 -0.0083 -0.0530 -0.1099 493 PHE A N   
3906 C CA  . PHE A 493 ? 0.3890 0.3392 0.3633 -0.0105 -0.0548 -0.1086 493 PHE A CA  
3907 C C   . PHE A 493 ? 0.3609 0.3053 0.3357 -0.0183 -0.0581 -0.1103 493 PHE A C   
3908 O O   . PHE A 493 ? 0.4603 0.4040 0.4429 -0.0234 -0.0564 -0.1073 493 PHE A O   
3909 C CB  . PHE A 493 ? 0.3971 0.3589 0.3847 -0.0104 -0.0515 -0.1021 493 PHE A CB  
3910 C CG  . PHE A 493 ? 0.3983 0.3702 0.3921 -0.0118 -0.0533 -0.1004 493 PHE A CG  
3911 C CD1 . PHE A 493 ? 0.3862 0.3594 0.3877 -0.0170 -0.0551 -0.0998 493 PHE A CD1 
3912 C CD2 . PHE A 493 ? 0.4406 0.4208 0.4325 -0.0084 -0.0534 -0.0995 493 PHE A CD2 
3913 C CE1 . PHE A 493 ? 0.4661 0.4483 0.4738 -0.0176 -0.0576 -0.0984 493 PHE A CE1 
3914 C CE2 . PHE A 493 ? 0.3758 0.3633 0.3717 -0.0103 -0.0557 -0.0976 493 PHE A CE2 
3915 C CZ  . PHE A 493 ? 0.4036 0.3919 0.4076 -0.0143 -0.0581 -0.0970 493 PHE A CZ  
3916 N N   . LYS A 494 ? 0.4129 0.3528 0.3782 -0.0199 -0.0629 -0.1157 494 LYS A N   
3917 C CA  . LYS A 494 ? 0.5347 0.4723 0.5023 -0.0285 -0.0675 -0.1175 494 LYS A CA  
3918 C C   . LYS A 494 ? 0.4438 0.3956 0.4202 -0.0289 -0.0705 -0.1152 494 LYS A C   
3919 O O   . LYS A 494 ? 0.3777 0.3369 0.3521 -0.0233 -0.0699 -0.1139 494 LYS A O   
3920 C CB  . LYS A 494 ? 0.5917 0.5158 0.5437 -0.0314 -0.0724 -0.1252 494 LYS A CB  
3921 C CG  . LYS A 494 ? 0.6422 0.5497 0.5868 -0.0335 -0.0703 -0.1281 494 LYS A CG  
3922 C CD  . LYS A 494 ? 0.7961 0.6904 0.7233 -0.0292 -0.0729 -0.1362 494 LYS A CD  
3923 C CE  . LYS A 494 ? 0.9458 0.8379 0.8644 -0.0339 -0.0801 -0.1425 494 LYS A CE  
3924 N NZ  . LYS A 494 ? 0.9942 0.8818 0.9170 -0.0468 -0.0846 -0.1443 494 LYS A NZ  
3925 N N   . SER A 495 ? 0.5181 0.4739 0.5042 -0.0358 -0.0737 -0.1145 495 SER A N   
3926 C CA  . SER A 495 ? 0.6063 0.5748 0.6000 -0.0358 -0.0780 -0.1131 495 SER A CA  
3927 C C   . SER A 495 ? 0.6811 0.6453 0.6596 -0.0372 -0.0851 -0.1186 495 SER A C   
3928 O O   . SER A 495 ? 0.8010 0.7525 0.7663 -0.0387 -0.0861 -0.1238 495 SER A O   
3929 C CB  . SER A 495 ? 0.6478 0.6240 0.6582 -0.0421 -0.0800 -0.1114 495 SER A CB  
3930 O OG  . SER A 495 ? 0.7705 0.7440 0.7783 -0.0505 -0.0876 -0.1157 495 SER A OG  
3931 N N   . THR A 496 ? 0.5738 0.5475 0.5527 -0.0365 -0.0902 -0.1178 496 THR A N   
3932 C CA  . THR A 496 ? 0.6379 0.6081 0.5991 -0.0372 -0.0971 -0.1229 496 THR A CA  
3933 C C   . THR A 496 ? 0.5514 0.5159 0.4947 -0.0297 -0.0929 -0.1251 496 THR A C   
3934 O O   . THR A 496 ? 0.6023 0.5724 0.5366 -0.0271 -0.0950 -0.1244 496 THR A O   
3935 C CB  . THR A 496 ? 0.8700 0.8314 0.8247 -0.0456 -0.1041 -0.1295 496 THR A CB  
3936 O OG1 . THR A 496 ? 0.8408 0.7870 0.7856 -0.0450 -0.0997 -0.1336 496 THR A OG1 
3937 C CG2 . THR A 496 ? 0.8284 0.7980 0.8027 -0.0540 -0.1078 -0.1272 496 THR A CG2 
3938 N N   . GLU A 497 ? 0.4725 0.4268 0.4105 -0.0265 -0.0873 -0.1275 497 GLU A N   
3939 C CA  . GLU A 497 ? 0.4912 0.4423 0.4147 -0.0184 -0.0828 -0.1297 497 GLU A CA  
3940 C C   . GLU A 497 ? 0.4351 0.3968 0.3682 -0.0132 -0.0762 -0.1231 497 GLU A C   
3941 O O   . GLU A 497 ? 0.3773 0.3442 0.3012 -0.0090 -0.0746 -0.1228 497 GLU A O   
3942 C CB  . GLU A 497 ? 0.7055 0.6419 0.6197 -0.0159 -0.0802 -0.1353 497 GLU A CB  
3943 C CG  . GLU A 497 ? 0.9777 0.9010 0.8761 -0.0197 -0.0865 -0.1439 497 GLU A CG  
3944 C CD  . GLU A 497 ? 1.1684 1.0848 1.0753 -0.0294 -0.0903 -0.1447 497 GLU A CD  
3945 O OE1 . GLU A 497 ? 1.2016 1.1281 1.1255 -0.0352 -0.0914 -0.1391 497 GLU A OE1 
3946 O OE2 . GLU A 497 ? 1.2257 1.1267 1.1223 -0.0312 -0.0919 -0.1514 497 GLU A OE2 
3947 N N   . GLN A 498 ? 0.3856 0.3500 0.3357 -0.0142 -0.0723 -0.1182 498 GLN A N   
3948 C CA  . GLN A 498 ? 0.3371 0.3114 0.2979 -0.0112 -0.0673 -0.1119 498 GLN A CA  
3949 C C   . GLN A 498 ? 0.3079 0.2839 0.2608 -0.0046 -0.0626 -0.1126 498 GLN A C   
3950 O O   . GLN A 498 ? 0.3179 0.3030 0.2718 -0.0033 -0.0608 -0.1090 498 GLN A O   
3951 C CB  . GLN A 498 ? 0.4358 0.4201 0.4017 -0.0136 -0.0707 -0.1081 498 GLN A CB  
3952 C CG  . GLN A 498 ? 0.5030 0.4901 0.4838 -0.0186 -0.0736 -0.1060 498 GLN A CG  
3953 C CD  . GLN A 498 ? 0.5230 0.5175 0.5043 -0.0212 -0.0805 -0.1048 498 GLN A CD  
3954 O OE1 . GLN A 498 ? 0.6363 0.6299 0.6158 -0.0253 -0.0872 -0.1079 498 GLN A OE1 
3955 N NE2 . GLN A 498 ? 0.3694 0.3710 0.3528 -0.0196 -0.0797 -0.1000 498 GLN A NE2 
3956 N N   . LYS A 499 ? 0.3424 0.3097 0.2872 -0.0007 -0.0607 -0.1172 499 LYS A N   
3957 C CA  . LYS A 499 ? 0.2627 0.2329 0.2018 0.0065  -0.0561 -0.1185 499 LYS A CA  
3958 C C   . LYS A 499 ? 0.2953 0.2729 0.2495 0.0070  -0.0521 -0.1126 499 LYS A C   
3959 O O   . LYS A 499 ? 0.2749 0.2493 0.2403 0.0036  -0.0520 -0.1093 499 LYS A O   
3960 C CB  . LYS A 499 ? 0.3040 0.2615 0.2316 0.0113  -0.0556 -0.1254 499 LYS A CB  
3961 C CG  . LYS A 499 ? 0.3122 0.2612 0.2215 0.0114  -0.0593 -0.1325 499 LYS A CG  
3962 C CD  . LYS A 499 ? 0.4431 0.3771 0.3407 0.0162  -0.0591 -0.1398 499 LYS A CD  
3963 C CE  . LYS A 499 ? 0.3658 0.2877 0.2472 0.0131  -0.0645 -0.1470 499 LYS A CE  
3964 N NZ  . LYS A 499 ? 0.3946 0.3013 0.2605 0.0205  -0.0635 -0.1555 499 LYS A NZ  
3965 N N   . TYR A 500 ? 0.2513 0.2388 0.2044 0.0105  -0.0489 -0.1114 500 TYR A N   
3966 C CA  . TYR A 500 ? 0.2882 0.2826 0.2539 0.0107  -0.0459 -0.1068 500 TYR A CA  
3967 C C   . TYR A 500 ? 0.2898 0.2955 0.2535 0.0203  -0.0441 -0.1132 500 TYR A C   
3968 O O   . TYR A 500 ? 0.3278 0.3385 0.2795 0.0273  -0.0439 -0.1203 500 TYR A O   
3969 C CB  . TYR A 500 ? 0.2361 0.2383 0.2108 0.0049  -0.0463 -0.1003 500 TYR A CB  
3970 C CG  . TYR A 500 ? 0.2735 0.2900 0.2443 0.0073  -0.0486 -0.1038 500 TYR A CG  
3971 C CD1 . TYR A 500 ? 0.2950 0.3103 0.2561 0.0054  -0.0524 -0.1048 500 TYR A CD1 
3972 C CD2 . TYR A 500 ? 0.2725 0.3059 0.2485 0.0105  -0.0474 -0.1061 500 TYR A CD2 
3973 C CE1 . TYR A 500 ? 0.3444 0.3731 0.2979 0.0071  -0.0549 -0.1071 500 TYR A CE1 
3974 C CE2 . TYR A 500 ? 0.3140 0.3641 0.2836 0.0115  -0.0489 -0.1087 500 TYR A CE2 
3975 C CZ  . TYR A 500 ? 0.3512 0.3977 0.3080 0.0100  -0.0525 -0.1086 500 TYR A CZ  
3976 O OH  . TYR A 500 ? 0.2556 0.3192 0.2021 0.0106  -0.0541 -0.1094 500 TYR A OH  
3977 N N   . LEU A 501 ? 0.2279 0.2395 0.2031 0.0218  -0.0429 -0.1117 501 LEU A N   
3978 C CA  . LEU A 501 ? 0.2957 0.3229 0.2732 0.0325  -0.0419 -0.1194 501 LEU A CA  
3979 C C   . LEU A 501 ? 0.3316 0.3823 0.3208 0.0315  -0.0417 -0.1199 501 LEU A C   
3980 O O   . LEU A 501 ? 0.2289 0.2767 0.2289 0.0229  -0.0429 -0.1130 501 LEU A O   
3981 C CB  . LEU A 501 ? 0.2322 0.2494 0.2137 0.0354  -0.0423 -0.1190 501 LEU A CB  
3982 C CG  . LEU A 501 ? 0.3122 0.3455 0.2978 0.0485  -0.0421 -0.1274 501 LEU A CG  
3983 C CD1 . LEU A 501 ? 0.3660 0.3975 0.3364 0.0594  -0.0396 -0.1346 501 LEU A CD1 
3984 C CD2 . LEU A 501 ? 0.3209 0.3446 0.3132 0.0496  -0.0448 -0.1256 501 LEU A CD2 
3985 N N   . THR A 502 ? 0.3236 0.3986 0.3085 0.0394  -0.0389 -0.1275 502 THR A N   
3986 C CA  . THR A 502 ? 0.3342 0.4378 0.3294 0.0364  -0.0384 -0.1286 502 THR A CA  
3987 C C   . THR A 502 ? 0.3385 0.4573 0.3467 0.0426  -0.0381 -0.1336 502 THR A C   
3988 O O   . THR A 502 ? 0.4154 0.5337 0.4204 0.0559  -0.0351 -0.1396 502 THR A O   
3989 C CB  . THR A 502 ? 0.2885 0.4186 0.2720 0.0395  -0.0326 -0.1298 502 THR A CB  
3990 O OG1 . THR A 502 ? 0.3244 0.4688 0.2999 0.0552  -0.0236 -0.1354 502 THR A OG1 
3991 C CG2 . THR A 502 ? 0.2777 0.3909 0.2459 0.0347  -0.0358 -0.1275 502 THR A CG2 
3992 N N   . LEU A 503 ? 0.3174 0.4450 0.3443 0.0315  -0.0404 -0.1228 503 LEU A N   
3993 C CA  . LEU A 503 ? 0.2871 0.4288 0.3323 0.0340  -0.0402 -0.1183 503 LEU A CA  
3994 C C   . LEU A 503 ? 0.3138 0.4898 0.3748 0.0287  -0.0341 -0.1046 503 LEU A C   
3995 O O   . LEU A 503 ? 0.3063 0.4836 0.3717 0.0146  -0.0363 -0.0951 503 LEU A O   
3996 C CB  . LEU A 503 ? 0.2281 0.3490 0.2805 0.0239  -0.0496 -0.1173 503 LEU A CB  
3997 C CG  . LEU A 503 ? 0.3117 0.3954 0.3518 0.0269  -0.0504 -0.1193 503 LEU A CG  
3998 C CD1 . LEU A 503 ? 0.1480 0.2099 0.1910 0.0161  -0.0518 -0.1070 503 LEU A CD1 
3999 C CD2 . LEU A 503 ? 0.1685 0.2513 0.2052 0.0420  -0.0511 -0.1288 503 LEU A CD2 
4000 N N   . ASN A 504 ? 0.4053 0.6093 0.4751 0.0403  -0.0262 -0.1035 504 ASN A N   
4001 C CA  . ASN A 504 ? 0.3853 0.6269 0.4746 0.0348  -0.0196 -0.0895 504 ASN A CA  
4002 C C   . ASN A 504 ? 0.3893 0.6601 0.4956 0.0493  -0.0135 -0.0899 504 ASN A C   
4003 O O   . ASN A 504 ? 0.3454 0.6046 0.4442 0.0655  -0.0139 -0.1018 504 ASN A O   
4004 C CB  . ASN A 504 ? 0.3102 0.5645 0.3870 0.0320  -0.0106 -0.0843 504 ASN A CB  
4005 C CG  . ASN A 504 ? 0.4634 0.7187 0.5196 0.0499  -0.0018 -0.0955 504 ASN A CG  
4006 O OD1 . ASN A 504 ? 0.5311 0.8155 0.5934 0.0618  0.0092  -0.0948 504 ASN A OD1 
4007 N ND2 . ASN A 504 ? 0.5209 0.7446 0.5525 0.0520  -0.0068 -0.1064 504 ASN A ND2 
4008 N N   . THR A 505 ? 0.4175 0.7263 0.5474 0.0436  -0.0081 -0.0766 505 THR A N   
4009 C CA  . THR A 505 ? 0.4535 0.7958 0.6060 0.0567  -0.0030 -0.0753 505 THR A CA  
4010 C C   . THR A 505 ? 0.5667 0.9301 0.7110 0.0773  0.0124  -0.0818 505 THR A C   
4011 O O   . THR A 505 ? 0.6856 1.0664 0.8426 0.0948  0.0160  -0.0864 505 THR A O   
4012 C CB  . THR A 505 ? 0.3319 0.7114 0.5170 0.0425  -0.0033 -0.0583 505 THR A CB  
4013 O OG1 . THR A 505 ? 0.3432 0.7406 0.5261 0.0302  0.0058  -0.0471 505 THR A OG1 
4014 C CG2 . THR A 505 ? 0.1969 0.5544 0.3903 0.0261  -0.0199 -0.0543 505 THR A CG2 
4015 N N   . GLU A 506 ? 0.5719 0.9330 0.6937 0.0763  0.0213  -0.0826 506 GLU A N   
4016 C CA  . GLU A 506 ? 0.7097 1.0894 0.8192 0.0958  0.0368  -0.0892 506 GLU A CA  
4017 C C   . GLU A 506 ? 0.7562 1.0984 0.8331 0.1124  0.0348  -0.1086 506 GLU A C   
4018 O O   . GLU A 506 ? 0.7923 1.1289 0.8688 0.1305  0.0353  -0.1179 506 GLU A O   
4019 C CB  . GLU A 506 ? 0.8290 1.2336 0.9316 0.0872  0.0498  -0.0782 506 GLU A CB  
4020 C CG  . GLU A 506 ? 0.9436 1.3197 1.0240 0.0695  0.0428  -0.0744 506 GLU A CG  
4021 C CD  . GLU A 506 ? 1.0118 1.3976 1.1130 0.0455  0.0369  -0.0566 506 GLU A CD  
4022 O OE1 . GLU A 506 ? 1.0486 1.4359 1.1746 0.0388  0.0276  -0.0530 506 GLU A OE1 
4023 O OE2 . GLU A 506 ? 1.0200 1.4097 1.1108 0.0333  0.0409  -0.0463 506 GLU A OE2 
4024 N N   . SER A 507 ? 0.7714 1.0834 0.8202 0.1046  0.0306  -0.1130 507 SER A N   
4025 C CA  . SER A 507 ? 0.7923 1.0696 0.8090 0.1175  0.0282  -0.1305 507 SER A CA  
4026 C C   . SER A 507 ? 0.6800 0.9155 0.6859 0.1046  0.0124  -0.1351 507 SER A C   
4027 O O   . SER A 507 ? 0.7189 0.9498 0.7251 0.0869  0.0076  -0.1265 507 SER A O   
4028 C CB  . SER A 507 ? 0.9428 1.2230 0.9318 0.1210  0.0382  -0.1314 507 SER A CB  
4029 O OG  . SER A 507 ? 1.0066 1.2833 0.9872 0.1033  0.0349  -0.1237 507 SER A OG  
4030 N N   . THR A 508 ? 0.5443 0.7475 0.5409 0.1124  0.0042  -0.1466 508 THR A N   
4031 C CA  . THR A 508 ? 0.4318 0.5955 0.4199 0.0999  -0.0096 -0.1493 508 THR A CA  
4032 C C   . THR A 508 ? 0.4556 0.5875 0.4179 0.0975  -0.0126 -0.1506 508 THR A C   
4033 O O   . THR A 508 ? 0.4704 0.5890 0.4199 0.1078  -0.0103 -0.1541 508 THR A O   
4034 C CB  . THR A 508 ? 0.4197 0.5645 0.4187 0.1020  -0.0182 -0.1511 508 THR A CB  
4035 O OG1 . THR A 508 ? 0.5858 0.7437 0.6072 0.0918  -0.0223 -0.1459 508 THR A OG1 
4036 C CG2 . THR A 508 ? 0.3320 0.4325 0.3167 0.0936  -0.0275 -0.1500 508 THR A CG2 
4037 N N   . ARG A 509 ? 0.4225 0.5432 0.3783 0.0839  -0.0176 -0.1473 509 ARG A N   
4038 C CA  . ARG A 509 ? 0.4214 0.5203 0.3554 0.0816  -0.0191 -0.1476 509 ARG A CA  
4039 C C   . ARG A 509 ? 0.3980 0.4648 0.3317 0.0680  -0.0286 -0.1434 509 ARG A C   
4040 O O   . ARG A 509 ? 0.3481 0.4131 0.2963 0.0573  -0.0331 -0.1378 509 ARG A O   
4041 C CB  . ARG A 509 ? 0.4113 0.5313 0.3329 0.0804  -0.0132 -0.1458 509 ARG A CB  
4042 C CG  . ARG A 509 ? 0.5269 0.6816 0.4463 0.0932  0.0008  -0.1463 509 ARG A CG  
4043 C CD  . ARG A 509 ? 0.7678 0.9203 0.6601 0.0983  0.0071  -0.1471 509 ARG A CD  
4044 N NE  . ARG A 509 ? 0.9207 1.0956 0.8110 0.1135  0.0211  -0.1480 509 ARG A NE  
4045 C CZ  . ARG A 509 ? 1.0046 1.2210 0.9043 0.1162  0.0347  -0.1405 509 ARG A CZ  
4046 N NH1 . ARG A 509 ? 0.9770 1.2173 0.8864 0.1039  0.0359  -0.1317 509 ARG A NH1 
4047 N NH2 . ARG A 509 ? 1.0699 1.3050 0.9707 0.1298  0.0476  -0.1402 509 ARG A NH2 
4048 N N   . ILE A 510 ? 0.4382 0.4813 0.3554 0.0683  -0.0304 -0.1455 510 ILE A N   
4049 C CA  . ILE A 510 ? 0.3874 0.4075 0.3033 0.0553  -0.0367 -0.1406 510 ILE A CA  
4050 C C   . ILE A 510 ? 0.3376 0.3619 0.2425 0.0503  -0.0383 -0.1396 510 ILE A C   
4051 O O   . ILE A 510 ? 0.3622 0.3886 0.2476 0.0568  -0.0357 -0.1447 510 ILE A O   
4052 C CB  . ILE A 510 ? 0.4252 0.4192 0.3288 0.0552  -0.0385 -0.1437 510 ILE A CB  
4053 C CG1 . ILE A 510 ? 0.4795 0.4684 0.3873 0.0635  -0.0367 -0.1465 510 ILE A CG1 
4054 C CG2 . ILE A 510 ? 0.3938 0.3713 0.3021 0.0407  -0.0432 -0.1372 510 ILE A CG2 
4055 C CD1 . ILE A 510 ? 0.5031 0.4950 0.4305 0.0584  -0.0385 -0.1401 510 ILE A CD1 
4056 N N   . MET A 511 ? 0.2865 0.3108 0.2026 0.0392  -0.0426 -0.1326 511 MET A N   
4057 C CA  . MET A 511 ? 0.3122 0.3383 0.2190 0.0336  -0.0464 -0.1305 511 MET A CA  
4058 C C   . MET A 511 ? 0.3686 0.3771 0.2810 0.0226  -0.0521 -0.1253 511 MET A C   
4059 O O   . MET A 511 ? 0.3732 0.3705 0.2959 0.0188  -0.0516 -0.1224 511 MET A O   
4060 C CB  . MET A 511 ? 0.3545 0.4023 0.2695 0.0314  -0.0458 -0.1266 511 MET A CB  
4061 C CG  . MET A 511 ? 0.4948 0.5655 0.4162 0.0394  -0.0389 -0.1298 511 MET A CG  
4062 S SD  . MET A 511 ? 0.8128 0.9174 0.7225 0.0415  -0.0335 -0.1287 511 MET A SD  
4063 C CE  . MET A 511 ? 0.3025 0.3930 0.1826 0.0436  -0.0354 -0.1299 511 MET A CE  
4064 N N   . THR A 512 ? 0.2846 0.2927 0.1893 0.0176  -0.0573 -0.1237 512 THR A N   
4065 C CA  . THR A 512 ? 0.4070 0.4040 0.3180 0.0081  -0.0625 -0.1195 512 THR A CA  
4066 C C   . THR A 512 ? 0.3901 0.3956 0.3092 0.0026  -0.0672 -0.1133 512 THR A C   
4067 O O   . THR A 512 ? 0.3153 0.3315 0.2254 0.0049  -0.0691 -0.1134 512 THR A O   
4068 C CB  . THR A 512 ? 0.4696 0.4549 0.3624 0.0066  -0.0669 -0.1250 512 THR A CB  
4069 O OG1 . THR A 512 ? 0.5178 0.5094 0.3909 0.0108  -0.0693 -0.1286 512 THR A OG1 
4070 C CG2 . THR A 512 ? 0.3223 0.2947 0.2075 0.0103  -0.0632 -0.1310 512 THR A CG2 
4071 N N   . LYS A 513 ? 0.4209 0.4222 0.3556 -0.0041 -0.0685 -0.1078 513 LYS A N   
4072 C CA  . LYS A 513 ? 0.2464 0.2533 0.1891 -0.0089 -0.0739 -0.1027 513 LYS A CA  
4073 C C   . LYS A 513 ? 0.2352 0.2527 0.1833 -0.0081 -0.0738 -0.0985 513 LYS A C   
4074 O O   . LYS A 513 ? 0.3514 0.3758 0.2914 -0.0085 -0.0798 -0.0974 513 LYS A O   
4075 C CB  . LYS A 513 ? 0.2688 0.2752 0.1975 -0.0106 -0.0823 -0.1057 513 LYS A CB  
4076 C CG  . LYS A 513 ? 0.2799 0.2762 0.2064 -0.0144 -0.0843 -0.1093 513 LYS A CG  
4077 C CD  . LYS A 513 ? 0.3047 0.3008 0.2165 -0.0167 -0.0937 -0.1129 513 LYS A CD  
4078 C CE  . LYS A 513 ? 0.4576 0.4443 0.3674 -0.0210 -0.0964 -0.1180 513 LYS A CE  
4079 N NZ  . LYS A 513 ? 0.5690 0.5571 0.4682 -0.0257 -0.1069 -0.1206 513 LYS A NZ  
4080 N N   . LEU A 514 ? 0.2722 0.2907 0.2326 -0.0079 -0.0678 -0.0957 514 LEU A N   
4081 C CA  . LEU A 514 ? 0.2997 0.3270 0.2667 -0.0091 -0.0679 -0.0917 514 LEU A CA  
4082 C C   . LEU A 514 ? 0.3466 0.3750 0.3195 -0.0136 -0.0742 -0.0863 514 LEU A C   
4083 O O   . LEU A 514 ? 0.3210 0.3438 0.3039 -0.0156 -0.0744 -0.0844 514 LEU A O   
4084 C CB  . LEU A 514 ? 0.2574 0.2817 0.2375 -0.0098 -0.0613 -0.0889 514 LEU A CB  
4085 C CG  . LEU A 514 ? 0.2973 0.3289 0.2850 -0.0126 -0.0612 -0.0849 514 LEU A CG  
4086 C CD1 . LEU A 514 ? 0.2183 0.2671 0.1973 -0.0099 -0.0625 -0.0893 514 LEU A CD1 
4087 C CD2 . LEU A 514 ? 0.1654 0.1908 0.1633 -0.0135 -0.0553 -0.0818 514 LEU A CD2 
4088 N N   . ARG A 515 ? 0.3463 0.3837 0.3128 -0.0146 -0.0797 -0.0840 515 ARG A N   
4089 C CA  . ARG A 515 ? 0.3631 0.4017 0.3345 -0.0179 -0.0875 -0.0783 515 ARG A CA  
4090 C C   . ARG A 515 ? 0.3651 0.4000 0.3389 -0.0175 -0.0928 -0.0790 515 ARG A C   
4091 O O   . ARG A 515 ? 0.3637 0.3968 0.3520 -0.0182 -0.0952 -0.0761 515 ARG A O   
4092 C CB  . ARG A 515 ? 0.3910 0.4258 0.3795 -0.0211 -0.0846 -0.0736 515 ARG A CB  
4093 C CG  . ARG A 515 ? 0.5115 0.5511 0.5011 -0.0236 -0.0811 -0.0721 515 ARG A CG  
4094 C CD  . ARG A 515 ? 0.4838 0.5328 0.4685 -0.0274 -0.0898 -0.0670 515 ARG A CD  
4095 N NE  . ARG A 515 ? 0.4925 0.5441 0.4872 -0.0330 -0.0874 -0.0635 515 ARG A NE  
4096 C CZ  . ARG A 515 ? 0.5492 0.6156 0.5441 -0.0337 -0.0821 -0.0659 515 ARG A CZ  
4097 N NH1 . ARG A 515 ? 0.5867 0.6650 0.5699 -0.0273 -0.0773 -0.0721 515 ARG A NH1 
4098 N NH2 . ARG A 515 ? 0.5338 0.6011 0.5397 -0.0403 -0.0788 -0.0592 515 ARG A NH2 
4099 N N   . ALA A 516 ? 0.3726 0.4069 0.3328 -0.0158 -0.0950 -0.0834 516 ALA A N   
4100 C CA  . ALA A 516 ? 0.3946 0.4272 0.3582 -0.0166 -0.1009 -0.0847 516 ALA A CA  
4101 C C   . ALA A 516 ? 0.4167 0.4544 0.3862 -0.0166 -0.1114 -0.0797 516 ALA A C   
4102 O O   . ALA A 516 ? 0.3457 0.3833 0.3333 -0.0164 -0.1132 -0.0791 516 ALA A O   
4103 C CB  . ALA A 516 ? 0.2634 0.2937 0.2070 -0.0158 -0.1035 -0.0900 516 ALA A CB  
4104 N N   . GLN A 517 ? 0.4526 0.4949 0.4061 -0.0158 -0.1186 -0.0758 517 GLN A N   
4105 C CA  . GLN A 517 ? 0.4803 0.5254 0.4355 -0.0144 -0.1305 -0.0693 517 GLN A CA  
4106 C C   . GLN A 517 ? 0.4021 0.4439 0.3792 -0.0137 -0.1303 -0.0651 517 GLN A C   
4107 O O   . GLN A 517 ? 0.3211 0.3618 0.3139 -0.0110 -0.1364 -0.0639 517 GLN A O   
4108 C CB  . GLN A 517 ? 0.6066 0.6552 0.5350 -0.0137 -0.1369 -0.0635 517 GLN A CB  
4109 C CG  . GLN A 517 ? 0.6144 0.6646 0.5211 -0.0123 -0.1464 -0.0625 517 GLN A CG  
4110 C CD  . GLN A 517 ? 0.7119 0.7638 0.5897 -0.0113 -0.1519 -0.0532 517 GLN A CD  
4111 O OE1 . GLN A 517 ? 0.7668 0.8211 0.6318 -0.0120 -0.1453 -0.0516 517 GLN A OE1 
4112 N NE2 . GLN A 517 ? 0.7354 0.7860 0.6017 -0.0093 -0.1639 -0.0458 517 GLN A NE2 
4113 N N   . GLN A 518 ? 0.3029 0.3429 0.2808 -0.0158 -0.1241 -0.0633 518 GLN A N   
4114 C CA  . GLN A 518 ? 0.2339 0.2669 0.2297 -0.0159 -0.1233 -0.0601 518 GLN A CA  
4115 C C   . GLN A 518 ? 0.4289 0.4583 0.4454 -0.0139 -0.1172 -0.0651 518 GLN A C   
4116 O O   . GLN A 518 ? 0.4655 0.4903 0.4966 -0.0106 -0.1225 -0.0635 518 GLN A O   
4117 C CB  . GLN A 518 ? 0.3205 0.3527 0.3144 -0.0203 -0.1158 -0.0590 518 GLN A CB  
4118 C CG  . GLN A 518 ? 0.3646 0.4012 0.3387 -0.0233 -0.1226 -0.0522 518 GLN A CG  
4119 C CD  . GLN A 518 ? 0.4370 0.4850 0.3911 -0.0219 -0.1188 -0.0574 518 GLN A CD  
4120 O OE1 . GLN A 518 ? 0.4459 0.4941 0.3979 -0.0192 -0.1153 -0.0641 518 GLN A OE1 
4121 N NE2 . GLN A 518 ? 0.3914 0.4472 0.3316 -0.0245 -0.1140 -0.0508 518 GLN A NE2 
4122 N N   . CYS A 519 ? 0.4110 0.4415 0.4277 -0.0153 -0.1070 -0.0704 519 CYS A N   
4123 C CA  . CYS A 519 ? 0.3210 0.3481 0.3540 -0.0140 -0.1004 -0.0736 519 CYS A CA  
4124 C C   . CYS A 519 ? 0.3852 0.4170 0.4283 -0.0115 -0.1081 -0.0757 519 CYS A C   
4125 O O   . CYS A 519 ? 0.4650 0.4966 0.5259 -0.0092 -0.1070 -0.0776 519 CYS A O   
4126 C CB  . CYS A 519 ? 0.2330 0.2574 0.2611 -0.0162 -0.0888 -0.0762 519 CYS A CB  
4127 S SG  . CYS A 519 ? 0.6266 0.6455 0.6523 -0.0182 -0.0793 -0.0733 519 CYS A SG  
4128 N N   . ARG A 520 ? 0.3606 0.3977 0.3925 -0.0119 -0.1166 -0.0755 520 ARG A N   
4129 C CA  . ARG A 520 ? 0.2774 0.3207 0.3187 -0.0100 -0.1267 -0.0762 520 ARG A CA  
4130 C C   . ARG A 520 ? 0.3032 0.3462 0.3592 -0.0045 -0.1357 -0.0722 520 ARG A C   
4131 O O   . ARG A 520 ? 0.2851 0.3327 0.3612 -0.0013 -0.1397 -0.0741 520 ARG A O   
4132 C CB  . ARG A 520 ? 0.3244 0.3718 0.3466 -0.0116 -0.1352 -0.0760 520 ARG A CB  
4133 C CG  . ARG A 520 ? 0.4252 0.4775 0.4518 -0.0142 -0.1387 -0.0804 520 ARG A CG  
4134 C CD  . ARG A 520 ? 0.6654 0.7186 0.6684 -0.0165 -0.1458 -0.0815 520 ARG A CD  
4135 N NE  . ARG A 520 ? 0.7738 0.8199 0.7601 -0.0199 -0.1368 -0.0862 520 ARG A NE  
4136 C CZ  . ARG A 520 ? 0.7808 0.8234 0.7438 -0.0193 -0.1350 -0.0864 520 ARG A CZ  
4137 N NH1 . ARG A 520 ? 0.6868 0.7329 0.6379 -0.0167 -0.1415 -0.0811 520 ARG A NH1 
4138 N NH2 . ARG A 520 ? 0.8245 0.8599 0.7752 -0.0207 -0.1271 -0.0915 520 ARG A NH2 
4139 N N   . PHE A 521 ? 0.3061 0.3434 0.3528 -0.0034 -0.1396 -0.0665 521 PHE A N   
4140 C CA  . PHE A 521 ? 0.3260 0.3576 0.3845 0.0021  -0.1495 -0.0615 521 PHE A CA  
4141 C C   . PHE A 521 ? 0.3277 0.3541 0.4083 0.0047  -0.1430 -0.0659 521 PHE A C   
4142 O O   . PHE A 521 ? 0.2927 0.3200 0.3932 0.0111  -0.1499 -0.0667 521 PHE A O   
4143 C CB  . PHE A 521 ? 0.3172 0.3399 0.3583 0.0009  -0.1555 -0.0527 521 PHE A CB  
4144 C CG  . PHE A 521 ? 0.3195 0.3296 0.3713 0.0059  -0.1656 -0.0462 521 PHE A CG  
4145 C CD1 . PHE A 521 ? 0.2807 0.2899 0.3367 0.0129  -0.1803 -0.0401 521 PHE A CD1 
4146 C CD2 . PHE A 521 ? 0.2535 0.2510 0.3107 0.0038  -0.1610 -0.0461 521 PHE A CD2 
4147 C CE1 . PHE A 521 ? 0.2915 0.2863 0.3570 0.0192  -0.1903 -0.0334 521 PHE A CE1 
4148 C CE2 . PHE A 521 ? 0.3938 0.3756 0.4598 0.0086  -0.1721 -0.0403 521 PHE A CE2 
4149 C CZ  . PHE A 521 ? 0.3683 0.3483 0.4387 0.0173  -0.1868 -0.0337 521 PHE A CZ  
4150 N N   . TRP A 522 ? 0.2882 0.3096 0.3652 0.0005  -0.1297 -0.0687 522 TRP A N   
4151 C CA  . TRP A 522 ? 0.3229 0.3370 0.4156 0.0026  -0.1231 -0.0724 522 TRP A CA  
4152 C C   . TRP A 522 ? 0.3706 0.3925 0.4820 0.0051  -0.1180 -0.0794 522 TRP A C   
4153 O O   . TRP A 522 ? 0.3384 0.3604 0.4707 0.0109  -0.1221 -0.0828 522 TRP A O   
4154 C CB  . TRP A 522 ? 0.1900 0.1966 0.2709 -0.0029 -0.1108 -0.0716 522 TRP A CB  
4155 C CG  . TRP A 522 ? 0.3054 0.3030 0.3752 -0.0058 -0.1165 -0.0650 522 TRP A CG  
4156 C CD1 . TRP A 522 ? 0.2914 0.2918 0.3436 -0.0117 -0.1147 -0.0610 522 TRP A CD1 
4157 C CD2 . TRP A 522 ? 0.2988 0.2816 0.3745 -0.0036 -0.1266 -0.0613 522 TRP A CD2 
4158 N NE1 . TRP A 522 ? 0.2745 0.2642 0.3213 -0.0147 -0.1228 -0.0538 522 TRP A NE1 
4159 C CE2 . TRP A 522 ? 0.2693 0.2455 0.3289 -0.0102 -0.1306 -0.0532 522 TRP A CE2 
4160 C CE3 . TRP A 522 ? 0.3242 0.2980 0.4179 0.0034  -0.1339 -0.0641 522 TRP A CE3 
4161 C CZ2 . TRP A 522 ? 0.3077 0.2649 0.3656 -0.0119 -0.1418 -0.0460 522 TRP A CZ2 
4162 C CZ3 . TRP A 522 ? 0.3434 0.2975 0.4359 0.0036  -0.1455 -0.0587 522 TRP A CZ3 
4163 C CH2 . TRP A 522 ? 0.3790 0.3232 0.4509 -0.0042 -0.1465 -0.0477 522 TRP A CH2 
4164 N N   . THR A 523 ? 0.4551 0.4836 0.5598 0.0006  -0.1099 -0.0817 523 THR A N   
4165 C CA  . THR A 523 ? 0.5163 0.5506 0.6365 0.0007  -0.1037 -0.0873 523 THR A CA  
4166 C C   . THR A 523 ? 0.4595 0.5071 0.5958 0.0026  -0.1133 -0.0895 523 THR A C   
4167 O O   . THR A 523 ? 0.4299 0.4854 0.5852 0.0029  -0.1105 -0.0943 523 THR A O   
4168 C CB  . THR A 523 ? 0.5612 0.5935 0.6672 -0.0054 -0.0916 -0.0873 523 THR A CB  
4169 O OG1 . THR A 523 ? 0.4852 0.5241 0.5856 -0.0091 -0.0952 -0.0880 523 THR A OG1 
4170 C CG2 . THR A 523 ? 0.5085 0.5321 0.5944 -0.0079 -0.0861 -0.0827 523 THR A CG2 
4171 N N   . SER A 524 ? 0.5085 0.5597 0.6375 0.0034  -0.1250 -0.0854 524 SER A N   
4172 C CA  . SER A 524 ? 0.5448 0.6097 0.6873 0.0047  -0.1355 -0.0857 524 SER A CA  
4173 C C   . SER A 524 ? 0.6147 0.6832 0.7717 0.0133  -0.1491 -0.0820 524 SER A C   
4174 O O   . SER A 524 ? 0.7388 0.8190 0.9213 0.0178  -0.1532 -0.0841 524 SER A O   
4175 C CB  . SER A 524 ? 0.6091 0.6773 0.7317 -0.0012 -0.1396 -0.0840 524 SER A CB  
4176 O OG  . SER A 524 ? 0.6975 0.7788 0.8319 -0.0004 -0.1517 -0.0833 524 SER A OG  
4177 N N   . PHE A 525 ? 0.6348 0.6936 0.7759 0.0157  -0.1562 -0.0756 525 PHE A N   
4178 C CA  . PHE A 525 ? 0.6546 0.7122 0.8056 0.0247  -0.1701 -0.0697 525 PHE A CA  
4179 C C   . PHE A 525 ? 0.6878 0.7362 0.8570 0.0320  -0.1684 -0.0716 525 PHE A C   
4180 O O   . PHE A 525 ? 0.7107 0.7659 0.9047 0.0408  -0.1736 -0.0724 525 PHE A O   
4181 C CB  . PHE A 525 ? 0.7175 0.7657 0.8414 0.0239  -0.1790 -0.0605 525 PHE A CB  
4182 C CG  . PHE A 525 ? 0.9096 0.9522 1.0380 0.0331  -0.1941 -0.0516 525 PHE A CG  
4183 C CD1 . PHE A 525 ? 0.9684 0.9947 1.1016 0.0389  -0.1966 -0.0478 525 PHE A CD1 
4184 C CD2 . PHE A 525 ? 1.0724 1.1237 1.1984 0.0360  -0.2065 -0.0462 525 PHE A CD2 
4185 C CE1 . PHE A 525 ? 1.0632 1.0803 1.1982 0.0483  -0.2102 -0.0381 525 PHE A CE1 
4186 C CE2 . PHE A 525 ? 1.1489 1.1931 1.2771 0.0453  -0.2201 -0.0366 525 PHE A CE2 
4187 C CZ  . PHE A 525 ? 1.1420 1.1681 1.2742 0.0518  -0.2214 -0.0322 525 PHE A CZ  
4188 N N   . PHE A 526 ? 0.6468 0.6803 0.8037 0.0285  -0.1612 -0.0722 526 PHE A N   
4189 C CA  . PHE A 526 ? 0.5681 0.5876 0.7363 0.0345  -0.1626 -0.0732 526 PHE A CA  
4190 C C   . PHE A 526 ? 0.5318 0.5575 0.7308 0.0412  -0.1566 -0.0829 526 PHE A C   
4191 O O   . PHE A 526 ? 0.5045 0.5224 0.7187 0.0522  -0.1627 -0.0819 526 PHE A O   
4192 C CB  . PHE A 526 ? 0.4483 0.4508 0.5946 0.0265  -0.1564 -0.0714 526 PHE A CB  
4193 C CG  . PHE A 526 ? 0.3938 0.3752 0.5421 0.0308  -0.1615 -0.0684 526 PHE A CG  
4194 C CD1 . PHE A 526 ? 0.4269 0.3929 0.5615 0.0344  -0.1718 -0.0554 526 PHE A CD1 
4195 C CD2 . PHE A 526 ? 0.3090 0.2794 0.4639 0.0310  -0.1491 -0.0756 526 PHE A CD2 
4196 C CE1 . PHE A 526 ? 0.3590 0.2977 0.4874 0.0376  -0.1701 -0.0499 526 PHE A CE1 
4197 C CE2 . PHE A 526 ? 0.3129 0.2566 0.4603 0.0347  -0.1474 -0.0710 526 PHE A CE2 
4198 C CZ  . PHE A 526 ? 0.3578 0.2849 0.4924 0.0378  -0.1582 -0.0582 526 PHE A CZ  
4199 N N   . PRO A 527 ? 0.4871 0.5252 0.6942 0.0358  -0.1440 -0.0911 527 PRO A N   
4200 C CA  . PRO A 527 ? 0.4765 0.5228 0.7130 0.0416  -0.1373 -0.1002 527 PRO A CA  
4201 C C   . PRO A 527 ? 0.4843 0.5448 0.7477 0.0537  -0.1444 -0.0984 527 PRO A C   
4202 O O   . PRO A 527 ? 0.4969 0.5634 0.7841 0.0616  -0.1371 -0.1042 527 PRO A O   
4203 C CB  . PRO A 527 ? 0.4169 0.4745 0.6522 0.0319  -0.1242 -0.1057 527 PRO A CB  
4204 C CG  . PRO A 527 ? 0.3969 0.4443 0.5988 0.0228  -0.1207 -0.1003 527 PRO A CG  
4205 C CD  . PRO A 527 ? 0.4272 0.4706 0.6162 0.0251  -0.1344 -0.0916 527 PRO A CD  
4206 N N   . LYS A 528 ? 0.4990 0.5644 0.7563 0.0556  -0.1567 -0.0898 528 LYS A N   
4207 C CA  . LYS A 528 ? 0.5948 0.6743 0.8749 0.0668  -0.1637 -0.0864 528 LYS A CA  
4208 C C   . LYS A 528 ? 0.7047 0.7668 0.9866 0.0813  -0.1710 -0.0803 528 LYS A C   
4209 O O   . LYS A 528 ? 0.7936 0.8645 1.0971 0.0932  -0.1715 -0.0795 528 LYS A O   
4210 C CB  . LYS A 528 ? 0.5469 0.6396 0.8197 0.0625  -0.1746 -0.0798 528 LYS A CB  
4211 C CG  . LYS A 528 ? 0.5118 0.6170 0.7785 0.0489  -0.1681 -0.0842 528 LYS A CG  
4212 C CD  . LYS A 528 ? 0.5798 0.6939 0.8351 0.0452  -0.1803 -0.0776 528 LYS A CD  
4213 C CE  . LYS A 528 ? 0.6102 0.7280 0.8490 0.0317  -0.1748 -0.0808 528 LYS A CE  
4214 N NZ  . LYS A 528 ? 0.6768 0.7992 0.8995 0.0285  -0.1875 -0.0749 528 LYS A NZ  
4215 N N   . VAL A 529 ? 0.7682 0.8045 1.0260 0.0801  -0.1759 -0.0751 529 VAL A N   
4216 C CA  . VAL A 529 ? 0.8394 0.8515 1.0912 0.0924  -0.1836 -0.0669 529 VAL A CA  
4217 C C   . VAL A 529 ? 0.8382 0.8375 1.1032 0.1034  -0.1719 -0.0732 529 VAL A C   
4218 O O   . VAL A 529 ? 0.7945 0.7959 1.0655 0.0996  -0.1578 -0.0834 529 VAL A O   
4219 C CB  . VAL A 529 ? 0.6910 0.6764 0.9107 0.0861  -0.1919 -0.0575 529 VAL A CB  
4220 C CG1 . VAL A 529 ? 0.6413 0.6379 0.8418 0.0752  -0.1999 -0.0513 529 VAL A CG1 
4221 C CG2 . VAL A 529 ? 0.6630 0.6327 0.8692 0.0764  -0.1780 -0.0634 529 VAL A CG2 
4222 O OXT . VAL A 529 ? 0.8287 0.8134 1.0945 0.1159  -0.1749 -0.0681 529 VAL A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  PRO 32  32  32  PRO PRO A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLN 47  47  47  GLN GLN A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  TRP 52  52  52  TRP TRP A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  HIS 77  77  77  HIS HIS A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  MET 81  81  81  MET MET A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  TRP 98  98  98  TRP TRP A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 TRP 177 177 177 TRP TRP A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 HIS 214 214 214 HIS HIS A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLN 223 223 223 GLN GLN A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 CYS 252 252 252 CYS CYS A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 CYS 263 263 263 CYS CYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 ASN 266 266 266 ASN ASN A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 VAL 279 279 279 VAL VAL A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 PRO 281 281 281 PRO PRO A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 THR 284 284 284 THR THR A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 PRO 292 292 292 PRO PRO A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 MET 302 302 302 MET MET A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 PHE 312 312 312 PHE PHE A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 ILE 317 317 317 ILE ILE A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 PHE 329 329 329 PHE PHE A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 TYR 332 332 332 TYR TYR A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 PRO 335 335 335 PRO PRO A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ASN 341 341 341 ASN ASN A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 ILE 344 344 344 ILE ILE A . n 
A 1 345 ILE 345 345 345 ILE ILE A . n 
A 1 346 THR 346 346 346 THR THR A . n 
A 1 347 ARG 347 347 347 ARG ARG A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 GLU 349 349 349 GLU GLU A . n 
A 1 350 PHE 350 350 350 PHE PHE A . n 
A 1 351 GLN 351 351 351 GLN GLN A . n 
A 1 352 GLU 352 352 352 GLU GLU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 PHE 357 357 357 PHE PHE A . n 
A 1 358 PHE 358 358 358 PHE PHE A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 VAL 361 361 361 VAL VAL A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 GLU 363 363 363 GLU GLU A . n 
A 1 364 PHE 364 364 364 PHE PHE A . n 
A 1 365 GLY 365 365 365 GLY GLY A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 SER 368 368 368 SER SER A . n 
A 1 369 ILE 369 369 369 ILE ILE A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 HIS 372 372 372 HIS HIS A . n 
A 1 373 TYR 373 373 373 TYR TYR A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 TRP 376 376 376 TRP TRP A . n 
A 1 377 VAL 377 377 377 VAL VAL A . n 
A 1 378 ASP 378 378 378 ASP ASP A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 GLN 380 380 380 GLN GLN A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 GLU 383 383 383 GLU GLU A . n 
A 1 384 ASN 384 384 384 ASN ASN A . n 
A 1 385 TYR 385 385 385 TYR TYR A . n 
A 1 386 ARG 386 386 386 ARG ARG A . n 
A 1 387 GLU 387 387 387 GLU GLU A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 VAL 392 392 392 VAL VAL A . n 
A 1 393 VAL 393 393 393 VAL VAL A . n 
A 1 394 GLY 394 394 394 GLY GLY A . n 
A 1 395 ASP 395 395 395 ASP ASP A . n 
A 1 396 TYR 396 396 396 TYR TYR A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 PHE 398 398 398 PHE PHE A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 CYS 400 400 400 CYS CYS A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 ALA 402 402 402 ALA ALA A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 LYS 407 407 407 LYS LYS A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 PHE 409 409 409 PHE PHE A . n 
A 1 410 SER 410 410 410 SER SER A . n 
A 1 411 GLU 411 411 411 GLU GLU A . n 
A 1 412 TRP 412 412 412 TRP TRP A . n 
A 1 413 GLY 413 413 413 GLY GLY A . n 
A 1 414 ASN 414 414 414 ASN ASN A . n 
A 1 415 ASN 415 415 415 ASN ASN A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 PHE 417 417 417 PHE PHE A . n 
A 1 418 PHE 418 418 418 PHE PHE A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 TYR 420 420 420 TYR TYR A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 GLU 422 422 422 GLU GLU A . n 
A 1 423 HIS 423 423 423 HIS HIS A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 SER 425 425 425 SER SER A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 LYS 427 427 427 LYS LYS A . n 
A 1 428 LEU 428 428 428 LEU LEU A . n 
A 1 429 PRO 429 429 429 PRO PRO A . n 
A 1 430 TRP 430 430 430 TRP TRP A . n 
A 1 431 PRO 431 431 431 PRO PRO A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 TRP 433 433 433 TRP TRP A . n 
A 1 434 MET 434 434 434 MET MET A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 VAL 436 436 436 VAL VAL A . n 
A 1 437 MET 437 437 437 MET MET A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 TYR 440 440 440 TYR TYR A . n 
A 1 441 GLU 441 441 441 GLU GLU A . n 
A 1 442 ILE 442 442 442 ILE ILE A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 PHE 444 444 444 PHE PHE A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 GLY 447 447 447 GLY GLY A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 PRO 449 449 449 PRO PRO A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 GLU 451 451 451 GLU GLU A . n 
A 1 452 ARG 452 452 452 ARG ARG A . n 
A 1 453 ARG 453 453 453 ARG ARG A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 GLN 455 455 455 GLN GLN A . n 
A 1 456 TYR 456 456 456 TYR TYR A . n 
A 1 457 THR 457 457 457 THR THR A . n 
A 1 458 LYS 458 458 458 LYS LYS A . n 
A 1 459 ALA 459 459 459 ALA ALA A . n 
A 1 460 GLU 460 460 460 GLU GLU A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 ILE 462 462 462 ILE ILE A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 SER 464 464 464 SER SER A . n 
A 1 465 ARG 465 465 465 ARG ARG A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ILE 467 467 467 ILE ILE A . n 
A 1 468 VAL 468 468 468 VAL VAL A . n 
A 1 469 LYS 469 469 469 LYS LYS A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 TRP 471 471 471 TRP TRP A . n 
A 1 472 ALA 472 472 472 ALA ALA A . n 
A 1 473 ASN 473 473 473 ASN ASN A . n 
A 1 474 PHE 474 474 474 PHE PHE A . n 
A 1 475 ALA 475 475 475 ALA ALA A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 TYR 477 477 477 TYR TYR A . n 
A 1 478 GLY 478 478 478 GLY GLY A . n 
A 1 479 ASN 479 479 479 ASN ASN A . n 
A 1 480 PRO 480 480 480 PRO PRO A . n 
A 1 481 GLN 481 481 481 GLN GLN A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 THR 483 483 483 THR THR A . n 
A 1 484 GLN 484 484 484 GLN GLN A . n 
A 1 485 ASN 485 485 485 ASN ASN A . n 
A 1 486 ASN 486 486 486 ASN ASN A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 THR 488 488 488 THR THR A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 TRP 490 490 490 TRP TRP A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 VAL 492 492 492 VAL VAL A . n 
A 1 493 PHE 493 493 493 PHE PHE A . n 
A 1 494 LYS 494 494 494 LYS LYS A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 GLN 498 498 498 GLN GLN A . n 
A 1 499 LYS 499 499 499 LYS LYS A . n 
A 1 500 TYR 500 500 500 TYR TYR A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 THR 502 502 502 THR THR A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 ASN 504 504 504 ASN ASN A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 GLU 506 506 506 GLU GLU A . n 
A 1 507 SER 507 507 507 SER SER A . n 
A 1 508 THR 508 508 508 THR THR A . n 
A 1 509 ARG 509 509 509 ARG ARG A . n 
A 1 510 ILE 510 510 510 ILE ILE A . n 
A 1 511 MET 511 511 511 MET MET A . n 
A 1 512 THR 512 512 512 THR THR A . n 
A 1 513 LYS 513 513 513 LYS LYS A . n 
A 1 514 LEU 514 514 514 LEU LEU A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 ALA 516 516 516 ALA ALA A . n 
A 1 517 GLN 517 517 517 GLN GLN A . n 
A 1 518 GLN 518 518 518 GLN GLN A . n 
A 1 519 CYS 519 519 519 CYS CYS A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 PHE 521 521 521 PHE PHE A . n 
A 1 522 TRP 522 522 522 TRP TRP A . n 
A 1 523 THR 523 523 523 THR THR A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 PHE 526 526 526 PHE PHE A . n 
A 1 527 PRO 527 527 527 PRO PRO A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B  2 UNX 1   705  705  UNX UNX A . 
C  2 UNX 1   706  706  UNX UNX A . 
D  2 UNX 1   707  707  UNX UNX A . 
E  2 UNX 1   709  709  UNX UNX A . 
F  2 UNX 1   710  710  UNX UNX A . 
G  2 UNX 1   711  711  UNX UNX A . 
H  2 UNX 1   712  712  UNX UNX A . 
I  3 NAG 1   540  540  NAG NAG A . 
J  4 FUL 2   541  541  FUL FUL A . 
K  3 NAG 1   550  550  NAG NAG A . 
L  3 NAG 1   560  560  NAG NAG A . 
M  3 NAG 2   561  561  NAG NAG A . 
N  4 FUL 3   562  562  FUL FUL A . 
O  3 NAG 1   570  570  NAG NAG A . 
P  3 NAG 2   571  571  NAG NAG A . 
Q  4 FUL 3   572  572  FUL FUL A . 
R  3 NAG 1   580  580  NAG NAG A . 
S  3 NAG 1   590  590  NAG NAG A . 
T  5 SO4 1   700  700  SO4 SO4 A . 
U  5 SO4 1   701  701  SO4 SO4 A . 
V  5 SO4 1   702  702  SO4 SO4 A . 
W  5 SO4 1   703  703  SO4 SO4 A . 
X  5 SO4 1   704  704  SO4 SO4 A . 
Y  6 CL  1   713  713  CL  CL  A . 
Z  7 4OJ 1   1530 1530 4OJ 4OJ A . 
AA 8 HOH 1   2001 2001 HOH HOH A . 
AA 8 HOH 2   2002 2002 HOH HOH A . 
AA 8 HOH 3   2003 2003 HOH HOH A . 
AA 8 HOH 4   2004 2004 HOH HOH A . 
AA 8 HOH 5   2005 2005 HOH HOH A . 
AA 8 HOH 6   2006 2006 HOH HOH A . 
AA 8 HOH 7   2007 2007 HOH HOH A . 
AA 8 HOH 8   2008 2008 HOH HOH A . 
AA 8 HOH 9   2009 2009 HOH HOH A . 
AA 8 HOH 10  2010 2010 HOH HOH A . 
AA 8 HOH 11  2011 2011 HOH HOH A . 
AA 8 HOH 12  2012 2012 HOH HOH A . 
AA 8 HOH 13  2013 2013 HOH HOH A . 
AA 8 HOH 14  2014 2014 HOH HOH A . 
AA 8 HOH 15  2015 2015 HOH HOH A . 
AA 8 HOH 16  2016 2016 HOH HOH A . 
AA 8 HOH 17  2017 2017 HOH HOH A . 
AA 8 HOH 18  2018 2018 HOH HOH A . 
AA 8 HOH 19  2019 2019 HOH HOH A . 
AA 8 HOH 20  2020 2020 HOH HOH A . 
AA 8 HOH 21  2021 2021 HOH HOH A . 
AA 8 HOH 22  2022 2022 HOH HOH A . 
AA 8 HOH 23  2023 2023 HOH HOH A . 
AA 8 HOH 24  2024 2024 HOH HOH A . 
AA 8 HOH 25  2025 2025 HOH HOH A . 
AA 8 HOH 26  2026 2026 HOH HOH A . 
AA 8 HOH 27  2027 2027 HOH HOH A . 
AA 8 HOH 28  2028 2028 HOH HOH A . 
AA 8 HOH 29  2029 2029 HOH HOH A . 
AA 8 HOH 30  2030 2030 HOH HOH A . 
AA 8 HOH 31  2031 2031 HOH HOH A . 
AA 8 HOH 32  2032 2032 HOH HOH A . 
AA 8 HOH 33  2033 2033 HOH HOH A . 
AA 8 HOH 34  2034 2034 HOH HOH A . 
AA 8 HOH 35  2035 2035 HOH HOH A . 
AA 8 HOH 36  2036 2036 HOH HOH A . 
AA 8 HOH 37  2037 2037 HOH HOH A . 
AA 8 HOH 38  2038 2038 HOH HOH A . 
AA 8 HOH 39  2039 2039 HOH HOH A . 
AA 8 HOH 40  2040 2040 HOH HOH A . 
AA 8 HOH 41  2041 2041 HOH HOH A . 
AA 8 HOH 42  2042 2042 HOH HOH A . 
AA 8 HOH 43  2043 2043 HOH HOH A . 
AA 8 HOH 44  2044 2044 HOH HOH A . 
AA 8 HOH 45  2045 2045 HOH HOH A . 
AA 8 HOH 46  2046 2046 HOH HOH A . 
AA 8 HOH 47  2047 2047 HOH HOH A . 
AA 8 HOH 48  2048 2048 HOH HOH A . 
AA 8 HOH 49  2049 2049 HOH HOH A . 
AA 8 HOH 50  2050 2050 HOH HOH A . 
AA 8 HOH 51  2051 2051 HOH HOH A . 
AA 8 HOH 52  2052 2052 HOH HOH A . 
AA 8 HOH 53  2053 2053 HOH HOH A . 
AA 8 HOH 54  2054 2054 HOH HOH A . 
AA 8 HOH 55  2055 2055 HOH HOH A . 
AA 8 HOH 56  2056 2056 HOH HOH A . 
AA 8 HOH 57  2057 2057 HOH HOH A . 
AA 8 HOH 58  2058 2058 HOH HOH A . 
AA 8 HOH 59  2059 2059 HOH HOH A . 
AA 8 HOH 60  2060 2060 HOH HOH A . 
AA 8 HOH 61  2061 2061 HOH HOH A . 
AA 8 HOH 62  2062 2062 HOH HOH A . 
AA 8 HOH 63  2063 2063 HOH HOH A . 
AA 8 HOH 64  2064 2064 HOH HOH A . 
AA 8 HOH 65  2065 2065 HOH HOH A . 
AA 8 HOH 66  2066 2066 HOH HOH A . 
AA 8 HOH 67  2067 2067 HOH HOH A . 
AA 8 HOH 68  2068 2068 HOH HOH A . 
AA 8 HOH 69  2069 2069 HOH HOH A . 
AA 8 HOH 70  2070 2070 HOH HOH A . 
AA 8 HOH 71  2071 2071 HOH HOH A . 
AA 8 HOH 72  2072 2072 HOH HOH A . 
AA 8 HOH 73  2073 2073 HOH HOH A . 
AA 8 HOH 74  2074 2074 HOH HOH A . 
AA 8 HOH 75  2075 2075 HOH HOH A . 
AA 8 HOH 76  2076 2076 HOH HOH A . 
AA 8 HOH 77  2077 2077 HOH HOH A . 
AA 8 HOH 78  2078 2078 HOH HOH A . 
AA 8 HOH 79  2079 2079 HOH HOH A . 
AA 8 HOH 80  2080 2080 HOH HOH A . 
AA 8 HOH 81  2081 2081 HOH HOH A . 
AA 8 HOH 82  2082 2082 HOH HOH A . 
AA 8 HOH 83  2083 2083 HOH HOH A . 
AA 8 HOH 84  2084 2084 HOH HOH A . 
AA 8 HOH 85  2085 2085 HOH HOH A . 
AA 8 HOH 86  2086 2086 HOH HOH A . 
AA 8 HOH 87  2087 2087 HOH HOH A . 
AA 8 HOH 88  2088 2088 HOH HOH A . 
AA 8 HOH 89  2089 2089 HOH HOH A . 
AA 8 HOH 90  2090 2090 HOH HOH A . 
AA 8 HOH 91  2091 2091 HOH HOH A . 
AA 8 HOH 92  2092 2092 HOH HOH A . 
AA 8 HOH 93  2093 2093 HOH HOH A . 
AA 8 HOH 94  2094 2094 HOH HOH A . 
AA 8 HOH 95  2095 2095 HOH HOH A . 
AA 8 HOH 96  2096 2096 HOH HOH A . 
AA 8 HOH 97  2097 2097 HOH HOH A . 
AA 8 HOH 98  2098 2098 HOH HOH A . 
AA 8 HOH 99  2099 2099 HOH HOH A . 
AA 8 HOH 100 2100 2100 HOH HOH A . 
AA 8 HOH 101 2101 2101 HOH HOH A . 
AA 8 HOH 102 2102 2102 HOH HOH A . 
AA 8 HOH 103 2103 2103 HOH HOH A . 
AA 8 HOH 104 2104 2104 HOH HOH A . 
AA 8 HOH 105 2105 2105 HOH HOH A . 
AA 8 HOH 106 2106 2106 HOH HOH A . 
AA 8 HOH 107 2107 2107 HOH HOH A . 
AA 8 HOH 108 2108 2108 HOH HOH A . 
AA 8 HOH 109 2109 2109 HOH HOH A . 
AA 8 HOH 110 2110 2110 HOH HOH A . 
AA 8 HOH 111 2111 2111 HOH HOH A . 
AA 8 HOH 112 2112 2112 HOH HOH A . 
AA 8 HOH 113 2113 2113 HOH HOH A . 
AA 8 HOH 114 2114 2114 HOH HOH A . 
AA 8 HOH 115 2115 2115 HOH HOH A . 
AA 8 HOH 116 2116 2116 HOH HOH A . 
AA 8 HOH 117 2117 2117 HOH HOH A . 
AA 8 HOH 118 2118 2118 HOH HOH A . 
AA 8 HOH 119 2119 2119 HOH HOH A . 
AA 8 HOH 120 2120 2120 HOH HOH A . 
AA 8 HOH 121 2121 2121 HOH HOH A . 
AA 8 HOH 122 2122 2122 HOH HOH A . 
AA 8 HOH 123 2123 2123 HOH HOH A . 
AA 8 HOH 124 2124 2124 HOH HOH A . 
AA 8 HOH 125 2125 2125 HOH HOH A . 
AA 8 HOH 126 2126 2126 HOH HOH A . 
AA 8 HOH 127 2127 2127 HOH HOH A . 
AA 8 HOH 128 2128 2128 HOH HOH A . 
AA 8 HOH 129 2129 2129 HOH HOH A . 
AA 8 HOH 130 2130 2130 HOH HOH A . 
AA 8 HOH 131 2131 2131 HOH HOH A . 
AA 8 HOH 132 2132 2132 HOH HOH A . 
AA 8 HOH 133 2133 2133 HOH HOH A . 
AA 8 HOH 134 2134 2134 HOH HOH A . 
AA 8 HOH 135 2135 2135 HOH HOH A . 
AA 8 HOH 136 2136 2136 HOH HOH A . 
AA 8 HOH 137 2137 2137 HOH HOH A . 
AA 8 HOH 138 2138 2138 HOH HOH A . 
AA 8 HOH 139 2139 2139 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 106 A ASN 106 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 256 A ASN 256 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-02-06 
2 'Structure model' 1 1 2013-03-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -14.7815 -32.1307 -35.3739 0.2526 0.1341 0.1826 -0.0817 -0.0397 -0.1293 1.7111 1.6131 2.5274 
0.4409 0.1482 0.4177  -0.0536 0.3157  -0.2752 -0.4094 0.1311 -0.0890 0.1528 0.0362  0.0492 
'X-RAY DIFFRACTION' 2 ? refined -19.4174 -31.9835 -10.8545 0.1418 0.1915 0.1819 -0.0458 -0.0752 -0.0754 1.2429 2.1013 2.2652 
0.0125 0.4689 -0.2786 0.0000  -0.4443 -0.1678 0.1672  0.1314 0.0708  0.1157 -0.3262 0.0746 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 3:316)'   
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 317:529)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE: 1.8.1_1168)' ? 1 
XDS    'data reduction' .                             ? 2 
XSCALE 'data scaling'   .                             ? 3 
MOLREP phasing          .                             ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 ND2 A ASN 485  ? ? C1  A NAG 580  ? ? 1.44 
2  1 ND2 A ASN 57   ? ? C1  A NAG 540  ? ? 1.44 
3  1 ND2 A ASN 341  ? ? C1  A NAG 570  ? ? 1.44 
4  1 ND2 A ASN 241  ? ? C1  A NAG 560  ? ? 1.46 
5  1 UNK A UNX 706  ? ? UNK A UNX 709  ? ? 1.83 
6  1 UNK A UNX 709  ? ? UNK A UNX 710  ? ? 1.90 
7  1 UNK A UNX 707  ? ? UNK A UNX 709  ? ? 2.00 
8  1 UNK A UNX 707  ? ? UNK A UNX 710  ? ? 2.10 
9  1 O   A HOH 2072 ? ? O   A HOH 2090 ? ? 2.11 
10 1 O   A HOH 2071 ? ? O   A HOH 2090 ? ? 2.15 
11 1 ND2 A ASN 485  ? ? C2  A NAG 580  ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     509 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    SO4 
_pdbx_validate_symm_contact.auth_seq_id_2     703 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   7_555 
_pdbx_validate_symm_contact.dist              2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CA A SER 198 ? ? CB A SER 198 ? ? 1.648 1.525 0.123 0.015 N 
2 1 CB A SER 198 ? ? OG A SER 198 ? ? 1.675 1.418 0.257 0.013 N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_1              198 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_2              198 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_3              198 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.05 
_pdbx_validate_rmsd_angle.angle_target_value         111.20 
_pdbx_validate_rmsd_angle.angle_deviation            16.85 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 43  ? ? 70.66   -8.00   
2  1 LYS A 45  ? ? -48.01  157.47  
3  1 ASP A 54  ? ? 60.17   -170.66 
4  1 ASP A 87  ? ? -37.44  134.88  
5  1 SER A 89  ? ? -173.49 149.52  
6  1 LYS A 103 ? ? -34.63  120.79  
7  1 ASN A 106 ? ? -144.99 59.73   
8  1 ASN A 159 ? ? -48.10  109.35  
9  1 ALA A 162 ? ? -161.37 75.11   
10 1 SER A 198 ? ? 59.38   -123.45 
11 1 ASP A 297 ? ? -136.33 -77.19  
12 1 ASP A 378 ? ? 62.48   84.20   
13 1 ASP A 379 ? ? -138.42 -59.26  
14 1 PHE A 398 ? ? -136.97 -62.93  
15 1 PRO A 480 ? ? -83.83  48.97   
16 1 ASN A 485 ? ? -116.56 62.71   
17 1 ASN A 486 ? ? 39.62   46.83   
18 1 THR A 496 ? ? 72.34   -58.61  
19 1 GLU A 506 ? ? -93.13  -73.23  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A ARG 40  ? CD ? A ARG 40  CD 
2 1 Y 0 A GLU 432 ? CD ? A GLU 432 CD 
3 1 N 1 A NAG 540 ? O1 ? I NAG 1   O1 
4 1 N 1 A NAG 560 ? O1 ? L NAG 1   O1 
5 1 N 1 A NAG 570 ? O1 ? O NAG 1   O1 
6 1 N 1 A NAG 580 ? O1 ? R NAG 1   O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 1 ? A GLU 1 
2 1 Y 1 A ASP 2 ? A ASP 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'UNKNOWN ATOM OR ION'                   UNX 
3 N-ACETYL-D-GLUCOSAMINE                  NAG 
4 BETA-L-FUCOSE                           FUL 
5 'SULFATE ION'                           SO4 
6 'CHLORIDE ION'                          CL  
7 '(2-methylphenyl) dihydrogen phosphate' 4OJ 
8 water                                   HOH 
#