data_4BC1
# 
_entry.id   4BC1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BC1         
PDBE  EBI-54259    
WWPDB D_1290054259 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- DECIDIUM COMPLEX' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- GALLAMINE COMPLEX' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- PROPIDIUM COMPLEX' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- TZ2PA6SYN COMPLEX' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- TZ2PA6ANTI COMPLEX' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE'     
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 2WLS unspecified 'CRYSTAL STRUCTURE OF MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH AMTS13' 
PDB 2WU3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND HI-6' 
PDB 2WU4 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND ORTHO-7' 
PDB 2XUD unspecified 'CRYSTAL STRUCTURE OF THE Y337A MUTANT OF MOUSE ACETYLCHOLINESTERASE' 
PDB 2XUF unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 1 MTH)' 
PDB 2XUG unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 1 WK)' 
PDB 2XUH unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 10 MTH)' 
PDB 2XUI unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 WK)' 
PDB 2XUJ unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 MTH)' 
PDB 2XUK unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX ( 10 MTH)' 
PDB 2XUO unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI INHIBITOR' 
PDB 2XUP unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 SYN INHIBITOR' 
PDB 2XUQ unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI-SYN INHIBITORS' 
PDB 4A16 unspecified 'STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEX WITH HUPRINE DERIVATIVE' 
PDB 4A23 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH RACEMIC C5685' 
PDB 4ARA unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH (R)- C5685 AT 2.5 A RESOLUTION.' 
PDB 4ARB unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH (S)- C5685 AT 2.25 A RESOLUTION.' 
PDB 4B7Z unspecified 
'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-1-(4-METHYLPHENYL)-METHANESULFONAMIDE'  
PDB 4B80 unspecified 
'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-1-(4-FLUORO-PHENYL)-METHANESULFONAMIDE' 
PDB 4B81 unspecified 
'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH 1-(4- CHLORO-PHENYL)-N-(2-DIETHYLAMINO-ETHYL)-METHANESULFONAMIDE' 
PDB 4B82 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-2-FLUORANYL-BENZENESULFONAMIDE' 
PDB 4B83 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-3-METHOXY-BENZENESULFONAMIDE' 
PDB 4B84 unspecified 
'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH N-(2- DIETHYLAMINO-ETHYL)-3-TRIFLUOROMETHYL-BENZENESULFONAMIDE'   
PDB 4B85 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH 4- CHLORANYL-N-(2-DIETHYLAMINO-ETHYL)-BENZENESULFONAMIDE' 
PDB 4BBZ unspecified 'STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY CBDP (2-MIN SOAK): CRESYL-PHOSPHOSERINE ADDUCT' 
PDB 4BC0 unspecified 'STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY CBDP (12-H SOAK): CRESYL-PHOSPHOSERINE ADDUCT' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BC1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-09-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Carletti, E.'     1 
'Colletier, J.-P.' 2 
'Schopfer, L.M.'   3 
'Santoni, G.'      4 
'Masson, P.'       5 
'Lockridge, O.'    6 
'Nachon, F.'       7 
'Weik, M.'         8 
# 
_citation.id                        primary 
_citation.title                     
;Inhibition Pathways of the Potent Organophosphate Cbdp with Cholinesterases Revealed by X-Ray Crystallographic Snapshots and Mass Spectrometry
;
_citation.journal_abbrev            Chem.Res.Toxicol. 
_citation.journal_volume            26 
_citation.page_first                280 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           CRTOEC 
_citation.country                   US 
_citation.journal_id_ISSN           0893-228X 
_citation.journal_id_CSD            2140 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23339663 
_citation.pdbx_database_id_DOI      10.1021/TX3004505 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Carletti, E.'     1 
primary 'Colletier, J.-P.' 2 
primary 'Schopfer, L.M.'   3 
primary 'Santoni, G.'      4 
primary 'Masson, P.'       5 
primary 'Lockridge, O.'    6 
primary 'Nachon, F.'       7 
primary 'Weik, M.'         8 
# 
_cell.entry_id           4BC1 
_cell.length_a           135.540 
_cell.length_b           173.250 
_cell.length_c           224.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BC1 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE           59764.488 4   3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' 
'CRESYL-SALIGENIN-PHOSPHATE ADDUCT ON S203' 
2 non-polymer syn 'O-CRESYL-SALIGENIN PHOSPHATE' 294.240   4   ?       ? ?                                   ? 
3 non-polymer man N-ACETYL-D-GLUCOSAMINE         221.208   7   ?       ? ?                                   ? 
4 non-polymer syn 'CHLORIDE ION'                 35.453    11  ?       ? ?                                   ? 
5 non-polymer syn 'SULFATE ION'                  96.063    15  ?       ? ?                                   ? 
6 water       nat water                          18.015    835 ?       ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'CHINESE HAMSTER' 
_entity_src_gen.pdbx_host_org_scientific_name      'CRICETULUS GRISEUS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            CHO-K1 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4BC1 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 4BC1 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
3 1 4BC1 C 1 ? 543 ? P21836 32 ? 574 ? 1 543 
4 1 4BC1 D 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                        ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                       ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                     ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                 ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                       ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                      ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                        ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                      ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                          ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                     ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                        ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                         ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                     ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE         ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE                  ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                        ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                         ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                  ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                      ? 'C4 H9 N O3'     119.119 
TQV non-polymer         . 'O-CRESYL-SALIGENIN PHOSPHATE' ? 'C14 H15 O5 P'   294.240 
TRP 'L-peptide linking' y TRYPTOPHAN                     ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                       ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                         ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4BC1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.5 
_exptl_crystal.density_percent_sol   78 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M TRIS HCL BUFFER PH 7.4, 1.6 M AMMONIUM SULFATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9765 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9765 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BC1 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.30 
_reflns.d_resolution_high            2.95 
_reflns.number_obs                   111473 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.00 
_reflns.B_iso_Wilson_estimate        63.89 
_reflns.pdbx_redundancy              4.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.95 
_reflns_shell.d_res_low              3.00 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.53 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.10 
_reflns_shell.pdbx_redundancy        4.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BC1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     111450 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.285 
_refine.ls_d_res_high                            2.950 
_refine.ls_percent_reflns_obs                    99.66 
_refine.ls_R_factor_obs                          0.1879 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1863 
_refine.ls_R_factor_R_free                       0.2378 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.0 
_refine.ls_number_reflns_R_free                  3344 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4A16' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.44 
_refine.pdbx_overall_phase_error                 27.00 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16791 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         260 
_refine_hist.number_atoms_solvent             835 
_refine_hist.number_atoms_total               17886 
_refine_hist.d_res_high                       2.950 
_refine_hist.d_res_low                        48.285 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 17683 'X-RAY DIFFRACTION' ? 
f_angle_d          1.368  ? ? 24190 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.498 ? ? 6363  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.085  ? ? 2580  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 3171  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.9500 2.9921  4428 0.3279 99.00  0.3706 . . 137 . . 
'X-RAY DIFFRACTION' . 2.9921 3.0368  4434 0.3245 99.00  0.3940 . . 137 . . 
'X-RAY DIFFRACTION' . 3.0368 3.0842  4470 0.3061 99.00  0.3756 . . 138 . . 
'X-RAY DIFFRACTION' . 3.0842 3.1348  4402 0.2942 99.00  0.3627 . . 136 . . 
'X-RAY DIFFRACTION' . 3.1348 3.1888  4456 0.2896 99.00  0.3721 . . 138 . . 
'X-RAY DIFFRACTION' . 3.1888 3.2468  4456 0.2737 99.00  0.3262 . . 138 . . 
'X-RAY DIFFRACTION' . 3.2468 3.3092  4477 0.2620 99.00  0.3264 . . 138 . . 
'X-RAY DIFFRACTION' . 3.3092 3.3768  4441 0.2493 100.00 0.3000 . . 138 . . 
'X-RAY DIFFRACTION' . 3.3768 3.4502  4481 0.2331 100.00 0.2892 . . 138 . . 
'X-RAY DIFFRACTION' . 3.4502 3.5304  4464 0.2199 100.00 0.2797 . . 138 . . 
'X-RAY DIFFRACTION' . 3.5304 3.6187  4486 0.2014 100.00 0.2493 . . 139 . . 
'X-RAY DIFFRACTION' . 3.6187 3.7165  4481 0.1943 100.00 0.2733 . . 139 . . 
'X-RAY DIFFRACTION' . 3.7165 3.8258  4489 0.1826 100.00 0.2466 . . 138 . . 
'X-RAY DIFFRACTION' . 3.8258 3.9492  4523 0.1688 100.00 0.2252 . . 140 . . 
'X-RAY DIFFRACTION' . 3.9492 4.0903  4495 0.1585 100.00 0.2264 . . 139 . . 
'X-RAY DIFFRACTION' . 4.0903 4.2540  4515 0.1521 100.00 0.1975 . . 140 . . 
'X-RAY DIFFRACTION' . 4.2540 4.4475  4504 0.1388 100.00 0.1875 . . 139 . . 
'X-RAY DIFFRACTION' . 4.4475 4.6818  4544 0.1324 100.00 0.1851 . . 141 . . 
'X-RAY DIFFRACTION' . 4.6818 4.9748  4520 0.1310 100.00 0.2069 . . 140 . . 
'X-RAY DIFFRACTION' . 4.9748 5.3585  4548 0.1432 100.00 0.1946 . . 140 . . 
'X-RAY DIFFRACTION' . 5.3585 5.8969  4547 0.1431 100.00 0.1888 . . 141 . . 
'X-RAY DIFFRACTION' . 5.8969 6.7482  4581 0.1587 100.00 0.1911 . . 142 . . 
'X-RAY DIFFRACTION' . 6.7482 8.4944  4599 0.1563 99.00  0.1991 . . 142 . . 
'X-RAY DIFFRACTION' . 8.4944 48.2913 4765 0.1872 99.00  0.2008 . . 148 . . 
# 
_struct.entry_id                  4BC1 
_struct.title                     
'Structure of mouse acetylcholinesterase inhibited by CBDP (30-min soak): cresyl-saligenin-phosphoserine adduct' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BC1 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, BUTYRYLCHOLINESTERASE, NERVE TRANSMISSION, INHIBITOR, ALPHA-BETA HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 5 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
EA N N 4 ? 
FA N N 2 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 4 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 5 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 6 ? 
QA N N 6 ? 
RA N N 6 ? 
SA N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2   2   PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3   3   LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4   4   GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P5   5   VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6   6   ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7   7   ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8   8   SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9   9   SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P10  10  ALA A 241 ? VAL A 255 ? ALA A 241 VAL A 255 1 ? 15 
HELX_P HELX_P11  11  ASP A 266 ? THR A 275 ? ASP A 266 THR A 275 1 ? 10 
HELX_P HELX_P12  12  PRO A 277 ? TRP A 286 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P13  13  HIS A 287 ? LEU A 289 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P14  14  THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15  15  GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P16  16  SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17  17  SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18  18  ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19  19  VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20  20  PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21  21  GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22  22  GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P23  23  ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P24  24  THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25  25  ARG A 525 ? SER A 541 ? ARG A 525 SER A 541 1 ? 17 
HELX_P HELX_P26  26  VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P27  27  PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P28  28  LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P29  29  GLY B 135 ? VAL B 141 ? GLY B 135 VAL B 141 1 ? 7  
HELX_P HELX_P30  30  VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P31  31  ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P32  32  ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P33  33  SER B 203 ? SER B 215 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P34  34  SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P35  35  SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P36  36  ASN B 265 ? ARG B 274 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P37  37  PRO B 277 ? GLU B 285 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P38  38  TRP B 286 ? LEU B 289 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P39  39  THR B 311 ? THR B 318 ? THR B 311 THR B 318 1 ? 8  
HELX_P HELX_P40  40  GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P41  41  SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P42  42  SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P43  43  ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P44  44  VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P45  45  GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P46  46  GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P47  47  ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P48  48  THR B 466 ? THR B 486 ? THR B 466 THR B 486 1 ? 21 
HELX_P HELX_P49  49  ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P50  50  LEU B 536 ? SER B 541 ? LEU B 536 SER B 541 1 ? 6  
HELX_P HELX_P51  51  VAL C 42  ? ARG C 46  ? VAL C 42  ARG C 46  5 ? 5  
HELX_P HELX_P52  52  PHE C 80  ? MET C 85  ? PHE C 80  MET C 85  1 ? 6  
HELX_P HELX_P53  53  LEU C 130 ? ASP C 134 ? LEU C 130 ASP C 134 5 ? 5  
HELX_P HELX_P54  54  GLY C 135 ? GLY C 143 ? GLY C 135 GLY C 143 1 ? 9  
HELX_P HELX_P55  55  VAL C 153 ? LEU C 159 ? VAL C 153 LEU C 159 1 ? 7  
HELX_P HELX_P56  56  ASN C 170 ? ILE C 187 ? ASN C 170 ILE C 187 1 ? 18 
HELX_P HELX_P57  57  ALA C 188 ? PHE C 190 ? ALA C 188 PHE C 190 5 ? 3  
HELX_P HELX_P58  58  SER C 203 ? SER C 215 ? SER C 203 SER C 215 1 ? 13 
HELX_P HELX_P59  59  SER C 215 ? SER C 220 ? SER C 215 SER C 220 1 ? 6  
HELX_P HELX_P60  60  ALA C 241 ? VAL C 255 ? ALA C 241 VAL C 255 1 ? 15 
HELX_P HELX_P61  61  ASP C 266 ? ARG C 276 ? ASP C 266 ARG C 276 1 ? 11 
HELX_P HELX_P62  62  PRO C 277 ? GLU C 285 ? PRO C 277 GLU C 285 1 ? 9  
HELX_P HELX_P63  63  TRP C 286 ? LEU C 289 ? TRP C 286 LEU C 289 5 ? 4  
HELX_P HELX_P64  64  THR C 311 ? GLY C 319 ? THR C 311 GLY C 319 1 ? 9  
HELX_P HELX_P65  65  GLY C 335 ? VAL C 340 ? GLY C 335 VAL C 340 1 ? 6  
HELX_P HELX_P66  66  SER C 355 ? VAL C 367 ? SER C 355 VAL C 367 1 ? 13 
HELX_P HELX_P67  67  SER C 371 ? THR C 383 ? SER C 371 THR C 383 1 ? 13 
HELX_P HELX_P68  68  ASP C 390 ? VAL C 407 ? ASP C 390 VAL C 407 1 ? 18 
HELX_P HELX_P69  69  VAL C 407 ? GLN C 421 ? VAL C 407 GLN C 421 1 ? 15 
HELX_P HELX_P70  70  PRO C 440 ? GLY C 444 ? PRO C 440 GLY C 444 5 ? 5  
HELX_P HELX_P71  71  GLU C 450 ? PHE C 455 ? GLU C 450 PHE C 455 1 ? 6  
HELX_P HELX_P72  72  GLY C 456 ? ASP C 460 ? GLY C 456 ASP C 460 5 ? 5  
HELX_P HELX_P73  73  ASP C 460 ? ASN C 464 ? ASP C 460 ASN C 464 5 ? 5  
HELX_P HELX_P74  74  THR C 466 ? GLY C 487 ? THR C 466 GLY C 487 1 ? 22 
HELX_P HELX_P75  75  ARG C 525 ? PHE C 535 ? ARG C 525 PHE C 535 1 ? 11 
HELX_P HELX_P76  76  PHE C 535 ? LEU C 540 ? PHE C 535 LEU C 540 1 ? 6  
HELX_P HELX_P77  77  VAL D 42  ? ARG D 46  ? VAL D 42  ARG D 46  5 ? 5  
HELX_P HELX_P78  78  PHE D 80  ? MET D 85  ? PHE D 80  MET D 85  1 ? 6  
HELX_P HELX_P79  79  LEU D 130 ? ASP D 134 ? LEU D 130 ASP D 134 5 ? 5  
HELX_P HELX_P80  80  GLY D 135 ? GLY D 143 ? GLY D 135 GLY D 143 1 ? 9  
HELX_P HELX_P81  81  VAL D 153 ? LEU D 159 ? VAL D 153 LEU D 159 1 ? 7  
HELX_P HELX_P82  82  ASN D 170 ? ILE D 187 ? ASN D 170 ILE D 187 1 ? 18 
HELX_P HELX_P83  83  ALA D 188 ? PHE D 190 ? ALA D 188 PHE D 190 5 ? 3  
HELX_P HELX_P84  84  SER D 203 ? SER D 215 ? SER D 203 SER D 215 1 ? 13 
HELX_P HELX_P85  85  LEU D 216 ? PHE D 222 ? LEU D 216 PHE D 222 5 ? 7  
HELX_P HELX_P86  86  ALA D 241 ? VAL D 255 ? ALA D 241 VAL D 255 1 ? 15 
HELX_P HELX_P87  87  ASN D 265 ? ARG D 276 ? ASN D 265 ARG D 276 1 ? 12 
HELX_P HELX_P88  88  PRO D 277 ? GLU D 285 ? PRO D 277 GLU D 285 1 ? 9  
HELX_P HELX_P89  89  TRP D 286 ? VAL D 288 ? TRP D 286 VAL D 288 5 ? 3  
HELX_P HELX_P90  90  THR D 311 ? GLY D 319 ? THR D 311 GLY D 319 1 ? 9  
HELX_P HELX_P91  91  GLY D 335 ? VAL D 340 ? GLY D 335 VAL D 340 1 ? 6  
HELX_P HELX_P92  92  SER D 355 ? VAL D 367 ? SER D 355 VAL D 367 1 ? 13 
HELX_P HELX_P93  93  SER D 371 ? THR D 383 ? SER D 371 THR D 383 1 ? 13 
HELX_P HELX_P94  94  ASP D 390 ? VAL D 407 ? ASP D 390 VAL D 407 1 ? 18 
HELX_P HELX_P95  95  VAL D 407 ? GLY D 422 ? VAL D 407 GLY D 422 1 ? 16 
HELX_P HELX_P96  96  PRO D 440 ? GLY D 444 ? PRO D 440 GLY D 444 5 ? 5  
HELX_P HELX_P97  97  GLU D 450 ? PHE D 455 ? GLU D 450 PHE D 455 1 ? 6  
HELX_P HELX_P98  98  GLY D 456 ? ASP D 460 ? GLY D 456 ASP D 460 5 ? 5  
HELX_P HELX_P99  99  ASP D 460 ? ASN D 464 ? ASP D 460 ASN D 464 5 ? 5  
HELX_P HELX_P100 100 THR D 466 ? THR D 486 ? THR D 466 THR D 486 1 ? 21 
HELX_P HELX_P101 101 ARG D 525 ? ARG D 534 ? ARG D 525 ARG D 534 1 ? 10 
HELX_P HELX_P102 102 ARG D 534 ? ALA D 542 ? ARG D 534 ALA D 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A  CYS 69  SG  ? ? ? 1_555 A  CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf2  disulf ? ? A  CYS 257 SG  ? ? ? 1_555 A  CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf3  disulf ? ? A  CYS 409 SG  ? ? ? 1_555 A  CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4  disulf ? ? B  CYS 69  SG  ? ? ? 1_555 B  CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf5  disulf ? ? B  CYS 257 SG  ? ? ? 1_555 B  CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf6  disulf ? ? B  CYS 409 SG  ? ? ? 1_555 B  CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf7  disulf ? ? C  CYS 69  SG  ? ? ? 1_555 C  CYS 96  SG ? ? C CYS 69  C CYS 96  1_555 ? ? ? ? ? ? ? 2.065 ? 
disulf8  disulf ? ? C  CYS 257 SG  ? ? ? 1_555 C  CYS 272 SG ? ? C CYS 257 C CYS 272 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf9  disulf ? ? C  CYS 409 SG  ? ? ? 1_555 C  CYS 529 SG ? ? C CYS 409 C CYS 529 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf10 disulf ? ? D  CYS 69  SG  ? ? ? 1_555 D  CYS 96  SG ? ? D CYS 69  D CYS 96  1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf11 disulf ? ? D  CYS 257 SG  ? ? ? 1_555 D  CYS 272 SG ? ? D CYS 257 D CYS 272 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf12 disulf ? ? D  CYS 409 SG  ? ? ? 1_555 D  CYS 529 SG ? ? D CYS 409 D CYS 529 1_555 ? ? ? ? ? ? ? 2.030 ? 
covale1  covale ? ? A  ASN 265 ND2 ? ? ? 1_555 F  NAG .   C1 ? ? A ASN 265 A NAG 701 1_555 ? ? ? ? ? ? ? 1.450 ? 
covale2  covale ? ? E  TQV .   P   ? ? ? 1_555 A  SER 203 OG ? ? A TQV 600 A SER 203 1_555 ? ? ? ? ? ? ? 1.688 ? 
covale3  covale ? ? B  ASN 265 ND2 ? ? ? 1_555 Q  NAG .   C1 ? ? B ASN 265 B NAG 701 1_555 ? ? ? ? ? ? ? 1.450 ? 
covale4  covale ? ? B  ASN 350 ND2 ? ? ? 1_555 R  NAG .   C1 ? ? B ASN 350 B NAG 702 1_555 ? ? ? ? ? ? ? 1.456 ? 
covale5  covale ? ? P  TQV .   P   ? ? ? 1_555 B  SER 203 OG ? ? B TQV 600 B SER 203 1_555 ? ? ? ? ? ? ? 1.680 ? 
covale6  covale ? ? C  ASN 265 ND2 ? ? ? 1_555 X  NAG .   C1 ? ? C ASN 265 C NAG 701 1_555 ? ? ? ? ? ? ? 1.451 ? 
covale7  covale ? ? W  TQV .   P   ? ? ? 1_555 C  SER 203 OG ? ? C TQV 600 C SER 203 1_555 ? ? ? ? ? ? ? 1.737 ? 
covale8  covale ? ? D  ASN 265 ND2 ? ? ? 1_555 GA NAG .   C1 ? ? D ASN 265 D NAG 701 1_555 ? ? ? ? ? ? ? 1.447 ? 
covale9  covale ? ? D  ASN 350 ND2 ? ? ? 1_555 HA NAG .   C1 ? ? D ASN 350 D NAG 702 1_555 ? ? ? ? ? ? ? 1.454 ? 
covale10 covale ? ? D  ASN 464 ND2 ? ? ? 1_555 IA NAG .   C1 ? ? D ASN 464 D NAG 703 1_555 ? ? ? ? ? ? ? 1.456 ? 
covale11 covale ? ? FA TQV .   P   ? ? ? 1_555 D  SER 203 OG ? ? D TQV 600 D SER 203 1_555 ? ? ? ? ? ? ? 1.684 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -1.36  
2  PRO 258 A . ? PRO 258 A PRO 259 A ? PRO 259 A 1 3.46   
3  SER 497 A . ? SER 497 A PRO 498 A ? PRO 498 A 1 -11.10 
4  TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 5.17   
5  CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 -3.59  
6  SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -3.89  
7  TYR 105 C . ? TYR 105 C PRO 106 C ? PRO 106 C 1 5.78   
8  PRO 258 C . ? PRO 258 C PRO 259 C ? PRO 259 C 1 -5.93  
9  TYR 105 D . ? TYR 105 D PRO 106 D ? PRO 106 D 1 3.62   
10 PRO 258 D . ? PRO 258 D PRO 259 D ? PRO 259 D 1 -7.26  
11 SER 497 D . ? SER 497 D PRO 498 D ? PRO 498 D 1 4.50   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
AD ? 2  ? 
AE ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
CA ? 3  ? 
CB ? 11 ? 
CC ? 2  ? 
CD ? 2  ? 
DA ? 3  ? 
DB ? 11 ? 
DC ? 2  ? 
DD ? 2  ? 
DE ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? anti-parallel 
AD 1  2  ? parallel      
AE 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
CA 1  2  ? anti-parallel 
CA 2  3  ? parallel      
CB 1  2  ? anti-parallel 
CB 2  3  ? anti-parallel 
CB 3  4  ? anti-parallel 
CB 4  5  ? parallel      
CB 5  6  ? parallel      
CB 6  7  ? parallel      
CB 7  8  ? parallel      
CB 8  9  ? parallel      
CB 9  10 ? parallel      
CB 10 11 ? anti-parallel 
CC 1  2  ? parallel      
CD 1  2  ? parallel      
DA 1  2  ? anti-parallel 
DA 2  3  ? parallel      
DB 1  2  ? anti-parallel 
DB 2  3  ? anti-parallel 
DB 3  4  ? anti-parallel 
DB 4  5  ? parallel      
DB 5  6  ? parallel      
DB 6  7  ? parallel      
DB 7  8  ? parallel      
DB 8  9  ? parallel      
DB 9  10 ? parallel      
DB 10 11 ? anti-parallel 
DC 1  2  ? anti-parallel 
DD 1  2  ? parallel      
DE 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? ARG A 11  ? LEU A 9   ARG A 11  
AA 2  GLN A 16  ? ARG A 18  ? GLN A 16  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  ALA A 38  ? GLU A 39  ? ALA A 38  GLU A 39  
AC 2  GLU A 51  ? PRO A 52  ? GLU A 51  PRO A 52  
AD 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AD 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
AE 1  VAL A 239 ? SER A 240 ? VAL A 239 SER A 240 
AE 2  VAL A 302 ? VAL A 303 ? VAL A 302 VAL A 303 
BA 1  LEU B 9   ? ARG B 11  ? LEU B 9   ARG B 11  
BA 2  GLN B 16  ? ARG B 18  ? GLN B 16  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? LYS B 23  ? ILE B 20  LYS B 23  
BB 2  PRO B 28  ? PRO B 36  ? PRO B 28  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
CA 1  LEU C 9   ? ARG C 11  ? LEU C 9   ARG C 11  
CA 2  GLN C 16  ? ARG C 18  ? GLN C 16  ARG C 18  
CA 3  VAL C 59  ? ASP C 61  ? VAL C 59  ASP C 61  
CB 1  ILE C 20  ? ALA C 24  ? ILE C 20  ALA C 24  
CB 2  GLY C 27  ? PRO C 36  ? GLY C 27  PRO C 36  
CB 3  TYR C 98  ? PRO C 104 ? TYR C 98  PRO C 104 
CB 4  VAL C 145 ? MET C 149 ? VAL C 145 MET C 149 
CB 5  THR C 112 ? ILE C 118 ? THR C 112 ILE C 118 
CB 6  GLY C 192 ? GLU C 202 ? GLY C 192 GLU C 202 
CB 7  ARG C 224 ? GLN C 228 ? ARG C 224 GLN C 228 
CB 8  GLN C 325 ? VAL C 331 ? GLN C 325 VAL C 331 
CB 9  ARG C 424 ? PHE C 430 ? ARG C 424 PHE C 430 
CB 10 GLN C 509 ? LEU C 513 ? GLN C 509 LEU C 513 
CB 11 VAL C 520 ? ARG C 522 ? VAL C 520 ARG C 522 
CC 1  VAL C 68  ? CYS C 69  ? VAL C 68  CYS C 69  
CC 2  LEU C 92  ? SER C 93  ? LEU C 92  SER C 93  
CD 1  VAL C 239 ? SER C 240 ? VAL C 239 SER C 240 
CD 2  VAL C 302 ? VAL C 303 ? VAL C 302 VAL C 303 
DA 1  LEU D 9   ? VAL D 12  ? LEU D 9   VAL D 12  
DA 2  GLY D 15  ? ARG D 18  ? GLY D 15  ARG D 18  
DA 3  VAL D 59  ? ASP D 61  ? VAL D 59  ASP D 61  
DB 1  ILE D 20  ? ALA D 24  ? ILE D 20  ALA D 24  
DB 2  GLY D 27  ? PRO D 36  ? GLY D 27  PRO D 36  
DB 3  TYR D 98  ? PRO D 104 ? TYR D 98  PRO D 104 
DB 4  VAL D 145 ? MET D 149 ? VAL D 145 MET D 149 
DB 5  THR D 112 ? ILE D 118 ? THR D 112 ILE D 118 
DB 6  GLY D 192 ? GLU D 202 ? GLY D 192 GLU D 202 
DB 7  ARG D 224 ? GLN D 228 ? ARG D 224 GLN D 228 
DB 8  GLN D 325 ? VAL D 331 ? GLN D 325 VAL D 331 
DB 9  ARG D 424 ? PHE D 430 ? ARG D 424 PHE D 430 
DB 10 GLN D 509 ? LEU D 513 ? GLN D 509 LEU D 513 
DB 11 GLU D 519 ? ARG D 522 ? GLU D 519 ARG D 522 
DC 1  ALA D 38  ? GLU D 39  ? ALA D 38  GLU D 39  
DC 2  GLU D 51  ? PRO D 52  ? GLU D 51  PRO D 52  
DD 1  VAL D 68  ? CYS D 69  ? VAL D 68  CYS D 69  
DD 2  LEU D 92  ? SER D 93  ? LEU D 92  SER D 93  
DE 1  VAL D 239 ? SER D 240 ? VAL D 239 SER D 240 
DE 2  VAL D 302 ? VAL D 303 ? VAL D 302 VAL D 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  N GLU A 39  ? N GLU A 39  O GLU A 51  ? O GLU A 51  
AD 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
AE 1  2  O VAL A 239 ? O VAL A 239 N VAL A 303 ? N VAL A 303 
BA 1  2  N VAL B 10  ? N VAL B 10  O LEU B 17  ? O LEU B 17  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N LEU B 22  ? N LEU B 22  O VAL B 29  ? O VAL B 29  
BB 2  3  N GLY B 34  ? N GLY B 34  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
CA 1  2  N VAL C 10  ? N VAL C 10  O LEU C 17  ? O LEU C 17  
CA 2  3  N ARG C 18  ? N ARG C 18  O LEU C 60  ? O LEU C 60  
CB 1  2  N ALA C 24  ? N ALA C 24  O GLY C 27  ? O GLY C 27  
CB 2  3  N ILE C 35  ? N ILE C 35  O LEU C 99  ? O LEU C 99  
CB 3  4  N TRP C 102 ? N TRP C 102 O LEU C 146 ? O LEU C 146 
CB 4  5  N VAL C 145 ? N VAL C 145 O PRO C 113 ? O PRO C 113 
CB 5  6  O THR C 112 ? O THR C 112 N ASP C 193 ? N ASP C 193 
CB 6  7  N LEU C 199 ? N LEU C 199 O ARG C 224 ? O ARG C 224 
CB 7  8  N ALA C 225 ? N ALA C 225 O GLN C 325 ? O GLN C 325 
CB 8  9  N VAL C 326 ? N VAL C 326 O ARG C 424 ? O ARG C 424 
CB 9  10 N ILE C 429 ? N ILE C 429 O VAL C 511 ? O VAL C 511 
CB 10 11 N TYR C 510 ? N TYR C 510 O ARG C 521 ? O ARG C 521 
CC 1  2  O VAL C 68  ? O VAL C 68  N SER C 93  ? N SER C 93  
CD 1  2  O VAL C 239 ? O VAL C 239 N VAL C 303 ? N VAL C 303 
DA 1  2  N VAL D 12  ? N VAL D 12  O GLY D 15  ? O GLY D 15  
DA 2  3  N ARG D 18  ? N ARG D 18  O LEU D 60  ? O LEU D 60  
DB 1  2  N ALA D 24  ? N ALA D 24  O GLY D 27  ? O GLY D 27  
DB 2  3  N ILE D 35  ? N ILE D 35  O LEU D 99  ? O LEU D 99  
DB 3  4  N TRP D 102 ? N TRP D 102 O LEU D 146 ? O LEU D 146 
DB 4  5  N VAL D 145 ? N VAL D 145 O PRO D 113 ? O PRO D 113 
DB 5  6  O THR D 112 ? O THR D 112 N ASP D 193 ? N ASP D 193 
DB 6  7  N LEU D 199 ? N LEU D 199 O ARG D 224 ? O ARG D 224 
DB 7  8  N ALA D 225 ? N ALA D 225 O GLN D 325 ? O GLN D 325 
DB 8  9  N VAL D 326 ? N VAL D 326 O ARG D 424 ? O ARG D 424 
DB 9  10 N ALA D 427 ? N ALA D 427 O GLN D 509 ? O GLN D 509 
DB 10 11 N SER D 512 ? N SER D 512 O GLU D 519 ? O GLU D 519 
DC 1  2  N GLU D 39  ? N GLU D 39  O GLU D 51  ? O GLU D 51  
DD 1  2  O VAL D 68  ? O VAL D 68  N SER D 93  ? N SER D 93  
DE 1  2  O VAL D 239 ? O VAL D 239 N VAL D 303 ? N VAL D 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TQV A 600'                            
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 1544'                            
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 1545'                           
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 1546'                           
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 1547'                           
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1548'                           
AC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE SO4 A 1549'                           
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 1550'                           
AC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1990'                            
BC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1991'                            
BC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TQV B 600'                            
BC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL B 1544'                            
BC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 1545'                           
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 1546'                           
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 1547'                           
BC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE TQV C 600'                            
BC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL C 1544'                            
BC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL C 1545'                            
CC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL C 1546'                            
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 C 1547'                           
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 C 1548'                           
CC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 C 1549'                           
CC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL C 1990'                            
CC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TQV D 600'                            
CC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 1545'                           
CC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 D 1546'                           
CC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 D 1547'                           
DC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL D 1990'                            
DC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL D 1991'                            
DC3 Software ? ? ? ? 3  'BINDING SITE FOR MONO-SACCHARIDE NAG A 701 BOUND TO ASN A 265' 
DC4 Software ? ? ? ? 3  'BINDING SITE FOR MONO-SACCHARIDE NAG B 701 BOUND TO ASN B 265' 
DC5 Software ? ? ? ? 2  'BINDING SITE FOR MONO-SACCHARIDE NAG B 702 BOUND TO ASN B 350' 
DC6 Software ? ? ? ? 2  'BINDING SITE FOR MONO-SACCHARIDE NAG C 701 BOUND TO ASN C 265' 
DC7 Software ? ? ? ? 2  'BINDING SITE FOR MONO-SACCHARIDE NAG D 701 BOUND TO ASN D 265' 
DC8 Software ? ? ? ? 2  'BINDING SITE FOR MONO-SACCHARIDE NAG D 702 BOUND TO ASN D 350' 
DC9 Software ? ? ? ? 2  'BINDING SITE FOR MONO-SACCHARIDE NAG D 703 BOUND TO ASN D 464' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 12 TRP A  86  ? TRP A 86   . ? 1_555 ? 
2   AC1 12 GLY A  121 ? GLY A 121  . ? 1_555 ? 
3   AC1 12 GLY A  122 ? GLY A 122  . ? 1_555 ? 
4   AC1 12 TYR A  124 ? TYR A 124  . ? 1_555 ? 
5   AC1 12 GLU A  202 ? GLU A 202  . ? 1_555 ? 
6   AC1 12 SER A  203 ? SER A 203  . ? 1_555 ? 
7   AC1 12 ALA A  204 ? ALA A 204  . ? 1_555 ? 
8   AC1 12 PHE A  295 ? PHE A 295  . ? 1_555 ? 
9   AC1 12 ARG A  296 ? ARG A 296  . ? 1_555 ? 
10  AC1 12 PHE A  297 ? PHE A 297  . ? 1_555 ? 
11  AC1 12 TYR A  337 ? TYR A 337  . ? 1_555 ? 
12  AC1 12 HIS A  447 ? HIS A 447  . ? 1_555 ? 
13  AC2 2  ARG A  165 ? ARG A 165  . ? 1_555 ? 
14  AC2 2  HOH PA .   ? HOH A 2034 . ? 1_555 ? 
15  AC3 5  ARG A  525 ? ARG A 525  . ? 1_555 ? 
16  AC3 5  ALA A  526 ? ALA A 526  . ? 1_555 ? 
17  AC3 5  GLN A  527 ? GLN A 527  . ? 1_555 ? 
18  AC3 5  THR A  528 ? THR A 528  . ? 1_555 ? 
19  AC3 5  HOH PA .   ? HOH A 2238 . ? 1_555 ? 
20  AC4 2  GLN A  413 ? GLN A 413  . ? 1_555 ? 
21  AC4 2  ARG A  417 ? ARG A 417  . ? 1_555 ? 
22  AC5 6  HIS A  381 ? HIS A 381  . ? 1_555 ? 
23  AC5 6  HOH PA .   ? HOH A 2244 . ? 1_555 ? 
24  AC5 6  HOH PA .   ? HOH A 2245 . ? 1_555 ? 
25  AC5 6  LEU B  380 ? LEU B 380  . ? 1_555 ? 
26  AC5 6  HIS B  381 ? HIS B 381  . ? 1_555 ? 
27  AC5 6  PHE B  531 ? PHE B 531  . ? 1_555 ? 
28  AC6 3  HIS A  432 ? HIS A 432  . ? 1_555 ? 
29  AC6 3  LEU A  515 ? LEU A 515  . ? 1_555 ? 
30  AC6 3  LYS A  516 ? LYS A 516  . ? 1_555 ? 
31  AC7 1  ARG A  136 ? ARG A 136  . ? 1_555 ? 
32  AC8 4  ARG A  46  ? ARG A 46   . ? 1_555 ? 
33  AC8 4  PRO A  277 ? PRO A 277  . ? 1_555 ? 
34  AC8 4  ALA A  278 ? ALA A 278  . ? 1_555 ? 
35  AC8 4  HOH PA .   ? HOH A 2247 . ? 1_555 ? 
36  AC9 1  HOH PA .   ? HOH A 2172 . ? 1_555 ? 
37  BC1 1  ARG A  356 ? ARG A 356  . ? 1_555 ? 
38  BC2 12 TRP B  86  ? TRP B 86   . ? 1_555 ? 
39  BC2 12 GLY B  121 ? GLY B 121  . ? 1_555 ? 
40  BC2 12 GLY B  122 ? GLY B 122  . ? 1_555 ? 
41  BC2 12 TYR B  124 ? TYR B 124  . ? 1_555 ? 
42  BC2 12 SER B  203 ? SER B 203  . ? 1_555 ? 
43  BC2 12 ALA B  204 ? ALA B 204  . ? 1_555 ? 
44  BC2 12 PHE B  295 ? PHE B 295  . ? 1_555 ? 
45  BC2 12 ARG B  296 ? ARG B 296  . ? 1_555 ? 
46  BC2 12 PHE B  297 ? PHE B 297  . ? 1_555 ? 
47  BC2 12 TYR B  337 ? TYR B 337  . ? 1_555 ? 
48  BC2 12 HIS B  447 ? HIS B 447  . ? 1_555 ? 
49  BC2 12 HOH QA .   ? HOH B 2042 . ? 1_555 ? 
50  BC3 1  ARG B  356 ? ARG B 356  . ? 1_555 ? 
51  BC4 4  ARG B  525 ? ARG B 525  . ? 1_555 ? 
52  BC4 4  ALA B  526 ? ALA B 526  . ? 1_555 ? 
53  BC4 4  GLN B  527 ? GLN B 527  . ? 1_555 ? 
54  BC4 4  THR B  528 ? THR B 528  . ? 1_555 ? 
55  BC5 4  HIS B  387 ? HIS B 387  . ? 1_555 ? 
56  BC5 4  PRO B  388 ? PRO B 388  . ? 1_555 ? 
57  BC5 4  GLU B  389 ? GLU B 389  . ? 1_555 ? 
58  BC5 4  ASP B  390 ? ASP B 390  . ? 1_555 ? 
59  BC6 4  GLN B  413 ? GLN B 413  . ? 1_555 ? 
60  BC6 4  ARG B  417 ? ARG B 417  . ? 1_555 ? 
61  BC6 4  ASN B  533 ? ASN B 533  . ? 1_555 ? 
62  BC6 4  HOH QA .   ? HOH B 2140 . ? 1_555 ? 
63  BC7 13 TRP C  86  ? TRP C 86   . ? 1_555 ? 
64  BC7 13 GLY C  121 ? GLY C 121  . ? 1_555 ? 
65  BC7 13 GLY C  122 ? GLY C 122  . ? 1_555 ? 
66  BC7 13 TYR C  124 ? TYR C 124  . ? 1_555 ? 
67  BC7 13 GLU C  202 ? GLU C 202  . ? 1_555 ? 
68  BC7 13 SER C  203 ? SER C 203  . ? 1_555 ? 
69  BC7 13 PHE C  295 ? PHE C 295  . ? 1_555 ? 
70  BC7 13 PHE C  297 ? PHE C 297  . ? 1_555 ? 
71  BC7 13 TYR C  337 ? TYR C 337  . ? 1_555 ? 
72  BC7 13 PHE C  338 ? PHE C 338  . ? 1_555 ? 
73  BC7 13 HIS C  447 ? HIS C 447  . ? 1_555 ? 
74  BC7 13 HOH RA .   ? HOH C 2103 . ? 1_555 ? 
75  BC7 13 HOH RA .   ? HOH C 2233 . ? 1_555 ? 
76  BC8 1  ARG C  90  ? ARG C 90   . ? 1_555 ? 
77  BC9 1  ALA C  278 ? ALA C 278  . ? 1_555 ? 
78  CC1 1  ARG C  522 ? ARG C 522  . ? 1_555 ? 
79  CC2 4  ARG C  525 ? ARG C 525  . ? 1_555 ? 
80  CC2 4  ALA C  526 ? ALA C 526  . ? 1_555 ? 
81  CC2 4  GLN C  527 ? GLN C 527  . ? 1_555 ? 
82  CC2 4  THR C  528 ? THR C 528  . ? 1_555 ? 
83  CC3 6  LEU C  380 ? LEU C 380  . ? 1_555 ? 
84  CC3 6  HIS C  381 ? HIS C 381  . ? 1_555 ? 
85  CC3 6  HOH RA .   ? HOH C 2257 . ? 1_555 ? 
86  CC3 6  HOH RA .   ? HOH C 2258 . ? 1_555 ? 
87  CC3 6  HIS D  381 ? HIS D 381  . ? 1_555 ? 
88  CC3 6  PHE D  531 ? PHE D 531  . ? 1_555 ? 
89  CC4 2  GLY C  43  ? GLY C 43   . ? 1_555 ? 
90  CC4 2  SER C  44  ? SER C 44   . ? 1_555 ? 
91  CC5 1  ARG C  18  ? ARG C 18   . ? 1_555 ? 
92  CC6 12 TRP D  86  ? TRP D 86   . ? 1_555 ? 
93  CC6 12 GLY D  121 ? GLY D 121  . ? 1_555 ? 
94  CC6 12 GLY D  122 ? GLY D 122  . ? 1_555 ? 
95  CC6 12 TYR D  124 ? TYR D 124  . ? 1_555 ? 
96  CC6 12 SER D  203 ? SER D 203  . ? 1_555 ? 
97  CC6 12 ALA D  204 ? ALA D 204  . ? 1_555 ? 
98  CC6 12 PHE D  295 ? PHE D 295  . ? 1_555 ? 
99  CC6 12 ARG D  296 ? ARG D 296  . ? 1_555 ? 
100 CC6 12 PHE D  297 ? PHE D 297  . ? 1_555 ? 
101 CC6 12 TYR D  337 ? TYR D 337  . ? 1_555 ? 
102 CC6 12 HIS D  447 ? HIS D 447  . ? 1_555 ? 
103 CC6 12 HOH SA .   ? HOH D 2074 . ? 1_555 ? 
104 CC7 4  ARG D  525 ? ARG D 525  . ? 1_555 ? 
105 CC7 4  ALA D  526 ? ALA D 526  . ? 1_555 ? 
106 CC7 4  GLN D  527 ? GLN D 527  . ? 1_555 ? 
107 CC7 4  THR D  528 ? THR D 528  . ? 1_555 ? 
108 CC8 5  ARG C  13  ? ARG C 13   . ? 2_555 ? 
109 CC8 5  PRO C  55  ? PRO C 55   . ? 2_555 ? 
110 CC8 5  VAL D  59  ? VAL D 59   . ? 1_555 ? 
111 CC8 5  LEU D  60  ? LEU D 60   . ? 1_555 ? 
112 CC8 5  ASP D  61  ? ASP D 61   . ? 1_555 ? 
113 CC9 3  HIS D  432 ? HIS D 432  . ? 1_555 ? 
114 CC9 3  ASN D  514 ? ASN D 514  . ? 1_555 ? 
115 CC9 3  LEU D  515 ? LEU D 515  . ? 1_555 ? 
116 DC1 1  HOH SA .   ? HOH D 2077 . ? 1_555 ? 
117 DC2 2  ARG A  253 ? ARG A 253  . ? 1_555 ? 
118 DC2 2  HIS D  287 ? HIS D 287  . ? 1_555 ? 
119 DC3 3  ASN A  265 ? ASN A 265  . ? 1_555 ? 
120 DC3 3  THR A  267 ? THR A 267  . ? 1_555 ? 
121 DC3 3  GLU A  268 ? GLU A 268  . ? 1_555 ? 
122 DC4 3  ASN B  265 ? ASN B 265  . ? 1_555 ? 
123 DC4 3  THR B  267 ? THR B 267  . ? 1_555 ? 
124 DC4 3  GLU B  268 ? GLU B 268  . ? 1_555 ? 
125 DC5 2  SER B  347 ? SER B 347  . ? 1_555 ? 
126 DC5 2  ASN B  350 ? ASN B 350  . ? 1_555 ? 
127 DC6 2  ASN C  265 ? ASN C 265  . ? 1_555 ? 
128 DC6 2  GLU C  268 ? GLU C 268  . ? 1_555 ? 
129 DC7 2  ASN D  265 ? ASN D 265  . ? 1_555 ? 
130 DC7 2  GLU D  268 ? GLU D 268  . ? 1_555 ? 
131 DC8 2  SER D  347 ? SER D 347  . ? 1_555 ? 
132 DC8 2  ASN D  350 ? ASN D 350  . ? 1_555 ? 
133 DC9 2  SER D  462 ? SER D 462  . ? 1_555 ? 
134 DC9 2  ASN D  464 ? ASN D 464  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BC1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BC1 
_atom_sites.fract_transf_matrix[1][1]   0.007378 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005772 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004446 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLU A  1 4   ? 0.976   -64.158 101.695 1.00 31.89  ? 4    GLU A N   1 
ATOM   2     C  CA  . GLU A  1 4   ? 1.126   -63.302 100.519 1.00 47.22  ? 4    GLU A CA  1 
ATOM   3     C  C   . GLU A  1 4   ? -0.201  -62.646 100.131 1.00 53.50  ? 4    GLU A C   1 
ATOM   4     O  O   . GLU A  1 4   ? -1.231  -63.322 100.081 1.00 54.76  ? 4    GLU A O   1 
ATOM   5     C  CB  . GLU A  1 4   ? 1.671   -64.100 99.337  1.00 48.35  ? 4    GLU A CB  1 
ATOM   6     C  CG  . GLU A  1 4   ? 2.202   -63.229 98.184  1.00 57.23  ? 4    GLU A CG  1 
ATOM   7     C  CD  . GLU A  1 4   ? 3.396   -62.336 98.580  1.00 64.16  ? 4    GLU A CD  1 
ATOM   8     O  OE1 . GLU A  1 4   ? 4.563   -62.798 98.492  1.00 58.29  ? 4    GLU A OE1 1 
ATOM   9     O  OE2 . GLU A  1 4   ? 3.168   -61.163 98.963  1.00 68.11  ? 4    GLU A OE2 1 
ATOM   10    N  N   . ASP A  1 5   ? -0.191  -61.336 99.869  1.00 28.45  ? 5    ASP A N   1 
ATOM   11    C  CA  . ASP A  1 5   ? -1.436  -60.644 99.577  1.00 33.27  ? 5    ASP A CA  1 
ATOM   12    C  C   . ASP A  1 5   ? -1.597  -60.525 98.073  1.00 38.41  ? 5    ASP A C   1 
ATOM   13    O  O   . ASP A  1 5   ? -0.826  -59.820 97.425  1.00 30.02  ? 5    ASP A O   1 
ATOM   14    C  CB  . ASP A  1 5   ? -1.499  -59.266 100.236 1.00 31.91  ? 5    ASP A CB  1 
ATOM   15    C  CG  . ASP A  1 5   ? -2.937  -58.692 100.286 1.00 36.95  ? 5    ASP A CG  1 
ATOM   16    O  OD1 . ASP A  1 5   ? -3.868  -59.280 99.684  1.00 31.40  ? 5    ASP A OD1 1 
ATOM   17    O  OD2 . ASP A  1 5   ? -3.135  -57.633 100.928 1.00 35.63  ? 5    ASP A OD2 1 
ATOM   18    N  N   . PRO A  1 6   ? -2.616  -61.215 97.516  1.00 46.41  ? 6    PRO A N   1 
ATOM   19    C  CA  . PRO A  1 6   ? -2.790  -61.297 96.062  1.00 36.80  ? 6    PRO A CA  1 
ATOM   20    C  C   . PRO A  1 6   ? -2.866  -59.922 95.448  1.00 37.02  ? 6    PRO A C   1 
ATOM   21    O  O   . PRO A  1 6   ? -2.473  -59.757 94.301  1.00 44.50  ? 6    PRO A O   1 
ATOM   22    C  CB  . PRO A  1 6   ? -4.132  -62.005 95.905  1.00 31.28  ? 6    PRO A CB  1 
ATOM   23    C  CG  . PRO A  1 6   ? -4.296  -62.769 97.169  1.00 36.73  ? 6    PRO A CG  1 
ATOM   24    C  CD  . PRO A  1 6   ? -3.677  -61.941 98.238  1.00 28.96  ? 6    PRO A CD  1 
ATOM   25    N  N   . GLN A  1 7   ? -3.337  -58.943 96.211  1.00 34.87  ? 7    GLN A N   1 
ATOM   26    C  CA  . GLN A  1 7   ? -3.497  -57.598 95.683  1.00 36.83  ? 7    GLN A CA  1 
ATOM   27    C  C   . GLN A  1 7   ? -2.198  -56.822 95.696  1.00 23.57  ? 7    GLN A C   1 
ATOM   28    O  O   . GLN A  1 7   ? -2.076  -55.827 95.015  1.00 55.20  ? 7    GLN A O   1 
ATOM   29    C  CB  . GLN A  1 7   ? -4.570  -56.835 96.461  1.00 34.10  ? 7    GLN A CB  1 
ATOM   30    C  CG  . GLN A  1 7   ? -5.914  -57.523 96.489  1.00 25.74  ? 7    GLN A CG  1 
ATOM   31    C  CD  . GLN A  1 7   ? -6.399  -57.906 95.107  1.00 37.81  ? 7    GLN A CD  1 
ATOM   32    O  OE1 . GLN A  1 7   ? -6.368  -57.102 94.175  1.00 34.76  ? 7    GLN A OE1 1 
ATOM   33    N  NE2 . GLN A  1 7   ? -6.849  -59.144 94.966  1.00 39.16  ? 7    GLN A NE2 1 
ATOM   34    N  N   . LEU A  1 8   ? -1.232  -57.279 96.475  1.00 39.32  ? 8    LEU A N   1 
ATOM   35    C  CA  . LEU A  1 8   ? 0.014   -56.548 96.634  1.00 23.23  ? 8    LEU A CA  1 
ATOM   36    C  C   . LEU A  1 8   ? 1.182   -57.192 95.900  1.00 78.98  ? 8    LEU A C   1 
ATOM   37    O  O   . LEU A  1 8   ? 2.289   -56.643 95.875  1.00 22.75  ? 8    LEU A O   1 
ATOM   38    C  CB  . LEU A  1 8   ? 0.357   -56.426 98.102  1.00 23.97  ? 8    LEU A CB  1 
ATOM   39    C  CG  . LEU A  1 8   ? -0.653  -55.577 98.840  1.00 23.69  ? 8    LEU A CG  1 
ATOM   40    C  CD1 . LEU A  1 8   ? -0.385  -55.605 100.316 1.00 48.46  ? 8    LEU A CD1 1 
ATOM   41    C  CD2 . LEU A  1 8   ? -0.549  -54.183 98.310  1.00 25.09  ? 8    LEU A CD2 1 
ATOM   42    N  N   . LEU A  1 9   ? 0.939   -58.358 95.313  1.00 23.95  ? 9    LEU A N   1 
ATOM   43    C  CA  . LEU A  1 9   ? 1.922   -58.986 94.457  1.00 24.09  ? 9    LEU A CA  1 
ATOM   44    C  C   . LEU A  1 9   ? 1.574   -58.675 93.016  1.00 36.02  ? 9    LEU A C   1 
ATOM   45    O  O   . LEU A  1 9   ? 0.484   -58.990 92.554  1.00 38.49  ? 9    LEU A O   1 
ATOM   46    C  CB  . LEU A  1 9   ? 1.930   -60.502 94.668  1.00 25.40  ? 9    LEU A CB  1 
ATOM   47    C  CG  . LEU A  1 9   ? 3.275   -61.241 94.689  1.00 26.02  ? 9    LEU A CG  1 
ATOM   48    C  CD1 . LEU A  1 9   ? 3.119   -62.652 94.191  1.00 27.15  ? 9    LEU A CD1 1 
ATOM   49    C  CD2 . LEU A  1 9   ? 4.306   -60.523 93.871  1.00 25.22  ? 9    LEU A CD2 1 
ATOM   50    N  N   . VAL A  1 10  ? 2.493   -58.042 92.298  1.00 39.10  ? 10   VAL A N   1 
ATOM   51    C  CA  . VAL A  1 10  ? 2.331   -57.930 90.851  1.00 40.01  ? 10   VAL A CA  1 
ATOM   52    C  C   . VAL A  1 10  ? 3.516   -58.515 90.100  1.00 35.89  ? 10   VAL A C   1 
ATOM   53    O  O   . VAL A  1 10  ? 4.622   -58.571 90.597  1.00 29.05  ? 10   VAL A O   1 
ATOM   54    C  CB  . VAL A  1 10  ? 2.115   -56.496 90.380  1.00 40.84  ? 10   VAL A CB  1 
ATOM   55    C  CG1 . VAL A  1 10  ? 1.154   -56.498 89.203  1.00 41.58  ? 10   VAL A CG1 1 
ATOM   56    C  CG2 . VAL A  1 10  ? 1.553   -55.664 91.495  1.00 46.18  ? 10   VAL A CG2 1 
ATOM   57    N  N   . ARG A  1 11  ? 3.259   -58.979 88.894  1.00 38.21  ? 11   ARG A N   1 
ATOM   58    C  CA  . ARG A  1 11  ? 4.315   -59.453 88.039  1.00 29.74  ? 11   ARG A CA  1 
ATOM   59    C  C   . ARG A  1 11  ? 4.236   -58.626 86.778  1.00 27.33  ? 11   ARG A C   1 
ATOM   60    O  O   . ARG A  1 11  ? 3.305   -58.767 85.974  1.00 30.29  ? 11   ARG A O   1 
ATOM   61    C  CB  . ARG A  1 11  ? 4.138   -60.928 87.717  1.00 33.73  ? 11   ARG A CB  1 
ATOM   62    C  CG  . ARG A  1 11  ? 5.040   -61.409 86.629  1.00 25.47  ? 11   ARG A CG  1 
ATOM   63    C  CD  . ARG A  1 11  ? 4.774   -62.851 86.237  1.00 73.93  ? 11   ARG A CD  1 
ATOM   64    N  NE  . ARG A  1 11  ? 3.937   -62.953 85.054  1.00 27.08  ? 11   ARG A NE  1 
ATOM   65    C  CZ  . ARG A  1 11  ? 4.279   -62.478 83.868  1.00 26.88  ? 11   ARG A CZ  1 
ATOM   66    N  NH1 . ARG A  1 11  ? 5.448   -61.871 83.696  1.00 30.65  ? 11   ARG A NH1 1 
ATOM   67    N  NH2 . ARG A  1 11  ? 3.455   -62.603 82.850  1.00 27.73  ? 11   ARG A NH2 1 
ATOM   68    N  N   . VAL A  1 12  ? 5.206   -57.729 86.654  1.00 22.78  ? 12   VAL A N   1 
ATOM   69    C  CA  . VAL A  1 12  ? 5.416   -56.937 85.463  1.00 27.59  ? 12   VAL A CA  1 
ATOM   70    C  C   . VAL A  1 12  ? 6.448   -57.649 84.577  1.00 31.83  ? 12   VAL A C   1 
ATOM   71    O  O   . VAL A  1 12  ? 6.895   -58.755 84.901  1.00 29.91  ? 12   VAL A O   1 
ATOM   72    C  CB  . VAL A  1 12  ? 5.875   -55.529 85.849  1.00 27.04  ? 12   VAL A CB  1 
ATOM   73    C  CG1 . VAL A  1 12  ? 4.894   -54.942 86.842  1.00 20.12  ? 12   VAL A CG1 1 
ATOM   74    C  CG2 . VAL A  1 12  ? 7.232   -55.583 86.462  1.00 20.87  ? 12   VAL A CG2 1 
ATOM   75    N  N   . ARG A  1 13  ? 6.811   -57.035 83.457  1.00 29.91  ? 13   ARG A N   1 
ATOM   76    C  CA  . ARG A  1 13  ? 7.664   -57.710 82.492  1.00 32.48  ? 13   ARG A CA  1 
ATOM   77    C  C   . ARG A  1 13  ? 9.036   -58.030 83.070  1.00 40.26  ? 13   ARG A C   1 
ATOM   78    O  O   . ARG A  1 13  ? 9.611   -59.081 82.786  1.00 46.61  ? 13   ARG A O   1 
ATOM   79    C  CB  . ARG A  1 13  ? 7.785   -56.893 81.211  1.00 36.66  ? 13   ARG A CB  1 
ATOM   80    C  CG  . ARG A  1 13  ? 6.514   -56.879 80.409  1.00 44.11  ? 13   ARG A CG  1 
ATOM   81    C  CD  . ARG A  1 13  ? 6.647   -56.043 79.152  1.00 52.85  ? 13   ARG A CD  1 
ATOM   82    N  NE  . ARG A  1 13  ? 5.354   -55.891 78.485  1.00 54.27  ? 13   ARG A NE  1 
ATOM   83    C  CZ  . ARG A  1 13  ? 5.143   -56.129 77.195  1.00 53.21  ? 13   ARG A CZ  1 
ATOM   84    N  NH1 . ARG A  1 13  ? 6.141   -56.530 76.419  1.00 52.55  ? 13   ARG A NH1 1 
ATOM   85    N  NH2 . ARG A  1 13  ? 3.933   -55.965 76.682  1.00 52.91  ? 13   ARG A NH2 1 
ATOM   86    N  N   . GLY A  1 14  ? 9.548   -57.129 83.900  1.00 40.64  ? 14   GLY A N   1 
ATOM   87    C  CA  . GLY A  1 14  ? 10.846  -57.324 84.512  1.00 36.08  ? 14   GLY A CA  1 
ATOM   88    C  C   . GLY A  1 14  ? 10.855  -58.434 85.536  1.00 31.43  ? 14   GLY A C   1 
ATOM   89    O  O   . GLY A  1 14  ? 11.860  -59.105 85.736  1.00 40.90  ? 14   GLY A O   1 
ATOM   90    N  N   . GLY A  1 15  ? 9.725   -58.625 86.192  1.00 28.13  ? 15   GLY A N   1 
ATOM   91    C  CA  . GLY A  1 15  ? 9.605   -59.660 87.196  1.00 29.36  ? 15   GLY A CA  1 
ATOM   92    C  C   . GLY A  1 15  ? 8.512   -59.330 88.194  1.00 32.02  ? 15   GLY A C   1 
ATOM   93    O  O   . GLY A  1 15  ? 7.606   -58.544 87.907  1.00 30.22  ? 15   GLY A O   1 
ATOM   94    N  N   . GLN A  1 16  ? 8.614   -59.923 89.377  1.00 33.01  ? 16   GLN A N   1 
ATOM   95    C  CA  . GLN A  1 16  ? 7.636   -59.720 90.420  1.00 24.38  ? 16   GLN A CA  1 
ATOM   96    C  C   . GLN A  1 16  ? 8.051   -58.628 91.404  1.00 29.74  ? 16   GLN A C   1 
ATOM   97    O  O   . GLN A  1 16  ? 9.237   -58.410 91.646  1.00 31.15  ? 16   GLN A O   1 
ATOM   98    C  CB  . GLN A  1 16  ? 7.359   -61.047 91.117  1.00 25.59  ? 16   GLN A CB  1 
ATOM   99    C  CG  . GLN A  1 16  ? 6.853   -62.143 90.142  1.00 27.70  ? 16   GLN A CG  1 
ATOM   100   C  CD  . GLN A  1 16  ? 6.082   -63.267 90.832  1.00 27.41  ? 16   GLN A CD  1 
ATOM   101   O  OE1 . GLN A  1 16  ? 5.269   -63.025 91.726  1.00 30.63  ? 16   GLN A OE1 1 
ATOM   102   N  NE2 . GLN A  1 16  ? 6.347   -64.501 90.425  1.00 28.65  ? 16   GLN A NE2 1 
ATOM   103   N  N   . LEU A  1 17  ? 7.052   -57.924 91.930  1.00 22.96  ? 17   LEU A N   1 
ATOM   104   C  CA  . LEU A  1 17  ? 7.231   -56.864 92.906  1.00 22.36  ? 17   LEU A CA  1 
ATOM   105   C  C   . LEU A  1 17  ? 6.105   -56.881 93.950  1.00 30.14  ? 17   LEU A C   1 
ATOM   106   O  O   . LEU A  1 17  ? 4.975   -57.300 93.662  1.00 23.69  ? 17   LEU A O   1 
ATOM   107   C  CB  . LEU A  1 17  ? 7.313   -55.510 92.209  1.00 21.21  ? 17   LEU A CB  1 
ATOM   108   C  CG  . LEU A  1 17  ? 6.112   -54.983 91.435  1.00 20.50  ? 17   LEU A CG  1 
ATOM   109   C  CD1 . LEU A  1 17  ? 5.156   -54.260 92.338  1.00 26.70  ? 17   LEU A CD1 1 
ATOM   110   C  CD2 . LEU A  1 17  ? 6.593   -54.032 90.377  1.00 20.13  ? 17   LEU A CD2 1 
ATOM   111   N  N   . ARG A  1 18  ? 6.420   -56.418 95.159  1.00 29.90  ? 18   ARG A N   1 
ATOM   112   C  CA  . ARG A  1 18  ? 5.489   -56.462 96.281  1.00 25.35  ? 18   ARG A CA  1 
ATOM   113   C  C   . ARG A  1 18  ? 5.148   -55.066 96.766  1.00 24.69  ? 18   ARG A C   1 
ATOM   114   O  O   . ARG A  1 18  ? 6.033   -54.275 97.074  1.00 25.36  ? 18   ARG A O   1 
ATOM   115   C  CB  . ARG A  1 18  ? 6.109   -57.254 97.427  1.00 29.89  ? 18   ARG A CB  1 
ATOM   116   C  CG  . ARG A  1 18  ? 5.225   -57.428 98.652  1.00 36.23  ? 18   ARG A CG  1 
ATOM   117   C  CD  . ARG A  1 18  ? 5.417   -58.823 99.263  1.00 42.15  ? 18   ARG A CD  1 
ATOM   118   N  NE  . ARG A  1 18  ? 6.816   -59.227 99.205  1.00 54.93  ? 18   ARG A NE  1 
ATOM   119   C  CZ  . ARG A  1 18  ? 7.237   -60.439 98.860  1.00 67.11  ? 18   ARG A CZ  1 
ATOM   120   N  NH1 . ARG A  1 18  ? 6.357   -61.388 98.551  1.00 67.44  ? 18   ARG A NH1 1 
ATOM   121   N  NH2 . ARG A  1 18  ? 8.542   -60.699 98.828  1.00 71.15  ? 18   ARG A NH2 1 
ATOM   122   N  N   . GLY A  1 19  ? 3.859   -54.760 96.834  1.00 27.11  ? 19   GLY A N   1 
ATOM   123   C  CA  . GLY A  1 19  ? 3.422   -53.449 97.281  1.00 28.33  ? 19   GLY A CA  1 
ATOM   124   C  C   . GLY A  1 19  ? 3.052   -53.368 98.756  1.00 33.30  ? 19   GLY A C   1 
ATOM   125   O  O   . GLY A  1 19  ? 3.374   -54.246 99.554  1.00 41.44  ? 19   GLY A O   1 
ATOM   126   N  N   . ILE A  1 20  ? 2.339   -52.310 99.114  1.00 26.53  ? 20   ILE A N   1 
ATOM   127   C  CA  . ILE A  1 20  ? 2.030   -52.025 100.498 1.00 26.04  ? 20   ILE A CA  1 
ATOM   128   C  C   . ILE A  1 20  ? 0.607   -51.485 100.606 1.00 28.78  ? 20   ILE A C   1 
ATOM   129   O  O   . ILE A  1 20  ? 0.158   -50.691 99.768  1.00 27.67  ? 20   ILE A O   1 
ATOM   130   C  CB  . ILE A  1 20  ? 3.052   -51.017 101.075 1.00 27.67  ? 20   ILE A CB  1 
ATOM   131   C  CG1 . ILE A  1 20  ? 2.833   -50.799 102.567 1.00 30.56  ? 20   ILE A CG1 1 
ATOM   132   C  CG2 . ILE A  1 20  ? 2.989   -49.694 100.354 1.00 20.72  ? 20   ILE A CG2 1 
ATOM   133   C  CD1 . ILE A  1 20  ? 3.881   -49.904 103.184 1.00 32.70  ? 20   ILE A CD1 1 
ATOM   134   N  N   . ARG A  1 21  ? -0.118  -51.941 101.621 1.00 27.33  ? 21   ARG A N   1 
ATOM   135   C  CA  . ARG A  1 21  ? -1.478  -51.467 101.810 1.00 29.99  ? 21   ARG A CA  1 
ATOM   136   C  C   . ARG A  1 21  ? -1.488  -50.234 102.705 1.00 34.92  ? 21   ARG A C   1 
ATOM   137   O  O   . ARG A  1 21  ? -1.103  -50.297 103.877 1.00 39.70  ? 21   ARG A O   1 
ATOM   138   C  CB  . ARG A  1 21  ? -2.392  -52.553 102.373 1.00 24.45  ? 21   ARG A CB  1 
ATOM   139   C  CG  . ARG A  1 21  ? -3.816  -52.068 102.533 1.00 24.79  ? 21   ARG A CG  1 
ATOM   140   C  CD  . ARG A  1 21  ? -4.768  -53.160 102.969 1.00 43.06  ? 21   ARG A CD  1 
ATOM   141   N  NE  . ARG A  1 21  ? -4.382  -53.808 104.217 1.00 47.40  ? 21   ARG A NE  1 
ATOM   142   C  CZ  . ARG A  1 21  ? -4.346  -53.199 105.398 1.00 57.90  ? 21   ARG A CZ  1 
ATOM   143   N  NH1 . ARG A  1 21  ? -4.656  -51.906 105.503 1.00 50.88  ? 21   ARG A NH1 1 
ATOM   144   N  NH2 . ARG A  1 21  ? -3.984  -53.886 106.479 1.00 67.28  ? 21   ARG A NH2 1 
ATOM   145   N  N   . LEU A  1 22  ? -1.934  -49.115 102.140 1.00 31.31  ? 22   LEU A N   1 
ATOM   146   C  CA  . LEU A  1 22  ? -1.927  -47.846 102.846 1.00 31.42  ? 22   LEU A CA  1 
ATOM   147   C  C   . LEU A  1 22  ? -3.297  -47.449 103.360 1.00 41.98  ? 22   LEU A C   1 
ATOM   148   O  O   . LEU A  1 22  ? -4.331  -47.843 102.801 1.00 45.72  ? 22   LEU A O   1 
ATOM   149   C  CB  . LEU A  1 22  ? -1.406  -46.749 101.936 1.00 21.27  ? 22   LEU A CB  1 
ATOM   150   C  CG  . LEU A  1 22  ? 0.034   -46.955 101.505 1.00 45.82  ? 22   LEU A CG  1 
ATOM   151   C  CD1 . LEU A  1 22  ? 0.498   -45.696 100.881 1.00 19.73  ? 22   LEU A CD1 1 
ATOM   152   C  CD2 . LEU A  1 22  ? 0.887   -47.309 102.680 1.00 21.48  ? 22   LEU A CD2 1 
ATOM   153   N  N   . LYS A  1 23  ? -3.296  -46.660 104.431 1.00 42.47  ? 23   LYS A N   1 
ATOM   154   C  CA  . LYS A  1 23  ? -4.527  -46.078 104.925 1.00 41.88  ? 23   LYS A CA  1 
ATOM   155   C  C   . LYS A  1 23  ? -4.704  -44.685 104.334 1.00 40.96  ? 23   LYS A C   1 
ATOM   156   O  O   . LYS A  1 23  ? -3.952  -43.766 104.640 1.00 49.17  ? 23   LYS A O   1 
ATOM   157   C  CB  . LYS A  1 23  ? -4.533  -46.023 106.453 1.00 50.35  ? 23   LYS A CB  1 
ATOM   158   C  CG  . LYS A  1 23  ? -5.742  -46.708 107.090 1.00 65.15  ? 23   LYS A CG  1 
ATOM   159   C  CD  . LYS A  1 23  ? -5.811  -46.468 108.606 1.00 74.48  ? 23   LYS A CD  1 
ATOM   160   C  CE  . LYS A  1 23  ? -6.163  -45.011 108.956 1.00 75.89  ? 23   LYS A CE  1 
ATOM   161   N  NZ  . LYS A  1 23  ? -7.607  -44.654 108.758 1.00 73.87  ? 23   LYS A NZ  1 
ATOM   162   N  N   . ALA A  1 24  ? -5.681  -44.545 103.448 1.00 36.67  ? 24   ALA A N   1 
ATOM   163   C  CA  . ALA A  1 24  ? -6.172  -43.230 103.061 1.00 32.90  ? 24   ALA A CA  1 
ATOM   164   C  C   . ALA A  1 24  ? -7.345  -42.950 104.001 1.00 30.88  ? 24   ALA A C   1 
ATOM   165   O  O   . ALA A  1 24  ? -7.820  -43.874 104.672 1.00 28.38  ? 24   ALA A O   1 
ATOM   166   C  CB  . ALA A  1 24  ? -6.608  -43.229 101.604 1.00 29.80  ? 24   ALA A CB  1 
ATOM   167   N  N   . PRO A  1 25  ? -7.788  -41.681 104.091 1.00 30.27  ? 25   PRO A N   1 
ATOM   168   C  CA  . PRO A  1 25  ? -8.863  -41.315 105.016 1.00 31.04  ? 25   PRO A CA  1 
ATOM   169   C  C   . PRO A  1 25  ? -10.056 -42.247 104.946 1.00 34.91  ? 25   PRO A C   1 
ATOM   170   O  O   . PRO A  1 25  ? -10.526 -42.737 105.975 1.00 37.57  ? 25   PRO A O   1 
ATOM   171   C  CB  . PRO A  1 25  ? -9.289  -39.940 104.509 1.00 28.72  ? 25   PRO A CB  1 
ATOM   172   C  CG  . PRO A  1 25  ? -8.050  -39.367 103.986 1.00 30.61  ? 25   PRO A CG  1 
ATOM   173   C  CD  . PRO A  1 25  ? -7.290  -40.501 103.362 1.00 29.46  ? 25   PRO A CD  1 
ATOM   174   N  N   . GLY A  1 26  ? -10.522 -42.503 103.734 1.00 26.44  ? 26   GLY A N   1 
ATOM   175   C  CA  . GLY A  1 26  ? -11.789 -43.176 103.548 1.00 35.68  ? 26   GLY A CA  1 
ATOM   176   C  C   . GLY A  1 26  ? -11.678 -44.657 103.297 1.00 31.72  ? 26   GLY A C   1 
ATOM   177   O  O   . GLY A  1 26  ? -12.667 -45.300 102.988 1.00 36.33  ? 26   GLY A O   1 
ATOM   178   N  N   . GLY A  1 27  ? -10.482 -45.207 103.424 1.00 33.61  ? 27   GLY A N   1 
ATOM   179   C  CA  . GLY A  1 27  ? -10.283 -46.622 103.169 1.00 34.05  ? 27   GLY A CA  1 
ATOM   180   C  C   . GLY A  1 27  ? -8.868  -46.959 102.757 1.00 31.23  ? 27   GLY A C   1 
ATOM   181   O  O   . GLY A  1 27  ? -8.010  -46.088 102.713 1.00 38.57  ? 27   GLY A O   1 
ATOM   182   N  N   . PRO A  1 28  ? -8.613  -48.235 102.457 1.00 28.03  ? 28   PRO A N   1 
ATOM   183   C  CA  . PRO A  1 28  ? -7.263  -48.654 102.074 1.00 28.69  ? 28   PRO A CA  1 
ATOM   184   C  C   . PRO A  1 28  ? -6.978  -48.461 100.594 1.00 31.38  ? 28   PRO A C   1 
ATOM   185   O  O   . PRO A  1 28  ? -7.865  -48.522 99.751  1.00 37.85  ? 28   PRO A O   1 
ATOM   186   C  CB  . PRO A  1 28  ? -7.281  -50.146 102.387 1.00 29.76  ? 28   PRO A CB  1 
ATOM   187   C  CG  . PRO A  1 28  ? -8.688  -50.541 102.145 1.00 26.31  ? 28   PRO A CG  1 
ATOM   188   C  CD  . PRO A  1 28  ? -9.526  -49.382 102.591 1.00 26.70  ? 28   PRO A CD  1 
ATOM   189   N  N   . VAL A  1 29  ? -5.728  -48.226 100.266 1.00 22.49  ? 29   VAL A N   1 
ATOM   190   C  CA  . VAL A  1 29  ? -5.354  -48.220 98.871  1.00 34.39  ? 29   VAL A CA  1 
ATOM   191   C  C   . VAL A  1 29  ? -4.135  -49.101 98.711  1.00 31.13  ? 29   VAL A C   1 
ATOM   192   O  O   . VAL A  1 29  ? -3.510  -49.477 99.698  1.00 33.41  ? 29   VAL A O   1 
ATOM   193   C  CB  . VAL A  1 29  ? -5.035  -46.805 98.367  1.00 36.18  ? 29   VAL A CB  1 
ATOM   194   C  CG1 . VAL A  1 29  ? -6.200  -45.883 98.625  1.00 21.02  ? 29   VAL A CG1 1 
ATOM   195   C  CG2 . VAL A  1 29  ? -3.777  -46.282 99.031  1.00 34.59  ? 29   VAL A CG2 1 
ATOM   196   N  N   . SER A  1 30  ? -3.800  -49.429 97.469  1.00 31.80  ? 30   SER A N   1 
ATOM   197   C  CA  . SER A  1 30  ? -2.589  -50.185 97.172  1.00 37.02  ? 30   SER A CA  1 
ATOM   198   C  C   . SER A  1 30  ? -1.502  -49.258 96.667  1.00 19.39  ? 30   SER A C   1 
ATOM   199   O  O   . SER A  1 30  ? -1.735  -48.457 95.775  1.00 27.94  ? 30   SER A O   1 
ATOM   200   C  CB  . SER A  1 30  ? -2.885  -51.243 96.119  1.00 36.96  ? 30   SER A CB  1 
ATOM   201   O  OG  . SER A  1 30  ? -4.099  -51.899 96.427  1.00 21.50  ? 30   SER A OG  1 
ATOM   202   N  N   . ALA A  1 31  ? -0.316  -49.353 97.244  1.00 25.41  ? 31   ALA A N   1 
ATOM   203   C  CA  . ALA A  1 31  ? 0.799   -48.539 96.767  1.00 26.61  ? 31   ALA A CA  1 
ATOM   204   C  C   . ALA A  1 31  ? 1.976   -49.415 96.404  1.00 28.66  ? 31   ALA A C   1 
ATOM   205   O  O   . ALA A  1 31  ? 2.431   -50.214 97.205  1.00 32.49  ? 31   ALA A O   1 
ATOM   206   C  CB  . ALA A  1 31  ? 1.212   -47.513 97.801  1.00 18.52  ? 31   ALA A CB  1 
ATOM   207   N  N   . PHE A  1 32  ? 2.456   -49.267 95.181  1.00 25.97  ? 32   PHE A N   1 
ATOM   208   C  CA  . PHE A  1 32  ? 3.627   -49.986 94.721  1.00 25.04  ? 32   PHE A CA  1 
ATOM   209   C  C   . PHE A  1 32  ? 4.602   -48.889 94.416  1.00 28.06  ? 32   PHE A C   1 
ATOM   210   O  O   . PHE A  1 32  ? 4.485   -48.234 93.369  1.00 16.84  ? 32   PHE A O   1 
ATOM   211   C  CB  . PHE A  1 32  ? 3.274   -50.799 93.473  1.00 18.22  ? 32   PHE A CB  1 
ATOM   212   C  CG  . PHE A  1 32  ? 2.034   -51.630 93.650  1.00 28.31  ? 32   PHE A CG  1 
ATOM   213   C  CD1 . PHE A  1 32  ? 0.776   -51.076 93.425  1.00 26.41  ? 32   PHE A CD1 1 
ATOM   214   C  CD2 . PHE A  1 32  ? 2.120   -52.940 94.099  1.00 19.72  ? 32   PHE A CD2 1 
ATOM   215   C  CE1 . PHE A  1 32  ? -0.374  -51.818 93.627  1.00 19.33  ? 32   PHE A CE1 1 
ATOM   216   C  CE2 . PHE A  1 32  ? 0.993   -53.679 94.302  1.00 43.26  ? 32   PHE A CE2 1 
ATOM   217   C  CZ  . PHE A  1 32  ? -0.268  -53.118 94.064  1.00 42.49  ? 32   PHE A CZ  1 
ATOM   218   N  N   . LEU A  1 33  ? 5.517   -48.650 95.359  1.00 17.73  ? 33   LEU A N   1 
ATOM   219   C  CA  . LEU A  1 33  ? 6.450   -47.523 95.270  1.00 22.96  ? 33   LEU A CA  1 
ATOM   220   C  C   . LEU A  1 33  ? 7.891   -47.941 94.964  1.00 26.00  ? 33   LEU A C   1 
ATOM   221   O  O   . LEU A  1 33  ? 8.382   -48.947 95.497  1.00 18.31  ? 33   LEU A O   1 
ATOM   222   C  CB  . LEU A  1 33  ? 6.457   -46.755 96.579  1.00 17.44  ? 33   LEU A CB  1 
ATOM   223   C  CG  . LEU A  1 33  ? 5.105   -46.389 97.154  1.00 27.50  ? 33   LEU A CG  1 
ATOM   224   C  CD1 . LEU A  1 33  ? 5.281   -45.922 98.566  1.00 18.02  ? 33   LEU A CD1 1 
ATOM   225   C  CD2 . LEU A  1 33  ? 4.506   -45.296 96.322  1.00 25.38  ? 33   LEU A CD2 1 
ATOM   226   N  N   . GLY A  1 34  ? 8.575   -47.160 94.123  1.00 21.09  ? 34   GLY A N   1 
ATOM   227   C  CA  . GLY A  1 34  ? 9.994   -47.378 93.891  1.00 22.45  ? 34   GLY A CA  1 
ATOM   228   C  C   . GLY A  1 34  ? 10.272  -48.519 92.924  1.00 30.16  ? 34   GLY A C   1 
ATOM   229   O  O   . GLY A  1 34  ? 11.179  -49.327 93.137  1.00 39.24  ? 34   GLY A O   1 
ATOM   230   N  N   . ILE A  1 35  ? 9.486   -48.579 91.853  1.00 22.01  ? 35   ILE A N   1 
ATOM   231   C  CA  . ILE A  1 35  ? 9.633   -49.610 90.837  1.00 22.71  ? 35   ILE A CA  1 
ATOM   232   C  C   . ILE A  1 35  ? 10.640  -49.121 89.805  1.00 25.74  ? 35   ILE A C   1 
ATOM   233   O  O   . ILE A  1 35  ? 10.500  -48.021 89.279  1.00 34.80  ? 35   ILE A O   1 
ATOM   234   C  CB  . ILE A  1 35  ? 8.280   -49.876 90.152  1.00 24.68  ? 35   ILE A CB  1 
ATOM   235   C  CG1 . ILE A  1 35  ? 7.192   -50.064 91.192  1.00 17.47  ? 35   ILE A CG1 1 
ATOM   236   C  CG2 . ILE A  1 35  ? 8.361   -51.081 89.255  1.00 18.01  ? 35   ILE A CG2 1 
ATOM   237   C  CD1 . ILE A  1 35  ? 5.875   -50.401 90.603  1.00 45.40  ? 35   ILE A CD1 1 
ATOM   238   N  N   . PRO A  1 36  ? 11.675  -49.921 89.521  1.00 23.80  ? 36   PRO A N   1 
ATOM   239   C  CA  . PRO A  1 36  ? 12.730  -49.418 88.629  1.00 23.50  ? 36   PRO A CA  1 
ATOM   240   C  C   . PRO A  1 36  ? 12.295  -49.516 87.178  1.00 22.92  ? 36   PRO A C   1 
ATOM   241   O  O   . PRO A  1 36  ? 11.825  -50.576 86.771  1.00 25.17  ? 36   PRO A O   1 
ATOM   242   C  CB  . PRO A  1 36  ? 13.896  -50.368 88.908  1.00 21.45  ? 36   PRO A CB  1 
ATOM   243   C  CG  . PRO A  1 36  ? 13.236  -51.644 89.303  1.00 20.12  ? 36   PRO A CG  1 
ATOM   244   C  CD  . PRO A  1 36  ? 11.974  -51.267 90.034  1.00 19.28  ? 36   PRO A CD  1 
ATOM   245   N  N   . PHE A  1 37  ? 12.423  -48.438 86.413  1.00 17.59  ? 37   PHE A N   1 
ATOM   246   C  CA  . PHE A  1 37  ? 11.999  -48.484 85.016  1.00 21.79  ? 37   PHE A CA  1 
ATOM   247   C  C   . PHE A  1 37  ? 13.159  -48.340 84.057  1.00 20.97  ? 37   PHE A C   1 
ATOM   248   O  O   . PHE A  1 37  ? 13.014  -48.460 82.853  1.00 20.20  ? 37   PHE A O   1 
ATOM   249   C  CB  . PHE A  1 37  ? 10.930  -47.438 84.714  1.00 23.32  ? 37   PHE A CB  1 
ATOM   250   C  CG  . PHE A  1 37  ? 11.390  -46.010 84.888  1.00 30.20  ? 37   PHE A CG  1 
ATOM   251   C  CD1 . PHE A  1 37  ? 11.306  -45.384 86.128  1.00 30.49  ? 37   PHE A CD1 1 
ATOM   252   C  CD2 . PHE A  1 37  ? 11.861  -45.280 83.803  1.00 25.13  ? 37   PHE A CD2 1 
ATOM   253   C  CE1 . PHE A  1 37  ? 11.699  -44.070 86.287  1.00 27.08  ? 37   PHE A CE1 1 
ATOM   254   C  CE2 . PHE A  1 37  ? 12.250  -43.964 83.955  1.00 22.88  ? 37   PHE A CE2 1 
ATOM   255   C  CZ  . PHE A  1 37  ? 12.178  -43.359 85.200  1.00 24.15  ? 37   PHE A CZ  1 
ATOM   256   N  N   . ALA A  1 38  ? 14.329  -48.094 84.603  1.00 31.45  ? 38   ALA A N   1 
ATOM   257   C  CA  . ALA A  1 38  ? 15.500  -47.969 83.773  1.00 32.66  ? 38   ALA A CA  1 
ATOM   258   C  C   . ALA A  1 38  ? 16.675  -48.490 84.552  1.00 26.71  ? 38   ALA A C   1 
ATOM   259   O  O   . ALA A  1 38  ? 16.615  -48.559 85.776  1.00 23.62  ? 38   ALA A O   1 
ATOM   260   C  CB  . ALA A  1 38  ? 15.719  -46.527 83.408  1.00 40.12  ? 38   ALA A CB  1 
ATOM   261   N  N   . GLU A  1 39  ? 17.730  -48.875 83.838  1.00 30.80  ? 39   GLU A N   1 
ATOM   262   C  CA  . GLU A  1 39  ? 19.021  -49.139 84.459  1.00 25.63  ? 39   GLU A CA  1 
ATOM   263   C  C   . GLU A  1 39  ? 19.534  -47.806 84.959  1.00 27.80  ? 39   GLU A C   1 
ATOM   264   O  O   . GLU A  1 39  ? 19.437  -46.796 84.253  1.00 29.87  ? 39   GLU A O   1 
ATOM   265   C  CB  . GLU A  1 39  ? 19.996  -49.740 83.448  1.00 26.62  ? 39   GLU A CB  1 
ATOM   266   C  CG  . GLU A  1 39  ? 19.753  -51.202 83.154  1.00 34.92  ? 39   GLU A CG  1 
ATOM   267   C  CD  . GLU A  1 39  ? 20.192  -52.095 84.301  1.00 49.51  ? 39   GLU A CD  1 
ATOM   268   O  OE1 . GLU A  1 39  ? 21.361  -51.948 84.744  1.00 58.05  ? 39   GLU A OE1 1 
ATOM   269   O  OE2 . GLU A  1 39  ? 19.370  -52.931 84.762  1.00 43.19  ? 39   GLU A OE2 1 
ATOM   270   N  N   . PRO A  1 40  ? 20.059  -47.789 86.185  1.00 21.64  ? 40   PRO A N   1 
ATOM   271   C  CA  . PRO A  1 40  ? 20.613  -46.587 86.814  1.00 29.86  ? 40   PRO A CA  1 
ATOM   272   C  C   . PRO A  1 40  ? 21.646  -45.866 85.935  1.00 30.79  ? 40   PRO A C   1 
ATOM   273   O  O   . PRO A  1 40  ? 22.699  -46.411 85.583  1.00 23.06  ? 40   PRO A O   1 
ATOM   274   C  CB  . PRO A  1 40  ? 21.265  -47.127 88.094  1.00 29.50  ? 40   PRO A CB  1 
ATOM   275   C  CG  . PRO A  1 40  ? 21.462  -48.559 87.849  1.00 33.99  ? 40   PRO A CG  1 
ATOM   276   C  CD  . PRO A  1 40  ? 20.302  -48.985 86.997  1.00 35.48  ? 40   PRO A CD  1 
ATOM   277   N  N   . PRO A  1 41  ? 21.335  -44.618 85.578  1.00 29.86  ? 41   PRO A N   1 
ATOM   278   C  CA  . PRO A  1 41  ? 22.173  -43.824 84.686  1.00 27.01  ? 41   PRO A CA  1 
ATOM   279   C  C   . PRO A  1 41  ? 23.358  -43.301 85.444  1.00 26.43  ? 41   PRO A C   1 
ATOM   280   O  O   . PRO A  1 41  ? 23.529  -42.090 85.493  1.00 34.40  ? 41   PRO A O   1 
ATOM   281   C  CB  . PRO A  1 41  ? 21.263  -42.648 84.326  1.00 28.10  ? 41   PRO A CB  1 
ATOM   282   C  CG  . PRO A  1 41  ? 20.402  -42.479 85.522  1.00 25.83  ? 41   PRO A CG  1 
ATOM   283   C  CD  . PRO A  1 41  ? 20.165  -43.861 86.058  1.00 28.39  ? 41   PRO A CD  1 
ATOM   284   N  N   . VAL A  1 42  ? 24.142  -44.184 86.051  1.00 23.19  ? 42   VAL A N   1 
ATOM   285   C  CA  . VAL A  1 42  ? 25.302  -43.753 86.818  1.00 24.13  ? 42   VAL A CA  1 
ATOM   286   C  C   . VAL A  1 42  ? 26.610  -44.045 86.097  1.00 32.47  ? 42   VAL A C   1 
ATOM   287   O  O   . VAL A  1 42  ? 26.650  -44.844 85.159  1.00 32.06  ? 42   VAL A O   1 
ATOM   288   C  CB  . VAL A  1 42  ? 25.347  -44.400 88.195  1.00 24.60  ? 42   VAL A CB  1 
ATOM   289   C  CG1 . VAL A  1 42  ? 24.015  -44.246 88.875  1.00 23.28  ? 42   VAL A CG1 1 
ATOM   290   C  CG2 . VAL A  1 42  ? 25.732  -45.844 88.077  1.00 25.76  ? 42   VAL A CG2 1 
ATOM   291   N  N   . GLY A  1 43  ? 27.678  -43.387 86.541  1.00 35.03  ? 43   GLY A N   1 
ATOM   292   C  CA  . GLY A  1 43  ? 28.981  -43.573 85.935  1.00 32.39  ? 43   GLY A CA  1 
ATOM   293   C  C   . GLY A  1 43  ? 28.975  -43.209 84.464  1.00 36.08  ? 43   GLY A C   1 
ATOM   294   O  O   . GLY A  1 43  ? 28.720  -42.059 84.107  1.00 44.18  ? 43   GLY A O   1 
ATOM   295   N  N   . SER A  1 44  ? 29.235  -44.189 83.603  1.00 35.69  ? 44   SER A N   1 
ATOM   296   C  CA  . SER A  1 44  ? 29.410  -43.924 82.176  1.00 39.17  ? 44   SER A CA  1 
ATOM   297   C  C   . SER A  1 44  ? 28.068  -43.709 81.468  1.00 36.60  ? 44   SER A C   1 
ATOM   298   O  O   . SER A  1 44  ? 28.004  -43.401 80.272  1.00 27.62  ? 44   SER A O   1 
ATOM   299   C  CB  . SER A  1 44  ? 30.179  -45.071 81.533  1.00 45.78  ? 44   SER A CB  1 
ATOM   300   O  OG  . SER A  1 44  ? 29.493  -46.289 81.761  1.00 58.55  ? 44   SER A OG  1 
ATOM   301   N  N   . ARG A  1 45  ? 26.987  -43.874 82.213  1.00 34.67  ? 45   ARG A N   1 
ATOM   302   C  CA  . ARG A  1 45  ? 25.678  -43.660 81.639  1.00 41.00  ? 45   ARG A CA  1 
ATOM   303   C  C   . ARG A  1 45  ? 25.212  -42.251 81.958  1.00 44.07  ? 45   ARG A C   1 
ATOM   304   O  O   . ARG A  1 45  ? 24.055  -41.897 81.716  1.00 52.34  ? 45   ARG A O   1 
ATOM   305   C  CB  . ARG A  1 45  ? 24.682  -44.707 82.136  1.00 45.62  ? 45   ARG A CB  1 
ATOM   306   C  CG  . ARG A  1 45  ? 24.953  -46.117 81.623  1.00 54.63  ? 45   ARG A CG  1 
ATOM   307   C  CD  . ARG A  1 45  ? 25.235  -46.141 80.115  1.00 66.08  ? 45   ARG A CD  1 
ATOM   308   N  NE  . ARG A  1 45  ? 24.153  -45.571 79.304  1.00 74.48  ? 45   ARG A NE  1 
ATOM   309   C  CZ  . ARG A  1 45  ? 24.113  -45.594 77.970  1.00 79.82  ? 45   ARG A CZ  1 
ATOM   310   N  NH1 . ARG A  1 45  ? 25.090  -46.168 77.278  1.00 88.33  ? 45   ARG A NH1 1 
ATOM   311   N  NH2 . ARG A  1 45  ? 23.090  -45.049 77.323  1.00 76.69  ? 45   ARG A NH2 1 
ATOM   312   N  N   . ARG A  1 46  ? 26.128  -41.447 82.491  1.00 35.12  ? 46   ARG A N   1 
ATOM   313   C  CA  . ARG A  1 46  ? 25.810  -40.075 82.865  1.00 33.36  ? 46   ARG A CA  1 
ATOM   314   C  C   . ARG A  1 46  ? 25.615  -39.229 81.613  1.00 36.48  ? 46   ARG A C   1 
ATOM   315   O  O   . ARG A  1 46  ? 26.393  -39.337 80.660  1.00 33.50  ? 46   ARG A O   1 
ATOM   316   C  CB  . ARG A  1 46  ? 26.914  -39.488 83.748  1.00 32.72  ? 46   ARG A CB  1 
ATOM   317   C  CG  . ARG A  1 46  ? 26.611  -38.101 84.311  1.00 33.77  ? 46   ARG A CG  1 
ATOM   318   C  CD  . ARG A  1 46  ? 27.858  -37.466 84.961  1.00 29.20  ? 46   ARG A CD  1 
ATOM   319   N  NE  . ARG A  1 46  ? 28.059  -37.940 86.320  1.00 29.25  ? 46   ARG A NE  1 
ATOM   320   C  CZ  . ARG A  1 46  ? 28.863  -37.358 87.190  1.00 32.65  ? 46   ARG A CZ  1 
ATOM   321   N  NH1 . ARG A  1 46  ? 29.517  -36.280 86.822  1.00 39.03  ? 46   ARG A NH1 1 
ATOM   322   N  NH2 . ARG A  1 46  ? 29.004  -37.844 88.413  1.00 25.89  ? 46   ARG A NH2 1 
ATOM   323   N  N   . PHE A  1 47  ? 24.562  -38.408 81.630  1.00 37.47  ? 47   PHE A N   1 
ATOM   324   C  CA  . PHE A  1 47  ? 24.173  -37.524 80.518  1.00 36.92  ? 47   PHE A CA  1 
ATOM   325   C  C   . PHE A  1 47  ? 23.579  -38.272 79.327  1.00 36.69  ? 47   PHE A C   1 
ATOM   326   O  O   . PHE A  1 47  ? 23.292  -37.655 78.300  1.00 32.96  ? 47   PHE A O   1 
ATOM   327   C  CB  . PHE A  1 47  ? 25.349  -36.683 79.994  1.00 32.45  ? 47   PHE A CB  1 
ATOM   328   C  CG  . PHE A  1 47  ? 26.160  -36.012 81.055  1.00 32.23  ? 47   PHE A CG  1 
ATOM   329   C  CD1 . PHE A  1 47  ? 25.554  -35.250 82.031  1.00 21.53  ? 47   PHE A CD1 1 
ATOM   330   C  CD2 . PHE A  1 47  ? 27.553  -36.127 81.048  1.00 35.43  ? 47   PHE A CD2 1 
ATOM   331   C  CE1 . PHE A  1 47  ? 26.296  -34.627 82.983  1.00 32.87  ? 47   PHE A CE1 1 
ATOM   332   C  CE2 . PHE A  1 47  ? 28.328  -35.504 82.010  1.00 24.45  ? 47   PHE A CE2 1 
ATOM   333   C  CZ  . PHE A  1 47  ? 27.707  -34.749 82.977  1.00 39.00  ? 47   PHE A CZ  1 
ATOM   334   N  N   . MET A  1 48  ? 23.427  -39.591 79.449  1.00 34.35  ? 48   MET A N   1 
ATOM   335   C  CA  . MET A  1 48  ? 23.010  -40.424 78.316  1.00 34.97  ? 48   MET A CA  1 
ATOM   336   C  C   . MET A  1 48  ? 21.589  -40.926 78.494  1.00 38.18  ? 48   MET A C   1 
ATOM   337   O  O   . MET A  1 48  ? 21.113  -41.053 79.621  1.00 42.90  ? 48   MET A O   1 
ATOM   338   C  CB  . MET A  1 48  ? 23.962  -41.603 78.116  1.00 23.31  ? 48   MET A CB  1 
ATOM   339   C  CG  . MET A  1 48  ? 25.399  -41.190 78.127  1.00 83.97  ? 48   MET A CG  1 
ATOM   340   S  SD  . MET A  1 48  ? 26.324  -42.219 77.013  1.00 58.05  ? 48   MET A SD  1 
ATOM   341   C  CE  . MET A  1 48  ? 25.371  -41.935 75.544  1.00 39.06  ? 48   MET A CE  1 
ATOM   342   N  N   . PRO A  1 49  ? 20.904  -41.218 77.380  1.00 20.91  ? 49   PRO A N   1 
ATOM   343   C  CA  . PRO A  1 49  ? 19.517  -41.643 77.484  1.00 32.16  ? 49   PRO A CA  1 
ATOM   344   C  C   . PRO A  1 49  ? 19.387  -42.871 78.375  1.00 34.13  ? 49   PRO A C   1 
ATOM   345   O  O   . PRO A  1 49  ? 20.370  -43.620 78.514  1.00 30.57  ? 49   PRO A O   1 
ATOM   346   C  CB  . PRO A  1 49  ? 19.167  -41.978 76.035  1.00 28.98  ? 49   PRO A CB  1 
ATOM   347   C  CG  . PRO A  1 49  ? 20.074  -41.143 75.229  1.00 21.30  ? 49   PRO A CG  1 
ATOM   348   C  CD  . PRO A  1 49  ? 21.346  -41.178 75.977  1.00 33.20  ? 49   PRO A CD  1 
ATOM   349   N  N   . PRO A  1 50  ? 18.202  -43.064 78.983  1.00 19.24  ? 50   PRO A N   1 
ATOM   350   C  CA  . PRO A  1 50  ? 17.969  -44.200 79.868  1.00 19.33  ? 50   PRO A CA  1 
ATOM   351   C  C   . PRO A  1 50  ? 17.963  -45.489 79.068  1.00 28.83  ? 50   PRO A C   1 
ATOM   352   O  O   . PRO A  1 50  ? 17.559  -45.483 77.890  1.00 20.47  ? 50   PRO A O   1 
ATOM   353   C  CB  . PRO A  1 50  ? 16.563  -43.933 80.390  1.00 32.44  ? 50   PRO A CB  1 
ATOM   354   C  CG  . PRO A  1 50  ? 15.888  -43.210 79.273  1.00 30.66  ? 50   PRO A CG  1 
ATOM   355   C  CD  . PRO A  1 50  ? 16.970  -42.293 78.749  1.00 29.82  ? 50   PRO A CD  1 
ATOM   356   N  N   . GLU A  1 51  ? 18.424  -46.567 79.701  1.00 23.13  ? 51   GLU A N   1 
ATOM   357   C  CA  . GLU A  1 51  ? 18.275  -47.917 79.176  1.00 29.86  ? 51   GLU A CA  1 
ATOM   358   C  C   . GLU A  1 51  ? 17.203  -48.612 80.005  1.00 39.27  ? 51   GLU A C   1 
ATOM   359   O  O   . GLU A  1 51  ? 17.201  -48.501 81.227  1.00 48.20  ? 51   GLU A O   1 
ATOM   360   C  CB  . GLU A  1 51  ? 19.570  -48.709 79.324  1.00 42.84  ? 51   GLU A CB  1 
ATOM   361   C  CG  . GLU A  1 51  ? 20.771  -48.155 78.572  1.00 59.89  ? 51   GLU A CG  1 
ATOM   362   C  CD  . GLU A  1 51  ? 22.091  -48.698 79.110  1.00 65.37  ? 51   GLU A CD  1 
ATOM   363   O  OE1 . GLU A  1 51  ? 22.425  -48.388 80.281  1.00 62.28  ? 51   GLU A OE1 1 
ATOM   364   O  OE2 . GLU A  1 51  ? 22.785  -49.434 78.365  1.00 66.03  ? 51   GLU A OE2 1 
ATOM   365   N  N   . PRO A  1 52  ? 16.288  -49.326 79.341  1.00 32.68  ? 52   PRO A N   1 
ATOM   366   C  CA  . PRO A  1 52  ? 15.285  -50.208 79.938  1.00 29.37  ? 52   PRO A CA  1 
ATOM   367   C  C   . PRO A  1 52  ? 15.840  -51.054 81.081  1.00 29.22  ? 52   PRO A C   1 
ATOM   368   O  O   . PRO A  1 52  ? 16.932  -51.582 80.961  1.00 34.06  ? 52   PRO A O   1 
ATOM   369   C  CB  . PRO A  1 52  ? 14.939  -51.126 78.777  1.00 22.10  ? 52   PRO A CB  1 
ATOM   370   C  CG  . PRO A  1 52  ? 15.083  -50.280 77.587  1.00 27.37  ? 52   PRO A CG  1 
ATOM   371   C  CD  . PRO A  1 52  ? 16.191  -49.311 77.872  1.00 31.12  ? 52   PRO A CD  1 
ATOM   372   N  N   . LYS A  1 53  ? 15.091  -51.191 82.167  1.00 29.35  ? 53   LYS A N   1 
ATOM   373   C  CA  . LYS A  1 53  ? 15.557  -51.938 83.324  1.00 28.83  ? 53   LYS A CA  1 
ATOM   374   C  C   . LYS A  1 53  ? 15.682  -53.419 83.011  1.00 31.88  ? 53   LYS A C   1 
ATOM   375   O  O   . LYS A  1 53  ? 14.690  -54.071 82.672  1.00 35.15  ? 53   LYS A O   1 
ATOM   376   C  CB  . LYS A  1 53  ? 14.596  -51.743 84.492  1.00 32.19  ? 53   LYS A CB  1 
ATOM   377   C  CG  . LYS A  1 53  ? 14.956  -52.538 85.728  1.00 36.09  ? 53   LYS A CG  1 
ATOM   378   C  CD  . LYS A  1 53  ? 16.277  -52.061 86.325  1.00 37.01  ? 53   LYS A CD  1 
ATOM   379   C  CE  . LYS A  1 53  ? 16.563  -52.733 87.661  1.00 31.22  ? 53   LYS A CE  1 
ATOM   380   N  NZ  . LYS A  1 53  ? 16.705  -54.194 87.435  1.00 23.62  ? 53   LYS A NZ  1 
ATOM   381   N  N   . ARG A  1 54  ? 16.902  -53.944 83.127  1.00 30.80  ? 54   ARG A N   1 
ATOM   382   C  CA  . ARG A  1 54  ? 17.155  -55.369 82.915  1.00 31.14  ? 54   ARG A CA  1 
ATOM   383   C  C   . ARG A  1 54  ? 16.394  -56.152 83.972  1.00 26.14  ? 54   ARG A C   1 
ATOM   384   O  O   . ARG A  1 54  ? 16.506  -55.848 85.170  1.00 24.94  ? 54   ARG A O   1 
ATOM   385   C  CB  . ARG A  1 54  ? 18.650  -55.720 83.054  1.00 47.31  ? 54   ARG A CB  1 
ATOM   386   C  CG  . ARG A  1 54  ? 19.647  -55.095 82.077  1.00 52.57  ? 54   ARG A CG  1 
ATOM   387   C  CD  . ARG A  1 54  ? 21.069  -55.531 82.446  1.00 68.86  ? 54   ARG A CD  1 
ATOM   388   N  NE  . ARG A  1 54  ? 21.267  -55.605 83.902  1.00 86.51  ? 54   ARG A NE  1 
ATOM   389   C  CZ  . ARG A  1 54  ? 21.566  -56.716 84.586  1.00 94.50  ? 54   ARG A CZ  1 
ATOM   390   N  NH1 . ARG A  1 54  ? 21.726  -57.879 83.960  1.00 94.84  ? 54   ARG A NH1 1 
ATOM   391   N  NH2 . ARG A  1 54  ? 21.716  -56.665 85.908  1.00 93.81  ? 54   ARG A NH2 1 
ATOM   392   N  N   . PRO A  1 55  ? 15.644  -57.182 83.538  1.00 29.56  ? 55   PRO A N   1 
ATOM   393   C  CA  . PRO A  1 55  ? 14.821  -58.083 84.353  1.00 31.53  ? 55   PRO A CA  1 
ATOM   394   C  C   . PRO A  1 55  ? 15.514  -58.569 85.610  1.00 35.84  ? 55   PRO A C   1 
ATOM   395   O  O   . PRO A  1 55  ? 16.730  -58.759 85.618  1.00 41.92  ? 55   PRO A O   1 
ATOM   396   C  CB  . PRO A  1 55  ? 14.595  -59.280 83.424  1.00 27.11  ? 55   PRO A CB  1 
ATOM   397   C  CG  . PRO A  1 55  ? 15.526  -59.108 82.314  1.00 27.76  ? 55   PRO A CG  1 
ATOM   398   C  CD  . PRO A  1 55  ? 15.676  -57.644 82.147  1.00 27.92  ? 55   PRO A CD  1 
ATOM   399   N  N   . TRP A  1 56  ? 14.730  -58.767 86.660  1.00 35.14  ? 56   TRP A N   1 
ATOM   400   C  CA  . TRP A  1 56  ? 15.256  -59.204 87.938  1.00 37.42  ? 56   TRP A CA  1 
ATOM   401   C  C   . TRP A  1 56  ? 14.586  -60.487 88.343  1.00 35.98  ? 56   TRP A C   1 
ATOM   402   O  O   . TRP A  1 56  ? 13.582  -60.886 87.755  1.00 38.16  ? 56   TRP A O   1 
ATOM   403   C  CB  . TRP A  1 56  ? 14.983  -58.156 89.008  1.00 40.93  ? 56   TRP A CB  1 
ATOM   404   C  CG  . TRP A  1 56  ? 13.528  -57.842 89.189  1.00 36.86  ? 56   TRP A CG  1 
ATOM   405   C  CD1 . TRP A  1 56  ? 12.656  -58.447 90.048  1.00 37.76  ? 56   TRP A CD1 1 
ATOM   406   C  CD2 . TRP A  1 56  ? 12.779  -56.835 88.500  1.00 33.03  ? 56   TRP A CD2 1 
ATOM   407   N  NE1 . TRP A  1 56  ? 11.409  -57.877 89.936  1.00 33.77  ? 56   TRP A NE1 1 
ATOM   408   C  CE2 . TRP A  1 56  ? 11.458  -56.888 88.988  1.00 34.24  ? 56   TRP A CE2 1 
ATOM   409   C  CE3 . TRP A  1 56  ? 13.094  -55.902 87.510  1.00 31.77  ? 56   TRP A CE3 1 
ATOM   410   C  CZ2 . TRP A  1 56  ? 10.456  -56.040 88.520  1.00 32.33  ? 56   TRP A CZ2 1 
ATOM   411   C  CZ3 . TRP A  1 56  ? 12.100  -55.061 87.055  1.00 40.73  ? 56   TRP A CZ3 1 
ATOM   412   C  CH2 . TRP A  1 56  ? 10.794  -55.137 87.557  1.00 21.40  ? 56   TRP A CH2 1 
ATOM   413   N  N   . SER A  1 57  ? 15.143  -61.125 89.361  1.00 28.76  ? 57   SER A N   1 
ATOM   414   C  CA  . SER A  1 57  ? 14.576  -62.349 89.896  1.00 29.67  ? 57   SER A CA  1 
ATOM   415   C  C   . SER A  1 57  ? 14.147  -62.096 91.318  1.00 32.11  ? 57   SER A C   1 
ATOM   416   O  O   . SER A  1 57  ? 14.536  -61.100 91.928  1.00 29.27  ? 57   SER A O   1 
ATOM   417   C  CB  . SER A  1 57  ? 15.594  -63.474 89.840  1.00 39.37  ? 57   SER A CB  1 
ATOM   418   O  OG  . SER A  1 57  ? 16.880  -62.987 90.169  1.00 44.11  ? 57   SER A OG  1 
ATOM   419   N  N   . GLY A  1 58  ? 13.321  -62.985 91.844  1.00 29.85  ? 58   GLY A N   1 
ATOM   420   C  CA  . GLY A  1 58  ? 12.788  -62.799 93.180  1.00 35.30  ? 58   GLY A CA  1 
ATOM   421   C  C   . GLY A  1 58  ? 11.765  -61.689 93.184  1.00 30.51  ? 58   GLY A C   1 
ATOM   422   O  O   . GLY A  1 58  ? 11.544  -61.052 92.158  1.00 28.16  ? 58   GLY A O   1 
ATOM   423   N  N   . VAL A  1 59  ? 11.130  -61.451 94.326  1.00 32.10  ? 59   VAL A N   1 
ATOM   424   C  CA  . VAL A  1 59  ? 10.135  -60.389 94.387  1.00 36.27  ? 59   VAL A CA  1 
ATOM   425   C  C   . VAL A  1 59  ? 10.767  -59.074 94.834  1.00 37.22  ? 59   VAL A C   1 
ATOM   426   O  O   . VAL A  1 59  ? 11.326  -58.986 95.918  1.00 45.13  ? 59   VAL A O   1 
ATOM   427   C  CB  . VAL A  1 59  ? 8.936   -60.766 95.287  1.00 40.15  ? 59   VAL A CB  1 
ATOM   428   C  CG1 . VAL A  1 59  ? 7.963   -59.606 95.386  1.00 25.48  ? 59   VAL A CG1 1 
ATOM   429   C  CG2 . VAL A  1 59  ? 8.231   -61.979 94.737  1.00 27.47  ? 59   VAL A CG2 1 
ATOM   430   N  N   . LEU A  1 60  ? 10.689  -58.060 93.984  1.00 24.60  ? 60   LEU A N   1 
ATOM   431   C  CA  . LEU A  1 60  ? 11.269  -56.759 94.293  1.00 37.04  ? 60   LEU A CA  1 
ATOM   432   C  C   . LEU A  1 60  ? 10.436  -56.020 95.340  1.00 38.88  ? 60   LEU A C   1 
ATOM   433   O  O   . LEU A  1 60  ? 9.207   -55.933 95.238  1.00 36.56  ? 60   LEU A O   1 
ATOM   434   C  CB  . LEU A  1 60  ? 11.384  -55.932 93.017  1.00 22.90  ? 60   LEU A CB  1 
ATOM   435   C  CG  . LEU A  1 60  ? 12.160  -54.611 93.012  1.00 23.59  ? 60   LEU A CG  1 
ATOM   436   C  CD1 . LEU A  1 60  ? 12.703  -54.328 91.611  1.00 22.31  ? 60   LEU A CD1 1 
ATOM   437   C  CD2 . LEU A  1 60  ? 11.315  -53.432 93.474  1.00 21.18  ? 60   LEU A CD2 1 
ATOM   438   N  N   . ASP A  1 61  ? 11.106  -55.478 96.348  1.00 35.88  ? 61   ASP A N   1 
ATOM   439   C  CA  . ASP A  1 61  ? 10.402  -54.765 97.409  1.00 35.82  ? 61   ASP A CA  1 
ATOM   440   C  C   . ASP A  1 61  ? 9.936   -53.368 96.969  1.00 33.81  ? 61   ASP A C   1 
ATOM   441   O  O   . ASP A  1 61  ? 10.733  -52.433 96.836  1.00 35.82  ? 61   ASP A O   1 
ATOM   442   C  CB  . ASP A  1 61  ? 11.272  -54.681 98.665  1.00 41.86  ? 61   ASP A CB  1 
ATOM   443   C  CG  . ASP A  1 61  ? 10.619  -53.882 99.767  1.00 51.53  ? 61   ASP A CG  1 
ATOM   444   O  OD1 . ASP A  1 61  ? 9.400   -54.066 99.980  1.00 59.05  ? 61   ASP A OD1 1 
ATOM   445   O  OD2 . ASP A  1 61  ? 11.319  -53.058 100.404 1.00 50.85  ? 61   ASP A OD2 1 
ATOM   446   N  N   . ALA A  1 62  ? 8.637   -53.229 96.749  1.00 31.02  ? 62   ALA A N   1 
ATOM   447   C  CA  . ALA A  1 62  ? 8.098   -51.972 96.249  1.00 32.29  ? 62   ALA A CA  1 
ATOM   448   C  C   . ALA A  1 62  ? 7.143   -51.300 97.244  1.00 33.30  ? 62   ALA A C   1 
ATOM   449   O  O   . ALA A  1 62  ? 5.991   -50.981 96.912  1.00 31.07  ? 62   ALA A O   1 
ATOM   450   C  CB  . ALA A  1 62  ? 7.414   -52.207 94.931  1.00 31.52  ? 62   ALA A CB  1 
ATOM   451   N  N   . THR A  1 63  ? 7.643   -51.059 98.452  1.00 30.49  ? 63   THR A N   1 
ATOM   452   C  CA  . THR A  1 63  ? 6.804   -50.617 99.561  1.00 29.64  ? 63   THR A CA  1 
ATOM   453   C  C   . THR A  1 63  ? 7.179   -49.242 100.088 1.00 34.66  ? 63   THR A C   1 
ATOM   454   O  O   . THR A  1 63  ? 6.522   -48.702 100.992 1.00 29.09  ? 63   THR A O   1 
ATOM   455   C  CB  . THR A  1 63  ? 6.939   -51.586 100.721 1.00 28.82  ? 63   THR A CB  1 
ATOM   456   O  OG1 . THR A  1 63  ? 8.328   -51.849 100.942 1.00 27.12  ? 63   THR A OG1 1 
ATOM   457   C  CG2 . THR A  1 63  ? 6.249   -52.883 100.390 1.00 34.13  ? 63   THR A CG2 1 
ATOM   458   N  N   . THR A  1 64  ? 8.255   -48.694 99.529  1.00 41.42  ? 64   THR A N   1 
ATOM   459   C  CA  . THR A  1 64  ? 8.850   -47.450 99.994  1.00 37.69  ? 64   THR A CA  1 
ATOM   460   C  C   . THR A  1 64  ? 9.241   -46.607 98.795  1.00 36.07  ? 64   THR A C   1 
ATOM   461   O  O   . THR A  1 64  ? 9.429   -47.130 97.704  1.00 42.30  ? 64   THR A O   1 
ATOM   462   C  CB  . THR A  1 64  ? 10.130  -47.732 100.764 1.00 41.79  ? 64   THR A CB  1 
ATOM   463   O  OG1 . THR A  1 64  ? 11.055  -48.411 99.900  1.00 57.20  ? 64   THR A OG1 1 
ATOM   464   C  CG2 . THR A  1 64  ? 9.844   -48.617 101.939 1.00 35.21  ? 64   THR A CG2 1 
ATOM   465   N  N   . PHE A  1 65  ? 9.388   -45.307 99.006  1.00 33.86  ? 65   PHE A N   1 
ATOM   466   C  CA  . PHE A  1 65  ? 9.804   -44.405 97.945  1.00 26.38  ? 65   PHE A CA  1 
ATOM   467   C  C   . PHE A  1 65  ? 11.276  -44.599 97.671  1.00 23.64  ? 65   PHE A C   1 
ATOM   468   O  O   . PHE A  1 65  ? 12.035  -44.927 98.576  1.00 27.24  ? 65   PHE A O   1 
ATOM   469   C  CB  . PHE A  1 65  ? 9.535   -42.953 98.339  1.00 23.66  ? 65   PHE A CB  1 
ATOM   470   C  CG  . PHE A  1 65  ? 8.157   -42.504 98.012  1.00 23.98  ? 65   PHE A CG  1 
ATOM   471   C  CD1 . PHE A  1 65  ? 7.647   -42.667 96.737  1.00 28.20  ? 65   PHE A CD1 1 
ATOM   472   C  CD2 . PHE A  1 65  ? 7.343   -41.977 98.988  1.00 27.48  ? 65   PHE A CD2 1 
ATOM   473   C  CE1 . PHE A  1 65  ? 6.354   -42.263 96.435  1.00 31.37  ? 65   PHE A CE1 1 
ATOM   474   C  CE2 . PHE A  1 65  ? 6.047   -41.589 98.697  1.00 28.77  ? 65   PHE A CE2 1 
ATOM   475   C  CZ  . PHE A  1 65  ? 5.554   -41.728 97.418  1.00 28.19  ? 65   PHE A CZ  1 
ATOM   476   N  N   . GLN A  1 66  ? 11.676  -44.399 96.421  1.00 21.83  ? 66   GLN A N   1 
ATOM   477   C  CA  . GLN A  1 66  ? 13.070  -44.550 96.044  1.00 24.70  ? 66   GLN A CA  1 
ATOM   478   C  C   . GLN A  1 66  ? 13.827  -43.224 96.139  1.00 31.62  ? 66   GLN A C   1 
ATOM   479   O  O   . GLN A  1 66  ? 13.239  -42.211 96.514  1.00 32.92  ? 66   GLN A O   1 
ATOM   480   C  CB  . GLN A  1 66  ? 13.167  -45.174 94.656  1.00 22.87  ? 66   GLN A CB  1 
ATOM   481   C  CG  . GLN A  1 66  ? 13.543  -46.648 94.707  1.00 31.15  ? 66   GLN A CG  1 
ATOM   482   C  CD  . GLN A  1 66  ? 14.956  -46.871 95.260  1.00 30.55  ? 66   GLN A CD  1 
ATOM   483   O  OE1 . GLN A  1 66  ? 15.670  -45.917 95.564  1.00 25.91  ? 66   GLN A OE1 1 
ATOM   484   N  NE2 . GLN A  1 66  ? 15.360  -48.130 95.381  1.00 26.19  ? 66   GLN A NE2 1 
ATOM   485   N  N   . ASN A  1 67  ? 15.117  -43.217 95.822  1.00 18.31  ? 67   ASN A N   1 
ATOM   486   C  CA  . ASN A  1 67  ? 15.879  -41.971 95.903  1.00 21.88  ? 67   ASN A CA  1 
ATOM   487   C  C   . ASN A  1 67  ? 15.343  -40.857 95.004  1.00 21.83  ? 67   ASN A C   1 
ATOM   488   O  O   . ASN A  1 67  ? 14.895  -41.112 93.876  1.00 16.68  ? 67   ASN A O   1 
ATOM   489   C  CB  . ASN A  1 67  ? 17.377  -42.166 95.575  1.00 21.11  ? 67   ASN A CB  1 
ATOM   490   C  CG  . ASN A  1 67  ? 18.038  -43.219 96.440  1.00 25.61  ? 67   ASN A CG  1 
ATOM   491   O  OD1 . ASN A  1 67  ? 18.142  -43.053 97.659  1.00 26.39  ? 67   ASN A OD1 1 
ATOM   492   N  ND2 . ASN A  1 67  ? 18.491  -44.313 95.817  1.00 20.79  ? 67   ASN A ND2 1 
ATOM   493   N  N   . VAL A  1 68  ? 15.417  -39.627 95.517  1.00 20.67  ? 68   VAL A N   1 
ATOM   494   C  CA  . VAL A  1 68  ? 15.259  -38.393 94.745  1.00 21.82  ? 68   VAL A CA  1 
ATOM   495   C  C   . VAL A  1 68  ? 16.515  -38.142 93.879  1.00 33.24  ? 68   VAL A C   1 
ATOM   496   O  O   . VAL A  1 68  ? 17.648  -38.349 94.323  1.00 17.58  ? 68   VAL A O   1 
ATOM   497   C  CB  . VAL A  1 68  ? 15.055  -37.198 95.698  1.00 16.54  ? 68   VAL A CB  1 
ATOM   498   C  CG1 . VAL A  1 68  ? 14.940  -35.911 94.946  1.00 15.93  ? 68   VAL A CG1 1 
ATOM   499   C  CG2 . VAL A  1 68  ? 13.835  -37.417 96.572  1.00 43.64  ? 68   VAL A CG2 1 
ATOM   500   N  N   . CYS A  1 69  ? 16.297  -37.714 92.636  1.00 30.66  ? 69   CYS A N   1 
ATOM   501   C  CA  . CYS A  1 69  ? 17.379  -37.514 91.678  1.00 20.46  ? 69   CYS A CA  1 
ATOM   502   C  C   . CYS A  1 69  ? 18.256  -36.372 92.124  1.00 24.51  ? 69   CYS A C   1 
ATOM   503   O  O   . CYS A  1 69  ? 17.757  -35.375 92.649  1.00 16.44  ? 69   CYS A O   1 
ATOM   504   C  CB  . CYS A  1 69  ? 16.822  -37.254 90.266  1.00 17.68  ? 69   CYS A CB  1 
ATOM   505   S  SG  . CYS A  1 69  ? 16.309  -38.759 89.395  1.00 55.36  ? 69   CYS A SG  1 
ATOM   506   N  N   . TYR A  1 70  ? 19.563  -36.526 91.908  1.00 26.88  ? 70   TYR A N   1 
ATOM   507   C  CA  . TYR A  1 70  ? 20.547  -35.600 92.438  1.00 21.05  ? 70   TYR A CA  1 
ATOM   508   C  C   . TYR A  1 70  ? 20.231  -34.232 91.907  1.00 19.27  ? 70   TYR A C   1 
ATOM   509   O  O   . TYR A  1 70  ? 19.931  -34.087 90.724  1.00 19.22  ? 70   TYR A O   1 
ATOM   510   C  CB  . TYR A  1 70  ? 21.924  -36.004 91.983  1.00 35.11  ? 70   TYR A CB  1 
ATOM   511   C  CG  . TYR A  1 70  ? 22.942  -35.874 93.064  1.00 38.14  ? 70   TYR A CG  1 
ATOM   512   C  CD1 . TYR A  1 70  ? 23.273  -34.636 93.563  1.00 44.71  ? 70   TYR A CD1 1 
ATOM   513   C  CD2 . TYR A  1 70  ? 23.571  -36.992 93.588  1.00 36.77  ? 70   TYR A CD2 1 
ATOM   514   C  CE1 . TYR A  1 70  ? 24.204  -34.502 94.555  1.00 51.47  ? 70   TYR A CE1 1 
ATOM   515   C  CE2 . TYR A  1 70  ? 24.495  -36.878 94.582  1.00 43.88  ? 70   TYR A CE2 1 
ATOM   516   C  CZ  . TYR A  1 70  ? 24.817  -35.624 95.067  1.00 56.79  ? 70   TYR A CZ  1 
ATOM   517   O  OH  . TYR A  1 70  ? 25.760  -35.480 96.066  1.00 67.69  ? 70   TYR A OH  1 
ATOM   518   N  N   . GLN A  1 71  ? 20.272  -33.231 92.780  1.00 19.94  ? 71   GLN A N   1 
ATOM   519   C  CA  . GLN A  1 71  ? 19.678  -31.936 92.459  1.00 24.97  ? 71   GLN A CA  1 
ATOM   520   C  C   . GLN A  1 71  ? 20.058  -30.848 93.462  1.00 27.96  ? 71   GLN A C   1 
ATOM   521   O  O   . GLN A  1 71  ? 20.416  -31.142 94.606  1.00 20.03  ? 71   GLN A O   1 
ATOM   522   C  CB  . GLN A  1 71  ? 18.141  -32.062 92.382  1.00 16.23  ? 71   GLN A CB  1 
ATOM   523   C  CG  . GLN A  1 71  ? 17.466  -32.292 93.718  1.00 16.35  ? 71   GLN A CG  1 
ATOM   524   C  CD  . GLN A  1 71  ? 15.966  -32.375 93.617  1.00 26.62  ? 71   GLN A CD  1 
ATOM   525   O  OE1 . GLN A  1 71  ? 15.240  -31.554 94.179  1.00 34.38  ? 71   GLN A OE1 1 
ATOM   526   N  NE2 . GLN A  1 71  ? 15.485  -33.382 92.917  1.00 17.94  ? 71   GLN A NE2 1 
ATOM   527   N  N   . TYR A  1 72  ? 19.970  -29.594 93.020  1.00 29.08  ? 72   TYR A N   1 
ATOM   528   C  CA  . TYR A  1 72  ? 20.141  -28.429 93.889  1.00 28.75  ? 72   TYR A CA  1 
ATOM   529   C  C   . TYR A  1 72  ? 19.079  -28.394 94.988  1.00 38.39  ? 72   TYR A C   1 
ATOM   530   O  O   . TYR A  1 72  ? 17.905  -28.688 94.738  1.00 44.66  ? 72   TYR A O   1 
ATOM   531   C  CB  . TYR A  1 72  ? 20.098  -27.140 93.047  1.00 26.49  ? 72   TYR A CB  1 
ATOM   532   C  CG  . TYR A  1 72  ? 20.090  -25.850 93.848  1.00 31.52  ? 72   TYR A CG  1 
ATOM   533   C  CD1 . TYR A  1 72  ? 21.277  -25.274 94.311  1.00 30.07  ? 72   TYR A CD1 1 
ATOM   534   C  CD2 . TYR A  1 72  ? 18.891  -25.202 94.130  1.00 36.49  ? 72   TYR A CD2 1 
ATOM   535   C  CE1 . TYR A  1 72  ? 21.261  -24.095 95.046  1.00 34.65  ? 72   TYR A CE1 1 
ATOM   536   C  CE2 . TYR A  1 72  ? 18.860  -24.035 94.862  1.00 41.33  ? 72   TYR A CE2 1 
ATOM   537   C  CZ  . TYR A  1 72  ? 20.042  -23.481 95.322  1.00 46.26  ? 72   TYR A CZ  1 
ATOM   538   O  OH  . TYR A  1 72  ? 19.977  -22.309 96.059  1.00 53.55  ? 72   TYR A OH  1 
ATOM   539   N  N   . VAL A  1 73  ? 19.485  -28.029 96.201  1.00 32.53  ? 73   VAL A N   1 
ATOM   540   C  CA  . VAL A  1 73  ? 18.525  -27.886 97.291  1.00 29.71  ? 73   VAL A CA  1 
ATOM   541   C  C   . VAL A  1 73  ? 18.324  -26.442 97.770  1.00 38.19  ? 73   VAL A C   1 
ATOM   542   O  O   . VAL A  1 73  ? 19.291  -25.711 98.054  1.00 38.16  ? 73   VAL A O   1 
ATOM   543   C  CB  . VAL A  1 73  ? 18.871  -28.784 98.473  1.00 25.10  ? 73   VAL A CB  1 
ATOM   544   C  CG1 . VAL A  1 73  ? 18.011  -28.434 99.654  1.00 19.99  ? 73   VAL A CG1 1 
ATOM   545   C  CG2 . VAL A  1 73  ? 18.681  -30.230 98.093  1.00 19.25  ? 73   VAL A CG2 1 
ATOM   546   N  N   . ASP A  1 74  ? 17.047  -26.065 97.871  1.00 38.46  ? 74   ASP A N   1 
ATOM   547   C  CA  . ASP A  1 74  ? 16.619  -24.710 98.201  1.00 42.13  ? 74   ASP A CA  1 
ATOM   548   C  C   . ASP A  1 74  ? 16.879  -24.254 99.652  1.00 40.86  ? 74   ASP A C   1 
ATOM   549   O  O   . ASP A  1 74  ? 16.483  -24.889 100.620 1.00 34.68  ? 74   ASP A O   1 
ATOM   550   C  CB  . ASP A  1 74  ? 15.146  -24.562 97.850  1.00 51.39  ? 74   ASP A CB  1 
ATOM   551   C  CG  . ASP A  1 74  ? 14.688  -23.134 97.885  1.00 60.21  ? 74   ASP A CG  1 
ATOM   552   O  OD1 . ASP A  1 74  ? 15.541  -22.226 97.999  1.00 55.75  ? 74   ASP A OD1 1 
ATOM   553   O  OD2 . ASP A  1 74  ? 13.464  -22.923 97.780  1.00 71.67  ? 74   ASP A OD2 1 
ATOM   554   N  N   . THR A  1 75  ? 17.531  -23.108 99.778  1.00 53.68  ? 75   THR A N   1 
ATOM   555   C  CA  . THR A  1 75  ? 18.080  -22.652 101.052 1.00 48.76  ? 75   THR A CA  1 
ATOM   556   C  C   . THR A  1 75  ? 17.673  -21.212 101.379 1.00 44.52  ? 75   THR A C   1 
ATOM   557   O  O   . THR A  1 75  ? 18.092  -20.654 102.391 1.00 42.16  ? 75   THR A O   1 
ATOM   558   C  CB  . THR A  1 75  ? 19.603  -22.739 101.004 1.00 41.32  ? 75   THR A CB  1 
ATOM   559   O  OG1 . THR A  1 75  ? 20.060  -22.209 99.747  1.00 45.13  ? 75   THR A OG1 1 
ATOM   560   C  CG2 . THR A  1 75  ? 20.034  -24.191 101.116 1.00 31.92  ? 75   THR A CG2 1 
ATOM   561   N  N   . LEU A  1 76  ? 16.850  -20.629 100.513 1.00 43.55  ? 76   LEU A N   1 
ATOM   562   C  CA  . LEU A  1 76  ? 16.369  -19.266 100.665 1.00 47.65  ? 76   LEU A CA  1 
ATOM   563   C  C   . LEU A  1 76  ? 15.812  -18.976 102.061 1.00 56.66  ? 76   LEU A C   1 
ATOM   564   O  O   . LEU A  1 76  ? 16.349  -18.149 102.807 1.00 63.90  ? 76   LEU A O   1 
ATOM   565   C  CB  . LEU A  1 76  ? 15.279  -19.010 99.636  1.00 45.15  ? 76   LEU A CB  1 
ATOM   566   C  CG  . LEU A  1 76  ? 14.662  -17.617 99.712  1.00 50.56  ? 76   LEU A CG  1 
ATOM   567   C  CD1 . LEU A  1 76  ? 15.720  -16.556 99.466  1.00 49.55  ? 76   LEU A CD1 1 
ATOM   568   C  CD2 . LEU A  1 76  ? 13.523  -17.497 98.718  1.00 53.61  ? 76   LEU A CD2 1 
ATOM   569   N  N   . TYR A  1 77  ? 14.727  -19.660 102.400 1.00 47.36  ? 77   TYR A N   1 
ATOM   570   C  CA  . TYR A  1 77  ? 14.103  -19.507 103.698 1.00 38.64  ? 77   TYR A CA  1 
ATOM   571   C  C   . TYR A  1 77  ? 14.124  -20.848 104.420 1.00 39.95  ? 77   TYR A C   1 
ATOM   572   O  O   . TYR A  1 77  ? 13.131  -21.568 104.408 1.00 44.26  ? 77   TYR A O   1 
ATOM   573   C  CB  . TYR A  1 77  ? 12.653  -19.046 103.532 1.00 43.03  ? 77   TYR A CB  1 
ATOM   574   C  CG  . TYR A  1 77  ? 12.463  -17.666 102.924 1.00 44.01  ? 77   TYR A CG  1 
ATOM   575   C  CD1 . TYR A  1 77  ? 13.002  -16.539 103.527 1.00 47.32  ? 77   TYR A CD1 1 
ATOM   576   C  CD2 . TYR A  1 77  ? 11.714  -17.492 101.767 1.00 41.03  ? 77   TYR A CD2 1 
ATOM   577   C  CE1 . TYR A  1 77  ? 12.819  -15.280 102.988 1.00 48.49  ? 77   TYR A CE1 1 
ATOM   578   C  CE2 . TYR A  1 77  ? 11.528  -16.237 101.219 1.00 40.83  ? 77   TYR A CE2 1 
ATOM   579   C  CZ  . TYR A  1 77  ? 12.081  -15.131 101.834 1.00 44.07  ? 77   TYR A CZ  1 
ATOM   580   O  OH  . TYR A  1 77  ? 11.898  -13.871 101.298 1.00 41.31  ? 77   TYR A OH  1 
ATOM   581   N  N   . PRO A  1 78  ? 15.262  -21.200 105.038 1.00 38.27  ? 78   PRO A N   1 
ATOM   582   C  CA  . PRO A  1 78  ? 15.427  -22.495 105.717 1.00 33.68  ? 78   PRO A CA  1 
ATOM   583   C  C   . PRO A  1 78  ? 14.572  -22.673 106.984 1.00 33.58  ? 78   PRO A C   1 
ATOM   584   O  O   . PRO A  1 78  ? 14.507  -21.791 107.844 1.00 31.23  ? 78   PRO A O   1 
ATOM   585   C  CB  . PRO A  1 78  ? 16.913  -22.503 106.075 1.00 32.66  ? 78   PRO A CB  1 
ATOM   586   C  CG  . PRO A  1 78  ? 17.290  -21.066 106.142 1.00 32.36  ? 78   PRO A CG  1 
ATOM   587   C  CD  . PRO A  1 78  ? 16.503  -20.410 105.064 1.00 36.15  ? 78   PRO A CD  1 
ATOM   588   N  N   . GLY A  1 79  ? 13.930  -23.830 107.098 1.00 34.27  ? 79   GLY A N   1 
ATOM   589   C  CA  . GLY A  1 79  ? 13.024  -24.090 108.200 1.00 39.79  ? 79   GLY A CA  1 
ATOM   590   C  C   . GLY A  1 79  ? 11.590  -23.788 107.808 1.00 43.76  ? 79   GLY A C   1 
ATOM   591   O  O   . GLY A  1 79  ? 10.639  -24.358 108.346 1.00 52.21  ? 79   GLY A O   1 
ATOM   592   N  N   . PHE A  1 80  ? 11.445  -22.891 106.842 1.00 37.86  ? 80   PHE A N   1 
ATOM   593   C  CA  . PHE A  1 80  ? 10.151  -22.392 106.403 1.00 31.97  ? 80   PHE A CA  1 
ATOM   594   C  C   . PHE A  1 80  ? 9.456   -23.400 105.496 1.00 34.85  ? 80   PHE A C   1 
ATOM   595   O  O   . PHE A  1 80  ? 9.995   -23.794 104.462 1.00 37.71  ? 80   PHE A O   1 
ATOM   596   C  CB  . PHE A  1 80  ? 10.370  -21.058 105.691 1.00 28.71  ? 80   PHE A CB  1 
ATOM   597   C  CG  . PHE A  1 80  ? 9.170   -20.524 104.985 1.00 32.01  ? 80   PHE A CG  1 
ATOM   598   C  CD1 . PHE A  1 80  ? 8.006   -20.230 105.681 1.00 35.97  ? 80   PHE A CD1 1 
ATOM   599   C  CD2 . PHE A  1 80  ? 9.222   -20.265 103.626 1.00 31.73  ? 80   PHE A CD2 1 
ATOM   600   C  CE1 . PHE A  1 80  ? 6.900   -19.721 105.031 1.00 35.55  ? 80   PHE A CE1 1 
ATOM   601   C  CE2 . PHE A  1 80  ? 8.128   -19.753 102.966 1.00 36.94  ? 80   PHE A CE2 1 
ATOM   602   C  CZ  . PHE A  1 80  ? 6.959   -19.481 103.673 1.00 41.13  ? 80   PHE A CZ  1 
ATOM   603   N  N   . GLU A  1 81  ? 8.257   -23.816 105.894 1.00 32.94  ? 81   GLU A N   1 
ATOM   604   C  CA  . GLU A  1 81  ? 7.522   -24.851 105.184 1.00 34.93  ? 81   GLU A CA  1 
ATOM   605   C  C   . GLU A  1 81  ? 7.345   -24.505 103.718 1.00 34.80  ? 81   GLU A C   1 
ATOM   606   O  O   . GLU A  1 81  ? 7.533   -25.353 102.848 1.00 36.69  ? 81   GLU A O   1 
ATOM   607   C  CB  . GLU A  1 81  ? 6.160   -25.071 105.841 1.00 55.40  ? 81   GLU A CB  1 
ATOM   608   C  CG  . GLU A  1 81  ? 5.776   -26.545 106.008 1.00 73.76  ? 81   GLU A CG  1 
ATOM   609   C  CD  . GLU A  1 81  ? 4.804   -27.031 104.942 1.00 86.10  ? 81   GLU A CD  1 
ATOM   610   O  OE1 . GLU A  1 81  ? 3.938   -26.222 104.519 1.00 89.12  ? 81   GLU A OE1 1 
ATOM   611   O  OE2 . GLU A  1 81  ? 4.906   -28.219 104.537 1.00 87.93  ? 81   GLU A OE2 1 
ATOM   612   N  N   . GLY A  1 82  ? 7.006   -23.248 103.452 1.00 45.05  ? 82   GLY A N   1 
ATOM   613   C  CA  . GLY A  1 82  ? 6.688   -22.781 102.110 1.00 46.10  ? 82   GLY A CA  1 
ATOM   614   C  C   . GLY A  1 82  ? 7.736   -23.023 101.035 1.00 39.32  ? 82   GLY A C   1 
ATOM   615   O  O   . GLY A  1 82  ? 7.394   -23.136 99.859  1.00 43.39  ? 82   GLY A O   1 
ATOM   616   N  N   . THR A  1 83  ? 9.007   -23.090 101.416 1.00 27.11  ? 83   THR A N   1 
ATOM   617   C  CA  . THR A  1 83  ? 10.030  -23.521 100.469 1.00 22.41  ? 83   THR A CA  1 
ATOM   618   C  C   . THR A  1 83  ? 10.334  -25.016 100.639 1.00 29.15  ? 83   THR A C   1 
ATOM   619   O  O   . THR A  1 83  ? 10.475  -25.759 99.666  1.00 37.34  ? 83   THR A O   1 
ATOM   620   C  CB  . THR A  1 83  ? 11.346  -22.673 100.550 1.00 44.41  ? 83   THR A CB  1 
ATOM   621   O  OG1 . THR A  1 83  ? 11.983  -22.827 101.827 1.00 20.38  ? 83   THR A OG1 1 
ATOM   622   C  CG2 . THR A  1 83  ? 11.062  -21.217 100.303 1.00 46.43  ? 83   THR A CG2 1 
ATOM   623   N  N   . GLU A  1 84  ? 10.424  -25.461 101.883 1.00 28.20  ? 84   GLU A N   1 
ATOM   624   C  CA  . GLU A  1 84  ? 10.914  -26.804 102.151 1.00 27.23  ? 84   GLU A CA  1 
ATOM   625   C  C   . GLU A  1 84  ? 10.019  -27.918 101.633 1.00 27.77  ? 84   GLU A C   1 
ATOM   626   O  O   . GLU A  1 84  ? 10.489  -29.027 101.400 1.00 29.35  ? 84   GLU A O   1 
ATOM   627   C  CB  . GLU A  1 84  ? 11.199  -26.990 103.638 1.00 20.65  ? 84   GLU A CB  1 
ATOM   628   C  CG  . GLU A  1 84  ? 12.654  -27.302 103.894 1.00 54.54  ? 84   GLU A CG  1 
ATOM   629   C  CD  . GLU A  1 84  ? 13.288  -26.319 104.846 1.00 56.76  ? 84   GLU A CD  1 
ATOM   630   O  OE1 . GLU A  1 84  ? 12.737  -26.152 105.954 1.00 56.84  ? 84   GLU A OE1 1 
ATOM   631   O  OE2 . GLU A  1 84  ? 14.327  -25.711 104.489 1.00 62.37  ? 84   GLU A OE2 1 
ATOM   632   N  N   . MET A  1 85  ? 8.732   -27.622 101.455 1.00 32.37  ? 85   MET A N   1 
ATOM   633   C  CA  . MET A  1 85  ? 7.780   -28.611 100.956 1.00 26.81  ? 85   MET A CA  1 
ATOM   634   C  C   . MET A  1 85  ? 8.227   -29.170 99.602  1.00 26.95  ? 85   MET A C   1 
ATOM   635   O  O   . MET A  1 85  ? 8.047   -30.351 99.316  1.00 29.98  ? 85   MET A O   1 
ATOM   636   C  CB  . MET A  1 85  ? 6.380   -28.008 100.861 1.00 19.03  ? 85   MET A CB  1 
ATOM   637   C  CG  . MET A  1 85  ? 6.274   -26.783 99.974  1.00 21.68  ? 85   MET A CG  1 
ATOM   638   S  SD  . MET A  1 85  ? 4.589   -26.132 99.843  1.00 47.83  ? 85   MET A SD  1 
ATOM   639   C  CE  . MET A  1 85  ? 3.696   -27.630 99.461  1.00 40.04  ? 85   MET A CE  1 
ATOM   640   N  N   . TRP A  1 86  ? 8.848   -28.312 98.799  1.00 24.22  ? 86   TRP A N   1 
ATOM   641   C  CA  . TRP A  1 86  ? 9.346   -28.676 97.480  1.00 23.02  ? 86   TRP A CA  1 
ATOM   642   C  C   . TRP A  1 86  ? 10.715  -29.364 97.524  1.00 31.09  ? 86   TRP A C   1 
ATOM   643   O  O   . TRP A  1 86  ? 11.115  -30.020 96.559  1.00 42.79  ? 86   TRP A O   1 
ATOM   644   C  CB  . TRP A  1 86  ? 9.421   -27.432 96.600  1.00 20.73  ? 86   TRP A CB  1 
ATOM   645   C  CG  . TRP A  1 86  ? 8.185   -26.609 96.667  1.00 26.34  ? 86   TRP A CG  1 
ATOM   646   C  CD1 . TRP A  1 86  ? 8.041   -25.391 97.262  1.00 30.34  ? 86   TRP A CD1 1 
ATOM   647   C  CD2 . TRP A  1 86  ? 6.909   -26.947 96.130  1.00 15.00  ? 86   TRP A CD2 1 
ATOM   648   N  NE1 . TRP A  1 86  ? 6.749   -24.951 97.125  1.00 29.48  ? 86   TRP A NE1 1 
ATOM   649   C  CE2 . TRP A  1 86  ? 6.035   -25.891 96.433  1.00 29.06  ? 86   TRP A CE2 1 
ATOM   650   C  CE3 . TRP A  1 86  ? 6.422   -28.036 95.416  1.00 23.19  ? 86   TRP A CE3 1 
ATOM   651   C  CZ2 . TRP A  1 86  ? 4.697   -25.898 96.054  1.00 29.85  ? 86   TRP A CZ2 1 
ATOM   652   C  CZ3 . TRP A  1 86  ? 5.085   -28.040 95.045  1.00 31.36  ? 86   TRP A CZ3 1 
ATOM   653   C  CH2 . TRP A  1 86  ? 4.242   -26.978 95.360  1.00 24.67  ? 86   TRP A CH2 1 
ATOM   654   N  N   . ASN A  1 87  ? 11.428  -29.227 98.638  1.00 24.73  ? 87   ASN A N   1 
ATOM   655   C  CA  . ASN A  1 87  ? 12.738  -29.868 98.786  1.00 31.02  ? 87   ASN A CA  1 
ATOM   656   C  C   . ASN A  1 87  ? 12.711  -31.404 98.822  1.00 31.55  ? 87   ASN A C   1 
ATOM   657   O  O   . ASN A  1 87  ? 11.689  -31.999 99.159  1.00 28.83  ? 87   ASN A O   1 
ATOM   658   C  CB  . ASN A  1 87  ? 13.456  -29.327 100.023 1.00 35.91  ? 87   ASN A CB  1 
ATOM   659   C  CG  . ASN A  1 87  ? 14.321  -28.132 99.715  1.00 34.87  ? 87   ASN A CG  1 
ATOM   660   O  OD1 . ASN A  1 87  ? 14.514  -27.758 98.555  1.00 38.36  ? 87   ASN A OD1 1 
ATOM   661   N  ND2 . ASN A  1 87  ? 14.857  -27.527 100.760 1.00 35.16  ? 87   ASN A ND2 1 
ATOM   662   N  N   . PRO A  1 88  ? 13.851  -32.050 98.488  1.00 34.29  ? 88   PRO A N   1 
ATOM   663   C  CA  . PRO A  1 88  ? 13.920  -33.515 98.426  1.00 31.83  ? 88   PRO A CA  1 
ATOM   664   C  C   . PRO A  1 88  ? 13.620  -34.135 99.773  1.00 34.58  ? 88   PRO A C   1 
ATOM   665   O  O   . PRO A  1 88  ? 14.084  -33.617 100.782 1.00 38.22  ? 88   PRO A O   1 
ATOM   666   C  CB  . PRO A  1 88  ? 15.381  -33.780 98.071  1.00 17.99  ? 88   PRO A CB  1 
ATOM   667   C  CG  . PRO A  1 88  ? 15.826  -32.558 97.415  1.00 24.05  ? 88   PRO A CG  1 
ATOM   668   C  CD  . PRO A  1 88  ? 15.147  -31.448 98.137  1.00 28.45  ? 88   PRO A CD  1 
ATOM   669   N  N   . ASN A  1 89  ? 12.861  -35.223 99.787  1.00 29.43  ? 89   ASN A N   1 
ATOM   670   C  CA  . ASN A  1 89  ? 12.477  -35.829 101.045 1.00 30.60  ? 89   ASN A CA  1 
ATOM   671   C  C   . ASN A  1 89  ? 12.989  -37.251 101.197 1.00 29.38  ? 89   ASN A C   1 
ATOM   672   O  O   . ASN A  1 89  ? 12.703  -37.908 102.194 1.00 30.00  ? 89   ASN A O   1 
ATOM   673   C  CB  . ASN A  1 89  ? 10.961  -35.725 101.281 1.00 37.70  ? 89   ASN A CB  1 
ATOM   674   C  CG  . ASN A  1 89  ? 10.141  -36.655 100.389 1.00 37.04  ? 89   ASN A CG  1 
ATOM   675   O  OD1 . ASN A  1 89  ? 10.590  -37.120 99.334  1.00 27.58  ? 89   ASN A OD1 1 
ATOM   676   N  ND2 . ASN A  1 89  ? 8.908   -36.909 100.815 1.00 42.69  ? 89   ASN A ND2 1 
ATOM   677   N  N   . ARG A  1 90  ? 13.740  -37.719 100.203 1.00 18.63  ? 90   ARG A N   1 
ATOM   678   C  CA  . ARG A  1 90  ? 14.581  -38.906 100.375 1.00 26.24  ? 90   ARG A CA  1 
ATOM   679   C  C   . ARG A  1 90  ? 16.037  -38.608 99.966  1.00 24.75  ? 90   ARG A C   1 
ATOM   680   O  O   . ARG A  1 90  ? 16.352  -37.486 99.589  1.00 25.81  ? 90   ARG A O   1 
ATOM   681   C  CB  . ARG A  1 90  ? 14.028  -40.085 99.600  1.00 18.86  ? 90   ARG A CB  1 
ATOM   682   C  CG  . ARG A  1 90  ? 12.630  -40.452 99.974  1.00 26.86  ? 90   ARG A CG  1 
ATOM   683   C  CD  . ARG A  1 90  ? 12.528  -41.053 101.357 1.00 35.79  ? 90   ARG A CD  1 
ATOM   684   N  NE  . ARG A  1 90  ? 11.191  -41.615 101.578 1.00 48.69  ? 90   ARG A NE  1 
ATOM   685   C  CZ  . ARG A  1 90  ? 10.186  -40.984 102.187 1.00 50.99  ? 90   ARG A CZ  1 
ATOM   686   N  NH1 . ARG A  1 90  ? 10.348  -39.756 102.675 1.00 53.36  ? 90   ARG A NH1 1 
ATOM   687   N  NH2 . ARG A  1 90  ? 9.013   -41.589 102.316 1.00 47.18  ? 90   ARG A NH2 1 
ATOM   688   N  N   . GLU A  1 91  ? 16.927  -39.590 100.047 1.00 25.25  ? 91   GLU A N   1 
ATOM   689   C  CA  . GLU A  1 91  ? 18.335  -39.328 99.741  1.00 36.54  ? 91   GLU A CA  1 
ATOM   690   C  C   . GLU A  1 91  ? 18.616  -38.977 98.268  1.00 32.90  ? 91   GLU A C   1 
ATOM   691   O  O   . GLU A  1 91  ? 17.874  -39.382 97.358  1.00 25.72  ? 91   GLU A O   1 
ATOM   692   C  CB  . GLU A  1 91  ? 19.203  -40.511 100.156 1.00 51.94  ? 91   GLU A CB  1 
ATOM   693   C  CG  . GLU A  1 91  ? 19.269  -40.750 101.646 1.00 73.15  ? 91   GLU A CG  1 
ATOM   694   C  CD  . GLU A  1 91  ? 20.015  -42.033 101.985 1.00 92.69  ? 91   GLU A CD  1 
ATOM   695   O  OE1 . GLU A  1 91  ? 20.167  -42.890 101.081 1.00 94.09  ? 91   GLU A OE1 1 
ATOM   696   O  OE2 . GLU A  1 91  ? 20.446  -42.186 103.152 1.00 100.97 ? 91   GLU A OE2 1 
ATOM   697   N  N   . LEU A  1 92  ? 19.698  -38.225 98.043  1.00 34.09  ? 92   LEU A N   1 
ATOM   698   C  CA  . LEU A  1 92  ? 20.150  -37.917 96.685  1.00 38.58  ? 92   LEU A CA  1 
ATOM   699   C  C   . LEU A  1 92  ? 21.032  -39.016 96.115  1.00 20.92  ? 92   LEU A C   1 
ATOM   700   O  O   . LEU A  1 92  ? 21.799  -39.646 96.833  1.00 58.02  ? 92   LEU A O   1 
ATOM   701   C  CB  . LEU A  1 92  ? 20.875  -36.578 96.622  1.00 20.47  ? 92   LEU A CB  1 
ATOM   702   C  CG  . LEU A  1 92  ? 20.099  -35.320 97.014  1.00 28.37  ? 92   LEU A CG  1 
ATOM   703   C  CD1 . LEU A  1 92  ? 20.858  -34.117 96.524  1.00 20.02  ? 92   LEU A CD1 1 
ATOM   704   C  CD2 . LEU A  1 92  ? 18.681  -35.306 96.448  1.00 27.13  ? 92   LEU A CD2 1 
ATOM   705   N  N   . SER A  1 93  ? 20.904  -39.230 94.812  1.00 23.05  ? 93   SER A N   1 
ATOM   706   C  CA  . SER A  1 93  ? 21.579  -40.307 94.095  1.00 20.85  ? 93   SER A CA  1 
ATOM   707   C  C   . SER A  1 93  ? 21.309  -40.186 92.602  1.00 29.06  ? 93   SER A C   1 
ATOM   708   O  O   . SER A  1 93  ? 20.214  -39.792 92.195  1.00 30.47  ? 93   SER A O   1 
ATOM   709   C  CB  . SER A  1 93  ? 21.123  -41.688 94.593  1.00 35.49  ? 93   SER A CB  1 
ATOM   710   O  OG  . SER A  1 93  ? 21.655  -42.743 93.807  1.00 21.72  ? 93   SER A OG  1 
ATOM   711   N  N   . GLU A  1 94  ? 22.309  -40.518 91.790  1.00 28.53  ? 94   GLU A N   1 
ATOM   712   C  CA  . GLU A  1 94  ? 22.127  -40.552 90.348  1.00 25.59  ? 94   GLU A CA  1 
ATOM   713   C  C   . GLU A  1 94  ? 21.395  -41.832 89.998  1.00 25.68  ? 94   GLU A C   1 
ATOM   714   O  O   . GLU A  1 94  ? 20.899  -41.984 88.889  1.00 28.21  ? 94   GLU A O   1 
ATOM   715   C  CB  . GLU A  1 94  ? 23.463  -40.468 89.602  1.00 27.86  ? 94   GLU A CB  1 
ATOM   716   C  CG  . GLU A  1 94  ? 24.287  -39.210 89.876  1.00 31.54  ? 94   GLU A CG  1 
ATOM   717   C  CD  . GLU A  1 94  ? 25.602  -39.180 89.087  1.00 37.47  ? 94   GLU A CD  1 
ATOM   718   O  OE1 . GLU A  1 94  ? 26.585  -39.839 89.513  1.00 35.63  ? 94   GLU A OE1 1 
ATOM   719   O  OE2 . GLU A  1 94  ? 25.650  -38.494 88.041  1.00 39.21  ? 94   GLU A OE2 1 
ATOM   720   N  N   . ASP A  1 95  ? 21.341  -42.758 90.951  1.00 25.56  ? 95   ASP A N   1 
ATOM   721   C  CA  . ASP A  1 95  ? 20.487  -43.938 90.818  1.00 29.96  ? 95   ASP A CA  1 
ATOM   722   C  C   . ASP A  1 95  ? 19.100  -43.553 91.295  1.00 31.41  ? 95   ASP A C   1 
ATOM   723   O  O   . ASP A  1 95  ? 18.786  -43.666 92.478  1.00 37.63  ? 95   ASP A O   1 
ATOM   724   C  CB  . ASP A  1 95  ? 21.002  -45.094 91.671  1.00 31.84  ? 95   ASP A CB  1 
ATOM   725   C  CG  . ASP A  1 95  ? 20.215  -46.364 91.463  1.00 32.96  ? 95   ASP A CG  1 
ATOM   726   O  OD1 . ASP A  1 95  ? 19.153  -46.298 90.822  1.00 28.13  ? 95   ASP A OD1 1 
ATOM   727   O  OD2 . ASP A  1 95  ? 20.658  -47.433 91.931  1.00 44.89  ? 95   ASP A OD2 1 
ATOM   728   N  N   . CYS A  1 96  ? 18.252  -43.115 90.383  1.00 21.98  ? 96   CYS A N   1 
ATOM   729   C  CA  . CYS A  1 96  ? 17.079  -42.440 90.847  1.00 27.86  ? 96   CYS A CA  1 
ATOM   730   C  C   . CYS A  1 96  ? 15.861  -42.638 89.965  1.00 32.44  ? 96   CYS A C   1 
ATOM   731   O  O   . CYS A  1 96  ? 14.792  -42.124 90.280  1.00 30.35  ? 96   CYS A O   1 
ATOM   732   C  CB  . CYS A  1 96  ? 17.412  -40.961 90.996  1.00 35.06  ? 96   CYS A CB  1 
ATOM   733   S  SG  . CYS A  1 96  ? 17.847  -40.129 89.464  1.00 24.33  ? 96   CYS A SG  1 
ATOM   734   N  N   . LEU A  1 97  ? 16.034  -43.373 88.866  1.00 38.03  ? 97   LEU A N   1 
ATOM   735   C  CA  . LEU A  1 97  ? 14.954  -43.625 87.918  1.00 16.36  ? 97   LEU A CA  1 
ATOM   736   C  C   . LEU A  1 97  ? 14.117  -44.769 88.403  1.00 16.49  ? 97   LEU A C   1 
ATOM   737   O  O   . LEU A  1 97  ? 14.283  -45.920 87.977  1.00 17.08  ? 97   LEU A O   1 
ATOM   738   C  CB  . LEU A  1 97  ? 15.479  -43.931 86.521  1.00 16.71  ? 97   LEU A CB  1 
ATOM   739   C  CG  . LEU A  1 97  ? 16.320  -42.807 85.915  1.00 18.15  ? 97   LEU A CG  1 
ATOM   740   C  CD1 . LEU A  1 97  ? 16.957  -43.238 84.613  1.00 17.30  ? 97   LEU A CD1 1 
ATOM   741   C  CD2 . LEU A  1 97  ? 15.460  -41.575 85.707  1.00 15.77  ? 97   LEU A CD2 1 
ATOM   742   N  N   . TYR A  1 98  ? 13.209  -44.417 89.308  1.00 30.13  ? 98   TYR A N   1 
ATOM   743   C  CA  . TYR A  1 98  ? 12.180  -45.304 89.820  1.00 23.91  ? 98   TYR A CA  1 
ATOM   744   C  C   . TYR A  1 98  ? 10.844  -44.608 89.634  1.00 20.33  ? 98   TYR A C   1 
ATOM   745   O  O   . TYR A  1 98  ? 10.810  -43.394 89.451  1.00 18.76  ? 98   TYR A O   1 
ATOM   746   C  CB  . TYR A  1 98  ? 12.455  -45.592 91.292  1.00 20.21  ? 98   TYR A CB  1 
ATOM   747   C  CG  . TYR A  1 98  ? 13.782  -46.275 91.473  1.00 28.54  ? 98   TYR A CG  1 
ATOM   748   C  CD1 . TYR A  1 98  ? 14.961  -45.531 91.604  1.00 28.45  ? 98   TYR A CD1 1 
ATOM   749   C  CD2 . TYR A  1 98  ? 13.875  -47.663 91.466  1.00 31.27  ? 98   TYR A CD2 1 
ATOM   750   C  CE1 . TYR A  1 98  ? 16.203  -46.150 91.749  1.00 21.93  ? 98   TYR A CE1 1 
ATOM   751   C  CE2 . TYR A  1 98  ? 15.108  -48.296 91.606  1.00 38.32  ? 98   TYR A CE2 1 
ATOM   752   C  CZ  . TYR A  1 98  ? 16.280  -47.532 91.749  1.00 31.04  ? 98   TYR A CZ  1 
ATOM   753   O  OH  . TYR A  1 98  ? 17.513  -48.162 91.887  1.00 32.53  ? 98   TYR A OH  1 
ATOM   754   N  N   . LEU A  1 99  ? 9.756   -45.376 89.654  1.00 24.10  ? 99   LEU A N   1 
ATOM   755   C  CA  . LEU A  1 99  ? 8.397   -44.821 89.593  1.00 22.24  ? 99   LEU A CA  1 
ATOM   756   C  C   . LEU A  1 99  ? 7.473   -45.462 90.618  1.00 23.15  ? 99   LEU A C   1 
ATOM   757   O  O   . LEU A  1 99  ? 7.843   -46.439 91.298  1.00 23.63  ? 99   LEU A O   1 
ATOM   758   C  CB  . LEU A  1 99  ? 7.790   -44.958 88.198  1.00 14.72  ? 99   LEU A CB  1 
ATOM   759   C  CG  . LEU A  1 99  ? 7.611   -46.352 87.588  1.00 18.74  ? 99   LEU A CG  1 
ATOM   760   C  CD1 . LEU A  1 99  ? 6.272   -46.950 87.947  1.00 20.77  ? 99   LEU A CD1 1 
ATOM   761   C  CD2 . LEU A  1 99  ? 7.781   -46.324 86.071  1.00 15.32  ? 99   LEU A CD2 1 
ATOM   762   N  N   . ASN A  1 100 ? 6.275   -44.886 90.724  1.00 19.70  ? 100  ASN A N   1 
ATOM   763   C  CA  . ASN A  1 100 ? 5.267   -45.296 91.698  1.00 20.59  ? 100  ASN A CA  1 
ATOM   764   C  C   . ASN A  1 100 ? 3.881   -45.415 91.108  1.00 17.04  ? 100  ASN A C   1 
ATOM   765   O  O   . ASN A  1 100 ? 3.489   -44.620 90.242  1.00 15.21  ? 100  ASN A O   1 
ATOM   766   C  CB  . ASN A  1 100 ? 5.155   -44.286 92.824  1.00 22.56  ? 100  ASN A CB  1 
ATOM   767   C  CG  . ASN A  1 100 ? 6.466   -43.706 93.211  1.00 26.62  ? 100  ASN A CG  1 
ATOM   768   O  OD1 . ASN A  1 100 ? 7.302   -44.372 93.809  1.00 32.65  ? 100  ASN A OD1 1 
ATOM   769   N  ND2 . ASN A  1 100 ? 6.657   -42.451 92.890  1.00 14.51  ? 100  ASN A ND2 1 
ATOM   770   N  N   . VAL A  1 101 ? 3.136   -46.389 91.618  1.00 15.66  ? 101  VAL A N   1 
ATOM   771   C  CA  . VAL A  1 101 ? 1.739   -46.578 91.242  1.00 18.22  ? 101  VAL A CA  1 
ATOM   772   C  C   . VAL A  1 101 ? 0.848   -46.686 92.475  1.00 19.25  ? 101  VAL A C   1 
ATOM   773   O  O   . VAL A  1 101 ? 1.092   -47.502 93.361  1.00 22.74  ? 101  VAL A O   1 
ATOM   774   C  CB  . VAL A  1 101 ? 1.563   -47.872 90.455  1.00 16.31  ? 101  VAL A CB  1 
ATOM   775   C  CG1 . VAL A  1 101 ? 0.185   -47.941 89.902  1.00 16.55  ? 101  VAL A CG1 1 
ATOM   776   C  CG2 . VAL A  1 101 ? 2.595   -47.974 89.349  1.00 16.09  ? 101  VAL A CG2 1 
ATOM   777   N  N   . TRP A  1 102 ? -0.176  -45.853 92.542  1.00 16.24  ? 102  TRP A N   1 
ATOM   778   C  CA  . TRP A  1 102 ? -1.245  -46.053 93.510  1.00 16.88  ? 102  TRP A CA  1 
ATOM   779   C  C   . TRP A  1 102 ? -2.441  -46.625 92.771  1.00 20.88  ? 102  TRP A C   1 
ATOM   780   O  O   . TRP A  1 102 ? -2.738  -46.188 91.663  1.00 23.94  ? 102  TRP A O   1 
ATOM   781   C  CB  . TRP A  1 102 ? -1.638  -44.723 94.144  1.00 16.74  ? 102  TRP A CB  1 
ATOM   782   C  CG  . TRP A  1 102 ? -0.637  -44.200 95.113  1.00 26.56  ? 102  TRP A CG  1 
ATOM   783   C  CD1 . TRP A  1 102 ? -0.589  -44.448 96.451  1.00 30.87  ? 102  TRP A CD1 1 
ATOM   784   C  CD2 . TRP A  1 102 ? 0.451   -43.324 94.831  1.00 21.39  ? 102  TRP A CD2 1 
ATOM   785   N  NE1 . TRP A  1 102 ? 0.473   -43.790 97.017  1.00 25.17  ? 102  TRP A NE1 1 
ATOM   786   C  CE2 . TRP A  1 102 ? 1.127   -43.091 96.041  1.00 18.41  ? 102  TRP A CE2 1 
ATOM   787   C  CE3 . TRP A  1 102 ? 0.929   -42.722 93.669  1.00 31.20  ? 102  TRP A CE3 1 
ATOM   788   C  CZ2 . TRP A  1 102 ? 2.258   -42.282 96.126  1.00 22.74  ? 102  TRP A CZ2 1 
ATOM   789   C  CZ3 . TRP A  1 102 ? 2.072   -41.912 93.757  1.00 36.10  ? 102  TRP A CZ3 1 
ATOM   790   C  CH2 . TRP A  1 102 ? 2.712   -41.700 94.980  1.00 15.14  ? 102  TRP A CH2 1 
ATOM   791   N  N   . THR A  1 103 ? -3.108  -47.614 93.360  1.00 23.31  ? 103  THR A N   1 
ATOM   792   C  CA  . THR A  1 103 ? -4.397  -48.108 92.848  1.00 29.54  ? 103  THR A CA  1 
ATOM   793   C  C   . THR A  1 103 ? -5.390  -48.308 94.001  1.00 27.59  ? 103  THR A C   1 
ATOM   794   O  O   . THR A  1 103 ? -5.006  -48.216 95.160  1.00 19.73  ? 103  THR A O   1 
ATOM   795   C  CB  . THR A  1 103 ? -4.250  -49.453 92.088  1.00 25.27  ? 103  THR A CB  1 
ATOM   796   O  OG1 . THR A  1 103 ? -4.237  -50.541 93.021  1.00 25.81  ? 103  THR A OG1 1 
ATOM   797   C  CG2 . THR A  1 103 ? -3.007  -49.472 91.238  1.00 23.23  ? 103  THR A CG2 1 
ATOM   798   N  N   . PRO A  1 104 ? -6.670  -48.580 93.697  1.00 20.31  ? 104  PRO A N   1 
ATOM   799   C  CA  . PRO A  1 104 ? -7.546  -48.849 94.845  1.00 25.66  ? 104  PRO A CA  1 
ATOM   800   C  C   . PRO A  1 104 ? -7.242  -50.204 95.430  1.00 23.59  ? 104  PRO A C   1 
ATOM   801   O  O   . PRO A  1 104 ? -6.561  -50.981 94.786  1.00 21.64  ? 104  PRO A O   1 
ATOM   802   C  CB  . PRO A  1 104 ? -8.952  -48.850 94.238  1.00 27.45  ? 104  PRO A CB  1 
ATOM   803   C  CG  . PRO A  1 104 ? -8.832  -48.046 93.020  1.00 38.35  ? 104  PRO A CG  1 
ATOM   804   C  CD  . PRO A  1 104 ? -7.446  -48.317 92.478  1.00 39.72  ? 104  PRO A CD  1 
ATOM   805   N  N   . TYR A  1 105 ? -7.733  -50.465 96.637  1.00 31.93  ? 105  TYR A N   1 
ATOM   806   C  CA  . TYR A  1 105 ? -7.600  -51.767 97.281  1.00 23.54  ? 105  TYR A CA  1 
ATOM   807   C  C   . TYR A  1 105 ? -8.988  -52.399 97.561  1.00 51.31  ? 105  TYR A C   1 
ATOM   808   O  O   . TYR A  1 105 ? -9.842  -51.809 98.222  1.00 25.43  ? 105  TYR A O   1 
ATOM   809   C  CB  . TYR A  1 105 ? -6.803  -51.625 98.571  1.00 32.39  ? 105  TYR A CB  1 
ATOM   810   C  CG  . TYR A  1 105 ? -6.480  -52.944 99.212  1.00 33.46  ? 105  TYR A CG  1 
ATOM   811   C  CD1 . TYR A  1 105 ? -7.421  -53.600 100.001 1.00 35.11  ? 105  TYR A CD1 1 
ATOM   812   C  CD2 . TYR A  1 105 ? -5.231  -53.537 99.037  1.00 33.15  ? 105  TYR A CD2 1 
ATOM   813   C  CE1 . TYR A  1 105 ? -7.139  -54.813 100.589 1.00 36.44  ? 105  TYR A CE1 1 
ATOM   814   C  CE2 . TYR A  1 105 ? -4.932  -54.747 99.624  1.00 36.38  ? 105  TYR A CE2 1 
ATOM   815   C  CZ  . TYR A  1 105 ? -5.899  -55.382 100.396 1.00 37.54  ? 105  TYR A CZ  1 
ATOM   816   O  OH  . TYR A  1 105 ? -5.628  -56.587 100.987 1.00 40.79  ? 105  TYR A OH  1 
ATOM   817   N  N   . PRO A  1 106 ? -9.233  -53.601 97.040  1.00 25.41  ? 106  PRO A N   1 
ATOM   818   C  CA  . PRO A  1 106 ? -8.369  -54.425 96.196  1.00 33.59  ? 106  PRO A CA  1 
ATOM   819   C  C   . PRO A  1 106 ? -8.115  -53.761 94.862  1.00 29.53  ? 106  PRO A C   1 
ATOM   820   O  O   . PRO A  1 106 ? -8.949  -52.978 94.400  1.00 31.89  ? 106  PRO A O   1 
ATOM   821   C  CB  . PRO A  1 106 ? -9.231  -55.659 95.941  1.00 26.18  ? 106  PRO A CB  1 
ATOM   822   C  CG  . PRO A  1 106 ? -10.610 -55.142 96.007  1.00 26.85  ? 106  PRO A CG  1 
ATOM   823   C  CD  . PRO A  1 106 ? -10.578 -54.174 97.146  1.00 28.08  ? 106  PRO A CD  1 
ATOM   824   N  N   . ARG A  1 107 ? -6.966  -54.068 94.278  1.00 28.43  ? 107  ARG A N   1 
ATOM   825   C  CA  . ARG A  1 107 ? -6.655  -53.717 92.909  1.00 31.04  ? 107  ARG A CA  1 
ATOM   826   C  C   . ARG A  1 107 ? -7.934  -53.838 92.051  1.00 32.76  ? 107  ARG A C   1 
ATOM   827   O  O   . ARG A  1 107 ? -8.657  -54.830 92.165  1.00 39.39  ? 107  ARG A O   1 
ATOM   828   C  CB  . ARG A  1 107 ? -5.548  -54.656 92.432  1.00 30.13  ? 107  ARG A CB  1 
ATOM   829   C  CG  . ARG A  1 107 ? -4.447  -53.971 91.686  1.00 28.02  ? 107  ARG A CG  1 
ATOM   830   C  CD  . ARG A  1 107 ? -3.070  -54.288 92.226  1.00 30.82  ? 107  ARG A CD  1 
ATOM   831   N  NE  . ARG A  1 107 ? -2.702  -55.706 92.302  1.00 30.42  ? 107  ARG A NE  1 
ATOM   832   C  CZ  . ARG A  1 107 ? -2.728  -56.570 91.293  1.00 31.82  ? 107  ARG A CZ  1 
ATOM   833   N  NH1 . ARG A  1 107 ? -3.152  -56.214 90.086  1.00 35.61  ? 107  ARG A NH1 1 
ATOM   834   N  NH2 . ARG A  1 107 ? -2.337  -57.812 91.503  1.00 32.74  ? 107  ARG A NH2 1 
ATOM   835   N  N   . PRO A  1 108 ? -8.235  -52.809 91.226  1.00 29.20  ? 108  PRO A N   1 
ATOM   836   C  CA  . PRO A  1 108 ? -9.538  -52.662 90.535  1.00 28.93  ? 108  PRO A CA  1 
ATOM   837   C  C   . PRO A  1 108 ? -9.857  -53.741 89.486  1.00 41.88  ? 108  PRO A C   1 
ATOM   838   O  O   . PRO A  1 108 ? -8.974  -54.231 88.784  1.00 48.55  ? 108  PRO A O   1 
ATOM   839   C  CB  . PRO A  1 108 ? -9.438  -51.285 89.876  1.00 30.74  ? 108  PRO A CB  1 
ATOM   840   C  CG  . PRO A  1 108 ? -7.921  -51.018 89.750  1.00 21.52  ? 108  PRO A CG  1 
ATOM   841   C  CD  . PRO A  1 108 ? -7.296  -51.708 90.916  1.00 30.88  ? 108  PRO A CD  1 
ATOM   842   N  N   . ALA A  1 109 ? -11.130 -54.104 89.382  1.00 49.62  ? 109  ALA A N   1 
ATOM   843   C  CA  . ALA A  1 109 ? -11.544 -55.235 88.549  1.00 48.52  ? 109  ALA A CA  1 
ATOM   844   C  C   . ALA A  1 109 ? -11.516 -54.918 87.064  1.00 46.94  ? 109  ALA A C   1 
ATOM   845   O  O   . ALA A  1 109 ? -11.096 -55.740 86.256  1.00 52.65  ? 109  ALA A O   1 
ATOM   846   C  CB  . ALA A  1 109 ? -12.935 -55.703 88.949  1.00 51.76  ? 109  ALA A CB  1 
ATOM   847   N  N   . SER A  1 110 ? -11.991 -53.729 86.713  1.00 45.09  ? 110  SER A N   1 
ATOM   848   C  CA  . SER A  1 110 ? -12.056 -53.298 85.325  1.00 44.42  ? 110  SER A CA  1 
ATOM   849   C  C   . SER A  1 110 ? -10.976 -52.281 85.036  1.00 24.61  ? 110  SER A C   1 
ATOM   850   O  O   . SER A  1 110 ? -10.640 -51.480 85.898  1.00 28.10  ? 110  SER A O   1 
ATOM   851   C  CB  . SER A  1 110 ? -13.431 -52.699 85.007  1.00 42.20  ? 110  SER A CB  1 
ATOM   852   O  OG  . SER A  1 110 ? -13.896 -51.922 86.091  1.00 45.65  ? 110  SER A OG  1 
ATOM   853   N  N   . PRO A  1 111 ? -10.429 -52.320 83.815  1.00 31.78  ? 111  PRO A N   1 
ATOM   854   C  CA  . PRO A  1 111 ? -9.433  -51.390 83.270  1.00 35.96  ? 111  PRO A CA  1 
ATOM   855   C  C   . PRO A  1 111 ? -9.717  -49.954 83.690  1.00 33.43  ? 111  PRO A C   1 
ATOM   856   O  O   . PRO A  1 111 ? -10.771 -49.420 83.372  1.00 36.17  ? 111  PRO A O   1 
ATOM   857   C  CB  . PRO A  1 111 ? -9.634  -51.531 81.767  1.00 42.00  ? 111  PRO A CB  1 
ATOM   858   C  CG  . PRO A  1 111 ? -10.199 -52.917 81.570  1.00 39.44  ? 111  PRO A CG  1 
ATOM   859   C  CD  . PRO A  1 111 ? -10.714 -53.422 82.881  1.00 31.42  ? 111  PRO A CD  1 
ATOM   860   N  N   . THR A  1 112 ? -8.786  -49.336 84.399  1.00 31.52  ? 112  THR A N   1 
ATOM   861   C  CA  . THR A  1 112 ? -9.059  -48.056 85.030  1.00 32.20  ? 112  THR A CA  1 
ATOM   862   C  C   . THR A  1 112 ? -8.253  -46.942 84.379  1.00 28.83  ? 112  THR A C   1 
ATOM   863   O  O   . THR A  1 112 ? -7.057  -47.094 84.168  1.00 28.64  ? 112  THR A O   1 
ATOM   864   C  CB  . THR A  1 112 ? -8.738  -48.131 86.528  1.00 33.96  ? 112  THR A CB  1 
ATOM   865   O  OG1 . THR A  1 112 ? -9.625  -49.065 87.150  1.00 36.18  ? 112  THR A OG1 1 
ATOM   866   C  CG2 . THR A  1 112 ? -8.914  -46.783 87.175  1.00 36.65  ? 112  THR A CG2 1 
ATOM   867   N  N   . PRO A  1 113 ? -8.910  -45.825 84.034  1.00 29.62  ? 113  PRO A N   1 
ATOM   868   C  CA  . PRO A  1 113 ? -8.192  -44.731 83.383  1.00 19.65  ? 113  PRO A CA  1 
ATOM   869   C  C   . PRO A  1 113 ? -7.030  -44.274 84.234  1.00 28.88  ? 113  PRO A C   1 
ATOM   870   O  O   . PRO A  1 113 ? -7.199  -43.981 85.433  1.00 22.15  ? 113  PRO A O   1 
ATOM   871   C  CB  . PRO A  1 113 ? -9.251  -43.644 83.277  1.00 26.91  ? 113  PRO A CB  1 
ATOM   872   C  CG  . PRO A  1 113 ? -10.512 -44.395 83.137  1.00 25.76  ? 113  PRO A CG  1 
ATOM   873   C  CD  . PRO A  1 113 ? -10.359 -45.585 84.055  1.00 28.78  ? 113  PRO A CD  1 
ATOM   874   N  N   . VAL A  1 114 ? -5.856  -44.237 83.600  1.00 33.53  ? 114  VAL A N   1 
ATOM   875   C  CA  . VAL A  1 114 ? -4.584  -43.996 84.273  1.00 17.03  ? 114  VAL A CA  1 
ATOM   876   C  C   . VAL A  1 114 ? -4.236  -42.520 84.236  1.00 30.28  ? 114  VAL A C   1 
ATOM   877   O  O   . VAL A  1 114 ? -4.359  -41.874 83.206  1.00 30.65  ? 114  VAL A O   1 
ATOM   878   C  CB  . VAL A  1 114 ? -3.447  -44.811 83.614  1.00 18.83  ? 114  VAL A CB  1 
ATOM   879   C  CG1 . VAL A  1 114 ? -2.093  -44.474 84.230  1.00 16.06  ? 114  VAL A CG1 1 
ATOM   880   C  CG2 . VAL A  1 114 ? -3.716  -46.292 83.743  1.00 20.83  ? 114  VAL A CG2 1 
ATOM   881   N  N   . LEU A  1 115 ? -3.831  -41.989 85.379  1.00 15.93  ? 115  LEU A N   1 
ATOM   882   C  CA  . LEU A  1 115 ? -3.288  -40.649 85.465  1.00 29.98  ? 115  LEU A CA  1 
ATOM   883   C  C   . LEU A  1 115 ? -1.757  -40.699 85.628  1.00 29.31  ? 115  LEU A C   1 
ATOM   884   O  O   . LEU A  1 115 ? -1.247  -41.377 86.525  1.00 35.38  ? 115  LEU A O   1 
ATOM   885   C  CB  . LEU A  1 115 ? -3.890  -39.973 86.679  1.00 15.44  ? 115  LEU A CB  1 
ATOM   886   C  CG  . LEU A  1 115 ? -5.149  -39.153 86.530  1.00 18.54  ? 115  LEU A CG  1 
ATOM   887   C  CD1 . LEU A  1 115 ? -5.254  -38.333 87.765  1.00 18.86  ? 115  LEU A CD1 1 
ATOM   888   C  CD2 . LEU A  1 115 ? -5.032  -38.257 85.336  1.00 18.43  ? 115  LEU A CD2 1 
ATOM   889   N  N   . ILE A  1 116 ? -1.010  -40.003 84.779  1.00 19.11  ? 116  ILE A N   1 
ATOM   890   C  CA  . ILE A  1 116 ? 0.440   -39.976 84.979  1.00 19.88  ? 116  ILE A CA  1 
ATOM   891   C  C   . ILE A  1 116 ? 0.882   -38.580 85.365  1.00 24.08  ? 116  ILE A C   1 
ATOM   892   O  O   . ILE A  1 116 ? 0.516   -37.604 84.716  1.00 28.07  ? 116  ILE A O   1 
ATOM   893   C  CB  . ILE A  1 116 ? 1.268   -40.444 83.757  1.00 17.60  ? 116  ILE A CB  1 
ATOM   894   C  CG1 . ILE A  1 116 ? 0.813   -41.809 83.255  1.00 24.74  ? 116  ILE A CG1 1 
ATOM   895   C  CG2 . ILE A  1 116 ? 2.713   -40.575 84.151  1.00 17.38  ? 116  ILE A CG2 1 
ATOM   896   C  CD1 . ILE A  1 116 ? 1.646   -42.360 82.148  1.00 14.65  ? 116  ILE A CD1 1 
ATOM   897   N  N   . TRP A  1 117 ? 1.681   -38.488 86.421  1.00 19.02  ? 117  TRP A N   1 
ATOM   898   C  CA  . TRP A  1 117 ? 2.045   -37.200 86.971  1.00 15.51  ? 117  TRP A CA  1 
ATOM   899   C  C   . TRP A  1 117 ? 3.490   -36.900 86.714  1.00 17.18  ? 117  TRP A C   1 
ATOM   900   O  O   . TRP A  1 117 ? 4.368   -37.669 87.101  1.00 25.44  ? 117  TRP A O   1 
ATOM   901   C  CB  . TRP A  1 117 ? 1.810   -37.177 88.475  1.00 22.27  ? 117  TRP A CB  1 
ATOM   902   C  CG  . TRP A  1 117 ? 2.390   -35.972 89.109  1.00 19.34  ? 117  TRP A CG  1 
ATOM   903   C  CD1 . TRP A  1 117 ? 3.548   -35.892 89.802  1.00 17.30  ? 117  TRP A CD1 1 
ATOM   904   C  CD2 . TRP A  1 117 ? 1.845   -34.655 89.080  1.00 25.35  ? 117  TRP A CD2 1 
ATOM   905   N  NE1 . TRP A  1 117 ? 3.764   -34.604 90.219  1.00 21.51  ? 117  TRP A NE1 1 
ATOM   906   C  CE2 . TRP A  1 117 ? 2.729   -33.822 89.787  1.00 25.59  ? 117  TRP A CE2 1 
ATOM   907   C  CE3 . TRP A  1 117 ? 0.695   -34.095 88.517  1.00 22.61  ? 117  TRP A CE3 1 
ATOM   908   C  CZ2 . TRP A  1 117 ? 2.496   -32.459 89.952  1.00 27.55  ? 117  TRP A CZ2 1 
ATOM   909   C  CZ3 . TRP A  1 117 ? 0.461   -32.746 88.687  1.00 18.16  ? 117  TRP A CZ3 1 
ATOM   910   C  CH2 . TRP A  1 117 ? 1.349   -31.943 89.398  1.00 19.58  ? 117  TRP A CH2 1 
ATOM   911   N  N   . ILE A  1 118 ? 3.732   -35.770 86.065  1.00 12.38  ? 118  ILE A N   1 
ATOM   912   C  CA  . ILE A  1 118 ? 5.077   -35.286 85.870  1.00 15.38  ? 118  ILE A CA  1 
ATOM   913   C  C   . ILE A  1 118 ? 5.258   -34.061 86.727  1.00 17.68  ? 118  ILE A C   1 
ATOM   914   O  O   . ILE A  1 118 ? 4.552   -33.071 86.529  1.00 18.67  ? 118  ILE A O   1 
ATOM   915   C  CB  . ILE A  1 118 ? 5.359   -34.881 84.419  1.00 16.39  ? 118  ILE A CB  1 
ATOM   916   C  CG1 . ILE A  1 118 ? 5.060   -36.018 83.445  1.00 13.87  ? 118  ILE A CG1 1 
ATOM   917   C  CG2 . ILE A  1 118 ? 6.807   -34.486 84.276  1.00 24.79  ? 118  ILE A CG2 1 
ATOM   918   C  CD1 . ILE A  1 118 ? 5.776   -35.850 82.094  1.00 13.56  ? 118  ILE A CD1 1 
ATOM   919   N  N   . TYR A  1 119 ? 6.221   -34.117 87.652  1.00 16.99  ? 119  TYR A N   1 
ATOM   920   C  CA  . TYR A  1 119 ? 6.466   -33.016 88.572  1.00 17.57  ? 119  TYR A CA  1 
ATOM   921   C  C   . TYR A  1 119 ? 7.215   -31.882 87.913  1.00 12.03  ? 119  TYR A C   1 
ATOM   922   O  O   . TYR A  1 119 ? 7.692   -32.050 86.814  1.00 12.78  ? 119  TYR A O   1 
ATOM   923   C  CB  . TYR A  1 119 ? 7.179   -33.494 89.822  1.00 12.30  ? 119  TYR A CB  1 
ATOM   924   C  CG  . TYR A  1 119 ? 8.528   -34.138 89.630  1.00 32.16  ? 119  TYR A CG  1 
ATOM   925   C  CD1 . TYR A  1 119 ? 9.643   -33.384 89.305  1.00 31.24  ? 119  TYR A CD1 1 
ATOM   926   C  CD2 . TYR A  1 119 ? 8.707   -35.496 89.859  1.00 32.00  ? 119  TYR A CD2 1 
ATOM   927   C  CE1 . TYR A  1 119 ? 10.883  -33.976 89.162  1.00 33.35  ? 119  TYR A CE1 1 
ATOM   928   C  CE2 . TYR A  1 119 ? 9.951   -36.092 89.728  1.00 29.08  ? 119  TYR A CE2 1 
ATOM   929   C  CZ  . TYR A  1 119 ? 11.032  -35.328 89.381  1.00 25.70  ? 119  TYR A CZ  1 
ATOM   930   O  OH  . TYR A  1 119 ? 12.269  -35.908 89.243  1.00 18.89  ? 119  TYR A OH  1 
ATOM   931   N  N   . GLY A  1 120 ? 7.289   -30.727 88.574  1.00 19.64  ? 120  GLY A N   1 
ATOM   932   C  CA  . GLY A  1 120 ? 8.032   -29.583 88.065  1.00 12.17  ? 120  GLY A CA  1 
ATOM   933   C  C   . GLY A  1 120 ? 9.189   -29.160 88.966  1.00 48.20  ? 120  GLY A C   1 
ATOM   934   O  O   . GLY A  1 120 ? 9.735   -29.952 89.732  1.00 12.54  ? 120  GLY A O   1 
ATOM   935   N  N   . GLY A  1 121 ? 9.576   -27.901 88.893  1.00 12.57  ? 121  GLY A N   1 
ATOM   936   C  CA  . GLY A  1 121 ? 10.711  -27.463 89.672  1.00 34.24  ? 121  GLY A CA  1 
ATOM   937   C  C   . GLY A  1 121 ? 11.933  -27.152 88.818  1.00 33.08  ? 121  GLY A C   1 
ATOM   938   O  O   . GLY A  1 121 ? 13.023  -27.660 89.067  1.00 13.30  ? 121  GLY A O   1 
ATOM   939   N  N   . GLY A  1 122 ? 11.720  -26.343 87.783  1.00 24.80  ? 122  GLY A N   1 
ATOM   940   C  CA  . GLY A  1 122 ? 12.777  -25.708 87.022  1.00 16.15  ? 122  GLY A CA  1 
ATOM   941   C  C   . GLY A  1 122 ? 13.606  -26.578 86.115  1.00 26.30  ? 122  GLY A C   1 
ATOM   942   O  O   . GLY A  1 122 ? 14.574  -26.094 85.521  1.00 31.89  ? 122  GLY A O   1 
ATOM   943   N  N   . PHE A  1 123 ? 13.231  -27.849 85.996  1.00 29.57  ? 123  PHE A N   1 
ATOM   944   C  CA  . PHE A  1 123 ? 14.105  -28.854 85.400  1.00 13.22  ? 123  PHE A CA  1 
ATOM   945   C  C   . PHE A  1 123 ? 15.398  -28.942 86.217  1.00 29.44  ? 123  PHE A C   1 
ATOM   946   O  O   . PHE A  1 123 ? 16.418  -29.454 85.749  1.00 26.85  ? 123  PHE A O   1 
ATOM   947   C  CB  . PHE A  1 123 ? 14.369  -28.574 83.914  1.00 20.62  ? 123  PHE A CB  1 
ATOM   948   C  CG  . PHE A  1 123 ? 13.121  -28.618 83.060  1.00 23.81  ? 123  PHE A CG  1 
ATOM   949   C  CD1 . PHE A  1 123 ? 12.480  -29.824 82.799  1.00 25.62  ? 123  PHE A CD1 1 
ATOM   950   C  CD2 . PHE A  1 123 ? 12.581  -27.461 82.527  1.00 24.41  ? 123  PHE A CD2 1 
ATOM   951   C  CE1 . PHE A  1 123 ? 11.316  -29.873 82.028  1.00 24.65  ? 123  PHE A CE1 1 
ATOM   952   C  CE2 . PHE A  1 123 ? 11.417  -27.508 81.751  1.00 26.88  ? 123  PHE A CE2 1 
ATOM   953   C  CZ  . PHE A  1 123 ? 10.792  -28.713 81.501  1.00 24.20  ? 123  PHE A CZ  1 
ATOM   954   N  N   . TYR A  1 124 ? 15.331  -28.453 87.456  1.00 28.80  ? 124  TYR A N   1 
ATOM   955   C  CA  . TYR A  1 124 ? 16.447  -28.521 88.381  1.00 14.39  ? 124  TYR A CA  1 
ATOM   956   C  C   . TYR A  1 124 ? 16.070  -29.213 89.692  1.00 17.18  ? 124  TYR A C   1 
ATOM   957   O  O   . TYR A  1 124 ? 16.807  -30.042 90.184  1.00 24.29  ? 124  TYR A O   1 
ATOM   958   C  CB  . TYR A  1 124 ? 17.070  -27.135 88.614  1.00 16.06  ? 124  TYR A CB  1 
ATOM   959   C  CG  . TYR A  1 124 ? 16.305  -26.217 89.529  1.00 21.46  ? 124  TYR A CG  1 
ATOM   960   C  CD1 . TYR A  1 124 ? 16.317  -26.400 90.919  1.00 26.22  ? 124  TYR A CD1 1 
ATOM   961   C  CD2 . TYR A  1 124 ? 15.609  -25.136 89.020  1.00 21.07  ? 124  TYR A CD2 1 
ATOM   962   C  CE1 . TYR A  1 124 ? 15.605  -25.559 91.772  1.00 28.66  ? 124  TYR A CE1 1 
ATOM   963   C  CE2 . TYR A  1 124 ? 14.899  -24.279 89.866  1.00 27.08  ? 124  TYR A CE2 1 
ATOM   964   C  CZ  . TYR A  1 124 ? 14.898  -24.496 91.239  1.00 32.27  ? 124  TYR A CZ  1 
ATOM   965   O  OH  . TYR A  1 124 ? 14.200  -23.645 92.073  1.00 38.17  ? 124  TYR A OH  1 
ATOM   966   N  N   . SER A  1 125 ? 14.931  -28.878 90.275  1.00 19.47  ? 125  SER A N   1 
ATOM   967   C  CA  . SER A  1 125 ? 14.538  -29.543 91.507  1.00 20.50  ? 125  SER A CA  1 
ATOM   968   C  C   . SER A  1 125 ? 13.568  -30.629 91.140  1.00 16.27  ? 125  SER A C   1 
ATOM   969   O  O   . SER A  1 125 ? 13.097  -30.665 90.013  1.00 13.31  ? 125  SER A O   1 
ATOM   970   C  CB  . SER A  1 125 ? 13.896  -28.569 92.496  1.00 27.47  ? 125  SER A CB  1 
ATOM   971   O  OG  . SER A  1 125 ? 12.742  -27.945 91.966  1.00 25.02  ? 125  SER A OG  1 
ATOM   972   N  N   . GLY A  1 126 ? 13.286  -31.532 92.073  1.00 17.90  ? 126  GLY A N   1 
ATOM   973   C  CA  . GLY A  1 126 ? 12.209  -32.463 91.828  1.00 25.06  ? 126  GLY A CA  1 
ATOM   974   C  C   . GLY A  1 126 ? 12.182  -33.854 92.410  1.00 29.19  ? 126  GLY A C   1 
ATOM   975   O  O   . GLY A  1 126 ? 13.202  -34.543 92.460  1.00 36.40  ? 126  GLY A O   1 
ATOM   976   N  N   . ALA A  1 127 ? 10.988  -34.274 92.820  1.00 18.48  ? 127  ALA A N   1 
ATOM   977   C  CA  . ALA A  1 127 ? 10.763  -35.659 93.218  1.00 19.50  ? 127  ALA A CA  1 
ATOM   978   C  C   . ALA A  1 127 ? 9.296   -36.034 93.227  1.00 21.46  ? 127  ALA A C   1 
ATOM   979   O  O   . ALA A  1 127 ? 8.429   -35.236 93.544  1.00 13.47  ? 127  ALA A O   1 
ATOM   980   C  CB  . ALA A  1 127 ? 11.359  -35.948 94.566  1.00 21.42  ? 127  ALA A CB  1 
ATOM   981   N  N   . ALA A  1 128 ? 9.054   -37.296 92.930  1.00 21.12  ? 128  ALA A N   1 
ATOM   982   C  CA  . ALA A  1 128 ? 7.730   -37.801 92.710  1.00 27.62  ? 128  ALA A CA  1 
ATOM   983   C  C   . ALA A  1 128 ? 7.155   -38.225 94.050  1.00 29.84  ? 128  ALA A C   1 
ATOM   984   O  O   . ALA A  1 128 ? 5.965   -38.584 94.155  1.00 18.93  ? 128  ALA A O   1 
ATOM   985   C  CB  . ALA A  1 128 ? 7.825   -38.969 91.774  1.00 30.88  ? 128  ALA A CB  1 
ATOM   986   N  N   . SER A  1 129 ? 8.026   -38.155 95.062  1.00 27.16  ? 129  SER A N   1 
ATOM   987   C  CA  . SER A  1 129 ? 7.756   -38.622 96.419  1.00 26.17  ? 129  SER A CA  1 
ATOM   988   C  C   . SER A  1 129 ? 7.400   -37.508 97.429  1.00 31.83  ? 129  SER A C   1 
ATOM   989   O  O   . SER A  1 129 ? 7.238   -37.774 98.629  1.00 36.28  ? 129  SER A O   1 
ATOM   990   C  CB  . SER A  1 129 ? 8.969   -39.406 96.930  1.00 23.76  ? 129  SER A CB  1 
ATOM   991   O  OG  . SER A  1 129 ? 10.174  -38.655 96.828  1.00 20.97  ? 129  SER A OG  1 
ATOM   992   N  N   . LEU A  1 130 ? 7.292   -36.266 96.960  1.00 26.84  ? 130  LEU A N   1 
ATOM   993   C  CA  . LEU A  1 130 ? 6.896   -35.158 97.833  1.00 28.73  ? 130  LEU A CA  1 
ATOM   994   C  C   . LEU A  1 130 ? 5.466   -35.350 98.347  1.00 34.99  ? 130  LEU A C   1 
ATOM   995   O  O   . LEU A  1 130 ? 4.649   -35.990 97.681  1.00 39.38  ? 130  LEU A O   1 
ATOM   996   C  CB  . LEU A  1 130 ? 7.009   -33.829 97.089  1.00 26.94  ? 130  LEU A CB  1 
ATOM   997   C  CG  . LEU A  1 130 ? 8.357   -33.492 96.457  1.00 20.08  ? 130  LEU A CG  1 
ATOM   998   C  CD1 . LEU A  1 130 ? 8.335   -32.052 96.019  1.00 19.41  ? 130  LEU A CD1 1 
ATOM   999   C  CD2 . LEU A  1 130 ? 9.463   -33.717 97.444  1.00 15.29  ? 130  LEU A CD2 1 
ATOM   1000  N  N   . ASP A  1 131 ? 5.156   -34.807 99.524  1.00 31.93  ? 131  ASP A N   1 
ATOM   1001  C  CA  . ASP A  1 131 ? 3.842   -35.053 100.120 1.00 21.93  ? 131  ASP A CA  1 
ATOM   1002  C  C   . ASP A  1 131 ? 2.731   -34.526 99.244  1.00 25.73  ? 131  ASP A C   1 
ATOM   1003  O  O   . ASP A  1 131 ? 1.652   -35.112 99.194  1.00 34.72  ? 131  ASP A O   1 
ATOM   1004  C  CB  . ASP A  1 131 ? 3.714   -34.450 101.512 1.00 26.78  ? 131  ASP A CB  1 
ATOM   1005  C  CG  . ASP A  1 131 ? 4.623   -35.111 102.522 1.00 37.79  ? 131  ASP A CG  1 
ATOM   1006  O  OD1 . ASP A  1 131 ? 5.224   -36.162 102.197 1.00 42.12  ? 131  ASP A OD1 1 
ATOM   1007  O  OD2 . ASP A  1 131 ? 4.734   -34.570 103.643 1.00 40.65  ? 131  ASP A OD2 1 
ATOM   1008  N  N   . VAL A  1 132 ? 2.992   -33.429 98.542  1.00 21.80  ? 132  VAL A N   1 
ATOM   1009  C  CA  . VAL A  1 132 ? 1.958   -32.803 97.708  1.00 26.51  ? 132  VAL A CA  1 
ATOM   1010  C  C   . VAL A  1 132 ? 1.591   -33.570 96.435  1.00 31.37  ? 132  VAL A C   1 
ATOM   1011  O  O   . VAL A  1 132 ? 0.614   -33.246 95.770  1.00 33.29  ? 132  VAL A O   1 
ATOM   1012  C  CB  . VAL A  1 132 ? 2.332   -31.368 97.321  1.00 27.89  ? 132  VAL A CB  1 
ATOM   1013  C  CG1 . VAL A  1 132 ? 1.864   -30.411 98.389  1.00 33.55  ? 132  VAL A CG1 1 
ATOM   1014  C  CG2 . VAL A  1 132 ? 3.846   -31.253 97.070  1.00 15.10  ? 132  VAL A CG2 1 
ATOM   1015  N  N   . TYR A  1 133 ? 2.383   -34.566 96.072  1.00 29.92  ? 133  TYR A N   1 
ATOM   1016  C  CA  . TYR A  1 133 ? 2.104   -35.304 94.857  1.00 27.44  ? 133  TYR A CA  1 
ATOM   1017  C  C   . TYR A  1 133 ? 1.732   -36.739 95.250  1.00 32.15  ? 133  TYR A C   1 
ATOM   1018  O  O   . TYR A  1 133 ? 2.146   -37.692 94.582  1.00 33.05  ? 133  TYR A O   1 
ATOM   1019  C  CB  . TYR A  1 133 ? 3.326   -35.358 93.925  1.00 23.65  ? 133  TYR A CB  1 
ATOM   1020  C  CG  . TYR A  1 133 ? 4.139   -34.090 93.600  1.00 18.51  ? 133  TYR A CG  1 
ATOM   1021  C  CD1 . TYR A  1 133 ? 3.552   -32.869 93.231  1.00 17.93  ? 133  TYR A CD1 1 
ATOM   1022  C  CD2 . TYR A  1 133 ? 5.515   -34.166 93.593  1.00 20.41  ? 133  TYR A CD2 1 
ATOM   1023  C  CE1 . TYR A  1 133 ? 4.353   -31.751 92.901  1.00 21.02  ? 133  TYR A CE1 1 
ATOM   1024  C  CE2 . TYR A  1 133 ? 6.318   -33.083 93.279  1.00 29.95  ? 133  TYR A CE2 1 
ATOM   1025  C  CZ  . TYR A  1 133 ? 5.765   -31.882 92.931  1.00 34.75  ? 133  TYR A CZ  1 
ATOM   1026  O  OH  . TYR A  1 133 ? 6.687   -30.868 92.634  1.00 13.04  ? 133  TYR A OH  1 
ATOM   1027  N  N   . ASP A  1 134 ? 0.976   -36.884 96.341  1.00 27.35  ? 134  ASP A N   1 
ATOM   1028  C  CA  . ASP A  1 134 ? 0.614   -38.191 96.908  1.00 22.13  ? 134  ASP A CA  1 
ATOM   1029  C  C   . ASP A  1 134 ? -0.684  -38.713 96.295  1.00 23.31  ? 134  ASP A C   1 
ATOM   1030  O  O   . ASP A  1 134 ? -1.770  -38.197 96.578  1.00 27.85  ? 134  ASP A O   1 
ATOM   1031  C  CB  . ASP A  1 134 ? 0.453   -38.069 98.432  1.00 25.21  ? 134  ASP A CB  1 
ATOM   1032  C  CG  . ASP A  1 134 ? 0.374   -39.427 99.158  1.00 32.76  ? 134  ASP A CG  1 
ATOM   1033  O  OD1 . ASP A  1 134 ? 0.324   -40.492 98.510  1.00 40.76  ? 134  ASP A OD1 1 
ATOM   1034  O  OD2 . ASP A  1 134 ? 0.353   -39.422 100.409 1.00 31.65  ? 134  ASP A OD2 1 
ATOM   1035  N  N   . GLY A  1 135 ? -0.566  -39.765 95.491  1.00 25.96  ? 135  GLY A N   1 
ATOM   1036  C  CA  . GLY A  1 135 ? -1.681  -40.302 94.740  1.00 15.87  ? 135  GLY A CA  1 
ATOM   1037  C  C   . GLY A  1 135 ? -2.727  -41.025 95.565  1.00 29.48  ? 135  GLY A C   1 
ATOM   1038  O  O   . GLY A  1 135 ? -3.792  -41.376 95.055  1.00 38.22  ? 135  GLY A O   1 
ATOM   1039  N  N   . ARG A  1 136 ? -2.452  -41.241 96.842  1.00 20.38  ? 136  ARG A N   1 
ATOM   1040  C  CA  . ARG A  1 136 ? -3.326  -42.088 97.654  1.00 25.57  ? 136  ARG A CA  1 
ATOM   1041  C  C   . ARG A  1 136 ? -4.798  -41.619 97.713  1.00 22.48  ? 136  ARG A C   1 
ATOM   1042  O  O   . ARG A  1 136 ? -5.718  -42.433 97.759  1.00 22.93  ? 136  ARG A O   1 
ATOM   1043  C  CB  . ARG A  1 136 ? -2.732  -42.266 99.051  1.00 20.82  ? 136  ARG A CB  1 
ATOM   1044  C  CG  . ARG A  1 136 ? -3.595  -41.750 100.150 1.00 20.74  ? 136  ARG A CG  1 
ATOM   1045  C  CD  . ARG A  1 136 ? -2.773  -40.936 101.106 1.00 28.80  ? 136  ARG A CD  1 
ATOM   1046  N  NE  . ARG A  1 136 ? -2.238  -41.719 102.217 1.00 31.63  ? 136  ARG A NE  1 
ATOM   1047  C  CZ  . ARG A  1 136 ? -0.967  -42.081 102.316 1.00 34.05  ? 136  ARG A CZ  1 
ATOM   1048  N  NH1 . ARG A  1 136 ? -0.102  -41.747 101.366 1.00 41.95  ? 136  ARG A NH1 1 
ATOM   1049  N  NH2 . ARG A  1 136 ? -0.560  -42.777 103.359 1.00 30.36  ? 136  ARG A NH2 1 
ATOM   1050  N  N   . PHE A  1 137 ? -5.014  -40.310 97.664  1.00 21.54  ? 137  PHE A N   1 
ATOM   1051  C  CA  . PHE A  1 137 ? -6.359  -39.761 97.792  1.00 28.01  ? 137  PHE A CA  1 
ATOM   1052  C  C   . PHE A  1 137 ? -7.159  -39.966 96.514  1.00 32.81  ? 137  PHE A C   1 
ATOM   1053  O  O   . PHE A  1 137 ? -8.343  -40.294 96.556  1.00 20.19  ? 137  PHE A O   1 
ATOM   1054  C  CB  . PHE A  1 137 ? -6.305  -38.277 98.171  1.00 19.43  ? 137  PHE A CB  1 
ATOM   1055  C  CG  . PHE A  1 137 ? -5.470  -37.999 99.383  1.00 38.23  ? 137  PHE A CG  1 
ATOM   1056  C  CD1 . PHE A  1 137 ? -5.984  -38.189 100.651 1.00 33.09  ? 137  PHE A CD1 1 
ATOM   1057  C  CD2 . PHE A  1 137 ? -4.158  -37.570 99.254  1.00 43.18  ? 137  PHE A CD2 1 
ATOM   1058  C  CE1 . PHE A  1 137 ? -5.215  -37.954 101.766 1.00 34.68  ? 137  PHE A CE1 1 
ATOM   1059  C  CE2 . PHE A  1 137 ? -3.377  -37.324 100.373 1.00 43.25  ? 137  PHE A CE2 1 
ATOM   1060  C  CZ  . PHE A  1 137 ? -3.907  -37.518 101.627 1.00 42.20  ? 137  PHE A CZ  1 
ATOM   1061  N  N   . LEU A  1 138 ? -6.497  -39.778 95.377  1.00 28.73  ? 138  LEU A N   1 
ATOM   1062  C  CA  . LEU A  1 138 ? -7.164  -39.906 94.090  1.00 25.64  ? 138  LEU A CA  1 
ATOM   1063  C  C   . LEU A  1 138 ? -7.520  -41.365 93.898  1.00 32.59  ? 138  LEU A C   1 
ATOM   1064  O  O   . LEU A  1 138 ? -8.616  -41.704 93.419  1.00 35.60  ? 138  LEU A O   1 
ATOM   1065  C  CB  . LEU A  1 138 ? -6.274  -39.380 92.963  1.00 19.45  ? 138  LEU A CB  1 
ATOM   1066  C  CG  . LEU A  1 138 ? -6.282  -37.866 92.836  1.00 29.35  ? 138  LEU A CG  1 
ATOM   1067  C  CD1 . LEU A  1 138 ? -4.963  -37.377 92.307  1.00 16.31  ? 138  LEU A CD1 1 
ATOM   1068  C  CD2 . LEU A  1 138 ? -7.415  -37.460 91.929  1.00 17.77  ? 138  LEU A CD2 1 
ATOM   1069  N  N   . ALA A  1 139 ? -6.597  -42.225 94.318  1.00 28.09  ? 139  ALA A N   1 
ATOM   1070  C  CA  . ALA A  1 139 ? -6.819  -43.655 94.245  1.00 30.27  ? 139  ALA A CA  1 
ATOM   1071  C  C   . ALA A  1 139 ? -8.021  -44.065 95.103  1.00 34.71  ? 139  ALA A C   1 
ATOM   1072  O  O   . ALA A  1 139 ? -8.940  -44.707 94.600  1.00 34.09  ? 139  ALA A O   1 
ATOM   1073  C  CB  . ALA A  1 139 ? -5.582  -44.409 94.657  1.00 23.59  ? 139  ALA A CB  1 
ATOM   1074  N  N   . GLN A  1 140 ? -8.016  -43.690 96.383  1.00 30.30  ? 140  GLN A N   1 
ATOM   1075  C  CA  . GLN A  1 140 ? -9.081  -44.113 97.281  1.00 21.72  ? 140  GLN A CA  1 
ATOM   1076  C  C   . GLN A  1 140 ? -10.419 -43.575 96.826  1.00 35.11  ? 140  GLN A C   1 
ATOM   1077  O  O   . GLN A  1 140 ? -11.390 -44.317 96.715  1.00 23.32  ? 140  GLN A O   1 
ATOM   1078  C  CB  . GLN A  1 140 ? -8.822  -43.605 98.694  1.00 25.42  ? 140  GLN A CB  1 
ATOM   1079  C  CG  . GLN A  1 140 ? -9.458  -44.445 99.792  1.00 27.36  ? 140  GLN A CG  1 
ATOM   1080  C  CD  . GLN A  1 140 ? -10.972 -44.357 99.817  1.00 31.01  ? 140  GLN A CD  1 
ATOM   1081  O  OE1 . GLN A  1 140 ? -11.555 -43.264 99.776  1.00 32.02  ? 140  GLN A OE1 1 
ATOM   1082  N  NE2 . GLN A  1 140 ? -11.620 -45.515 99.883  1.00 30.36  ? 140  GLN A NE2 1 
ATOM   1083  N  N   . VAL A  1 141 ? -10.446 -42.274 96.566  1.00 31.29  ? 141  VAL A N   1 
ATOM   1084  C  CA  . VAL A  1 141 ? -11.683 -41.516 96.431  1.00 22.93  ? 141  VAL A CA  1 
ATOM   1085  C  C   . VAL A  1 141 ? -12.287 -41.581 95.036  1.00 33.77  ? 141  VAL A C   1 
ATOM   1086  O  O   . VAL A  1 141 ? -13.488 -41.872 94.885  1.00 31.74  ? 141  VAL A O   1 
ATOM   1087  C  CB  . VAL A  1 141 ? -11.462 -40.044 96.850  1.00 38.46  ? 141  VAL A CB  1 
ATOM   1088  C  CG1 . VAL A  1 141 ? -12.537 -39.131 96.289  1.00 23.41  ? 141  VAL A CG1 1 
ATOM   1089  C  CG2 . VAL A  1 141 ? -11.374 -39.927 98.361  1.00 23.39  ? 141  VAL A CG2 1 
ATOM   1090  N  N   . GLU A  1 142 ? -11.470 -41.320 94.016  1.00 30.38  ? 142  GLU A N   1 
ATOM   1091  C  CA  . GLU A  1 142 ? -11.979 -41.331 92.649  1.00 27.39  ? 142  GLU A CA  1 
ATOM   1092  C  C   . GLU A  1 142 ? -11.726 -42.642 91.927  1.00 29.43  ? 142  GLU A C   1 
ATOM   1093  O  O   . GLU A  1 142 ? -12.103 -42.806 90.764  1.00 27.40  ? 142  GLU A O   1 
ATOM   1094  C  CB  . GLU A  1 142 ? -11.435 -40.163 91.842  1.00 24.97  ? 142  GLU A CB  1 
ATOM   1095  C  CG  . GLU A  1 142 ? -12.167 -38.870 92.085  1.00 34.94  ? 142  GLU A CG  1 
ATOM   1096  C  CD  . GLU A  1 142 ? -13.668 -39.011 91.941  1.00 45.61  ? 142  GLU A CD  1 
ATOM   1097  O  OE1 . GLU A  1 142 ? -14.143 -39.840 91.124  1.00 47.51  ? 142  GLU A OE1 1 
ATOM   1098  O  OE2 . GLU A  1 142 ? -14.378 -38.283 92.660  1.00 49.17  ? 142  GLU A OE2 1 
ATOM   1099  N  N   . GLY A  1 143 ? -11.078 -43.565 92.627  1.00 35.46  ? 143  GLY A N   1 
ATOM   1100  C  CA  . GLY A  1 143 ? -10.857 -44.909 92.132  1.00 37.94  ? 143  GLY A CA  1 
ATOM   1101  C  C   . GLY A  1 143 ? -9.719  -45.017 91.149  1.00 39.89  ? 143  GLY A C   1 
ATOM   1102  O  O   . GLY A  1 143 ? -9.577  -46.041 90.492  1.00 41.88  ? 143  GLY A O   1 
ATOM   1103  N  N   . ALA A  1 144 ? -8.902  -43.975 91.056  1.00 19.67  ? 144  ALA A N   1 
ATOM   1104  C  CA  . ALA A  1 144 ? -7.926  -43.893 89.972  1.00 34.71  ? 144  ALA A CA  1 
ATOM   1105  C  C   . ALA A  1 144 ? -6.689  -44.759 90.129  1.00 32.79  ? 144  ALA A C   1 
ATOM   1106  O  O   . ALA A  1 144 ? -6.333  -45.186 91.230  1.00 18.36  ? 144  ALA A O   1 
ATOM   1107  C  CB  . ALA A  1 144 ? -7.512  -42.471 89.742  1.00 34.72  ? 144  ALA A CB  1 
ATOM   1108  N  N   . VAL A  1 145 ? -6.044  -45.015 88.996  1.00 17.89  ? 145  VAL A N   1 
ATOM   1109  C  CA  . VAL A  1 145 ? -4.701  -45.580 88.999  1.00 29.22  ? 145  VAL A CA  1 
ATOM   1110  C  C   . VAL A  1 145 ? -3.731  -44.455 88.703  1.00 25.91  ? 145  VAL A C   1 
ATOM   1111  O  O   . VAL A  1 145 ? -3.727  -43.913 87.603  1.00 18.43  ? 145  VAL A O   1 
ATOM   1112  C  CB  . VAL A  1 145 ? -4.509  -46.681 87.955  1.00 26.18  ? 145  VAL A CB  1 
ATOM   1113  C  CG1 . VAL A  1 145 ? -3.070  -47.146 87.973  1.00 17.16  ? 145  VAL A CG1 1 
ATOM   1114  C  CG2 . VAL A  1 145 ? -5.419  -47.824 88.246  1.00 18.55  ? 145  VAL A CG2 1 
ATOM   1115  N  N   . LEU A  1 146 ? -2.932  -44.083 89.692  1.00 16.10  ? 146  LEU A N   1 
ATOM   1116  C  CA  . LEU A  1 146 ? -2.050  -42.938 89.522  1.00 29.04  ? 146  LEU A CA  1 
ATOM   1117  C  C   . LEU A  1 146 ? -0.564  -43.317 89.488  1.00 23.98  ? 146  LEU A C   1 
ATOM   1118  O  O   . LEU A  1 146 ? -0.036  -44.005 90.375  1.00 17.30  ? 146  LEU A O   1 
ATOM   1119  C  CB  . LEU A  1 146 ? -2.335  -41.879 90.583  1.00 15.37  ? 146  LEU A CB  1 
ATOM   1120  C  CG  . LEU A  1 146 ? -1.658  -40.541 90.346  1.00 26.61  ? 146  LEU A CG  1 
ATOM   1121  C  CD1 . LEU A  1 146 ? -2.585  -39.456 90.732  1.00 15.02  ? 146  LEU A CD1 1 
ATOM   1122  C  CD2 . LEU A  1 146 ? -0.426  -40.453 91.174  1.00 31.68  ? 146  LEU A CD2 1 
ATOM   1123  N  N   . VAL A  1 147 ? 0.108   -42.867 88.443  1.00 14.57  ? 147  VAL A N   1 
ATOM   1124  C  CA  . VAL A  1 147 ? 1.518   -43.168 88.281  1.00 23.09  ? 147  VAL A CA  1 
ATOM   1125  C  C   . VAL A  1 147 ? 2.305   -41.884 88.302  1.00 13.79  ? 147  VAL A C   1 
ATOM   1126  O  O   . VAL A  1 147 ? 1.900   -40.908 87.678  1.00 15.37  ? 147  VAL A O   1 
ATOM   1127  C  CB  . VAL A  1 147 ? 1.769   -43.867 86.948  1.00 18.60  ? 147  VAL A CB  1 
ATOM   1128  C  CG1 . VAL A  1 147 ? 3.217   -44.227 86.799  1.00 14.39  ? 147  VAL A CG1 1 
ATOM   1129  C  CG2 . VAL A  1 147 ? 0.904   -45.106 86.855  1.00 17.50  ? 147  VAL A CG2 1 
ATOM   1130  N  N   . SER A  1 148 ? 3.415   -41.873 89.033  1.00 23.90  ? 148  SER A N   1 
ATOM   1131  C  CA  . SER A  1 148 ? 4.360   -40.753 88.931  1.00 21.29  ? 148  SER A CA  1 
ATOM   1132  C  C   . SER A  1 148 ? 5.748   -41.307 88.899  1.00 17.70  ? 148  SER A C   1 
ATOM   1133  O  O   . SER A  1 148 ? 6.040   -42.238 89.630  1.00 24.13  ? 148  SER A O   1 
ATOM   1134  C  CB  . SER A  1 148 ? 4.225   -39.769 90.092  1.00 27.05  ? 148  SER A CB  1 
ATOM   1135  O  OG  . SER A  1 148 ? 4.913   -40.193 91.251  1.00 13.48  ? 148  SER A OG  1 
ATOM   1136  N  N   . MET A  1 149 ? 6.609   -40.760 88.051  1.00 27.98  ? 149  MET A N   1 
ATOM   1137  C  CA  . MET A  1 149 ? 7.982   -41.235 87.994  1.00 13.42  ? 149  MET A CA  1 
ATOM   1138  C  C   . MET A  1 149 ? 8.892   -40.154 88.458  1.00 17.11  ? 149  MET A C   1 
ATOM   1139  O  O   . MET A  1 149 ? 8.519   -38.986 88.464  1.00 12.93  ? 149  MET A O   1 
ATOM   1140  C  CB  . MET A  1 149 ? 8.389   -41.579 86.568  1.00 13.55  ? 149  MET A CB  1 
ATOM   1141  C  CG  . MET A  1 149 ? 8.753   -40.376 85.733  1.00 13.26  ? 149  MET A CG  1 
ATOM   1142  S  SD  . MET A  1 149 ? 7.375   -39.258 85.428  1.00 29.95  ? 149  MET A SD  1 
ATOM   1143  C  CE  . MET A  1 149 ? 7.128   -39.541 83.702  1.00 13.08  ? 149  MET A CE  1 
ATOM   1144  N  N   . ASN A  1 150 ? 10.094  -40.550 88.857  1.00 25.50  ? 150  ASN A N   1 
ATOM   1145  C  CA  . ASN A  1 150 ? 11.208  -39.632 88.952  1.00 13.68  ? 150  ASN A CA  1 
ATOM   1146  C  C   . ASN A  1 150 ? 11.775  -39.480 87.565  1.00 26.92  ? 150  ASN A C   1 
ATOM   1147  O  O   . ASN A  1 150 ? 11.728  -40.417 86.783  1.00 13.90  ? 150  ASN A O   1 
ATOM   1148  C  CB  . ASN A  1 150 ? 12.250  -40.197 89.877  1.00 14.28  ? 150  ASN A CB  1 
ATOM   1149  C  CG  . ASN A  1 150 ? 11.946  -39.908 91.309  1.00 14.38  ? 150  ASN A CG  1 
ATOM   1150  O  OD1 . ASN A  1 150 ? 11.388  -38.868 91.618  1.00 43.83  ? 150  ASN A OD1 1 
ATOM   1151  N  ND2 . ASN A  1 150 ? 12.294  -40.829 92.201  1.00 25.15  ? 150  ASN A ND2 1 
ATOM   1152  N  N   . TYR A  1 151 ? 12.264  -38.291 87.237  1.00 28.90  ? 151  TYR A N   1 
ATOM   1153  C  CA  . TYR A  1 151 ? 13.063  -38.101 86.025  1.00 23.64  ? 151  TYR A CA  1 
ATOM   1154  C  C   . TYR A  1 151 ? 14.272  -37.286 86.411  1.00 21.35  ? 151  TYR A C   1 
ATOM   1155  O  O   . TYR A  1 151 ? 14.288  -36.665 87.475  1.00 29.55  ? 151  TYR A O   1 
ATOM   1156  C  CB  . TYR A  1 151 ? 12.274  -37.434 84.890  1.00 17.94  ? 151  TYR A CB  1 
ATOM   1157  C  CG  . TYR A  1 151 ? 11.775  -36.038 85.183  1.00 15.22  ? 151  TYR A CG  1 
ATOM   1158  C  CD1 . TYR A  1 151 ? 12.560  -34.936 84.905  1.00 18.48  ? 151  TYR A CD1 1 
ATOM   1159  C  CD2 . TYR A  1 151 ? 10.506  -35.819 85.715  1.00 14.83  ? 151  TYR A CD2 1 
ATOM   1160  C  CE1 . TYR A  1 151 ? 12.115  -33.653 85.154  1.00 21.49  ? 151  TYR A CE1 1 
ATOM   1161  C  CE2 . TYR A  1 151 ? 10.044  -34.534 85.969  1.00 12.33  ? 151  TYR A CE2 1 
ATOM   1162  C  CZ  . TYR A  1 151 ? 10.860  -33.458 85.684  1.00 26.65  ? 151  TYR A CZ  1 
ATOM   1163  O  OH  . TYR A  1 151 ? 10.446  -32.175 85.927  1.00 25.25  ? 151  TYR A OH  1 
ATOM   1164  N  N   . ARG A  1 152 ? 15.298  -37.308 85.570  1.00 19.50  ? 152  ARG A N   1 
ATOM   1165  C  CA  . ARG A  1 152 ? 16.532  -36.600 85.900  1.00 22.65  ? 152  ARG A CA  1 
ATOM   1166  C  C   . ARG A  1 152 ? 16.374  -35.107 85.694  1.00 21.72  ? 152  ARG A C   1 
ATOM   1167  O  O   . ARG A  1 152 ? 15.919  -34.647 84.653  1.00 24.07  ? 152  ARG A O   1 
ATOM   1168  C  CB  . ARG A  1 152 ? 17.736  -37.128 85.104  1.00 23.50  ? 152  ARG A CB  1 
ATOM   1169  C  CG  . ARG A  1 152 ? 18.456  -38.307 85.743  1.00 24.25  ? 152  ARG A CG  1 
ATOM   1170  C  CD  . ARG A  1 152 ? 19.442  -38.902 84.769  1.00 27.45  ? 152  ARG A CD  1 
ATOM   1171  N  NE  . ARG A  1 152 ? 18.778  -39.555 83.641  1.00 30.97  ? 152  ARG A NE  1 
ATOM   1172  C  CZ  . ARG A  1 152 ? 19.403  -39.956 82.538  1.00 27.62  ? 152  ARG A CZ  1 
ATOM   1173  N  NH1 . ARG A  1 152 ? 20.699  -39.751 82.420  1.00 31.79  ? 152  ARG A NH1 1 
ATOM   1174  N  NH2 . ARG A  1 152 ? 18.737  -40.545 81.551  1.00 23.13  ? 152  ARG A NH2 1 
ATOM   1175  N  N   . VAL A  1 153 ? 16.754  -34.356 86.709  1.00 22.07  ? 153  VAL A N   1 
ATOM   1176  C  CA  . VAL A  1 153 ? 16.762  -32.914 86.624  1.00 23.22  ? 153  VAL A CA  1 
ATOM   1177  C  C   . VAL A  1 153 ? 18.220  -32.447 86.600  1.00 25.79  ? 153  VAL A C   1 
ATOM   1178  O  O   . VAL A  1 153 ? 19.138  -33.276 86.690  1.00 25.08  ? 153  VAL A O   1 
ATOM   1179  C  CB  . VAL A  1 153 ? 16.053  -32.355 87.831  1.00 25.63  ? 153  VAL A CB  1 
ATOM   1180  C  CG1 . VAL A  1 153 ? 14.594  -32.828 87.822  1.00 27.84  ? 153  VAL A CG1 1 
ATOM   1181  C  CG2 . VAL A  1 153 ? 16.752  -32.845 89.075  1.00 14.70  ? 153  VAL A CG2 1 
ATOM   1182  N  N   . GLY A  1 154 ? 18.424  -31.136 86.452  1.00 18.25  ? 154  GLY A N   1 
ATOM   1183  C  CA  . GLY A  1 154 ? 19.753  -30.536 86.537  1.00 24.89  ? 154  GLY A CA  1 
ATOM   1184  C  C   . GLY A  1 154 ? 20.662  -30.888 85.372  1.00 31.15  ? 154  GLY A C   1 
ATOM   1185  O  O   . GLY A  1 154 ? 20.171  -31.237 84.306  1.00 16.30  ? 154  GLY A O   1 
ATOM   1186  N  N   . THR A  1 155 ? 21.979  -30.801 85.559  1.00 17.53  ? 155  THR A N   1 
ATOM   1187  C  CA  . THR A  1 155 ? 22.889  -31.179 84.482  1.00 18.27  ? 155  THR A CA  1 
ATOM   1188  C  C   . THR A  1 155 ? 22.695  -32.639 84.125  1.00 24.86  ? 155  THR A C   1 
ATOM   1189  O  O   . THR A  1 155 ? 22.804  -33.008 82.970  1.00 20.33  ? 155  THR A O   1 
ATOM   1190  C  CB  . THR A  1 155 ? 24.393  -30.901 84.780  1.00 19.50  ? 155  THR A CB  1 
ATOM   1191  O  OG1 . THR A  1 155 ? 24.857  -31.712 85.866  1.00 20.01  ? 155  THR A OG1 1 
ATOM   1192  C  CG2 . THR A  1 155 ? 24.626  -29.458 85.119  1.00 41.48  ? 155  THR A CG2 1 
ATOM   1193  N  N   . PHE A  1 156 ? 22.361  -33.462 85.107  1.00 18.11  ? 156  PHE A N   1 
ATOM   1194  C  CA  . PHE A  1 156 ? 22.324  -34.895 84.871  1.00 31.59  ? 156  PHE A CA  1 
ATOM   1195  C  C   . PHE A  1 156 ? 21.278  -35.194 83.832  1.00 31.11  ? 156  PHE A C   1 
ATOM   1196  O  O   . PHE A  1 156 ? 21.505  -36.017 82.940  1.00 23.21  ? 156  PHE A O   1 
ATOM   1197  C  CB  . PHE A  1 156 ? 22.078  -35.672 86.165  1.00 18.30  ? 156  PHE A CB  1 
ATOM   1198  C  CG  . PHE A  1 156 ? 23.004  -35.284 87.273  1.00 19.04  ? 156  PHE A CG  1 
ATOM   1199  C  CD1 . PHE A  1 156 ? 24.315  -35.735 87.280  1.00 47.93  ? 156  PHE A CD1 1 
ATOM   1200  C  CD2 . PHE A  1 156 ? 22.590  -34.420 88.272  1.00 18.65  ? 156  PHE A CD2 1 
ATOM   1201  C  CE1 . PHE A  1 156 ? 25.180  -35.354 88.275  1.00 51.69  ? 156  PHE A CE1 1 
ATOM   1202  C  CE2 . PHE A  1 156 ? 23.441  -34.043 89.276  1.00 48.05  ? 156  PHE A CE2 1 
ATOM   1203  C  CZ  . PHE A  1 156 ? 24.739  -34.505 89.278  1.00 52.01  ? 156  PHE A CZ  1 
ATOM   1204  N  N   . GLY A  1 157 ? 20.156  -34.474 83.930  1.00 38.45  ? 157  GLY A N   1 
ATOM   1205  C  CA  . GLY A  1 157 ? 19.045  -34.634 83.018  1.00 16.11  ? 157  GLY A CA  1 
ATOM   1206  C  C   . GLY A  1 157 ? 19.150  -33.797 81.758  1.00 45.70  ? 157  GLY A C   1 
ATOM   1207  O  O   . GLY A  1 157 ? 18.629  -34.197 80.721  1.00 16.20  ? 157  GLY A O   1 
ATOM   1208  N  N   . PHE A  1 158 ? 19.818  -32.648 81.816  1.00 16.49  ? 158  PHE A N   1 
ATOM   1209  C  CA  . PHE A  1 158 ? 19.776  -31.729 80.678  1.00 16.59  ? 158  PHE A CA  1 
ATOM   1210  C  C   . PHE A  1 158 ? 21.051  -31.068 80.138  1.00 27.44  ? 158  PHE A C   1 
ATOM   1211  O  O   . PHE A  1 158 ? 20.942  -30.189 79.281  1.00 24.57  ? 158  PHE A O   1 
ATOM   1212  C  CB  . PHE A  1 158 ? 18.705  -30.671 80.919  1.00 23.43  ? 158  PHE A CB  1 
ATOM   1213  C  CG  . PHE A  1 158 ? 17.353  -31.252 81.080  1.00 22.24  ? 158  PHE A CG  1 
ATOM   1214  C  CD1 . PHE A  1 158 ? 16.633  -31.650 79.978  1.00 29.78  ? 158  PHE A CD1 1 
ATOM   1215  C  CD2 . PHE A  1 158 ? 16.824  -31.463 82.340  1.00 14.59  ? 158  PHE A CD2 1 
ATOM   1216  C  CE1 . PHE A  1 158 ? 15.377  -32.219 80.139  1.00 35.15  ? 158  PHE A CE1 1 
ATOM   1217  C  CE2 . PHE A  1 158 ? 15.597  -32.038 82.507  1.00 31.49  ? 158  PHE A CE2 1 
ATOM   1218  C  CZ  . PHE A  1 158 ? 14.863  -32.412 81.410  1.00 24.95  ? 158  PHE A CZ  1 
ATOM   1219  N  N   . LEU A  1 159 ? 22.239  -31.465 80.606  1.00 32.98  ? 159  LEU A N   1 
ATOM   1220  C  CA  . LEU A  1 159 ? 23.478  -30.930 80.035  1.00 19.35  ? 159  LEU A CA  1 
ATOM   1221  C  C   . LEU A  1 159 ? 23.623  -31.459 78.623  1.00 19.93  ? 159  LEU A C   1 
ATOM   1222  O  O   . LEU A  1 159 ? 23.630  -32.662 78.415  1.00 32.27  ? 159  LEU A O   1 
ATOM   1223  C  CB  . LEU A  1 159 ? 24.717  -31.303 80.860  1.00 25.80  ? 159  LEU A CB  1 
ATOM   1224  C  CG  . LEU A  1 159 ? 26.030  -30.657 80.352  1.00 28.17  ? 159  LEU A CG  1 
ATOM   1225  C  CD1 . LEU A  1 159 ? 26.682  -29.792 81.392  1.00 21.84  ? 159  LEU A CD1 1 
ATOM   1226  C  CD2 . LEU A  1 159 ? 27.020  -31.679 79.845  1.00 22.72  ? 159  LEU A CD2 1 
ATOM   1227  N  N   . ALA A  1 160 ? 23.742  -30.561 77.651  1.00 27.41  ? 160  ALA A N   1 
ATOM   1228  C  CA  . ALA A  1 160 ? 23.734  -30.971 76.248  1.00 27.58  ? 160  ALA A CA  1 
ATOM   1229  C  C   . ALA A  1 160 ? 24.865  -30.381 75.414  1.00 29.02  ? 160  ALA A C   1 
ATOM   1230  O  O   . ALA A  1 160 ? 25.066  -29.174 75.369  1.00 27.66  ? 160  ALA A O   1 
ATOM   1231  C  CB  . ALA A  1 160 ? 22.394  -30.649 75.601  1.00 20.05  ? 160  ALA A CB  1 
ATOM   1232  N  N   . LEU A  1 161 ? 25.596  -31.258 74.746  1.00 23.20  ? 161  LEU A N   1 
ATOM   1233  C  CA  . LEU A  1 161 ? 26.439  -30.863 73.642  1.00 27.16  ? 161  LEU A CA  1 
ATOM   1234  C  C   . LEU A  1 161 ? 25.756  -31.412 72.405  1.00 35.70  ? 161  LEU A C   1 
ATOM   1235  O  O   . LEU A  1 161 ? 26.060  -32.527 71.964  1.00 39.50  ? 161  LEU A O   1 
ATOM   1236  C  CB  . LEU A  1 161 ? 27.827  -31.451 73.798  1.00 29.11  ? 161  LEU A CB  1 
ATOM   1237  C  CG  . LEU A  1 161 ? 28.529  -30.955 75.053  1.00 25.91  ? 161  LEU A CG  1 
ATOM   1238  C  CD1 . LEU A  1 161 ? 29.854  -31.623 75.172  1.00 30.16  ? 161  LEU A CD1 1 
ATOM   1239  C  CD2 . LEU A  1 161 ? 28.712  -29.473 74.992  1.00 25.94  ? 161  LEU A CD2 1 
ATOM   1240  N  N   . PRO A  1 162 ? 24.808  -30.630 71.857  1.00 32.11  ? 162  PRO A N   1 
ATOM   1241  C  CA  . PRO A  1 162 ? 23.854  -30.982 70.801  1.00 27.94  ? 162  PRO A CA  1 
ATOM   1242  C  C   . PRO A  1 162 ? 24.532  -31.622 69.617  1.00 40.92  ? 162  PRO A C   1 
ATOM   1243  O  O   . PRO A  1 162 ? 25.280  -30.945 68.912  1.00 46.01  ? 162  PRO A O   1 
ATOM   1244  C  CB  . PRO A  1 162 ? 23.329  -29.630 70.354  1.00 23.76  ? 162  PRO A CB  1 
ATOM   1245  C  CG  . PRO A  1 162 ? 23.480  -28.782 71.517  1.00 33.95  ? 162  PRO A CG  1 
ATOM   1246  C  CD  . PRO A  1 162 ? 24.715  -29.207 72.209  1.00 28.80  ? 162  PRO A CD  1 
ATOM   1247  N  N   . GLY A  1 163 ? 24.271  -32.903 69.390  1.00 49.07  ? 163  GLY A N   1 
ATOM   1248  C  CA  . GLY A  1 163 ? 24.814  -33.577 68.229  1.00 52.86  ? 163  GLY A CA  1 
ATOM   1249  C  C   . GLY A  1 163 ? 25.814  -34.640 68.606  1.00 55.84  ? 163  GLY A C   1 
ATOM   1250  O  O   . GLY A  1 163 ? 26.123  -35.527 67.817  1.00 59.96  ? 163  GLY A O   1 
ATOM   1251  N  N   . SER A  1 164 ? 26.336  -34.552 69.818  1.00 57.36  ? 164  SER A N   1 
ATOM   1252  C  CA  . SER A  1 164 ? 27.242  -35.581 70.277  1.00 57.40  ? 164  SER A CA  1 
ATOM   1253  C  C   . SER A  1 164 ? 26.439  -36.819 70.649  1.00 53.33  ? 164  SER A C   1 
ATOM   1254  O  O   . SER A  1 164 ? 25.207  -36.789 70.734  1.00 46.17  ? 164  SER A O   1 
ATOM   1255  C  CB  . SER A  1 164 ? 28.027  -35.112 71.489  1.00 57.50  ? 164  SER A CB  1 
ATOM   1256  O  OG  . SER A  1 164 ? 27.480  -35.692 72.655  1.00 59.83  ? 164  SER A OG  1 
ATOM   1257  N  N   . ARG A  1 165 ? 27.155  -37.910 70.870  1.00 50.07  ? 165  ARG A N   1 
ATOM   1258  C  CA  . ARG A  1 165 ? 26.540  -39.156 71.264  1.00 42.27  ? 165  ARG A CA  1 
ATOM   1259  C  C   . ARG A  1 165 ? 26.501  -39.217 72.789  1.00 37.89  ? 165  ARG A C   1 
ATOM   1260  O  O   . ARG A  1 165 ? 25.541  -39.709 73.373  1.00 42.89  ? 165  ARG A O   1 
ATOM   1261  C  CB  . ARG A  1 165 ? 27.329  -40.336 70.671  1.00 44.08  ? 165  ARG A CB  1 
ATOM   1262  C  CG  . ARG A  1 165 ? 27.002  -41.682 71.303  1.00 57.33  ? 165  ARG A CG  1 
ATOM   1263  C  CD  . ARG A  1 165 ? 28.021  -42.781 70.972  1.00 69.83  ? 165  ARG A CD  1 
ATOM   1264  N  NE  . ARG A  1 165 ? 28.180  -43.719 72.090  1.00 81.80  ? 165  ARG A NE  1 
ATOM   1265  C  CZ  . ARG A  1 165 ? 27.290  -44.651 72.444  1.00 88.91  ? 165  ARG A CZ  1 
ATOM   1266  N  NH1 . ARG A  1 165 ? 26.150  -44.795 71.770  1.00 88.85  ? 165  ARG A NH1 1 
ATOM   1267  N  NH2 . ARG A  1 165 ? 27.540  -45.446 73.481  1.00 90.20  ? 165  ARG A NH2 1 
ATOM   1268  N  N   . GLU A  1 166 ? 27.535  -38.672 73.425  1.00 34.23  ? 166  GLU A N   1 
ATOM   1269  C  CA  . GLU A  1 166 ? 27.758  -38.849 74.861  1.00 38.02  ? 166  GLU A CA  1 
ATOM   1270  C  C   . GLU A  1 166 ? 26.924  -37.927 75.737  1.00 40.65  ? 166  GLU A C   1 
ATOM   1271  O  O   . GLU A  1 166 ? 26.674  -38.244 76.896  1.00 47.26  ? 166  GLU A O   1 
ATOM   1272  C  CB  . GLU A  1 166 ? 29.236  -38.648 75.214  1.00 44.31  ? 166  GLU A CB  1 
ATOM   1273  C  CG  . GLU A  1 166 ? 30.230  -39.178 74.209  1.00 42.35  ? 166  GLU A CG  1 
ATOM   1274  C  CD  . GLU A  1 166 ? 30.321  -40.693 74.197  1.00 59.04  ? 166  GLU A CD  1 
ATOM   1275  O  OE1 . GLU A  1 166 ? 29.779  -41.348 75.121  1.00 56.38  ? 166  GLU A OE1 1 
ATOM   1276  O  OE2 . GLU A  1 166 ? 30.944  -41.232 73.250  1.00 72.61  ? 166  GLU A OE2 1 
ATOM   1277  N  N   . ALA A  1 167 ? 26.516  -36.784 75.191  1.00 39.89  ? 167  ALA A N   1 
ATOM   1278  C  CA  . ALA A  1 167 ? 25.578  -35.881 75.871  1.00 35.79  ? 167  ALA A CA  1 
ATOM   1279  C  C   . ALA A  1 167 ? 24.539  -35.261 74.904  1.00 30.47  ? 167  ALA A C   1 
ATOM   1280  O  O   . ALA A  1 167 ? 24.562  -34.067 74.631  1.00 28.71  ? 167  ALA A O   1 
ATOM   1281  C  CB  . ALA A  1 167 ? 26.345  -34.799 76.613  1.00 32.09  ? 167  ALA A CB  1 
ATOM   1282  N  N   . PRO A  1 168 ? 23.607  -36.076 74.395  1.00 32.15  ? 168  PRO A N   1 
ATOM   1283  C  CA  . PRO A  1 168 ? 22.729  -35.650 73.301  1.00 34.18  ? 168  PRO A CA  1 
ATOM   1284  C  C   . PRO A  1 168 ? 21.714  -34.596 73.688  1.00 28.71  ? 168  PRO A C   1 
ATOM   1285  O  O   . PRO A  1 168 ? 21.233  -33.888 72.801  1.00 28.67  ? 168  PRO A O   1 
ATOM   1286  C  CB  . PRO A  1 168 ? 21.969  -36.928 72.964  1.00 37.40  ? 168  PRO A CB  1 
ATOM   1287  C  CG  . PRO A  1 168 ? 21.863  -37.615 74.257  1.00 38.29  ? 168  PRO A CG  1 
ATOM   1288  C  CD  . PRO A  1 168 ? 23.239  -37.414 74.877  1.00 38.25  ? 168  PRO A CD  1 
ATOM   1289  N  N   . GLY A  1 169 ? 21.368  -34.517 74.968  1.00 25.99  ? 169  GLY A N   1 
ATOM   1290  C  CA  . GLY A  1 169 ? 20.352  -33.578 75.414  1.00 24.78  ? 169  GLY A CA  1 
ATOM   1291  C  C   . GLY A  1 169 ? 18.937  -34.128 75.527  1.00 20.94  ? 169  GLY A C   1 
ATOM   1292  O  O   . GLY A  1 169 ? 18.531  -35.009 74.768  1.00 23.28  ? 169  GLY A O   1 
ATOM   1293  N  N   . ASN A  1 170 ? 18.198  -33.585 76.490  1.00 21.75  ? 170  ASN A N   1 
ATOM   1294  C  CA  . ASN A  1 170 ? 16.809  -33.932 76.780  1.00 26.23  ? 170  ASN A CA  1 
ATOM   1295  C  C   . ASN A  1 170 ? 16.649  -35.313 77.392  1.00 33.75  ? 170  ASN A C   1 
ATOM   1296  O  O   . ASN A  1 170 ? 15.554  -35.879 77.382  1.00 33.36  ? 170  ASN A O   1 
ATOM   1297  C  CB  . ASN A  1 170 ? 15.906  -33.768 75.550  1.00 16.63  ? 170  ASN A CB  1 
ATOM   1298  C  CG  . ASN A  1 170 ? 15.953  -32.371 74.982  1.00 26.11  ? 170  ASN A CG  1 
ATOM   1299  O  OD1 . ASN A  1 170 ? 16.234  -31.416 75.696  1.00 22.97  ? 170  ASN A OD1 1 
ATOM   1300  N  ND2 . ASN A  1 170 ? 15.676  -32.240 73.697  1.00 17.33  ? 170  ASN A ND2 1 
ATOM   1301  N  N   . VAL A  1 171 ? 17.728  -35.852 77.944  1.00 16.88  ? 171  VAL A N   1 
ATOM   1302  C  CA  . VAL A  1 171 ? 17.629  -37.170 78.566  1.00 25.79  ? 171  VAL A CA  1 
ATOM   1303  C  C   . VAL A  1 171 ? 16.605  -37.250 79.725  1.00 20.49  ? 171  VAL A C   1 
ATOM   1304  O  O   . VAL A  1 171 ? 16.106  -38.327 80.013  1.00 15.97  ? 171  VAL A O   1 
ATOM   1305  C  CB  . VAL A  1 171 ? 19.031  -37.829 78.917  1.00 17.81  ? 171  VAL A CB  1 
ATOM   1306  C  CG1 . VAL A  1 171 ? 19.905  -37.859 77.707  1.00 18.84  ? 171  VAL A CG1 1 
ATOM   1307  C  CG2 . VAL A  1 171 ? 19.734  -37.128 80.052  1.00 17.72  ? 171  VAL A CG2 1 
ATOM   1308  N  N   . GLY A  1 172 ? 16.276  -36.136 80.369  1.00 15.40  ? 172  GLY A N   1 
ATOM   1309  C  CA  . GLY A  1 172 ? 15.243  -36.164 81.395  1.00 45.03  ? 172  GLY A CA  1 
ATOM   1310  C  C   . GLY A  1 172 ? 13.861  -36.469 80.816  1.00 14.33  ? 172  GLY A C   1 
ATOM   1311  O  O   . GLY A  1 172 ? 13.033  -37.216 81.386  1.00 23.97  ? 172  GLY A O   1 
ATOM   1312  N  N   . LEU A  1 173 ? 13.626  -35.880 79.652  1.00 22.42  ? 173  LEU A N   1 
ATOM   1313  C  CA  . LEU A  1 173 ? 12.417  -36.108 78.893  1.00 28.81  ? 173  LEU A CA  1 
ATOM   1314  C  C   . LEU A  1 173 ? 12.348  -37.560 78.435  1.00 25.85  ? 173  LEU A C   1 
ATOM   1315  O  O   . LEU A  1 173 ? 11.279  -38.168 78.437  1.00 28.75  ? 173  LEU A O   1 
ATOM   1316  C  CB  . LEU A  1 173 ? 12.386  -35.176 77.691  1.00 24.22  ? 173  LEU A CB  1 
ATOM   1317  C  CG  . LEU A  1 173 ? 12.167  -33.717 78.039  1.00 22.80  ? 173  LEU A CG  1 
ATOM   1318  C  CD1 . LEU A  1 173 ? 12.497  -32.838 76.832  1.00 14.73  ? 173  LEU A CD1 1 
ATOM   1319  C  CD2 . LEU A  1 173 ? 10.733  -33.545 78.471  1.00 13.76  ? 173  LEU A CD2 1 
ATOM   1320  N  N   . LEU A  1 174 ? 13.492  -38.105 78.043  1.00 19.90  ? 174  LEU A N   1 
ATOM   1321  C  CA  . LEU A  1 174 ? 13.575  -39.502 77.661  1.00 22.19  ? 174  LEU A CA  1 
ATOM   1322  C  C   . LEU A  1 174 ? 13.301  -40.408 78.853  1.00 31.08  ? 174  LEU A C   1 
ATOM   1323  O  O   . LEU A  1 174 ? 12.740  -41.489 78.681  1.00 40.99  ? 174  LEU A O   1 
ATOM   1324  C  CB  . LEU A  1 174 ? 14.948  -39.812 77.074  1.00 26.97  ? 174  LEU A CB  1 
ATOM   1325  C  CG  . LEU A  1 174 ? 15.195  -39.160 75.718  1.00 26.71  ? 174  LEU A CG  1 
ATOM   1326  C  CD1 . LEU A  1 174 ? 16.560  -39.537 75.158  1.00 18.60  ? 174  LEU A CD1 1 
ATOM   1327  C  CD2 . LEU A  1 174 ? 14.078  -39.575 74.789  1.00 21.78  ? 174  LEU A CD2 1 
ATOM   1328  N  N   . ASP A  1 175 ? 13.698  -39.980 80.055  1.00 25.05  ? 175  ASP A N   1 
ATOM   1329  C  CA  . ASP A  1 175 ? 13.358  -40.720 81.275  1.00 21.57  ? 175  ASP A CA  1 
ATOM   1330  C  C   . ASP A  1 175 ? 11.834  -40.776 81.412  1.00 23.21  ? 175  ASP A C   1 
ATOM   1331  O  O   . ASP A  1 175 ? 11.240  -41.862 81.518  1.00 14.86  ? 175  ASP A O   1 
ATOM   1332  C  CB  . ASP A  1 175 ? 13.996  -40.096 82.524  1.00 14.96  ? 175  ASP A CB  1 
ATOM   1333  C  CG  . ASP A  1 175 ? 15.520  -40.146 82.496  1.00 33.40  ? 175  ASP A CG  1 
ATOM   1334  O  OD1 . ASP A  1 175 ? 16.067  -41.013 81.793  1.00 38.82  ? 175  ASP A OD1 1 
ATOM   1335  O  OD2 . ASP A  1 175 ? 16.184  -39.324 83.170  1.00 24.65  ? 175  ASP A OD2 1 
ATOM   1336  N  N   . GLN A  1 176 ? 11.213  -39.599 81.384  1.00 14.15  ? 176  GLN A N   1 
ATOM   1337  C  CA  . GLN A  1 176 ? 9.757   -39.506 81.406  1.00 13.81  ? 176  GLN A CA  1 
ATOM   1338  C  C   . GLN A  1 176 ? 9.079   -40.420 80.381  1.00 25.41  ? 176  GLN A C   1 
ATOM   1339  O  O   . GLN A  1 176 ? 8.059   -41.079 80.669  1.00 14.25  ? 176  GLN A O   1 
ATOM   1340  C  CB  . GLN A  1 176 ? 9.317   -38.072 81.128  1.00 13.45  ? 176  GLN A CB  1 
ATOM   1341  C  CG  . GLN A  1 176 ? 9.876   -37.041 82.065  1.00 22.25  ? 176  GLN A CG  1 
ATOM   1342  C  CD  . GLN A  1 176 ? 9.371   -35.662 81.733  1.00 26.02  ? 176  GLN A CD  1 
ATOM   1343  O  OE1 . GLN A  1 176 ? 8.785   -35.446 80.676  1.00 31.51  ? 176  GLN A OE1 1 
ATOM   1344  N  NE2 . GLN A  1 176 ? 9.584   -34.719 82.638  1.00 24.91  ? 176  GLN A NE2 1 
ATOM   1345  N  N   . ARG A  1 177 ? 9.651   -40.447 79.181  1.00 18.54  ? 177  ARG A N   1 
ATOM   1346  C  CA  . ARG A  1 177 ? 9.067   -41.202 78.086  1.00 22.76  ? 177  ARG A CA  1 
ATOM   1347  C  C   . ARG A  1 177 ? 9.169   -42.680 78.396  1.00 27.82  ? 177  ARG A C   1 
ATOM   1348  O  O   . ARG A  1 177 ? 8.217   -43.432 78.197  1.00 25.28  ? 177  ARG A O   1 
ATOM   1349  C  CB  . ARG A  1 177 ? 9.749   -40.876 76.755  1.00 15.93  ? 177  ARG A CB  1 
ATOM   1350  C  CG  . ARG A  1 177 ? 9.456   -41.870 75.652  1.00 16.80  ? 177  ARG A CG  1 
ATOM   1351  C  CD  . ARG A  1 177 ? 10.189  -41.533 74.359  1.00 17.54  ? 177  ARG A CD  1 
ATOM   1352  N  NE  . ARG A  1 177 ? 9.627   -40.336 73.739  1.00 25.02  ? 177  ARG A NE  1 
ATOM   1353  C  CZ  . ARG A  1 177 ? 10.173  -39.681 72.719  1.00 27.01  ? 177  ARG A CZ  1 
ATOM   1354  N  NH1 . ARG A  1 177 ? 11.319  -40.097 72.194  1.00 28.80  ? 177  ARG A NH1 1 
ATOM   1355  N  NH2 . ARG A  1 177 ? 9.575   -38.594 72.235  1.00 27.47  ? 177  ARG A NH2 1 
ATOM   1356  N  N   . LEU A  1 178 ? 10.325  -43.096 78.902  1.00 29.59  ? 178  LEU A N   1 
ATOM   1357  C  CA  . LEU A  1 178 ? 10.516  -44.498 79.247  1.00 27.35  ? 178  LEU A CA  1 
ATOM   1358  C  C   . LEU A  1 178 ? 9.474   -44.888 80.291  1.00 28.75  ? 178  LEU A C   1 
ATOM   1359  O  O   . LEU A  1 178 ? 8.854   -45.946 80.193  1.00 28.43  ? 178  LEU A O   1 
ATOM   1360  C  CB  . LEU A  1 178 ? 11.939  -44.753 79.734  1.00 20.62  ? 178  LEU A CB  1 
ATOM   1361  C  CG  . LEU A  1 178 ? 12.406  -46.179 80.012  1.00 18.46  ? 178  LEU A CG  1 
ATOM   1362  C  CD1 . LEU A  1 178 ? 12.017  -47.104 78.897  1.00 18.32  ? 178  LEU A CD1 1 
ATOM   1363  C  CD2 . LEU A  1 178 ? 13.928  -46.203 80.208  1.00 19.21  ? 178  LEU A CD2 1 
ATOM   1364  N  N   . ALA A  1 179 ? 9.248   -44.015 81.265  1.00 26.69  ? 179  ALA A N   1 
ATOM   1365  C  CA  . ALA A  1 179 ? 8.198   -44.276 82.240  1.00 23.82  ? 179  ALA A CA  1 
ATOM   1366  C  C   . ALA A  1 179 ? 6.834   -44.440 81.544  1.00 24.96  ? 179  ALA A C   1 
ATOM   1367  O  O   . ALA A  1 179 ? 6.042   -45.325 81.896  1.00 29.09  ? 179  ALA A O   1 
ATOM   1368  C  CB  . ALA A  1 179 ? 8.166   -43.182 83.298  1.00 14.37  ? 179  ALA A CB  1 
ATOM   1369  N  N   . LEU A  1 180 ? 6.574   -43.614 80.532  1.00 25.26  ? 180  LEU A N   1 
ATOM   1370  C  CA  . LEU A  1 180 ? 5.328   -43.740 79.769  1.00 26.49  ? 180  LEU A CA  1 
ATOM   1371  C  C   . LEU A  1 180 ? 5.206   -45.090 79.072  1.00 34.70  ? 180  LEU A C   1 
ATOM   1372  O  O   . LEU A  1 180 ? 4.116   -45.679 79.026  1.00 37.97  ? 180  LEU A O   1 
ATOM   1373  C  CB  . LEU A  1 180 ? 5.218   -42.639 78.731  1.00 15.38  ? 180  LEU A CB  1 
ATOM   1374  C  CG  . LEU A  1 180 ? 4.494   -41.374 79.152  1.00 20.07  ? 180  LEU A CG  1 
ATOM   1375  C  CD1 . LEU A  1 180 ? 4.796   -40.987 80.582  1.00 14.21  ? 180  LEU A CD1 1 
ATOM   1376  C  CD2 . LEU A  1 180 ? 4.901   -40.289 78.205  1.00 14.87  ? 180  LEU A CD2 1 
ATOM   1377  N  N   . GLN A  1 181 ? 6.321   -45.572 78.529  1.00 16.66  ? 181  GLN A N   1 
ATOM   1378  C  CA  . GLN A  1 181 ? 6.367   -46.882 77.898  1.00 23.50  ? 181  GLN A CA  1 
ATOM   1379  C  C   . GLN A  1 181 ? 6.104   -47.985 78.925  1.00 25.99  ? 181  GLN A C   1 
ATOM   1380  O  O   . GLN A  1 181 ? 5.380   -48.942 78.653  1.00 27.99  ? 181  GLN A O   1 
ATOM   1381  C  CB  . GLN A  1 181 ? 7.716   -47.112 77.211  1.00 25.34  ? 181  GLN A CB  1 
ATOM   1382  C  CG  . GLN A  1 181 ? 7.991   -46.199 76.037  1.00 29.66  ? 181  GLN A CG  1 
ATOM   1383  C  CD  . GLN A  1 181 ? 9.349   -46.453 75.413  1.00 40.52  ? 181  GLN A CD  1 
ATOM   1384  O  OE1 . GLN A  1 181 ? 10.013  -47.439 75.731  1.00 49.56  ? 181  GLN A OE1 1 
ATOM   1385  N  NE2 . GLN A  1 181 ? 9.774   -45.562 74.525  1.00 41.22  ? 181  GLN A NE2 1 
ATOM   1386  N  N   . TRP A  1 182 ? 6.697   -47.849 80.106  1.00 23.35  ? 182  TRP A N   1 
ATOM   1387  C  CA  . TRP A  1 182 ? 6.486   -48.816 81.176  1.00 24.76  ? 182  TRP A CA  1 
ATOM   1388  C  C   . TRP A  1 182 ? 5.010   -48.885 81.488  1.00 35.92  ? 182  TRP A C   1 
ATOM   1389  O  O   . TRP A  1 182 ? 4.448   -49.969 81.578  1.00 44.69  ? 182  TRP A O   1 
ATOM   1390  C  CB  . TRP A  1 182 ? 7.251   -48.413 82.430  1.00 25.31  ? 182  TRP A CB  1 
ATOM   1391  C  CG  . TRP A  1 182 ? 7.334   -49.482 83.473  1.00 22.42  ? 182  TRP A CG  1 
ATOM   1392  C  CD1 . TRP A  1 182 ? 8.316   -50.414 83.615  1.00 25.78  ? 182  TRP A CD1 1 
ATOM   1393  C  CD2 . TRP A  1 182 ? 6.414   -49.707 84.535  1.00 21.10  ? 182  TRP A CD2 1 
ATOM   1394  N  NE1 . TRP A  1 182 ? 8.059   -51.212 84.696  1.00 24.11  ? 182  TRP A NE1 1 
ATOM   1395  C  CE2 . TRP A  1 182 ? 6.894   -50.795 85.278  1.00 24.81  ? 182  TRP A CE2 1 
ATOM   1396  C  CE3 . TRP A  1 182 ? 5.226   -49.092 84.934  1.00 25.79  ? 182  TRP A CE3 1 
ATOM   1397  C  CZ2 . TRP A  1 182 ? 6.225   -51.285 86.389  1.00 32.70  ? 182  TRP A CZ2 1 
ATOM   1398  C  CZ3 . TRP A  1 182 ? 4.563   -49.581 86.038  1.00 28.03  ? 182  TRP A CZ3 1 
ATOM   1399  C  CH2 . TRP A  1 182 ? 5.058   -50.666 86.749  1.00 30.81  ? 182  TRP A CH2 1 
ATOM   1400  N  N   . VAL A  1 183 ? 4.380   -47.723 81.637  1.00 30.79  ? 183  VAL A N   1 
ATOM   1401  C  CA  . VAL A  1 183 ? 2.945   -47.693 81.845  1.00 22.91  ? 183  VAL A CA  1 
ATOM   1402  C  C   . VAL A  1 183 ? 2.189   -48.398 80.722  1.00 24.37  ? 183  VAL A C   1 
ATOM   1403  O  O   . VAL A  1 183 ? 1.294   -49.198 81.004  1.00 35.54  ? 183  VAL A O   1 
ATOM   1404  C  CB  . VAL A  1 183 ? 2.413   -46.270 82.022  1.00 23.58  ? 183  VAL A CB  1 
ATOM   1405  C  CG1 . VAL A  1 183 ? 0.886   -46.279 82.039  1.00 16.30  ? 183  VAL A CG1 1 
ATOM   1406  C  CG2 . VAL A  1 183 ? 2.963   -45.665 83.306  1.00 17.49  ? 183  VAL A CG2 1 
ATOM   1407  N  N   . GLN A  1 184 ? 2.545   -48.126 79.463  1.00 24.65  ? 184  GLN A N   1 
ATOM   1408  C  CA  . GLN A  1 184 ? 1.826   -48.754 78.340  1.00 28.99  ? 184  GLN A CA  1 
ATOM   1409  C  C   . GLN A  1 184 ? 1.954   -50.268 78.375  1.00 36.90  ? 184  GLN A C   1 
ATOM   1410  O  O   . GLN A  1 184 ? 0.995   -50.982 78.045  1.00 49.24  ? 184  GLN A O   1 
ATOM   1411  C  CB  . GLN A  1 184 ? 2.286   -48.242 76.968  1.00 26.68  ? 184  GLN A CB  1 
ATOM   1412  C  CG  . GLN A  1 184 ? 1.289   -48.552 75.834  1.00 34.50  ? 184  GLN A CG  1 
ATOM   1413  C  CD  . GLN A  1 184 ? 1.901   -48.523 74.425  1.00 44.53  ? 184  GLN A CD  1 
ATOM   1414  O  OE1 . GLN A  1 184 ? 2.925   -49.151 74.161  1.00 45.62  ? 184  GLN A OE1 1 
ATOM   1415  N  NE2 . GLN A  1 184 ? 1.256   -47.800 73.516  1.00 50.85  ? 184  GLN A NE2 1 
ATOM   1416  N  N   . GLU A  1 185 ? 3.130   -50.740 78.799  1.00 28.55  ? 185  GLU A N   1 
ATOM   1417  C  CA  . GLU A  1 185 ? 3.474   -52.164 78.810  1.00 28.17  ? 185  GLU A CA  1 
ATOM   1418  C  C   . GLU A  1 185 ? 3.024   -52.940 80.053  1.00 35.53  ? 185  GLU A C   1 
ATOM   1419  O  O   . GLU A  1 185 ? 2.933   -54.163 80.009  1.00 45.00  ? 185  GLU A O   1 
ATOM   1420  C  CB  . GLU A  1 185 ? 4.985   -52.349 78.625  1.00 31.48  ? 185  GLU A CB  1 
ATOM   1421  C  CG  . GLU A  1 185 ? 5.488   -52.118 77.197  1.00 49.92  ? 185  GLU A CG  1 
ATOM   1422  C  CD  . GLU A  1 185 ? 7.023   -52.045 77.085  1.00 65.22  ? 185  GLU A CD  1 
ATOM   1423  O  OE1 . GLU A  1 185 ? 7.725   -52.548 77.999  1.00 69.84  ? 185  GLU A OE1 1 
ATOM   1424  O  OE2 . GLU A  1 185 ? 7.520   -51.474 76.079  1.00 64.83  ? 185  GLU A OE2 1 
ATOM   1425  N  N   . ASN A  1 186 ? 2.744   -52.248 81.155  1.00 35.86  ? 186  ASN A N   1 
ATOM   1426  C  CA  . ASN A  1 186 ? 2.555   -52.916 82.450  1.00 31.38  ? 186  ASN A CA  1 
ATOM   1427  C  C   . ASN A  1 186 ? 1.384   -52.438 83.304  1.00 29.04  ? 186  ASN A C   1 
ATOM   1428  O  O   . ASN A  1 186 ? 1.074   -53.063 84.317  1.00 27.73  ? 186  ASN A O   1 
ATOM   1429  C  CB  . ASN A  1 186 ? 3.823   -52.798 83.317  1.00 27.50  ? 186  ASN A CB  1 
ATOM   1430  C  CG  . ASN A  1 186 ? 5.060   -53.249 82.603  1.00 29.90  ? 186  ASN A CG  1 
ATOM   1431  O  OD1 . ASN A  1 186 ? 5.498   -54.394 82.731  1.00 27.93  ? 186  ASN A OD1 1 
ATOM   1432  N  ND2 . ASN A  1 186 ? 5.639   -52.347 81.837  1.00 38.07  ? 186  ASN A ND2 1 
ATOM   1433  N  N   . ILE A  1 187 ? 0.757   -51.322 82.955  1.00 29.43  ? 187  ILE A N   1 
ATOM   1434  C  CA  . ILE A  1 187 ? -0.225  -50.774 83.883  1.00 27.49  ? 187  ILE A CA  1 
ATOM   1435  C  C   . ILE A  1 187 ? -1.468  -51.656 83.960  1.00 33.90  ? 187  ILE A C   1 
ATOM   1436  O  O   . ILE A  1 187 ? -2.229  -51.569 84.910  1.00 33.55  ? 187  ILE A O   1 
ATOM   1437  C  CB  . ILE A  1 187 ? -0.601  -49.305 83.576  1.00 20.51  ? 187  ILE A CB  1 
ATOM   1438  C  CG1 . ILE A  1 187 ? -0.995  -48.587 84.869  1.00 20.66  ? 187  ILE A CG1 1 
ATOM   1439  C  CG2 . ILE A  1 187 ? -1.700  -49.230 82.544  1.00 22.88  ? 187  ILE A CG2 1 
ATOM   1440  C  CD1 . ILE A  1 187 ? 0.139   -48.537 85.876  1.00 24.01  ? 187  ILE A CD1 1 
ATOM   1441  N  N   . ALA A  1 188 ? -1.648  -52.525 82.968  1.00 38.29  ? 188  ALA A N   1 
ATOM   1442  C  CA  . ALA A  1 188 ? -2.791  -53.432 82.938  1.00 35.49  ? 188  ALA A CA  1 
ATOM   1443  C  C   . ALA A  1 188 ? -2.743  -54.404 84.107  1.00 36.76  ? 188  ALA A C   1 
ATOM   1444  O  O   . ALA A  1 188 ? -3.788  -54.847 84.620  1.00 32.74  ? 188  ALA A O   1 
ATOM   1445  C  CB  . ALA A  1 188 ? -2.819  -54.191 81.621  1.00 32.60  ? 188  ALA A CB  1 
ATOM   1446  N  N   . ALA A  1 189 ? -1.517  -54.727 84.518  1.00 21.05  ? 189  ALA A N   1 
ATOM   1447  C  CA  . ALA A  1 189 ? -1.281  -55.706 85.576  1.00 21.49  ? 189  ALA A CA  1 
ATOM   1448  C  C   . ALA A  1 189 ? -1.818  -55.210 86.905  1.00 26.78  ? 189  ALA A C   1 
ATOM   1449  O  O   . ALA A  1 189 ? -2.246  -55.999 87.744  1.00 31.10  ? 189  ALA A O   1 
ATOM   1450  C  CB  . ALA A  1 189 ? 0.193   -56.022 85.687  1.00 21.36  ? 189  ALA A CB  1 
ATOM   1451  N  N   . PHE A  1 190 ? -1.796  -53.892 87.074  1.00 25.39  ? 190  PHE A N   1 
ATOM   1452  C  CA  . PHE A  1 190 ? -2.301  -53.237 88.273  1.00 26.48  ? 190  PHE A CA  1 
ATOM   1453  C  C   . PHE A  1 190 ? -3.784  -52.865 88.140  1.00 33.06  ? 190  PHE A C   1 
ATOM   1454  O  O   . PHE A  1 190 ? -4.392  -52.372 89.085  1.00 38.16  ? 190  PHE A O   1 
ATOM   1455  C  CB  . PHE A  1 190 ? -1.498  -51.966 88.559  1.00 22.30  ? 190  PHE A CB  1 
ATOM   1456  C  CG  . PHE A  1 190 ? -0.025  -52.192 88.730  1.00 18.73  ? 190  PHE A CG  1 
ATOM   1457  C  CD1 . PHE A  1 190 ? 0.784   -52.438 87.641  1.00 18.71  ? 190  PHE A CD1 1 
ATOM   1458  C  CD2 . PHE A  1 190 ? 0.554   -52.112 89.978  1.00 18.64  ? 190  PHE A CD2 1 
ATOM   1459  C  CE1 . PHE A  1 190 ? 2.135   -52.627 87.799  1.00 30.08  ? 190  PHE A CE1 1 
ATOM   1460  C  CE2 . PHE A  1 190 ? 1.905   -52.300 90.142  1.00 25.50  ? 190  PHE A CE2 1 
ATOM   1461  C  CZ  . PHE A  1 190 ? 2.698   -52.557 89.050  1.00 26.54  ? 190  PHE A CZ  1 
ATOM   1462  N  N   . GLY A  1 191 ? -4.368  -53.072 86.968  1.00 20.73  ? 191  GLY A N   1 
ATOM   1463  C  CA  . GLY A  1 191 ? -5.763  -52.729 86.785  1.00 29.13  ? 191  GLY A CA  1 
ATOM   1464  C  C   . GLY A  1 191 ? -5.962  -51.475 85.965  1.00 29.40  ? 191  GLY A C   1 
ATOM   1465  O  O   . GLY A  1 191 ? -7.083  -51.153 85.575  1.00 35.22  ? 191  GLY A O   1 
ATOM   1466  N  N   . GLY A  1 192 ? -4.870  -50.764 85.702  1.00 28.70  ? 192  GLY A N   1 
ATOM   1467  C  CA  . GLY A  1 192 ? -4.895  -49.607 84.828  1.00 28.37  ? 192  GLY A CA  1 
ATOM   1468  C  C   . GLY A  1 192 ? -5.324  -50.011 83.429  1.00 35.80  ? 192  GLY A C   1 
ATOM   1469  O  O   . GLY A  1 192 ? -5.488  -51.190 83.140  1.00 44.74  ? 192  GLY A O   1 
ATOM   1470  N  N   . ASP A  1 193 ? -5.504  -49.029 82.557  1.00 33.96  ? 193  ASP A N   1 
ATOM   1471  C  CA  . ASP A  1 193 ? -6.023  -49.271 81.221  1.00 30.75  ? 193  ASP A CA  1 
ATOM   1472  C  C   . ASP A  1 193 ? -5.157  -48.523 80.235  1.00 27.15  ? 193  ASP A C   1 
ATOM   1473  O  O   . ASP A  1 193 ? -5.287  -47.319 80.101  1.00 35.04  ? 193  ASP A O   1 
ATOM   1474  C  CB  . ASP A  1 193 ? -7.478  -48.794 81.147  1.00 33.76  ? 193  ASP A CB  1 
ATOM   1475  C  CG  . ASP A  1 193 ? -8.063  -48.840 79.737  1.00 35.64  ? 193  ASP A CG  1 
ATOM   1476  O  OD1 . ASP A  1 193 ? -7.467  -49.470 78.839  1.00 40.41  ? 193  ASP A OD1 1 
ATOM   1477  O  OD2 . ASP A  1 193 ? -9.153  -48.251 79.542  1.00 31.78  ? 193  ASP A OD2 1 
ATOM   1478  N  N   . PRO A  1 194 ? -4.269  -49.238 79.532  1.00 23.78  ? 194  PRO A N   1 
ATOM   1479  C  CA  . PRO A  1 194 ? -3.344  -48.568 78.609  1.00 33.74  ? 194  PRO A CA  1 
ATOM   1480  C  C   . PRO A  1 194 ? -4.059  -47.781 77.512  1.00 38.71  ? 194  PRO A C   1 
ATOM   1481  O  O   . PRO A  1 194 ? -3.431  -46.899 76.911  1.00 40.37  ? 194  PRO A O   1 
ATOM   1482  C  CB  . PRO A  1 194 ? -2.546  -49.728 77.997  1.00 38.67  ? 194  PRO A CB  1 
ATOM   1483  C  CG  . PRO A  1 194 ? -2.732  -50.880 78.926  1.00 35.40  ? 194  PRO A CG  1 
ATOM   1484  C  CD  . PRO A  1 194 ? -4.085  -50.698 79.548  1.00 25.16  ? 194  PRO A CD  1 
ATOM   1485  N  N   . MET A  1 195 ? -5.338  -48.092 77.272  1.00 34.71  ? 195  MET A N   1 
ATOM   1486  C  CA  . MET A  1 195 ? -6.125  -47.436 76.233  1.00 22.18  ? 195  MET A CA  1 
ATOM   1487  C  C   . MET A  1 195 ? -6.593  -46.035 76.604  1.00 36.05  ? 195  MET A C   1 
ATOM   1488  O  O   . MET A  1 195 ? -7.117  -45.310 75.763  1.00 40.97  ? 195  MET A O   1 
ATOM   1489  C  CB  . MET A  1 195 ? -7.338  -48.275 75.878  1.00 42.48  ? 195  MET A CB  1 
ATOM   1490  C  CG  . MET A  1 195 ? -7.072  -49.477 75.007  1.00 24.48  ? 195  MET A CG  1 
ATOM   1491  S  SD  . MET A  1 195 ? -8.476  -50.612 75.089  1.00 67.20  ? 195  MET A SD  1 
ATOM   1492  C  CE  . MET A  1 195 ? -9.864  -49.574 74.593  1.00 26.78  ? 195  MET A CE  1 
ATOM   1493  N  N   . SER A  1 196 ? -6.413  -45.655 77.864  1.00 32.45  ? 196  SER A N   1 
ATOM   1494  C  CA  . SER A  1 196 ? -6.805  -44.325 78.333  1.00 31.11  ? 196  SER A CA  1 
ATOM   1495  C  C   . SER A  1 196 ? -5.794  -43.775 79.332  1.00 19.06  ? 196  SER A C   1 
ATOM   1496  O  O   . SER A  1 196 ? -5.907  -43.976 80.535  1.00 27.27  ? 196  SER A O   1 
ATOM   1497  C  CB  . SER A  1 196 ? -8.219  -44.349 78.938  1.00 29.01  ? 196  SER A CB  1 
ATOM   1498  O  OG  . SER A  1 196 ? -8.479  -43.216 79.752  1.00 31.41  ? 196  SER A OG  1 
ATOM   1499  N  N   . VAL A  1 197 ? -4.798  -43.078 78.809  1.00 30.35  ? 197  VAL A N   1 
ATOM   1500  C  CA  . VAL A  1 197 ? -3.765  -42.477 79.639  1.00 29.42  ? 197  VAL A CA  1 
ATOM   1501  C  C   . VAL A  1 197 ? -3.749  -40.967 79.543  1.00 28.29  ? 197  VAL A C   1 
ATOM   1502  O  O   . VAL A  1 197 ? -3.609  -40.409 78.461  1.00 36.00  ? 197  VAL A O   1 
ATOM   1503  C  CB  . VAL A  1 197 ? -2.370  -42.964 79.279  1.00 17.06  ? 197  VAL A CB  1 
ATOM   1504  C  CG1 . VAL A  1 197 ? -1.381  -42.123 79.989  1.00 16.14  ? 197  VAL A CG1 1 
ATOM   1505  C  CG2 . VAL A  1 197 ? -2.204  -44.396 79.696  1.00 17.31  ? 197  VAL A CG2 1 
ATOM   1506  N  N   . THR A  1 198 ? -3.879  -40.322 80.694  1.00 25.11  ? 198  THR A N   1 
ATOM   1507  C  CA  . THR A  1 198 ? -3.766  -38.884 80.802  1.00 22.32  ? 198  THR A CA  1 
ATOM   1508  C  C   . THR A  1 198 ? -2.463  -38.478 81.478  1.00 19.59  ? 198  THR A C   1 
ATOM   1509  O  O   . THR A  1 198 ? -2.104  -39.011 82.529  1.00 24.10  ? 198  THR A O   1 
ATOM   1510  C  CB  . THR A  1 198 ? -4.913  -38.351 81.610  1.00 16.52  ? 198  THR A CB  1 
ATOM   1511  O  OG1 . THR A  1 198 ? -6.099  -38.531 80.848  1.00 17.50  ? 198  THR A OG1 1 
ATOM   1512  C  CG2 . THR A  1 198 ? -4.712  -36.881 81.890  1.00 17.81  ? 198  THR A CG2 1 
ATOM   1513  N  N   . LEU A  1 199 ? -1.742  -37.550 80.867  1.00 19.76  ? 199  LEU A N   1 
ATOM   1514  C  CA  . LEU A  1 199 ? -0.586  -36.969 81.531  1.00 25.96  ? 199  LEU A CA  1 
ATOM   1515  C  C   . LEU A  1 199 ? -1.055  -35.664 82.165  1.00 28.64  ? 199  LEU A C   1 
ATOM   1516  O  O   . LEU A  1 199 ? -1.723  -34.870 81.510  1.00 30.61  ? 199  LEU A O   1 
ATOM   1517  C  CB  . LEU A  1 199 ? 0.543   -36.673 80.533  1.00 14.14  ? 199  LEU A CB  1 
ATOM   1518  C  CG  . LEU A  1 199 ? 1.028   -37.743 79.554  1.00 24.61  ? 199  LEU A CG  1 
ATOM   1519  C  CD1 . LEU A  1 199 ? 2.141   -37.194 78.702  1.00 21.45  ? 199  LEU A CD1 1 
ATOM   1520  C  CD2 . LEU A  1 199 ? 1.498   -39.007 80.261  1.00 24.92  ? 199  LEU A CD2 1 
ATOM   1521  N  N   . PHE A  1 200 ? -0.733  -35.438 83.433  1.00 22.27  ? 200  PHE A N   1 
ATOM   1522  C  CA  . PHE A  1 200 ? -0.905  -34.107 83.990  1.00 13.72  ? 200  PHE A CA  1 
ATOM   1523  C  C   . PHE A  1 200 ? 0.366   -33.641 84.672  1.00 30.75  ? 200  PHE A C   1 
ATOM   1524  O  O   . PHE A  1 200 ? 1.057   -34.434 85.289  1.00 12.92  ? 200  PHE A O   1 
ATOM   1525  C  CB  . PHE A  1 200 ? -2.147  -33.976 84.884  1.00 18.04  ? 200  PHE A CB  1 
ATOM   1526  C  CG  . PHE A  1 200 ? -2.088  -34.718 86.200  1.00 19.55  ? 200  PHE A CG  1 
ATOM   1527  C  CD1 . PHE A  1 200 ? -1.757  -36.061 86.265  1.00 22.79  ? 200  PHE A CD1 1 
ATOM   1528  C  CD2 . PHE A  1 200 ? -2.442  -34.073 87.373  1.00 19.03  ? 200  PHE A CD2 1 
ATOM   1529  C  CE1 . PHE A  1 200 ? -1.733  -36.735 87.479  1.00 23.15  ? 200  PHE A CE1 1 
ATOM   1530  C  CE2 . PHE A  1 200 ? -2.427  -34.746 88.581  1.00 23.10  ? 200  PHE A CE2 1 
ATOM   1531  C  CZ  . PHE A  1 200 ? -2.065  -36.079 88.635  1.00 19.70  ? 200  PHE A CZ  1 
ATOM   1532  N  N   . GLY A  1 201 ? 0.687   -32.360 84.513  1.00 31.56  ? 201  GLY A N   1 
ATOM   1533  C  CA  . GLY A  1 201 ? 1.890   -31.817 85.111  1.00 12.69  ? 201  GLY A CA  1 
ATOM   1534  C  C   . GLY A  1 201 ? 1.770   -30.363 85.514  1.00 32.33  ? 201  GLY A C   1 
ATOM   1535  O  O   . GLY A  1 201 ? 0.738   -29.725 85.262  1.00 37.05  ? 201  GLY A O   1 
ATOM   1536  N  N   . GLU A  1 202 ? 2.834   -29.828 86.119  1.00 26.08  ? 202  GLU A N   1 
ATOM   1537  C  CA  . GLU A  1 202 ? 2.834   -28.453 86.634  1.00 22.46  ? 202  GLU A CA  1 
ATOM   1538  C  C   . GLU A  1 202 ? 4.184   -27.753 86.465  1.00 24.54  ? 202  GLU A C   1 
ATOM   1539  O  O   . GLU A  1 202 ? 5.216   -28.390 86.625  1.00 32.80  ? 202  GLU A O   1 
ATOM   1540  C  CB  . GLU A  1 202 ? 2.427   -28.463 88.107  1.00 22.80  ? 202  GLU A CB  1 
ATOM   1541  C  CG  . GLU A  1 202 ? 1.953   -27.130 88.635  1.00 25.65  ? 202  GLU A CG  1 
ATOM   1542  C  CD  . GLU A  1 202 ? 3.078   -26.347 89.249  1.00 35.79  ? 202  GLU A CD  1 
ATOM   1543  O  OE1 . GLU A  1 202 ? 4.097   -26.980 89.601  1.00 45.56  ? 202  GLU A OE1 1 
ATOM   1544  O  OE2 . GLU A  1 202 ? 2.953   -25.109 89.381  1.00 35.11  ? 202  GLU A OE2 1 
ATOM   1545  N  N   . SER A  1 203 ? 4.177   -26.446 86.171  1.00 24.23  ? 203  SER A N   1 
ATOM   1546  C  CA  . SER A  1 203 ? 5.420   -25.667 85.998  1.00 17.64  ? 203  SER A CA  1 
ATOM   1547  C  C   . SER A  1 203 ? 6.216   -26.445 84.937  1.00 17.64  ? 203  SER A C   1 
ATOM   1548  O  O   . SER A  1 203 ? 5.654   -26.831 83.913  1.00 12.57  ? 203  SER A O   1 
ATOM   1549  C  CB  . SER A  1 203 ? 6.172   -25.519 87.385  1.00 34.33  ? 203  SER A CB  1 
ATOM   1550  O  OG  . SER A  1 203 ? 7.176   -24.411 87.451  1.00 38.46  ? 203  SER A OG  1 
ATOM   1551  N  N   . ALA A  1 204 ? 7.487   -26.716 85.192  1.00 17.10  ? 204  ALA A N   1 
ATOM   1552  C  CA  . ALA A  1 204 ? 8.304   -27.535 84.308  1.00 12.32  ? 204  ALA A CA  1 
ATOM   1553  C  C   . ALA A  1 204 ? 7.605   -28.844 83.900  1.00 17.79  ? 204  ALA A C   1 
ATOM   1554  O  O   . ALA A  1 204 ? 7.643   -29.254 82.732  1.00 12.31  ? 204  ALA A O   1 
ATOM   1555  C  CB  . ALA A  1 204 ? 9.663   -27.816 84.979  1.00 12.34  ? 204  ALA A CB  1 
ATOM   1556  N  N   . GLY A  1 205 ? 6.956   -29.488 84.863  1.00 17.73  ? 205  GLY A N   1 
ATOM   1557  C  CA  . GLY A  1 205 ? 6.137   -30.662 84.590  1.00 23.59  ? 205  GLY A CA  1 
ATOM   1558  C  C   . GLY A  1 205 ? 5.191   -30.461 83.427  1.00 26.41  ? 205  GLY A C   1 
ATOM   1559  O  O   . GLY A  1 205 ? 5.193   -31.248 82.489  1.00 12.39  ? 205  GLY A O   1 
ATOM   1560  N  N   . ALA A  1 206 ? 4.414   -29.384 83.470  1.00 12.45  ? 206  ALA A N   1 
ATOM   1561  C  CA  . ALA A  1 206 ? 3.497   -29.062 82.383  1.00 21.01  ? 206  ALA A CA  1 
ATOM   1562  C  C   . ALA A  1 206 ? 4.256   -28.875 81.080  1.00 19.00  ? 206  ALA A C   1 
ATOM   1563  O  O   . ALA A  1 206 ? 3.823   -29.372 80.020  1.00 15.67  ? 206  ALA A O   1 
ATOM   1564  C  CB  . ALA A  1 206 ? 2.677   -27.836 82.695  1.00 22.64  ? 206  ALA A CB  1 
ATOM   1565  N  N   . ALA A  1 207 ? 5.403   -28.201 81.157  1.00 12.85  ? 207  ALA A N   1 
ATOM   1566  C  CA  . ALA A  1 207 ? 6.227   -28.020 79.965  1.00 13.09  ? 207  ALA A CA  1 
ATOM   1567  C  C   . ALA A  1 207 ? 6.581   -29.395 79.431  1.00 22.65  ? 207  ALA A C   1 
ATOM   1568  O  O   . ALA A  1 207 ? 6.443   -29.660 78.229  1.00 19.17  ? 207  ALA A O   1 
ATOM   1569  C  CB  . ALA A  1 207 ? 7.453   -27.236 80.275  1.00 16.19  ? 207  ALA A CB  1 
ATOM   1570  N  N   . SER A  1 208 ? 6.960   -30.297 80.331  1.00 12.78  ? 208  SER A N   1 
ATOM   1571  C  CA  . SER A  1 208 ? 7.283   -31.643 79.899  1.00 12.88  ? 208  SER A CA  1 
ATOM   1572  C  C   . SER A  1 208 ? 6.097   -32.275 79.190  1.00 22.74  ? 208  SER A C   1 
ATOM   1573  O  O   . SER A  1 208 ? 6.268   -32.800 78.084  1.00 13.58  ? 208  SER A O   1 
ATOM   1574  C  CB  . SER A  1 208 ? 7.770   -32.483 81.069  1.00 17.97  ? 208  SER A CB  1 
ATOM   1575  O  OG  . SER A  1 208 ? 8.790   -31.791 81.768  1.00 12.46  ? 208  SER A OG  1 
ATOM   1576  N  N   . VAL A  1 209 ? 4.901   -32.147 79.787  1.00 17.82  ? 209  VAL A N   1 
ATOM   1577  C  CA  . VAL A  1 209 ? 3.670   -32.681 79.195  1.00 13.48  ? 209  VAL A CA  1 
ATOM   1578  C  C   . VAL A  1 209 ? 3.507   -32.055 77.818  1.00 14.03  ? 209  VAL A C   1 
ATOM   1579  O  O   . VAL A  1 209 ? 3.284   -32.747 76.824  1.00 14.53  ? 209  VAL A O   1 
ATOM   1580  C  CB  . VAL A  1 209 ? 2.434   -32.396 80.081  1.00 21.92  ? 209  VAL A CB  1 
ATOM   1581  C  CG1 . VAL A  1 209 ? 1.156   -32.712 79.351  1.00 14.07  ? 209  VAL A CG1 1 
ATOM   1582  C  CG2 . VAL A  1 209 ? 2.492   -33.191 81.371  1.00 13.10  ? 209  VAL A CG2 1 
ATOM   1583  N  N   . GLY A  1 210 ? 3.726   -30.750 77.743  1.00 29.22  ? 210  GLY A N   1 
ATOM   1584  C  CA  . GLY A  1 210 ? 3.658   -30.072 76.464  1.00 35.70  ? 210  GLY A CA  1 
ATOM   1585  C  C   . GLY A  1 210 ? 4.588   -30.720 75.460  1.00 36.94  ? 210  GLY A C   1 
ATOM   1586  O  O   . GLY A  1 210 ? 4.162   -31.084 74.359  1.00 33.62  ? 210  GLY A O   1 
ATOM   1587  N  N   . MET A  1 211 ? 5.842   -30.917 75.859  1.00 14.56  ? 211  MET A N   1 
ATOM   1588  C  CA  . MET A  1 211 ? 6.784   -31.530 74.960  1.00 22.63  ? 211  MET A CA  1 
ATOM   1589  C  C   . MET A  1 211 ? 6.329   -32.907 74.510  1.00 20.03  ? 211  MET A C   1 
ATOM   1590  O  O   . MET A  1 211 ? 6.447   -33.240 73.332  1.00 19.35  ? 211  MET A O   1 
ATOM   1591  C  CB  . MET A  1 211 ? 8.178   -31.599 75.580  1.00 27.30  ? 211  MET A CB  1 
ATOM   1592  C  CG  . MET A  1 211 ? 9.079   -30.468 75.127  1.00 14.88  ? 211  MET A CG  1 
ATOM   1593  S  SD  . MET A  1 211 ? 9.600   -29.475 76.498  1.00 28.39  ? 211  MET A SD  1 
ATOM   1594  C  CE  . MET A  1 211 ? 9.310   -27.862 75.826  1.00 66.21  ? 211  MET A CE  1 
ATOM   1595  N  N   . HIS A  1 212 ? 5.771   -33.705 75.413  1.00 14.91  ? 212  HIS A N   1 
ATOM   1596  C  CA  . HIS A  1 212 ? 5.376   -35.033 74.964  1.00 22.14  ? 212  HIS A CA  1 
ATOM   1597  C  C   . HIS A  1 212 ? 4.221   -34.959 73.962  1.00 25.56  ? 212  HIS A C   1 
ATOM   1598  O  O   . HIS A  1 212 ? 4.080   -35.841 73.127  1.00 34.00  ? 212  HIS A O   1 
ATOM   1599  C  CB  . HIS A  1 212 ? 4.996   -35.929 76.125  1.00 20.66  ? 212  HIS A CB  1 
ATOM   1600  C  CG  . HIS A  1 212 ? 6.133   -36.272 77.028  1.00 16.82  ? 212  HIS A CG  1 
ATOM   1601  N  ND1 . HIS A  1 212 ? 7.145   -37.128 76.653  1.00 16.29  ? 212  HIS A ND1 1 
ATOM   1602  C  CD2 . HIS A  1 212 ? 6.396   -35.906 78.305  1.00 17.05  ? 212  HIS A CD2 1 
ATOM   1603  C  CE1 . HIS A  1 212 ? 7.993   -37.262 77.658  1.00 29.19  ? 212  HIS A CE1 1 
ATOM   1604  N  NE2 . HIS A  1 212 ? 7.557   -36.538 78.674  1.00 28.77  ? 212  HIS A NE2 1 
ATOM   1605  N  N   . ILE A  1 213 ? 3.398   -33.913 74.046  1.00 22.25  ? 213  ILE A N   1 
ATOM   1606  C  CA  . ILE A  1 213 ? 2.372   -33.683 73.037  1.00 20.34  ? 213  ILE A CA  1 
ATOM   1607  C  C   . ILE A  1 213 ? 3.062   -33.461 71.700  1.00 20.24  ? 213  ILE A C   1 
ATOM   1608  O  O   . ILE A  1 213 ? 2.712   -34.077 70.694  1.00 21.54  ? 213  ILE A O   1 
ATOM   1609  C  CB  . ILE A  1 213 ? 1.490   -32.453 73.385  1.00 22.21  ? 213  ILE A CB  1 
ATOM   1610  C  CG1 . ILE A  1 213 ? 0.291   -32.868 74.233  1.00 17.48  ? 213  ILE A CG1 1 
ATOM   1611  C  CG2 . ILE A  1 213 ? 0.976   -31.785 72.144  1.00 17.87  ? 213  ILE A CG2 1 
ATOM   1612  C  CD1 . ILE A  1 213 ? -0.112  -31.812 75.222  1.00 16.41  ? 213  ILE A CD1 1 
ATOM   1613  N  N   . LEU A  1 214 ? 4.088   -32.618 71.720  1.00 23.85  ? 214  LEU A N   1 
ATOM   1614  C  CA  . LEU A  1 214 ? 4.759   -32.175 70.506  1.00 27.32  ? 214  LEU A CA  1 
ATOM   1615  C  C   . LEU A  1 214 ? 5.768   -33.146 69.880  1.00 26.08  ? 214  LEU A C   1 
ATOM   1616  O  O   . LEU A  1 214 ? 6.204   -32.924 68.760  1.00 25.79  ? 214  LEU A O   1 
ATOM   1617  C  CB  . LEU A  1 214 ? 5.426   -30.827 70.769  1.00 30.57  ? 214  LEU A CB  1 
ATOM   1618  C  CG  . LEU A  1 214 ? 4.368   -29.786 71.096  1.00 28.38  ? 214  LEU A CG  1 
ATOM   1619  C  CD1 . LEU A  1 214 ? 4.970   -28.420 71.297  1.00 17.53  ? 214  LEU A CD1 1 
ATOM   1620  C  CD2 . LEU A  1 214 ? 3.370   -29.777 69.962  1.00 18.79  ? 214  LEU A CD2 1 
ATOM   1621  N  N   . SER A  1 215 ? 6.135   -34.214 70.578  1.00 18.07  ? 215  SER A N   1 
ATOM   1622  C  CA  . SER A  1 215 ? 7.164   -35.115 70.061  1.00 24.80  ? 215  SER A CA  1 
ATOM   1623  C  C   . SER A  1 215 ? 6.565   -36.464 69.763  1.00 24.31  ? 215  SER A C   1 
ATOM   1624  O  O   . SER A  1 215 ? 6.243   -37.206 70.685  1.00 25.65  ? 215  SER A O   1 
ATOM   1625  C  CB  . SER A  1 215 ? 8.295   -35.286 71.085  1.00 27.39  ? 215  SER A CB  1 
ATOM   1626  O  OG  . SER A  1 215 ? 9.312   -36.153 70.614  1.00 21.22  ? 215  SER A OG  1 
ATOM   1627  N  N   . LEU A  1 216 ? 6.446   -36.792 68.482  1.00 26.98  ? 216  LEU A N   1 
ATOM   1628  C  CA  . LEU A  1 216 ? 5.672   -37.956 68.025  1.00 28.75  ? 216  LEU A CA  1 
ATOM   1629  C  C   . LEU A  1 216 ? 5.747   -39.268 68.842  1.00 36.33  ? 216  LEU A C   1 
ATOM   1630  O  O   . LEU A  1 216 ? 4.703   -39.776 69.310  1.00 51.80  ? 216  LEU A O   1 
ATOM   1631  C  CB  . LEU A  1 216 ? 5.956   -38.233 66.550  1.00 28.74  ? 216  LEU A CB  1 
ATOM   1632  C  CG  . LEU A  1 216 ? 4.771   -38.115 65.613  1.00 23.40  ? 216  LEU A CG  1 
ATOM   1633  C  CD1 . LEU A  1 216 ? 4.980   -39.133 64.546  1.00 24.78  ? 216  LEU A CD1 1 
ATOM   1634  C  CD2 . LEU A  1 216 ? 3.479   -38.358 66.348  1.00 56.01  ? 216  LEU A CD2 1 
ATOM   1635  N  N   . PRO A  1 217 ? 6.959   -39.822 69.025  1.00 28.41  ? 217  PRO A N   1 
ATOM   1636  C  CA  . PRO A  1 217 ? 7.043   -41.099 69.749  1.00 30.66  ? 217  PRO A CA  1 
ATOM   1637  C  C   . PRO A  1 217 ? 6.497   -41.072 71.181  1.00 35.49  ? 217  PRO A C   1 
ATOM   1638  O  O   . PRO A  1 217 ? 6.173   -42.142 71.691  1.00 40.39  ? 217  PRO A O   1 
ATOM   1639  C  CB  . PRO A  1 217 ? 8.548   -41.420 69.751  1.00 24.54  ? 217  PRO A CB  1 
ATOM   1640  C  CG  . PRO A  1 217 ? 9.216   -40.142 69.469  1.00 24.94  ? 217  PRO A CG  1 
ATOM   1641  C  CD  . PRO A  1 217 ? 8.287   -39.337 68.620  1.00 20.77  ? 217  PRO A CD  1 
ATOM   1642  N  N   . SER A  1 218 ? 6.414   -39.901 71.817  1.00 32.56  ? 218  SER A N   1 
ATOM   1643  C  CA  . SER A  1 218 ? 5.743   -39.790 73.109  1.00 26.09  ? 218  SER A CA  1 
ATOM   1644  C  C   . SER A  1 218 ? 4.248   -39.732 72.850  1.00 24.05  ? 218  SER A C   1 
ATOM   1645  O  O   . SER A  1 218 ? 3.464   -40.381 73.533  1.00 21.51  ? 218  SER A O   1 
ATOM   1646  C  CB  . SER A  1 218 ? 6.176   -38.533 73.867  1.00 24.73  ? 218  SER A CB  1 
ATOM   1647  O  OG  . SER A  1 218 ? 7.553   -38.568 74.208  1.00 29.78  ? 218  SER A OG  1 
ATOM   1648  N  N   . ARG A  1 219 ? 3.866   -38.968 71.833  1.00 23.05  ? 219  ARG A N   1 
ATOM   1649  C  CA  . ARG A  1 219 ? 2.459   -38.728 71.522  1.00 27.39  ? 219  ARG A CA  1 
ATOM   1650  C  C   . ARG A  1 219 ? 1.712   -40.027 71.311  1.00 30.77  ? 219  ARG A C   1 
ATOM   1651  O  O   . ARG A  1 219 ? 0.532   -40.151 71.665  1.00 25.20  ? 219  ARG A O   1 
ATOM   1652  C  CB  . ARG A  1 219 ? 2.323   -37.841 70.285  1.00 27.33  ? 219  ARG A CB  1 
ATOM   1653  C  CG  . ARG A  1 219 ? 0.897   -37.467 69.956  1.00 32.36  ? 219  ARG A CG  1 
ATOM   1654  C  CD  . ARG A  1 219 ? 0.168   -36.834 71.133  1.00 39.70  ? 219  ARG A CD  1 
ATOM   1655  N  NE  . ARG A  1 219 ? -1.229  -36.601 70.783  1.00 51.39  ? 219  ARG A NE  1 
ATOM   1656  C  CZ  . ARG A  1 219 ? -2.224  -37.433 71.088  1.00 60.42  ? 219  ARG A CZ  1 
ATOM   1657  N  NH1 . ARG A  1 219 ? -1.974  -38.542 71.775  1.00 61.36  ? 219  ARG A NH1 1 
ATOM   1658  N  NH2 . ARG A  1 219 ? -3.469  -37.152 70.715  1.00 63.91  ? 219  ARG A NH2 1 
ATOM   1659  N  N   . SER A  1 220 ? 2.418   -41.003 70.753  1.00 33.85  ? 220  SER A N   1 
ATOM   1660  C  CA  . SER A  1 220 ? 1.818   -42.310 70.535  1.00 30.68  ? 220  SER A CA  1 
ATOM   1661  C  C   . SER A  1 220 ? 1.448   -43.060 71.841  1.00 42.82  ? 220  SER A C   1 
ATOM   1662  O  O   . SER A  1 220 ? 0.659   -44.012 71.812  1.00 47.57  ? 220  SER A O   1 
ATOM   1663  C  CB  . SER A  1 220 ? 2.733   -43.147 69.644  1.00 29.66  ? 220  SER A CB  1 
ATOM   1664  O  OG  . SER A  1 220 ? 2.854   -44.460 70.155  1.00 35.30  ? 220  SER A OG  1 
ATOM   1665  N  N   . LEU A  1 221 ? 1.983   -42.613 72.980  1.00 36.63  ? 221  LEU A N   1 
ATOM   1666  C  CA  . LEU A  1 221 ? 1.807   -43.320 74.266  1.00 32.83  ? 221  LEU A CA  1 
ATOM   1667  C  C   . LEU A  1 221 ? 0.734   -42.806 75.247  1.00 33.27  ? 221  LEU A C   1 
ATOM   1668  O  O   . LEU A  1 221 ? 0.698   -43.249 76.391  1.00 34.60  ? 221  LEU A O   1 
ATOM   1669  C  CB  . LEU A  1 221 ? 3.135   -43.371 75.031  1.00 26.21  ? 221  LEU A CB  1 
ATOM   1670  C  CG  . LEU A  1 221 ? 4.313   -44.000 74.292  1.00 29.79  ? 221  LEU A CG  1 
ATOM   1671  C  CD1 . LEU A  1 221 ? 5.630   -43.765 75.029  1.00 29.54  ? 221  LEU A CD1 1 
ATOM   1672  C  CD2 . LEU A  1 221 ? 4.077   -45.479 74.077  1.00 33.49  ? 221  LEU A CD2 1 
ATOM   1673  N  N   . PHE A  1 222 ? -0.115  -41.873 74.840  1.00 30.82  ? 222  PHE A N   1 
ATOM   1674  C  CA  . PHE A  1 222 ? -1.157  -41.367 75.739  1.00 27.23  ? 222  PHE A CA  1 
ATOM   1675  C  C   . PHE A  1 222 ? -2.201  -40.641 74.935  1.00 29.32  ? 222  PHE A C   1 
ATOM   1676  O  O   . PHE A  1 222 ? -2.074  -40.524 73.717  1.00 40.10  ? 222  PHE A O   1 
ATOM   1677  C  CB  . PHE A  1 222 ? -0.594  -40.431 76.806  1.00 29.28  ? 222  PHE A CB  1 
ATOM   1678  C  CG  . PHE A  1 222 ? -0.092  -39.120 76.265  1.00 31.98  ? 222  PHE A CG  1 
ATOM   1679  C  CD1 . PHE A  1 222 ? 1.184   -39.015 75.739  1.00 27.82  ? 222  PHE A CD1 1 
ATOM   1680  C  CD2 . PHE A  1 222 ? -0.885  -37.991 76.296  1.00 31.01  ? 222  PHE A CD2 1 
ATOM   1681  C  CE1 . PHE A  1 222 ? 1.649   -37.818 75.234  1.00 20.18  ? 222  PHE A CE1 1 
ATOM   1682  C  CE2 . PHE A  1 222 ? -0.414  -36.794 75.794  1.00 29.50  ? 222  PHE A CE2 1 
ATOM   1683  C  CZ  . PHE A  1 222 ? 0.856   -36.710 75.261  1.00 17.74  ? 222  PHE A CZ  1 
ATOM   1684  N  N   . HIS A  1 223 ? -3.222  -40.130 75.610  1.00 26.39  ? 223  HIS A N   1 
ATOM   1685  C  CA  . HIS A  1 223 ? -4.412  -39.679 74.900  1.00 31.34  ? 223  HIS A CA  1 
ATOM   1686  C  C   . HIS A  1 223 ? -4.901  -38.284 75.287  1.00 19.21  ? 223  HIS A C   1 
ATOM   1687  O  O   . HIS A  1 223 ? -5.454  -37.572 74.462  1.00 65.46  ? 223  HIS A O   1 
ATOM   1688  C  CB  . HIS A  1 223 ? -5.524  -40.718 75.071  1.00 35.05  ? 223  HIS A CB  1 
ATOM   1689  C  CG  . HIS A  1 223 ? -5.061  -42.135 74.896  1.00 37.02  ? 223  HIS A CG  1 
ATOM   1690  N  ND1 . HIS A  1 223 ? -4.440  -42.845 75.899  1.00 37.92  ? 223  HIS A ND1 1 
ATOM   1691  C  CD2 . HIS A  1 223 ? -5.123  -42.971 73.832  1.00 39.52  ? 223  HIS A CD2 1 
ATOM   1692  C  CE1 . HIS A  1 223 ? -4.144  -44.059 75.466  1.00 32.69  ? 223  HIS A CE1 1 
ATOM   1693  N  NE2 . HIS A  1 223 ? -4.547  -44.160 74.213  1.00 33.38  ? 223  HIS A NE2 1 
ATOM   1694  N  N   . ARG A  1 224 ? -4.679  -37.897 76.535  1.00 39.02  ? 224  ARG A N   1 
ATOM   1695  C  CA  . ARG A  1 224 ? -5.138  -36.617 77.036  1.00 18.20  ? 224  ARG A CA  1 
ATOM   1696  C  C   . ARG A  1 224 ? -4.089  -35.926 77.879  1.00 26.23  ? 224  ARG A C   1 
ATOM   1697  O  O   . ARG A  1 224 ? -3.359  -36.572 78.627  1.00 28.80  ? 224  ARG A O   1 
ATOM   1698  C  CB  . ARG A  1 224 ? -6.354  -36.835 77.913  1.00 33.46  ? 224  ARG A CB  1 
ATOM   1699  C  CG  . ARG A  1 224 ? -7.608  -37.030 77.135  1.00 36.04  ? 224  ARG A CG  1 
ATOM   1700  C  CD  . ARG A  1 224 ? -8.722  -37.472 78.022  1.00 41.00  ? 224  ARG A CD  1 
ATOM   1701  N  NE  . ARG A  1 224 ? -8.677  -38.899 78.296  1.00 45.23  ? 224  ARG A NE  1 
ATOM   1702  C  CZ  . ARG A  1 224 ? -8.914  -39.830 77.382  1.00 51.35  ? 224  ARG A CZ  1 
ATOM   1703  N  NH1 . ARG A  1 224 ? -9.186  -39.476 76.131  1.00 52.81  ? 224  ARG A NH1 1 
ATOM   1704  N  NH2 . ARG A  1 224 ? -8.867  -41.113 77.715  1.00 55.56  ? 224  ARG A NH2 1 
ATOM   1705  N  N   . ALA A  1 225 ? -4.041  -34.602 77.811  1.00 27.80  ? 225  ALA A N   1 
ATOM   1706  C  CA  . ALA A  1 225 ? -3.078  -33.873 78.630  1.00 16.14  ? 225  ALA A CA  1 
ATOM   1707  C  C   . ALA A  1 225 ? -3.730  -32.832 79.516  1.00 24.89  ? 225  ALA A C   1 
ATOM   1708  O  O   . ALA A  1 225 ? -4.795  -32.316 79.199  1.00 30.36  ? 225  ALA A O   1 
ATOM   1709  C  CB  . ALA A  1 225 ? -2.018  -33.221 77.756  1.00 20.14  ? 225  ALA A CB  1 
ATOM   1710  N  N   . VAL A  1 226 ? -3.080  -32.538 80.635  1.00 21.48  ? 226  VAL A N   1 
ATOM   1711  C  CA  . VAL A  1 226 ? -3.442  -31.428 81.497  1.00 18.58  ? 226  VAL A CA  1 
ATOM   1712  C  C   . VAL A  1 226 ? -2.163  -30.674 81.809  1.00 20.06  ? 226  VAL A C   1 
ATOM   1713  O  O   . VAL A  1 226 ? -1.237  -31.233 82.422  1.00 30.22  ? 226  VAL A O   1 
ATOM   1714  C  CB  . VAL A  1 226 ? -4.007  -31.884 82.854  1.00 15.47  ? 226  VAL A CB  1 
ATOM   1715  C  CG1 . VAL A  1 226 ? -4.740  -30.741 83.540  1.00 15.89  ? 226  VAL A CG1 1 
ATOM   1716  C  CG2 . VAL A  1 226 ? -4.877  -33.088 82.710  1.00 15.95  ? 226  VAL A CG2 1 
ATOM   1717  N  N   . LEU A  1 227 ? -2.131  -29.409 81.399  1.00 16.86  ? 227  LEU A N   1 
ATOM   1718  C  CA  . LEU A  1 227 ? -1.029  -28.505 81.681  1.00 23.06  ? 227  LEU A CA  1 
ATOM   1719  C  C   . LEU A  1 227 ? -1.399  -27.423 82.716  1.00 25.72  ? 227  LEU A C   1 
ATOM   1720  O  O   . LEU A  1 227 ? -2.161  -26.479 82.424  1.00 28.34  ? 227  LEU A O   1 
ATOM   1721  C  CB  . LEU A  1 227 ? -0.522  -27.889 80.370  1.00 28.25  ? 227  LEU A CB  1 
ATOM   1722  C  CG  . LEU A  1 227 ? 0.149   -28.829 79.342  1.00 23.25  ? 227  LEU A CG  1 
ATOM   1723  C  CD1 . LEU A  1 227 ? -0.834  -29.707 78.582  1.00 18.72  ? 227  LEU A CD1 1 
ATOM   1724  C  CD2 . LEU A  1 227 ? 0.965   -28.040 78.363  1.00 14.79  ? 227  LEU A CD2 1 
ATOM   1725  N  N   . GLN A  1 228 ? -0.870  -27.579 83.930  1.00 14.25  ? 228  GLN A N   1 
ATOM   1726  C  CA  . GLN A  1 228 ? -1.107  -26.627 85.005  1.00 14.47  ? 228  GLN A CA  1 
ATOM   1727  C  C   . GLN A  1 228 ? 0.039   -25.625 85.175  1.00 24.77  ? 228  GLN A C   1 
ATOM   1728  O  O   . GLN A  1 228 ? 1.149   -26.001 85.567  1.00 25.52  ? 228  GLN A O   1 
ATOM   1729  C  CB  . GLN A  1 228 ? -1.256  -27.386 86.303  1.00 14.34  ? 228  GLN A CB  1 
ATOM   1730  C  CG  . GLN A  1 228 ? -2.175  -28.582 86.218  1.00 23.26  ? 228  GLN A CG  1 
ATOM   1731  C  CD  . GLN A  1 228 ? -2.249  -29.321 87.538  1.00 28.44  ? 228  GLN A CD  1 
ATOM   1732  O  OE1 . GLN A  1 228 ? -2.786  -30.416 87.627  1.00 14.62  ? 228  GLN A OE1 1 
ATOM   1733  N  NE2 . GLN A  1 228 ? -1.692  -28.719 88.572  1.00 37.09  ? 228  GLN A NE2 1 
ATOM   1734  N  N   . SER A  1 229 ? -0.222  -24.351 84.897  1.00 20.03  ? 229  SER A N   1 
ATOM   1735  C  CA  . SER A  1 229 ? 0.774   -23.298 85.106  1.00 17.15  ? 229  SER A CA  1 
ATOM   1736  C  C   . SER A  1 229 ? 2.111   -23.588 84.428  1.00 19.56  ? 229  SER A C   1 
ATOM   1737  O  O   . SER A  1 229 ? 3.155   -23.469 85.061  1.00 19.50  ? 229  SER A O   1 
ATOM   1738  C  CB  . SER A  1 229 ? 1.047   -23.090 86.597  1.00 16.47  ? 229  SER A CB  1 
ATOM   1739  O  OG  . SER A  1 229 ? -0.134  -22.939 87.348  1.00 22.81  ? 229  SER A OG  1 
ATOM   1740  N  N   . GLY A  1 230 ? 2.083   -23.978 83.158  1.00 20.15  ? 230  GLY A N   1 
ATOM   1741  C  CA  . GLY A  1 230 ? 3.310   -24.160 82.404  1.00 18.51  ? 230  GLY A CA  1 
ATOM   1742  C  C   . GLY A  1 230 ? 3.028   -24.593 80.985  1.00 24.20  ? 230  GLY A C   1 
ATOM   1743  O  O   . GLY A  1 230 ? 2.002   -25.219 80.728  1.00 36.28  ? 230  GLY A O   1 
ATOM   1744  N  N   . THR A  1 231 ? 3.923   -24.251 80.061  1.00 21.58  ? 231  THR A N   1 
ATOM   1745  C  CA  . THR A  1 231 ? 3.762   -24.610 78.651  1.00 28.05  ? 231  THR A CA  1 
ATOM   1746  C  C   . THR A  1 231 ? 5.092   -25.027 78.018  1.00 27.78  ? 231  THR A C   1 
ATOM   1747  O  O   . THR A  1 231 ? 6.157   -24.707 78.543  1.00 22.24  ? 231  THR A O   1 
ATOM   1748  C  CB  . THR A  1 231 ? 3.192   -23.438 77.839  1.00 37.85  ? 231  THR A CB  1 
ATOM   1749  O  OG1 . THR A  1 231 ? 4.086   -22.327 77.931  1.00 35.69  ? 231  THR A OG1 1 
ATOM   1750  C  CG2 . THR A  1 231 ? 1.811   -23.034 78.349  1.00 46.97  ? 231  THR A CG2 1 
ATOM   1751  N  N   . PRO A  1 232 ? 5.031   -25.751 76.884  1.00 28.01  ? 232  PRO A N   1 
ATOM   1752  C  CA  . PRO A  1 232 ? 6.268   -26.092 76.191  1.00 19.54  ? 232  PRO A CA  1 
ATOM   1753  C  C   . PRO A  1 232 ? 6.829   -24.885 75.452  1.00 15.25  ? 232  PRO A C   1 
ATOM   1754  O  O   . PRO A  1 232 ? 8.033   -24.816 75.274  1.00 34.46  ? 232  PRO A O   1 
ATOM   1755  C  CB  . PRO A  1 232 ? 5.821   -27.180 75.212  1.00 19.44  ? 232  PRO A CB  1 
ATOM   1756  C  CG  . PRO A  1 232 ? 4.405   -26.846 74.909  1.00 22.64  ? 232  PRO A CG  1 
ATOM   1757  C  CD  . PRO A  1 232 ? 3.856   -26.350 76.219  1.00 30.44  ? 232  PRO A CD  1 
ATOM   1758  N  N   . ASN A  1 233 ? 5.979   -23.949 75.041  1.00 23.18  ? 233  ASN A N   1 
ATOM   1759  C  CA  . ASN A  1 233 ? 6.420   -22.688 74.459  1.00 16.30  ? 233  ASN A CA  1 
ATOM   1760  C  C   . ASN A  1 233 ? 6.735   -21.708 75.582  1.00 28.10  ? 233  ASN A C   1 
ATOM   1761  O  O   . ASN A  1 233 ? 6.690   -22.077 76.745  1.00 24.78  ? 233  ASN A O   1 
ATOM   1762  C  CB  . ASN A  1 233 ? 5.331   -22.123 73.558  1.00 31.06  ? 233  ASN A CB  1 
ATOM   1763  C  CG  . ASN A  1 233 ? 3.949   -22.123 74.227  1.00 27.80  ? 233  ASN A CG  1 
ATOM   1764  O  OD1 . ASN A  1 233 ? 3.402   -23.180 74.540  1.00 21.48  ? 233  ASN A OD1 1 
ATOM   1765  N  ND2 . ASN A  1 233 ? 3.380   -20.934 74.428  1.00 17.48  ? 233  ASN A ND2 1 
ATOM   1766  N  N   . GLY A  1 234 ? 7.053   -20.461 75.266  1.00 16.47  ? 234  GLY A N   1 
ATOM   1767  C  CA  . GLY A  1 234 ? 7.430   -19.527 76.321  1.00 31.03  ? 234  GLY A CA  1 
ATOM   1768  C  C   . GLY A  1 234 ? 8.933   -19.339 76.557  1.00 30.94  ? 234  GLY A C   1 
ATOM   1769  O  O   . GLY A  1 234 ? 9.766   -20.052 75.988  1.00 16.16  ? 234  GLY A O   1 
ATOM   1770  N  N   . PRO A  1 235 ? 9.292   -18.371 77.413  1.00 26.27  ? 235  PRO A N   1 
ATOM   1771  C  CA  . PRO A  1 235 ? 10.688  -17.945 77.511  1.00 16.37  ? 235  PRO A CA  1 
ATOM   1772  C  C   . PRO A  1 235 ? 11.639  -18.882 78.264  1.00 28.30  ? 235  PRO A C   1 
ATOM   1773  O  O   . PRO A  1 235 ? 12.847  -18.755 78.066  1.00 25.35  ? 235  PRO A O   1 
ATOM   1774  C  CB  . PRO A  1 235 ? 10.590  -16.605 78.256  1.00 18.82  ? 235  PRO A CB  1 
ATOM   1775  C  CG  . PRO A  1 235 ? 9.374   -16.734 79.097  1.00 21.36  ? 235  PRO A CG  1 
ATOM   1776  C  CD  . PRO A  1 235 ? 8.403   -17.553 78.261  1.00 27.40  ? 235  PRO A CD  1 
ATOM   1777  N  N   . TRP A  1 236 ? 11.136  -19.791 79.096  1.00 25.85  ? 236  TRP A N   1 
ATOM   1778  C  CA  . TRP A  1 236 ? 12.011  -20.471 80.055  1.00 20.90  ? 236  TRP A CA  1 
ATOM   1779  C  C   . TRP A  1 236 ? 12.182  -21.962 79.871  1.00 27.16  ? 236  TRP A C   1 
ATOM   1780  O  O   . TRP A  1 236 ? 13.091  -22.550 80.453  1.00 32.83  ? 236  TRP A O   1 
ATOM   1781  C  CB  . TRP A  1 236 ? 11.514  -20.228 81.476  1.00 20.05  ? 236  TRP A CB  1 
ATOM   1782  C  CG  . TRP A  1 236 ? 10.055  -20.605 81.707  1.00 23.30  ? 236  TRP A CG  1 
ATOM   1783  C  CD1 . TRP A  1 236 ? 8.971   -19.774 81.640  1.00 21.25  ? 236  TRP A CD1 1 
ATOM   1784  C  CD2 . TRP A  1 236 ? 9.542   -21.899 82.063  1.00 21.77  ? 236  TRP A CD2 1 
ATOM   1785  N  NE1 . TRP A  1 236 ? 7.824   -20.465 81.934  1.00 17.01  ? 236  TRP A NE1 1 
ATOM   1786  C  CE2 . TRP A  1 236 ? 8.144   -21.770 82.198  1.00 16.07  ? 236  TRP A CE2 1 
ATOM   1787  C  CE3 . TRP A  1 236 ? 10.131  -23.149 82.292  1.00 22.93  ? 236  TRP A CE3 1 
ATOM   1788  C  CZ2 . TRP A  1 236 ? 7.322   -22.843 82.541  1.00 13.47  ? 236  TRP A CZ2 1 
ATOM   1789  C  CZ3 . TRP A  1 236 ? 9.312   -24.216 82.625  1.00 25.53  ? 236  TRP A CZ3 1 
ATOM   1790  C  CH2 . TRP A  1 236 ? 7.923   -24.055 82.749  1.00 25.49  ? 236  TRP A CH2 1 
ATOM   1791  N  N   . ALA A  1 237 ? 11.304  -22.569 79.078  1.00 24.34  ? 237  ALA A N   1 
ATOM   1792  C  CA  . ALA A  1 237 ? 11.169  -24.021 79.024  1.00 14.86  ? 237  ALA A CA  1 
ATOM   1793  C  C   . ALA A  1 237 ? 12.114  -24.703 78.031  1.00 16.15  ? 237  ALA A C   1 
ATOM   1794  O  O   . ALA A  1 237 ? 12.255  -25.926 78.046  1.00 20.90  ? 237  ALA A O   1 
ATOM   1795  C  CB  . ALA A  1 237 ? 9.734   -24.389 78.729  1.00 13.98  ? 237  ALA A CB  1 
ATOM   1796  N  N   . THR A  1 238 ? 12.747  -23.924 77.156  1.00 16.85  ? 238  THR A N   1 
ATOM   1797  C  CA  . THR A  1 238 ? 13.687  -24.490 76.178  1.00 25.19  ? 238  THR A CA  1 
ATOM   1798  C  C   . THR A  1 238 ? 14.962  -23.659 75.947  1.00 16.19  ? 238  THR A C   1 
ATOM   1799  O  O   . THR A  1 238 ? 15.100  -22.552 76.443  1.00 16.24  ? 238  THR A O   1 
ATOM   1800  C  CB  . THR A  1 238 ? 13.007  -24.779 74.821  1.00 21.05  ? 238  THR A CB  1 
ATOM   1801  O  OG1 . THR A  1 238 ? 12.285  -23.625 74.395  1.00 25.60  ? 238  THR A OG1 1 
ATOM   1802  C  CG2 . THR A  1 238 ? 12.047  -25.923 74.937  1.00 15.60  ? 238  THR A CG2 1 
ATOM   1803  N  N   . VAL A  1 239 ? 15.900  -24.213 75.196  1.00 16.77  ? 239  VAL A N   1 
ATOM   1804  C  CA  . VAL A  1 239 ? 17.094  -23.459 74.800  1.00 17.55  ? 239  VAL A CA  1 
ATOM   1805  C  C   . VAL A  1 239 ? 17.502  -23.849 73.396  1.00 25.16  ? 239  VAL A C   1 
ATOM   1806  O  O   . VAL A  1 239 ? 17.403  -25.019 73.019  1.00 28.08  ? 239  VAL A O   1 
ATOM   1807  C  CB  . VAL A  1 239 ? 18.305  -23.759 75.711  1.00 24.07  ? 239  VAL A CB  1 
ATOM   1808  C  CG1 . VAL A  1 239 ? 18.235  -22.959 77.006  1.00 17.20  ? 239  VAL A CG1 1 
ATOM   1809  C  CG2 . VAL A  1 239 ? 18.414  -25.262 75.987  1.00 17.38  ? 239  VAL A CG2 1 
ATOM   1810  N  N   . SER A  1 240 ? 17.972  -22.887 72.618  1.00 26.73  ? 240  SER A N   1 
ATOM   1811  C  CA  . SER A  1 240 ? 18.616  -23.229 71.357  1.00 30.45  ? 240  SER A CA  1 
ATOM   1812  C  C   . SER A  1 240 ? 19.835  -24.121 71.600  1.00 33.01  ? 240  SER A C   1 
ATOM   1813  O  O   . SER A  1 240 ? 20.473  -24.058 72.652  1.00 35.84  ? 240  SER A O   1 
ATOM   1814  C  CB  . SER A  1 240 ? 19.061  -21.972 70.629  1.00 36.65  ? 240  SER A CB  1 
ATOM   1815  O  OG  . SER A  1 240 ? 19.881  -21.169 71.461  1.00 42.06  ? 240  SER A OG  1 
ATOM   1816  N  N   . ALA A  1 241 ? 20.155  -24.951 70.620  1.00 29.13  ? 241  ALA A N   1 
ATOM   1817  C  CA  . ALA A  1 241 ? 21.308  -25.824 70.714  1.00 30.74  ? 241  ALA A CA  1 
ATOM   1818  C  C   . ALA A  1 241 ? 22.590  -25.007 70.902  1.00 36.89  ? 241  ALA A C   1 
ATOM   1819  O  O   . ALA A  1 241 ? 23.555  -25.462 71.535  1.00 36.39  ? 241  ALA A O   1 
ATOM   1820  C  CB  . ALA A  1 241 ? 21.404  -26.659 69.473  1.00 22.90  ? 241  ALA A CB  1 
ATOM   1821  N  N   . GLY A  1 242 ? 22.604  -23.802 70.344  1.00 38.21  ? 242  GLY A N   1 
ATOM   1822  C  CA  . GLY A  1 242 ? 23.751  -22.929 70.503  1.00 37.16  ? 242  GLY A CA  1 
ATOM   1823  C  C   . GLY A  1 242 ? 23.974  -22.621 71.971  1.00 36.47  ? 242  GLY A C   1 
ATOM   1824  O  O   . GLY A  1 242 ? 25.027  -22.921 72.537  1.00 36.53  ? 242  GLY A O   1 
ATOM   1825  N  N   . GLU A  1 243 ? 22.958  -22.038 72.593  1.00 35.22  ? 243  GLU A N   1 
ATOM   1826  C  CA  . GLU A  1 243 ? 23.017  -21.717 74.003  1.00 31.12  ? 243  GLU A CA  1 
ATOM   1827  C  C   . GLU A  1 243 ? 23.306  -22.944 74.864  1.00 34.45  ? 243  GLU A C   1 
ATOM   1828  O  O   . GLU A  1 243 ? 24.172  -22.888 75.722  1.00 21.51  ? 243  GLU A O   1 
ATOM   1829  C  CB  . GLU A  1 243 ? 21.728  -21.044 74.454  1.00 30.26  ? 243  GLU A CB  1 
ATOM   1830  C  CG  . GLU A  1 243 ? 21.679  -20.801 75.946  1.00 29.48  ? 243  GLU A CG  1 
ATOM   1831  C  CD  . GLU A  1 243 ? 22.581  -19.669 76.400  1.00 31.70  ? 243  GLU A CD  1 
ATOM   1832  O  OE1 . GLU A  1 243 ? 23.181  -18.974 75.539  1.00 27.46  ? 243  GLU A OE1 1 
ATOM   1833  O  OE2 . GLU A  1 243 ? 22.668  -19.473 77.634  1.00 34.29  ? 243  GLU A OE2 1 
ATOM   1834  N  N   . ALA A  1 244 ? 22.591  -24.048 74.652  1.00 28.56  ? 244  ALA A N   1 
ATOM   1835  C  CA  . ALA A  1 244 ? 22.896  -25.256 75.411  1.00 29.88  ? 244  ALA A CA  1 
ATOM   1836  C  C   . ALA A  1 244 ? 24.398  -25.593 75.317  1.00 36.18  ? 244  ALA A C   1 
ATOM   1837  O  O   . ALA A  1 244 ? 25.062  -25.801 76.335  1.00 21.73  ? 244  ALA A O   1 
ATOM   1838  C  CB  . ALA A  1 244 ? 22.045  -26.406 74.960  1.00 19.97  ? 244  ALA A CB  1 
ATOM   1839  N  N   . ARG A  1 245 ? 24.931  -25.594 74.101  1.00 22.65  ? 245  ARG A N   1 
ATOM   1840  C  CA  . ARG A  1 245 ? 26.345  -25.926 73.898  1.00 45.30  ? 245  ARG A CA  1 
ATOM   1841  C  C   . ARG A  1 245 ? 27.283  -24.986 74.676  1.00 36.71  ? 245  ARG A C   1 
ATOM   1842  O  O   . ARG A  1 245 ? 28.177  -25.439 75.415  1.00 25.03  ? 245  ARG A O   1 
ATOM   1843  C  CB  . ARG A  1 245 ? 26.692  -25.954 72.404  1.00 25.13  ? 245  ARG A CB  1 
ATOM   1844  C  CG  . ARG A  1 245 ? 28.186  -26.081 72.117  1.00 63.65  ? 245  ARG A CG  1 
ATOM   1845  C  CD  . ARG A  1 245 ? 28.466  -26.527 70.681  1.00 27.95  ? 245  ARG A CD  1 
ATOM   1846  N  NE  . ARG A  1 245 ? 27.918  -27.853 70.439  1.00 42.00  ? 245  ARG A NE  1 
ATOM   1847  C  CZ  . ARG A  1 245 ? 28.612  -28.975 70.593  1.00 39.99  ? 245  ARG A CZ  1 
ATOM   1848  N  NH1 . ARG A  1 245 ? 29.888  -28.907 70.967  1.00 33.44  ? 245  ARG A NH1 1 
ATOM   1849  N  NH2 . ARG A  1 245 ? 28.033  -30.155 70.370  1.00 38.96  ? 245  ARG A NH2 1 
ATOM   1850  N  N   . ARG A  1 246 ? 27.053  -23.685 74.505  1.00 26.24  ? 246  ARG A N   1 
ATOM   1851  C  CA  . ARG A  1 246 ? 27.666  -22.646 75.323  1.00 24.77  ? 246  ARG A CA  1 
ATOM   1852  C  C   . ARG A  1 246 ? 27.638  -23.012 76.810  1.00 33.38  ? 246  ARG A C   1 
ATOM   1853  O  O   . ARG A  1 246 ? 28.680  -23.191 77.413  1.00 36.92  ? 246  ARG A O   1 
ATOM   1854  C  CB  . ARG A  1 246 ? 26.941  -21.319 75.092  1.00 24.39  ? 246  ARG A CB  1 
ATOM   1855  C  CG  . ARG A  1 246 ? 27.665  -20.121 75.633  1.00 45.45  ? 246  ARG A CG  1 
ATOM   1856  C  CD  . ARG A  1 246 ? 26.807  -18.861 75.598  1.00 43.39  ? 246  ARG A CD  1 
ATOM   1857  N  NE  . ARG A  1 246 ? 25.818  -18.828 76.674  1.00 37.99  ? 246  ARG A NE  1 
ATOM   1858  C  CZ  . ARG A  1 246 ? 26.095  -18.548 77.945  1.00 34.23  ? 246  ARG A CZ  1 
ATOM   1859  N  NH1 . ARG A  1 246 ? 27.341  -18.285 78.328  1.00 36.36  ? 246  ARG A NH1 1 
ATOM   1860  N  NH2 . ARG A  1 246 ? 25.120  -18.540 78.841  1.00 29.37  ? 246  ARG A NH2 1 
ATOM   1861  N  N   . ARG A  1 247 ? 26.442  -23.146 77.382  1.00 26.36  ? 247  ARG A N   1 
ATOM   1862  C  CA  . ARG A  1 247 ? 26.246  -23.435 78.801  1.00 25.34  ? 247  ARG A CA  1 
ATOM   1863  C  C   . ARG A  1 247 ? 26.998  -24.676 79.305  1.00 30.24  ? 247  ARG A C   1 
ATOM   1864  O  O   . ARG A  1 247 ? 27.611  -24.626 80.364  1.00 33.48  ? 247  ARG A O   1 
ATOM   1865  C  CB  . ARG A  1 247 ? 24.751  -23.533 79.129  1.00 20.73  ? 247  ARG A CB  1 
ATOM   1866  C  CG  . ARG A  1 247 ? 23.987  -22.216 78.997  1.00 22.09  ? 247  ARG A CG  1 
ATOM   1867  C  CD  . ARG A  1 247 ? 22.563  -22.312 79.562  1.00 19.13  ? 247  ARG A CD  1 
ATOM   1868  N  NE  . ARG A  1 247 ? 21.702  -21.179 79.200  1.00 18.85  ? 247  ARG A NE  1 
ATOM   1869  C  CZ  . ARG A  1 247 ? 20.429  -21.063 79.583  1.00 34.11  ? 247  ARG A CZ  1 
ATOM   1870  N  NH1 . ARG A  1 247 ? 19.881  -21.992 80.350  1.00 30.82  ? 247  ARG A NH1 1 
ATOM   1871  N  NH2 . ARG A  1 247 ? 19.693  -20.024 79.216  1.00 31.37  ? 247  ARG A NH2 1 
ATOM   1872  N  N   . ALA A  1 248 ? 26.950  -25.778 78.555  1.00 30.97  ? 248  ALA A N   1 
ATOM   1873  C  CA  . ALA A  1 248 ? 27.633  -27.009 78.959  1.00 25.36  ? 248  ALA A CA  1 
ATOM   1874  C  C   . ALA A  1 248 ? 29.116  -26.796 78.942  1.00 35.34  ? 248  ALA A C   1 
ATOM   1875  O  O   . ALA A  1 248 ? 29.824  -27.122 79.907  1.00 45.12  ? 248  ALA A O   1 
ATOM   1876  C  CB  . ALA A  1 248 ? 27.294  -28.138 78.040  1.00 23.17  ? 248  ALA A CB  1 
ATOM   1877  N  N   . THR A  1 249 ? 29.594  -26.269 77.824  1.00 25.60  ? 249  THR A N   1 
ATOM   1878  C  CA  . THR A  1 249 ? 31.009  -25.936 77.690  1.00 52.30  ? 249  THR A CA  1 
ATOM   1879  C  C   . THR A  1 249 ? 31.474  -25.123 78.911  1.00 27.44  ? 249  THR A C   1 
ATOM   1880  O  O   . THR A  1 249 ? 32.413  -25.503 79.603  1.00 76.00  ? 249  THR A O   1 
ATOM   1881  C  CB  . THR A  1 249 ? 31.251  -25.167 76.383  1.00 27.99  ? 249  THR A CB  1 
ATOM   1882  O  OG1 . THR A  1 249 ? 31.243  -26.082 75.277  1.00 28.43  ? 249  THR A OG1 1 
ATOM   1883  C  CG2 . THR A  1 249 ? 32.573  -24.446 76.435  1.00 97.61  ? 249  THR A CG2 1 
ATOM   1884  N  N   . LEU A  1 250 ? 30.772  -24.035 79.202  1.00 48.21  ? 250  LEU A N   1 
ATOM   1885  C  CA  . LEU A  1 250 ? 31.104  -23.157 80.318  1.00 45.77  ? 250  LEU A CA  1 
ATOM   1886  C  C   . LEU A  1 250 ? 31.084  -23.878 81.658  1.00 46.90  ? 250  LEU A C   1 
ATOM   1887  O  O   . LEU A  1 250 ? 31.988  -23.700 82.460  1.00 53.80  ? 250  LEU A O   1 
ATOM   1888  C  CB  . LEU A  1 250 ? 30.167  -21.946 80.352  1.00 44.98  ? 250  LEU A CB  1 
ATOM   1889  C  CG  . LEU A  1 250 ? 30.280  -21.001 81.546  1.00 26.01  ? 250  LEU A CG  1 
ATOM   1890  C  CD1 . LEU A  1 250 ? 31.684  -20.535 81.694  1.00 27.68  ? 250  LEU A CD1 1 
ATOM   1891  C  CD2 . LEU A  1 250 ? 29.339  -19.823 81.379  1.00 50.51  ? 250  LEU A CD2 1 
ATOM   1892  N  N   . LEU A  1 251 ? 30.056  -24.683 81.903  1.00 40.87  ? 251  LEU A N   1 
ATOM   1893  C  CA  . LEU A  1 251 ? 29.988  -25.472 83.129  1.00 37.52  ? 251  LEU A CA  1 
ATOM   1894  C  C   . LEU A  1 251 ? 31.247  -26.309 83.299  1.00 32.58  ? 251  LEU A C   1 
ATOM   1895  O  O   . LEU A  1 251 ? 31.877  -26.300 84.362  1.00 31.34  ? 251  LEU A O   1 
ATOM   1896  C  CB  . LEU A  1 251 ? 28.781  -26.394 83.121  1.00 23.69  ? 251  LEU A CB  1 
ATOM   1897  C  CG  . LEU A  1 251 ? 28.679  -27.087 84.469  1.00 23.53  ? 251  LEU A CG  1 
ATOM   1898  C  CD1 . LEU A  1 251 ? 27.970  -26.190 85.462  1.00 22.83  ? 251  LEU A CD1 1 
ATOM   1899  C  CD2 . LEU A  1 251 ? 27.962  -28.392 84.353  1.00 25.39  ? 251  LEU A CD2 1 
ATOM   1900  N  N   . ALA A  1 252 ? 31.606  -27.023 82.235  1.00 31.83  ? 252  ALA A N   1 
ATOM   1901  C  CA  . ALA A  1 252 ? 32.823  -27.822 82.229  1.00 35.46  ? 252  ALA A CA  1 
ATOM   1902  C  C   . ALA A  1 252 ? 34.012  -26.962 82.592  1.00 41.87  ? 252  ALA A C   1 
ATOM   1903  O  O   . ALA A  1 252 ? 34.806  -27.332 83.450  1.00 48.22  ? 252  ALA A O   1 
ATOM   1904  C  CB  . ALA A  1 252 ? 33.037  -28.461 80.879  1.00 37.97  ? 252  ALA A CB  1 
ATOM   1905  N  N   . ARG A  1 253 ? 34.128  -25.808 81.948  1.00 44.62  ? 253  ARG A N   1 
ATOM   1906  C  CA  . ARG A  1 253 ? 35.225  -24.901 82.254  1.00 49.45  ? 253  ARG A CA  1 
ATOM   1907  C  C   . ARG A  1 253 ? 35.263  -24.601 83.753  1.00 44.52  ? 253  ARG A C   1 
ATOM   1908  O  O   . ARG A  1 253 ? 36.316  -24.661 84.385  1.00 48.71  ? 253  ARG A O   1 
ATOM   1909  C  CB  . ARG A  1 253 ? 35.108  -23.611 81.442  1.00 59.05  ? 253  ARG A CB  1 
ATOM   1910  C  CG  . ARG A  1 253 ? 36.175  -23.449 80.355  1.00 69.89  ? 253  ARG A CG  1 
ATOM   1911  C  CD  . ARG A  1 253 ? 36.187  -22.019 79.789  1.00 77.24  ? 253  ARG A CD  1 
ATOM   1912  N  NE  . ARG A  1 253 ? 37.535  -21.457 79.742  1.00 80.84  ? 253  ARG A NE  1 
ATOM   1913  C  CZ  . ARG A  1 253 ? 38.101  -20.774 80.734  1.00 79.91  ? 253  ARG A CZ  1 
ATOM   1914  N  NH1 . ARG A  1 253 ? 37.434  -20.551 81.866  1.00 70.82  ? 253  ARG A NH1 1 
ATOM   1915  N  NH2 . ARG A  1 253 ? 39.342  -20.315 80.590  1.00 83.21  ? 253  ARG A NH2 1 
ATOM   1916  N  N   . LEU A  1 254 ? 34.094  -24.331 84.317  1.00 38.15  ? 254  LEU A N   1 
ATOM   1917  C  CA  . LEU A  1 254 ? 33.963  -23.972 85.721  1.00 34.53  ? 254  LEU A CA  1 
ATOM   1918  C  C   . LEU A  1 254 ? 34.346  -25.097 86.670  1.00 38.20  ? 254  LEU A C   1 
ATOM   1919  O  O   . LEU A  1 254 ? 34.817  -24.820 87.762  1.00 44.77  ? 254  LEU A O   1 
ATOM   1920  C  CB  . LEU A  1 254 ? 32.537  -23.512 86.025  1.00 28.26  ? 254  LEU A CB  1 
ATOM   1921  C  CG  . LEU A  1 254 ? 32.100  -22.221 85.348  1.00 27.83  ? 254  LEU A CG  1 
ATOM   1922  C  CD1 . LEU A  1 254 ? 30.709  -21.857 85.798  1.00 26.28  ? 254  LEU A CD1 1 
ATOM   1923  C  CD2 . LEU A  1 254 ? 33.063  -21.116 85.671  1.00 29.22  ? 254  LEU A CD2 1 
ATOM   1924  N  N   . VAL A  1 255 ? 34.123  -26.357 86.291  1.00 39.87  ? 255  VAL A N   1 
ATOM   1925  C  CA  . VAL A  1 255 ? 34.585  -27.447 87.156  1.00 30.96  ? 255  VAL A CA  1 
ATOM   1926  C  C   . VAL A  1 255 ? 35.931  -28.008 86.735  1.00 48.93  ? 255  VAL A C   1 
ATOM   1927  O  O   . VAL A  1 255 ? 36.207  -29.186 86.941  1.00 49.04  ? 255  VAL A O   1 
ATOM   1928  C  CB  . VAL A  1 255 ? 33.604  -28.600 87.258  1.00 29.69  ? 255  VAL A CB  1 
ATOM   1929  C  CG1 . VAL A  1 255 ? 32.314  -28.121 87.870  1.00 49.43  ? 255  VAL A CG1 1 
ATOM   1930  C  CG2 . VAL A  1 255 ? 33.363  -29.214 85.894  1.00 60.87  ? 255  VAL A CG2 1 
ATOM   1931  N  N   . GLY A  1 256 ? 36.772  -27.158 86.157  1.00 51.46  ? 256  GLY A N   1 
ATOM   1932  C  CA  . GLY A  1 256 ? 38.132  -27.540 85.824  1.00 54.07  ? 256  GLY A CA  1 
ATOM   1933  C  C   . GLY A  1 256 ? 38.209  -28.511 84.666  1.00 51.18  ? 256  GLY A C   1 
ATOM   1934  O  O   . GLY A  1 256 ? 39.257  -29.090 84.398  1.00 51.50  ? 256  GLY A O   1 
ATOM   1935  N  N   . CYS A  1 257 ? 37.099  -28.663 83.956  1.00 45.91  ? 257  CYS A N   1 
ATOM   1936  C  CA  . CYS A  1 257 ? 37.017  -29.611 82.858  1.00 44.91  ? 257  CYS A CA  1 
ATOM   1937  C  C   . CYS A  1 257 ? 37.227  -29.001 81.478  1.00 57.37  ? 257  CYS A C   1 
ATOM   1938  O  O   . CYS A  1 257 ? 36.447  -29.244 80.570  1.00 56.26  ? 257  CYS A O   1 
ATOM   1939  C  CB  . CYS A  1 257 ? 35.667  -30.330 82.885  1.00 44.55  ? 257  CYS A CB  1 
ATOM   1940  S  SG  . CYS A  1 257 ? 35.785  -32.061 83.255  1.00 75.17  ? 257  CYS A SG  1 
ATOM   1941  N  N   . PRO A  1 258 ? 38.256  -28.170 81.308  1.00 82.81  ? 258  PRO A N   1 
ATOM   1942  C  CA  . PRO A  1 258 ? 38.540  -28.229 79.876  1.00 94.33  ? 258  PRO A CA  1 
ATOM   1943  C  C   . PRO A  1 258 ? 39.159  -29.581 79.451  1.00 96.92  ? 258  PRO A C   1 
ATOM   1944  O  O   . PRO A  1 258 ? 38.639  -30.150 78.488  1.00 90.49  ? 258  PRO A O   1 
ATOM   1945  C  CB  . PRO A  1 258 ? 39.477  -27.037 79.654  1.00 101.74 ? 258  PRO A CB  1 
ATOM   1946  C  CG  . PRO A  1 258 ? 39.071  -26.046 80.717  1.00 97.72  ? 258  PRO A CG  1 
ATOM   1947  C  CD  . PRO A  1 258 ? 38.709  -26.900 81.913  1.00 93.13  ? 258  PRO A CD  1 
ATOM   1948  N  N   . PRO A  1 259 ? 40.182  -30.122 80.168  1.00 105.31 ? 259  PRO A N   1 
ATOM   1949  C  CA  . PRO A  1 259 ? 40.915  -29.773 81.407  1.00 110.67 ? 259  PRO A CA  1 
ATOM   1950  C  C   . PRO A  1 259 ? 41.948  -28.626 81.318  1.00 122.13 ? 259  PRO A C   1 
ATOM   1951  O  O   . PRO A  1 259 ? 41.948  -27.757 82.196  1.00 124.99 ? 259  PRO A O   1 
ATOM   1952  C  CB  . PRO A  1 259 ? 41.635  -31.085 81.780  1.00 105.59 ? 259  PRO A CB  1 
ATOM   1953  C  CG  . PRO A  1 259 ? 40.986  -32.152 80.961  1.00 102.25 ? 259  PRO A CG  1 
ATOM   1954  C  CD  . PRO A  1 259 ? 40.565  -31.468 79.701  1.00 104.12 ? 259  PRO A CD  1 
ATOM   1955  N  N   . GLY A  1 260 ? 42.812  -28.635 80.302  1.00 124.86 ? 260  GLY A N   1 
ATOM   1956  C  CA  . GLY A  1 260 ? 43.833  -27.607 80.141  1.00 121.84 ? 260  GLY A CA  1 
ATOM   1957  C  C   . GLY A  1 260 ? 43.342  -26.294 79.543  1.00 119.60 ? 260  GLY A C   1 
ATOM   1958  O  O   . GLY A  1 260 ? 43.750  -25.216 79.981  1.00 116.19 ? 260  GLY A O   1 
ATOM   1959  N  N   . GLY A  1 261 ? 42.473  -26.382 78.536  1.00 121.31 ? 261  GLY A N   1 
ATOM   1960  C  CA  . GLY A  1 261 ? 41.894  -25.204 77.906  1.00 122.48 ? 261  GLY A CA  1 
ATOM   1961  C  C   . GLY A  1 261 ? 40.947  -25.518 76.756  1.00 122.88 ? 261  GLY A C   1 
ATOM   1962  O  O   . GLY A  1 261 ? 40.383  -24.610 76.139  1.00 120.23 ? 261  GLY A O   1 
ATOM   1963  N  N   . ALA A  1 262 ? 40.764  -26.807 76.474  1.00 124.71 ? 262  ALA A N   1 
ATOM   1964  C  CA  . ALA A  1 262 ? 39.981  -27.252 75.317  1.00 122.81 ? 262  ALA A CA  1 
ATOM   1965  C  C   . ALA A  1 262 ? 38.458  -27.238 75.530  1.00 119.70 ? 262  ALA A C   1 
ATOM   1966  O  O   . ALA A  1 262 ? 37.913  -26.351 76.195  1.00 113.65 ? 262  ALA A O   1 
ATOM   1967  C  CB  . ALA A  1 262 ? 40.448  -28.644 74.864  1.00 120.50 ? 262  ALA A CB  1 
ATOM   1968  N  N   . GLY A  1 263 ? 37.788  -28.232 74.949  1.00 121.49 ? 263  GLY A N   1 
ATOM   1969  C  CA  . GLY A  1 263 ? 36.337  -28.323 74.955  1.00 120.12 ? 263  GLY A CA  1 
ATOM   1970  C  C   . GLY A  1 263 ? 35.804  -28.661 73.569  1.00 122.30 ? 263  GLY A C   1 
ATOM   1971  O  O   . GLY A  1 263 ? 34.599  -28.876 73.383  1.00 114.53 ? 263  GLY A O   1 
ATOM   1972  N  N   . GLY A  1 264 ? 36.718  -28.714 72.597  1.00 130.82 ? 264  GLY A N   1 
ATOM   1973  C  CA  . GLY A  1 264 ? 36.384  -28.949 71.198  1.00 130.21 ? 264  GLY A CA  1 
ATOM   1974  C  C   . GLY A  1 264 ? 36.005  -30.385 70.883  1.00 123.81 ? 264  GLY A C   1 
ATOM   1975  O  O   . GLY A  1 264 ? 34.992  -30.641 70.227  1.00 127.92 ? 264  GLY A O   1 
ATOM   1976  N  N   . ASN A  1 265 ? 36.831  -31.324 71.332  1.00 109.08 ? 265  ASN A N   1 
ATOM   1977  C  CA  . ASN A  1 265 ? 36.477  -32.732 71.289  1.00 92.75  ? 265  ASN A CA  1 
ATOM   1978  C  C   . ASN A  1 265 ? 35.401  -32.970 72.350  1.00 80.38  ? 265  ASN A C   1 
ATOM   1979  O  O   . ASN A  1 265 ? 35.693  -32.963 73.544  1.00 80.07  ? 265  ASN A O   1 
ATOM   1980  C  CB  . ASN A  1 265 ? 37.716  -33.583 71.564  1.00 91.00  ? 265  ASN A CB  1 
ATOM   1981  C  CG  . ASN A  1 265 ? 37.539  -35.026 71.153  1.00 92.83  ? 265  ASN A CG  1 
ATOM   1982  O  OD1 . ASN A  1 265 ? 36.802  -35.769 71.792  1.00 89.64  ? 265  ASN A OD1 1 
ATOM   1983  N  ND2 . ASN A  1 265 ? 38.221  -35.434 70.079  1.00 103.91 ? 265  ASN A ND2 1 
ATOM   1984  N  N   . ASP A  1 266 ? 34.155  -33.147 71.918  1.00 66.71  ? 266  ASP A N   1 
ATOM   1985  C  CA  . ASP A  1 266 ? 33.042  -33.282 72.851  1.00 52.81  ? 266  ASP A CA  1 
ATOM   1986  C  C   . ASP A  1 266 ? 33.216  -34.497 73.717  1.00 50.72  ? 266  ASP A C   1 
ATOM   1987  O  O   . ASP A  1 266 ? 32.953  -34.465 74.926  1.00 54.81  ? 266  ASP A O   1 
ATOM   1988  C  CB  . ASP A  1 266 ? 31.719  -33.428 72.107  1.00 52.57  ? 266  ASP A CB  1 
ATOM   1989  C  CG  . ASP A  1 266 ? 31.208  -32.119 71.570  1.00 57.63  ? 266  ASP A CG  1 
ATOM   1990  O  OD1 . ASP A  1 266 ? 31.763  -31.058 71.930  1.00 65.38  ? 266  ASP A OD1 1 
ATOM   1991  O  OD2 . ASP A  1 266 ? 30.236  -32.154 70.792  1.00 55.17  ? 266  ASP A OD2 1 
ATOM   1992  N  N   . THR A  1 267 ? 33.648  -35.577 73.080  1.00 46.78  ? 267  THR A N   1 
ATOM   1993  C  CA  . THR A  1 267 ? 33.737  -36.862 73.748  1.00 47.94  ? 267  THR A CA  1 
ATOM   1994  C  C   . THR A  1 267 ? 34.647  -36.731 74.964  1.00 52.80  ? 267  THR A C   1 
ATOM   1995  O  O   . THR A  1 267 ? 34.252  -37.086 76.081  1.00 55.00  ? 267  THR A O   1 
ATOM   1996  C  CB  . THR A  1 267 ? 34.220  -37.964 72.785  1.00 52.33  ? 267  THR A CB  1 
ATOM   1997  O  OG1 . THR A  1 267 ? 33.965  -37.556 71.434  1.00 58.63  ? 267  THR A OG1 1 
ATOM   1998  C  CG2 . THR A  1 267 ? 33.500  -39.280 73.055  1.00 35.58  ? 267  THR A CG2 1 
ATOM   1999  N  N   . GLU A  1 268 ? 35.831  -36.156 74.747  1.00 55.97  ? 268  GLU A N   1 
ATOM   2000  C  CA  . GLU A  1 268 ? 36.827  -35.983 75.802  1.00 55.08  ? 268  GLU A CA  1 
ATOM   2001  C  C   . GLU A  1 268 ? 36.468  -34.921 76.833  1.00 50.25  ? 268  GLU A C   1 
ATOM   2002  O  O   . GLU A  1 268 ? 37.186  -34.756 77.825  1.00 52.82  ? 268  GLU A O   1 
ATOM   2003  C  CB  . GLU A  1 268 ? 38.199  -35.693 75.205  1.00 66.67  ? 268  GLU A CB  1 
ATOM   2004  C  CG  . GLU A  1 268 ? 38.826  -36.921 74.573  1.00 84.28  ? 268  GLU A CG  1 
ATOM   2005  C  CD  . GLU A  1 268 ? 40.331  -36.983 74.765  1.00 99.38  ? 268  GLU A CD  1 
ATOM   2006  O  OE1 . GLU A  1 268 ? 40.922  -35.975 75.220  1.00 102.70 ? 268  GLU A OE1 1 
ATOM   2007  O  OE2 . GLU A  1 268 ? 40.919  -38.043 74.456  1.00 104.93 ? 268  GLU A OE2 1 
ATOM   2008  N  N   . LEU A  1 269 ? 35.358  -34.218 76.596  1.00 44.43  ? 269  LEU A N   1 
ATOM   2009  C  CA  . LEU A  1 269 ? 34.843  -33.206 77.516  1.00 36.41  ? 269  LEU A CA  1 
ATOM   2010  C  C   . LEU A  1 269 ? 33.847  -33.845 78.447  1.00 39.97  ? 269  LEU A C   1 
ATOM   2011  O  O   . LEU A  1 269 ? 33.989  -33.782 79.672  1.00 45.16  ? 269  LEU A O   1 
ATOM   2012  C  CB  . LEU A  1 269 ? 34.143  -32.086 76.746  1.00 35.05  ? 269  LEU A CB  1 
ATOM   2013  C  CG  . LEU A  1 269 ? 33.541  -30.924 77.540  1.00 38.38  ? 269  LEU A CG  1 
ATOM   2014  C  CD1 . LEU A  1 269 ? 34.652  -30.082 78.109  1.00 46.07  ? 269  LEU A CD1 1 
ATOM   2015  C  CD2 . LEU A  1 269 ? 32.628  -30.061 76.683  1.00 29.86  ? 269  LEU A CD2 1 
ATOM   2016  N  N   . ILE A  1 270 ? 32.830  -34.457 77.845  1.00 39.55  ? 270  ILE A N   1 
ATOM   2017  C  CA  . ILE A  1 270 ? 31.800  -35.164 78.588  1.00 39.55  ? 270  ILE A CA  1 
ATOM   2018  C  C   . ILE A  1 270 ? 32.457  -36.227 79.435  1.00 41.00  ? 270  ILE A C   1 
ATOM   2019  O  O   . ILE A  1 270 ? 32.016  -36.511 80.552  1.00 35.93  ? 270  ILE A O   1 
ATOM   2020  C  CB  . ILE A  1 270 ? 30.810  -35.818 77.630  1.00 49.15  ? 270  ILE A CB  1 
ATOM   2021  C  CG1 . ILE A  1 270 ? 30.113  -34.730 76.824  1.00 58.01  ? 270  ILE A CG1 1 
ATOM   2022  C  CG2 . ILE A  1 270 ? 29.788  -36.682 78.383  1.00 27.36  ? 270  ILE A CG2 1 
ATOM   2023  C  CD1 . ILE A  1 270 ? 29.767  -35.149 75.441  1.00 67.34  ? 270  ILE A CD1 1 
ATOM   2024  N  N   . ALA A  1 271 ? 33.533  -36.798 78.893  1.00 47.19  ? 271  ALA A N   1 
ATOM   2025  C  CA  . ALA A  1 271 ? 34.344  -37.775 79.608  1.00 39.82  ? 271  ALA A CA  1 
ATOM   2026  C  C   . ALA A  1 271 ? 34.882  -37.185 80.901  1.00 37.97  ? 271  ALA A C   1 
ATOM   2027  O  O   . ALA A  1 271 ? 34.737  -37.781 81.967  1.00 40.19  ? 271  ALA A O   1 
ATOM   2028  C  CB  . ALA A  1 271 ? 35.472  -38.229 78.748  1.00 37.58  ? 271  ALA A CB  1 
ATOM   2029  N  N   . CYS A  1 272 ? 35.500  -36.014 80.808  1.00 37.45  ? 272  CYS A N   1 
ATOM   2030  C  CA  . CYS A  1 272 ? 36.031  -35.364 81.997  1.00 42.58  ? 272  CYS A CA  1 
ATOM   2031  C  C   . CYS A  1 272 ? 34.910  -35.105 82.988  1.00 43.72  ? 272  CYS A C   1 
ATOM   2032  O  O   . CYS A  1 272 ? 35.062  -35.365 84.183  1.00 45.46  ? 272  CYS A O   1 
ATOM   2033  C  CB  . CYS A  1 272 ? 36.752  -34.058 81.638  1.00 47.02  ? 272  CYS A CB  1 
ATOM   2034  S  SG  . CYS A  1 272 ? 37.499  -33.144 83.032  1.00 95.84  ? 272  CYS A SG  1 
ATOM   2035  N  N   . LEU A  1 273 ? 33.786  -34.595 82.478  1.00 46.52  ? 273  LEU A N   1 
ATOM   2036  C  CA  . LEU A  1 273 ? 32.624  -34.266 83.312  1.00 37.63  ? 273  LEU A CA  1 
ATOM   2037  C  C   . LEU A  1 273 ? 32.146  -35.467 84.103  1.00 32.68  ? 273  LEU A C   1 
ATOM   2038  O  O   . LEU A  1 273 ? 31.841  -35.363 85.285  1.00 32.13  ? 273  LEU A O   1 
ATOM   2039  C  CB  . LEU A  1 273 ? 31.482  -33.748 82.455  1.00 27.66  ? 273  LEU A CB  1 
ATOM   2040  C  CG  . LEU A  1 273 ? 31.392  -32.248 82.227  1.00 35.06  ? 273  LEU A CG  1 
ATOM   2041  C  CD1 . LEU A  1 273 ? 30.467  -31.989 81.079  1.00 31.00  ? 273  LEU A CD1 1 
ATOM   2042  C  CD2 . LEU A  1 273 ? 30.877  -31.557 83.460  1.00 34.57  ? 273  LEU A CD2 1 
ATOM   2043  N  N   . ARG A  1 274 ? 32.111  -36.619 83.448  1.00 33.71  ? 274  ARG A N   1 
ATOM   2044  C  CA  . ARG A  1 274 ? 31.715  -37.856 84.109  1.00 38.30  ? 274  ARG A CA  1 
ATOM   2045  C  C   . ARG A  1 274 ? 32.664  -38.273 85.242  1.00 43.64  ? 274  ARG A C   1 
ATOM   2046  O  O   . ARG A  1 274 ? 32.285  -39.034 86.133  1.00 41.98  ? 274  ARG A O   1 
ATOM   2047  C  CB  . ARG A  1 274 ? 31.517  -38.975 83.079  1.00 40.07  ? 274  ARG A CB  1 
ATOM   2048  C  CG  . ARG A  1 274 ? 30.238  -38.795 82.252  1.00 42.44  ? 274  ARG A CG  1 
ATOM   2049  C  CD  . ARG A  1 274 ? 29.767  -40.087 81.620  1.00 42.10  ? 274  ARG A CD  1 
ATOM   2050  N  NE  . ARG A  1 274 ? 30.257  -40.239 80.254  1.00 47.35  ? 274  ARG A NE  1 
ATOM   2051  C  CZ  . ARG A  1 274 ? 29.481  -40.204 79.177  1.00 48.55  ? 274  ARG A CZ  1 
ATOM   2052  N  NH1 . ARG A  1 274 ? 28.175  -40.026 79.309  1.00 55.53  ? 274  ARG A NH1 1 
ATOM   2053  N  NH2 . ARG A  1 274 ? 30.005  -40.356 77.971  1.00 46.42  ? 274  ARG A NH2 1 
ATOM   2054  N  N   . THR A  1 275 ? 33.891  -37.758 85.220  1.00 47.13  ? 275  THR A N   1 
ATOM   2055  C  CA  . THR A  1 275 ? 34.814  -37.982 86.327  1.00 50.86  ? 275  THR A CA  1 
ATOM   2056  C  C   . THR A  1 275 ? 34.597  -36.997 87.474  1.00 50.91  ? 275  THR A C   1 
ATOM   2057  O  O   . THR A  1 275 ? 35.460  -36.858 88.335  1.00 60.61  ? 275  THR A O   1 
ATOM   2058  C  CB  . THR A  1 275 ? 36.293  -37.858 85.898  1.00 57.61  ? 275  THR A CB  1 
ATOM   2059  O  OG1 . THR A  1 275 ? 36.677  -36.481 85.905  1.00 55.73  ? 275  THR A OG1 1 
ATOM   2060  C  CG2 . THR A  1 275 ? 36.523  -38.452 84.517  1.00 62.51  ? 275  THR A CG2 1 
ATOM   2061  N  N   . ARG A  1 276 ? 33.467  -36.299 87.491  1.00 44.35  ? 276  ARG A N   1 
ATOM   2062  C  CA  . ARG A  1 276 ? 33.252  -35.279 88.515  1.00 40.36  ? 276  ARG A CA  1 
ATOM   2063  C  C   . ARG A  1 276 ? 32.184  -35.693 89.489  1.00 36.11  ? 276  ARG A C   1 
ATOM   2064  O  O   . ARG A  1 276 ? 31.132  -36.175 89.088  1.00 34.90  ? 276  ARG A O   1 
ATOM   2065  C  CB  . ARG A  1 276 ? 32.884  -33.922 87.903  1.00 29.60  ? 276  ARG A CB  1 
ATOM   2066  C  CG  . ARG A  1 276 ? 34.069  -33.094 87.463  1.00 42.91  ? 276  ARG A CG  1 
ATOM   2067  C  CD  . ARG A  1 276 ? 35.067  -32.855 88.596  1.00 50.38  ? 276  ARG A CD  1 
ATOM   2068  N  NE  . ARG A  1 276 ? 36.247  -32.152 88.097  1.00 64.91  ? 276  ARG A NE  1 
ATOM   2069  C  CZ  . ARG A  1 276 ? 37.255  -32.742 87.452  1.00 77.16  ? 276  ARG A CZ  1 
ATOM   2070  N  NH1 . ARG A  1 276 ? 37.228  -34.054 87.247  1.00 82.34  ? 276  ARG A NH1 1 
ATOM   2071  N  NH2 . ARG A  1 276 ? 38.295  -32.030 87.015  1.00 77.51  ? 276  ARG A NH2 1 
ATOM   2072  N  N   . PRO A  1 277 ? 32.441  -35.481 90.778  1.00 30.01  ? 277  PRO A N   1 
ATOM   2073  C  CA  . PRO A  1 277 ? 31.414  -35.680 91.799  1.00 43.04  ? 277  PRO A CA  1 
ATOM   2074  C  C   . PRO A  1 277 ? 30.137  -34.914 91.446  1.00 27.12  ? 277  PRO A C   1 
ATOM   2075  O  O   . PRO A  1 277 ? 30.197  -33.823 90.885  1.00 37.11  ? 277  PRO A O   1 
ATOM   2076  C  CB  . PRO A  1 277 ? 32.051  -35.076 93.053  1.00 41.72  ? 277  PRO A CB  1 
ATOM   2077  C  CG  . PRO A  1 277 ? 33.497  -35.053 92.786  1.00 37.83  ? 277  PRO A CG  1 
ATOM   2078  C  CD  . PRO A  1 277 ? 33.636  -34.821 91.319  1.00 38.36  ? 277  PRO A CD  1 
ATOM   2079  N  N   . ALA A  1 278 ? 28.991  -35.494 91.775  1.00 40.32  ? 278  ALA A N   1 
ATOM   2080  C  CA  . ALA A  1 278 ? 27.701  -34.925 91.409  1.00 34.64  ? 278  ALA A CA  1 
ATOM   2081  C  C   . ALA A  1 278 ? 27.471  -33.556 92.058  1.00 35.47  ? 278  ALA A C   1 
ATOM   2082  O  O   . ALA A  1 278 ? 26.946  -32.633 91.425  1.00 33.93  ? 278  ALA A O   1 
ATOM   2083  C  CB  . ALA A  1 278 ? 26.606  -35.878 91.763  1.00 23.46  ? 278  ALA A CB  1 
ATOM   2084  N  N   . GLN A  1 279 ? 27.886  -33.401 93.310  1.00 37.22  ? 279  GLN A N   1 
ATOM   2085  C  CA  . GLN A  1 279 ? 27.713  -32.107 93.955  1.00 39.17  ? 279  GLN A CA  1 
ATOM   2086  C  C   . GLN A  1 279 ? 28.624  -31.028 93.357  1.00 46.32  ? 279  GLN A C   1 
ATOM   2087  O  O   . GLN A  1 279 ? 28.351  -29.851 93.534  1.00 50.40  ? 279  GLN A O   1 
ATOM   2088  C  CB  . GLN A  1 279 ? 27.898  -32.195 95.475  1.00 34.54  ? 279  GLN A CB  1 
ATOM   2089  C  CG  . GLN A  1 279 ? 27.127  -31.127 96.252  1.00 29.61  ? 279  GLN A CG  1 
ATOM   2090  C  CD  . GLN A  1 279 ? 25.619  -31.400 96.295  1.00 34.71  ? 279  GLN A CD  1 
ATOM   2091  O  OE1 . GLN A  1 279 ? 25.186  -32.518 96.579  1.00 32.79  ? 279  GLN A OE1 1 
ATOM   2092  N  NE2 . GLN A  1 279 ? 24.819  -30.376 96.004  1.00 35.76  ? 279  GLN A NE2 1 
ATOM   2093  N  N   . ASP A  1 280 ? 29.699  -31.414 92.665  1.00 42.33  ? 280  ASP A N   1 
ATOM   2094  C  CA  . ASP A  1 280 ? 30.515  -30.430 91.958  1.00 37.44  ? 280  ASP A CA  1 
ATOM   2095  C  C   . ASP A  1 280 ? 29.628  -29.777 90.899  1.00 35.42  ? 280  ASP A C   1 
ATOM   2096  O  O   . ASP A  1 280 ? 29.468  -28.534 90.836  1.00 36.76  ? 280  ASP A O   1 
ATOM   2097  C  CB  . ASP A  1 280 ? 31.709  -31.112 91.302  1.00 52.05  ? 280  ASP A CB  1 
ATOM   2098  C  CG  . ASP A  1 280 ? 32.971  -30.248 91.313  1.00 73.66  ? 280  ASP A CG  1 
ATOM   2099  O  OD1 . ASP A  1 280 ? 32.865  -29.031 91.588  1.00 78.68  ? 280  ASP A OD1 1 
ATOM   2100  O  OD2 . ASP A  1 280 ? 34.071  -30.792 91.035  1.00 79.50  ? 280  ASP A OD2 1 
ATOM   2101  N  N   . LEU A  1 281 ? 29.017  -30.640 90.093  1.00 33.08  ? 281  LEU A N   1 
ATOM   2102  C  CA  . LEU A  1 281 ? 28.065  -30.224 89.073  1.00 23.44  ? 281  LEU A CA  1 
ATOM   2103  C  C   . LEU A  1 281 ? 26.891  -29.434 89.644  1.00 45.49  ? 281  LEU A C   1 
ATOM   2104  O  O   . LEU A  1 281 ? 26.478  -28.426 89.086  1.00 21.75  ? 281  LEU A O   1 
ATOM   2105  C  CB  . LEU A  1 281 ? 27.582  -31.435 88.281  1.00 22.89  ? 281  LEU A CB  1 
ATOM   2106  C  CG  . LEU A  1 281 ? 28.755  -32.070 87.551  1.00 24.14  ? 281  LEU A CG  1 
ATOM   2107  C  CD1 . LEU A  1 281 ? 28.384  -33.268 86.722  1.00 23.83  ? 281  LEU A CD1 1 
ATOM   2108  C  CD2 . LEU A  1 281 ? 29.370  -31.005 86.681  1.00 42.73  ? 281  LEU A CD2 1 
ATOM   2109  N  N   . VAL A  1 282 ? 26.353  -29.858 90.770  1.00 22.07  ? 282  VAL A N   1 
ATOM   2110  C  CA  . VAL A  1 282 ? 25.270  -29.067 91.306  1.00 29.84  ? 282  VAL A CA  1 
ATOM   2111  C  C   . VAL A  1 282 ? 25.804  -27.702 91.725  1.00 21.83  ? 282  VAL A C   1 
ATOM   2112  O  O   . VAL A  1 282 ? 25.507  -26.700 91.101  1.00 25.30  ? 282  VAL A O   1 
ATOM   2113  C  CB  . VAL A  1 282 ? 24.487  -29.771 92.438  1.00 24.86  ? 282  VAL A CB  1 
ATOM   2114  C  CG1 . VAL A  1 282 ? 23.248  -28.990 92.735  1.00 21.42  ? 282  VAL A CG1 1 
ATOM   2115  C  CG2 . VAL A  1 282 ? 24.077  -31.174 92.022  1.00 21.76  ? 282  VAL A CG2 1 
ATOM   2116  N  N   . ASP A  1 283 ? 26.640  -27.675 92.745  1.00 41.34  ? 283  ASP A N   1 
ATOM   2117  C  CA  . ASP A  1 283 ? 27.262  -26.442 93.213  1.00 37.62  ? 283  ASP A CA  1 
ATOM   2118  C  C   . ASP A  1 283 ? 27.749  -25.488 92.122  1.00 38.68  ? 283  ASP A C   1 
ATOM   2119  O  O   . ASP A  1 283 ? 27.964  -24.304 92.394  1.00 43.76  ? 283  ASP A O   1 
ATOM   2120  C  CB  . ASP A  1 283 ? 28.413  -26.767 94.165  1.00 34.92  ? 283  ASP A CB  1 
ATOM   2121  C  CG  . ASP A  1 283 ? 27.953  -27.542 95.374  1.00 35.87  ? 283  ASP A CG  1 
ATOM   2122  O  OD1 . ASP A  1 283 ? 26.722  -27.574 95.615  1.00 37.41  ? 283  ASP A OD1 1 
ATOM   2123  O  OD2 . ASP A  1 283 ? 28.813  -28.115 96.078  1.00 35.97  ? 283  ASP A OD2 1 
ATOM   2124  N  N   . HIS A  1 284 ? 27.917  -25.991 90.899  1.00 32.44  ? 284  HIS A N   1 
ATOM   2125  C  CA  . HIS A  1 284 ? 28.261  -25.102 89.789  1.00 23.87  ? 284  HIS A CA  1 
ATOM   2126  C  C   . HIS A  1 284 ? 27.193  -24.821 88.715  1.00 26.23  ? 284  HIS A C   1 
ATOM   2127  O  O   . HIS A  1 284 ? 27.371  -23.924 87.899  1.00 22.68  ? 284  HIS A O   1 
ATOM   2128  C  CB  . HIS A  1 284 ? 29.543  -25.576 89.117  1.00 43.73  ? 284  HIS A CB  1 
ATOM   2129  C  CG  . HIS A  1 284 ? 30.774  -25.293 89.913  1.00 48.10  ? 284  HIS A CG  1 
ATOM   2130  N  ND1 . HIS A  1 284 ? 31.318  -26.204 90.789  1.00 50.28  ? 284  HIS A ND1 1 
ATOM   2131  C  CD2 . HIS A  1 284 ? 31.563  -24.195 89.972  1.00 55.81  ? 284  HIS A CD2 1 
ATOM   2132  C  CE1 . HIS A  1 284 ? 32.396  -25.684 91.347  1.00 56.19  ? 284  HIS A CE1 1 
ATOM   2133  N  NE2 . HIS A  1 284 ? 32.565  -24.465 90.870  1.00 59.05  ? 284  HIS A NE2 1 
ATOM   2134  N  N   . GLU A  1 285 ? 26.084  -25.554 88.714  1.00 23.47  ? 285  GLU A N   1 
ATOM   2135  C  CA  . GLU A  1 285 ? 25.120  -25.444 87.597  1.00 22.44  ? 285  GLU A CA  1 
ATOM   2136  C  C   . GLU A  1 285 ? 24.489  -24.071 87.319  1.00 20.74  ? 285  GLU A C   1 
ATOM   2137  O  O   . GLU A  1 285 ? 24.282  -23.718 86.162  1.00 27.58  ? 285  GLU A O   1 
ATOM   2138  C  CB  . GLU A  1 285 ? 24.024  -26.506 87.689  1.00 22.86  ? 285  GLU A CB  1 
ATOM   2139  C  CG  . GLU A  1 285 ? 23.054  -26.290 88.809  1.00 33.81  ? 285  GLU A CG  1 
ATOM   2140  C  CD  . GLU A  1 285 ? 22.064  -27.402 88.902  1.00 42.92  ? 285  GLU A CD  1 
ATOM   2141  O  OE1 . GLU A  1 285 ? 22.469  -28.566 88.722  1.00 45.04  ? 285  GLU A OE1 1 
ATOM   2142  O  OE2 . GLU A  1 285 ? 20.878  -27.112 89.139  1.00 51.47  ? 285  GLU A OE2 1 
ATOM   2143  N  N   . TRP A  1 286 ? 24.196  -23.300 88.360  1.00 21.34  ? 286  TRP A N   1 
ATOM   2144  C  CA  . TRP A  1 286 ? 23.497  -22.024 88.179  1.00 27.13  ? 286  TRP A CA  1 
ATOM   2145  C  C   . TRP A  1 286 ? 24.404  -20.937 87.625  1.00 33.27  ? 286  TRP A C   1 
ATOM   2146  O  O   . TRP A  1 286 ? 23.932  -19.873 87.212  1.00 31.77  ? 286  TRP A O   1 
ATOM   2147  C  CB  . TRP A  1 286 ? 22.905  -21.534 89.500  1.00 24.03  ? 286  TRP A CB  1 
ATOM   2148  C  CG  . TRP A  1 286 ? 21.708  -22.302 89.993  1.00 29.95  ? 286  TRP A CG  1 
ATOM   2149  C  CD1 . TRP A  1 286 ? 21.713  -23.415 90.789  1.00 32.37  ? 286  TRP A CD1 1 
ATOM   2150  C  CD2 . TRP A  1 286 ? 20.332  -21.994 89.747  1.00 31.77  ? 286  TRP A CD2 1 
ATOM   2151  N  NE1 . TRP A  1 286 ? 20.429  -23.823 91.038  1.00 31.83  ? 286  TRP A NE1 1 
ATOM   2152  C  CE2 . TRP A  1 286 ? 19.562  -22.967 90.413  1.00 33.03  ? 286  TRP A CE2 1 
ATOM   2153  C  CE3 . TRP A  1 286 ? 19.677  -20.994 89.022  1.00 29.77  ? 286  TRP A CE3 1 
ATOM   2154  C  CZ2 . TRP A  1 286 ? 18.169  -22.969 90.376  1.00 32.35  ? 286  TRP A CZ2 1 
ATOM   2155  C  CZ3 . TRP A  1 286 ? 18.291  -20.999 88.986  1.00 29.53  ? 286  TRP A CZ3 1 
ATOM   2156  C  CH2 . TRP A  1 286 ? 17.554  -21.978 89.659  1.00 31.81  ? 286  TRP A CH2 1 
ATOM   2157  N  N   . HIS A  1 287 ? 25.705  -21.203 87.631  1.00 29.07  ? 287  HIS A N   1 
ATOM   2158  C  CA  . HIS A  1 287 ? 26.679  -20.172 87.339  1.00 36.51  ? 287  HIS A CA  1 
ATOM   2159  C  C   . HIS A  1 287 ? 26.718  -19.815 85.864  1.00 36.36  ? 287  HIS A C   1 
ATOM   2160  O  O   . HIS A  1 287 ? 27.242  -18.768 85.490  1.00 44.60  ? 287  HIS A O   1 
ATOM   2161  C  CB  . HIS A  1 287 ? 28.074  -20.606 87.797  1.00 44.91  ? 287  HIS A CB  1 
ATOM   2162  C  CG  . HIS A  1 287 ? 28.163  -20.924 89.256  1.00 46.02  ? 287  HIS A CG  1 
ATOM   2163  N  ND1 . HIS A  1 287 ? 27.073  -20.858 90.101  1.00 48.82  ? 287  HIS A ND1 1 
ATOM   2164  C  CD2 . HIS A  1 287 ? 29.213  -21.311 90.020  1.00 40.88  ? 287  HIS A CD2 1 
ATOM   2165  C  CE1 . HIS A  1 287 ? 27.450  -21.191 91.324  1.00 49.44  ? 287  HIS A CE1 1 
ATOM   2166  N  NE2 . HIS A  1 287 ? 28.741  -21.475 91.299  1.00 46.27  ? 287  HIS A NE2 1 
ATOM   2167  N  N   . VAL A  1 288 ? 26.171  -20.678 85.022  1.00 30.06  ? 288  VAL A N   1 
ATOM   2168  C  CA  . VAL A  1 288 ? 26.257  -20.459 83.587  1.00 36.91  ? 288  VAL A CA  1 
ATOM   2169  C  C   . VAL A  1 288 ? 25.152  -19.560 82.997  1.00 43.96  ? 288  VAL A C   1 
ATOM   2170  O  O   . VAL A  1 288 ? 25.246  -19.152 81.842  1.00 47.09  ? 288  VAL A O   1 
ATOM   2171  C  CB  . VAL A  1 288 ? 26.279  -21.783 82.839  1.00 37.14  ? 288  VAL A CB  1 
ATOM   2172  C  CG1 . VAL A  1 288 ? 27.559  -22.523 83.136  1.00 22.79  ? 288  VAL A CG1 1 
ATOM   2173  C  CG2 . VAL A  1 288 ? 25.065  -22.610 83.231  1.00 33.53  ? 288  VAL A CG2 1 
ATOM   2174  N  N   . LEU A  1 289 ? 24.112  -19.258 83.770  1.00 20.45  ? 289  LEU A N   1 
ATOM   2175  C  CA  . LEU A  1 289 ? 23.072  -18.352 83.302  1.00 26.93  ? 289  LEU A CA  1 
ATOM   2176  C  C   . LEU A  1 289 ? 23.685  -17.055 82.805  1.00 20.87  ? 289  LEU A C   1 
ATOM   2177  O  O   . LEU A  1 289 ? 24.470  -16.452 83.504  1.00 30.12  ? 289  LEU A O   1 
ATOM   2178  C  CB  . LEU A  1 289 ? 22.039  -18.065 84.402  1.00 19.32  ? 289  LEU A CB  1 
ATOM   2179  C  CG  . LEU A  1 289 ? 21.074  -19.208 84.743  1.00 18.33  ? 289  LEU A CG  1 
ATOM   2180  C  CD1 . LEU A  1 289 ? 20.098  -18.825 85.835  1.00 17.91  ? 289  LEU A CD1 1 
ATOM   2181  C  CD2 . LEU A  1 289 ? 20.357  -19.627 83.506  1.00 17.78  ? 289  LEU A CD2 1 
ATOM   2182  N  N   . PRO A  1 290 ? 23.324  -16.631 81.581  1.00 36.59  ? 290  PRO A N   1 
ATOM   2183  C  CA  . PRO A  1 290 ? 23.899  -15.482 80.875  1.00 26.04  ? 290  PRO A CA  1 
ATOM   2184  C  C   . PRO A  1 290 ? 23.545  -14.118 81.461  1.00 31.60  ? 290  PRO A C   1 
ATOM   2185  O  O   . PRO A  1 290 ? 24.376  -13.201 81.396  1.00 23.09  ? 290  PRO A O   1 
ATOM   2186  C  CB  . PRO A  1 290 ? 23.274  -15.602 79.485  1.00 28.51  ? 290  PRO A CB  1 
ATOM   2187  C  CG  . PRO A  1 290 ? 21.995  -16.275 79.705  1.00 20.41  ? 290  PRO A CG  1 
ATOM   2188  C  CD  . PRO A  1 290 ? 22.281  -17.284 80.768  1.00 42.93  ? 290  PRO A CD  1 
ATOM   2189  N  N   . GLN A  1 291 ? 22.331  -13.976 81.994  1.00 32.95  ? 291  GLN A N   1 
ATOM   2190  C  CA  . GLN A  1 291 ? 21.891  -12.694 82.526  1.00 21.55  ? 291  GLN A CA  1 
ATOM   2191  C  C   . GLN A  1 291 ? 21.344  -12.804 83.928  1.00 42.25  ? 291  GLN A C   1 
ATOM   2192  O  O   . GLN A  1 291 ? 21.013  -13.888 84.385  1.00 20.39  ? 291  GLN A O   1 
ATOM   2193  C  CB  . GLN A  1 291 ? 20.853  -12.069 81.614  1.00 32.61  ? 291  GLN A CB  1 
ATOM   2194  C  CG  . GLN A  1 291 ? 21.433  -11.496 80.354  1.00 38.60  ? 291  GLN A CG  1 
ATOM   2195  C  CD  . GLN A  1 291 ? 20.794  -12.064 79.113  1.00 44.35  ? 291  GLN A CD  1 
ATOM   2196  O  OE1 . GLN A  1 291 ? 20.549  -13.270 79.015  1.00 37.67  ? 291  GLN A OE1 1 
ATOM   2197  N  NE2 . GLN A  1 291 ? 20.515  -11.192 78.148  1.00 56.68  ? 291  GLN A NE2 1 
ATOM   2198  N  N   . GLU A  1 292 ? 21.272  -11.669 84.606  1.00 21.70  ? 292  GLU A N   1 
ATOM   2199  C  CA  . GLU A  1 292 ? 20.672  -11.574 85.925  1.00 21.50  ? 292  GLU A CA  1 
ATOM   2200  C  C   . GLU A  1 292 ? 19.134  -11.718 85.816  1.00 33.44  ? 292  GLU A C   1 
ATOM   2201  O  O   . GLU A  1 292 ? 18.445  -10.859 85.257  1.00 32.45  ? 292  GLU A O   1 
ATOM   2202  C  CB  . GLU A  1 292 ? 21.029  -10.223 86.526  1.00 22.57  ? 292  GLU A CB  1 
ATOM   2203  C  CG  . GLU A  1 292 ? 20.786  -10.103 88.010  1.00 22.77  ? 292  GLU A CG  1 
ATOM   2204  C  CD  . GLU A  1 292 ? 20.911  -8.670  88.482  1.00 38.17  ? 292  GLU A CD  1 
ATOM   2205  O  OE1 . GLU A  1 292 ? 21.167  -7.792  87.632  1.00 35.97  ? 292  GLU A OE1 1 
ATOM   2206  O  OE2 . GLU A  1 292 ? 20.756  -8.416  89.696  1.00 39.21  ? 292  GLU A OE2 1 
ATOM   2207  N  N   . SER A  1 293 ? 18.586  -12.795 86.365  1.00 27.75  ? 293  SER A N   1 
ATOM   2208  C  CA  . SER A  1 293 ? 17.238  -13.172 86.014  1.00 27.22  ? 293  SER A CA  1 
ATOM   2209  C  C   . SER A  1 293 ? 16.545  -13.934 87.111  1.00 27.88  ? 293  SER A C   1 
ATOM   2210  O  O   . SER A  1 293 ? 17.178  -14.393 88.059  1.00 27.37  ? 293  SER A O   1 
ATOM   2211  C  CB  . SER A  1 293 ? 17.302  -14.085 84.800  1.00 34.91  ? 293  SER A CB  1 
ATOM   2212  O  OG  . SER A  1 293 ? 17.804  -15.350 85.186  1.00 39.47  ? 293  SER A OG  1 
ATOM   2213  N  N   . ILE A  1 294 ? 15.228  -14.058 86.971  1.00 33.21  ? 294  ILE A N   1 
ATOM   2214  C  CA  . ILE A  1 294 ? 14.462  -15.046 87.719  1.00 33.38  ? 294  ILE A CA  1 
ATOM   2215  C  C   . ILE A  1 294 ? 13.666  -15.853 86.715  1.00 30.07  ? 294  ILE A C   1 
ATOM   2216  O  O   . ILE A  1 294 ? 13.547  -15.444 85.566  1.00 26.59  ? 294  ILE A O   1 
ATOM   2217  C  CB  . ILE A  1 294 ? 13.508  -14.414 88.731  1.00 28.91  ? 294  ILE A CB  1 
ATOM   2218  C  CG1 . ILE A  1 294 ? 12.416  -13.609 88.018  1.00 33.21  ? 294  ILE A CG1 1 
ATOM   2219  C  CG2 . ILE A  1 294 ? 14.291  -13.574 89.708  1.00 28.25  ? 294  ILE A CG2 1 
ATOM   2220  C  CD1 . ILE A  1 294 ? 11.406  -12.969 88.959  1.00 18.14  ? 294  ILE A CD1 1 
ATOM   2221  N  N   . PHE A  1 295 ? 13.148  -17.000 87.147  1.00 30.55  ? 295  PHE A N   1 
ATOM   2222  C  CA  . PHE A  1 295 ? 12.321  -17.849 86.295  1.00 25.91  ? 295  PHE A CA  1 
ATOM   2223  C  C   . PHE A  1 295 ? 13.099  -18.305 85.065  1.00 25.58  ? 295  PHE A C   1 
ATOM   2224  O  O   . PHE A  1 295 ? 12.575  -18.333 83.952  1.00 32.15  ? 295  PHE A O   1 
ATOM   2225  C  CB  . PHE A  1 295 ? 11.028  -17.124 85.904  1.00 18.34  ? 295  PHE A CB  1 
ATOM   2226  C  CG  . PHE A  1 295 ? 9.828   -18.017 85.818  1.00 23.08  ? 295  PHE A CG  1 
ATOM   2227  C  CD1 . PHE A  1 295 ? 9.890   -19.234 85.167  1.00 27.55  ? 295  PHE A CD1 1 
ATOM   2228  C  CD2 . PHE A  1 295 ? 8.628   -17.637 86.394  1.00 25.16  ? 295  PHE A CD2 1 
ATOM   2229  C  CE1 . PHE A  1 295 ? 8.764   -20.043 85.085  1.00 27.46  ? 295  PHE A CE1 1 
ATOM   2230  C  CE2 . PHE A  1 295 ? 7.510   -18.438 86.315  1.00 14.89  ? 295  PHE A CE2 1 
ATOM   2231  C  CZ  . PHE A  1 295 ? 7.567   -19.632 85.664  1.00 20.06  ? 295  PHE A CZ  1 
ATOM   2232  N  N   . ARG A  1 296 ? 14.358  -18.659 85.285  1.00 21.24  ? 296  ARG A N   1 
ATOM   2233  C  CA  . ARG A  1 296 ? 15.244  -19.146 84.230  1.00 30.47  ? 296  ARG A CA  1 
ATOM   2234  C  C   . ARG A  1 296 ? 16.237  -20.113 84.849  1.00 30.71  ? 296  ARG A C   1 
ATOM   2235  O  O   . ARG A  1 296 ? 16.882  -19.782 85.843  1.00 34.41  ? 296  ARG A O   1 
ATOM   2236  C  CB  . ARG A  1 296 ? 16.052  -17.995 83.624  1.00 30.62  ? 296  ARG A CB  1 
ATOM   2237  C  CG  . ARG A  1 296 ? 15.244  -16.926 82.941  1.00 23.49  ? 296  ARG A CG  1 
ATOM   2238  C  CD  . ARG A  1 296 ? 14.605  -17.407 81.656  1.00 18.35  ? 296  ARG A CD  1 
ATOM   2239  N  NE  . ARG A  1 296 ? 14.085  -16.262 80.924  1.00 19.15  ? 296  ARG A NE  1 
ATOM   2240  C  CZ  . ARG A  1 296 ? 12.862  -15.781 81.086  1.00 22.55  ? 296  ARG A CZ  1 
ATOM   2241  N  NH1 . ARG A  1 296 ? 12.036  -16.384 81.931  1.00 19.80  ? 296  ARG A NH1 1 
ATOM   2242  N  NH2 . ARG A  1 296 ? 12.466  -14.715 80.393  1.00 24.83  ? 296  ARG A NH2 1 
ATOM   2243  N  N   A PHE A  1 297 ? 16.318  -21.339 84.338  0.50 26.11  ? 297  PHE A N   1 
ATOM   2244  N  N   B PHE A  1 297 ? 16.436  -21.252 84.198  0.50 25.68  ? 297  PHE A N   1 
ATOM   2245  C  CA  A PHE A  1 297 ? 17.347  -22.244 84.847  0.50 26.98  ? 297  PHE A CA  1 
ATOM   2246  C  CA  B PHE A  1 297 ? 17.251  -22.310 84.767  0.50 27.50  ? 297  PHE A CA  1 
ATOM   2247  C  C   A PHE A  1 297 ? 18.304  -22.679 83.764  0.50 27.45  ? 297  PHE A C   1 
ATOM   2248  C  C   B PHE A  1 297 ? 18.278  -22.798 83.755  0.50 27.36  ? 297  PHE A C   1 
ATOM   2249  O  O   A PHE A  1 297 ? 17.945  -22.785 82.596  0.50 30.48  ? 297  PHE A O   1 
ATOM   2250  O  O   B PHE A  1 297 ? 17.937  -23.035 82.602  0.50 30.37  ? 297  PHE A O   1 
ATOM   2251  C  CB  A PHE A  1 297 ? 16.791  -23.470 85.588  0.50 30.22  ? 297  PHE A CB  1 
ATOM   2252  C  CB  B PHE A  1 297 ? 16.322  -23.434 85.205  0.50 31.55  ? 297  PHE A CB  1 
ATOM   2253  C  CG  A PHE A  1 297 ? 17.845  -24.510 85.895  0.50 29.03  ? 297  PHE A CG  1 
ATOM   2254  C  CG  B PHE A  1 297 ? 14.944  -22.949 85.577  0.50 32.32  ? 297  PHE A CG  1 
ATOM   2255  C  CD1 A PHE A  1 297 ? 18.886  -24.223 86.772  0.50 25.43  ? 297  PHE A CD1 1 
ATOM   2256  C  CD1 B PHE A  1 297 ? 14.728  -22.293 86.779  0.50 32.52  ? 297  PHE A CD1 1 
ATOM   2257  C  CD2 A PHE A  1 297 ? 17.815  -25.755 85.278  0.50 15.06  ? 297  PHE A CD2 1 
ATOM   2258  C  CD2 B PHE A  1 297 ? 13.879  -23.117 84.713  0.50 33.78  ? 297  PHE A CD2 1 
ATOM   2259  C  CE1 A PHE A  1 297 ? 19.873  -25.157 87.033  0.50 23.73  ? 297  PHE A CE1 1 
ATOM   2260  C  CE1 B PHE A  1 297 ? 13.476  -21.833 87.116  0.50 34.36  ? 297  PHE A CE1 1 
ATOM   2261  C  CE2 A PHE A  1 297 ? 18.786  -26.697 85.537  0.50 15.48  ? 297  PHE A CE2 1 
ATOM   2262  C  CE2 B PHE A  1 297 ? 12.615  -22.662 85.046  0.50 34.82  ? 297  PHE A CE2 1 
ATOM   2263  C  CZ  A PHE A  1 297 ? 19.823  -26.401 86.417  0.50 25.95  ? 297  PHE A CZ  1 
ATOM   2264  C  CZ  B PHE A  1 297 ? 12.412  -22.021 86.248  0.50 34.97  ? 297  PHE A CZ  1 
ATOM   2265  N  N   . SER A  1 298 ? 19.533  -22.927 84.187  1.00 22.65  ? 298  SER A N   1 
ATOM   2266  C  CA  . SER A  1 298 ? 20.631  -23.276 83.310  1.00 26.29  ? 298  SER A CA  1 
ATOM   2267  C  C   . SER A  1 298 ? 20.383  -24.414 82.320  1.00 26.62  ? 298  SER A C   1 
ATOM   2268  O  O   . SER A  1 298 ? 20.753  -24.307 81.147  1.00 28.87  ? 298  SER A O   1 
ATOM   2269  C  CB  . SER A  1 298 ? 21.844  -23.601 84.168  1.00 35.58  ? 298  SER A CB  1 
ATOM   2270  O  OG  . SER A  1 298 ? 22.088  -22.564 85.095  1.00 47.33  ? 298  SER A OG  1 
ATOM   2271  N  N   . PHE A  1 299 ? 19.753  -25.492 82.777  1.00 18.68  ? 299  PHE A N   1 
ATOM   2272  C  CA  . PHE A  1 299 ? 19.613  -26.670 81.936  1.00 19.90  ? 299  PHE A CA  1 
ATOM   2273  C  C   . PHE A  1 299 ? 18.168  -27.143 81.785  1.00 28.99  ? 299  PHE A C   1 
ATOM   2274  O  O   . PHE A  1 299 ? 17.551  -27.612 82.734  1.00 38.29  ? 299  PHE A O   1 
ATOM   2275  C  CB  . PHE A  1 299 ? 20.530  -27.762 82.451  1.00 16.63  ? 299  PHE A CB  1 
ATOM   2276  C  CG  . PHE A  1 299 ? 21.990  -27.361 82.449  1.00 26.65  ? 299  PHE A CG  1 
ATOM   2277  C  CD1 . PHE A  1 299 ? 22.781  -27.548 81.324  1.00 26.75  ? 299  PHE A CD1 1 
ATOM   2278  C  CD2 . PHE A  1 299 ? 22.570  -26.799 83.563  1.00 22.05  ? 299  PHE A CD2 1 
ATOM   2279  C  CE1 . PHE A  1 299 ? 24.114  -27.186 81.324  1.00 23.50  ? 299  PHE A CE1 1 
ATOM   2280  C  CE2 . PHE A  1 299 ? 23.912  -26.432 83.562  1.00 22.84  ? 299  PHE A CE2 1 
ATOM   2281  C  CZ  . PHE A  1 299 ? 24.677  -26.627 82.447  1.00 22.28  ? 299  PHE A CZ  1 
ATOM   2282  N  N   . VAL A  1 300 ? 17.629  -26.983 80.580  1.00 25.44  ? 300  VAL A N   1 
ATOM   2283  C  CA  . VAL A  1 300 ? 16.231  -27.252 80.301  1.00 14.74  ? 300  VAL A CA  1 
ATOM   2284  C  C   . VAL A  1 300 ? 16.128  -28.066 79.015  1.00 20.16  ? 300  VAL A C   1 
ATOM   2285  O  O   . VAL A  1 300 ? 17.146  -28.376 78.421  1.00 21.86  ? 300  VAL A O   1 
ATOM   2286  C  CB  . VAL A  1 300 ? 15.453  -25.944 80.127  1.00 32.68  ? 300  VAL A CB  1 
ATOM   2287  C  CG1 . VAL A  1 300 ? 15.644  -25.054 81.310  1.00 14.53  ? 300  VAL A CG1 1 
ATOM   2288  C  CG2 . VAL A  1 300 ? 15.916  -25.241 78.899  1.00 38.33  ? 300  VAL A CG2 1 
ATOM   2289  N  N   . PRO A  1 301 ? 14.907  -28.458 78.600  1.00 24.23  ? 301  PRO A N   1 
ATOM   2290  C  CA  . PRO A  1 301 ? 14.866  -29.070 77.276  1.00 28.67  ? 301  PRO A CA  1 
ATOM   2291  C  C   . PRO A  1 301 ? 15.560  -28.229 76.190  1.00 15.83  ? 301  PRO A C   1 
ATOM   2292  O  O   . PRO A  1 301 ? 15.538  -26.997 76.202  1.00 25.12  ? 301  PRO A O   1 
ATOM   2293  C  CB  . PRO A  1 301 ? 13.364  -29.215 77.030  1.00 14.72  ? 301  PRO A CB  1 
ATOM   2294  C  CG  . PRO A  1 301 ? 12.849  -29.524 78.351  1.00 57.48  ? 301  PRO A CG  1 
ATOM   2295  C  CD  . PRO A  1 301 ? 13.675  -28.763 79.352  1.00 14.00  ? 301  PRO A CD  1 
ATOM   2296  N  N   . VAL A  1 302 ? 16.208  -28.915 75.262  1.00 27.29  ? 302  VAL A N   1 
ATOM   2297  C  CA  . VAL A  1 302 ? 16.947  -28.238 74.209  1.00 26.61  ? 302  VAL A CA  1 
ATOM   2298  C  C   . VAL A  1 302 ? 16.247  -28.492 72.905  1.00 30.40  ? 302  VAL A C   1 
ATOM   2299  O  O   . VAL A  1 302 ? 15.492  -29.455 72.772  1.00 36.13  ? 302  VAL A O   1 
ATOM   2300  C  CB  . VAL A  1 302 ? 18.392  -28.740 74.103  1.00 18.14  ? 302  VAL A CB  1 
ATOM   2301  C  CG1 . VAL A  1 302 ? 18.433  -30.112 73.472  1.00 18.57  ? 302  VAL A CG1 1 
ATOM   2302  C  CG2 . VAL A  1 302 ? 19.212  -27.785 73.290  1.00 41.40  ? 302  VAL A CG2 1 
ATOM   2303  N  N   . VAL A  1 303 ? 16.479  -27.618 71.944  1.00 18.53  ? 303  VAL A N   1 
ATOM   2304  C  CA  . VAL A  1 303 ? 15.865  -27.787 70.651  1.00 30.18  ? 303  VAL A CA  1 
ATOM   2305  C  C   . VAL A  1 303 ? 16.895  -28.445 69.725  1.00 28.41  ? 303  VAL A C   1 
ATOM   2306  O  O   . VAL A  1 303 ? 17.612  -27.787 68.972  1.00 28.53  ? 303  VAL A O   1 
ATOM   2307  C  CB  . VAL A  1 303 ? 15.286  -26.455 70.145  1.00 19.37  ? 303  VAL A CB  1 
ATOM   2308  C  CG1 . VAL A  1 303 ? 14.473  -26.663 68.931  1.00 20.02  ? 303  VAL A CG1 1 
ATOM   2309  C  CG2 . VAL A  1 303 ? 14.416  -25.860 71.216  1.00 18.38  ? 303  VAL A CG2 1 
ATOM   2310  N  N   . ASP A  1 304 ? 16.946  -29.772 69.819  1.00 30.53  ? 304  ASP A N   1 
ATOM   2311  C  CA  . ASP A  1 304 ? 17.909  -30.615 69.110  1.00 28.86  ? 304  ASP A CA  1 
ATOM   2312  C  C   . ASP A  1 304 ? 17.496  -31.059 67.697  1.00 29.69  ? 304  ASP A C   1 
ATOM   2313  O  O   . ASP A  1 304 ? 18.287  -31.677 66.987  1.00 37.11  ? 304  ASP A O   1 
ATOM   2314  C  CB  . ASP A  1 304 ? 18.256  -31.859 69.964  1.00 25.53  ? 304  ASP A CB  1 
ATOM   2315  C  CG  . ASP A  1 304 ? 17.013  -32.686 70.392  1.00 55.63  ? 304  ASP A CG  1 
ATOM   2316  O  OD1 . ASP A  1 304 ? 15.849  -32.263 70.147  1.00 58.12  ? 304  ASP A OD1 1 
ATOM   2317  O  OD2 . ASP A  1 304 ? 17.218  -33.769 71.002  1.00 48.10  ? 304  ASP A OD2 1 
ATOM   2318  N  N   . GLY A  1 305 ? 16.266  -30.765 67.293  1.00 26.33  ? 305  GLY A N   1 
ATOM   2319  C  CA  . GLY A  1 305 ? 15.756  -31.304 66.053  1.00 23.10  ? 305  GLY A CA  1 
ATOM   2320  C  C   . GLY A  1 305 ? 15.674  -32.816 66.096  1.00 39.58  ? 305  GLY A C   1 
ATOM   2321  O  O   . GLY A  1 305 ? 15.785  -33.481 65.077  1.00 46.04  ? 305  GLY A O   1 
ATOM   2322  N  N   . ASP A  1 306 ? 15.498  -33.364 67.290  1.00 42.45  ? 306  ASP A N   1 
ATOM   2323  C  CA  . ASP A  1 306 ? 15.265  -34.793 67.467  1.00 45.36  ? 306  ASP A CA  1 
ATOM   2324  C  C   . ASP A  1 306 ? 14.024  -34.968 68.339  1.00 45.37  ? 306  ASP A C   1 
ATOM   2325  O  O   . ASP A  1 306 ? 12.949  -35.272 67.825  1.00 51.63  ? 306  ASP A O   1 
ATOM   2326  C  CB  . ASP A  1 306 ? 16.499  -35.477 68.079  1.00 50.00  ? 306  ASP A CB  1 
ATOM   2327  C  CG  . ASP A  1 306 ? 16.292  -36.973 68.354  1.00 54.48  ? 306  ASP A CG  1 
ATOM   2328  O  OD1 . ASP A  1 306 ? 15.258  -37.558 67.953  1.00 52.28  ? 306  ASP A OD1 1 
ATOM   2329  O  OD2 . ASP A  1 306 ? 17.200  -37.571 68.969  1.00 57.10  ? 306  ASP A OD2 1 
ATOM   2330  N  N   . PHE A  1 307 ? 14.157  -34.760 69.647  1.00 37.90  ? 307  PHE A N   1 
ATOM   2331  C  CA  . PHE A  1 307 ? 12.990  -34.842 70.503  1.00 31.01  ? 307  PHE A CA  1 
ATOM   2332  C  C   . PHE A  1 307 ? 12.033  -33.767 70.059  1.00 32.67  ? 307  PHE A C   1 
ATOM   2333  O  O   . PHE A  1 307 ? 10.861  -34.030 69.804  1.00 35.80  ? 307  PHE A O   1 
ATOM   2334  C  CB  . PHE A  1 307 ? 13.334  -34.638 71.970  1.00 22.92  ? 307  PHE A CB  1 
ATOM   2335  C  CG  . PHE A  1 307 ? 12.240  -35.078 72.898  1.00 24.56  ? 307  PHE A CG  1 
ATOM   2336  C  CD1 . PHE A  1 307 ? 11.105  -34.302 73.073  1.00 29.80  ? 307  PHE A CD1 1 
ATOM   2337  C  CD2 . PHE A  1 307 ? 12.323  -36.289 73.563  1.00 21.25  ? 307  PHE A CD2 1 
ATOM   2338  C  CE1 . PHE A  1 307 ? 10.085  -34.710 73.918  1.00 27.22  ? 307  PHE A CE1 1 
ATOM   2339  C  CE2 . PHE A  1 307 ? 11.321  -36.700 74.406  1.00 22.11  ? 307  PHE A CE2 1 
ATOM   2340  C  CZ  . PHE A  1 307 ? 10.198  -35.908 74.585  1.00 26.76  ? 307  PHE A CZ  1 
ATOM   2341  N  N   . LEU A  1 308 ? 12.543  -32.548 69.962  1.00 31.44  ? 308  LEU A N   1 
ATOM   2342  C  CA  . LEU A  1 308 ? 11.757  -31.462 69.413  1.00 33.77  ? 308  LEU A CA  1 
ATOM   2343  C  C   . LEU A  1 308 ? 12.266  -31.199 68.013  1.00 39.89  ? 308  LEU A C   1 
ATOM   2344  O  O   . LEU A  1 308 ? 13.400  -30.752 67.837  1.00 41.27  ? 308  LEU A O   1 
ATOM   2345  C  CB  . LEU A  1 308 ? 11.877  -30.217 70.279  1.00 33.51  ? 308  LEU A CB  1 
ATOM   2346  C  CG  . LEU A  1 308 ? 11.408  -30.442 71.705  1.00 17.21  ? 308  LEU A CG  1 
ATOM   2347  C  CD1 . LEU A  1 308 ? 11.566  -29.186 72.498  1.00 27.63  ? 308  LEU A CD1 1 
ATOM   2348  C  CD2 . LEU A  1 308 ? 9.962   -30.876 71.677  1.00 52.17  ? 308  LEU A CD2 1 
ATOM   2349  N  N   . SER A  1 309 ? 11.434  -31.500 67.022  1.00 38.12  ? 309  SER A N   1 
ATOM   2350  C  CA  . SER A  1 309 ? 11.828  -31.385 65.626  1.00 33.65  ? 309  SER A CA  1 
ATOM   2351  C  C   . SER A  1 309 ? 12.013  -29.921 65.214  1.00 35.19  ? 309  SER A C   1 
ATOM   2352  O  O   . SER A  1 309 ? 12.782  -29.612 64.305  1.00 39.73  ? 309  SER A O   1 
ATOM   2353  C  CB  . SER A  1 309 ? 10.789  -32.058 64.744  1.00 32.93  ? 309  SER A CB  1 
ATOM   2354  O  OG  . SER A  1 309 ? 9.586   -31.319 64.773  1.00 38.48  ? 309  SER A OG  1 
ATOM   2355  N  N   . ASP A  1 310 ? 11.296  -29.023 65.879  1.00 33.89  ? 310  ASP A N   1 
ATOM   2356  C  CA  . ASP A  1 310 ? 11.552  -27.592 65.743  1.00 37.59  ? 310  ASP A CA  1 
ATOM   2357  C  C   . ASP A  1 310 ? 11.298  -26.932 67.097  1.00 41.21  ? 310  ASP A C   1 
ATOM   2358  O  O   . ASP A  1 310 ? 11.090  -27.628 68.092  1.00 44.22  ? 310  ASP A O   1 
ATOM   2359  C  CB  . ASP A  1 310 ? 10.642  -26.987 64.682  1.00 41.51  ? 310  ASP A CB  1 
ATOM   2360  C  CG  . ASP A  1 310 ? 11.318  -25.893 63.895  1.00 45.37  ? 310  ASP A CG  1 
ATOM   2361  O  OD1 . ASP A  1 310 ? 11.422  -24.762 64.406  1.00 44.15  ? 310  ASP A OD1 1 
ATOM   2362  O  OD2 . ASP A  1 310 ? 11.743  -26.165 62.757  1.00 54.22  ? 310  ASP A OD2 1 
ATOM   2363  N  N   . THR A  1 311 ? 11.309  -25.601 67.145  1.00 36.92  ? 311  THR A N   1 
ATOM   2364  C  CA  . THR A  1 311 ? 10.947  -24.886 68.366  1.00 29.08  ? 311  THR A CA  1 
ATOM   2365  C  C   . THR A  1 311 ? 9.536   -25.296 68.736  1.00 34.28  ? 311  THR A C   1 
ATOM   2366  O  O   . THR A  1 311 ? 8.743   -25.657 67.859  1.00 33.18  ? 311  THR A O   1 
ATOM   2367  C  CB  . THR A  1 311 ? 10.943  -23.350 68.171  1.00 31.20  ? 311  THR A CB  1 
ATOM   2368  O  OG1 . THR A  1 311 ? 9.833   -22.965 67.352  1.00 33.24  ? 311  THR A OG1 1 
ATOM   2369  C  CG2 . THR A  1 311 ? 12.233  -22.869 67.533  1.00 32.78  ? 311  THR A CG2 1 
ATOM   2370  N  N   . PRO A  1 312 ? 9.211   -25.250 70.035  1.00 35.62  ? 312  PRO A N   1 
ATOM   2371  C  CA  . PRO A  1 312 ? 7.845   -25.624 70.387  1.00 27.57  ? 312  PRO A CA  1 
ATOM   2372  C  C   . PRO A  1 312 ? 6.896   -24.688 69.673  1.00 34.90  ? 312  PRO A C   1 
ATOM   2373  O  O   . PRO A  1 312 ? 5.894   -25.142 69.134  1.00 38.72  ? 312  PRO A O   1 
ATOM   2374  C  CB  . PRO A  1 312 ? 7.788   -25.386 71.900  1.00 17.15  ? 312  PRO A CB  1 
ATOM   2375  C  CG  . PRO A  1 312 ? 9.195   -25.434 72.350  1.00 36.46  ? 312  PRO A CG  1 
ATOM   2376  C  CD  . PRO A  1 312 ? 10.009  -24.878 71.216  1.00 40.82  ? 312  PRO A CD  1 
ATOM   2377  N  N   . GLU A  1 313 ? 7.231   -23.403 69.635  1.00 42.15  ? 313  GLU A N   1 
ATOM   2378  C  CA  . GLU A  1 313 ? 6.285   -22.414 69.132  1.00 49.68  ? 313  GLU A CA  1 
ATOM   2379  C  C   . GLU A  1 313 ? 5.870   -22.740 67.687  1.00 48.80  ? 313  GLU A C   1 
ATOM   2380  O  O   . GLU A  1 313 ? 4.679   -22.650 67.322  1.00 48.96  ? 313  GLU A O   1 
ATOM   2381  C  CB  . GLU A  1 313 ? 6.828   -20.987 69.320  1.00 49.22  ? 313  GLU A CB  1 
ATOM   2382  C  CG  . GLU A  1 313 ? 7.457   -20.366 68.100  1.00 59.85  ? 313  GLU A CG  1 
ATOM   2383  C  CD  . GLU A  1 313 ? 6.832   -19.025 67.774  1.00 70.21  ? 313  GLU A CD  1 
ATOM   2384  O  OE1 . GLU A  1 313 ? 6.204   -18.443 68.696  1.00 71.14  ? 313  GLU A OE1 1 
ATOM   2385  O  OE2 . GLU A  1 313 ? 6.956   -18.571 66.606  1.00 71.17  ? 313  GLU A OE2 1 
ATOM   2386  N  N   . ALA A  1 314 ? 6.852   -23.188 66.903  1.00 40.12  ? 314  ALA A N   1 
ATOM   2387  C  CA  . ALA A  1 314 ? 6.633   -23.653 65.538  1.00 36.38  ? 314  ALA A CA  1 
ATOM   2388  C  C   . ALA A  1 314 ? 5.616   -24.799 65.513  1.00 37.30  ? 314  ALA A C   1 
ATOM   2389  O  O   . ALA A  1 314 ? 4.600   -24.746 64.809  1.00 39.96  ? 314  ALA A O   1 
ATOM   2390  C  CB  . ALA A  1 314 ? 7.939   -24.114 64.947  1.00 23.11  ? 314  ALA A CB  1 
ATOM   2391  N  N   . LEU A  1 315 ? 5.906   -25.826 66.304  1.00 30.07  ? 315  LEU A N   1 
ATOM   2392  C  CA  . LEU A  1 315 ? 5.110   -27.034 66.351  1.00 27.24  ? 315  LEU A CA  1 
ATOM   2393  C  C   . LEU A  1 315 ? 3.667   -26.763 66.752  1.00 34.76  ? 315  LEU A C   1 
ATOM   2394  O  O   . LEU A  1 315 ? 2.736   -27.283 66.129  1.00 36.45  ? 315  LEU A O   1 
ATOM   2395  C  CB  . LEU A  1 315 ? 5.758   -28.019 67.313  1.00 28.80  ? 315  LEU A CB  1 
ATOM   2396  C  CG  . LEU A  1 315 ? 6.956   -28.669 66.630  1.00 34.62  ? 315  LEU A CG  1 
ATOM   2397  C  CD1 . LEU A  1 315 ? 7.927   -29.265 67.626  1.00 31.41  ? 315  LEU A CD1 1 
ATOM   2398  C  CD2 . LEU A  1 315 ? 6.436   -29.727 65.674  1.00 40.60  ? 315  LEU A CD2 1 
ATOM   2399  N  N   . ILE A  1 316 ? 3.479   -25.944 67.784  1.00 33.98  ? 316  ILE A N   1 
ATOM   2400  C  CA  . ILE A  1 316 ? 2.139   -25.623 68.241  1.00 35.70  ? 316  ILE A CA  1 
ATOM   2401  C  C   . ILE A  1 316 ? 1.462   -24.780 67.175  1.00 47.16  ? 316  ILE A C   1 
ATOM   2402  O  O   . ILE A  1 316 ? 0.231   -24.782 67.044  1.00 54.16  ? 316  ILE A O   1 
ATOM   2403  C  CB  . ILE A  1 316 ? 2.122   -24.903 69.608  1.00 35.43  ? 316  ILE A CB  1 
ATOM   2404  C  CG1 . ILE A  1 316 ? 2.606   -23.464 69.483  1.00 48.15  ? 316  ILE A CG1 1 
ATOM   2405  C  CG2 . ILE A  1 316 ? 2.982   -25.637 70.612  1.00 32.49  ? 316  ILE A CG2 1 
ATOM   2406  C  CD1 . ILE A  1 316 ? 2.395   -22.655 70.733  1.00 54.95  ? 316  ILE A CD1 1 
ATOM   2407  N  N   . ASN A  1 317 ? 2.266   -24.069 66.390  1.00 48.70  ? 317  ASN A N   1 
ATOM   2408  C  CA  . ASN A  1 317 ? 1.675   -23.278 65.327  1.00 49.31  ? 317  ASN A CA  1 
ATOM   2409  C  C   . ASN A  1 317 ? 1.163   -24.120 64.171  1.00 47.82  ? 317  ASN A C   1 
ATOM   2410  O  O   . ASN A  1 317 ? 0.104   -23.843 63.618  1.00 46.93  ? 317  ASN A O   1 
ATOM   2411  C  CB  . ASN A  1 317 ? 2.638   -22.201 64.842  1.00 52.77  ? 317  ASN A CB  1 
ATOM   2412  C  CG  . ASN A  1 317 ? 2.211   -20.826 65.284  1.00 63.57  ? 317  ASN A CG  1 
ATOM   2413  O  OD1 . ASN A  1 317 ? 1.432   -20.164 64.595  1.00 67.28  ? 317  ASN A OD1 1 
ATOM   2414  N  ND2 . ASN A  1 317 ? 2.682   -20.397 66.460  1.00 65.04  ? 317  ASN A ND2 1 
ATOM   2415  N  N   . THR A  1 318 ? 1.903   -25.173 63.844  1.00 46.49  ? 318  THR A N   1 
ATOM   2416  C  CA  . THR A  1 318 ? 1.734   -25.863 62.574  1.00 44.09  ? 318  THR A CA  1 
ATOM   2417  C  C   . THR A  1 318 ? 1.357   -27.327 62.739  1.00 43.81  ? 318  THR A C   1 
ATOM   2418  O  O   . THR A  1 318 ? 1.446   -28.103 61.787  1.00 45.69  ? 318  THR A O   1 
ATOM   2419  C  CB  . THR A  1 318 ? 3.038   -25.819 61.777  1.00 45.06  ? 318  THR A CB  1 
ATOM   2420  O  OG1 . THR A  1 318 ? 4.044   -26.540 62.499  1.00 50.58  ? 318  THR A OG1 1 
ATOM   2421  C  CG2 . THR A  1 318 ? 3.503   -24.379 61.582  1.00 42.12  ? 318  THR A CG2 1 
ATOM   2422  N  N   . GLY A  1 319 ? 0.949   -27.710 63.942  1.00 44.56  ? 319  GLY A N   1 
ATOM   2423  C  CA  . GLY A  1 319 ? 0.589   -29.093 64.205  1.00 45.39  ? 319  GLY A CA  1 
ATOM   2424  C  C   . GLY A  1 319 ? -0.821  -29.404 63.758  1.00 44.86  ? 319  GLY A C   1 
ATOM   2425  O  O   . GLY A  1 319 ? -1.497  -28.541 63.209  1.00 44.34  ? 319  GLY A O   1 
ATOM   2426  N  N   . ASP A  1 320 ? -1.249  -30.648 63.958  1.00 49.48  ? 320  ASP A N   1 
ATOM   2427  C  CA  . ASP A  1 320 ? -2.659  -31.019 63.813  1.00 51.11  ? 320  ASP A CA  1 
ATOM   2428  C  C   . ASP A  1 320 ? -3.089  -31.775 65.055  1.00 50.71  ? 320  ASP A C   1 
ATOM   2429  O  O   . ASP A  1 320 ? -2.624  -32.878 65.322  1.00 54.56  ? 320  ASP A O   1 
ATOM   2430  C  CB  . ASP A  1 320 ? -2.907  -31.864 62.565  1.00 57.20  ? 320  ASP A CB  1 
ATOM   2431  C  CG  . ASP A  1 320 ? -4.309  -32.466 62.534  1.00 67.11  ? 320  ASP A CG  1 
ATOM   2432  O  OD1 . ASP A  1 320 ? -5.292  -31.698 62.436  1.00 72.95  ? 320  ASP A OD1 1 
ATOM   2433  O  OD2 . ASP A  1 320 ? -4.429  -33.710 62.595  1.00 68.17  ? 320  ASP A OD2 1 
ATOM   2434  N  N   . PHE A  1 321 ? -3.978  -31.173 65.824  1.00 51.09  ? 321  PHE A N   1 
ATOM   2435  C  CA  . PHE A  1 321 ? -4.314  -31.725 67.119  1.00 49.64  ? 321  PHE A CA  1 
ATOM   2436  C  C   . PHE A  1 321 ? -5.780  -32.166 67.265  1.00 56.74  ? 321  PHE A C   1 
ATOM   2437  O  O   . PHE A  1 321 ? -6.329  -32.124 68.361  1.00 58.26  ? 321  PHE A O   1 
ATOM   2438  C  CB  . PHE A  1 321 ? -3.977  -30.698 68.186  1.00 44.01  ? 321  PHE A CB  1 
ATOM   2439  C  CG  . PHE A  1 321 ? -2.553  -30.214 68.143  1.00 45.91  ? 321  PHE A CG  1 
ATOM   2440  C  CD1 . PHE A  1 321 ? -1.525  -30.982 68.671  1.00 46.96  ? 321  PHE A CD1 1 
ATOM   2441  C  CD2 . PHE A  1 321 ? -2.244  -28.972 67.606  1.00 40.40  ? 321  PHE A CD2 1 
ATOM   2442  C  CE1 . PHE A  1 321 ? -0.217  -30.521 68.655  1.00 39.75  ? 321  PHE A CE1 1 
ATOM   2443  C  CE2 . PHE A  1 321 ? -0.940  -28.508 67.591  1.00 29.35  ? 321  PHE A CE2 1 
ATOM   2444  C  CZ  . PHE A  1 321 ? 0.069   -29.283 68.120  1.00 31.97  ? 321  PHE A CZ  1 
ATOM   2445  N  N   . GLN A  1 322 ? -6.404  -32.597 66.173  1.00 59.46  ? 322  GLN A N   1 
ATOM   2446  C  CA  . GLN A  1 322 ? -7.789  -33.054 66.221  1.00 66.10  ? 322  GLN A CA  1 
ATOM   2447  C  C   . GLN A  1 322 ? -7.950  -34.196 67.224  1.00 66.38  ? 322  GLN A C   1 
ATOM   2448  O  O   . GLN A  1 322 ? -8.958  -34.303 67.929  1.00 63.43  ? 322  GLN A O   1 
ATOM   2449  C  CB  . GLN A  1 322 ? -8.238  -33.513 64.831  1.00 76.74  ? 322  GLN A CB  1 
ATOM   2450  C  CG  . GLN A  1 322 ? -8.022  -32.481 63.725  1.00 83.97  ? 322  GLN A CG  1 
ATOM   2451  C  CD  . GLN A  1 322 ? -8.521  -32.956 62.363  1.00 91.36  ? 322  GLN A CD  1 
ATOM   2452  O  OE1 . GLN A  1 322 ? -8.784  -34.144 62.159  1.00 89.05  ? 322  GLN A OE1 1 
ATOM   2453  N  NE2 . GLN A  1 322 ? -8.654  -32.021 61.425  1.00 97.18  ? 322  GLN A NE2 1 
ATOM   2454  N  N   . ASP A  1 323 ? -6.913  -35.021 67.295  1.00 70.05  ? 323  ASP A N   1 
ATOM   2455  C  CA  . ASP A  1 323 ? -6.896  -36.263 68.060  1.00 75.94  ? 323  ASP A CA  1 
ATOM   2456  C  C   . ASP A  1 323 ? -6.859  -36.051 69.583  1.00 63.20  ? 323  ASP A C   1 
ATOM   2457  O  O   . ASP A  1 323 ? -6.822  -37.008 70.359  1.00 62.64  ? 323  ASP A O   1 
ATOM   2458  C  CB  . ASP A  1 323 ? -5.650  -37.049 67.617  1.00 94.61  ? 323  ASP A CB  1 
ATOM   2459  C  CG  . ASP A  1 323 ? -5.677  -38.506 68.047  1.00 109.50 ? 323  ASP A CG  1 
ATOM   2460  O  OD1 . ASP A  1 323 ? -6.786  -39.078 68.165  1.00 114.53 ? 323  ASP A OD1 1 
ATOM   2461  O  OD2 . ASP A  1 323 ? -4.579  -39.077 68.258  1.00 111.96 ? 323  ASP A OD2 1 
ATOM   2462  N  N   . LEU A  1 324 ? -6.892  -34.797 70.014  1.00 53.81  ? 324  LEU A N   1 
ATOM   2463  C  CA  . LEU A  1 324 ? -6.347  -34.459 71.323  1.00 40.57  ? 324  LEU A CA  1 
ATOM   2464  C  C   . LEU A  1 324 ? -7.216  -33.564 72.201  1.00 37.22  ? 324  LEU A C   1 
ATOM   2465  O  O   . LEU A  1 324 ? -7.792  -32.583 71.738  1.00 42.33  ? 324  LEU A O   1 
ATOM   2466  C  CB  . LEU A  1 324 ? -4.985  -33.789 71.127  1.00 34.51  ? 324  LEU A CB  1 
ATOM   2467  C  CG  . LEU A  1 324 ? -4.260  -33.311 72.374  1.00 32.65  ? 324  LEU A CG  1 
ATOM   2468  C  CD1 . LEU A  1 324 ? -3.790  -34.508 73.146  1.00 19.48  ? 324  LEU A CD1 1 
ATOM   2469  C  CD2 . LEU A  1 324 ? -3.108  -32.406 71.991  1.00 37.89  ? 324  LEU A CD2 1 
ATOM   2470  N  N   . GLN A  1 325 ? -7.276  -33.901 73.485  1.00 31.56  ? 325  GLN A N   1 
ATOM   2471  C  CA  . GLN A  1 325 ? -7.954  -33.074 74.465  1.00 28.61  ? 325  GLN A CA  1 
ATOM   2472  C  C   . GLN A  1 325 ? -6.956  -32.617 75.518  1.00 20.10  ? 325  GLN A C   1 
ATOM   2473  O  O   . GLN A  1 325 ? -6.185  -33.425 76.056  1.00 31.67  ? 325  GLN A O   1 
ATOM   2474  C  CB  . GLN A  1 325 ? -9.104  -33.837 75.126  1.00 34.90  ? 325  GLN A CB  1 
ATOM   2475  C  CG  . GLN A  1 325 ? -10.007 -34.607 74.169  1.00 42.90  ? 325  GLN A CG  1 
ATOM   2476  C  CD  . GLN A  1 325 ? -9.697  -36.093 74.157  1.00 54.82  ? 325  GLN A CD  1 
ATOM   2477  O  OE1 . GLN A  1 325 ? -10.054 -36.821 75.082  1.00 62.45  ? 325  GLN A OE1 1 
ATOM   2478  N  NE2 . GLN A  1 325 ? -9.014  -36.549 73.113  1.00 59.16  ? 325  GLN A NE2 1 
ATOM   2479  N  N   . VAL A  1 326 ? -6.991  -31.317 75.804  1.00 20.04  ? 326  VAL A N   1 
ATOM   2480  C  CA  . VAL A  1 326 ? -6.111  -30.692 76.775  1.00 18.95  ? 326  VAL A CA  1 
ATOM   2481  C  C   . VAL A  1 326 ? -6.878  -29.856 77.765  1.00 28.65  ? 326  VAL A C   1 
ATOM   2482  O  O   . VAL A  1 326 ? -7.818  -29.156 77.406  1.00 33.96  ? 326  VAL A O   1 
ATOM   2483  C  CB  . VAL A  1 326 ? -5.147  -29.719 76.113  1.00 18.72  ? 326  VAL A CB  1 
ATOM   2484  C  CG1 . VAL A  1 326 ? -3.731  -30.271 76.109  1.00 17.77  ? 326  VAL A CG1 1 
ATOM   2485  C  CG2 . VAL A  1 326 ? -5.600  -29.421 74.729  1.00 20.12  ? 326  VAL A CG2 1 
ATOM   2486  N  N   . LEU A  1 327 ? -6.442  -29.912 79.015  1.00 31.42  ? 327  LEU A N   1 
ATOM   2487  C  CA  . LEU A  1 327 ? -6.927  -29.030 80.063  1.00 33.00  ? 327  LEU A CA  1 
ATOM   2488  C  C   . LEU A  1 327 ? -5.772  -28.126 80.524  1.00 35.78  ? 327  LEU A C   1 
ATOM   2489  O  O   . LEU A  1 327 ? -4.830  -28.598 81.139  1.00 37.28  ? 327  LEU A O   1 
ATOM   2490  C  CB  . LEU A  1 327 ? -7.425  -29.871 81.230  1.00 30.81  ? 327  LEU A CB  1 
ATOM   2491  C  CG  . LEU A  1 327 ? -7.954  -29.125 82.446  1.00 28.56  ? 327  LEU A CG  1 
ATOM   2492  C  CD1 . LEU A  1 327 ? -9.209  -28.414 82.064  1.00 26.94  ? 327  LEU A CD1 1 
ATOM   2493  C  CD2 . LEU A  1 327 ? -8.212  -30.091 83.580  1.00 18.45  ? 327  LEU A CD2 1 
ATOM   2494  N  N   . VAL A  1 328 ? -5.844  -26.833 80.216  1.00 36.55  ? 328  VAL A N   1 
ATOM   2495  C  CA  . VAL A  1 328 ? -4.816  -25.873 80.597  1.00 17.46  ? 328  VAL A CA  1 
ATOM   2496  C  C   . VAL A  1 328 ? -5.325  -24.910 81.646  1.00 25.63  ? 328  VAL A C   1 
ATOM   2497  O  O   . VAL A  1 328 ? -6.515  -24.575 81.672  1.00 18.77  ? 328  VAL A O   1 
ATOM   2498  C  CB  . VAL A  1 328 ? -4.441  -24.975 79.429  1.00 21.35  ? 328  VAL A CB  1 
ATOM   2499  C  CG1 . VAL A  1 328 ? -2.970  -25.073 79.152  1.00 16.96  ? 328  VAL A CG1 1 
ATOM   2500  C  CG2 . VAL A  1 328 ? -5.250  -25.326 78.208  1.00 18.69  ? 328  VAL A CG2 1 
ATOM   2501  N  N   . GLY A  1 329 ? -4.423  -24.419 82.488  1.00 25.91  ? 329  GLY A N   1 
ATOM   2502  C  CA  . GLY A  1 329 ? -4.842  -23.395 83.434  1.00 27.01  ? 329  GLY A CA  1 
ATOM   2503  C  C   . GLY A  1 329 ? -3.752  -22.693 84.219  1.00 34.66  ? 329  GLY A C   1 
ATOM   2504  O  O   . GLY A  1 329 ? -2.615  -23.158 84.264  1.00 41.82  ? 329  GLY A O   1 
ATOM   2505  N  N   . VAL A  1 330 ? -4.094  -21.567 84.844  1.00 31.10  ? 330  VAL A N   1 
ATOM   2506  C  CA  . VAL A  1 330 ? -3.115  -20.871 85.690  1.00 31.99  ? 330  VAL A CA  1 
ATOM   2507  C  C   . VAL A  1 330 ? -3.671  -20.567 87.078  1.00 35.06  ? 330  VAL A C   1 
ATOM   2508  O  O   . VAL A  1 330 ? -4.888  -20.519 87.257  1.00 32.82  ? 330  VAL A O   1 
ATOM   2509  C  CB  . VAL A  1 330 ? -2.637  -19.553 85.050  1.00 17.68  ? 330  VAL A CB  1 
ATOM   2510  C  CG1 . VAL A  1 330 ? -2.256  -19.778 83.615  1.00 27.39  ? 330  VAL A CG1 1 
ATOM   2511  C  CG2 . VAL A  1 330 ? -3.714  -18.502 85.126  1.00 21.93  ? 330  VAL A CG2 1 
ATOM   2512  N  N   . VAL A  1 331 ? -2.791  -20.362 88.057  1.00 17.53  ? 331  VAL A N   1 
ATOM   2513  C  CA  . VAL A  1 331 ? -3.231  -19.851 89.358  1.00 18.22  ? 331  VAL A CA  1 
ATOM   2514  C  C   . VAL A  1 331 ? -3.349  -18.332 89.267  1.00 26.73  ? 331  VAL A C   1 
ATOM   2515  O  O   . VAL A  1 331 ? -2.905  -17.740 88.283  1.00 29.78  ? 331  VAL A O   1 
ATOM   2516  C  CB  . VAL A  1 331 ? -2.306  -20.264 90.544  1.00 17.74  ? 331  VAL A CB  1 
ATOM   2517  C  CG1 . VAL A  1 331 ? -2.107  -21.773 90.580  1.00 16.99  ? 331  VAL A CG1 1 
ATOM   2518  C  CG2 . VAL A  1 331 ? -0.972  -19.562 90.470  1.00 17.36  ? 331  VAL A CG2 1 
ATOM   2519  N  N   . LYS A  1 332 ? -3.937  -17.703 90.282  1.00 19.95  ? 332  LYS A N   1 
ATOM   2520  C  CA  . LYS A  1 332 ? -4.311  -16.291 90.195  1.00 29.63  ? 332  LYS A CA  1 
ATOM   2521  C  C   . LYS A  1 332 ? -3.123  -15.355 90.290  1.00 26.63  ? 332  LYS A C   1 
ATOM   2522  O  O   . LYS A  1 332 ? -3.162  -14.238 89.787  1.00 27.46  ? 332  LYS A O   1 
ATOM   2523  C  CB  . LYS A  1 332 ? -5.353  -15.921 91.265  1.00 34.42  ? 332  LYS A CB  1 
ATOM   2524  C  CG  . LYS A  1 332 ? -5.941  -14.509 91.124  1.00 34.54  ? 332  LYS A CG  1 
ATOM   2525  C  CD  . LYS A  1 332 ? -7.107  -14.242 92.076  1.00 31.51  ? 332  LYS A CD  1 
ATOM   2526  C  CE  . LYS A  1 332 ? -6.848  -13.035 92.995  1.00 38.51  ? 332  LYS A CE  1 
ATOM   2527  N  NZ  . LYS A  1 332 ? -5.893  -13.334 94.133  1.00 44.52  ? 332  LYS A NZ  1 
ATOM   2528  N  N   . ASP A  1 333 ? -2.062  -15.816 90.932  1.00 27.92  ? 333  ASP A N   1 
ATOM   2529  C  CA  . ASP A  1 333 ? -0.899  -14.973 91.145  1.00 30.45  ? 333  ASP A CA  1 
ATOM   2530  C  C   . ASP A  1 333 ? 0.386   -15.680 90.753  1.00 33.17  ? 333  ASP A C   1 
ATOM   2531  O  O   . ASP A  1 333 ? 1.277   -15.893 91.576  1.00 39.56  ? 333  ASP A O   1 
ATOM   2532  C  CB  . ASP A  1 333 ? -0.857  -14.513 92.596  1.00 29.41  ? 333  ASP A CB  1 
ATOM   2533  C  CG  . ASP A  1 333 ? -1.979  -13.575 92.919  1.00 39.49  ? 333  ASP A CG  1 
ATOM   2534  O  OD1 . ASP A  1 333 ? -3.119  -14.059 93.093  1.00 39.97  ? 333  ASP A OD1 1 
ATOM   2535  O  OD2 . ASP A  1 333 ? -1.727  -12.351 92.972  1.00 48.35  ? 333  ASP A OD2 1 
ATOM   2536  N  N   . GLU A  1 334 ? 0.471   -16.034 89.481  1.00 27.42  ? 334  GLU A N   1 
ATOM   2537  C  CA  . GLU A  1 334 ? 1.614   -16.769 88.967  1.00 25.59  ? 334  GLU A CA  1 
ATOM   2538  C  C   . GLU A  1 334 ? 2.967   -16.187 89.348  1.00 27.07  ? 334  GLU A C   1 
ATOM   2539  O  O   . GLU A  1 334 ? 3.902   -16.928 89.663  1.00 20.72  ? 334  GLU A O   1 
ATOM   2540  C  CB  . GLU A  1 334 ? 1.517   -16.884 87.451  1.00 22.00  ? 334  GLU A CB  1 
ATOM   2541  C  CG  . GLU A  1 334 ? 0.429   -17.819 87.002  1.00 26.28  ? 334  GLU A CG  1 
ATOM   2542  C  CD  . GLU A  1 334 ? 0.716   -19.256 87.373  1.00 28.51  ? 334  GLU A CD  1 
ATOM   2543  O  OE1 . GLU A  1 334 ? 1.889   -19.583 87.683  1.00 30.00  ? 334  GLU A OE1 1 
ATOM   2544  O  OE2 . GLU A  1 334 ? -0.234  -20.062 87.345  1.00 30.99  ? 334  GLU A OE2 1 
ATOM   2545  N  N   . GLY A  1 335 ? 3.069   -14.865 89.340  1.00 29.02  ? 335  GLY A N   1 
ATOM   2546  C  CA  . GLY A  1 335 ? 4.375   -14.246 89.414  1.00 26.17  ? 335  GLY A CA  1 
ATOM   2547  C  C   . GLY A  1 335 ? 4.962   -14.155 90.800  1.00 30.29  ? 335  GLY A C   1 
ATOM   2548  O  O   . GLY A  1 335 ? 6.178   -14.229 90.967  1.00 35.38  ? 335  GLY A O   1 
ATOM   2549  N  N   . SER A  1 336 ? 4.102   -14.004 91.798  1.00 27.46  ? 336  SER A N   1 
ATOM   2550  C  CA  . SER A  1 336 ? 4.561   -13.563 93.107  1.00 29.99  ? 336  SER A CA  1 
ATOM   2551  C  C   . SER A  1 336 ? 5.689   -14.404 93.709  1.00 23.99  ? 336  SER A C   1 
ATOM   2552  O  O   . SER A  1 336 ? 6.660   -13.849 94.199  1.00 21.76  ? 336  SER A O   1 
ATOM   2553  C  CB  . SER A  1 336 ? 3.395   -13.464 94.077  1.00 20.32  ? 336  SER A CB  1 
ATOM   2554  O  OG  . SER A  1 336 ? 2.895   -14.752 94.322  1.00 19.76  ? 336  SER A OG  1 
ATOM   2555  N  N   . TYR A  1 337 ? 5.567   -15.729 93.655  1.00 25.25  ? 337  TYR A N   1 
ATOM   2556  C  CA  . TYR A  1 337 ? 6.521   -16.626 94.319  1.00 23.62  ? 337  TYR A CA  1 
ATOM   2557  C  C   . TYR A  1 337 ? 7.947   -16.310 93.902  1.00 27.79  ? 337  TYR A C   1 
ATOM   2558  O  O   . TYR A  1 337 ? 8.860   -16.365 94.712  1.00 32.68  ? 337  TYR A O   1 
ATOM   2559  C  CB  . TYR A  1 337 ? 6.182   -18.103 94.025  1.00 22.46  ? 337  TYR A CB  1 
ATOM   2560  C  CG  . TYR A  1 337 ? 7.165   -19.142 94.580  1.00 37.00  ? 337  TYR A CG  1 
ATOM   2561  C  CD1 . TYR A  1 337 ? 8.388   -19.392 93.951  1.00 45.50  ? 337  TYR A CD1 1 
ATOM   2562  C  CD2 . TYR A  1 337 ? 6.853   -19.902 95.706  1.00 44.78  ? 337  TYR A CD2 1 
ATOM   2563  C  CE1 . TYR A  1 337 ? 9.279   -20.345 94.440  1.00 50.14  ? 337  TYR A CE1 1 
ATOM   2564  C  CE2 . TYR A  1 337 ? 7.739   -20.861 96.206  1.00 51.26  ? 337  TYR A CE2 1 
ATOM   2565  C  CZ  . TYR A  1 337 ? 8.957   -21.080 95.569  1.00 57.22  ? 337  TYR A CZ  1 
ATOM   2566  O  OH  . TYR A  1 337 ? 9.850   -22.038 96.052  1.00 59.12  ? 337  TYR A OH  1 
ATOM   2567  N  N   . PHE A  1 338 ? 8.127   -15.952 92.639  1.00 28.09  ? 338  PHE A N   1 
ATOM   2568  C  CA  . PHE A  1 338 ? 9.459   -15.820 92.073  1.00 25.05  ? 338  PHE A CA  1 
ATOM   2569  C  C   . PHE A  1 338 ? 10.177  -14.548 92.492  1.00 28.92  ? 338  PHE A C   1 
ATOM   2570  O  O   . PHE A  1 338 ? 11.409  -14.481 92.435  1.00 31.68  ? 338  PHE A O   1 
ATOM   2571  C  CB  . PHE A  1 338 ? 9.394   -15.939 90.552  1.00 20.15  ? 338  PHE A CB  1 
ATOM   2572  C  CG  . PHE A  1 338 ? 8.904   -17.263 90.098  1.00 25.11  ? 338  PHE A CG  1 
ATOM   2573  C  CD1 . PHE A  1 338 ? 7.541   -17.510 89.995  1.00 26.13  ? 338  PHE A CD1 1 
ATOM   2574  C  CD2 . PHE A  1 338 ? 9.800   -18.284 89.820  1.00 27.59  ? 338  PHE A CD2 1 
ATOM   2575  C  CE1 . PHE A  1 338 ? 7.076   -18.747 89.609  1.00 25.22  ? 338  PHE A CE1 1 
ATOM   2576  C  CE2 . PHE A  1 338 ? 9.351   -19.522 89.437  1.00 26.83  ? 338  PHE A CE2 1 
ATOM   2577  C  CZ  . PHE A  1 338 ? 7.974   -19.755 89.330  1.00 28.30  ? 338  PHE A CZ  1 
ATOM   2578  N  N   . LEU A  1 339 ? 9.415   -13.548 92.917  1.00 24.28  ? 339  LEU A N   1 
ATOM   2579  C  CA  . LEU A  1 339 ? 9.991   -12.246 93.231  1.00 25.97  ? 339  LEU A CA  1 
ATOM   2580  C  C   . LEU A  1 339 ? 10.945  -12.304 94.407  1.00 34.77  ? 339  LEU A C   1 
ATOM   2581  O  O   . LEU A  1 339 ? 11.908  -11.532 94.462  1.00 37.90  ? 339  LEU A O   1 
ATOM   2582  C  CB  . LEU A  1 339 ? 8.900   -11.213 93.487  1.00 20.96  ? 339  LEU A CB  1 
ATOM   2583  C  CG  . LEU A  1 339 ? 7.935   -11.111 92.311  1.00 24.06  ? 339  LEU A CG  1 
ATOM   2584  C  CD1 . LEU A  1 339 ? 6.792   -10.142 92.600  1.00 21.24  ? 339  LEU A CD1 1 
ATOM   2585  C  CD2 . LEU A  1 339 ? 8.712   -10.698 91.081  1.00 22.65  ? 339  LEU A CD2 1 
ATOM   2586  N  N   . VAL A  1 340 ? 10.707  -13.226 95.334  1.00 20.32  ? 340  VAL A N   1 
ATOM   2587  C  CA  . VAL A  1 340 ? 11.553  -13.270 96.517  1.00 36.03  ? 340  VAL A CA  1 
ATOM   2588  C  C   . VAL A  1 340 ? 12.878  -13.954 96.204  1.00 38.14  ? 340  VAL A C   1 
ATOM   2589  O  O   . VAL A  1 340 ? 13.786  -14.008 97.036  1.00 32.04  ? 340  VAL A O   1 
ATOM   2590  C  CB  . VAL A  1 340 ? 10.862  -13.964 97.668  1.00 21.25  ? 340  VAL A CB  1 
ATOM   2591  C  CG1 . VAL A  1 340 ? 9.661   -13.154 98.104  1.00 36.79  ? 340  VAL A CG1 1 
ATOM   2592  C  CG2 . VAL A  1 340 ? 10.423  -15.326 97.232  1.00 30.32  ? 340  VAL A CG2 1 
ATOM   2593  N  N   . TYR A  1 341 ? 12.980  -14.460 94.980  1.00 42.74  ? 341  TYR A N   1 
ATOM   2594  C  CA  . TYR A  1 341 ? 14.164  -15.176 94.535  1.00 42.62  ? 341  TYR A CA  1 
ATOM   2595  C  C   . TYR A  1 341 ? 15.106  -14.337 93.682  1.00 51.48  ? 341  TYR A C   1 
ATOM   2596  O  O   . TYR A  1 341 ? 15.917  -14.885 92.940  1.00 60.77  ? 341  TYR A O   1 
ATOM   2597  C  CB  . TYR A  1 341 ? 13.749  -16.395 93.722  1.00 36.23  ? 341  TYR A CB  1 
ATOM   2598  C  CG  . TYR A  1 341 ? 13.365  -17.570 94.557  1.00 44.23  ? 341  TYR A CG  1 
ATOM   2599  C  CD1 . TYR A  1 341 ? 12.113  -17.650 95.139  1.00 54.24  ? 341  TYR A CD1 1 
ATOM   2600  C  CD2 . TYR A  1 341 ? 14.253  -18.608 94.767  1.00 53.31  ? 341  TYR A CD2 1 
ATOM   2601  C  CE1 . TYR A  1 341 ? 11.754  -18.736 95.916  1.00 61.33  ? 341  TYR A CE1 1 
ATOM   2602  C  CE2 . TYR A  1 341 ? 13.907  -19.703 95.541  1.00 58.41  ? 341  TYR A CE2 1 
ATOM   2603  C  CZ  . TYR A  1 341 ? 12.655  -19.762 96.111  1.00 63.65  ? 341  TYR A CZ  1 
ATOM   2604  O  OH  . TYR A  1 341 ? 12.299  -20.851 96.876  1.00 70.62  ? 341  TYR A OH  1 
ATOM   2605  N  N   . GLY A  1 342 ? 15.008  -13.018 93.753  1.00 50.92  ? 342  GLY A N   1 
ATOM   2606  C  CA  . GLY A  1 342 ? 15.885  -12.223 92.921  1.00 47.96  ? 342  GLY A CA  1 
ATOM   2607  C  C   . GLY A  1 342 ? 15.548  -10.760 92.778  1.00 47.27  ? 342  GLY A C   1 
ATOM   2608  O  O   . GLY A  1 342 ? 16.456  -9.933  92.704  1.00 56.12  ? 342  GLY A O   1 
ATOM   2609  N  N   . VAL A  1 343 ? 14.260  -10.434 92.728  1.00 35.14  ? 343  VAL A N   1 
ATOM   2610  C  CA  . VAL A  1 343 ? 13.850  -9.044  92.593  1.00 37.89  ? 343  VAL A CA  1 
ATOM   2611  C  C   . VAL A  1 343 ? 13.899  -8.310  93.938  1.00 46.28  ? 343  VAL A C   1 
ATOM   2612  O  O   . VAL A  1 343 ? 13.100  -8.578  94.835  1.00 46.98  ? 343  VAL A O   1 
ATOM   2613  C  CB  . VAL A  1 343 ? 12.460  -8.956  92.000  1.00 38.04  ? 343  VAL A CB  1 
ATOM   2614  C  CG1 . VAL A  1 343 ? 12.026  -7.508  91.881  1.00 39.47  ? 343  VAL A CG1 1 
ATOM   2615  C  CG2 . VAL A  1 343 ? 12.454  -9.634  90.660  1.00 38.79  ? 343  VAL A CG2 1 
ATOM   2616  N  N   . PRO A  1 344 ? 14.850  -7.374  94.078  1.00 49.76  ? 344  PRO A N   1 
ATOM   2617  C  CA  . PRO A  1 344 ? 15.118  -6.703  95.351  1.00 51.49  ? 344  PRO A CA  1 
ATOM   2618  C  C   . PRO A  1 344 ? 13.929  -5.884  95.826  1.00 38.94  ? 344  PRO A C   1 
ATOM   2619  O  O   . PRO A  1 344 ? 13.371  -5.123  95.042  1.00 39.16  ? 344  PRO A O   1 
ATOM   2620  C  CB  . PRO A  1 344 ? 16.291  -5.774  95.013  1.00 26.60  ? 344  PRO A CB  1 
ATOM   2621  C  CG  . PRO A  1 344 ? 16.893  -6.359  93.807  1.00 25.69  ? 344  PRO A CG  1 
ATOM   2622  C  CD  . PRO A  1 344 ? 15.754  -6.895  93.022  1.00 45.91  ? 344  PRO A CD  1 
ATOM   2623  N  N   . GLY A  1 345 ? 13.570  -6.047  97.095  1.00 28.93  ? 345  GLY A N   1 
ATOM   2624  C  CA  . GLY A  1 345 ? 12.507  -5.285  97.715  1.00 32.65  ? 345  GLY A CA  1 
ATOM   2625  C  C   . GLY A  1 345 ? 11.356  -6.199  98.080  1.00 44.82  ? 345  GLY A C   1 
ATOM   2626  O  O   . GLY A  1 345 ? 10.390  -5.773  98.720  1.00 48.65  ? 345  GLY A O   1 
ATOM   2627  N  N   . PHE A  1 346 ? 11.470  -7.465  97.676  1.00 45.43  ? 346  PHE A N   1 
ATOM   2628  C  CA  . PHE A  1 346 ? 10.416  -8.457  97.877  1.00 40.00  ? 346  PHE A CA  1 
ATOM   2629  C  C   . PHE A  1 346 ? 10.829  -9.541  98.867  1.00 42.61  ? 346  PHE A C   1 
ATOM   2630  O  O   . PHE A  1 346 ? 11.854  -10.190 98.693  1.00 48.26  ? 346  PHE A O   1 
ATOM   2631  C  CB  . PHE A  1 346 ? 10.040  -9.094  96.540  1.00 35.48  ? 346  PHE A CB  1 
ATOM   2632  C  CG  . PHE A  1 346 ? 9.279   -8.178  95.631  1.00 37.91  ? 346  PHE A CG  1 
ATOM   2633  C  CD1 . PHE A  1 346 ? 9.947   -7.312  94.781  1.00 36.69  ? 346  PHE A CD1 1 
ATOM   2634  C  CD2 . PHE A  1 346 ? 7.883   -8.178  95.631  1.00 36.79  ? 346  PHE A CD2 1 
ATOM   2635  C  CE1 . PHE A  1 346 ? 9.235   -6.469  93.941  1.00 40.44  ? 346  PHE A CE1 1 
ATOM   2636  C  CE2 . PHE A  1 346 ? 7.157   -7.337  94.796  1.00 31.08  ? 346  PHE A CE2 1 
ATOM   2637  C  CZ  . PHE A  1 346 ? 7.827   -6.482  93.949  1.00 38.31  ? 346  PHE A CZ  1 
ATOM   2638  N  N   . SER A  1 347 ? 10.017  -9.739  99.899  1.00 40.56  ? 347  SER A N   1 
ATOM   2639  C  CA  . SER A  1 347 ? 10.315  -10.718 100.934 1.00 41.17  ? 347  SER A CA  1 
ATOM   2640  C  C   . SER A  1 347 ? 9.031   -11.390 101.416 1.00 44.25  ? 347  SER A C   1 
ATOM   2641  O  O   . SER A  1 347 ? 7.939   -10.844 101.269 1.00 52.03  ? 347  SER A O   1 
ATOM   2642  C  CB  . SER A  1 347 ? 11.008  -10.034 102.110 1.00 49.72  ? 347  SER A CB  1 
ATOM   2643  O  OG  . SER A  1 347 ? 11.533  -10.981 103.026 1.00 61.41  ? 347  SER A OG  1 
ATOM   2644  N  N   . LYS A  1 348 ? 9.158   -12.576 102.001 1.00 38.56  ? 348  LYS A N   1 
ATOM   2645  C  CA  . LYS A  1 348 ? 8.003   -13.258 102.568 1.00 34.41  ? 348  LYS A CA  1 
ATOM   2646  C  C   . LYS A  1 348 ? 7.642   -12.640 103.915 1.00 42.01  ? 348  LYS A C   1 
ATOM   2647  O  O   . LYS A  1 348 ? 6.588   -12.921 104.493 1.00 46.51  ? 348  LYS A O   1 
ATOM   2648  C  CB  . LYS A  1 348 ? 8.294   -14.752 102.738 1.00 31.16  ? 348  LYS A CB  1 
ATOM   2649  C  CG  . LYS A  1 348 ? 9.157   -15.074 103.940 1.00 40.47  ? 348  LYS A CG  1 
ATOM   2650  C  CD  . LYS A  1 348 ? 9.214   -16.565 104.246 1.00 42.63  ? 348  LYS A CD  1 
ATOM   2651  C  CE  . LYS A  1 348 ? 9.814   -16.787 105.628 1.00 44.61  ? 348  LYS A CE  1 
ATOM   2652  N  NZ  . LYS A  1 348 ? 9.016   -16.119 106.701 1.00 44.70  ? 348  LYS A NZ  1 
ATOM   2653  N  N   . ASP A  1 349 ? 8.523   -11.772 104.397 1.00 43.98  ? 349  ASP A N   1 
ATOM   2654  C  CA  . ASP A  1 349 ? 8.478   -11.325 105.775 1.00 43.94  ? 349  ASP A CA  1 
ATOM   2655  C  C   . ASP A  1 349 ? 7.761   -9.997  105.970 1.00 44.05  ? 349  ASP A C   1 
ATOM   2656  O  O   . ASP A  1 349 ? 7.578   -9.555  107.101 1.00 50.16  ? 349  ASP A O   1 
ATOM   2657  C  CB  . ASP A  1 349 ? 9.899   -11.242 106.331 1.00 47.79  ? 349  ASP A CB  1 
ATOM   2658  C  CG  . ASP A  1 349 ? 10.551  -12.611 106.491 1.00 52.75  ? 349  ASP A CG  1 
ATOM   2659  O  OD1 . ASP A  1 349 ? 9.913   -13.513 107.078 1.00 53.62  ? 349  ASP A OD1 1 
ATOM   2660  O  OD2 . ASP A  1 349 ? 11.704  -12.784 106.029 1.00 56.64  ? 349  ASP A OD2 1 
ATOM   2661  N  N   . ASN A  1 350 ? 7.357   -9.355  104.878 1.00 39.87  ? 350  ASN A N   1 
ATOM   2662  C  CA  . ASN A  1 350 ? 6.611   -8.098  104.981 1.00 42.09  ? 350  ASN A CA  1 
ATOM   2663  C  C   . ASN A  1 350 ? 5.780   -7.824  103.740 1.00 40.81  ? 350  ASN A C   1 
ATOM   2664  O  O   . ASN A  1 350 ? 5.806   -8.606  102.800 1.00 41.93  ? 350  ASN A O   1 
ATOM   2665  C  CB  . ASN A  1 350 ? 7.554   -6.929  105.233 1.00 41.47  ? 350  ASN A CB  1 
ATOM   2666  C  CG  . ASN A  1 350 ? 8.552   -6.758  104.126 1.00 45.01  ? 350  ASN A CG  1 
ATOM   2667  O  OD1 . ASN A  1 350 ? 8.224   -6.244  103.062 1.00 47.72  ? 350  ASN A OD1 1 
ATOM   2668  N  ND2 . ASN A  1 350 ? 9.783   -7.199  104.359 1.00 51.90  ? 350  ASN A ND2 1 
ATOM   2669  N  N   . GLU A  1 351 ? 5.064   -6.702  103.725 1.00 42.50  ? 351  GLU A N   1 
ATOM   2670  C  CA  . GLU A  1 351 ? 4.174   -6.376  102.605 1.00 45.91  ? 351  GLU A CA  1 
ATOM   2671  C  C   . GLU A  1 351 ? 4.885   -6.132  101.272 1.00 39.79  ? 351  GLU A C   1 
ATOM   2672  O  O   . GLU A  1 351 ? 4.229   -5.959  100.249 1.00 37.89  ? 351  GLU A O   1 
ATOM   2673  C  CB  . GLU A  1 351 ? 3.286   -5.176  102.941 1.00 54.92  ? 351  GLU A CB  1 
ATOM   2674  C  CG  . GLU A  1 351 ? 1.916   -5.538  103.487 1.00 61.98  ? 351  GLU A CG  1 
ATOM   2675  C  CD  . GLU A  1 351 ? 1.206   -4.333  104.062 1.00 74.79  ? 351  GLU A CD  1 
ATOM   2676  O  OE1 . GLU A  1 351 ? 1.338   -3.234  103.479 1.00 76.05  ? 351  GLU A OE1 1 
ATOM   2677  O  OE2 . GLU A  1 351 ? 0.534   -4.478  105.109 1.00 82.02  ? 351  GLU A OE2 1 
ATOM   2678  N  N   . SER A  1 352 ? 6.214   -6.115  101.294 1.00 38.46  ? 352  SER A N   1 
ATOM   2679  C  CA  . SER A  1 352 ? 7.015   -5.937  100.092 1.00 38.36  ? 352  SER A CA  1 
ATOM   2680  C  C   . SER A  1 352 ? 6.523   -4.790  99.228  1.00 41.98  ? 352  SER A C   1 
ATOM   2681  O  O   . SER A  1 352 ? 6.159   -4.987  98.067  1.00 42.57  ? 352  SER A O   1 
ATOM   2682  C  CB  . SER A  1 352 ? 7.039   -7.225  99.283  1.00 43.33  ? 352  SER A CB  1 
ATOM   2683  O  OG  . SER A  1 352 ? 7.815   -8.204  99.944  1.00 51.34  ? 352  SER A OG  1 
ATOM   2684  N  N   . LEU A  1 353 ? 6.486   -3.597  99.810  1.00 42.66  ? 353  LEU A N   1 
ATOM   2685  C  CA  . LEU A  1 353 ? 6.082   -2.410  99.075  1.00 41.11  ? 353  LEU A CA  1 
ATOM   2686  C  C   . LEU A  1 353 ? 7.321   -1.785  98.451  1.00 49.81  ? 353  LEU A C   1 
ATOM   2687  O  O   . LEU A  1 353 ? 8.349   -1.633  99.114  1.00 60.06  ? 353  LEU A O   1 
ATOM   2688  C  CB  . LEU A  1 353 ? 5.365   -1.440  100.006 1.00 35.67  ? 353  LEU A CB  1 
ATOM   2689  C  CG  . LEU A  1 353 ? 4.098   -2.044  100.622 1.00 35.00  ? 353  LEU A CG  1 
ATOM   2690  C  CD1 . LEU A  1 353 ? 3.552   -1.168  101.725 1.00 35.91  ? 353  LEU A CD1 1 
ATOM   2691  C  CD2 . LEU A  1 353 ? 3.041   -2.255  99.562  1.00 33.19  ? 353  LEU A CD2 1 
ATOM   2692  N  N   . ILE A  1 354 ? 7.245   -1.447  97.171  1.00 46.28  ? 354  ILE A N   1 
ATOM   2693  C  CA  . ILE A  1 354 ? 8.458   -1.073  96.456  1.00 44.89  ? 354  ILE A CA  1 
ATOM   2694  C  C   . ILE A  1 354 ? 8.432   0.311   95.848  1.00 45.63  ? 354  ILE A C   1 
ATOM   2695  O  O   . ILE A  1 354 ? 7.367   0.856   95.534  1.00 42.29  ? 354  ILE A O   1 
ATOM   2696  C  CB  . ILE A  1 354 ? 8.782   -2.073  95.353  1.00 41.64  ? 354  ILE A CB  1 
ATOM   2697  C  CG1 . ILE A  1 354 ? 7.496   -2.489  94.640  1.00 37.09  ? 354  ILE A CG1 1 
ATOM   2698  C  CG2 . ILE A  1 354 ? 9.461   -3.285  95.944  1.00 42.40  ? 354  ILE A CG2 1 
ATOM   2699  C  CD1 . ILE A  1 354 ? 7.718   -3.000  93.239  1.00 35.54  ? 354  ILE A CD1 1 
ATOM   2700  N  N   . SER A  1 355 ? 9.628   0.869   95.683  1.00 46.38  ? 355  SER A N   1 
ATOM   2701  C  CA  . SER A  1 355 ? 9.782   2.157   95.032  1.00 46.40  ? 355  SER A CA  1 
ATOM   2702  C  C   . SER A  1 355 ? 9.667   1.948   93.544  1.00 40.80  ? 355  SER A C   1 
ATOM   2703  O  O   . SER A  1 355 ? 9.741   0.819   93.061  1.00 41.20  ? 355  SER A O   1 
ATOM   2704  C  CB  . SER A  1 355 ? 11.127  2.806   95.381  1.00 50.36  ? 355  SER A CB  1 
ATOM   2705  O  OG  . SER A  1 355 ? 12.231  2.045   94.930  1.00 47.47  ? 355  SER A OG  1 
ATOM   2706  N  N   . ARG A  1 356 ? 9.483   3.036   92.813  1.00 42.39  ? 356  ARG A N   1 
ATOM   2707  C  CA  . ARG A  1 356 ? 9.378   2.931   91.373  1.00 44.17  ? 356  ARG A CA  1 
ATOM   2708  C  C   . ARG A  1 356 ? 10.702  2.441   90.788  1.00 49.47  ? 356  ARG A C   1 
ATOM   2709  O  O   . ARG A  1 356 ? 10.722  1.618   89.864  1.00 49.08  ? 356  ARG A O   1 
ATOM   2710  C  CB  . ARG A  1 356 ? 8.932   4.258   90.757  1.00 35.80  ? 356  ARG A CB  1 
ATOM   2711  C  CG  . ARG A  1 356 ? 8.788   4.172   89.267  1.00 35.34  ? 356  ARG A CG  1 
ATOM   2712  C  CD  . ARG A  1 356 ? 7.791   5.147   88.695  1.00 40.51  ? 356  ARG A CD  1 
ATOM   2713  N  NE  . ARG A  1 356 ? 7.525   4.768   87.312  1.00 48.25  ? 356  ARG A NE  1 
ATOM   2714  C  CZ  . ARG A  1 356 ? 6.481   4.040   86.923  1.00 49.66  ? 356  ARG A CZ  1 
ATOM   2715  N  NH1 . ARG A  1 356 ? 5.576   3.649   87.815  1.00 47.04  ? 356  ARG A NH1 1 
ATOM   2716  N  NH2 . ARG A  1 356 ? 6.332   3.724   85.638  1.00 48.18  ? 356  ARG A NH2 1 
ATOM   2717  N  N   . ALA A  1 357 ? 11.803  2.930   91.349  1.00 44.84  ? 357  ALA A N   1 
ATOM   2718  C  CA  . ALA A  1 357 ? 13.121  2.511   90.905  1.00 51.74  ? 357  ALA A CA  1 
ATOM   2719  C  C   . ALA A  1 357 ? 13.284  0.987   90.977  1.00 56.65  ? 357  ALA A C   1 
ATOM   2720  O  O   . ALA A  1 357 ? 13.642  0.328   89.984  1.00 64.17  ? 357  ALA A O   1 
ATOM   2721  C  CB  . ALA A  1 357 ? 14.170  3.193   91.726  1.00 57.76  ? 357  ALA A CB  1 
ATOM   2722  N  N   . GLN A  1 358 ? 13.003  0.431   92.150  1.00 53.25  ? 358  GLN A N   1 
ATOM   2723  C  CA  . GLN A  1 358 ? 13.028  -1.013  92.343  1.00 51.00  ? 358  GLN A CA  1 
ATOM   2724  C  C   . GLN A  1 358 ? 12.121  -1.730  91.353  1.00 46.95  ? 358  GLN A C   1 
ATOM   2725  O  O   . GLN A  1 358 ? 12.436  -2.834  90.915  1.00 42.83  ? 358  GLN A O   1 
ATOM   2726  C  CB  . GLN A  1 358 ? 12.573  -1.370  93.746  1.00 49.14  ? 358  GLN A CB  1 
ATOM   2727  C  CG  . GLN A  1 358 ? 13.510  -0.959  94.827  1.00 46.55  ? 358  GLN A CG  1 
ATOM   2728  C  CD  . GLN A  1 358 ? 12.935  -1.271  96.181  1.00 49.60  ? 358  GLN A CD  1 
ATOM   2729  O  OE1 . GLN A  1 358 ? 11.759  -0.995  96.450  1.00 53.82  ? 358  GLN A OE1 1 
ATOM   2730  N  NE2 . GLN A  1 358 ? 13.749  -1.869  97.040  1.00 47.03  ? 358  GLN A NE2 1 
ATOM   2731  N  N   . PHE A  1 359 ? 10.988  -1.111  91.023  1.00 37.49  ? 359  PHE A N   1 
ATOM   2732  C  CA  . PHE A  1 359 ? 10.116  -1.665  90.002  1.00 33.12  ? 359  PHE A CA  1 
ATOM   2733  C  C   . PHE A  1 359 ? 10.817  -1.741  88.634  1.00 33.97  ? 359  PHE A C   1 
ATOM   2734  O  O   . PHE A  1 359 ? 10.796  -2.783  87.979  1.00 25.60  ? 359  PHE A O   1 
ATOM   2735  C  CB  . PHE A  1 359 ? 8.781   -0.901  89.904  1.00 33.32  ? 359  PHE A CB  1 
ATOM   2736  C  CG  . PHE A  1 359 ? 7.928   -1.331  88.738  1.00 27.39  ? 359  PHE A CG  1 
ATOM   2737  C  CD1 . PHE A  1 359 ? 7.279   -2.561  88.753  1.00 30.22  ? 359  PHE A CD1 1 
ATOM   2738  C  CD2 . PHE A  1 359 ? 7.804   -0.526  87.614  1.00 27.97  ? 359  PHE A CD2 1 
ATOM   2739  C  CE1 . PHE A  1 359 ? 6.511   -2.969  87.668  1.00 31.20  ? 359  PHE A CE1 1 
ATOM   2740  C  CE2 . PHE A  1 359 ? 7.048   -0.926  86.523  1.00 27.52  ? 359  PHE A CE2 1 
ATOM   2741  C  CZ  . PHE A  1 359 ? 6.395   -2.143  86.548  1.00 32.19  ? 359  PHE A CZ  1 
ATOM   2742  N  N   . LEU A  1 360 ? 11.436  -0.653  88.198  1.00 27.69  ? 360  LEU A N   1 
ATOM   2743  C  CA  . LEU A  1 360 ? 12.081  -0.667  86.894  1.00 27.43  ? 360  LEU A CA  1 
ATOM   2744  C  C   . LEU A  1 360 ? 13.210  -1.717  86.862  1.00 35.38  ? 360  LEU A C   1 
ATOM   2745  O  O   . LEU A  1 360 ? 13.287  -2.570  85.933  1.00 36.63  ? 360  LEU A O   1 
ATOM   2746  C  CB  . LEU A  1 360 ? 12.584  0.739   86.521  1.00 33.70  ? 360  LEU A CB  1 
ATOM   2747  C  CG  . LEU A  1 360 ? 11.640  1.959   86.652  1.00 33.24  ? 360  LEU A CG  1 
ATOM   2748  C  CD1 . LEU A  1 360 ? 12.330  3.274   86.284  1.00 31.42  ? 360  LEU A CD1 1 
ATOM   2749  C  CD2 . LEU A  1 360 ? 10.392  1.824   85.811  1.00 37.24  ? 360  LEU A CD2 1 
ATOM   2750  N  N   . ALA A  1 361 ? 14.057  -1.695  87.894  1.00 30.38  ? 361  ALA A N   1 
ATOM   2751  C  CA  . ALA A  1 361 ? 15.158  -2.661  87.962  1.00 37.23  ? 361  ALA A CA  1 
ATOM   2752  C  C   . ALA A  1 361 ? 14.616  -4.089  87.967  1.00 40.48  ? 361  ALA A C   1 
ATOM   2753  O  O   . ALA A  1 361 ? 15.216  -5.033  87.405  1.00 40.80  ? 361  ALA A O   1 
ATOM   2754  C  CB  . ALA A  1 361 ? 15.992  -2.424  89.175  1.00 26.92  ? 361  ALA A CB  1 
ATOM   2755  N  N   . GLY A  1 362 ? 13.456  -4.223  88.596  1.00 24.66  ? 362  GLY A N   1 
ATOM   2756  C  CA  . GLY A  1 362 ? 12.796  -5.499  88.737  1.00 23.53  ? 362  GLY A CA  1 
ATOM   2757  C  C   . GLY A  1 362 ? 12.284  -5.970  87.404  1.00 26.13  ? 362  GLY A C   1 
ATOM   2758  O  O   . GLY A  1 362 ? 12.212  -7.159  87.159  1.00 24.22  ? 362  GLY A O   1 
ATOM   2759  N  N   . VAL A  1 363 ? 11.915  -5.039  86.535  1.00 28.86  ? 363  VAL A N   1 
ATOM   2760  C  CA  . VAL A  1 363 ? 11.423  -5.432  85.225  1.00 28.28  ? 363  VAL A CA  1 
ATOM   2761  C  C   . VAL A  1 363 ? 12.596  -5.946  84.460  1.00 22.55  ? 363  VAL A C   1 
ATOM   2762  O  O   . VAL A  1 363 ? 12.507  -7.009  83.848  1.00 22.19  ? 363  VAL A O   1 
ATOM   2763  C  CB  . VAL A  1 363 ? 10.781  -4.274  84.466  1.00 35.39  ? 363  VAL A CB  1 
ATOM   2764  C  CG1 . VAL A  1 363 ? 10.547  -4.650  83.016  1.00 23.52  ? 363  VAL A CG1 1 
ATOM   2765  C  CG2 . VAL A  1 363 ? 9.484   -3.875  85.144  1.00 24.26  ? 363  VAL A CG2 1 
ATOM   2766  N  N   . ARG A  1 364 ? 13.709  -5.210  84.518  1.00 38.36  ? 364  ARG A N   1 
ATOM   2767  C  CA  . ARG A  1 364 ? 14.944  -5.700  83.864  1.00 26.66  ? 364  ARG A CA  1 
ATOM   2768  C  C   . ARG A  1 364 ? 15.324  -7.119  84.306  1.00 23.91  ? 364  ARG A C   1 
ATOM   2769  O  O   . ARG A  1 364 ? 15.701  -7.941  83.478  1.00 25.65  ? 364  ARG A O   1 
ATOM   2770  C  CB  . ARG A  1 364 ? 16.134  -4.761  84.069  1.00 25.27  ? 364  ARG A CB  1 
ATOM   2771  C  CG  . ARG A  1 364 ? 15.916  -3.313  83.647  1.00 38.85  ? 364  ARG A CG  1 
ATOM   2772  C  CD  . ARG A  1 364 ? 15.149  -3.176  82.340  1.00 46.39  ? 364  ARG A CD  1 
ATOM   2773  N  NE  . ARG A  1 364 ? 15.795  -3.837  81.211  1.00 53.93  ? 364  ARG A NE  1 
ATOM   2774  C  CZ  . ARG A  1 364 ? 16.641  -3.237  80.380  1.00 62.33  ? 364  ARG A CZ  1 
ATOM   2775  N  NH1 . ARG A  1 364 ? 16.962  -1.959  80.557  1.00 64.41  ? 364  ARG A NH1 1 
ATOM   2776  N  NH2 . ARG A  1 364 ? 17.171  -3.916  79.373  1.00 64.80  ? 364  ARG A NH2 1 
ATOM   2777  N  N   . ILE A  1 365 ? 15.214  -7.405  85.605  1.00 23.71  ? 365  ILE A N   1 
ATOM   2778  C  CA  . ILE A  1 365 ? 15.463  -8.766  86.116  1.00 25.38  ? 365  ILE A CA  1 
ATOM   2779  C  C   . ILE A  1 365 ? 14.433  -9.812  85.668  1.00 30.56  ? 365  ILE A C   1 
ATOM   2780  O  O   . ILE A  1 365 ? 14.796  -10.914 85.256  1.00 37.33  ? 365  ILE A O   1 
ATOM   2781  C  CB  . ILE A  1 365 ? 15.514  -8.794  87.660  1.00 30.50  ? 365  ILE A CB  1 
ATOM   2782  C  CG1 . ILE A  1 365 ? 16.909  -8.448  88.161  1.00 22.13  ? 365  ILE A CG1 1 
ATOM   2783  C  CG2 . ILE A  1 365 ? 15.130  -10.163 88.189  1.00 31.88  ? 365  ILE A CG2 1 
ATOM   2784  C  CD1 . ILE A  1 365 ? 16.910  -7.339  89.175  1.00 26.88  ? 365  ILE A CD1 1 
ATOM   2785  N  N   . GLY A  1 366 ? 13.154  -9.463  85.762  1.00 27.24  ? 366  GLY A N   1 
ATOM   2786  C  CA  . GLY A  1 366 ? 12.057  -10.354 85.429  1.00 24.03  ? 366  GLY A CA  1 
ATOM   2787  C  C   . GLY A  1 366 ? 11.925  -10.651 83.944  1.00 32.75  ? 366  GLY A C   1 
ATOM   2788  O  O   . GLY A  1 366 ? 11.696  -11.801 83.581  1.00 18.35  ? 366  GLY A O   1 
ATOM   2789  N  N   . VAL A  1 367 ? 12.059  -9.635  83.088  1.00 19.80  ? 367  VAL A N   1 
ATOM   2790  C  CA  . VAL A  1 367 ? 12.080  -9.864  81.641  1.00 27.19  ? 367  VAL A CA  1 
ATOM   2791  C  C   . VAL A  1 367 ? 13.507  -9.739  81.116  1.00 26.60  ? 367  VAL A C   1 
ATOM   2792  O  O   . VAL A  1 367 ? 13.827  -8.803  80.394  1.00 29.22  ? 367  VAL A O   1 
ATOM   2793  C  CB  . VAL A  1 367 ? 11.148  -8.887  80.870  1.00 41.24  ? 367  VAL A CB  1 
ATOM   2794  C  CG1 . VAL A  1 367 ? 10.921  -9.370  79.441  1.00 36.96  ? 367  VAL A CG1 1 
ATOM   2795  C  CG2 . VAL A  1 367 ? 9.811   -8.761  81.565  1.00 42.79  ? 367  VAL A CG2 1 
ATOM   2796  N  N   . PRO A  1 368 ? 14.361  -10.716 81.453  1.00 26.71  ? 368  PRO A N   1 
ATOM   2797  C  CA  . PRO A  1 368 ? 15.823  -10.657 81.395  1.00 31.84  ? 368  PRO A CA  1 
ATOM   2798  C  C   . PRO A  1 368 ? 16.352  -10.375 80.002  1.00 34.81  ? 368  PRO A C   1 
ATOM   2799  O  O   . PRO A  1 368 ? 17.318  -9.620  79.828  1.00 36.13  ? 368  PRO A O   1 
ATOM   2800  C  CB  . PRO A  1 368 ? 16.240  -12.078 81.789  1.00 26.74  ? 368  PRO A CB  1 
ATOM   2801  C  CG  . PRO A  1 368 ? 15.041  -12.681 82.386  1.00 27.00  ? 368  PRO A CG  1 
ATOM   2802  C  CD  . PRO A  1 368 ? 13.912  -12.098 81.634  1.00 27.70  ? 368  PRO A CD  1 
ATOM   2803  N  N   . GLN A  1 369 ? 15.709  -10.994 79.021  1.00 30.04  ? 369  GLN A N   1 
ATOM   2804  C  CA  A GLN A  1 369 ? 16.110  -10.894 77.635  0.61 31.99  ? 369  GLN A CA  1 
ATOM   2805  C  CA  B GLN A  1 369 ? 16.149  -10.859 77.632  0.39 31.89  ? 369  GLN A CA  1 
ATOM   2806  C  C   . GLN A  1 369 ? 15.426  -9.731  76.893  1.00 33.36  ? 369  GLN A C   1 
ATOM   2807  O  O   . GLN A  1 369 ? 15.360  -9.714  75.669  1.00 36.53  ? 369  GLN A O   1 
ATOM   2808  C  CB  A GLN A  1 369 ? 15.847  -12.235 76.944  0.61 32.49  ? 369  GLN A CB  1 
ATOM   2809  C  CB  B GLN A  1 369 ? 16.015  -12.187 76.873  0.39 32.26  ? 369  GLN A CB  1 
ATOM   2810  C  CG  A GLN A  1 369 ? 16.834  -13.351 77.337  0.61 31.83  ? 369  GLN A CG  1 
ATOM   2811  C  CG  B GLN A  1 369 ? 17.352  -12.894 76.562  0.39 32.00  ? 369  GLN A CG  1 
ATOM   2812  C  CD  A GLN A  1 369 ? 16.430  -14.124 78.584  0.61 30.58  ? 369  GLN A CD  1 
ATOM   2813  C  CD  B GLN A  1 369 ? 18.027  -12.396 75.287  0.39 34.18  ? 369  GLN A CD  1 
ATOM   2814  O  OE1 A GLN A  1 369 ? 15.249  -14.367 78.823  0.61 18.33  ? 369  GLN A OE1 1 
ATOM   2815  O  OE1 B GLN A  1 369 ? 18.608  -11.308 75.258  0.39 22.29  ? 369  GLN A OE1 1 
ATOM   2816  N  NE2 A GLN A  1 369 ? 17.421  -14.532 79.373  0.61 18.84  ? 369  GLN A NE2 1 
ATOM   2817  N  NE2 B GLN A  1 369 ? 17.958  -13.200 74.229  0.39 21.51  ? 369  GLN A NE2 1 
ATOM   2818  N  N   . ALA A  1 370 ? 14.911  -8.763  77.637  1.00 31.95  ? 370  ALA A N   1 
ATOM   2819  C  CA  . ALA A  1 370 ? 14.320  -7.590  77.012  1.00 32.51  ? 370  ALA A CA  1 
ATOM   2820  C  C   . ALA A  1 370 ? 15.396  -6.628  76.540  1.00 41.95  ? 370  ALA A C   1 
ATOM   2821  O  O   . ALA A  1 370 ? 16.446  -6.511  77.166  1.00 47.11  ? 370  ALA A O   1 
ATOM   2822  C  CB  . ALA A  1 370 ? 13.406  -6.884  77.976  1.00 30.58  ? 370  ALA A CB  1 
ATOM   2823  N  N   . SER A  1 371 ? 15.129  -5.940  75.434  1.00 44.17  ? 371  SER A N   1 
ATOM   2824  C  CA  . SER A  1 371 ? 15.931  -4.790  75.044  1.00 39.53  ? 371  SER A CA  1 
ATOM   2825  C  C   . SER A  1 371 ? 15.480  -3.634  75.916  1.00 41.28  ? 371  SER A C   1 
ATOM   2826  O  O   . SER A  1 371 ? 14.437  -3.721  76.558  1.00 41.69  ? 371  SER A O   1 
ATOM   2827  C  CB  . SER A  1 371 ? 15.693  -4.453  73.579  1.00 40.54  ? 371  SER A CB  1 
ATOM   2828  O  OG  . SER A  1 371 ? 14.315  -4.249  73.330  1.00 47.49  ? 371  SER A OG  1 
ATOM   2829  N  N   . ASP A  1 372 ? 16.256  -2.557  75.951  1.00 46.75  ? 372  ASP A N   1 
ATOM   2830  C  CA  . ASP A  1 372 ? 15.856  -1.375  76.710  1.00 47.02  ? 372  ASP A CA  1 
ATOM   2831  C  C   . ASP A  1 372 ? 14.458  -0.935  76.279  1.00 43.86  ? 372  ASP A C   1 
ATOM   2832  O  O   . ASP A  1 372 ? 13.626  -0.596  77.120  1.00 49.55  ? 372  ASP A O   1 
ATOM   2833  C  CB  . ASP A  1 372 ? 16.852  -0.220  76.527  1.00 53.61  ? 372  ASP A CB  1 
ATOM   2834  C  CG  . ASP A  1 372 ? 18.199  -0.494  77.172  1.00 60.34  ? 372  ASP A CG  1 
ATOM   2835  O  OD1 . ASP A  1 372 ? 18.640  -1.664  77.172  1.00 69.11  ? 372  ASP A OD1 1 
ATOM   2836  O  OD2 . ASP A  1 372 ? 18.823  0.465   77.678  1.00 58.56  ? 372  ASP A OD2 1 
ATOM   2837  N  N   . LEU A  1 373 ? 14.196  -0.968  74.973  1.00 32.75  ? 373  LEU A N   1 
ATOM   2838  C  CA  . LEU A  1 373 ? 12.908  -0.534  74.453  1.00 33.14  ? 373  LEU A CA  1 
ATOM   2839  C  C   . LEU A  1 373 ? 11.761  -1.479  74.847  1.00 32.68  ? 373  LEU A C   1 
ATOM   2840  O  O   . LEU A  1 373 ? 10.643  -1.046  75.158  1.00 31.16  ? 373  LEU A O   1 
ATOM   2841  C  CB  . LEU A  1 373 ? 12.964  -0.371  72.941  1.00 30.05  ? 373  LEU A CB  1 
ATOM   2842  C  CG  . LEU A  1 373 ? 11.723  0.365   72.435  1.00 33.33  ? 373  LEU A CG  1 
ATOM   2843  C  CD1 . LEU A  1 373 ? 11.629  1.732   73.086  1.00 31.99  ? 373  LEU A CD1 1 
ATOM   2844  C  CD2 . LEU A  1 373 ? 11.740  0.492   70.939  1.00 33.63  ? 373  LEU A CD2 1 
ATOM   2845  N  N   . ALA A  1 374 ? 12.043  -2.772  74.827  1.00 28.26  ? 374  ALA A N   1 
ATOM   2846  C  CA  . ALA A  1 374 ? 11.077  -3.756  75.281  1.00 34.86  ? 374  ALA A CA  1 
ATOM   2847  C  C   . ALA A  1 374 ? 10.706  -3.472  76.732  1.00 35.94  ? 374  ALA A C   1 
ATOM   2848  O  O   . ALA A  1 374 ? 9.528   -3.428  77.092  1.00 39.56  ? 374  ALA A O   1 
ATOM   2849  C  CB  . ALA A  1 374 ? 11.657  -5.158  75.139  1.00 41.19  ? 374  ALA A CB  1 
ATOM   2850  N  N   . ALA A  1 375 ? 11.727  -3.272  77.558  1.00 33.63  ? 375  ALA A N   1 
ATOM   2851  C  CA  . ALA A  1 375 ? 11.527  -2.973  78.964  1.00 34.93  ? 375  ALA A CA  1 
ATOM   2852  C  C   . ALA A  1 375 ? 10.710  -1.704  79.131  1.00 46.82  ? 375  ALA A C   1 
ATOM   2853  O  O   . ALA A  1 375 ? 9.839   -1.622  79.997  1.00 53.48  ? 375  ALA A O   1 
ATOM   2854  C  CB  . ALA A  1 375 ? 12.855  -2.835  79.662  1.00 34.84  ? 375  ALA A CB  1 
ATOM   2855  N  N   . GLU A  1 376 ? 10.987  -0.717  78.290  1.00 45.79  ? 376  GLU A N   1 
ATOM   2856  C  CA  . GLU A  1 376 ? 10.244  0.523   78.337  1.00 48.20  ? 376  GLU A CA  1 
ATOM   2857  C  C   . GLU A  1 376 ? 8.771   0.259   78.049  1.00 42.70  ? 376  GLU A C   1 
ATOM   2858  O  O   . GLU A  1 376 ? 7.900   0.802   78.720  1.00 45.16  ? 376  GLU A O   1 
ATOM   2859  C  CB  . GLU A  1 376 ? 10.813  1.523   77.343  1.00 61.27  ? 376  GLU A CB  1 
ATOM   2860  C  CG  . GLU A  1 376 ? 10.996  2.915   77.914  1.00 78.90  ? 376  GLU A CG  1 
ATOM   2861  C  CD  . GLU A  1 376 ? 12.426  3.406   77.760  1.00 93.48  ? 376  GLU A CD  1 
ATOM   2862  O  OE1 . GLU A  1 376 ? 13.277  2.609   77.306  1.00 98.04  ? 376  GLU A OE1 1 
ATOM   2863  O  OE2 . GLU A  1 376 ? 12.702  4.582   78.088  1.00 98.07  ? 376  GLU A OE2 1 
ATOM   2864  N  N   . ALA A  1 377 ? 8.491   -0.589  77.064  1.00 37.05  ? 377  ALA A N   1 
ATOM   2865  C  CA  . ALA A  1 377 ? 7.101   -0.888  76.716  1.00 34.81  ? 377  ALA A CA  1 
ATOM   2866  C  C   . ALA A  1 377 ? 6.418   -1.602  77.861  1.00 34.10  ? 377  ALA A C   1 
ATOM   2867  O  O   . ALA A  1 377 ? 5.237   -1.370  78.141  1.00 34.83  ? 377  ALA A O   1 
ATOM   2868  C  CB  . ALA A  1 377 ? 7.020   -1.733  75.458  1.00 30.26  ? 377  ALA A CB  1 
ATOM   2869  N  N   . VAL A  1 378 ? 7.167   -2.479  78.518  1.00 31.33  ? 378  VAL A N   1 
ATOM   2870  C  CA  . VAL A  1 378 ? 6.621   -3.223  79.633  1.00 33.20  ? 378  VAL A CA  1 
ATOM   2871  C  C   . VAL A  1 378 ? 6.217   -2.261  80.730  1.00 36.12  ? 378  VAL A C   1 
ATOM   2872  O  O   . VAL A  1 378 ? 5.057   -2.270  81.180  1.00 39.24  ? 378  VAL A O   1 
ATOM   2873  C  CB  . VAL A  1 378 ? 7.627   -4.233  80.181  1.00 24.45  ? 378  VAL A CB  1 
ATOM   2874  C  CG1 . VAL A  1 378 ? 7.126   -4.828  81.473  1.00 32.79  ? 378  VAL A CG1 1 
ATOM   2875  C  CG2 . VAL A  1 378 ? 7.841   -5.329  79.176  1.00 34.03  ? 378  VAL A CG2 1 
ATOM   2876  N  N   . VAL A  1 379 ? 7.174   -1.423  81.138  1.00 31.92  ? 379  VAL A N   1 
ATOM   2877  C  CA  . VAL A  1 379 ? 6.953   -0.454  82.208  1.00 33.97  ? 379  VAL A CA  1 
ATOM   2878  C  C   . VAL A  1 379 ? 5.769   0.429   81.875  1.00 40.99  ? 379  VAL A C   1 
ATOM   2879  O  O   . VAL A  1 379 ? 4.908   0.671   82.718  1.00 46.72  ? 379  VAL A O   1 
ATOM   2880  C  CB  . VAL A  1 379 ? 8.170   0.448   82.447  1.00 34.87  ? 379  VAL A CB  1 
ATOM   2881  C  CG1 . VAL A  1 379 ? 7.816   1.527   83.433  1.00 39.83  ? 379  VAL A CG1 1 
ATOM   2882  C  CG2 . VAL A  1 379 ? 9.344   -0.356  82.956  1.00 35.47  ? 379  VAL A CG2 1 
ATOM   2883  N  N   . LEU A  1 380 ? 5.719   0.895   80.634  1.00 46.09  ? 380  LEU A N   1 
ATOM   2884  C  CA  . LEU A  1 380 ? 4.608   1.728   80.180  1.00 46.04  ? 380  LEU A CA  1 
ATOM   2885  C  C   . LEU A  1 380 ? 3.258   1.002   80.345  1.00 38.69  ? 380  LEU A C   1 
ATOM   2886  O  O   . LEU A  1 380 ? 2.323   1.557   80.907  1.00 36.10  ? 380  LEU A O   1 
ATOM   2887  C  CB  . LEU A  1 380 ? 4.844   2.204   78.735  1.00 44.04  ? 380  LEU A CB  1 
ATOM   2888  C  CG  . LEU A  1 380 ? 5.486   3.563   78.356  1.00 107.56 ? 380  LEU A CG  1 
ATOM   2889  C  CD1 . LEU A  1 380 ? 4.481   4.695   78.516  1.00 108.25 ? 380  LEU A CD1 1 
ATOM   2890  C  CD2 . LEU A  1 380 ? 6.832   3.927   79.050  1.00 32.98  ? 380  LEU A CD2 1 
ATOM   2891  N  N   . HIS A  1 381 ? 3.175   -0.244  79.895  1.00 29.62  ? 381  HIS A N   1 
ATOM   2892  C  CA  . HIS A  1 381 ? 1.914   -0.985  79.962  1.00 39.87  ? 381  HIS A CA  1 
ATOM   2893  C  C   . HIS A  1 381 ? 1.484   -1.277  81.379  1.00 39.18  ? 381  HIS A C   1 
ATOM   2894  O  O   . HIS A  1 381 ? 0.287   -1.345  81.669  1.00 36.13  ? 381  HIS A O   1 
ATOM   2895  C  CB  . HIS A  1 381 ? 2.003   -2.323  79.213  1.00 42.33  ? 381  HIS A CB  1 
ATOM   2896  C  CG  . HIS A  1 381 ? 0.787   -3.188  79.372  1.00 43.34  ? 381  HIS A CG  1 
ATOM   2897  N  ND1 . HIS A  1 381 ? -0.226  -3.228  78.437  1.00 49.42  ? 381  HIS A ND1 1 
ATOM   2898  C  CD2 . HIS A  1 381 ? 0.417   -4.039  80.360  1.00 42.42  ? 381  HIS A CD2 1 
ATOM   2899  C  CE1 . HIS A  1 381 ? -1.163  -4.067  78.840  1.00 47.62  ? 381  HIS A CE1 1 
ATOM   2900  N  NE2 . HIS A  1 381 ? -0.798  -4.572  80.004  1.00 44.53  ? 381  HIS A NE2 1 
ATOM   2901  N  N   . TYR A  1 382 ? 2.457   -1.489  82.259  1.00 41.56  ? 382  TYR A N   1 
ATOM   2902  C  CA  . TYR A  1 382 ? 2.136   -1.988  83.593  1.00 38.78  ? 382  TYR A CA  1 
ATOM   2903  C  C   . TYR A  1 382 ? 1.973   -0.905  84.650  1.00 42.37  ? 382  TYR A C   1 
ATOM   2904  O  O   . TYR A  1 382 ? 1.486   -1.173  85.747  1.00 44.08  ? 382  TYR A O   1 
ATOM   2905  C  CB  . TYR A  1 382 ? 3.147   -3.039  84.024  1.00 35.18  ? 382  TYR A CB  1 
ATOM   2906  C  CG  . TYR A  1 382 ? 2.817   -4.410  83.473  1.00 34.44  ? 382  TYR A CG  1 
ATOM   2907  C  CD1 . TYR A  1 382 ? 3.197   -4.775  82.195  1.00 33.14  ? 382  TYR A CD1 1 
ATOM   2908  C  CD2 . TYR A  1 382 ? 2.118   -5.336  84.237  1.00 28.76  ? 382  TYR A CD2 1 
ATOM   2909  C  CE1 . TYR A  1 382 ? 2.891   -6.025  81.698  1.00 33.50  ? 382  TYR A CE1 1 
ATOM   2910  C  CE2 . TYR A  1 382 ? 1.812   -6.578  83.747  1.00 26.85  ? 382  TYR A CE2 1 
ATOM   2911  C  CZ  . TYR A  1 382 ? 2.192   -6.921  82.474  1.00 30.15  ? 382  TYR A CZ  1 
ATOM   2912  O  OH  . TYR A  1 382 ? 1.882   -8.171  81.976  1.00 29.61  ? 382  TYR A OH  1 
ATOM   2913  N  N   . THR A  1 383 ? 2.353   0.320   84.309  1.00 30.21  ? 383  THR A N   1 
ATOM   2914  C  CA  . THR A  1 383 ? 2.206   1.429   85.229  1.00 40.54  ? 383  THR A CA  1 
ATOM   2915  C  C   . THR A  1 383 ? 0.766   1.908   85.213  1.00 53.39  ? 383  THR A C   1 
ATOM   2916  O  O   . THR A  1 383 ? 0.115   1.901   84.166  1.00 57.60  ? 383  THR A O   1 
ATOM   2917  C  CB  . THR A  1 383 ? 3.108   2.603   84.839  1.00 32.40  ? 383  THR A CB  1 
ATOM   2918  O  OG1 . THR A  1 383 ? 4.486   2.222   84.953  1.00 33.93  ? 383  THR A OG1 1 
ATOM   2919  C  CG2 . THR A  1 383 ? 2.854   3.790   85.741  1.00 33.96  ? 383  THR A CG2 1 
ATOM   2920  N  N   . ASP A  1 384 ? 0.261   2.282   86.386  1.00 57.41  ? 384  ASP A N   1 
ATOM   2921  C  CA  . ASP A  1 384 ? -0.946  3.083   86.482  1.00 58.11  ? 384  ASP A CA  1 
ATOM   2922  C  C   . ASP A  1 384 ? -0.469  4.525   86.447  1.00 52.33  ? 384  ASP A C   1 
ATOM   2923  O  O   . ASP A  1 384 ? 0.128   5.009   87.408  1.00 52.18  ? 384  ASP A O   1 
ATOM   2924  C  CB  . ASP A  1 384 ? -1.689  2.775   87.784  1.00 66.27  ? 384  ASP A CB  1 
ATOM   2925  C  CG  . ASP A  1 384 ? -2.726  3.829   88.140  1.00 75.07  ? 384  ASP A CG  1 
ATOM   2926  O  OD1 . ASP A  1 384 ? -3.280  4.478   87.219  1.00 80.17  ? 384  ASP A OD1 1 
ATOM   2927  O  OD2 . ASP A  1 384 ? -2.984  4.002   89.354  1.00 75.58  ? 384  ASP A OD2 1 
ATOM   2928  N  N   . TRP A  1 385 ? -0.715  5.205   85.331  1.00 48.40  ? 385  TRP A N   1 
ATOM   2929  C  CA  . TRP A  1 385 ? -0.129  6.524   85.104  1.00 46.07  ? 385  TRP A CA  1 
ATOM   2930  C  C   . TRP A  1 385 ? -0.805  7.622   85.914  1.00 54.95  ? 385  TRP A C   1 
ATOM   2931  O  O   . TRP A  1 385 ? -0.366  8.778   85.919  1.00 55.68  ? 385  TRP A O   1 
ATOM   2932  C  CB  . TRP A  1 385 ? -0.071  6.844   83.602  1.00 43.12  ? 385  TRP A CB  1 
ATOM   2933  C  CG  . TRP A  1 385 ? 0.947   5.986   82.930  1.00 47.52  ? 385  TRP A CG  1 
ATOM   2934  C  CD1 . TRP A  1 385 ? 0.726   4.864   82.180  1.00 46.53  ? 385  TRP A CD1 1 
ATOM   2935  C  CD2 . TRP A  1 385 ? 2.364   6.134   83.019  1.00 48.97  ? 385  TRP A CD2 1 
ATOM   2936  N  NE1 . TRP A  1 385 ? 1.921   4.321   81.777  1.00 40.78  ? 385  TRP A NE1 1 
ATOM   2937  C  CE2 . TRP A  1 385 ? 2.941   5.083   82.284  1.00 46.41  ? 385  TRP A CE2 1 
ATOM   2938  C  CE3 . TRP A  1 385 ? 3.200   7.059   83.645  1.00 50.77  ? 385  TRP A CE3 1 
ATOM   2939  C  CZ2 . TRP A  1 385 ? 4.315   4.938   82.155  1.00 52.54  ? 385  TRP A CZ2 1 
ATOM   2940  C  CZ3 . TRP A  1 385 ? 4.558   6.914   83.516  1.00 56.48  ? 385  TRP A CZ3 1 
ATOM   2941  C  CH2 . TRP A  1 385 ? 5.106   5.862   82.778  1.00 57.89  ? 385  TRP A CH2 1 
ATOM   2942  N  N   . LEU A  1 386 ? -1.865  7.242   86.618  1.00 61.82  ? 386  LEU A N   1 
ATOM   2943  C  CA  . LEU A  1 386 ? -2.567  8.164   87.492  1.00 70.10  ? 386  LEU A CA  1 
ATOM   2944  C  C   . LEU A  1 386 ? -1.901  8.190   88.860  1.00 71.76  ? 386  LEU A C   1 
ATOM   2945  O  O   . LEU A  1 386 ? -1.868  9.229   89.527  1.00 81.36  ? 386  LEU A O   1 
ATOM   2946  C  CB  . LEU A  1 386 ? -4.035  7.760   87.611  1.00 74.96  ? 386  LEU A CB  1 
ATOM   2947  C  CG  . LEU A  1 386 ? -5.019  8.850   87.188  1.00 79.48  ? 386  LEU A CG  1 
ATOM   2948  C  CD1 . LEU A  1 386 ? -6.455  8.341   87.262  1.00 82.33  ? 386  LEU A CD1 1 
ATOM   2949  C  CD2 . LEU A  1 386 ? -4.818  10.104  88.037  1.00 78.31  ? 386  LEU A CD2 1 
ATOM   2950  N  N   . HIS A  1 387 ? -1.380  7.035   89.268  1.00 63.48  ? 387  HIS A N   1 
ATOM   2951  C  CA  . HIS A  1 387 ? -0.626  6.901   90.511  1.00 66.14  ? 387  HIS A CA  1 
ATOM   2952  C  C   . HIS A  1 387 ? 0.617   6.039   90.266  1.00 56.46  ? 387  HIS A C   1 
ATOM   2953  O  O   . HIS A  1 387 ? 0.681   4.888   90.707  1.00 51.45  ? 387  HIS A O   1 
ATOM   2954  C  CB  . HIS A  1 387 ? -1.496  6.272   91.611  1.00 78.20  ? 387  HIS A CB  1 
ATOM   2955  C  CG  . HIS A  1 387 ? -2.427  7.236   92.290  1.00 86.73  ? 387  HIS A CG  1 
ATOM   2956  N  ND1 . HIS A  1 387 ? -3.620  7.644   91.731  1.00 88.11  ? 387  HIS A ND1 1 
ATOM   2957  C  CD2 . HIS A  1 387 ? -2.344  7.859   93.491  1.00 88.84  ? 387  HIS A CD2 1 
ATOM   2958  C  CE1 . HIS A  1 387 ? -4.225  8.484   92.551  1.00 90.08  ? 387  HIS A CE1 1 
ATOM   2959  N  NE2 . HIS A  1 387 ? -3.473  8.630   93.627  1.00 90.75  ? 387  HIS A NE2 1 
ATOM   2960  N  N   . PRO A  1 388 ? 1.610   6.597   89.555  1.00 50.64  ? 388  PRO A N   1 
ATOM   2961  C  CA  . PRO A  1 388 ? 2.810   5.889   89.091  1.00 45.67  ? 388  PRO A CA  1 
ATOM   2962  C  C   . PRO A  1 388 ? 3.748   5.564   90.231  1.00 46.25  ? 388  PRO A C   1 
ATOM   2963  O  O   . PRO A  1 388 ? 4.648   4.744   90.073  1.00 40.79  ? 388  PRO A O   1 
ATOM   2964  C  CB  . PRO A  1 388 ? 3.499   6.917   88.187  1.00 43.22  ? 388  PRO A CB  1 
ATOM   2965  C  CG  . PRO A  1 388 ? 2.500   7.994   87.965  1.00 47.82  ? 388  PRO A CG  1 
ATOM   2966  C  CD  . PRO A  1 388 ? 1.645   8.016   89.180  1.00 49.63  ? 388  PRO A CD  1 
ATOM   2967  N  N   . GLU A  1 389 ? 3.538   6.230   91.361  1.00 54.73  ? 389  GLU A N   1 
ATOM   2968  C  CA  . GLU A  1 389 ? 4.438   6.137   92.504  1.00 56.60  ? 389  GLU A CA  1 
ATOM   2969  C  C   . GLU A  1 389 ? 3.947   5.146   93.564  1.00 50.55  ? 389  GLU A C   1 
ATOM   2970  O  O   . GLU A  1 389 ? 4.742   4.627   94.351  1.00 48.50  ? 389  GLU A O   1 
ATOM   2971  C  CB  . GLU A  1 389 ? 4.654   7.531   93.116  1.00 63.01  ? 389  GLU A CB  1 
ATOM   2972  C  CG  . GLU A  1 389 ? 5.404   8.525   92.204  1.00 70.18  ? 389  GLU A CG  1 
ATOM   2973  C  CD  . GLU A  1 389 ? 6.885   8.166   91.986  1.00 74.43  ? 389  GLU A CD  1 
ATOM   2974  O  OE1 . GLU A  1 389 ? 7.400   7.251   92.668  1.00 76.80  ? 389  GLU A OE1 1 
ATOM   2975  O  OE2 . GLU A  1 389 ? 7.541   8.803   91.131  1.00 73.85  ? 389  GLU A OE2 1 
ATOM   2976  N  N   . ASP A  1 390 ? 2.640   4.888   93.564  1.00 46.89  ? 390  ASP A N   1 
ATOM   2977  C  CA  . ASP A  1 390 ? 2.004   3.978   94.513  1.00 43.98  ? 390  ASP A CA  1 
ATOM   2978  C  C   . ASP A  1 390 ? 2.721   2.627   94.602  1.00 43.52  ? 390  ASP A C   1 
ATOM   2979  O  O   . ASP A  1 390 ? 2.799   1.871   93.621  1.00 43.87  ? 390  ASP A O   1 
ATOM   2980  C  CB  . ASP A  1 390 ? 0.518   3.797   94.164  1.00 50.27  ? 390  ASP A CB  1 
ATOM   2981  C  CG  . ASP A  1 390 ? -0.199  2.820   95.091  1.00 57.85  ? 390  ASP A CG  1 
ATOM   2982  O  OD1 . ASP A  1 390 ? 0.103   2.793   96.300  1.00 62.18  ? 390  ASP A OD1 1 
ATOM   2983  O  OD2 . ASP A  1 390 ? -1.074  2.073   94.608  1.00 59.82  ? 390  ASP A OD2 1 
ATOM   2984  N  N   . PRO A  1 391 ? 3.265   2.331   95.788  1.00 43.72  ? 391  PRO A N   1 
ATOM   2985  C  CA  . PRO A  1 391 ? 3.985   1.089   96.047  1.00 45.09  ? 391  PRO A CA  1 
ATOM   2986  C  C   . PRO A  1 391 ? 3.095   -0.121  95.879  1.00 43.58  ? 391  PRO A C   1 
ATOM   2987  O  O   . PRO A  1 391 ? 3.573   -1.116  95.359  1.00 51.27  ? 391  PRO A O   1 
ATOM   2988  C  CB  . PRO A  1 391 ? 4.391   1.221   97.514  1.00 46.08  ? 391  PRO A CB  1 
ATOM   2989  C  CG  . PRO A  1 391 ? 4.414   2.666   97.769  1.00 42.99  ? 391  PRO A CG  1 
ATOM   2990  C  CD  . PRO A  1 391 ? 3.296   3.225   96.954  1.00 44.08  ? 391  PRO A CD  1 
ATOM   2991  N  N   . THR A  1 392 ? 1.842   -0.058  96.313  1.00 36.81  ? 392  THR A N   1 
ATOM   2992  C  CA  . THR A  1 392 ? 1.006   -1.252  96.252  1.00 39.22  ? 392  THR A CA  1 
ATOM   2993  C  C   . THR A  1 392 ? 0.739   -1.676  94.804  1.00 41.20  ? 392  THR A C   1 
ATOM   2994  O  O   . THR A  1 392 ? 0.943   -2.863  94.432  1.00 38.39  ? 392  THR A O   1 
ATOM   2995  C  CB  . THR A  1 392 ? -0.296  -1.099  97.052  1.00 41.21  ? 392  THR A CB  1 
ATOM   2996  O  OG1 . THR A  1 392 ? -0.003  -1.100  98.458  1.00 34.99  ? 392  THR A OG1 1 
ATOM   2997  C  CG2 . THR A  1 392 ? -1.196  -2.255  96.760  1.00 41.24  ? 392  THR A CG2 1 
ATOM   2998  N  N   . HIS A  1 393 ? 0.315   -0.706  93.985  1.00 42.56  ? 393  HIS A N   1 
ATOM   2999  C  CA  A HIS A  1 393 ? 0.105   -1.001  92.571  0.44 42.25  ? 393  HIS A CA  1 
ATOM   3000  C  CA  B HIS A  1 393 ? 0.105   -0.919  92.559  0.56 42.47  ? 393  HIS A CA  1 
ATOM   3001  C  C   . HIS A  1 393 ? 1.388   -1.482  91.945  1.00 40.58  ? 393  HIS A C   1 
ATOM   3002  O  O   . HIS A  1 393 ? 1.352   -2.418  91.157  1.00 44.83  ? 393  HIS A O   1 
ATOM   3003  C  CB  A HIS A  1 393 ? -0.436  0.168   91.746  0.44 44.64  ? 393  HIS A CB  1 
ATOM   3004  C  CB  B HIS A  1 393 ? -0.275  0.398   91.857  0.56 45.19  ? 393  HIS A CB  1 
ATOM   3005  C  CG  A HIS A  1 393 ? -0.764  -0.211  90.329  0.44 43.66  ? 393  HIS A CG  1 
ATOM   3006  C  CG  B HIS A  1 393 ? -1.738  0.748   91.925  0.56 48.67  ? 393  HIS A CG  1 
ATOM   3007  N  ND1 A HIS A  1 393 ? 0.193   -0.620  89.423  0.44 41.04  ? 393  HIS A ND1 1 
ATOM   3008  N  ND1 B HIS A  1 393 ? -2.700  -0.110  92.417  0.56 51.93  ? 393  HIS A ND1 1 
ATOM   3009  C  CD2 A HIS A  1 393 ? -1.946  -0.263  89.671  0.44 47.50  ? 393  HIS A CD2 1 
ATOM   3010  C  CD2 B HIS A  1 393 ? -2.399  1.872   91.550  0.56 45.30  ? 393  HIS A CD2 1 
ATOM   3011  C  CE1 A HIS A  1 393 ? -0.384  -0.902  88.269  0.44 30.81  ? 393  HIS A CE1 1 
ATOM   3012  C  CE1 B HIS A  1 393 ? -3.886  0.470   92.345  0.56 47.54  ? 393  HIS A CE1 1 
ATOM   3013  N  NE2 A HIS A  1 393 ? -1.681  -0.691  88.392  0.44 51.07  ? 393  HIS A NE2 1 
ATOM   3014  N  NE2 B HIS A  1 393 ? -3.731  1.672   91.822  0.56 43.74  ? 393  HIS A NE2 1 
ATOM   3015  N  N   . LEU A  1 394 ? 2.515   -0.867  92.303  1.00 33.60  ? 394  LEU A N   1 
ATOM   3016  C  CA  . LEU A  1 394 ? 3.811   -1.301  91.766  1.00 31.07  ? 394  LEU A CA  1 
ATOM   3017  C  C   . LEU A  1 394 ? 4.111   -2.765  92.075  1.00 27.98  ? 394  LEU A C   1 
ATOM   3018  O  O   . LEU A  1 394 ? 4.336   -3.544  91.168  1.00 44.30  ? 394  LEU A O   1 
ATOM   3019  C  CB  . LEU A  1 394 ? 4.956   -0.399  92.235  1.00 30.48  ? 394  LEU A CB  1 
ATOM   3020  C  CG  . LEU A  1 394 ? 5.147   0.927   91.491  1.00 39.47  ? 394  LEU A CG  1 
ATOM   3021  C  CD1 . LEU A  1 394 ? 6.297   1.716   92.082  1.00 32.04  ? 394  LEU A CD1 1 
ATOM   3022  C  CD2 . LEU A  1 394 ? 5.389   0.669   90.025  1.00 30.39  ? 394  LEU A CD2 1 
ATOM   3023  N  N   . ARG A  1 395 ? 4.111   -3.119  93.354  1.00 31.30  ? 395  ARG A N   1 
ATOM   3024  C  CA  . ARG A  1 395 ? 4.290   -4.494  93.822  1.00 27.03  ? 395  ARG A CA  1 
ATOM   3025  C  C   . ARG A  1 395 ? 3.446   -5.474  93.016  1.00 34.04  ? 395  ARG A C   1 
ATOM   3026  O  O   . ARG A  1 395 ? 3.987   -6.382  92.328  1.00 33.74  ? 395  ARG A O   1 
ATOM   3027  C  CB  . ARG A  1 395 ? 3.901   -4.576  95.303  1.00 27.83  ? 395  ARG A CB  1 
ATOM   3028  C  CG  . ARG A  1 395 ? 3.993   -5.955  95.902  1.00 28.83  ? 395  ARG A CG  1 
ATOM   3029  C  CD  . ARG A  1 395 ? 2.659   -6.416  96.438  1.00 27.22  ? 395  ARG A CD  1 
ATOM   3030  N  NE  . ARG A  1 395 ? 2.414   -5.963  97.802  1.00 28.57  ? 395  ARG A NE  1 
ATOM   3031  C  CZ  . ARG A  1 395 ? 1.201   -5.799  98.324  1.00 42.58  ? 395  ARG A CZ  1 
ATOM   3032  N  NH1 . ARG A  1 395 ? 0.127   -6.034  97.584  1.00 47.00  ? 395  ARG A NH1 1 
ATOM   3033  N  NH2 . ARG A  1 395 ? 1.054   -5.385  99.578  1.00 41.42  ? 395  ARG A NH2 1 
ATOM   3034  N  N   . ASP A  1 396 ? 2.124   -5.265  93.075  1.00 36.92  ? 396  ASP A N   1 
ATOM   3035  C  CA  . ASP A  1 396 ? 1.189   -6.126  92.333  1.00 35.47  ? 396  ASP A CA  1 
ATOM   3036  C  C   . ASP A  1 396 ? 1.488   -6.195  90.825  1.00 35.86  ? 396  ASP A C   1 
ATOM   3037  O  O   . ASP A  1 396 ? 1.301   -7.242  90.183  1.00 31.85  ? 396  ASP A O   1 
ATOM   3038  C  CB  . ASP A  1 396 ? -0.256  -5.683  92.559  1.00 38.24  ? 396  ASP A CB  1 
ATOM   3039  C  CG  . ASP A  1 396 ? -0.675  -5.784  94.002  1.00 41.74  ? 396  ASP A CG  1 
ATOM   3040  O  OD1 . ASP A  1 396 ? 0.049   -6.440  94.776  1.00 41.00  ? 396  ASP A OD1 1 
ATOM   3041  O  OD2 . ASP A  1 396 ? -1.729  -5.217  94.359  1.00 47.28  ? 396  ASP A OD2 1 
ATOM   3042  N  N   . ALA A  1 397 ? 1.959   -5.074  90.279  1.00 36.56  ? 397  ALA A N   1 
ATOM   3043  C  CA  . ALA A  1 397 ? 2.370   -4.991  88.886  1.00 33.05  ? 397  ALA A CA  1 
ATOM   3044  C  C   . ALA A  1 397 ? 3.573   -5.864  88.624  1.00 36.36  ? 397  ALA A C   1 
ATOM   3045  O  O   . ALA A  1 397 ? 3.614   -6.521  87.622  1.00 38.79  ? 397  ALA A O   1 
ATOM   3046  C  CB  . ALA A  1 397 ? 2.679   -3.568  88.482  1.00 29.51  ? 397  ALA A CB  1 
ATOM   3047  N  N   . MET A  1 398 ? 4.562   -5.865  89.502  1.00 24.13  ? 398  MET A N   1 
ATOM   3048  C  CA  . MET A  1 398 ? 5.761   -6.643  89.256  1.00 29.74  ? 398  MET A CA  1 
ATOM   3049  C  C   . MET A  1 398 ? 5.387   -8.128  89.258  1.00 34.81  ? 398  MET A C   1 
ATOM   3050  O  O   . MET A  1 398 ? 5.786   -8.908  88.348  1.00 40.86  ? 398  MET A O   1 
ATOM   3051  C  CB  . MET A  1 398 ? 6.809   -6.316  90.320  1.00 29.71  ? 398  MET A CB  1 
ATOM   3052  C  CG  . MET A  1 398 ? 8.167   -6.953  90.106  1.00 23.53  ? 398  MET A CG  1 
ATOM   3053  S  SD  . MET A  1 398 ? 9.160   -6.114  88.862  1.00 37.60  ? 398  MET A SD  1 
ATOM   3054  C  CE  . MET A  1 398 ? 9.034   -7.308  87.538  1.00 45.96  ? 398  MET A CE  1 
ATOM   3055  N  N   . SER A  1 399 ? 4.593   -8.507  90.266  1.00 37.23  ? 399  SER A N   1 
ATOM   3056  C  CA  . SER A  1 399 ? 4.003   -9.859  90.303  1.00 37.24  ? 399  SER A CA  1 
ATOM   3057  C  C   . SER A  1 399 ? 3.335   -10.201 88.954  1.00 38.15  ? 399  SER A C   1 
ATOM   3058  O  O   . SER A  1 399 ? 3.578   -11.264 88.350  1.00 36.49  ? 399  SER A O   1 
ATOM   3059  C  CB  . SER A  1 399 ? 2.980   -9.961  91.447  1.00 32.52  ? 399  SER A CB  1 
ATOM   3060  O  OG  . SER A  1 399 ? 2.524   -11.283 91.646  1.00 29.86  ? 399  SER A OG  1 
ATOM   3061  N  N   . ALA A  1 400 ? 2.517   -9.272  88.468  1.00 34.52  ? 400  ALA A N   1 
ATOM   3062  C  CA  . ALA A  1 400 ? 1.846   -9.465  87.193  1.00 31.64  ? 400  ALA A CA  1 
ATOM   3063  C  C   . ALA A  1 400 ? 2.798   -9.607  85.996  1.00 28.62  ? 400  ALA A C   1 
ATOM   3064  O  O   . ALA A  1 400 ? 2.644   -10.537 85.237  1.00 23.40  ? 400  ALA A O   1 
ATOM   3065  C  CB  . ALA A  1 400 ? 0.798   -8.384  86.949  1.00 23.00  ? 400  ALA A CB  1 
ATOM   3066  N  N   . VAL A  1 401 ? 3.753   -8.695  85.816  1.00 21.46  ? 401  VAL A N   1 
ATOM   3067  C  CA  . VAL A  1 401 ? 4.759   -8.820  84.759  1.00 21.02  ? 401  VAL A CA  1 
ATOM   3068  C  C   . VAL A  1 401 ? 5.318   -10.225 84.773  1.00 39.39  ? 401  VAL A C   1 
ATOM   3069  O  O   . VAL A  1 401 ? 5.180   -10.950 83.794  1.00 19.39  ? 401  VAL A O   1 
ATOM   3070  C  CB  . VAL A  1 401 ? 5.940   -7.834  84.917  1.00 21.48  ? 401  VAL A CB  1 
ATOM   3071  C  CG1 . VAL A  1 401 ? 7.086   -8.260  84.053  1.00 20.92  ? 401  VAL A CG1 1 
ATOM   3072  C  CG2 . VAL A  1 401 ? 5.542   -6.436  84.532  1.00 22.69  ? 401  VAL A CG2 1 
ATOM   3073  N  N   . VAL A  1 402 ? 5.901   -10.641 85.893  1.00 19.47  ? 402  VAL A N   1 
ATOM   3074  C  CA  . VAL A  1 402 ? 6.517   -11.968 85.895  1.00 27.92  ? 402  VAL A CA  1 
ATOM   3075  C  C   . VAL A  1 402 ? 5.541   -13.121 85.549  1.00 28.98  ? 402  VAL A C   1 
ATOM   3076  O  O   . VAL A  1 402 ? 5.872   -14.055 84.773  1.00 17.27  ? 402  VAL A O   1 
ATOM   3077  C  CB  . VAL A  1 402 ? 7.241   -12.233 87.207  1.00 18.32  ? 402  VAL A CB  1 
ATOM   3078  C  CG1 . VAL A  1 402 ? 7.650   -13.680 87.292  1.00 17.40  ? 402  VAL A CG1 1 
ATOM   3079  C  CG2 . VAL A  1 402 ? 8.448   -11.341 87.300  1.00 35.87  ? 402  VAL A CG2 1 
ATOM   3080  N  N   . GLY A  1 403 ? 4.326   -13.027 86.086  1.00 18.28  ? 403  GLY A N   1 
ATOM   3081  C  CA  . GLY A  1 403 ? 3.325   -14.057 85.848  1.00 17.93  ? 403  GLY A CA  1 
ATOM   3082  C  C   . GLY A  1 403 ? 2.863   -14.145 84.410  1.00 18.01  ? 403  GLY A C   1 
ATOM   3083  O  O   . GLY A  1 403 ? 2.825   -15.213 83.808  1.00 17.43  ? 403  GLY A O   1 
ATOM   3084  N  N   . ASP A  1 404 ? 2.502   -12.996 83.870  1.00 18.86  ? 404  ASP A N   1 
ATOM   3085  C  CA  . ASP A  1 404 ? 2.078   -12.849 82.499  1.00 19.23  ? 404  ASP A CA  1 
ATOM   3086  C  C   . ASP A  1 404 ? 3.133   -13.303 81.523  1.00 33.58  ? 404  ASP A C   1 
ATOM   3087  O  O   . ASP A  1 404 ? 2.838   -14.046 80.588  1.00 33.29  ? 404  ASP A O   1 
ATOM   3088  C  CB  . ASP A  1 404 ? 1.764   -11.392 82.242  1.00 27.02  ? 404  ASP A CB  1 
ATOM   3089  C  CG  . ASP A  1 404 ? 0.671   -10.887 83.130  1.00 38.50  ? 404  ASP A CG  1 
ATOM   3090  O  OD1 . ASP A  1 404 ? 0.123   -11.713 83.904  1.00 42.71  ? 404  ASP A OD1 1 
ATOM   3091  O  OD2 . ASP A  1 404 ? 0.355   -9.676  83.045  1.00 42.51  ? 404  ASP A OD2 1 
ATOM   3092  N  N   . HIS A  1 405 ? 4.363   -12.849 81.749  1.00 34.04  ? 405  HIS A N   1 
ATOM   3093  C  CA  . HIS A  1 405 ? 5.463   -13.139 80.848  1.00 18.25  ? 405  HIS A CA  1 
ATOM   3094  C  C   . HIS A  1 405 ? 5.763   -14.611 80.843  1.00 33.02  ? 405  HIS A C   1 
ATOM   3095  O  O   . HIS A  1 405 ? 5.863   -15.208 79.779  1.00 17.24  ? 405  HIS A O   1 
ATOM   3096  C  CB  . HIS A  1 405 ? 6.704   -12.360 81.261  1.00 34.22  ? 405  HIS A CB  1 
ATOM   3097  C  CG  . HIS A  1 405 ? 7.925   -12.677 80.448  1.00 31.06  ? 405  HIS A CG  1 
ATOM   3098  N  ND1 . HIS A  1 405 ? 7.930   -12.664 79.071  1.00 32.23  ? 405  HIS A ND1 1 
ATOM   3099  C  CD2 . HIS A  1 405 ? 9.182   -13.003 80.825  1.00 23.05  ? 405  HIS A CD2 1 
ATOM   3100  C  CE1 . HIS A  1 405 ? 9.141   -12.963 78.633  1.00 26.78  ? 405  HIS A CE1 1 
ATOM   3101  N  NE2 . HIS A  1 405 ? 9.917   -13.182 79.678  1.00 23.53  ? 405  HIS A NE2 1 
ATOM   3102  N  N   . ASN A  1 406 ? 5.897   -15.202 82.027  1.00 16.81  ? 406  ASN A N   1 
ATOM   3103  C  CA  . ASN A  1 406 ? 6.387   -16.576 82.088  1.00 20.16  ? 406  ASN A CA  1 
ATOM   3104  C  C   . ASN A  1 406 ? 5.319   -17.663 82.000  1.00 20.32  ? 406  ASN A C   1 
ATOM   3105  O  O   . ASN A  1 406 ? 5.540   -18.725 81.421  1.00 22.06  ? 406  ASN A O   1 
ATOM   3106  C  CB  . ASN A  1 406 ? 7.254   -16.792 83.333  1.00 20.39  ? 406  ASN A CB  1 
ATOM   3107  C  CG  . ASN A  1 406 ? 8.582   -16.068 83.252  1.00 25.13  ? 406  ASN A CG  1 
ATOM   3108  O  OD1 . ASN A  1 406 ? 9.441   -16.416 82.446  1.00 28.65  ? 406  ASN A OD1 1 
ATOM   3109  N  ND2 . ASN A  1 406 ? 8.755   -15.053 84.085  1.00 25.21  ? 406  ASN A ND2 1 
ATOM   3110  N  N   . VAL A  1 407 ? 4.162   -17.408 82.585  1.00 19.87  ? 407  VAL A N   1 
ATOM   3111  C  CA  . VAL A  1 407 ? 3.146   -18.431 82.623  1.00 19.20  ? 407  VAL A CA  1 
ATOM   3112  C  C   . VAL A  1 407 ? 1.895   -18.051 81.864  1.00 24.04  ? 407  VAL A C   1 
ATOM   3113  O  O   . VAL A  1 407 ? 1.530   -18.731 80.916  1.00 28.03  ? 407  VAL A O   1 
ATOM   3114  C  CB  . VAL A  1 407 ? 2.770   -18.767 84.049  1.00 22.31  ? 407  VAL A CB  1 
ATOM   3115  C  CG1 . VAL A  1 407 ? 1.664   -19.792 84.054  1.00 21.41  ? 407  VAL A CG1 1 
ATOM   3116  C  CG2 . VAL A  1 407 ? 4.000   -19.271 84.801  1.00 15.05  ? 407  VAL A CG2 1 
ATOM   3117  N  N   . VAL A  1 408 ? 1.242   -16.967 82.269  1.00 24.27  ? 408  VAL A N   1 
ATOM   3118  C  CA  . VAL A  1 408 ? -0.138  -16.712 81.828  1.00 25.69  ? 408  VAL A CA  1 
ATOM   3119  C  C   . VAL A  1 408 ? -0.307  -16.589 80.327  1.00 18.52  ? 408  VAL A C   1 
ATOM   3120  O  O   . VAL A  1 408 ? -1.069  -17.320 79.734  1.00 20.72  ? 408  VAL A O   1 
ATOM   3121  C  CB  . VAL A  1 408 ? -0.764  -15.465 82.453  1.00 18.97  ? 408  VAL A CB  1 
ATOM   3122  C  CG1 . VAL A  1 408 ? -2.152  -15.324 81.925  1.00 19.90  ? 408  VAL A CG1 1 
ATOM   3123  C  CG2 . VAL A  1 408 ? -0.762  -15.536 83.977  1.00 18.78  ? 408  VAL A CG2 1 
ATOM   3124  N  N   . CYS A  1 409 ? 0.408   -15.662 79.716  1.00 19.30  ? 409  CYS A N   1 
ATOM   3125  C  CA  . CYS A  1 409 ? 0.320   -15.476 78.271  1.00 19.74  ? 409  CYS A CA  1 
ATOM   3126  C  C   . CYS A  1 409 ? 0.891   -16.625 77.418  1.00 19.46  ? 409  CYS A C   1 
ATOM   3127  O  O   . CYS A  1 409 ? 0.475   -16.816 76.279  1.00 19.39  ? 409  CYS A O   1 
ATOM   3128  C  CB  . CYS A  1 409 ? 0.931   -14.135 77.877  1.00 24.00  ? 409  CYS A CB  1 
ATOM   3129  S  SG  . CYS A  1 409 ? 0.047   -12.753 78.611  1.00 26.87  ? 409  CYS A SG  1 
ATOM   3130  N  N   . PRO A  1 410 ? 1.874   -17.370 77.941  1.00 22.46  ? 410  PRO A N   1 
ATOM   3131  C  CA  . PRO A  1 410 ? 2.110   -18.588 77.172  1.00 17.52  ? 410  PRO A CA  1 
ATOM   3132  C  C   . PRO A  1 410 ? 0.924   -19.556 77.230  1.00 26.50  ? 410  PRO A C   1 
ATOM   3133  O  O   . PRO A  1 410 ? 0.599   -20.147 76.212  1.00 23.57  ? 410  PRO A O   1 
ATOM   3134  C  CB  . PRO A  1 410 ? 3.352   -19.168 77.835  1.00 21.30  ? 410  PRO A CB  1 
ATOM   3135  C  CG  . PRO A  1 410 ? 4.110   -17.965 78.256  1.00 18.24  ? 410  PRO A CG  1 
ATOM   3136  C  CD  . PRO A  1 410 ? 3.062   -16.992 78.729  1.00 23.33  ? 410  PRO A CD  1 
ATOM   3137  N  N   . VAL A  1 411 ? 0.282   -19.716 78.381  1.00 17.35  ? 411  VAL A N   1 
ATOM   3138  C  CA  . VAL A  1 411 ? -0.935  -20.531 78.442  1.00 55.68  ? 411  VAL A CA  1 
ATOM   3139  C  C   . VAL A  1 411 ? -2.064  -20.015 77.533  1.00 60.16  ? 411  VAL A C   1 
ATOM   3140  O  O   . VAL A  1 411 ? -2.771  -20.782 76.886  1.00 19.12  ? 411  VAL A O   1 
ATOM   3141  C  CB  . VAL A  1 411 ? -1.435  -20.654 79.862  1.00 17.35  ? 411  VAL A CB  1 
ATOM   3142  C  CG1 . VAL A  1 411 ? -2.709  -21.440 79.880  1.00 17.75  ? 411  VAL A CG1 1 
ATOM   3143  C  CG2 . VAL A  1 411 ? -0.390  -21.335 80.691  1.00 24.97  ? 411  VAL A CG2 1 
ATOM   3144  N  N   . ALA A  1 412 ? -2.229  -18.707 77.497  1.00 19.42  ? 412  ALA A N   1 
ATOM   3145  C  CA  . ALA A  1 412 ? -3.042  -18.083 76.489  1.00 20.63  ? 412  ALA A CA  1 
ATOM   3146  C  C   . ALA A  1 412 ? -2.652  -18.584 75.091  1.00 25.81  ? 412  ALA A C   1 
ATOM   3147  O  O   . ALA A  1 412 ? -3.391  -19.310 74.452  1.00 21.30  ? 412  ALA A O   1 
ATOM   3148  C  CB  . ALA A  1 412 ? -2.881  -16.605 76.577  1.00 21.23  ? 412  ALA A CB  1 
ATOM   3149  N  N   . GLN A  1 413 ? -1.471  -18.199 74.636  1.00 34.41  ? 413  GLN A N   1 
ATOM   3150  C  CA  . GLN A  1 413 ? -0.943  -18.586 73.329  1.00 37.23  ? 413  GLN A CA  1 
ATOM   3151  C  C   . GLN A  1 413 ? -1.179  -20.059 72.945  1.00 33.32  ? 413  GLN A C   1 
ATOM   3152  O  O   . GLN A  1 413 ? -1.772  -20.355 71.901  1.00 28.99  ? 413  GLN A O   1 
ATOM   3153  C  CB  . GLN A  1 413 ? 0.546   -18.241 73.287  1.00 33.11  ? 413  GLN A CB  1 
ATOM   3154  C  CG  . GLN A  1 413 ? 1.324   -18.987 72.253  1.00 42.19  ? 413  GLN A CG  1 
ATOM   3155  C  CD  . GLN A  1 413 ? 2.322   -18.108 71.557  1.00 53.40  ? 413  GLN A CD  1 
ATOM   3156  O  OE1 . GLN A  1 413 ? 1.941   -17.251 70.758  1.00 55.82  ? 413  GLN A OE1 1 
ATOM   3157  N  NE2 . GLN A  1 413 ? 3.614   -18.306 71.856  1.00 56.49  ? 413  GLN A NE2 1 
ATOM   3158  N  N   . LEU A  1 414 ? -0.709  -20.963 73.802  1.00 26.38  ? 414  LEU A N   1 
ATOM   3159  C  CA  . LEU A  1 414 ? -0.937  -22.396 73.672  1.00 24.52  ? 414  LEU A CA  1 
ATOM   3160  C  C   . LEU A  1 414 ? -2.423  -22.796 73.594  1.00 30.14  ? 414  LEU A C   1 
ATOM   3161  O  O   . LEU A  1 414 ? -2.805  -23.580 72.735  1.00 34.03  ? 414  LEU A O   1 
ATOM   3162  C  CB  . LEU A  1 414 ? -0.251  -23.140 74.814  1.00 17.96  ? 414  LEU A CB  1 
ATOM   3163  C  CG  . LEU A  1 414 ? -0.373  -24.661 74.738  1.00 27.01  ? 414  LEU A CG  1 
ATOM   3164  C  CD1 . LEU A  1 414 ? 0.276   -25.196 73.479  1.00 17.97  ? 414  LEU A CD1 1 
ATOM   3165  C  CD2 . LEU A  1 414 ? 0.261   -25.277 75.949  1.00 16.61  ? 414  LEU A CD2 1 
ATOM   3166  N  N   . ALA A  1 415 ? -3.271  -22.280 74.469  1.00 20.07  ? 415  ALA A N   1 
ATOM   3167  C  CA  . ALA A  1 415 ? -4.681  -22.629 74.335  1.00 32.15  ? 415  ALA A CA  1 
ATOM   3168  C  C   . ALA A  1 415 ? -5.247  -22.158 72.989  1.00 28.52  ? 415  ALA A C   1 
ATOM   3169  O  O   . ALA A  1 415 ? -5.983  -22.889 72.327  1.00 31.60  ? 415  ALA A O   1 
ATOM   3170  C  CB  . ALA A  1 415 ? -5.512  -22.086 75.496  1.00 21.12  ? 415  ALA A CB  1 
ATOM   3171  N  N   . GLY A  1 416 ? -4.882  -20.945 72.588  1.00 26.23  ? 416  GLY A N   1 
ATOM   3172  C  CA  . GLY A  1 416 ? -5.376  -20.355 71.358  1.00 29.23  ? 416  GLY A CA  1 
ATOM   3173  C  C   . GLY A  1 416 ? -4.996  -21.209 70.175  1.00 32.34  ? 416  GLY A C   1 
ATOM   3174  O  O   . GLY A  1 416 ? -5.826  -21.551 69.340  1.00 35.00  ? 416  GLY A O   1 
ATOM   3175  N  N   . ARG A  1 417 ? -3.726  -21.581 70.123  1.00 39.74  ? 417  ARG A N   1 
ATOM   3176  C  CA  . ARG A  1 417 ? -3.227  -22.333 68.990  1.00 37.01  ? 417  ARG A CA  1 
ATOM   3177  C  C   . ARG A  1 417 ? -3.819  -23.735 68.986  1.00 37.02  ? 417  ARG A C   1 
ATOM   3178  O  O   . ARG A  1 417 ? -4.372  -24.166 67.984  1.00 39.23  ? 417  ARG A O   1 
ATOM   3179  C  CB  . ARG A  1 417 ? -1.697  -22.334 68.970  1.00 36.66  ? 417  ARG A CB  1 
ATOM   3180  C  CG  . ARG A  1 417 ? -1.108  -20.922 68.876  1.00 49.00  ? 417  ARG A CG  1 
ATOM   3181  C  CD  . ARG A  1 417 ? -0.375  -20.684 67.567  1.00 62.54  ? 417  ARG A CD  1 
ATOM   3182  N  NE  . ARG A  1 417 ? -1.171  -21.108 66.416  1.00 75.61  ? 417  ARG A NE  1 
ATOM   3183  C  CZ  . ARG A  1 417 ? -1.645  -20.290 65.480  1.00 77.84  ? 417  ARG A CZ  1 
ATOM   3184  N  NH1 . ARG A  1 417 ? -1.396  -18.986 65.549  1.00 81.72  ? 417  ARG A NH1 1 
ATOM   3185  N  NH2 . ARG A  1 417 ? -2.361  -20.780 64.472  1.00 70.61  ? 417  ARG A NH2 1 
ATOM   3186  N  N   . LEU A  1 418 ? -3.734  -24.436 70.109  1.00 35.41  ? 418  LEU A N   1 
ATOM   3187  C  CA  . LEU A  1 418 ? -4.265  -25.795 70.167  1.00 31.40  ? 418  LEU A CA  1 
ATOM   3188  C  C   . LEU A  1 418 ? -5.738  -25.830 69.774  1.00 34.88  ? 418  LEU A C   1 
ATOM   3189  O  O   . LEU A  1 418 ? -6.155  -26.695 69.018  1.00 41.51  ? 418  LEU A O   1 
ATOM   3190  C  CB  . LEU A  1 418 ? -4.063  -26.419 71.553  1.00 26.48  ? 418  LEU A CB  1 
ATOM   3191  C  CG  . LEU A  1 418 ? -2.657  -26.858 71.948  1.00 25.62  ? 418  LEU A CG  1 
ATOM   3192  C  CD1 . LEU A  1 418 ? -2.720  -27.680 73.216  1.00 19.16  ? 418  LEU A CD1 1 
ATOM   3193  C  CD2 . LEU A  1 418 ? -2.007  -27.629 70.821  1.00 20.43  ? 418  LEU A CD2 1 
ATOM   3194  N  N   . ALA A  1 419 ? -6.519  -24.881 70.279  1.00 33.95  ? 419  ALA A N   1 
ATOM   3195  C  CA  . ALA A  1 419 ? -7.934  -24.813 69.935  1.00 34.86  ? 419  ALA A CA  1 
ATOM   3196  C  C   . ALA A  1 419 ? -8.062  -24.592 68.444  1.00 39.86  ? 419  ALA A C   1 
ATOM   3197  O  O   . ALA A  1 419 ? -8.877  -25.232 67.770  1.00 42.94  ? 419  ALA A O   1 
ATOM   3198  C  CB  . ALA A  1 419 ? -8.619  -23.693 70.687  1.00 30.93  ? 419  ALA A CB  1 
ATOM   3199  N  N   . ALA A  1 420 ? -7.227  -23.693 67.936  1.00 37.32  ? 420  ALA A N   1 
ATOM   3200  C  CA  . ALA A  1 420 ? -7.255  -23.312 66.530  1.00 36.02  ? 420  ALA A CA  1 
ATOM   3201  C  C   . ALA A  1 420 ? -6.833  -24.443 65.605  1.00 31.95  ? 420  ALA A C   1 
ATOM   3202  O  O   . ALA A  1 420 ? -7.067  -24.402 64.412  1.00 31.99  ? 420  ALA A O   1 
ATOM   3203  C  CB  . ALA A  1 420 ? -6.365  -22.117 66.312  1.00 34.71  ? 420  ALA A CB  1 
ATOM   3204  N  N   . GLN A  1 421 ? -6.212  -25.457 66.170  1.00 36.04  ? 421  GLN A N   1 
ATOM   3205  C  CA  . GLN A  1 421 ? -5.497  -26.438 65.382  1.00 39.84  ? 421  GLN A CA  1 
ATOM   3206  C  C   . GLN A  1 421 ? -6.178  -27.786 65.514  1.00 36.56  ? 421  GLN A C   1 
ATOM   3207  O  O   . GLN A  1 421 ? -5.561  -28.819 65.242  1.00 31.68  ? 421  GLN A O   1 
ATOM   3208  C  CB  . GLN A  1 421 ? -4.062  -26.541 65.906  1.00 47.32  ? 421  GLN A CB  1 
ATOM   3209  C  CG  . GLN A  1 421 ? -2.993  -26.489 64.859  1.00 51.77  ? 421  GLN A CG  1 
ATOM   3210  C  CD  . GLN A  1 421 ? -3.103  -25.268 64.000  1.00 57.68  ? 421  GLN A CD  1 
ATOM   3211  O  OE1 . GLN A  1 421 ? -3.282  -24.160 64.501  1.00 63.04  ? 421  GLN A OE1 1 
ATOM   3212  N  NE2 . GLN A  1 421 ? -3.012  -25.457 62.691  1.00 59.42  ? 421  GLN A NE2 1 
ATOM   3213  N  N   . GLY A  1 422 ? -7.431  -27.775 65.975  1.00 37.59  ? 422  GLY A N   1 
ATOM   3214  C  CA  . GLY A  1 422 ? -8.218  -28.993 66.083  1.00 42.13  ? 422  GLY A CA  1 
ATOM   3215  C  C   . GLY A  1 422 ? -8.479  -29.548 67.479  1.00 44.86  ? 422  GLY A C   1 
ATOM   3216  O  O   . GLY A  1 422 ? -9.430  -30.303 67.689  1.00 50.28  ? 422  GLY A O   1 
ATOM   3217  N  N   . ALA A  1 423 ? -7.643  -29.189 68.442  1.00 39.74  ? 423  ALA A N   1 
ATOM   3218  C  CA  . ALA A  1 423 ? -7.744  -29.787 69.769  1.00 33.72  ? 423  ALA A CA  1 
ATOM   3219  C  C   . ALA A  1 423 ? -8.974  -29.301 70.495  1.00 33.74  ? 423  ALA A C   1 
ATOM   3220  O  O   . ALA A  1 423 ? -9.478  -28.216 70.208  1.00 33.70  ? 423  ALA A O   1 
ATOM   3221  C  CB  . ALA A  1 423 ? -6.499  -29.485 70.588  1.00 29.83  ? 423  ALA A CB  1 
ATOM   3222  N  N   . ARG A  1 424 ? -9.462  -30.116 71.427  1.00 36.00  ? 424  ARG A N   1 
ATOM   3223  C  CA  . ARG A  1 424 ? -10.484 -29.660 72.360  1.00 39.04  ? 424  ARG A CA  1 
ATOM   3224  C  C   . ARG A  1 424 ? -9.807  -29.250 73.647  1.00 38.45  ? 424  ARG A C   1 
ATOM   3225  O  O   . ARG A  1 424 ? -9.218  -30.082 74.346  1.00 32.51  ? 424  ARG A O   1 
ATOM   3226  C  CB  . ARG A  1 424 ? -11.546 -30.716 72.648  1.00 38.94  ? 424  ARG A CB  1 
ATOM   3227  C  CG  . ARG A  1 424 ? -12.547 -30.231 73.669  1.00 48.93  ? 424  ARG A CG  1 
ATOM   3228  C  CD  . ARG A  1 424 ? -13.524 -31.314 74.051  1.00 68.98  ? 424  ARG A CD  1 
ATOM   3229  N  NE  . ARG A  1 424 ? -14.368 -31.687 72.921  1.00 90.44  ? 424  ARG A NE  1 
ATOM   3230  C  CZ  . ARG A  1 424 ? -15.544 -31.130 72.642  1.00 99.93  ? 424  ARG A CZ  1 
ATOM   3231  N  NH1 . ARG A  1 424 ? -16.029 -30.167 73.416  1.00 97.56  ? 424  ARG A NH1 1 
ATOM   3232  N  NH2 . ARG A  1 424 ? -16.237 -31.542 71.587  1.00 106.63 ? 424  ARG A NH2 1 
ATOM   3233  N  N   . VAL A  1 425 ? -9.903  -27.958 73.946  1.00 39.73  ? 425  VAL A N   1 
ATOM   3234  C  CA  . VAL A  1 425 ? -9.233  -27.354 75.091  1.00 32.71  ? 425  VAL A CA  1 
ATOM   3235  C  C   . VAL A  1 425 ? -10.263 -26.959 76.159  1.00 37.43  ? 425  VAL A C   1 
ATOM   3236  O  O   . VAL A  1 425 ? -11.379 -26.528 75.832  1.00 37.44  ? 425  VAL A O   1 
ATOM   3237  C  CB  . VAL A  1 425 ? -8.470  -26.092 74.638  1.00 26.16  ? 425  VAL A CB  1 
ATOM   3238  C  CG1 . VAL A  1 425 ? -7.891  -25.376 75.794  1.00 27.51  ? 425  VAL A CG1 1 
ATOM   3239  C  CG2 . VAL A  1 425 ? -7.381  -26.445 73.647  1.00 24.42  ? 425  VAL A CG2 1 
ATOM   3240  N  N   . TYR A  1 426 ? -9.902  -27.138 77.427  1.00 36.39  ? 426  TYR A N   1 
ATOM   3241  C  CA  . TYR A  1 426 ? -10.653 -26.547 78.533  1.00 37.67  ? 426  TYR A CA  1 
ATOM   3242  C  C   . TYR A  1 426 ? -9.688  -25.680 79.352  1.00 43.05  ? 426  TYR A C   1 
ATOM   3243  O  O   . TYR A  1 426 ? -8.534  -26.061 79.568  1.00 37.80  ? 426  TYR A O   1 
ATOM   3244  C  CB  . TYR A  1 426 ? -11.283 -27.628 79.405  1.00 27.57  ? 426  TYR A CB  1 
ATOM   3245  C  CG  . TYR A  1 426 ? -12.351 -28.439 78.711  1.00 30.79  ? 426  TYR A CG  1 
ATOM   3246  C  CD1 . TYR A  1 426 ? -13.673 -28.047 78.741  1.00 27.85  ? 426  TYR A CD1 1 
ATOM   3247  C  CD2 . TYR A  1 426 ? -12.037 -29.607 78.037  1.00 35.99  ? 426  TYR A CD2 1 
ATOM   3248  C  CE1 . TYR A  1 426 ? -14.638 -28.782 78.112  1.00 27.47  ? 426  TYR A CE1 1 
ATOM   3249  C  CE2 . TYR A  1 426 ? -13.003 -30.352 77.406  1.00 24.81  ? 426  TYR A CE2 1 
ATOM   3250  C  CZ  . TYR A  1 426 ? -14.298 -29.931 77.446  1.00 31.56  ? 426  TYR A CZ  1 
ATOM   3251  O  OH  . TYR A  1 426 ? -15.277 -30.661 76.816  1.00 40.69  ? 426  TYR A OH  1 
ATOM   3252  N  N   . ALA A  1 427 ? -10.137 -24.510 79.799  1.00 41.86  ? 427  ALA A N   1 
ATOM   3253  C  CA  . ALA A  1 427 ? -9.217  -23.619 80.498  1.00 32.00  ? 427  ALA A CA  1 
ATOM   3254  C  C   . ALA A  1 427 ? -9.720  -23.201 81.870  1.00 30.33  ? 427  ALA A C   1 
ATOM   3255  O  O   . ALA A  1 427 ? -10.923 -23.018 82.075  1.00 34.34  ? 427  ALA A O   1 
ATOM   3256  C  CB  . ALA A  1 427 ? -8.906  -22.408 79.656  1.00 29.30  ? 427  ALA A CB  1 
ATOM   3257  N  N   . TYR A  1 428 ? -8.792  -23.042 82.810  1.00 27.00  ? 428  TYR A N   1 
ATOM   3258  C  CA  . TYR A  1 428 ? -9.173  -22.632 84.158  1.00 25.39  ? 428  TYR A CA  1 
ATOM   3259  C  C   . TYR A  1 428 ? -8.268  -21.582 84.778  1.00 25.74  ? 428  TYR A C   1 
ATOM   3260  O  O   . TYR A  1 428 ? -7.078  -21.443 84.427  1.00 29.44  ? 428  TYR A O   1 
ATOM   3261  C  CB  . TYR A  1 428 ? -9.231  -23.837 85.107  1.00 24.96  ? 428  TYR A CB  1 
ATOM   3262  C  CG  . TYR A  1 428 ? -7.873  -24.439 85.421  1.00 27.88  ? 428  TYR A CG  1 
ATOM   3263  C  CD1 . TYR A  1 428 ? -7.048  -23.893 86.400  1.00 18.90  ? 428  TYR A CD1 1 
ATOM   3264  C  CD2 . TYR A  1 428 ? -7.427  -25.561 84.749  1.00 23.82  ? 428  TYR A CD2 1 
ATOM   3265  C  CE1 . TYR A  1 428 ? -5.845  -24.432 86.678  1.00 17.83  ? 428  TYR A CE1 1 
ATOM   3266  C  CE2 . TYR A  1 428 ? -6.226  -26.106 85.031  1.00 24.39  ? 428  TYR A CE2 1 
ATOM   3267  C  CZ  . TYR A  1 428 ? -5.428  -25.541 85.992  1.00 26.11  ? 428  TYR A CZ  1 
ATOM   3268  O  OH  . TYR A  1 428 ? -4.194  -26.107 86.260  1.00 21.64  ? 428  TYR A OH  1 
ATOM   3269  N  N   . ILE A  1 429 ? -8.834  -20.882 85.755  1.00 24.31  ? 429  ILE A N   1 
ATOM   3270  C  CA  . ILE A  1 429 ? -8.030  -20.065 86.640  1.00 33.41  ? 429  ILE A CA  1 
ATOM   3271  C  C   . ILE A  1 429 ? -8.270  -20.476 88.092  1.00 38.36  ? 429  ILE A C   1 
ATOM   3272  O  O   . ILE A  1 429 ? -9.367  -20.380 88.589  1.00 22.50  ? 429  ILE A O   1 
ATOM   3273  C  CB  . ILE A  1 429 ? -8.243  -18.545 86.386  1.00 30.72  ? 429  ILE A CB  1 
ATOM   3274  C  CG1 . ILE A  1 429 ? -7.269  -17.711 87.231  1.00 32.23  ? 429  ILE A CG1 1 
ATOM   3275  C  CG2 . ILE A  1 429 ? -9.700  -18.150 86.573  1.00 30.96  ? 429  ILE A CG2 1 
ATOM   3276  C  CD1 . ILE A  1 429 ? -7.443  -16.216 87.086  1.00 39.18  ? 429  ILE A CD1 1 
ATOM   3277  N  N   . PHE A  1 430 ? -7.234  -20.968 88.760  1.00 43.75  ? 430  PHE A N   1 
ATOM   3278  C  CA  . PHE A  1 430 ? -7.353  -21.402 90.146  1.00 43.59  ? 430  PHE A CA  1 
ATOM   3279  C  C   . PHE A  1 430 ? -7.209  -20.228 91.111  1.00 39.74  ? 430  PHE A C   1 
ATOM   3280  O  O   . PHE A  1 430 ? -6.112  -19.697 91.259  1.00 35.68  ? 430  PHE A O   1 
ATOM   3281  C  CB  . PHE A  1 430 ? -6.277  -22.441 90.461  1.00 39.94  ? 430  PHE A CB  1 
ATOM   3282  C  CG  . PHE A  1 430 ? -6.414  -23.031 91.819  1.00 40.24  ? 430  PHE A CG  1 
ATOM   3283  C  CD1 . PHE A  1 430 ? -7.242  -24.110 92.031  1.00 40.57  ? 430  PHE A CD1 1 
ATOM   3284  C  CD2 . PHE A  1 430 ? -5.758  -22.478 92.895  1.00 41.47  ? 430  PHE A CD2 1 
ATOM   3285  C  CE1 . PHE A  1 430 ? -7.392  -24.643 93.285  1.00 39.45  ? 430  PHE A CE1 1 
ATOM   3286  C  CE2 . PHE A  1 430 ? -5.907  -23.009 94.151  1.00 44.66  ? 430  PHE A CE2 1 
ATOM   3287  C  CZ  . PHE A  1 430 ? -6.725  -24.094 94.345  1.00 42.33  ? 430  PHE A CZ  1 
ATOM   3288  N  N   . GLU A  1 431 ? -8.296  -19.846 91.785  1.00 35.99  ? 431  GLU A N   1 
ATOM   3289  C  CA  . GLU A  1 431 ? -8.293  -18.629 92.616  1.00 35.26  ? 431  GLU A CA  1 
ATOM   3290  C  C   . GLU A  1 431 ? -8.391  -18.818 94.141  1.00 37.72  ? 431  GLU A C   1 
ATOM   3291  O  O   . GLU A  1 431 ? -8.796  -17.890 94.850  1.00 41.77  ? 431  GLU A O   1 
ATOM   3292  C  CB  . GLU A  1 431 ? -9.418  -17.683 92.185  1.00 35.03  ? 431  GLU A CB  1 
ATOM   3293  C  CG  . GLU A  1 431 ? -9.369  -17.236 90.741  1.00 39.37  ? 431  GLU A CG  1 
ATOM   3294  C  CD  . GLU A  1 431 ? -10.478 -16.252 90.395  1.00 46.90  ? 431  GLU A CD  1 
ATOM   3295  O  OE1 . GLU A  1 431 ? -11.652 -16.499 90.753  1.00 46.76  ? 431  GLU A OE1 1 
ATOM   3296  O  OE2 . GLU A  1 431 ? -10.167 -15.223 89.761  1.00 52.29  ? 431  GLU A OE2 1 
ATOM   3297  N  N   . HIS A  1 432 ? -8.029  -19.988 94.658  1.00 31.87  ? 432  HIS A N   1 
ATOM   3298  C  CA  . HIS A  1 432 ? -8.173  -20.216 96.094  1.00 27.65  ? 432  HIS A CA  1 
ATOM   3299  C  C   . HIS A  1 432 ? -6.880  -20.227 96.904  1.00 35.02  ? 432  HIS A C   1 
ATOM   3300  O  O   . HIS A  1 432 ? -6.003  -21.088 96.741  1.00 32.90  ? 432  HIS A O   1 
ATOM   3301  C  CB  . HIS A  1 432 ? -8.956  -21.489 96.392  1.00 26.10  ? 432  HIS A CB  1 
ATOM   3302  C  CG  . HIS A  1 432 ? -9.149  -21.735 97.856  1.00 35.37  ? 432  HIS A CG  1 
ATOM   3303  N  ND1 . HIS A  1 432 ? -10.134 -21.112 98.593  1.00 39.25  ? 432  HIS A ND1 1 
ATOM   3304  C  CD2 . HIS A  1 432 ? -8.465  -22.514 98.728  1.00 40.42  ? 432  HIS A CD2 1 
ATOM   3305  C  CE1 . HIS A  1 432 ? -10.062 -21.512 99.850  1.00 40.64  ? 432  HIS A CE1 1 
ATOM   3306  N  NE2 . HIS A  1 432 ? -9.057  -22.361 99.959  1.00 41.19  ? 432  HIS A NE2 1 
ATOM   3307  N  N   . ARG A  1 433 ? -6.781  -19.270 97.812  1.00 39.79  ? 433  ARG A N   1 
ATOM   3308  C  CA  . ARG A  1 433 ? -5.695  -19.284 98.763  1.00 33.36  ? 433  ARG A CA  1 
ATOM   3309  C  C   . ARG A  1 433 ? -5.997  -20.318 99.848  1.00 32.77  ? 433  ARG A C   1 
ATOM   3310  O  O   . ARG A  1 433 ? -6.971  -20.181 100.593 1.00 40.87  ? 433  ARG A O   1 
ATOM   3311  C  CB  . ARG A  1 433 ? -5.511  -17.898 99.371  1.00 31.70  ? 433  ARG A CB  1 
ATOM   3312  C  CG  . ARG A  1 433 ? -4.113  -17.680 99.917  1.00 36.18  ? 433  ARG A CG  1 
ATOM   3313  C  CD  . ARG A  1 433 ? -3.920  -16.277 100.431 1.00 34.32  ? 433  ARG A CD  1 
ATOM   3314  N  NE  . ARG A  1 433 ? -3.091  -16.283 101.624 1.00 33.07  ? 433  ARG A NE  1 
ATOM   3315  C  CZ  . ARG A  1 433 ? -1.780  -16.122 101.608 1.00 46.40  ? 433  ARG A CZ  1 
ATOM   3316  N  NH1 . ARG A  1 433 ? -1.152  -15.941 100.456 1.00 53.19  ? 433  ARG A NH1 1 
ATOM   3317  N  NH2 . ARG A  1 433 ? -1.099  -16.141 102.741 1.00 56.08  ? 433  ARG A NH2 1 
ATOM   3318  N  N   . ALA A  1 434 ? -5.172  -21.360 99.916  1.00 26.83  ? 434  ALA A N   1 
ATOM   3319  C  CA  . ALA A  1 434 ? -5.278  -22.380 100.963 1.00 26.69  ? 434  ALA A CA  1 
ATOM   3320  C  C   . ALA A  1 434 ? -5.242  -21.789 102.365 1.00 31.23  ? 434  ALA A C   1 
ATOM   3321  O  O   . ALA A  1 434 ? -4.328  -21.036 102.707 1.00 28.61  ? 434  ALA A O   1 
ATOM   3322  C  CB  . ALA A  1 434 ? -4.172  -23.399 100.820 1.00 27.99  ? 434  ALA A CB  1 
ATOM   3323  N  N   . SER A  1 435 ? -6.229  -22.155 103.181 1.00 34.82  ? 435  SER A N   1 
ATOM   3324  C  CA  . SER A  1 435 ? -6.324  -21.650 104.544 1.00 32.21  ? 435  SER A CA  1 
ATOM   3325  C  C   . SER A  1 435 ? -5.005  -21.847 105.282 1.00 32.76  ? 435  SER A C   1 
ATOM   3326  O  O   . SER A  1 435 ? -4.655  -21.063 106.163 1.00 37.19  ? 435  SER A O   1 
ATOM   3327  C  CB  . SER A  1 435 ? -7.449  -22.350 105.299 1.00 28.73  ? 435  SER A CB  1 
ATOM   3328  O  OG  . SER A  1 435 ? -7.081  -23.673 105.639 1.00 57.94  ? 435  SER A OG  1 
ATOM   3329  N  N   . THR A  1 436 ? -4.267  -22.880 104.886 1.00 33.56  ? 436  THR A N   1 
ATOM   3330  C  CA  . THR A  1 436 ? -3.028  -23.267 105.554 1.00 39.69  ? 436  THR A CA  1 
ATOM   3331  C  C   . THR A  1 436 ? -1.750  -22.670 104.940 1.00 34.92  ? 436  THR A C   1 
ATOM   3332  O  O   . THR A  1 436 ? -0.650  -23.024 105.344 1.00 31.62  ? 436  THR A O   1 
ATOM   3333  C  CB  . THR A  1 436 ? -2.883  -24.796 105.554 1.00 49.17  ? 436  THR A CB  1 
ATOM   3334  O  OG1 . THR A  1 436 ? -2.452  -25.235 104.258 1.00 49.44  ? 436  THR A OG1 1 
ATOM   3335  C  CG2 . THR A  1 436 ? -4.216  -25.457 105.894 1.00 53.24  ? 436  THR A CG2 1 
ATOM   3336  N  N   . LEU A  1 437 ? -1.897  -21.778 103.963 1.00 37.10  ? 437  LEU A N   1 
ATOM   3337  C  CA  . LEU A  1 437 ? -0.754  -21.181 103.271 1.00 33.87  ? 437  LEU A CA  1 
ATOM   3338  C  C   . LEU A  1 437 ? 0.178   -20.467 104.244 1.00 37.49  ? 437  LEU A C   1 
ATOM   3339  O  O   . LEU A  1 437 ? -0.269  -19.681 105.084 1.00 39.67  ? 437  LEU A O   1 
ATOM   3340  C  CB  . LEU A  1 437 ? -1.230  -20.182 102.210 1.00 38.79  ? 437  LEU A CB  1 
ATOM   3341  C  CG  . LEU A  1 437 ? -0.609  -20.190 100.805 1.00 46.29  ? 437  LEU A CG  1 
ATOM   3342  C  CD1 . LEU A  1 437 ? 0.854   -20.656 100.795 1.00 42.70  ? 437  LEU A CD1 1 
ATOM   3343  C  CD2 . LEU A  1 437 ? -1.454  -21.030 99.856  1.00 52.00  ? 437  LEU A CD2 1 
ATOM   3344  N  N   . THR A  1 438 ? 1.475   -20.732 104.108 1.00 36.27  ? 438  THR A N   1 
ATOM   3345  C  CA  . THR A  1 438 ? 2.494   -20.148 104.978 1.00 32.88  ? 438  THR A CA  1 
ATOM   3346  C  C   . THR A  1 438 ? 3.162   -18.912 104.373 1.00 34.65  ? 438  THR A C   1 
ATOM   3347  O  O   . THR A  1 438 ? 3.847   -18.165 105.072 1.00 40.26  ? 438  THR A O   1 
ATOM   3348  C  CB  . THR A  1 438 ? 3.555   -21.182 105.319 1.00 38.41  ? 438  THR A CB  1 
ATOM   3349  O  OG1 . THR A  1 438 ? 3.951   -21.874 104.126 1.00 48.23  ? 438  THR A OG1 1 
ATOM   3350  C  CG2 . THR A  1 438 ? 2.983   -22.186 106.281 1.00 34.04  ? 438  THR A CG2 1 
ATOM   3351  N  N   . TRP A  1 439 ? 2.955   -18.705 103.073 1.00 33.84  ? 439  TRP A N   1 
ATOM   3352  C  CA  . TRP A  1 439 ? 3.440   -17.513 102.370 1.00 31.33  ? 439  TRP A CA  1 
ATOM   3353  C  C   . TRP A  1 439 ? 2.589   -16.301 102.714 1.00 35.61  ? 439  TRP A C   1 
ATOM   3354  O  O   . TRP A  1 439 ? 1.391   -16.434 102.931 1.00 24.91  ? 439  TRP A O   1 
ATOM   3355  C  CB  . TRP A  1 439 ? 3.390   -17.725 100.864 1.00 21.89  ? 439  TRP A CB  1 
ATOM   3356  C  CG  . TRP A  1 439 ? 4.382   -18.689 100.360 1.00 20.80  ? 439  TRP A CG  1 
ATOM   3357  C  CD1 . TRP A  1 439 ? 4.149   -19.967 99.971  1.00 26.17  ? 439  TRP A CD1 1 
ATOM   3358  C  CD2 . TRP A  1 439 ? 5.771   -18.459 100.171 1.00 33.62  ? 439  TRP A CD2 1 
ATOM   3359  N  NE1 . TRP A  1 439 ? 5.307   -20.556 99.547  1.00 22.15  ? 439  TRP A NE1 1 
ATOM   3360  C  CE2 . TRP A  1 439 ? 6.324   -19.646 99.661  1.00 28.95  ? 439  TRP A CE2 1 
ATOM   3361  C  CE3 . TRP A  1 439 ? 6.607   -17.365 100.383 1.00 40.47  ? 439  TRP A CE3 1 
ATOM   3362  C  CZ2 . TRP A  1 439 ? 7.676   -19.773 99.366  1.00 30.19  ? 439  TRP A CZ2 1 
ATOM   3363  C  CZ3 . TRP A  1 439 ? 7.953   -17.490 100.081 1.00 38.55  ? 439  TRP A CZ3 1 
ATOM   3364  C  CH2 . TRP A  1 439 ? 8.473   -18.686 99.581  1.00 31.35  ? 439  TRP A CH2 1 
ATOM   3365  N  N   . PRO A  1 440 ? 3.197   -15.103 102.723 1.00 42.67  ? 440  PRO A N   1 
ATOM   3366  C  CA  . PRO A  1 440 ? 2.484   -13.909 103.199 1.00 38.34  ? 440  PRO A CA  1 
ATOM   3367  C  C   . PRO A  1 440 ? 1.251   -13.558 102.363 1.00 32.78  ? 440  PRO A C   1 
ATOM   3368  O  O   . PRO A  1 440 ? 1.037   -14.131 101.302 1.00 31.88  ? 440  PRO A O   1 
ATOM   3369  C  CB  . PRO A  1 440 ? 3.552   -12.805 103.120 1.00 36.07  ? 440  PRO A CB  1 
ATOM   3370  C  CG  . PRO A  1 440 ? 4.498   -13.263 102.073 1.00 38.70  ? 440  PRO A CG  1 
ATOM   3371  C  CD  . PRO A  1 440 ? 4.528   -14.771 102.176 1.00 44.63  ? 440  PRO A CD  1 
ATOM   3372  N  N   . LEU A  1 441 ? 0.448   -12.624 102.854 1.00 33.48  ? 441  LEU A N   1 
ATOM   3373  C  CA  . LEU A  1 441 ? -0.800  -12.259 102.199 1.00 36.37  ? 441  LEU A CA  1 
ATOM   3374  C  C   . LEU A  1 441 ? -0.610  -11.610 100.826 1.00 41.45  ? 441  LEU A C   1 
ATOM   3375  O  O   . LEU A  1 441 ? -1.446  -11.778 99.936  1.00 26.96  ? 441  LEU A O   1 
ATOM   3376  C  CB  . LEU A  1 441 ? -1.594  -11.319 103.104 1.00 42.06  ? 441  LEU A CB  1 
ATOM   3377  C  CG  . LEU A  1 441 ? -3.041  -11.735 103.364 1.00 45.57  ? 441  LEU A CG  1 
ATOM   3378  C  CD1 . LEU A  1 441 ? -3.686  -10.814 104.389 1.00 51.58  ? 441  LEU A CD1 1 
ATOM   3379  C  CD2 . LEU A  1 441 ? -3.842  -11.763 102.067 1.00 43.03  ? 441  LEU A CD2 1 
ATOM   3380  N  N   . TRP A  1 442 ? 0.482   -10.864 100.656 1.00 43.08  ? 442  TRP A N   1 
ATOM   3381  C  CA  . TRP A  1 442 ? 0.662   -10.080 99.437  1.00 39.31  ? 442  TRP A CA  1 
ATOM   3382  C  C   . TRP A  1 442 ? 0.881   -10.966 98.211  1.00 38.69  ? 442  TRP A C   1 
ATOM   3383  O  O   . TRP A  1 442 ? 0.760   -10.497 97.081  1.00 41.63  ? 442  TRP A O   1 
ATOM   3384  C  CB  . TRP A  1 442 ? 1.780   -9.028  99.582  1.00 36.17  ? 442  TRP A CB  1 
ATOM   3385  C  CG  . TRP A  1 442 ? 3.178   -9.594  99.593  1.00 39.18  ? 442  TRP A CG  1 
ATOM   3386  C  CD1 . TRP A  1 442 ? 3.967   -9.790  100.687 1.00 40.26  ? 442  TRP A CD1 1 
ATOM   3387  C  CD2 . TRP A  1 442 ? 3.952   -10.036 98.459  1.00 29.75  ? 442  TRP A CD2 1 
ATOM   3388  N  NE1 . TRP A  1 442 ? 5.176   -10.329 100.309 1.00 32.88  ? 442  TRP A NE1 1 
ATOM   3389  C  CE2 . TRP A  1 442 ? 5.186   -10.496 98.951  1.00 27.12  ? 442  TRP A CE2 1 
ATOM   3390  C  CE3 . TRP A  1 442 ? 3.713   -10.095 97.085  1.00 28.90  ? 442  TRP A CE3 1 
ATOM   3391  C  CZ2 . TRP A  1 442 ? 6.175   -11.006 98.120  1.00 32.63  ? 442  TRP A CZ2 1 
ATOM   3392  C  CZ3 . TRP A  1 442 ? 4.690   -10.602 96.262  1.00 31.11  ? 442  TRP A CZ3 1 
ATOM   3393  C  CH2 . TRP A  1 442 ? 5.911   -11.047 96.779  1.00 34.52  ? 442  TRP A CH2 1 
ATOM   3394  N  N   . MET A  1 443 ? 1.190   -12.243 98.436  1.00 34.45  ? 443  MET A N   1 
ATOM   3395  C  CA  . MET A  1 443 ? 1.475   -13.180 97.347  1.00 29.11  ? 443  MET A CA  1 
ATOM   3396  C  C   . MET A  1 443 ? 0.245   -13.900 96.775  1.00 31.50  ? 443  MET A C   1 
ATOM   3397  O  O   . MET A  1 443 ? 0.382   -14.726 95.876  1.00 21.47  ? 443  MET A O   1 
ATOM   3398  C  CB  . MET A  1 443 ? 2.496   -14.220 97.790  1.00 28.57  ? 443  MET A CB  1 
ATOM   3399  C  CG  . MET A  1 443 ? 3.881   -13.693 98.062  1.00 22.21  ? 443  MET A CG  1 
ATOM   3400  S  SD  . MET A  1 443 ? 4.939   -15.086 98.482  1.00 34.74  ? 443  MET A SD  1 
ATOM   3401  C  CE  . MET A  1 443 ? 6.421   -14.702 97.558  1.00 63.26  ? 443  MET A CE  1 
ATOM   3402  N  N   . GLY A  1 444 ? -0.946  -13.595 97.295  1.00 39.13  ? 444  GLY A N   1 
ATOM   3403  C  CA  . GLY A  1 444 ? -2.200  -14.100 96.737  1.00 40.23  ? 444  GLY A CA  1 
ATOM   3404  C  C   . GLY A  1 444 ? -2.298  -15.618 96.663  1.00 36.38  ? 444  GLY A C   1 
ATOM   3405  O  O   . GLY A  1 444 ? -2.170  -16.301 97.677  1.00 38.59  ? 444  GLY A O   1 
ATOM   3406  N  N   . VAL A  1 445 ? -2.528  -16.149 95.464  1.00 25.25  ? 445  VAL A N   1 
ATOM   3407  C  CA  . VAL A  1 445 ? -2.591  -17.592 95.262  1.00 21.18  ? 445  VAL A CA  1 
ATOM   3408  C  C   . VAL A  1 445 ? -1.428  -17.985 94.377  1.00 24.51  ? 445  VAL A C   1 
ATOM   3409  O  O   . VAL A  1 445 ? -1.580  -18.046 93.160  1.00 26.14  ? 445  VAL A O   1 
ATOM   3410  C  CB  . VAL A  1 445 ? -3.904  -18.018 94.566  1.00 26.75  ? 445  VAL A CB  1 
ATOM   3411  C  CG1 . VAL A  1 445 ? -3.992  -19.530 94.456  1.00 20.38  ? 445  VAL A CG1 1 
ATOM   3412  C  CG2 . VAL A  1 445 ? -5.113  -17.475 95.310  1.00 22.63  ? 445  VAL A CG2 1 
ATOM   3413  N  N   . PRO A  1 446 ? -0.258  -18.248 94.989  1.00 26.04  ? 446  PRO A N   1 
ATOM   3414  C  CA  . PRO A  1 446 ? 1.009   -18.421 94.275  1.00 25.29  ? 446  PRO A CA  1 
ATOM   3415  C  C   . PRO A  1 446 ? 1.099   -19.669 93.398  1.00 29.84  ? 446  PRO A C   1 
ATOM   3416  O  O   . PRO A  1 446 ? 0.335   -20.642 93.507  1.00 27.86  ? 446  PRO A O   1 
ATOM   3417  C  CB  . PRO A  1 446 ? 2.046   -18.522 95.404  1.00 23.99  ? 446  PRO A CB  1 
ATOM   3418  C  CG  . PRO A  1 446 ? 1.372   -18.019 96.598  1.00 24.83  ? 446  PRO A CG  1 
ATOM   3419  C  CD  . PRO A  1 446 ? -0.064  -18.360 96.440  1.00 26.47  ? 446  PRO A CD  1 
ATOM   3420  N  N   . HIS A  1 447 ? 2.089   -19.601 92.520  1.00 27.05  ? 447  HIS A N   1 
ATOM   3421  C  CA  . HIS A  1 447 ? 2.419   -20.638 91.574  1.00 22.51  ? 447  HIS A CA  1 
ATOM   3422  C  C   . HIS A  1 447 ? 2.742   -21.907 92.333  1.00 27.42  ? 447  HIS A C   1 
ATOM   3423  O  O   . HIS A  1 447 ? 3.685   -21.941 93.119  1.00 28.05  ? 447  HIS A O   1 
ATOM   3424  C  CB  . HIS A  1 447 ? 3.622   -20.143 90.783  1.00 20.75  ? 447  HIS A CB  1 
ATOM   3425  C  CG  . HIS A  1 447 ? 4.190   -21.125 89.812  1.00 19.90  ? 447  HIS A CG  1 
ATOM   3426  N  ND1 . HIS A  1 447 ? 3.612   -21.381 88.587  1.00 21.77  ? 447  HIS A ND1 1 
ATOM   3427  C  CD2 . HIS A  1 447 ? 5.336   -21.848 89.848  1.00 21.93  ? 447  HIS A CD2 1 
ATOM   3428  C  CE1 . HIS A  1 447 ? 4.356   -22.252 87.927  1.00 27.23  ? 447  HIS A CE1 1 
ATOM   3429  N  NE2 . HIS A  1 447 ? 5.409   -22.549 88.669  1.00 27.84  ? 447  HIS A NE2 1 
ATOM   3430  N  N   . GLY A  1 448 ? 1.927   -22.938 92.119  1.00 30.51  ? 448  GLY A N   1 
ATOM   3431  C  CA  . GLY A  1 448 ? 2.150   -24.236 92.724  1.00 22.65  ? 448  GLY A CA  1 
ATOM   3432  C  C   . GLY A  1 448 ? 1.135   -24.633 93.771  1.00 22.62  ? 448  GLY A C   1 
ATOM   3433  O  O   . GLY A  1 448 ? 1.050   -25.795 94.148  1.00 25.05  ? 448  GLY A O   1 
ATOM   3434  N  N   . TYR A  1 449 ? 0.351   -23.679 94.245  1.00 26.56  ? 449  TYR A N   1 
ATOM   3435  C  CA  . TYR A  1 449 ? -0.467  -23.943 95.421  1.00 29.27  ? 449  TYR A CA  1 
ATOM   3436  C  C   . TYR A  1 449 ? -1.889  -24.344 95.104  1.00 27.72  ? 449  TYR A C   1 
ATOM   3437  O  O   . TYR A  1 449 ? -2.820  -24.032 95.856  1.00 31.20  ? 449  TYR A O   1 
ATOM   3438  C  CB  . TYR A  1 449 ? -0.367  -22.788 96.422  1.00 27.96  ? 449  TYR A CB  1 
ATOM   3439  C  CG  . TYR A  1 449 ? 1.011   -22.794 97.017  1.00 23.30  ? 449  TYR A CG  1 
ATOM   3440  C  CD1 . TYR A  1 449 ? 2.071   -22.196 96.359  1.00 24.97  ? 449  TYR A CD1 1 
ATOM   3441  C  CD2 . TYR A  1 449 ? 1.268   -23.480 98.184  1.00 23.19  ? 449  TYR A CD2 1 
ATOM   3442  C  CE1 . TYR A  1 449 ? 3.350   -22.248 96.876  1.00 28.71  ? 449  TYR A CE1 1 
ATOM   3443  C  CE2 . TYR A  1 449 ? 2.529   -23.537 98.712  1.00 29.48  ? 449  TYR A CE2 1 
ATOM   3444  C  CZ  . TYR A  1 449 ? 3.580   -22.923 98.058  1.00 27.69  ? 449  TYR A CZ  1 
ATOM   3445  O  OH  . TYR A  1 449 ? 4.854   -22.978 98.603  1.00 20.17  ? 449  TYR A OH  1 
ATOM   3446  N  N   . GLU A  1 450 ? -2.030  -25.048 93.985  1.00 18.85  ? 450  GLU A N   1 
ATOM   3447  C  CA  . GLU A  1 450 ? -3.295  -25.645 93.600  1.00 28.59  ? 450  GLU A CA  1 
ATOM   3448  C  C   . GLU A  1 450 ? -3.092  -27.148 93.603  1.00 30.85  ? 450  GLU A C   1 
ATOM   3449  O  O   . GLU A  1 450 ? -4.049  -27.922 93.577  1.00 44.83  ? 450  GLU A O   1 
ATOM   3450  C  CB  . GLU A  1 450 ? -3.748  -25.177 92.205  1.00 28.89  ? 450  GLU A CB  1 
ATOM   3451  C  CG  . GLU A  1 450 ? -3.206  -25.999 91.041  1.00 16.24  ? 450  GLU A CG  1 
ATOM   3452  C  CD  . GLU A  1 450 ? -1.805  -25.603 90.653  1.00 30.26  ? 450  GLU A CD  1 
ATOM   3453  O  OE1 . GLU A  1 450 ? -1.057  -25.114 91.528  1.00 32.78  ? 450  GLU A OE1 1 
ATOM   3454  O  OE2 . GLU A  1 450 ? -1.450  -25.770 89.466  1.00 27.25  ? 450  GLU A OE2 1 
ATOM   3455  N  N   . ILE A  1 451 ? -1.836  -27.556 93.649  1.00 18.12  ? 451  ILE A N   1 
ATOM   3456  C  CA  . ILE A  1 451 ? -1.506  -28.967 93.523  1.00 20.23  ? 451  ILE A CA  1 
ATOM   3457  C  C   . ILE A  1 451 ? -2.131  -29.754 94.666  1.00 23.07  ? 451  ILE A C   1 
ATOM   3458  O  O   . ILE A  1 451 ? -2.823  -30.752 94.436  1.00 22.59  ? 451  ILE A O   1 
ATOM   3459  C  CB  . ILE A  1 451 ? 0.043   -29.211 93.465  1.00 22.19  ? 451  ILE A CB  1 
ATOM   3460  C  CG1 . ILE A  1 451 ? 0.680   -28.433 92.314  1.00 14.28  ? 451  ILE A CG1 1 
ATOM   3461  C  CG2 . ILE A  1 451 ? 0.358   -30.697 93.317  1.00 14.37  ? 451  ILE A CG2 1 
ATOM   3462  C  CD1 . ILE A  1 451 ? 2.167   -28.724 92.150  1.00 74.70  ? 451  ILE A CD1 1 
ATOM   3463  N  N   . GLU A  1 452 ? -1.901  -29.283 95.891  1.00 16.50  ? 452  GLU A N   1 
ATOM   3464  C  CA  . GLU A  1 452 ? -2.391  -29.948 97.095  1.00 26.51  ? 452  GLU A CA  1 
ATOM   3465  C  C   . GLU A  1 452 ? -3.910  -30.139 97.077  1.00 33.14  ? 452  GLU A C   1 
ATOM   3466  O  O   . GLU A  1 452 ? -4.451  -31.008 97.754  1.00 31.76  ? 452  GLU A O   1 
ATOM   3467  C  CB  . GLU A  1 452 ? -1.949  -29.176 98.346  1.00 26.79  ? 452  GLU A CB  1 
ATOM   3468  C  CG  . GLU A  1 452 ? -2.300  -27.691 98.340  1.00 31.76  ? 452  GLU A CG  1 
ATOM   3469  C  CD  . GLU A  1 452 ? -1.489  -26.889 99.345  1.00 37.99  ? 452  GLU A CD  1 
ATOM   3470  O  OE1 . GLU A  1 452 ? -0.327  -26.544 99.049  1.00 40.50  ? 452  GLU A OE1 1 
ATOM   3471  O  OE2 . GLU A  1 452 ? -2.014  -26.595 100.434 1.00 39.03  ? 452  GLU A OE2 1 
ATOM   3472  N  N   . PHE A  1 453 ? -4.595  -29.330 96.288  1.00 18.08  ? 453  PHE A N   1 
ATOM   3473  C  CA  . PHE A  1 453 ? -6.014  -29.490 96.135  1.00 32.74  ? 453  PHE A CA  1 
ATOM   3474  C  C   . PHE A  1 453 ? -6.351  -30.555 95.091  1.00 37.45  ? 453  PHE A C   1 
ATOM   3475  O  O   . PHE A  1 453 ? -7.177  -31.429 95.347  1.00 40.20  ? 453  PHE A O   1 
ATOM   3476  C  CB  . PHE A  1 453 ? -6.646  -28.141 95.822  1.00 33.65  ? 453  PHE A CB  1 
ATOM   3477  C  CG  . PHE A  1 453 ? -6.618  -27.197 96.984  1.00 36.32  ? 453  PHE A CG  1 
ATOM   3478  C  CD1 . PHE A  1 453 ? -5.439  -26.560 97.346  1.00 35.71  ? 453  PHE A CD1 1 
ATOM   3479  C  CD2 . PHE A  1 453 ? -7.762  -26.973 97.740  1.00 36.33  ? 453  PHE A CD2 1 
ATOM   3480  C  CE1 . PHE A  1 453 ? -5.400  -25.703 98.426  1.00 36.42  ? 453  PHE A CE1 1 
ATOM   3481  C  CE2 . PHE A  1 453 ? -7.735  -26.119 98.821  1.00 35.96  ? 453  PHE A CE2 1 
ATOM   3482  C  CZ  . PHE A  1 453 ? -6.554  -25.482 99.166  1.00 38.44  ? 453  PHE A CZ  1 
ATOM   3483  N  N   . ILE A  1 454 ? -5.703  -30.491 93.927  1.00 33.14  ? 454  ILE A N   1 
ATOM   3484  C  CA  . ILE A  1 454 ? -5.926  -31.472 92.860  1.00 26.12  ? 454  ILE A CA  1 
ATOM   3485  C  C   . ILE A  1 454 ? -5.674  -32.892 93.373  1.00 25.28  ? 454  ILE A C   1 
ATOM   3486  O  O   . ILE A  1 454 ? -6.444  -33.803 93.095  1.00 23.25  ? 454  ILE A O   1 
ATOM   3487  C  CB  . ILE A  1 454 ? -5.038  -31.198 91.601  1.00 29.09  ? 454  ILE A CB  1 
ATOM   3488  C  CG1 . ILE A  1 454 ? -5.342  -29.828 90.989  1.00 32.53  ? 454  ILE A CG1 1 
ATOM   3489  C  CG2 . ILE A  1 454 ? -5.232  -32.270 90.539  1.00 20.45  ? 454  ILE A CG2 1 
ATOM   3490  C  CD1 . ILE A  1 454 ? -6.800  -29.458 91.024  1.00 28.55  ? 454  ILE A CD1 1 
ATOM   3491  N  N   . PHE A  1 455 ? -4.602  -33.068 94.141  1.00 31.41  ? 455  PHE A N   1 
ATOM   3492  C  CA  . PHE A  1 455 ? -4.273  -34.371 94.713  1.00 32.16  ? 455  PHE A CA  1 
ATOM   3493  C  C   . PHE A  1 455 ? -5.136  -34.725 95.904  1.00 32.75  ? 455  PHE A C   1 
ATOM   3494  O  O   . PHE A  1 455 ? -5.074  -35.840 96.396  1.00 37.66  ? 455  PHE A O   1 
ATOM   3495  C  CB  . PHE A  1 455 ? -2.811  -34.425 95.127  1.00 16.05  ? 455  PHE A CB  1 
ATOM   3496  C  CG  . PHE A  1 455 ? -1.888  -34.754 94.003  1.00 24.99  ? 455  PHE A CG  1 
ATOM   3497  C  CD1 . PHE A  1 455 ? -1.482  -33.769 93.108  1.00 23.62  ? 455  PHE A CD1 1 
ATOM   3498  C  CD2 . PHE A  1 455 ? -1.431  -36.045 93.826  1.00 19.45  ? 455  PHE A CD2 1 
ATOM   3499  C  CE1 . PHE A  1 455 ? -0.631  -34.062 92.060  1.00 22.17  ? 455  PHE A CE1 1 
ATOM   3500  C  CE2 . PHE A  1 455 ? -0.586  -36.342 92.785  1.00 27.75  ? 455  PHE A CE2 1 
ATOM   3501  C  CZ  . PHE A  1 455 ? -0.182  -35.344 91.898  1.00 28.79  ? 455  PHE A CZ  1 
ATOM   3502  N  N   . GLY A  1 456 ? -5.918  -33.766 96.380  1.00 34.73  ? 456  GLY A N   1 
ATOM   3503  C  CA  . GLY A  1 456 ? -6.891  -34.024 97.423  1.00 40.36  ? 456  GLY A CA  1 
ATOM   3504  C  C   . GLY A  1 456 ? -6.348  -34.144 98.832  1.00 46.30  ? 456  GLY A C   1 
ATOM   3505  O  O   . GLY A  1 456 ? -6.938  -34.822 99.664  1.00 51.55  ? 456  GLY A O   1 
ATOM   3506  N  N   . LEU A  1 457 ? -5.235  -33.487 99.112  1.00 19.37  ? 457  LEU A N   1 
ATOM   3507  C  CA  . LEU A  1 457 ? -4.722  -33.453 100.469 1.00 19.93  ? 457  LEU A CA  1 
ATOM   3508  C  C   . LEU A  1 457 ? -5.678  -32.916 101.555 1.00 25.17  ? 457  LEU A C   1 
ATOM   3509  O  O   . LEU A  1 457 ? -5.566  -33.330 102.713 1.00 22.03  ? 457  LEU A O   1 
ATOM   3510  C  CB  . LEU A  1 457 ? -3.408  -32.689 100.528 1.00 19.35  ? 457  LEU A CB  1 
ATOM   3511  C  CG  . LEU A  1 457 ? -2.131  -33.483 100.257 1.00 22.71  ? 457  LEU A CG  1 
ATOM   3512  C  CD1 . LEU A  1 457 ? -2.179  -34.096 98.887  1.00 22.88  ? 457  LEU A CD1 1 
ATOM   3513  C  CD2 . LEU A  1 457 ? -0.930  -32.584 100.374 1.00 18.18  ? 457  LEU A CD2 1 
ATOM   3514  N  N   . PRO A  1 458 ? -6.615  -31.999 101.215 1.00 24.23  ? 458  PRO A N   1 
ATOM   3515  C  CA  . PRO A  1 458 ? -7.486  -31.583 102.322 1.00 33.86  ? 458  PRO A CA  1 
ATOM   3516  C  C   . PRO A  1 458 ? -8.454  -32.662 102.825 1.00 41.16  ? 458  PRO A C   1 
ATOM   3517  O  O   . PRO A  1 458 ? -9.182  -32.413 103.793 1.00 44.72  ? 458  PRO A O   1 
ATOM   3518  C  CB  . PRO A  1 458 ? -8.276  -30.405 101.730 1.00 27.58  ? 458  PRO A CB  1 
ATOM   3519  C  CG  . PRO A  1 458 ? -7.446  -29.896 100.672 1.00 22.36  ? 458  PRO A CG  1 
ATOM   3520  C  CD  . PRO A  1 458 ? -6.782  -31.099 100.065 1.00 21.25  ? 458  PRO A CD  1 
ATOM   3521  N  N   . LEU A  1 459 ? -8.471  -33.826 102.181 1.00 38.66  ? 459  LEU A N   1 
ATOM   3522  C  CA  . LEU A  1 459 ? -9.305  -34.927 102.631 1.00 24.38  ? 459  LEU A CA  1 
ATOM   3523  C  C   . LEU A  1 459 ? -8.679  -35.632 103.826 1.00 35.62  ? 459  LEU A C   1 
ATOM   3524  O  O   . LEU A  1 459 ? -9.300  -36.500 104.442 1.00 33.55  ? 459  LEU A O   1 
ATOM   3525  C  CB  . LEU A  1 459 ? -9.571  -35.913 101.495 1.00 29.61  ? 459  LEU A CB  1 
ATOM   3526  C  CG  . LEU A  1 459 ? -10.681 -35.453 100.547 1.00 36.02  ? 459  LEU A CG  1 
ATOM   3527  C  CD1 . LEU A  1 459 ? -10.088 -34.754 99.349  1.00 47.07  ? 459  LEU A CD1 1 
ATOM   3528  C  CD2 . LEU A  1 459 ? -11.546 -36.607 100.111 1.00 30.88  ? 459  LEU A CD2 1 
ATOM   3529  N  N   . ASP A  1 460 ? -7.447  -35.247 104.149 1.00 34.51  ? 460  ASP A N   1 
ATOM   3530  C  CA  . ASP A  1 460 ? -6.735  -35.781 105.302 1.00 34.67  ? 460  ASP A CA  1 
ATOM   3531  C  C   . ASP A  1 460 ? -6.977  -34.838 106.465 1.00 43.42  ? 460  ASP A C   1 
ATOM   3532  O  O   . ASP A  1 460 ? -6.332  -33.795 106.560 1.00 49.49  ? 460  ASP A O   1 
ATOM   3533  C  CB  . ASP A  1 460 ? -5.247  -35.857 104.987 1.00 30.32  ? 460  ASP A CB  1 
ATOM   3534  C  CG  . ASP A  1 460 ? -4.416  -36.397 106.138 1.00 40.25  ? 460  ASP A CG  1 
ATOM   3535  O  OD1 . ASP A  1 460 ? -4.890  -36.425 107.297 1.00 25.46  ? 460  ASP A OD1 1 
ATOM   3536  O  OD2 . ASP A  1 460 ? -3.258  -36.791 105.870 1.00 45.86  ? 460  ASP A OD2 1 
ATOM   3537  N  N   . PRO A  1 461 ? -7.902  -35.209 107.364 1.00 47.85  ? 461  PRO A N   1 
ATOM   3538  C  CA  . PRO A  1 461 ? -8.317  -34.340 108.474 1.00 49.72  ? 461  PRO A CA  1 
ATOM   3539  C  C   . PRO A  1 461 ? -7.145  -33.869 109.340 1.00 45.59  ? 461  PRO A C   1 
ATOM   3540  O  O   . PRO A  1 461 ? -7.167  -32.741 109.839 1.00 52.73  ? 461  PRO A O   1 
ATOM   3541  C  CB  . PRO A  1 461 ? -9.280  -35.221 109.277 1.00 46.22  ? 461  PRO A CB  1 
ATOM   3542  C  CG  . PRO A  1 461 ? -8.961  -36.621 108.861 1.00 48.51  ? 461  PRO A CG  1 
ATOM   3543  C  CD  . PRO A  1 461 ? -8.538  -36.533 107.434 1.00 48.26  ? 461  PRO A CD  1 
ATOM   3544  N  N   . SER A  1 462 ? -6.119  -34.698 109.487 1.00 31.00  ? 462  SER A N   1 
ATOM   3545  C  CA  . SER A  1 462 ? -4.930  -34.269 110.212 1.00 40.83  ? 462  SER A CA  1 
ATOM   3546  C  C   . SER A  1 462 ? -4.259  -33.026 109.597 1.00 44.05  ? 462  SER A C   1 
ATOM   3547  O  O   . SER A  1 462 ? -3.414  -32.387 110.233 1.00 47.84  ? 462  SER A O   1 
ATOM   3548  C  CB  . SER A  1 462 ? -3.909  -35.402 110.289 1.00 45.01  ? 462  SER A CB  1 
ATOM   3549  O  OG  . SER A  1 462 ? -2.930  -35.270 109.273 1.00 45.58  ? 462  SER A OG  1 
ATOM   3550  N  N   . LEU A  1 463 ? -4.627  -32.678 108.369 1.00 36.07  ? 463  LEU A N   1 
ATOM   3551  C  CA  . LEU A  1 463 ? -3.922  -31.612 107.676 1.00 31.37  ? 463  LEU A CA  1 
ATOM   3552  C  C   . LEU A  1 463 ? -4.545  -30.234 107.852 1.00 36.66  ? 463  LEU A C   1 
ATOM   3553  O  O   . LEU A  1 463 ? -4.072  -29.256 107.272 1.00 40.26  ? 463  LEU A O   1 
ATOM   3554  C  CB  . LEU A  1 463 ? -3.705  -31.967 106.205 1.00 33.73  ? 463  LEU A CB  1 
ATOM   3555  C  CG  . LEU A  1 463 ? -2.525  -32.931 105.979 1.00 36.70  ? 463  LEU A CG  1 
ATOM   3556  C  CD1 . LEU A  1 463 ? -2.474  -33.435 104.540 1.00 43.89  ? 463  LEU A CD1 1 
ATOM   3557  C  CD2 . LEU A  1 463 ? -1.178  -32.293 106.373 1.00 26.95  ? 463  LEU A CD2 1 
ATOM   3558  N  N   . ASN A  1 464 ? -5.599  -30.163 108.659 1.00 42.81  ? 464  ASN A N   1 
ATOM   3559  C  CA  . ASN A  1 464 ? -6.113  -28.884 109.146 1.00 47.72  ? 464  ASN A CA  1 
ATOM   3560  C  C   . ASN A  1 464 ? -6.645  -27.902 108.086 1.00 43.06  ? 464  ASN A C   1 
ATOM   3561  O  O   . ASN A  1 464 ? -6.624  -26.692 108.300 1.00 43.77  ? 464  ASN A O   1 
ATOM   3562  C  CB  . ASN A  1 464 ? -5.060  -28.188 110.034 1.00 56.44  ? 464  ASN A CB  1 
ATOM   3563  C  CG  . ASN A  1 464 ? -4.759  -28.959 111.326 1.00 68.16  ? 464  ASN A CG  1 
ATOM   3564  O  OD1 . ASN A  1 464 ? -5.648  -29.587 111.918 1.00 75.26  ? 464  ASN A OD1 1 
ATOM   3565  N  ND2 . ASN A  1 464 ? -3.500  -28.903 111.770 1.00 63.49  ? 464  ASN A ND2 1 
ATOM   3566  N  N   . TYR A  1 465 ? -7.126  -28.408 106.952 1.00 40.30  ? 465  TYR A N   1 
ATOM   3567  C  CA  . TYR A  1 465 ? -7.861  -27.555 106.015 1.00 31.64  ? 465  TYR A CA  1 
ATOM   3568  C  C   . TYR A  1 465 ? -9.251  -27.360 106.585 1.00 30.21  ? 465  TYR A C   1 
ATOM   3569  O  O   . TYR A  1 465 ? -9.597  -27.971 107.582 1.00 30.39  ? 465  TYR A O   1 
ATOM   3570  C  CB  . TYR A  1 465 ? -7.949  -28.172 104.611 1.00 27.70  ? 465  TYR A CB  1 
ATOM   3571  C  CG  . TYR A  1 465 ? -6.625  -28.244 103.866 1.00 30.89  ? 465  TYR A CG  1 
ATOM   3572  C  CD1 . TYR A  1 465 ? -5.762  -29.292 104.077 1.00 24.88  ? 465  TYR A CD1 1 
ATOM   3573  C  CD2 . TYR A  1 465 ? -6.251  -27.264 102.955 1.00 34.63  ? 465  TYR A CD2 1 
ATOM   3574  C  CE1 . TYR A  1 465 ? -4.580  -29.374 103.419 1.00 23.86  ? 465  TYR A CE1 1 
ATOM   3575  C  CE2 . TYR A  1 465 ? -5.066  -27.338 102.290 1.00 22.60  ? 465  TYR A CE2 1 
ATOM   3576  C  CZ  . TYR A  1 465 ? -4.223  -28.401 102.532 1.00 33.53  ? 465  TYR A CZ  1 
ATOM   3577  O  OH  . TYR A  1 465 ? -2.996  -28.524 101.899 1.00 39.41  ? 465  TYR A OH  1 
ATOM   3578  N  N   . THR A  1 466 ? -10.042 -26.505 105.949 1.00 35.98  ? 466  THR A N   1 
ATOM   3579  C  CA  . THR A  1 466 ? -11.424 -26.266 106.353 1.00 35.79  ? 466  THR A CA  1 
ATOM   3580  C  C   . THR A  1 466 ? -12.333 -27.226 105.624 1.00 35.81  ? 466  THR A C   1 
ATOM   3581  O  O   . THR A  1 466 ? -11.932 -27.823 104.640 1.00 29.75  ? 466  THR A O   1 
ATOM   3582  C  CB  . THR A  1 466 ? -11.862 -24.867 105.967 1.00 32.02  ? 466  THR A CB  1 
ATOM   3583  O  OG1 . THR A  1 466 ? -11.917 -24.770 104.537 1.00 35.70  ? 466  THR A OG1 1 
ATOM   3584  C  CG2 . THR A  1 466 ? -10.871 -23.862 106.496 1.00 36.32  ? 466  THR A CG2 1 
ATOM   3585  N  N   . THR A  1 467 ? -13.569 -27.358 106.085 1.00 42.09  ? 467  THR A N   1 
ATOM   3586  C  CA  . THR A  1 467 ? -14.519 -28.262 105.439 1.00 44.90  ? 467  THR A CA  1 
ATOM   3587  C  C   . THR A  1 467 ? -14.853 -27.811 104.011 1.00 48.80  ? 467  THR A C   1 
ATOM   3588  O  O   . THR A  1 467 ? -14.964 -28.637 103.080 1.00 47.82  ? 467  THR A O   1 
ATOM   3589  C  CB  . THR A  1 467 ? -15.772 -28.399 106.281 1.00 44.45  ? 467  THR A CB  1 
ATOM   3590  O  OG1 . THR A  1 467 ? -15.524 -29.358 107.312 1.00 48.19  ? 467  THR A OG1 1 
ATOM   3591  C  CG2 . THR A  1 467 ? -16.929 -28.865 105.438 1.00 47.59  ? 467  THR A CG2 1 
ATOM   3592  N  N   . GLU A  1 468 ? -14.993 -26.496 103.857 1.00 50.21  ? 468  GLU A N   1 
ATOM   3593  C  CA  . GLU A  1 468 ? -15.062 -25.853 102.555 1.00 53.96  ? 468  GLU A CA  1 
ATOM   3594  C  C   . GLU A  1 468 ? -13.963 -26.391 101.648 1.00 44.87  ? 468  GLU A C   1 
ATOM   3595  O  O   . GLU A  1 468 ? -14.206 -26.764 100.502 1.00 40.81  ? 468  GLU A O   1 
ATOM   3596  C  CB  . GLU A  1 468 ? -14.857 -24.344 102.709 1.00 69.82  ? 468  GLU A CB  1 
ATOM   3597  C  CG  . GLU A  1 468 ? -15.830 -23.668 103.643 1.00 80.90  ? 468  GLU A CG  1 
ATOM   3598  C  CD  . GLU A  1 468 ? -17.257 -23.772 103.149 1.00 88.58  ? 468  GLU A CD  1 
ATOM   3599  O  OE1 . GLU A  1 468 ? -17.468 -23.704 101.915 1.00 85.62  ? 468  GLU A OE1 1 
ATOM   3600  O  OE2 . GLU A  1 468 ? -18.166 -23.927 103.998 1.00 93.80  ? 468  GLU A OE2 1 
ATOM   3601  N  N   . GLU A  1 469 ? -12.744 -26.428 102.173 1.00 41.52  ? 469  GLU A N   1 
ATOM   3602  C  CA  . GLU A  1 469 ? -11.611 -26.866 101.383 1.00 27.20  ? 469  GLU A CA  1 
ATOM   3603  C  C   . GLU A  1 469 ? -11.648 -28.359 101.066 1.00 43.90  ? 469  GLU A C   1 
ATOM   3604  O  O   . GLU A  1 469 ? -11.162 -28.776 100.026 1.00 46.99  ? 469  GLU A O   1 
ATOM   3605  C  CB  . GLU A  1 469 ? -10.310 -26.471 102.071 1.00 26.65  ? 469  GLU A CB  1 
ATOM   3606  C  CG  . GLU A  1 469 ? -10.073 -24.978 102.036 1.00 41.67  ? 469  GLU A CG  1 
ATOM   3607  C  CD  . GLU A  1 469 ? -8.845  -24.574 102.802 1.00 42.26  ? 469  GLU A CD  1 
ATOM   3608  O  OE1 . GLU A  1 469 ? -8.627  -25.140 103.889 1.00 44.94  ? 469  GLU A OE1 1 
ATOM   3609  O  OE2 . GLU A  1 469 ? -8.093  -23.700 102.319 1.00 40.61  ? 469  GLU A OE2 1 
ATOM   3610  N  N   . ARG A  1 470 ? -12.227 -29.157 101.958 1.00 41.49  ? 470  ARG A N   1 
ATOM   3611  C  CA  . ARG A  1 470 ? -12.367 -30.594 101.728 1.00 43.40  ? 470  ARG A CA  1 
ATOM   3612  C  C   . ARG A  1 470 ? -13.293 -30.799 100.536 1.00 41.96  ? 470  ARG A C   1 
ATOM   3613  O  O   . ARG A  1 470 ? -12.937 -31.448 99.538  1.00 52.88  ? 470  ARG A O   1 
ATOM   3614  C  CB  . ARG A  1 470 ? -12.944 -31.288 102.969 1.00 45.51  ? 470  ARG A CB  1 
ATOM   3615  C  CG  . ARG A  1 470 ? -12.702 -32.797 103.038 1.00 49.27  ? 470  ARG A CG  1 
ATOM   3616  C  CD  . ARG A  1 470 ? -14.008 -33.583 103.107 1.00 61.77  ? 470  ARG A CD  1 
ATOM   3617  N  NE  . ARG A  1 470 ? -14.833 -33.184 104.247 1.00 78.32  ? 470  ARG A NE  1 
ATOM   3618  C  CZ  . ARG A  1 470 ? -16.149 -32.968 104.196 1.00 83.65  ? 470  ARG A CZ  1 
ATOM   3619  N  NH1 . ARG A  1 470 ? -16.814 -33.115 103.055 1.00 80.08  ? 470  ARG A NH1 1 
ATOM   3620  N  NH2 . ARG A  1 470 ? -16.806 -32.606 105.293 1.00 85.89  ? 470  ARG A NH2 1 
ATOM   3621  N  N   . ILE A  1 471 ? -14.480 -30.223 100.645 1.00 32.93  ? 471  ILE A N   1 
ATOM   3622  C  CA  . ILE A  1 471 ? -15.434 -30.235 99.544  1.00 36.53  ? 471  ILE A CA  1 
ATOM   3623  C  C   . ILE A  1 471 ? -14.827 -29.747 98.212  1.00 39.87  ? 471  ILE A C   1 
ATOM   3624  O  O   . ILE A  1 471 ? -14.962 -30.397 97.169  1.00 39.90  ? 471  ILE A O   1 
ATOM   3625  C  CB  . ILE A  1 471 ? -16.648 -29.357 99.887  1.00 35.04  ? 471  ILE A CB  1 
ATOM   3626  C  CG1 . ILE A  1 471 ? -17.435 -29.967 101.045 1.00 32.34  ? 471  ILE A CG1 1 
ATOM   3627  C  CG2 . ILE A  1 471 ? -17.525 -29.174 98.678  1.00 32.52  ? 471  ILE A CG2 1 
ATOM   3628  C  CD1 . ILE A  1 471 ? -18.690 -29.205 101.368 1.00 39.44  ? 471  ILE A CD1 1 
ATOM   3629  N  N   . PHE A  1 472 ? -14.162 -28.598 98.257  1.00 36.33  ? 472  PHE A N   1 
ATOM   3630  C  CA  . PHE A  1 472 ? -13.537 -28.015 97.080  1.00 33.15  ? 472  PHE A CA  1 
ATOM   3631  C  C   . PHE A  1 472 ? -12.539 -29.009 96.470  1.00 33.95  ? 472  PHE A C   1 
ATOM   3632  O  O   . PHE A  1 472 ? -12.519 -29.230 95.250  1.00 39.99  ? 472  PHE A O   1 
ATOM   3633  C  CB  . PHE A  1 472 ? -12.861 -26.706 97.493  1.00 37.06  ? 472  PHE A CB  1 
ATOM   3634  C  CG  . PHE A  1 472 ? -12.118 -26.008 96.390  1.00 36.15  ? 472  PHE A CG  1 
ATOM   3635  C  CD1 . PHE A  1 472 ? -12.686 -25.831 95.150  1.00 37.12  ? 472  PHE A CD1 1 
ATOM   3636  C  CD2 . PHE A  1 472 ? -10.860 -25.483 96.621  1.00 24.13  ? 472  PHE A CD2 1 
ATOM   3637  C  CE1 . PHE A  1 472 ? -11.991 -25.176 94.156  1.00 38.12  ? 472  PHE A CE1 1 
ATOM   3638  C  CE2 . PHE A  1 472 ? -10.175 -24.831 95.634  1.00 23.28  ? 472  PHE A CE2 1 
ATOM   3639  C  CZ  . PHE A  1 472 ? -10.737 -24.678 94.403  1.00 23.35  ? 472  PHE A CZ  1 
ATOM   3640  N  N   . ALA A  1 473 ? -11.739 -29.631 97.331  1.00 30.01  ? 473  ALA A N   1 
ATOM   3641  C  CA  . ALA A  1 473 ? -10.774 -30.640 96.910  1.00 22.71  ? 473  ALA A CA  1 
ATOM   3642  C  C   . ALA A  1 473 ? -11.460 -31.755 96.145  1.00 31.92  ? 473  ALA A C   1 
ATOM   3643  O  O   . ALA A  1 473 ? -11.029 -32.124 95.049  1.00 30.36  ? 473  ALA A O   1 
ATOM   3644  C  CB  . ALA A  1 473 ? -10.036 -31.208 98.107  1.00 22.56  ? 473  ALA A CB  1 
ATOM   3645  N  N   . GLN A  1 474 ? -12.534 -32.286 96.723  1.00 38.20  ? 474  GLN A N   1 
ATOM   3646  C  CA  . GLN A  1 474 ? -13.316 -33.321 96.045  1.00 38.77  ? 474  GLN A CA  1 
ATOM   3647  C  C   . GLN A  1 474 ? -13.862 -32.864 94.690  1.00 36.48  ? 474  GLN A C   1 
ATOM   3648  O  O   . GLN A  1 474 ? -13.897 -33.642 93.724  1.00 32.59  ? 474  GLN A O   1 
ATOM   3649  C  CB  . GLN A  1 474 ? -14.445 -33.800 96.948  1.00 41.96  ? 474  GLN A CB  1 
ATOM   3650  C  CG  . GLN A  1 474 ? -13.935 -34.366 98.251  1.00 47.80  ? 474  GLN A CG  1 
ATOM   3651  C  CD  . GLN A  1 474 ? -15.047 -34.812 99.165  1.00 49.31  ? 474  GLN A CD  1 
ATOM   3652  O  OE1 . GLN A  1 474 ? -15.532 -34.039 99.987  1.00 51.63  ? 474  GLN A OE1 1 
ATOM   3653  N  NE2 . GLN A  1 474 ? -15.457 -36.070 99.030  1.00 47.51  ? 474  GLN A NE2 1 
ATOM   3654  N  N   . ARG A  1 475 ? -14.266 -31.598 94.616  1.00 31.75  ? 475  ARG A N   1 
ATOM   3655  C  CA  . ARG A  1 475 ? -14.769 -31.047 93.363  1.00 34.07  ? 475  ARG A CA  1 
ATOM   3656  C  C   . ARG A  1 475 ? -13.691 -31.066 92.285  1.00 34.77  ? 475  ARG A C   1 
ATOM   3657  O  O   . ARG A  1 475 ? -13.919 -31.553 91.170  1.00 23.68  ? 475  ARG A O   1 
ATOM   3658  C  CB  . ARG A  1 475 ? -15.324 -29.634 93.562  1.00 40.36  ? 475  ARG A CB  1 
ATOM   3659  C  CG  . ARG A  1 475 ? -16.338 -29.217 92.494  1.00 52.25  ? 475  ARG A CG  1 
ATOM   3660  C  CD  . ARG A  1 475 ? -17.203 -28.033 92.941  1.00 61.50  ? 475  ARG A CD  1 
ATOM   3661  N  NE  . ARG A  1 475 ? -16.878 -26.793 92.232  1.00 66.86  ? 475  ARG A NE  1 
ATOM   3662  C  CZ  . ARG A  1 475 ? -16.259 -25.750 92.782  1.00 69.76  ? 475  ARG A CZ  1 
ATOM   3663  N  NH1 . ARG A  1 475 ? -15.893 -25.781 94.059  1.00 72.66  ? 475  ARG A NH1 1 
ATOM   3664  N  NH2 . ARG A  1 475 ? -16.006 -24.669 92.055  1.00 67.84  ? 475  ARG A NH2 1 
ATOM   3665  N  N   . LEU A  1 476 ? -12.510 -30.555 92.630  1.00 33.83  ? 476  LEU A N   1 
ATOM   3666  C  CA  . LEU A  1 476 ? -11.383 -30.571 91.694  1.00 32.52  ? 476  LEU A CA  1 
ATOM   3667  C  C   . LEU A  1 476 ? -11.024 -31.994 91.281  1.00 35.39  ? 476  LEU A C   1 
ATOM   3668  O  O   . LEU A  1 476 ? -10.826 -32.266 90.097  1.00 32.76  ? 476  LEU A O   1 
ATOM   3669  C  CB  . LEU A  1 476 ? -10.154 -29.852 92.266  1.00 27.87  ? 476  LEU A CB  1 
ATOM   3670  C  CG  . LEU A  1 476 ? -10.321 -28.343 92.443  1.00 27.61  ? 476  LEU A CG  1 
ATOM   3671  C  CD1 . LEU A  1 476 ? -9.150  -27.752 93.158  1.00 20.49  ? 476  LEU A CD1 1 
ATOM   3672  C  CD2 . LEU A  1 476 ? -10.526 -27.676 91.113  1.00 27.27  ? 476  LEU A CD2 1 
ATOM   3673  N  N   . MET A  1 477 ? -10.952 -32.899 92.252  1.00 20.80  ? 477  MET A N   1 
ATOM   3674  C  CA  . MET A  1 477 ? -10.638 -34.290 91.942  1.00 24.74  ? 477  MET A CA  1 
ATOM   3675  C  C   . MET A  1 477 ? -11.631 -34.855 90.935  1.00 26.73  ? 477  MET A C   1 
ATOM   3676  O  O   . MET A  1 477 ? -11.230 -35.539 89.995  1.00 27.55  ? 477  MET A O   1 
ATOM   3677  C  CB  . MET A  1 477 ? -10.585 -35.152 93.207  1.00 23.48  ? 477  MET A CB  1 
ATOM   3678  C  CG  . MET A  1 477 ? -9.337  -34.955 94.054  1.00 20.23  ? 477  MET A CG  1 
ATOM   3679  S  SD  . MET A  1 477 ? -9.428  -35.679 95.716  1.00 30.60  ? 477  MET A SD  1 
ATOM   3680  C  CE  . MET A  1 477 ? -9.258  -37.407 95.341  1.00 29.26  ? 477  MET A CE  1 
ATOM   3681  N  N   . LYS A  1 478 ? -12.919 -34.548 91.121  1.00 31.18  ? 478  LYS A N   1 
ATOM   3682  C  CA  . LYS A  1 478 ? -13.949 -34.996 90.175  1.00 30.53  ? 478  LYS A CA  1 
ATOM   3683  C  C   . LYS A  1 478 ? -13.688 -34.414 88.805  1.00 33.07  ? 478  LYS A C   1 
ATOM   3684  O  O   . LYS A  1 478 ? -13.720 -35.136 87.817  1.00 31.43  ? 478  LYS A O   1 
ATOM   3685  C  CB  . LYS A  1 478 ? -15.363 -34.635 90.640  1.00 38.22  ? 478  LYS A CB  1 
ATOM   3686  C  CG  . LYS A  1 478 ? -16.073 -35.741 91.441  1.00 49.16  ? 478  LYS A CG  1 
ATOM   3687  C  CD  . LYS A  1 478 ? -17.061 -36.559 90.597  1.00 57.57  ? 478  LYS A CD  1 
ATOM   3688  C  CE  . LYS A  1 478 ? -17.283 -37.975 91.175  1.00 62.78  ? 478  LYS A CE  1 
ATOM   3689  N  NZ  . LYS A  1 478 ? -17.741 -38.009 92.609  1.00 63.41  ? 478  LYS A NZ  1 
ATOM   3690  N  N   . TYR A  1 479 ? -13.407 -33.114 88.749  1.00 38.53  ? 479  TYR A N   1 
ATOM   3691  C  CA  . TYR A  1 479 ? -13.095 -32.455 87.480  1.00 34.19  ? 479  TYR A CA  1 
ATOM   3692  C  C   . TYR A  1 479 ? -11.984 -33.157 86.728  1.00 26.46  ? 479  TYR A C   1 
ATOM   3693  O  O   . TYR A  1 479 ? -12.171 -33.618 85.588  1.00 21.33  ? 479  TYR A O   1 
ATOM   3694  C  CB  . TYR A  1 479 ? -12.702 -31.007 87.725  1.00 34.66  ? 479  TYR A CB  1 
ATOM   3695  C  CG  . TYR A  1 479 ? -13.880 -30.088 87.969  1.00 42.70  ? 479  TYR A CG  1 
ATOM   3696  C  CD1 . TYR A  1 479 ? -15.072 -30.263 87.290  1.00 38.09  ? 479  TYR A CD1 1 
ATOM   3697  C  CD2 . TYR A  1 479 ? -13.798 -29.046 88.886  1.00 43.17  ? 479  TYR A CD2 1 
ATOM   3698  C  CE1 . TYR A  1 479 ? -16.135 -29.426 87.508  1.00 42.66  ? 479  TYR A CE1 1 
ATOM   3699  C  CE2 . TYR A  1 479 ? -14.865 -28.202 89.106  1.00 39.52  ? 479  TYR A CE2 1 
ATOM   3700  C  CZ  . TYR A  1 479 ? -16.028 -28.392 88.413  1.00 44.78  ? 479  TYR A CZ  1 
ATOM   3701  O  OH  . TYR A  1 479 ? -17.101 -27.550 88.625  1.00 53.76  ? 479  TYR A OH  1 
ATOM   3702  N  N   . TRP A  1 480 ? -10.828 -33.241 87.385  1.00 25.17  ? 480  TRP A N   1 
ATOM   3703  C  CA  . TRP A  1 480 ? -9.633  -33.851 86.799  1.00 27.09  ? 480  TRP A CA  1 
ATOM   3704  C  C   . TRP A  1 480 ? -9.854  -35.296 86.378  1.00 27.79  ? 480  TRP A C   1 
ATOM   3705  O  O   . TRP A  1 480 ? -9.461  -35.673 85.285  1.00 23.84  ? 480  TRP A O   1 
ATOM   3706  C  CB  . TRP A  1 480 ? -8.453  -33.784 87.753  1.00 17.99  ? 480  TRP A CB  1 
ATOM   3707  C  CG  . TRP A  1 480 ? -7.491  -32.674 87.484  1.00 25.10  ? 480  TRP A CG  1 
ATOM   3708  C  CD1 . TRP A  1 480 ? -6.134  -32.785 87.235  1.00 17.32  ? 480  TRP A CD1 1 
ATOM   3709  C  CD2 . TRP A  1 480 ? -7.788  -31.271 87.458  1.00 25.56  ? 480  TRP A CD2 1 
ATOM   3710  N  NE1 . TRP A  1 480 ? -5.589  -31.536 87.050  1.00 16.11  ? 480  TRP A NE1 1 
ATOM   3711  C  CE2 . TRP A  1 480 ? -6.574  -30.592 87.190  1.00 21.16  ? 480  TRP A CE2 1 
ATOM   3712  C  CE3 . TRP A  1 480 ? -8.954  -30.525 87.641  1.00 18.74  ? 480  TRP A CE3 1 
ATOM   3713  C  CZ2 . TRP A  1 480 ? -6.507  -29.205 87.094  1.00 17.07  ? 480  TRP A CZ2 1 
ATOM   3714  C  CZ3 . TRP A  1 480 ? -8.881  -29.144 87.547  1.00 35.19  ? 480  TRP A CZ3 1 
ATOM   3715  C  CH2 . TRP A  1 480 ? -7.666  -28.500 87.268  1.00 18.08  ? 480  TRP A CH2 1 
ATOM   3716  N  N   . THR A  1 481 ? -10.484 -36.110 87.222  1.00 29.04  ? 481  THR A N   1 
ATOM   3717  C  CA  . THR A  1 481 ? -10.664 -37.511 86.844  1.00 29.67  ? 481  THR A CA  1 
ATOM   3718  C  C   . THR A  1 481 ? -11.684 -37.680 85.735  1.00 25.55  ? 481  THR A C   1 
ATOM   3719  O  O   . THR A  1 481 ? -11.591 -38.612 84.939  1.00 25.78  ? 481  THR A O   1 
ATOM   3720  C  CB  . THR A  1 481 ? -11.028 -38.422 88.024  1.00 28.97  ? 481  THR A CB  1 
ATOM   3721  O  OG1 . THR A  1 481 ? -12.262 -37.987 88.601  1.00 32.43  ? 481  THR A OG1 1 
ATOM   3722  C  CG2 . THR A  1 481 ? -9.930  -38.394 89.067  1.00 26.47  ? 481  THR A CG2 1 
ATOM   3723  N  N   . ASN A  1 482 ? -12.658 -36.783 85.686  1.00 26.46  ? 482  ASN A N   1 
ATOM   3724  C  CA  . ASN A  1 482 ? -13.647 -36.823 84.615  1.00 32.97  ? 482  ASN A CA  1 
ATOM   3725  C  C   . ASN A  1 482 ? -12.959 -36.531 83.318  1.00 40.80  ? 482  ASN A C   1 
ATOM   3726  O  O   . ASN A  1 482 ? -13.227 -37.165 82.285  1.00 43.86  ? 482  ASN A O   1 
ATOM   3727  C  CB  . ASN A  1 482 ? -14.738 -35.783 84.822  1.00 26.91  ? 482  ASN A CB  1 
ATOM   3728  C  CG  . ASN A  1 482 ? -15.678 -36.171 85.893  1.00 31.97  ? 482  ASN A CG  1 
ATOM   3729  O  OD1 . ASN A  1 482 ? -15.681 -37.325 86.334  1.00 38.15  ? 482  ASN A OD1 1 
ATOM   3730  N  ND2 . ASN A  1 482 ? -16.494 -35.225 86.333  1.00 34.98  ? 482  ASN A ND2 1 
ATOM   3731  N  N   . PHE A  1 483 ? -12.074 -35.543 83.368  1.00 38.85  ? 483  PHE A N   1 
ATOM   3732  C  CA  . PHE A  1 483 ? -11.346 -35.223 82.174  1.00 32.80  ? 483  PHE A CA  1 
ATOM   3733  C  C   . PHE A  1 483 ? -10.554 -36.439 81.763  1.00 30.21  ? 483  PHE A C   1 
ATOM   3734  O  O   . PHE A  1 483 ? -10.707 -36.939 80.651  1.00 36.34  ? 483  PHE A O   1 
ATOM   3735  C  CB  . PHE A  1 483 ? -10.421 -34.066 82.381  1.00 20.17  ? 483  PHE A CB  1 
ATOM   3736  C  CG  . PHE A  1 483 ? -9.582  -33.806 81.206  1.00 63.15  ? 483  PHE A CG  1 
ATOM   3737  C  CD1 . PHE A  1 483 ? -10.158 -33.330 80.056  1.00 20.65  ? 483  PHE A CD1 1 
ATOM   3738  C  CD2 . PHE A  1 483 ? -8.228  -34.079 81.226  1.00 18.64  ? 483  PHE A CD2 1 
ATOM   3739  C  CE1 . PHE A  1 483 ? -9.415  -33.090 78.956  1.00 26.89  ? 483  PHE A CE1 1 
ATOM   3740  C  CE2 . PHE A  1 483 ? -7.469  -33.843 80.125  1.00 31.57  ? 483  PHE A CE2 1 
ATOM   3741  C  CZ  . PHE A  1 483 ? -8.061  -33.339 78.984  1.00 26.40  ? 483  PHE A CZ  1 
ATOM   3742  N  N   . ALA A  1 484 ? -9.747  -36.925 82.700  1.00 27.90  ? 484  ALA A N   1 
ATOM   3743  C  CA  . ALA A  1 484 ? -8.844  -38.054 82.506  1.00 29.53  ? 484  ALA A CA  1 
ATOM   3744  C  C   . ALA A  1 484 ? -9.542  -39.245 81.869  1.00 36.65  ? 484  ALA A C   1 
ATOM   3745  O  O   . ALA A  1 484 ? -8.956  -39.973 81.038  1.00 19.70  ? 484  ALA A O   1 
ATOM   3746  C  CB  . ALA A  1 484 ? -8.248  -38.452 83.848  1.00 18.25  ? 484  ALA A CB  1 
ATOM   3747  N  N   . ARG A  1 485 ? -10.803 -39.424 82.274  1.00 38.94  ? 485  ARG A N   1 
ATOM   3748  C  CA  . ARG A  1 485 ? -11.606 -40.564 81.881  1.00 21.79  ? 485  ARG A CA  1 
ATOM   3749  C  C   . ARG A  1 485 ? -12.173 -40.349 80.501  1.00 31.18  ? 485  ARG A C   1 
ATOM   3750  O  O   . ARG A  1 485 ? -12.310 -41.305 79.738  1.00 23.31  ? 485  ARG A O   1 
ATOM   3751  C  CB  . ARG A  1 485 ? -12.751 -40.765 82.870  1.00 77.84  ? 485  ARG A CB  1 
ATOM   3752  C  CG  . ARG A  1 485 ? -13.697 -41.964 82.577  1.00 40.08  ? 485  ARG A CG  1 
ATOM   3753  C  CD  . ARG A  1 485 ? -14.941 -42.012 83.512  1.00 70.14  ? 485  ARG A CD  1 
ATOM   3754  N  NE  . ARG A  1 485 ? -14.753 -41.277 84.773  1.00 77.58  ? 485  ARG A NE  1 
ATOM   3755  C  CZ  . ARG A  1 485 ? -14.153 -41.767 85.863  1.00 80.65  ? 485  ARG A CZ  1 
ATOM   3756  N  NH1 . ARG A  1 485 ? -13.669 -43.009 85.868  1.00 81.41  ? 485  ARG A NH1 1 
ATOM   3757  N  NH2 . ARG A  1 485 ? -14.031 -41.009 86.952  1.00 76.70  ? 485  ARG A NH2 1 
ATOM   3758  N  N   . THR A  1 486 ? -12.518 -39.096 80.180  1.00 28.78  ? 486  THR A N   1 
ATOM   3759  C  CA  . THR A  1 486 ? -13.381 -38.821 79.016  1.00 30.13  ? 486  THR A CA  1 
ATOM   3760  C  C   . THR A  1 486 ? -13.158 -37.520 78.245  1.00 30.88  ? 486  THR A C   1 
ATOM   3761  O  O   . THR A  1 486 ? -14.106 -37.046 77.608  1.00 26.32  ? 486  THR A O   1 
ATOM   3762  C  CB  . THR A  1 486 ? -14.842 -38.699 79.442  1.00 25.65  ? 486  THR A CB  1 
ATOM   3763  O  OG1 . THR A  1 486 ? -14.970 -37.551 80.284  1.00 25.38  ? 486  THR A OG1 1 
ATOM   3764  C  CG2 . THR A  1 486 ? -15.292 -39.913 80.184  1.00 25.99  ? 486  THR A CG2 1 
ATOM   3765  N  N   . GLY A  1 487 ? -11.959 -36.931 78.312  1.00 31.20  ? 487  GLY A N   1 
ATOM   3766  C  CA  . GLY A  1 487 ? -11.673 -35.668 77.628  1.00 32.62  ? 487  GLY A CA  1 
ATOM   3767  C  C   . GLY A  1 487 ? -12.619 -34.492 77.888  1.00 35.90  ? 487  GLY A C   1 
ATOM   3768  O  O   . GLY A  1 487 ? -12.683 -33.531 77.113  1.00 35.84  ? 487  GLY A O   1 
ATOM   3769  N  N   . ASP A  1 488 ? -13.357 -34.576 78.987  1.00 34.09  ? 488  ASP A N   1 
ATOM   3770  C  CA  . ASP A  1 488 ? -14.274 -33.544 79.410  1.00 24.97  ? 488  ASP A CA  1 
ATOM   3771  C  C   . ASP A  1 488 ? -14.238 -33.610 80.929  1.00 46.14  ? 488  ASP A C   1 
ATOM   3772  O  O   . ASP A  1 488 ? -14.347 -34.701 81.502  1.00 40.11  ? 488  ASP A O   1 
ATOM   3773  C  CB  . ASP A  1 488 ? -15.683 -33.886 78.897  1.00 38.97  ? 488  ASP A CB  1 
ATOM   3774  C  CG  . ASP A  1 488 ? -16.699 -32.762 79.107  1.00 36.81  ? 488  ASP A CG  1 
ATOM   3775  O  OD1 . ASP A  1 488 ? -16.641 -32.044 80.128  1.00 27.62  ? 488  ASP A OD1 1 
ATOM   3776  O  OD2 . ASP A  1 488 ? -17.577 -32.606 78.234  1.00 32.24  ? 488  ASP A OD2 1 
ATOM   3777  N  N   . PRO A  1 489 ? -14.066 -32.452 81.593  1.00 24.12  ? 489  PRO A N   1 
ATOM   3778  C  CA  . PRO A  1 489 ? -14.187 -32.354 83.057  1.00 35.54  ? 489  PRO A CA  1 
ATOM   3779  C  C   . PRO A  1 489 ? -15.638 -32.307 83.598  1.00 42.38  ? 489  PRO A C   1 
ATOM   3780  O  O   . PRO A  1 489 ? -15.808 -32.428 84.813  1.00 42.10  ? 489  PRO A O   1 
ATOM   3781  C  CB  . PRO A  1 489 ? -13.492 -31.032 83.376  1.00 23.28  ? 489  PRO A CB  1 
ATOM   3782  C  CG  . PRO A  1 489 ? -13.689 -30.212 82.139  1.00 36.53  ? 489  PRO A CG  1 
ATOM   3783  C  CD  . PRO A  1 489 ? -13.634 -31.181 80.987  1.00 23.99  ? 489  PRO A CD  1 
ATOM   3784  N  N   . ASN A  1 490 ? -16.648 -32.133 82.746  1.00 26.86  ? 490  ASN A N   1 
ATOM   3785  C  CA  . ASN A  1 490 ? -18.028 -32.026 83.228  1.00 58.71  ? 490  ASN A CA  1 
ATOM   3786  C  C   . ASN A  1 490 ? -18.576 -33.296 83.850  1.00 64.74  ? 490  ASN A C   1 
ATOM   3787  O  O   . ASN A  1 490 ? -18.050 -34.387 83.628  1.00 68.03  ? 490  ASN A O   1 
ATOM   3788  C  CB  . ASN A  1 490 ? -18.972 -31.583 82.113  1.00 51.44  ? 490  ASN A CB  1 
ATOM   3789  C  CG  . ASN A  1 490 ? -18.985 -30.097 81.933  1.00 43.79  ? 490  ASN A CG  1 
ATOM   3790  O  OD1 . ASN A  1 490 ? -20.006 -29.451 82.154  1.00 46.25  ? 490  ASN A OD1 1 
ATOM   3791  N  ND2 . ASN A  1 490 ? -17.838 -29.531 81.549  1.00 34.40  ? 490  ASN A ND2 1 
ATOM   3792  N  N   . ASP A  1 491 ? -19.643 -33.137 84.625  1.00 68.55  ? 491  ASP A N   1 
ATOM   3793  C  CA  . ASP A  1 491 ? -20.327 -34.267 85.234  1.00 83.78  ? 491  ASP A CA  1 
ATOM   3794  C  C   . ASP A  1 491 ? -21.414 -34.751 84.289  1.00 87.48  ? 491  ASP A C   1 
ATOM   3795  O  O   . ASP A  1 491 ? -22.422 -34.067 84.097  1.00 92.14  ? 491  ASP A O   1 
ATOM   3796  C  CB  . ASP A  1 491 ? -20.934 -33.869 86.583  1.00 96.03  ? 491  ASP A CB  1 
ATOM   3797  C  CG  . ASP A  1 491 ? -19.880 -33.453 87.599  1.00 104.36 ? 491  ASP A CG  1 
ATOM   3798  O  OD1 . ASP A  1 491 ? -19.313 -32.345 87.459  1.00 105.02 ? 491  ASP A OD1 1 
ATOM   3799  O  OD2 . ASP A  1 491 ? -19.612 -34.239 88.536  1.00 108.29 ? 491  ASP A OD2 1 
ATOM   3800  N  N   . PRO A  1 492 ? -21.210 -35.936 83.696  1.00 85.53  ? 492  PRO A N   1 
ATOM   3801  C  CA  . PRO A  1 492 ? -22.120 -36.466 82.678  1.00 87.37  ? 492  PRO A CA  1 
ATOM   3802  C  C   . PRO A  1 492 ? -23.507 -36.601 83.270  1.00 96.32  ? 492  PRO A C   1 
ATOM   3803  O  O   . PRO A  1 492 ? -24.476 -36.065 82.725  1.00 93.38  ? 492  PRO A O   1 
ATOM   3804  C  CB  . PRO A  1 492 ? -21.544 -37.853 82.378  1.00 84.88  ? 492  PRO A CB  1 
ATOM   3805  C  CG  . PRO A  1 492 ? -20.128 -37.810 82.877  1.00 85.85  ? 492  PRO A CG  1 
ATOM   3806  C  CD  . PRO A  1 492 ? -20.166 -36.905 84.063  1.00 84.71  ? 492  PRO A CD  1 
ATOM   3807  N  N   . ARG A  1 493 ? -23.580 -37.299 84.401  1.00 107.31 ? 493  ARG A N   1 
ATOM   3808  C  CA  . ARG A  1 493 ? -24.829 -37.481 85.130  1.00 115.31 ? 493  ARG A CA  1 
ATOM   3809  C  C   . ARG A  1 493 ? -25.211 -36.200 85.864  1.00 126.03 ? 493  ARG A C   1 
ATOM   3810  O  O   . ARG A  1 493 ? -25.394 -36.210 87.083  1.00 128.62 ? 493  ARG A O   1 
ATOM   3811  C  CB  . ARG A  1 493 ? -24.714 -38.642 86.128  1.00 108.35 ? 493  ARG A CB  1 
ATOM   3812  C  CG  . ARG A  1 493 ? -24.870 -40.027 85.515  1.00 104.44 ? 493  ARG A CG  1 
ATOM   3813  C  CD  . ARG A  1 493 ? -24.859 -41.106 86.589  1.00 105.11 ? 493  ARG A CD  1 
ATOM   3814  N  NE  . ARG A  1 493 ? -25.651 -40.730 87.762  1.00 109.39 ? 493  ARG A NE  1 
ATOM   3815  C  CZ  . ARG A  1 493 ? -26.982 -40.782 87.828  1.00 105.79 ? 493  ARG A CZ  1 
ATOM   3816  N  NH1 . ARG A  1 493 ? -27.691 -41.188 86.782  1.00 105.16 ? 493  ARG A NH1 1 
ATOM   3817  N  NH2 . ARG A  1 493 ? -27.607 -40.420 88.943  1.00 99.71  ? 493  ARG A NH2 1 
ATOM   3818  N  N   . ASP A  1 494 ? -25.330 -35.105 85.114  1.00 131.16 ? 494  ASP A N   1 
ATOM   3819  C  CA  . ASP A  1 494 ? -25.689 -33.811 85.683  1.00 133.38 ? 494  ASP A CA  1 
ATOM   3820  C  C   . ASP A  1 494 ? -25.922 -32.747 84.611  1.00 134.95 ? 494  ASP A C   1 
ATOM   3821  O  O   . ASP A  1 494 ? -25.684 -32.966 83.419  1.00 131.77 ? 494  ASP A O   1 
ATOM   3822  C  CB  . ASP A  1 494 ? -24.598 -33.323 86.645  1.00 130.93 ? 494  ASP A CB  1 
ATOM   3823  C  CG  . ASP A  1 494 ? -25.161 -32.543 87.821  1.00 131.08 ? 494  ASP A CG  1 
ATOM   3824  O  OD1 . ASP A  1 494 ? -26.385 -32.284 87.841  1.00 130.96 ? 494  ASP A OD1 1 
ATOM   3825  O  OD2 . ASP A  1 494 ? -24.373 -32.185 88.722  1.00 130.30 ? 494  ASP A OD2 1 
ATOM   3826  N  N   . SER A  1 495 ? -26.406 -31.597 85.066  1.00 138.81 ? 495  SER A N   1 
ATOM   3827  C  CA  . SER A  1 495 ? -26.490 -30.383 84.265  1.00 139.19 ? 495  SER A CA  1 
ATOM   3828  C  C   . SER A  1 495 ? -26.263 -29.199 85.211  1.00 142.59 ? 495  SER A C   1 
ATOM   3829  O  O   . SER A  1 495 ? -26.082 -28.055 84.778  1.00 141.79 ? 495  SER A O   1 
ATOM   3830  C  CB  . SER A  1 495 ? -27.846 -30.281 83.551  1.00 136.21 ? 495  SER A CB  1 
ATOM   3831  O  OG  . SER A  1 495 ? -28.934 -30.296 84.462  1.00 131.99 ? 495  SER A OG  1 
ATOM   3832  N  N   . LYS A  1 496 ? -26.250 -29.500 86.510  1.00 143.18 ? 496  LYS A N   1 
ATOM   3833  C  CA  . LYS A  1 496 ? -26.103 -28.491 87.558  1.00 138.07 ? 496  LYS A CA  1 
ATOM   3834  C  C   . LYS A  1 496 ? -24.665 -28.370 88.083  1.00 135.67 ? 496  LYS A C   1 
ATOM   3835  O  O   . LYS A  1 496 ? -24.256 -29.096 88.994  1.00 131.40 ? 496  LYS A O   1 
ATOM   3836  C  CB  . LYS A  1 496 ? -27.088 -28.768 88.706  1.00 130.02 ? 496  LYS A CB  1 
ATOM   3837  C  CG  . LYS A  1 496 ? -27.171 -27.661 89.752  1.00 122.84 ? 496  LYS A CG  1 
ATOM   3838  C  CD  . LYS A  1 496 ? -27.177 -26.270 89.112  1.00 116.24 ? 496  LYS A CD  1 
ATOM   3839  C  CE  . LYS A  1 496 ? -28.421 -26.022 88.266  1.00 111.55 ? 496  LYS A CE  1 
ATOM   3840  N  NZ  . LYS A  1 496 ? -28.162 -24.994 87.216  1.00 106.03 ? 496  LYS A NZ  1 
ATOM   3841  N  N   . SER A  1 497 ? -23.911 -27.444 87.493  1.00 136.88 ? 497  SER A N   1 
ATOM   3842  C  CA  . SER A  1 497 ? -22.529 -27.175 87.906  1.00 136.97 ? 497  SER A CA  1 
ATOM   3843  C  C   . SER A  1 497 ? -22.135 -25.679 87.971  1.00 131.06 ? 497  SER A C   1 
ATOM   3844  O  O   . SER A  1 497 ? -21.508 -25.261 88.952  1.00 129.29 ? 497  SER A O   1 
ATOM   3845  C  CB  . SER A  1 497 ? -21.513 -28.012 87.100  1.00 139.92 ? 497  SER A CB  1 
ATOM   3846  O  OG  . SER A  1 497 ? -21.992 -28.334 85.802  1.00 142.06 ? 497  SER A OG  1 
ATOM   3847  N  N   . PRO A  1 498 ? -22.465 -24.873 86.930  1.00 123.91 ? 498  PRO A N   1 
ATOM   3848  C  CA  . PRO A  1 498 ? -22.974 -25.184 85.585  1.00 114.95 ? 498  PRO A CA  1 
ATOM   3849  C  C   . PRO A  1 498 ? -21.840 -25.650 84.668  1.00 100.08 ? 498  PRO A C   1 
ATOM   3850  O  O   . PRO A  1 498 ? -20.686 -25.670 85.093  1.00 96.26  ? 498  PRO A O   1 
ATOM   3851  C  CB  . PRO A  1 498 ? -23.543 -23.844 85.106  1.00 116.70 ? 498  PRO A CB  1 
ATOM   3852  C  CG  . PRO A  1 498 ? -22.753 -22.828 85.818  1.00 117.80 ? 498  PRO A CG  1 
ATOM   3853  C  CD  . PRO A  1 498 ? -22.455 -23.416 87.171  1.00 121.70 ? 498  PRO A CD  1 
ATOM   3854  N  N   . GLN A  1 499 ? -22.166 -26.030 83.438  1.00 89.91  ? 499  GLN A N   1 
ATOM   3855  C  CA  . GLN A  1 499 ? -21.174 -26.611 82.540  1.00 78.22  ? 499  GLN A CA  1 
ATOM   3856  C  C   . GLN A  1 499 ? -19.926 -25.747 82.357  1.00 60.86  ? 499  GLN A C   1 
ATOM   3857  O  O   . GLN A  1 499 ? -19.994 -24.521 82.362  1.00 48.07  ? 499  GLN A O   1 
ATOM   3858  C  CB  . GLN A  1 499 ? -21.794 -26.947 81.182  1.00 86.17  ? 499  GLN A CB  1 
ATOM   3859  C  CG  . GLN A  1 499 ? -22.904 -27.979 81.239  1.00 96.58  ? 499  GLN A CG  1 
ATOM   3860  C  CD  . GLN A  1 499 ? -24.263 -27.372 80.936  1.00 114.94 ? 499  GLN A CD  1 
ATOM   3861  O  OE1 . GLN A  1 499 ? -24.357 -26.240 80.451  1.00 119.30 ? 499  GLN A OE1 1 
ATOM   3862  N  NE2 . GLN A  1 499 ? -25.325 -28.120 81.223  1.00 121.88 ? 499  GLN A NE2 1 
ATOM   3863  N  N   . TRP A  1 500 ? -18.790 -26.429 82.228  1.00 61.42  ? 500  TRP A N   1 
ATOM   3864  C  CA  . TRP A  1 500 ? -17.480 -25.841 81.965  1.00 54.18  ? 500  TRP A CA  1 
ATOM   3865  C  C   . TRP A  1 500 ? -17.262 -25.951 80.463  1.00 47.27  ? 500  TRP A C   1 
ATOM   3866  O  O   . TRP A  1 500 ? -17.031 -27.041 79.950  1.00 48.62  ? 500  TRP A O   1 
ATOM   3867  C  CB  . TRP A  1 500 ? -16.430 -26.657 82.715  1.00 27.86  ? 500  TRP A CB  1 
ATOM   3868  C  CG  . TRP A  1 500 ? -15.005 -26.239 82.536  1.00 32.03  ? 500  TRP A CG  1 
ATOM   3869  C  CD1 . TRP A  1 500 ? -14.492 -25.416 81.573  1.00 28.73  ? 500  TRP A CD1 1 
ATOM   3870  C  CD2 . TRP A  1 500 ? -13.895 -26.635 83.353  1.00 29.34  ? 500  TRP A CD2 1 
ATOM   3871  N  NE1 . TRP A  1 500 ? -13.136 -25.274 81.745  1.00 30.05  ? 500  TRP A NE1 1 
ATOM   3872  C  CE2 . TRP A  1 500 ? -12.747 -26.013 82.831  1.00 33.09  ? 500  TRP A CE2 1 
ATOM   3873  C  CE3 . TRP A  1 500 ? -13.763 -27.457 84.477  1.00 27.36  ? 500  TRP A CE3 1 
ATOM   3874  C  CZ2 . TRP A  1 500 ? -11.483 -26.182 83.402  1.00 35.33  ? 500  TRP A CZ2 1 
ATOM   3875  C  CZ3 . TRP A  1 500 ? -12.506 -27.624 85.041  1.00 28.52  ? 500  TRP A CZ3 1 
ATOM   3876  C  CH2 . TRP A  1 500 ? -11.386 -26.993 84.505  1.00 27.64  ? 500  TRP A CH2 1 
ATOM   3877  N  N   . PRO A  1 501 ? -17.357 -24.824 79.747  1.00 40.20  ? 501  PRO A N   1 
ATOM   3878  C  CA  . PRO A  1 501 ? -17.321 -24.817 78.283  1.00 36.16  ? 501  PRO A CA  1 
ATOM   3879  C  C   . PRO A  1 501 ? -15.901 -24.865 77.716  1.00 31.62  ? 501  PRO A C   1 
ATOM   3880  O  O   . PRO A  1 501 ? -14.960 -24.401 78.357  1.00 32.26  ? 501  PRO A O   1 
ATOM   3881  C  CB  . PRO A  1 501 ? -17.982 -23.488 77.938  1.00 40.23  ? 501  PRO A CB  1 
ATOM   3882  C  CG  . PRO A  1 501 ? -17.666 -22.623 79.073  1.00 32.04  ? 501  PRO A CG  1 
ATOM   3883  C  CD  . PRO A  1 501 ? -17.575 -23.479 80.294  1.00 31.14  ? 501  PRO A CD  1 
ATOM   3884  N  N   . PRO A  1 502 ? -15.745 -25.437 76.517  1.00 31.45  ? 502  PRO A N   1 
ATOM   3885  C  CA  . PRO A  1 502 ? -14.436 -25.545 75.865  1.00 31.14  ? 502  PRO A CA  1 
ATOM   3886  C  C   . PRO A  1 502 ? -13.875 -24.182 75.478  1.00 36.32  ? 502  PRO A C   1 
ATOM   3887  O  O   . PRO A  1 502 ? -14.655 -23.319 75.056  1.00 35.31  ? 502  PRO A O   1 
ATOM   3888  C  CB  . PRO A  1 502 ? -14.740 -26.357 74.605  1.00 32.62  ? 502  PRO A CB  1 
ATOM   3889  C  CG  . PRO A  1 502 ? -16.019 -27.074 74.914  1.00 39.53  ? 502  PRO A CG  1 
ATOM   3890  C  CD  . PRO A  1 502 ? -16.801 -26.128 75.762  1.00 37.65  ? 502  PRO A CD  1 
ATOM   3891  N  N   . TYR A  1 503 ? -12.559 -23.994 75.635  1.00 35.07  ? 503  TYR A N   1 
ATOM   3892  C  CA  . TYR A  1 503 ? -11.895 -22.759 75.213  1.00 32.04  ? 503  TYR A CA  1 
ATOM   3893  C  C   . TYR A  1 503 ? -11.825 -22.727 73.693  1.00 31.89  ? 503  TYR A C   1 
ATOM   3894  O  O   . TYR A  1 503 ? -11.444 -23.709 73.065  1.00 33.70  ? 503  TYR A O   1 
ATOM   3895  C  CB  . TYR A  1 503 ? -10.487 -22.628 75.812  1.00 33.28  ? 503  TYR A CB  1 
ATOM   3896  C  CG  . TYR A  1 503 ? -9.774  -21.354 75.401  1.00 38.19  ? 503  TYR A CG  1 
ATOM   3897  C  CD1 . TYR A  1 503 ? -9.995  -20.162 76.083  1.00 42.44  ? 503  TYR A CD1 1 
ATOM   3898  C  CD2 . TYR A  1 503 ? -8.892  -21.337 74.328  1.00 39.00  ? 503  TYR A CD2 1 
ATOM   3899  C  CE1 . TYR A  1 503 ? -9.362  -18.986 75.711  1.00 41.19  ? 503  TYR A CE1 1 
ATOM   3900  C  CE2 . TYR A  1 503 ? -8.258  -20.169 73.945  1.00 42.34  ? 503  TYR A CE2 1 
ATOM   3901  C  CZ  . TYR A  1 503 ? -8.498  -18.994 74.642  1.00 47.11  ? 503  TYR A CZ  1 
ATOM   3902  O  OH  . TYR A  1 503 ? -7.871  -17.822 74.276  1.00 53.75  ? 503  TYR A OH  1 
ATOM   3903  N  N   . THR A  1 504 ? -12.221 -21.604 73.106  1.00 34.37  ? 504  THR A N   1 
ATOM   3904  C  CA  . THR A  1 504 ? -12.286 -21.464 71.658  1.00 29.95  ? 504  THR A CA  1 
ATOM   3905  C  C   . THR A  1 504 ? -11.780 -20.096 71.253  1.00 39.42  ? 504  THR A C   1 
ATOM   3906  O  O   . THR A  1 504 ? -11.837 -19.137 72.025  1.00 34.93  ? 504  THR A O   1 
ATOM   3907  C  CB  . THR A  1 504 ? -13.719 -21.626 71.130  1.00 39.79  ? 504  THR A CB  1 
ATOM   3908  O  OG1 . THR A  1 504 ? -14.570 -20.628 71.709  1.00 39.02  ? 504  THR A OG1 1 
ATOM   3909  C  CG2 . THR A  1 504 ? -14.259 -22.989 71.476  1.00 40.83  ? 504  THR A CG2 1 
ATOM   3910  N  N   . THR A  1 505 ? -11.281 -20.000 70.034  1.00 42.17  ? 505  THR A N   1 
ATOM   3911  C  CA  . THR A  1 505 ? -10.641 -18.769 69.616  1.00 44.88  ? 505  THR A CA  1 
ATOM   3912  C  C   . THR A  1 505 ? -11.719 -17.714 69.489  1.00 44.36  ? 505  THR A C   1 
ATOM   3913  O  O   . THR A  1 505 ? -11.523 -16.560 69.854  1.00 42.09  ? 505  THR A O   1 
ATOM   3914  C  CB  . THR A  1 505 ? -9.843  -18.967 68.319  1.00 48.01  ? 505  THR A CB  1 
ATOM   3915  O  OG1 . THR A  1 505 ? -10.626 -19.730 67.390  1.00 55.05  ? 505  THR A OG1 1 
ATOM   3916  C  CG2 . THR A  1 505 ? -8.530  -19.717 68.621  1.00 33.50  ? 505  THR A CG2 1 
ATOM   3917  N  N   . ALA A  1 506 ? -12.878 -18.150 69.011  1.00 51.70  ? 506  ALA A N   1 
ATOM   3918  C  CA  . ALA A  1 506 ? -14.082 -17.331 68.962  1.00 46.83  ? 506  ALA A CA  1 
ATOM   3919  C  C   . ALA A  1 506 ? -14.407 -16.716 70.322  1.00 47.18  ? 506  ALA A C   1 
ATOM   3920  O  O   . ALA A  1 506 ? -14.233 -15.515 70.537  1.00 43.62  ? 506  ALA A O   1 
ATOM   3921  C  CB  . ALA A  1 506 ? -15.259 -18.183 68.481  1.00 45.93  ? 506  ALA A CB  1 
ATOM   3922  N  N   . ALA A  1 507 ? -14.854 -17.569 71.240  1.00 54.43  ? 507  ALA A N   1 
ATOM   3923  C  CA  . ALA A  1 507 ? -15.474 -17.141 72.493  1.00 55.30  ? 507  ALA A CA  1 
ATOM   3924  C  C   . ALA A  1 507 ? -14.507 -16.962 73.666  1.00 47.51  ? 507  ALA A C   1 
ATOM   3925  O  O   . ALA A  1 507 ? -14.796 -16.198 74.586  1.00 42.41  ? 507  ALA A O   1 
ATOM   3926  C  CB  . ALA A  1 507 ? -16.597 -18.110 72.872  1.00 59.88  ? 507  ALA A CB  1 
ATOM   3927  N  N   . GLN A  1 508 ? -13.386 -17.683 73.637  1.00 49.01  ? 508  GLN A N   1 
ATOM   3928  C  CA  . GLN A  1 508 ? -12.323 -17.531 74.624  1.00 30.01  ? 508  GLN A CA  1 
ATOM   3929  C  C   . GLN A  1 508 ? -12.785 -17.732 76.074  1.00 46.38  ? 508  GLN A C   1 
ATOM   3930  O  O   . GLN A  1 508 ? -12.426 -16.963 76.962  1.00 46.45  ? 508  GLN A O   1 
ATOM   3931  C  CB  . GLN A  1 508 ? -11.664 -16.171 74.453  1.00 30.15  ? 508  GLN A CB  1 
ATOM   3932  C  CG  . GLN A  1 508 ? -11.046 -15.956 73.078  1.00 50.81  ? 508  GLN A CG  1 
ATOM   3933  C  CD  . GLN A  1 508 ? -10.254 -14.647 72.972  1.00 53.51  ? 508  GLN A CD  1 
ATOM   3934  O  OE1 . GLN A  1 508 ? -10.673 -13.709 72.293  1.00 65.50  ? 508  GLN A OE1 1 
ATOM   3935  N  NE2 . GLN A  1 508 ? -9.106  -14.588 73.636  1.00 43.36  ? 508  GLN A NE2 1 
ATOM   3936  N  N   . GLN A  1 509 ? -13.563 -18.783 76.314  1.00 40.57  ? 509  GLN A N   1 
ATOM   3937  C  CA  . GLN A  1 509 ? -14.153 -19.012 77.630  1.00 37.29  ? 509  GLN A CA  1 
ATOM   3938  C  C   . GLN A  1 509 ? -13.342 -19.916 78.548  1.00 33.62  ? 509  GLN A C   1 
ATOM   3939  O  O   . GLN A  1 509 ? -12.896 -20.994 78.153  1.00 37.55  ? 509  GLN A O   1 
ATOM   3940  C  CB  . GLN A  1 509 ? -15.538 -19.618 77.474  1.00 36.35  ? 509  GLN A CB  1 
ATOM   3941  C  CG  . GLN A  1 509 ? -16.348 -19.007 76.382  1.00 38.40  ? 509  GLN A CG  1 
ATOM   3942  C  CD  . GLN A  1 509 ? -17.763 -19.499 76.419  1.00 49.25  ? 509  GLN A CD  1 
ATOM   3943  O  OE1 . GLN A  1 509 ? -18.571 -19.000 77.198  1.00 58.75  ? 509  GLN A OE1 1 
ATOM   3944  N  NE2 . GLN A  1 509 ? -18.076 -20.497 75.593  1.00 50.65  ? 509  GLN A NE2 1 
ATOM   3945  N  N   . TYR A  1 510 ? -13.189 -19.482 79.791  1.00 30.81  ? 510  TYR A N   1 
ATOM   3946  C  CA  . TYR A  1 510 ? -12.528 -20.266 80.827  1.00 33.18  ? 510  TYR A CA  1 
ATOM   3947  C  C   . TYR A  1 510 ? -13.366 -20.160 82.088  1.00 34.96  ? 510  TYR A C   1 
ATOM   3948  O  O   . TYR A  1 510 ? -14.254 -19.333 82.158  1.00 32.39  ? 510  TYR A O   1 
ATOM   3949  C  CB  . TYR A  1 510 ? -11.100 -19.757 81.079  1.00 27.94  ? 510  TYR A CB  1 
ATOM   3950  C  CG  . TYR A  1 510 ? -10.989 -18.322 81.587  1.00 34.56  ? 510  TYR A CG  1 
ATOM   3951  C  CD1 . TYR A  1 510 ? -11.083 -17.237 80.721  1.00 33.58  ? 510  TYR A CD1 1 
ATOM   3952  C  CD2 . TYR A  1 510 ? -10.764 -18.056 82.935  1.00 43.37  ? 510  TYR A CD2 1 
ATOM   3953  C  CE1 . TYR A  1 510 ? -10.975 -15.931 81.185  1.00 33.00  ? 510  TYR A CE1 1 
ATOM   3954  C  CE2 . TYR A  1 510 ? -10.654 -16.750 83.404  1.00 46.00  ? 510  TYR A CE2 1 
ATOM   3955  C  CZ  . TYR A  1 510 ? -10.761 -15.697 82.525  1.00 43.32  ? 510  TYR A CZ  1 
ATOM   3956  O  OH  . TYR A  1 510 ? -10.656 -14.408 83.001  1.00 52.47  ? 510  TYR A OH  1 
ATOM   3957  N  N   . VAL A  1 511 ? -13.090 -20.991 83.083  1.00 36.36  ? 511  VAL A N   1 
ATOM   3958  C  CA  . VAL A  1 511 ? -13.836 -20.921 84.332  1.00 36.55  ? 511  VAL A CA  1 
ATOM   3959  C  C   . VAL A  1 511 ? -12.915 -20.587 85.493  1.00 37.46  ? 511  VAL A C   1 
ATOM   3960  O  O   . VAL A  1 511 ? -11.717 -20.848 85.449  1.00 31.65  ? 511  VAL A O   1 
ATOM   3961  C  CB  . VAL A  1 511 ? -14.490 -22.253 84.663  1.00 39.61  ? 511  VAL A CB  1 
ATOM   3962  C  CG1 . VAL A  1 511 ? -15.608 -22.560 83.692  1.00 28.23  ? 511  VAL A CG1 1 
ATOM   3963  C  CG2 . VAL A  1 511 ? -13.426 -23.350 84.649  1.00 40.02  ? 511  VAL A CG2 1 
ATOM   3964  N  N   . SER A  1 512 ? -13.498 -20.003 86.529  1.00 44.49  ? 512  SER A N   1 
ATOM   3965  C  CA  . SER A  1 512 ? -12.812 -19.757 87.774  1.00 26.21  ? 512  SER A CA  1 
ATOM   3966  C  C   . SER A  1 512 ? -13.091 -20.930 88.662  1.00 71.11  ? 512  SER A C   1 
ATOM   3967  O  O   . SER A  1 512 ? -14.242 -21.270 88.921  1.00 73.20  ? 512  SER A O   1 
ATOM   3968  C  CB  . SER A  1 512 ? -13.389 -18.520 88.435  1.00 52.02  ? 512  SER A CB  1 
ATOM   3969  O  OG  . SER A  1 512 ? -14.801 -18.654 88.575  1.00 51.39  ? 512  SER A OG  1 
ATOM   3970  N  N   . LEU A  1 513 ? -12.029 -21.564 89.110  1.00 24.60  ? 513  LEU A N   1 
ATOM   3971  C  CA  . LEU A  1 513 ? -12.116 -22.590 90.129  1.00 36.20  ? 513  LEU A CA  1 
ATOM   3972  C  C   . LEU A  1 513 ? -11.806 -21.951 91.470  1.00 32.07  ? 513  LEU A C   1 
ATOM   3973  O  O   . LEU A  1 513 ? -10.658 -21.608 91.765  1.00 39.53  ? 513  LEU A O   1 
ATOM   3974  C  CB  . LEU A  1 513 ? -11.111 -23.716 89.874  1.00 22.85  ? 513  LEU A CB  1 
ATOM   3975  C  CG  . LEU A  1 513 ? -11.279 -24.491 88.576  1.00 32.81  ? 513  LEU A CG  1 
ATOM   3976  C  CD1 . LEU A  1 513 ? -10.097 -25.444 88.358  1.00 21.05  ? 513  LEU A CD1 1 
ATOM   3977  C  CD2 . LEU A  1 513 ? -12.610 -25.215 88.594  1.00 23.62  ? 513  LEU A CD2 1 
ATOM   3978  N  N   . ASN A  1 514 ? -12.838 -21.786 92.279  1.00 29.65  ? 514  ASN A N   1 
ATOM   3979  C  CA  . ASN A  1 514 ? -12.668 -21.314 93.632  1.00 35.04  ? 514  ASN A CA  1 
ATOM   3980  C  C   . ASN A  1 514 ? -13.735 -21.987 94.498  1.00 40.13  ? 514  ASN A C   1 
ATOM   3981  O  O   . ASN A  1 514 ? -14.307 -23.008 94.090  1.00 35.56  ? 514  ASN A O   1 
ATOM   3982  C  CB  . ASN A  1 514 ? -12.750 -19.787 93.673  1.00 40.55  ? 514  ASN A CB  1 
ATOM   3983  C  CG  . ASN A  1 514 ? -14.095 -19.251 93.191  1.00 40.45  ? 514  ASN A CG  1 
ATOM   3984  O  OD1 . ASN A  1 514 ? -15.146 -19.817 93.489  1.00 41.09  ? 514  ASN A OD1 1 
ATOM   3985  N  ND2 . ASN A  1 514 ? -14.062 -18.155 92.439  1.00 37.41  ? 514  ASN A ND2 1 
ATOM   3986  N  N   . LEU A  1 515 ? -14.015 -21.421 95.671  1.00 41.76  ? 515  LEU A N   1 
ATOM   3987  C  CA  . LEU A  1 515 ? -14.995 -22.026 96.569  1.00 40.02  ? 515  LEU A CA  1 
ATOM   3988  C  C   . LEU A  1 515 ? -16.409 -21.861 96.037  1.00 37.81  ? 515  LEU A C   1 
ATOM   3989  O  O   . LEU A  1 515 ? -17.226 -22.758 96.192  1.00 40.41  ? 515  LEU A O   1 
ATOM   3990  C  CB  . LEU A  1 515 ? -14.881 -21.495 98.001  1.00 38.62  ? 515  LEU A CB  1 
ATOM   3991  C  CG  . LEU A  1 515 ? -13.566 -21.802 98.722  1.00 29.65  ? 515  LEU A CG  1 
ATOM   3992  C  CD1 . LEU A  1 515 ? -13.685 -21.587 100.228 1.00 35.45  ? 515  LEU A CD1 1 
ATOM   3993  C  CD2 . LEU A  1 515 ? -13.094 -23.213 98.415  1.00 45.54  ? 515  LEU A CD2 1 
ATOM   3994  N  N   . LYS A  1 516 ? -16.685 -20.725 95.400  1.00 39.77  ? 516  LYS A N   1 
ATOM   3995  C  CA  . LYS A  1 516 ? -17.990 -20.486 94.784  1.00 42.08  ? 516  LYS A CA  1 
ATOM   3996  C  C   . LYS A  1 516 ? -18.142 -21.436 93.599  1.00 49.38  ? 516  LYS A C   1 
ATOM   3997  O  O   . LYS A  1 516 ? -17.137 -21.918 93.060  1.00 31.27  ? 516  LYS A O   1 
ATOM   3998  C  CB  . LYS A  1 516 ? -18.137 -19.026 94.313  1.00 38.98  ? 516  LYS A CB  1 
ATOM   3999  C  CG  . LYS A  1 516 ? -17.852 -17.960 95.359  1.00 46.15  ? 516  LYS A CG  1 
ATOM   4000  C  CD  . LYS A  1 516 ? -17.669 -16.593 94.682  1.00 59.42  ? 516  LYS A CD  1 
ATOM   4001  C  CE  . LYS A  1 516 ? -16.857 -15.588 95.536  1.00 71.38  ? 516  LYS A CE  1 
ATOM   4002  N  NZ  . LYS A  1 516 ? -15.358 -15.740 95.467  1.00 69.49  ? 516  LYS A NZ  1 
ATOM   4003  N  N   . PRO A  1 517 ? -19.404 -21.720 93.200  1.00 54.01  ? 517  PRO A N   1 
ATOM   4004  C  CA  . PRO A  1 517 ? -19.714 -22.559 92.035  1.00 46.94  ? 517  PRO A CA  1 
ATOM   4005  C  C   . PRO A  1 517 ? -19.026 -22.045 90.773  1.00 44.46  ? 517  PRO A C   1 
ATOM   4006  O  O   . PRO A  1 517 ? -18.573 -20.897 90.779  1.00 45.67  ? 517  PRO A O   1 
ATOM   4007  C  CB  . PRO A  1 517 ? -21.233 -22.411 91.903  1.00 41.21  ? 517  PRO A CB  1 
ATOM   4008  C  CG  . PRO A  1 517 ? -21.587 -21.216 92.731  1.00 44.11  ? 517  PRO A CG  1 
ATOM   4009  C  CD  . PRO A  1 517 ? -20.638 -21.261 93.857  1.00 36.73  ? 517  PRO A CD  1 
ATOM   4010  N  N   . LEU A  1 518 ? -18.941 -22.861 89.722  1.00 41.23  ? 518  LEU A N   1 
ATOM   4011  C  CA  . LEU A  1 518 ? -18.284 -22.419 88.484  1.00 37.60  ? 518  LEU A CA  1 
ATOM   4012  C  C   . LEU A  1 518 ? -18.859 -21.105 87.965  1.00 44.93  ? 518  LEU A C   1 
ATOM   4013  O  O   . LEU A  1 518 ? -20.062 -20.845 88.050  1.00 51.33  ? 518  LEU A O   1 
ATOM   4014  C  CB  . LEU A  1 518 ? -18.314 -23.495 87.382  1.00 36.54  ? 518  LEU A CB  1 
ATOM   4015  C  CG  . LEU A  1 518 ? -17.237 -24.588 87.419  1.00 40.30  ? 518  LEU A CG  1 
ATOM   4016  C  CD1 . LEU A  1 518 ? -17.156 -25.360 86.118  1.00 28.81  ? 518  LEU A CD1 1 
ATOM   4017  C  CD2 . LEU A  1 518 ? -15.906 -23.953 87.741  1.00 43.05  ? 518  LEU A CD2 1 
ATOM   4018  N  N   . GLU A  1 519 ? -17.973 -20.263 87.462  1.00 54.21  ? 519  GLU A N   1 
ATOM   4019  C  CA  . GLU A  1 519 ? -18.351 -18.992 86.873  1.00 64.61  ? 519  GLU A CA  1 
ATOM   4020  C  C   . GLU A  1 519 ? -17.540 -18.922 85.584  1.00 60.47  ? 519  GLU A C   1 
ATOM   4021  O  O   . GLU A  1 519 ? -16.335 -19.205 85.596  1.00 56.85  ? 519  GLU A O   1 
ATOM   4022  C  CB  . GLU A  1 519 ? -17.993 -17.860 87.845  1.00 75.58  ? 519  GLU A CB  1 
ATOM   4023  C  CG  . GLU A  1 519 ? -18.126 -16.423 87.337  1.00 81.26  ? 519  GLU A CG  1 
ATOM   4024  C  CD  . GLU A  1 519 ? -17.278 -15.451 88.171  1.00 80.88  ? 519  GLU A CD  1 
ATOM   4025  O  OE1 . GLU A  1 519 ? -17.066 -15.730 89.378  1.00 78.55  ? 519  GLU A OE1 1 
ATOM   4026  O  OE2 . GLU A  1 519 ? -16.803 -14.429 87.620  1.00 78.01  ? 519  GLU A OE2 1 
ATOM   4027  N  N   . VAL A  1 520 ? -18.194 -18.609 84.466  1.00 59.15  ? 520  VAL A N   1 
ATOM   4028  C  CA  . VAL A  1 520 ? -17.482 -18.535 83.194  1.00 32.81  ? 520  VAL A CA  1 
ATOM   4029  C  C   . VAL A  1 520 ? -17.086 -17.130 82.811  1.00 45.94  ? 520  VAL A C   1 
ATOM   4030  O  O   . VAL A  1 520 ? -17.899 -16.209 82.799  1.00 49.23  ? 520  VAL A O   1 
ATOM   4031  C  CB  . VAL A  1 520 ? -18.245 -19.150 82.044  1.00 35.24  ? 520  VAL A CB  1 
ATOM   4032  C  CG1 . VAL A  1 520 ? -17.698 -18.639 80.704  1.00 33.58  ? 520  VAL A CG1 1 
ATOM   4033  C  CG2 . VAL A  1 520 ? -18.119 -20.624 82.127  1.00 32.72  ? 520  VAL A CG2 1 
ATOM   4034  N  N   . ARG A  1 521 ? -15.807 -16.997 82.496  1.00 41.08  ? 521  ARG A N   1 
ATOM   4035  C  CA  . ARG A  1 521 ? -15.209 -15.748 82.134  1.00 40.39  ? 521  ARG A CA  1 
ATOM   4036  C  C   . ARG A  1 521 ? -14.711 -15.875 80.712  1.00 40.80  ? 521  ARG A C   1 
ATOM   4037  O  O   . ARG A  1 521 ? -14.370 -16.960 80.259  1.00 30.38  ? 521  ARG A O   1 
ATOM   4038  C  CB  . ARG A  1 521 ? -14.070 -15.454 83.098  1.00 35.01  ? 521  ARG A CB  1 
ATOM   4039  C  CG  . ARG A  1 521 ? -14.519 -15.451 84.549  1.00 34.02  ? 521  ARG A CG  1 
ATOM   4040  C  CD  . ARG A  1 521 ? -13.432 -14.900 85.423  1.00 41.50  ? 521  ARG A CD  1 
ATOM   4041  N  NE  . ARG A  1 521 ? -13.746 -14.983 86.845  1.00 48.73  ? 521  ARG A NE  1 
ATOM   4042  C  CZ  . ARG A  1 521 ? -12.813 -14.960 87.788  1.00 55.60  ? 521  ARG A CZ  1 
ATOM   4043  N  NH1 . ARG A  1 521 ? -11.533 -14.869 87.436  1.00 59.83  ? 521  ARG A NH1 1 
ATOM   4044  N  NH2 . ARG A  1 521 ? -13.149 -15.042 89.068  1.00 54.76  ? 521  ARG A NH2 1 
ATOM   4045  N  N   . ARG A  1 522 ? -14.714 -14.757 80.005  1.00 42.26  ? 522  ARG A N   1 
ATOM   4046  C  CA  . ARG A  1 522 ? -14.250 -14.723 78.639  1.00 48.49  ? 522  ARG A CA  1 
ATOM   4047  C  C   . ARG A  1 522 ? -12.975 -13.867 78.592  1.00 52.58  ? 522  ARG A C   1 
ATOM   4048  O  O   . ARG A  1 522 ? -12.798 -12.946 79.399  1.00 55.47  ? 522  ARG A O   1 
ATOM   4049  C  CB  . ARG A  1 522 ? -15.357 -14.175 77.737  1.00 56.30  ? 522  ARG A CB  1 
ATOM   4050  C  CG  . ARG A  1 522 ? -16.737 -14.812 77.999  1.00 68.07  ? 522  ARG A CG  1 
ATOM   4051  C  CD  . ARG A  1 522 ? -17.789 -14.390 76.969  1.00 78.39  ? 522  ARG A CD  1 
ATOM   4052  N  NE  . ARG A  1 522 ? -17.278 -14.488 75.598  1.00 88.26  ? 522  ARG A NE  1 
ATOM   4053  C  CZ  . ARG A  1 522 ? -17.171 -13.461 74.752  1.00 91.33  ? 522  ARG A CZ  1 
ATOM   4054  N  NH1 . ARG A  1 522 ? -17.562 -12.247 75.124  1.00 94.00  ? 522  ARG A NH1 1 
ATOM   4055  N  NH2 . ARG A  1 522 ? -16.681 -13.648 73.528  1.00 87.47  ? 522  ARG A NH2 1 
ATOM   4056  N  N   . GLY A  1 523 ? -12.071 -14.198 77.677  1.00 45.05  ? 523  GLY A N   1 
ATOM   4057  C  CA  . GLY A  1 523 ? -10.822 -13.476 77.565  1.00 43.89  ? 523  GLY A CA  1 
ATOM   4058  C  C   . GLY A  1 523 ? -9.838  -13.760 78.685  1.00 43.88  ? 523  GLY A C   1 
ATOM   4059  O  O   . GLY A  1 523 ? -10.003 -13.287 79.810  1.00 53.50  ? 523  GLY A O   1 
ATOM   4060  N  N   . LEU A  1 524 ? -8.805  -14.530 78.370  1.00 30.51  ? 524  LEU A N   1 
ATOM   4061  C  CA  . LEU A  1 524 ? -7.753  -14.834 79.328  1.00 32.67  ? 524  LEU A CA  1 
ATOM   4062  C  C   . LEU A  1 524 ? -6.615  -13.803 79.210  1.00 38.12  ? 524  LEU A C   1 
ATOM   4063  O  O   . LEU A  1 524 ? -5.708  -13.967 78.380  1.00 37.59  ? 524  LEU A O   1 
ATOM   4064  C  CB  . LEU A  1 524 ? -7.235  -16.251 79.059  1.00 34.21  ? 524  LEU A CB  1 
ATOM   4065  C  CG  . LEU A  1 524 ? -6.447  -17.061 80.095  1.00 31.19  ? 524  LEU A CG  1 
ATOM   4066  C  CD1 . LEU A  1 524 ? -7.146  -17.066 81.441  1.00 24.64  ? 524  LEU A CD1 1 
ATOM   4067  C  CD2 . LEU A  1 524 ? -6.298  -18.487 79.580  1.00 21.62  ? 524  LEU A CD2 1 
ATOM   4068  N  N   . ARG A  1 525 ? -6.664  -12.757 80.040  1.00 36.82  ? 525  ARG A N   1 
ATOM   4069  C  CA  . ARG A  1 525 ? -5.737  -11.615 79.945  1.00 39.36  ? 525  ARG A CA  1 
ATOM   4070  C  C   . ARG A  1 525 ? -5.527  -11.207 78.485  1.00 42.96  ? 525  ARG A C   1 
ATOM   4071  O  O   . ARG A  1 525 ? -4.398  -11.091 78.014  1.00 40.64  ? 525  ARG A O   1 
ATOM   4072  C  CB  . ARG A  1 525 ? -4.386  -11.899 80.625  1.00 38.39  ? 525  ARG A CB  1 
ATOM   4073  C  CG  . ARG A  1 525 ? -4.445  -12.178 82.148  1.00 53.45  ? 525  ARG A CG  1 
ATOM   4074  C  CD  . ARG A  1 525 ? -4.636  -10.934 83.014  1.00 63.82  ? 525  ARG A CD  1 
ATOM   4075  N  NE  . ARG A  1 525 ? -3.527  -9.988  82.879  1.00 77.12  ? 525  ARG A NE  1 
ATOM   4076  C  CZ  . ARG A  1 525 ? -3.621  -8.678  83.118  1.00 84.56  ? 525  ARG A CZ  1 
ATOM   4077  N  NH1 . ARG A  1 525 ? -4.779  -8.150  83.511  1.00 90.52  ? 525  ARG A NH1 1 
ATOM   4078  N  NH2 . ARG A  1 525 ? -2.558  -7.891  82.962  1.00 77.93  ? 525  ARG A NH2 1 
ATOM   4079  N  N   . ALA A  1 526 ? -6.635  -10.990 77.783  1.00 43.72  ? 526  ALA A N   1 
ATOM   4080  C  CA  . ALA A  1 526 ? -6.630  -10.860 76.329  1.00 42.06  ? 526  ALA A CA  1 
ATOM   4081  C  C   . ALA A  1 526 ? -5.724  -9.762  75.807  1.00 42.34  ? 526  ALA A C   1 
ATOM   4082  O  O   . ALA A  1 526 ? -4.860  -10.014 74.964  1.00 46.60  ? 526  ALA A O   1 
ATOM   4083  C  CB  . ALA A  1 526 ? -8.044  -10.662 75.810  1.00 41.70  ? 526  ALA A CB  1 
ATOM   4084  N  N   . GLN A  1 527 ? -5.927  -8.547  76.298  1.00 40.06  ? 527  GLN A N   1 
ATOM   4085  C  CA  . GLN A  1 527 ? -5.181  -7.403  75.798  1.00 40.53  ? 527  GLN A CA  1 
ATOM   4086  C  C   . GLN A  1 527 ? -3.699  -7.499  76.194  1.00 41.15  ? 527  GLN A C   1 
ATOM   4087  O  O   . GLN A  1 527 ? -2.798  -7.436  75.339  1.00 42.67  ? 527  GLN A O   1 
ATOM   4088  C  CB  . GLN A  1 527 ? -5.832  -6.108  76.286  1.00 36.69  ? 527  GLN A CB  1 
ATOM   4089  C  CG  . GLN A  1 527 ? -7.372  -6.134  76.195  1.00 42.07  ? 527  GLN A CG  1 
ATOM   4090  C  CD  . GLN A  1 527 ? -7.936  -5.812  74.795  1.00 50.69  ? 527  GLN A CD  1 
ATOM   4091  O  OE1 . GLN A  1 527 ? -8.819  -6.521  74.282  1.00 45.68  ? 527  GLN A OE1 1 
ATOM   4092  N  NE2 . GLN A  1 527 ? -7.448  -4.723  74.192  1.00 53.32  ? 527  GLN A NE2 1 
ATOM   4093  N  N   . THR A  1 528 ? -3.449  -7.686  77.485  1.00 37.57  ? 528  THR A N   1 
ATOM   4094  C  CA  . THR A  1 528 ? -2.087  -7.834  77.975  1.00 35.86  ? 528  THR A CA  1 
ATOM   4095  C  C   . THR A  1 528 ? -1.352  -8.936  77.211  1.00 41.90  ? 528  THR A C   1 
ATOM   4096  O  O   . THR A  1 528 ? -0.188  -8.779  76.827  1.00 43.27  ? 528  THR A O   1 
ATOM   4097  C  CB  . THR A  1 528 ? -2.063  -8.105  79.498  1.00 31.09  ? 528  THR A CB  1 
ATOM   4098  O  OG1 . THR A  1 528 ? -2.317  -6.882  80.193  1.00 35.20  ? 528  THR A OG1 1 
ATOM   4099  C  CG2 . THR A  1 528 ? -0.704  -8.639  79.942  1.00 27.30  ? 528  THR A CG2 1 
ATOM   4100  N  N   . CYS A  1 529 ? -2.042  -10.042 76.959  1.00 43.04  ? 529  CYS A N   1 
ATOM   4101  C  CA  . CYS A  1 529 ? -1.424  -11.143 76.232  1.00 39.86  ? 529  CYS A CA  1 
ATOM   4102  C  C   . CYS A  1 529 ? -1.244  -10.848 74.749  1.00 39.67  ? 529  CYS A C   1 
ATOM   4103  O  O   . CYS A  1 529 ? -0.390  -11.450 74.104  1.00 39.19  ? 529  CYS A O   1 
ATOM   4104  C  CB  . CYS A  1 529 ? -2.184  -12.450 76.444  1.00 37.15  ? 529  CYS A CB  1 
ATOM   4105  S  SG  . CYS A  1 529 ? -1.872  -13.147 78.072  1.00 35.57  ? 529  CYS A SG  1 
ATOM   4106  N  N   . ALA A  1 530 ? -2.042  -9.933  74.203  1.00 36.32  ? 530  ALA A N   1 
ATOM   4107  C  CA  . ALA A  1 530 ? -1.811  -9.504  72.830  1.00 35.04  ? 530  ALA A CA  1 
ATOM   4108  C  C   . ALA A  1 530 ? -0.507  -8.743  72.815  1.00 39.33  ? 530  ALA A C   1 
ATOM   4109  O  O   . ALA A  1 530 ? 0.288   -8.879  71.889  1.00 38.02  ? 530  ALA A O   1 
ATOM   4110  C  CB  . ALA A  1 530 ? -2.934  -8.637  72.327  1.00 37.14  ? 530  ALA A CB  1 
ATOM   4111  N  N   . PHE A  1 531 ? -0.294  -7.950  73.863  1.00 41.75  ? 531  PHE A N   1 
ATOM   4112  C  CA  . PHE A  1 531 ? 0.966   -7.232  74.046  1.00 36.37  ? 531  PHE A CA  1 
ATOM   4113  C  C   . PHE A  1 531 ? 2.141   -8.189  74.103  1.00 41.00  ? 531  PHE A C   1 
ATOM   4114  O  O   . PHE A  1 531 ? 3.125   -8.019  73.382  1.00 48.87  ? 531  PHE A O   1 
ATOM   4115  C  CB  . PHE A  1 531 ? 0.904   -6.418  75.331  1.00 36.78  ? 531  PHE A CB  1 
ATOM   4116  C  CG  . PHE A  1 531 ? 2.206   -5.781  75.732  1.00 41.87  ? 531  PHE A CG  1 
ATOM   4117  C  CD1 . PHE A  1 531 ? 2.620   -4.589  75.154  1.00 47.48  ? 531  PHE A CD1 1 
ATOM   4118  C  CD2 . PHE A  1 531 ? 2.986   -6.342  76.732  1.00 39.54  ? 531  PHE A CD2 1 
ATOM   4119  C  CE1 . PHE A  1 531 ? 3.796   -3.989  75.548  1.00 49.29  ? 531  PHE A CE1 1 
ATOM   4120  C  CE2 . PHE A  1 531 ? 4.166   -5.755  77.128  1.00 38.87  ? 531  PHE A CE2 1 
ATOM   4121  C  CZ  . PHE A  1 531 ? 4.565   -4.569  76.550  1.00 47.13  ? 531  PHE A CZ  1 
ATOM   4122  N  N   . TRP A  1 532 ? 2.029   -9.196  74.965  1.00 42.02  ? 532  TRP A N   1 
ATOM   4123  C  CA  . TRP A  1 532 ? 3.125   -10.137 75.199  1.00 36.61  ? 532  TRP A CA  1 
ATOM   4124  C  C   . TRP A  1 532 ? 3.430   -11.032 74.007  1.00 35.34  ? 532  TRP A C   1 
ATOM   4125  O  O   . TRP A  1 532 ? 4.598   -11.346 73.741  1.00 30.68  ? 532  TRP A O   1 
ATOM   4126  C  CB  . TRP A  1 532 ? 2.841   -11.005 76.427  1.00 32.82  ? 532  TRP A CB  1 
ATOM   4127  C  CG  . TRP A  1 532 ? 3.152   -10.314 77.690  1.00 21.58  ? 532  TRP A CG  1 
ATOM   4128  C  CD1 . TRP A  1 532 ? 2.267   -9.860  78.608  1.00 37.43  ? 532  TRP A CD1 1 
ATOM   4129  C  CD2 . TRP A  1 532 ? 4.451   -9.967  78.174  1.00 38.39  ? 532  TRP A CD2 1 
ATOM   4130  N  NE1 . TRP A  1 532 ? 2.928   -9.259  79.645  1.00 21.86  ? 532  TRP A NE1 1 
ATOM   4131  C  CE2 . TRP A  1 532 ? 4.274   -9.308  79.401  1.00 34.59  ? 532  TRP A CE2 1 
ATOM   4132  C  CE3 . TRP A  1 532 ? 5.748   -10.156 77.691  1.00 20.90  ? 532  TRP A CE3 1 
ATOM   4133  C  CZ2 . TRP A  1 532 ? 5.344   -8.836  80.154  1.00 34.70  ? 532  TRP A CZ2 1 
ATOM   4134  C  CZ3 . TRP A  1 532 ? 6.806   -9.682  78.439  1.00 29.49  ? 532  TRP A CZ3 1 
ATOM   4135  C  CH2 . TRP A  1 532 ? 6.599   -9.038  79.658  1.00 20.95  ? 532  TRP A CH2 1 
ATOM   4136  N  N   . ASN A  1 533 ? 2.381   -11.430 73.293  1.00 33.83  ? 533  ASN A N   1 
ATOM   4137  C  CA  . ASN A  1 533 ? 2.495   -12.478 72.292  1.00 22.98  ? 533  ASN A CA  1 
ATOM   4138  C  C   . ASN A  1 533 ? 2.518   -12.013 70.847  1.00 30.14  ? 533  ASN A C   1 
ATOM   4139  O  O   . ASN A  1 533 ? 2.990   -12.733 69.976  1.00 30.31  ? 533  ASN A O   1 
ATOM   4140  C  CB  . ASN A  1 533 ? 1.378   -13.501 72.480  1.00 22.74  ? 533  ASN A CB  1 
ATOM   4141  C  CG  . ASN A  1 533 ? 1.527   -14.283 73.758  1.00 31.96  ? 533  ASN A CG  1 
ATOM   4142  O  OD1 . ASN A  1 533 ? 2.600   -14.297 74.364  1.00 35.30  ? 533  ASN A OD1 1 
ATOM   4143  N  ND2 . ASN A  1 533 ? 0.460   -14.953 74.172  1.00 25.41  ? 533  ASN A ND2 1 
ATOM   4144  N  N   . ARG A  1 534 ? 1.997   -10.822 70.586  1.00 35.92  ? 534  ARG A N   1 
ATOM   4145  C  CA  . ARG A  1 534 ? 1.916   -10.328 69.216  1.00 39.49  ? 534  ARG A CA  1 
ATOM   4146  C  C   . ARG A  1 534 ? 2.888   -9.179  68.946  1.00 42.34  ? 534  ARG A C   1 
ATOM   4147  O  O   . ARG A  1 534 ? 3.509   -9.128  67.885  1.00 49.69  ? 534  ARG A O   1 
ATOM   4148  C  CB  . ARG A  1 534 ? 0.486   -9.887  68.882  1.00 40.63  ? 534  ARG A CB  1 
ATOM   4149  C  CG  . ARG A  1 534 ? -0.494  -11.009 68.684  1.00 41.04  ? 534  ARG A CG  1 
ATOM   4150  C  CD  . ARG A  1 534 ? -1.898  -10.456 68.597  1.00 57.26  ? 534  ARG A CD  1 
ATOM   4151  N  NE  . ARG A  1 534 ? -2.906  -11.507 68.720  1.00 68.04  ? 534  ARG A NE  1 
ATOM   4152  C  CZ  . ARG A  1 534 ? -3.561  -12.032 67.691  1.00 71.35  ? 534  ARG A CZ  1 
ATOM   4153  N  NH1 . ARG A  1 534 ? -3.319  -11.589 66.457  1.00 70.17  ? 534  ARG A NH1 1 
ATOM   4154  N  NH2 . ARG A  1 534 ? -4.458  -12.994 67.901  1.00 68.46  ? 534  ARG A NH2 1 
ATOM   4155  N  N   . PHE A  1 535 ? 3.012   -8.260  69.900  1.00 36.54  ? 535  PHE A N   1 
ATOM   4156  C  CA  . PHE A  1 535 ? 3.827   -7.069  69.705  1.00 35.76  ? 535  PHE A CA  1 
ATOM   4157  C  C   . PHE A  1 535 ? 5.267   -7.266  70.180  1.00 34.05  ? 535  PHE A C   1 
ATOM   4158  O  O   . PHE A  1 535 ? 6.226   -7.108  69.398  1.00 27.28  ? 535  PHE A O   1 
ATOM   4159  C  CB  . PHE A  1 535 ? 3.193   -5.865  70.405  1.00 28.56  ? 535  PHE A CB  1 
ATOM   4160  C  CG  . PHE A  1 535 ? 3.971   -4.591  70.232  1.00 40.65  ? 535  PHE A CG  1 
ATOM   4161  C  CD1 . PHE A  1 535 ? 3.807   -3.815  69.095  1.00 37.58  ? 535  PHE A CD1 1 
ATOM   4162  C  CD2 . PHE A  1 535 ? 4.880   -4.176  71.204  1.00 41.80  ? 535  PHE A CD2 1 
ATOM   4163  C  CE1 . PHE A  1 535 ? 4.526   -2.650  68.931  1.00 41.58  ? 535  PHE A CE1 1 
ATOM   4164  C  CE2 . PHE A  1 535 ? 5.615   -3.008  71.050  1.00 38.56  ? 535  PHE A CE2 1 
ATOM   4165  C  CZ  . PHE A  1 535 ? 5.438   -2.246  69.915  1.00 44.92  ? 535  PHE A CZ  1 
ATOM   4166  N  N   . LEU A  1 536 ? 5.413   -7.603  71.459  1.00 29.02  ? 536  LEU A N   1 
ATOM   4167  C  CA  . LEU A  1 536 ? 6.736   -7.741  72.075  1.00 37.41  ? 536  LEU A CA  1 
ATOM   4168  C  C   . LEU A  1 536 ? 7.780   -8.431  71.182  1.00 35.92  ? 536  LEU A C   1 
ATOM   4169  O  O   . LEU A  1 536 ? 8.899   -7.927  71.067  1.00 41.78  ? 536  LEU A O   1 
ATOM   4170  C  CB  . LEU A  1 536 ? 6.641   -8.413  73.454  1.00 50.10  ? 536  LEU A CB  1 
ATOM   4171  C  CG  . LEU A  1 536 ? 7.876   -8.455  74.372  1.00 50.84  ? 536  LEU A CG  1 
ATOM   4172  C  CD1 . LEU A  1 536 ? 8.698   -9.755  74.190  1.00 51.39  ? 536  LEU A CD1 1 
ATOM   4173  C  CD2 . LEU A  1 536 ? 8.747   -7.217  74.181  1.00 45.99  ? 536  LEU A CD2 1 
ATOM   4174  N  N   . PRO A  1 537 ? 7.420   -9.563  70.531  1.00 36.47  ? 537  PRO A N   1 
ATOM   4175  C  CA  . PRO A  1 537 ? 8.388   -10.169 69.606  1.00 36.77  ? 537  PRO A CA  1 
ATOM   4176  C  C   . PRO A  1 537 ? 8.739   -9.285  68.394  1.00 39.19  ? 537  PRO A C   1 
ATOM   4177  O  O   . PRO A  1 537 ? 9.920   -9.200  68.044  1.00 42.74  ? 537  PRO A O   1 
ATOM   4178  C  CB  . PRO A  1 537 ? 7.696   -11.471 69.173  1.00 35.99  ? 537  PRO A CB  1 
ATOM   4179  C  CG  . PRO A  1 537 ? 6.255   -11.293 69.494  1.00 33.08  ? 537  PRO A CG  1 
ATOM   4180  C  CD  . PRO A  1 537 ? 6.242   -10.436 70.715  1.00 37.90  ? 537  PRO A CD  1 
ATOM   4181  N  N   . LYS A  1 538 ? 7.752   -8.628  67.781  1.00 34.53  ? 538  LYS A N   1 
ATOM   4182  C  CA  . LYS A  1 538 ? 8.041   -7.621  66.753  1.00 38.19  ? 538  LYS A CA  1 
ATOM   4183  C  C   . LYS A  1 538 ? 8.949   -6.509  67.296  1.00 34.02  ? 538  LYS A C   1 
ATOM   4184  O  O   . LYS A  1 538 ? 9.593   -5.805  66.540  1.00 34.04  ? 538  LYS A O   1 
ATOM   4185  C  CB  . LYS A  1 538 ? 6.753   -7.005  66.181  1.00 29.78  ? 538  LYS A CB  1 
ATOM   4186  C  CG  . LYS A  1 538 ? 5.941   -7.961  65.361  1.00 57.04  ? 538  LYS A CG  1 
ATOM   4187  C  CD  . LYS A  1 538 ? 4.705   -7.310  64.797  1.00 60.85  ? 538  LYS A CD  1 
ATOM   4188  C  CE  . LYS A  1 538 ? 3.801   -8.367  64.177  1.00 68.83  ? 538  LYS A CE  1 
ATOM   4189  N  NZ  . LYS A  1 538 ? 2.518   -7.807  63.658  1.00 75.78  ? 538  LYS A NZ  1 
ATOM   4190  N  N   . LEU A  1 539 ? 8.993   -6.338  68.609  1.00 34.71  ? 539  LEU A N   1 
ATOM   4191  C  CA  . LEU A  1 539 ? 9.749   -5.216  69.145  1.00 45.41  ? 539  LEU A CA  1 
ATOM   4192  C  C   . LEU A  1 539 ? 11.190  -5.531  69.541  1.00 64.59  ? 539  LEU A C   1 
ATOM   4193  O  O   . LEU A  1 539 ? 12.114  -4.886  69.057  1.00 69.30  ? 539  LEU A O   1 
ATOM   4194  C  CB  . LEU A  1 539 ? 9.028   -4.596  70.337  1.00 47.88  ? 539  LEU A CB  1 
ATOM   4195  C  CG  . LEU A  1 539 ? 9.796   -3.391  70.867  1.00 52.46  ? 539  LEU A CG  1 
ATOM   4196  C  CD1 . LEU A  1 539 ? 9.638   -2.226  69.903  1.00 56.83  ? 539  LEU A CD1 1 
ATOM   4197  C  CD2 . LEU A  1 539 ? 9.360   -3.021  72.269  1.00 51.93  ? 539  LEU A CD2 1 
ATOM   4198  N  N   . LEU A  1 540 ? 11.389  -6.493  70.441  1.00 79.03  ? 540  LEU A N   1 
ATOM   4199  C  CA  . LEU A  1 540 ? 12.745  -6.749  70.952  1.00 87.86  ? 540  LEU A CA  1 
ATOM   4200  C  C   . LEU A  1 540 ? 13.630  -7.440  69.894  1.00 100.21 ? 540  LEU A C   1 
ATOM   4201  O  O   . LEU A  1 540 ? 14.865  -7.453  70.003  1.00 98.06  ? 540  LEU A O   1 
ATOM   4202  C  CB  . LEU A  1 540 ? 12.728  -7.476  72.319  1.00 78.10  ? 540  LEU A CB  1 
ATOM   4203  C  CG  . LEU A  1 540 ? 12.550  -8.993  72.477  1.00 70.91  ? 540  LEU A CG  1 
ATOM   4204  C  CD1 . LEU A  1 540 ? 12.239  -9.367  73.919  1.00 60.68  ? 540  LEU A CD1 1 
ATOM   4205  C  CD2 . LEU A  1 540 ? 11.490  -9.566  71.548  1.00 75.11  ? 540  LEU A CD2 1 
ATOM   4206  N  N   . SER A  1 541 ? 12.975  -8.007  68.877  1.00 106.69 ? 541  SER A N   1 
ATOM   4207  C  CA  . SER A  1 541 ? 13.624  -8.386  67.623  1.00 110.02 ? 541  SER A CA  1 
ATOM   4208  C  C   . SER A  1 541 ? 13.314  -7.264  66.645  1.00 115.44 ? 541  SER A C   1 
ATOM   4209  O  O   . SER A  1 541 ? 12.314  -6.570  66.818  1.00 120.38 ? 541  SER A O   1 
ATOM   4210  C  CB  . SER A  1 541 ? 13.073  -9.706  67.092  1.00 109.78 ? 541  SER A CB  1 
ATOM   4211  O  OG  . SER A  1 541 ? 11.770  -9.533  66.563  1.00 111.08 ? 541  SER A OG  1 
ATOM   4212  N  N   . ALA A  1 542 ? 14.146  -7.103  65.616  1.00 116.21 ? 542  ALA A N   1 
ATOM   4213  C  CA  . ALA A  1 542 ? 14.205  -5.861  64.826  1.00 115.54 ? 542  ALA A CA  1 
ATOM   4214  C  C   . ALA A  1 542 ? 14.562  -4.658  65.723  1.00 119.95 ? 542  ALA A C   1 
ATOM   4215  O  O   . ALA A  1 542 ? 14.104  -3.530  65.496  1.00 114.87 ? 542  ALA A O   1 
ATOM   4216  C  CB  . ALA A  1 542 ? 12.913  -5.617  64.026  1.00 108.20 ? 542  ALA A CB  1 
ATOM   4217  N  N   . THR A  1 543 ? 15.377  -4.941  66.748  1.00 126.07 ? 543  THR A N   1 
ATOM   4218  C  CA  . THR A  1 543 ? 15.990  -3.941  67.630  1.00 128.38 ? 543  THR A CA  1 
ATOM   4219  C  C   . THR A  1 543 ? 17.523  -4.049  67.509  1.00 128.35 ? 543  THR A C   1 
ATOM   4220  O  O   . THR A  1 543 ? 18.088  -5.114  67.228  1.00 123.65 ? 543  THR A O   1 
ATOM   4221  C  CB  . THR A  1 543 ? 15.544  -4.115  69.132  1.00 71.65  ? 543  THR A CB  1 
ATOM   4222  O  OG1 . THR A  1 543 ? 15.343  -2.833  69.759  1.00 65.80  ? 543  THR A OG1 1 
ATOM   4223  C  CG2 . THR A  1 543 ? 16.573  -4.930  69.934  1.00 70.15  ? 543  THR A CG2 1 
ATOM   4224  O  OXT . THR A  1 543 ? 18.256  -3.073  67.669  1.00 131.54 ? 543  THR A OXT 1 
ATOM   4225  N  N   . ASP B  1 5   ? -26.180 58.979  67.038  1.00 98.05  ? 5    ASP B N   1 
ATOM   4226  C  CA  . ASP B  1 5   ? -25.804 58.335  68.296  1.00 114.30 ? 5    ASP B CA  1 
ATOM   4227  C  C   . ASP B  1 5   ? -24.357 58.648  68.681  1.00 115.31 ? 5    ASP B C   1 
ATOM   4228  O  O   . ASP B  1 5   ? -23.444 58.466  67.874  1.00 108.70 ? 5    ASP B O   1 
ATOM   4229  C  CB  . ASP B  1 5   ? -25.994 56.823  68.200  1.00 109.61 ? 5    ASP B CB  1 
ATOM   4230  C  CG  . ASP B  1 5   ? -26.041 56.156  69.557  1.00 110.38 ? 5    ASP B CG  1 
ATOM   4231  O  OD1 . ASP B  1 5   ? -24.973 55.963  70.184  1.00 95.03  ? 5    ASP B OD1 1 
ATOM   4232  O  OD2 . ASP B  1 5   ? -27.158 55.821  69.996  1.00 112.59 ? 5    ASP B OD2 1 
ATOM   4233  N  N   . PRO B  1 6   ? -24.141 59.101  69.929  1.00 123.43 ? 6    PRO B N   1 
ATOM   4234  C  CA  . PRO B  1 6   ? -22.819 59.584  70.346  1.00 122.96 ? 6    PRO B CA  1 
ATOM   4235  C  C   . PRO B  1 6   ? -21.767 58.483  70.380  1.00 119.44 ? 6    PRO B C   1 
ATOM   4236  O  O   . PRO B  1 6   ? -20.607 58.733  70.052  1.00 117.47 ? 6    PRO B O   1 
ATOM   4237  C  CB  . PRO B  1 6   ? -23.070 60.118  71.765  1.00 127.09 ? 6    PRO B CB  1 
ATOM   4238  C  CG  . PRO B  1 6   ? -24.256 59.355  72.258  1.00 128.41 ? 6    PRO B CG  1 
ATOM   4239  C  CD  . PRO B  1 6   ? -25.116 59.129  71.038  1.00 129.25 ? 6    PRO B CD  1 
ATOM   4240  N  N   . GLN B  1 7   ? -22.168 57.277  70.763  1.00 119.24 ? 7    GLN B N   1 
ATOM   4241  C  CA  . GLN B  1 7   ? -21.201 56.216  71.004  1.00 115.95 ? 7    GLN B CA  1 
ATOM   4242  C  C   . GLN B  1 7   ? -21.238 55.109  69.964  1.00 110.64 ? 7    GLN B C   1 
ATOM   4243  O  O   . GLN B  1 7   ? -20.780 53.997  70.218  1.00 108.14 ? 7    GLN B O   1 
ATOM   4244  C  CB  . GLN B  1 7   ? -21.394 55.632  72.397  1.00 119.97 ? 7    GLN B CB  1 
ATOM   4245  C  CG  . GLN B  1 7   ? -22.810 55.218  72.679  1.00 122.74 ? 7    GLN B CG  1 
ATOM   4246  C  CD  . GLN B  1 7   ? -22.977 54.667  74.072  1.00 126.37 ? 7    GLN B CD  1 
ATOM   4247  O  OE1 . GLN B  1 7   ? -23.990 54.053  74.374  1.00 128.54 ? 7    GLN B OE1 1 
ATOM   4248  N  NE2 . GLN B  1 7   ? -21.984 54.885  74.932  1.00 94.90  ? 7    GLN B NE2 1 
ATOM   4249  N  N   . LEU B  1 8   ? -21.796 55.411  68.799  1.00 111.42 ? 8    LEU B N   1 
ATOM   4250  C  CA  . LEU B  1 8   ? -21.591 54.562  67.643  1.00 85.01  ? 8    LEU B CA  1 
ATOM   4251  C  C   . LEU B  1 8   ? -20.397 55.120  66.881  1.00 100.46 ? 8    LEU B C   1 
ATOM   4252  O  O   . LEU B  1 8   ? -19.787 54.422  66.077  1.00 100.45 ? 8    LEU B O   1 
ATOM   4253  C  CB  . LEU B  1 8   ? -22.833 54.495  66.752  1.00 85.70  ? 8    LEU B CB  1 
ATOM   4254  C  CG  . LEU B  1 8   ? -24.015 53.661  67.245  1.00 86.71  ? 8    LEU B CG  1 
ATOM   4255  C  CD1 . LEU B  1 8   ? -24.624 52.877  66.109  1.00 85.28  ? 8    LEU B CD1 1 
ATOM   4256  C  CD2 . LEU B  1 8   ? -23.628 52.737  68.377  1.00 86.02  ? 8    LEU B CD2 1 
ATOM   4257  N  N   . LEU B  1 9   ? -20.061 56.379  67.153  1.00 100.38 ? 9    LEU B N   1 
ATOM   4258  C  CA  . LEU B  1 9   ? -18.902 57.024  66.531  1.00 96.10  ? 9    LEU B CA  1 
ATOM   4259  C  C   . LEU B  1 9   ? -17.699 57.036  67.475  1.00 96.74  ? 9    LEU B C   1 
ATOM   4260  O  O   . LEU B  1 9   ? -17.708 57.727  68.495  1.00 96.78  ? 9    LEU B O   1 
ATOM   4261  C  CB  . LEU B  1 9   ? -19.235 58.452  66.071  1.00 98.63  ? 9    LEU B CB  1 
ATOM   4262  C  CG  . LEU B  1 9   ? -19.977 58.625  64.741  1.00 86.18  ? 9    LEU B CG  1 
ATOM   4263  C  CD1 . LEU B  1 9   ? -21.466 58.302  64.876  1.00 87.76  ? 9    LEU B CD1 1 
ATOM   4264  C  CD2 . LEU B  1 9   ? -19.766 60.027  64.187  1.00 87.66  ? 9    LEU B CD2 1 
ATOM   4265  N  N   . VAL B  1 10  ? -16.665 56.273  67.126  1.00 94.73  ? 10   VAL B N   1 
ATOM   4266  C  CA  . VAL B  1 10  ? -15.492 56.122  67.982  1.00 80.08  ? 10   VAL B CA  1 
ATOM   4267  C  C   . VAL B  1 10  ? -14.217 56.460  67.224  1.00 78.39  ? 10   VAL B C   1 
ATOM   4268  O  O   . VAL B  1 10  ? -14.071 56.064  66.084  1.00 76.42  ? 10   VAL B O   1 
ATOM   4269  C  CB  . VAL B  1 10  ? -15.372 54.673  68.466  1.00 96.31  ? 10   VAL B CB  1 
ATOM   4270  C  CG1 . VAL B  1 10  ? -14.135 54.498  69.330  1.00 77.45  ? 10   VAL B CG1 1 
ATOM   4271  C  CG2 . VAL B  1 10  ? -16.621 54.261  69.219  1.00 96.86  ? 10   VAL B CG2 1 
ATOM   4272  N  N   . ARG B  1 11  ? -13.287 57.180  67.844  1.00 89.82  ? 11   ARG B N   1 
ATOM   4273  C  CA  . ARG B  1 11  ? -12.023 57.487  67.165  1.00 87.76  ? 11   ARG B CA  1 
ATOM   4274  C  C   . ARG B  1 11  ? -10.836 56.651  67.647  1.00 82.53  ? 11   ARG B C   1 
ATOM   4275  O  O   . ARG B  1 11  ? -10.491 56.669  68.831  1.00 80.92  ? 11   ARG B O   1 
ATOM   4276  C  CB  . ARG B  1 11  ? -11.679 58.980  67.249  1.00 89.65  ? 11   ARG B CB  1 
ATOM   4277  C  CG  . ARG B  1 11  ? -10.227 59.292  66.883  1.00 87.74  ? 11   ARG B CG  1 
ATOM   4278  C  CD  . ARG B  1 11  ? -9.977  60.783  66.799  1.00 89.40  ? 11   ARG B CD  1 
ATOM   4279  N  NE  . ARG B  1 11  ? -10.179 61.305  65.451  1.00 90.58  ? 11   ARG B NE  1 
ATOM   4280  C  CZ  . ARG B  1 11  ? -10.796 62.450  65.175  1.00 97.56  ? 11   ARG B CZ  1 
ATOM   4281  N  NH1 . ARG B  1 11  ? -11.290 63.202  66.156  1.00 85.82  ? 11   ARG B NH1 1 
ATOM   4282  N  NH2 . ARG B  1 11  ? -10.920 62.843  63.913  1.00 98.03  ? 11   ARG B NH2 1 
ATOM   4283  N  N   . VAL B  1 12  ? -10.215 55.930  66.713  1.00 78.03  ? 12   VAL B N   1 
ATOM   4284  C  CA  . VAL B  1 12  ? -9.013  55.154  66.995  1.00 78.16  ? 12   VAL B CA  1 
ATOM   4285  C  C   . VAL B  1 12  ? -7.809  55.880  66.403  1.00 81.59  ? 12   VAL B C   1 
ATOM   4286  O  O   . VAL B  1 12  ? -7.980  56.903  65.730  1.00 82.14  ? 12   VAL B O   1 
ATOM   4287  C  CB  . VAL B  1 12  ? -9.123  53.745  66.416  1.00 75.04  ? 12   VAL B CB  1 
ATOM   4288  C  CG1 . VAL B  1 12  ? -10.508 53.200  66.675  1.00 68.96  ? 12   VAL B CG1 1 
ATOM   4289  C  CG2 . VAL B  1 12  ? -8.834  53.755  64.922  1.00 72.86  ? 12   VAL B CG2 1 
ATOM   4290  N  N   . ARG B  1 13  ? -6.606  55.358  66.656  1.00 68.85  ? 13   ARG B N   1 
ATOM   4291  C  CA  . ARG B  1 13  ? -5.362  56.025  66.256  1.00 95.89  ? 13   ARG B CA  1 
ATOM   4292  C  C   . ARG B  1 13  ? -5.317  56.409  64.776  1.00 93.45  ? 13   ARG B C   1 
ATOM   4293  O  O   . ARG B  1 13  ? -4.818  57.478  64.417  1.00 95.51  ? 13   ARG B O   1 
ATOM   4294  C  CB  . ARG B  1 13  ? -4.139  55.182  66.639  1.00 99.71  ? 13   ARG B CB  1 
ATOM   4295  C  CG  . ARG B  1 13  ? -2.922  55.404  65.748  1.00 107.74 ? 13   ARG B CG  1 
ATOM   4296  C  CD  . ARG B  1 13  ? -1.605  55.152  66.479  1.00 116.22 ? 13   ARG B CD  1 
ATOM   4297  N  NE  . ARG B  1 13  ? -0.910  56.406  66.775  1.00 123.29 ? 13   ARG B NE  1 
ATOM   4298  C  CZ  . ARG B  1 13  ? 0.316   56.493  67.285  1.00 123.55 ? 13   ARG B CZ  1 
ATOM   4299  N  NH1 . ARG B  1 13  ? 1.010   55.393  67.565  1.00 118.84 ? 13   ARG B NH1 1 
ATOM   4300  N  NH2 . ARG B  1 13  ? 0.849   57.688  67.513  1.00 125.57 ? 13   ARG B NH2 1 
ATOM   4301  N  N   . GLY B  1 14  ? -5.859  55.544  63.925  1.00 91.91  ? 14   GLY B N   1 
ATOM   4302  C  CA  . GLY B  1 14  ? -5.934  55.825  62.504  1.00 90.98  ? 14   GLY B CA  1 
ATOM   4303  C  C   . GLY B  1 14  ? -6.909  56.943  62.178  1.00 93.38  ? 14   GLY B C   1 
ATOM   4304  O  O   . GLY B  1 14  ? -6.557  57.898  61.486  1.00 97.88  ? 14   GLY B O   1 
ATOM   4305  N  N   . GLY B  1 15  ? -8.136  56.829  62.679  1.00 89.37  ? 15   GLY B N   1 
ATOM   4306  C  CA  . GLY B  1 15  ? -9.166  57.809  62.388  1.00 86.70  ? 15   GLY B CA  1 
ATOM   4307  C  C   . GLY B  1 15  ? -10.476 57.463  63.060  1.00 83.69  ? 15   GLY B C   1 
ATOM   4308  O  O   . GLY B  1 15  ? -10.481 56.793  64.092  1.00 72.03  ? 15   GLY B O   1 
ATOM   4309  N  N   . GLN B  1 16  ? -11.583 57.909  62.468  1.00 81.82  ? 16   GLN B N   1 
ATOM   4310  C  CA  . GLN B  1 16  ? -12.908 57.752  63.069  1.00 82.90  ? 16   GLN B CA  1 
ATOM   4311  C  C   . GLN B  1 16  ? -13.700 56.597  62.477  1.00 77.69  ? 16   GLN B C   1 
ATOM   4312  O  O   . GLN B  1 16  ? -13.584 56.294  61.297  1.00 76.54  ? 16   GLN B O   1 
ATOM   4313  C  CB  . GLN B  1 16  ? -13.725 59.033  62.916  1.00 91.34  ? 16   GLN B CB  1 
ATOM   4314  C  CG  . GLN B  1 16  ? -12.906 60.273  62.626  1.00 97.30  ? 16   GLN B CG  1 
ATOM   4315  C  CD  . GLN B  1 16  ? -13.705 61.538  62.858  1.00 100.15 ? 16   GLN B CD  1 
ATOM   4316  O  OE1 . GLN B  1 16  ? -14.566 61.573  63.740  1.00 99.07  ? 16   GLN B OE1 1 
ATOM   4317  N  NE2 . GLN B  1 16  ? -13.436 62.582  62.063  1.00 98.32  ? 16   GLN B NE2 1 
ATOM   4318  N  N   . LEU B  1 17  ? -14.535 55.986  63.306  1.00 74.11  ? 17   LEU B N   1 
ATOM   4319  C  CA  . LEU B  1 17  ? -15.272 54.779  62.955  1.00 88.99  ? 17   LEU B CA  1 
ATOM   4320  C  C   . LEU B  1 17  ? -16.745 54.930  63.286  1.00 90.54  ? 17   LEU B C   1 
ATOM   4321  O  O   . LEU B  1 17  ? -17.093 55.467  64.335  1.00 77.19  ? 17   LEU B O   1 
ATOM   4322  C  CB  . LEU B  1 17  ? -14.729 53.577  63.740  1.00 92.01  ? 17   LEU B CB  1 
ATOM   4323  C  CG  . LEU B  1 17  ? -13.351 52.983  63.426  1.00 87.06  ? 17   LEU B CG  1 
ATOM   4324  C  CD1 . LEU B  1 17  ? -12.952 51.994  64.508  1.00 67.55  ? 17   LEU B CD1 1 
ATOM   4325  C  CD2 . LEU B  1 17  ? -13.343 52.310  62.055  1.00 82.55  ? 17   LEU B CD2 1 
ATOM   4326  N  N   . ARG B  1 18  ? -17.600 54.436  62.398  1.00 74.43  ? 18   ARG B N   1 
ATOM   4327  C  CA  . ARG B  1 18  ? -19.035 54.399  62.640  1.00 97.04  ? 18   ARG B CA  1 
ATOM   4328  C  C   . ARG B  1 18  ? -19.490 52.959  62.811  1.00 91.44  ? 18   ARG B C   1 
ATOM   4329  O  O   . ARG B  1 18  ? -19.398 52.161  61.880  1.00 90.44  ? 18   ARG B O   1 
ATOM   4330  C  CB  . ARG B  1 18  ? -19.797 55.058  61.487  1.00 103.59 ? 18   ARG B CB  1 
ATOM   4331  C  CG  . ARG B  1 18  ? -21.314 55.064  61.651  1.00 110.20 ? 18   ARG B CG  1 
ATOM   4332  C  CD  . ARG B  1 18  ? -22.011 55.885  60.561  1.00 116.76 ? 18   ARG B CD  1 
ATOM   4333  N  NE  . ARG B  1 18  ? -21.850 57.332  60.733  1.00 122.25 ? 18   ARG B NE  1 
ATOM   4334  C  CZ  . ARG B  1 18  ? -22.628 58.096  61.503  1.00 125.18 ? 18   ARG B CZ  1 
ATOM   4335  N  NH1 . ARG B  1 18  ? -23.624 57.560  62.198  1.00 125.21 ? 18   ARG B NH1 1 
ATOM   4336  N  NH2 . ARG B  1 18  ? -22.406 59.403  61.589  1.00 125.09 ? 18   ARG B NH2 1 
ATOM   4337  N  N   . GLY B  1 19  ? -19.980 52.635  64.004  1.00 89.29  ? 19   GLY B N   1 
ATOM   4338  C  CA  . GLY B  1 19  ? -20.432 51.290  64.315  1.00 88.97  ? 19   GLY B CA  1 
ATOM   4339  C  C   . GLY B  1 19  ? -21.886 51.033  63.969  1.00 76.58  ? 19   GLY B C   1 
ATOM   4340  O  O   . GLY B  1 19  ? -22.434 51.654  63.063  1.00 104.28 ? 19   GLY B O   1 
ATOM   4341  N  N   . ILE B  1 20  ? -22.510 50.109  64.693  1.00 76.89  ? 20   ILE B N   1 
ATOM   4342  C  CA  . ILE B  1 20  ? -23.912 49.765  64.483  1.00 110.73 ? 20   ILE B CA  1 
ATOM   4343  C  C   . ILE B  1 20  ? -24.531 49.208  65.772  1.00 111.35 ? 20   ILE B C   1 
ATOM   4344  O  O   . ILE B  1 20  ? -23.874 48.465  66.509  1.00 113.94 ? 20   ILE B O   1 
ATOM   4345  C  CB  . ILE B  1 20  ? -24.070 48.744  63.340  1.00 76.10  ? 20   ILE B CB  1 
ATOM   4346  C  CG1 . ILE B  1 20  ? -25.539 48.383  63.132  1.00 77.69  ? 20   ILE B CG1 1 
ATOM   4347  C  CG2 . ILE B  1 20  ? -23.257 47.495  63.630  1.00 93.77  ? 20   ILE B CG2 1 
ATOM   4348  C  CD1 . ILE B  1 20  ? -25.765 47.319  62.099  1.00 75.88  ? 20   ILE B CD1 1 
ATOM   4349  N  N   . ARG B  1 21  ? -25.776 49.593  66.062  1.00 108.12 ? 21   ARG B N   1 
ATOM   4350  C  CA  . ARG B  1 21  ? -26.526 48.989  67.165  1.00 102.91 ? 21   ARG B CA  1 
ATOM   4351  C  C   . ARG B  1 21  ? -27.136 47.662  66.699  1.00 100.29 ? 21   ARG B C   1 
ATOM   4352  O  O   . ARG B  1 21  ? -27.655 47.561  65.582  1.00 98.84  ? 21   ARG B O   1 
ATOM   4353  C  CB  . ARG B  1 21  ? -27.621 49.935  67.684  1.00 100.69 ? 21   ARG B CB  1 
ATOM   4354  C  CG  . ARG B  1 21  ? -28.289 49.474  68.985  1.00 98.74  ? 21   ARG B CG  1 
ATOM   4355  C  CD  . ARG B  1 21  ? -29.679 50.086  69.188  1.00 104.53 ? 21   ARG B CD  1 
ATOM   4356  N  NE  . ARG B  1 21  ? -29.650 51.338  69.945  1.00 109.78 ? 21   ARG B NE  1 
ATOM   4357  C  CZ  . ARG B  1 21  ? -29.857 52.547  69.423  1.00 112.82 ? 21   ARG B CZ  1 
ATOM   4358  N  NH1 . ARG B  1 21  ? -30.118 52.689  68.127  1.00 108.00 ? 21   ARG B NH1 1 
ATOM   4359  N  NH2 . ARG B  1 21  ? -29.806 53.621  70.203  1.00 117.48 ? 21   ARG B NH2 1 
ATOM   4360  N  N   . LEU B  1 22  ? -27.062 46.646  67.554  1.00 97.65  ? 22   LEU B N   1 
ATOM   4361  C  CA  . LEU B  1 22  ? -27.543 45.311  67.214  1.00 97.92  ? 22   LEU B CA  1 
ATOM   4362  C  C   . LEU B  1 22  ? -28.453 44.746  68.292  1.00 101.84 ? 22   LEU B C   1 
ATOM   4363  O  O   . LEU B  1 22  ? -28.139 44.802  69.488  1.00 84.80  ? 22   LEU B O   1 
ATOM   4364  C  CB  . LEU B  1 22  ? -26.372 44.355  66.978  1.00 95.75  ? 22   LEU B CB  1 
ATOM   4365  C  CG  . LEU B  1 22  ? -25.747 44.293  65.583  1.00 93.25  ? 22   LEU B CG  1 
ATOM   4366  C  CD1 . LEU B  1 22  ? -24.453 43.502  65.648  1.00 89.27  ? 22   LEU B CD1 1 
ATOM   4367  C  CD2 . LEU B  1 22  ? -26.717 43.671  64.578  1.00 93.16  ? 22   LEU B CD2 1 
ATOM   4368  N  N   . LYS B  1 23  ? -29.576 44.190  67.846  1.00 106.75 ? 23   LYS B N   1 
ATOM   4369  C  CA  . LYS B  1 23  ? -30.589 43.635  68.734  1.00 113.42 ? 23   LYS B CA  1 
ATOM   4370  C  C   . LYS B  1 23  ? -30.184 42.247  69.235  1.00 110.72 ? 23   LYS B C   1 
ATOM   4371  O  O   . LYS B  1 23  ? -30.040 41.307  68.451  1.00 108.14 ? 23   LYS B O   1 
ATOM   4372  C  CB  . LYS B  1 23  ? -31.954 43.573  68.022  1.00 117.66 ? 23   LYS B CB  1 
ATOM   4373  C  CG  . LYS B  1 23  ? -32.531 44.936  67.595  1.00 117.65 ? 23   LYS B CG  1 
ATOM   4374  C  CD  . LYS B  1 23  ? -33.413 44.826  66.339  1.00 113.13 ? 23   LYS B CD  1 
ATOM   4375  C  CE  . LYS B  1 23  ? -33.877 46.201  65.843  1.00 107.47 ? 23   LYS B CE  1 
ATOM   4376  N  NZ  . LYS B  1 23  ? -34.501 46.156  64.484  1.00 100.23 ? 23   LYS B NZ  1 
ATOM   4377  N  N   . ALA B  1 24  ? -29.986 42.135  70.545  1.00 110.41 ? 24   ALA B N   1 
ATOM   4378  C  CA  . ALA B  1 24  ? -29.770 40.847  71.196  1.00 106.94 ? 24   ALA B CA  1 
ATOM   4379  C  C   . ALA B  1 24  ? -31.018 40.507  72.010  1.00 112.00 ? 24   ALA B C   1 
ATOM   4380  O  O   . ALA B  1 24  ? -31.780 41.409  72.375  1.00 118.99 ? 24   ALA B O   1 
ATOM   4381  C  CB  . ALA B  1 24  ? -28.541 40.909  72.096  1.00 102.67 ? 24   ALA B CB  1 
ATOM   4382  N  N   . PRO B  1 25  ? -31.248 39.208  72.278  1.00 107.45 ? 25   PRO B N   1 
ATOM   4383  C  CA  . PRO B  1 25  ? -32.368 38.780  73.123  1.00 107.91 ? 25   PRO B CA  1 
ATOM   4384  C  C   . PRO B  1 25  ? -32.430 39.573  74.415  1.00 108.41 ? 25   PRO B C   1 
ATOM   4385  O  O   . PRO B  1 25  ? -33.507 40.029  74.800  1.00 109.65 ? 25   PRO B O   1 
ATOM   4386  C  CB  . PRO B  1 25  ? -32.029 37.323  73.416  1.00 105.63 ? 25   PRO B CB  1 
ATOM   4387  C  CG  . PRO B  1 25  ? -31.352 36.877  72.176  1.00 104.03 ? 25   PRO B CG  1 
ATOM   4388  C  CD  . PRO B  1 25  ? -30.540 38.056  71.697  1.00 103.20 ? 25   PRO B CD  1 
ATOM   4389  N  N   . GLY B  1 26  ? -31.280 39.749  75.058  1.00 107.91 ? 26   GLY B N   1 
ATOM   4390  C  CA  . GLY B  1 26  ? -31.198 40.567  76.254  1.00 113.17 ? 26   GLY B CA  1 
ATOM   4391  C  C   . GLY B  1 26  ? -31.537 42.026  76.005  1.00 116.05 ? 26   GLY B C   1 
ATOM   4392  O  O   . GLY B  1 26  ? -32.689 42.437  76.168  1.00 118.02 ? 26   GLY B O   1 
ATOM   4393  N  N   . GLY B  1 27  ? -30.538 42.812  75.610  1.00 115.40 ? 27   GLY B N   1 
ATOM   4394  C  CA  . GLY B  1 27  ? -30.735 44.233  75.377  1.00 118.15 ? 27   GLY B CA  1 
ATOM   4395  C  C   . GLY B  1 27  ? -30.260 44.724  74.021  1.00 114.47 ? 27   GLY B C   1 
ATOM   4396  O  O   . GLY B  1 27  ? -30.623 44.157  72.992  1.00 112.90 ? 27   GLY B O   1 
ATOM   4397  N  N   . PRO B  1 28  ? -29.482 45.817  74.015  1.00 113.95 ? 28   PRO B N   1 
ATOM   4398  C  CA  . PRO B  1 28  ? -28.815 46.337  72.817  1.00 110.30 ? 28   PRO B CA  1 
ATOM   4399  C  C   . PRO B  1 28  ? -27.314 46.039  72.843  1.00 107.85 ? 28   PRO B C   1 
ATOM   4400  O  O   . PRO B  1 28  ? -26.772 45.762  73.916  1.00 110.07 ? 28   PRO B O   1 
ATOM   4401  C  CB  . PRO B  1 28  ? -29.039 47.840  72.946  1.00 110.04 ? 28   PRO B CB  1 
ATOM   4402  C  CG  . PRO B  1 28  ? -28.975 48.073  74.435  1.00 114.27 ? 28   PRO B CG  1 
ATOM   4403  C  CD  . PRO B  1 28  ? -29.490 46.812  75.104  1.00 116.44 ? 28   PRO B CD  1 
ATOM   4404  N  N   . VAL B  1 29  ? -26.652 46.069  71.685  1.00 100.93 ? 29   VAL B N   1 
ATOM   4405  C  CA  . VAL B  1 29  ? -25.189 45.955  71.657  1.00 94.65  ? 29   VAL B CA  1 
ATOM   4406  C  C   . VAL B  1 29  ? -24.528 46.891  70.640  1.00 94.12  ? 29   VAL B C   1 
ATOM   4407  O  O   . VAL B  1 29  ? -25.061 47.113  69.557  1.00 81.85  ? 29   VAL B O   1 
ATOM   4408  C  CB  . VAL B  1 29  ? -24.700 44.505  71.396  1.00 90.49  ? 29   VAL B CB  1 
ATOM   4409  C  CG1 . VAL B  1 29  ? -23.648 44.120  72.419  1.00 79.53  ? 29   VAL B CG1 1 
ATOM   4410  C  CG2 . VAL B  1 29  ? -25.856 43.508  71.410  1.00 90.77  ? 29   VAL B CG2 1 
ATOM   4411  N  N   . SER B  1 30  ? -23.367 47.436  71.002  1.00 96.81  ? 30   SER B N   1 
ATOM   4412  C  CA  . SER B  1 30  ? -22.543 48.234  70.083  1.00 96.05  ? 30   SER B CA  1 
ATOM   4413  C  C   . SER B  1 30  ? -21.591 47.319  69.314  1.00 85.64  ? 30   SER B C   1 
ATOM   4414  O  O   . SER B  1 30  ? -20.881 46.515  69.916  1.00 84.90  ? 30   SER B O   1 
ATOM   4415  C  CB  . SER B  1 30  ? -21.731 49.294  70.845  1.00 99.87  ? 30   SER B CB  1 
ATOM   4416  O  OG  . SER B  1 30  ? -22.531 50.388  71.270  1.00 102.26 ? 30   SER B OG  1 
ATOM   4417  N  N   . ALA B  1 31  ? -21.575 47.445  67.990  1.00 79.12  ? 31   ALA B N   1 
ATOM   4418  C  CA  . ALA B  1 31  ? -20.773 46.564  67.145  1.00 73.22  ? 31   ALA B CA  1 
ATOM   4419  C  C   . ALA B  1 31  ? -19.956 47.367  66.149  1.00 71.74  ? 31   ALA B C   1 
ATOM   4420  O  O   . ALA B  1 31  ? -20.441 48.344  65.599  1.00 74.45  ? 31   ALA B O   1 
ATOM   4421  C  CB  . ALA B  1 31  ? -21.668 45.589  66.412  1.00 71.54  ? 31   ALA B CB  1 
ATOM   4422  N  N   . PHE B  1 32  ? -18.717 46.955  65.919  1.00 70.55  ? 32   PHE B N   1 
ATOM   4423  C  CA  . PHE B  1 32  ? -17.850 47.629  64.955  1.00 75.74  ? 32   PHE B CA  1 
ATOM   4424  C  C   . PHE B  1 32  ? -17.178 46.590  64.065  1.00 78.76  ? 32   PHE B C   1 
ATOM   4425  O  O   . PHE B  1 32  ? -16.132 46.032  64.420  1.00 81.06  ? 32   PHE B O   1 
ATOM   4426  C  CB  . PHE B  1 32  ? -16.785 48.454  65.671  1.00 77.97  ? 32   PHE B CB  1 
ATOM   4427  C  CG  . PHE B  1 32  ? -17.341 49.479  66.607  1.00 83.24  ? 32   PHE B CG  1 
ATOM   4428  C  CD1 . PHE B  1 32  ? -17.646 49.145  67.918  1.00 82.78  ? 32   PHE B CD1 1 
ATOM   4429  C  CD2 . PHE B  1 32  ? -17.553 50.781  66.177  1.00 88.19  ? 32   PHE B CD2 1 
ATOM   4430  C  CE1 . PHE B  1 32  ? -18.155 50.090  68.782  1.00 87.85  ? 32   PHE B CE1 1 
ATOM   4431  C  CE2 . PHE B  1 32  ? -18.066 51.735  67.037  1.00 91.17  ? 32   PHE B CE2 1 
ATOM   4432  C  CZ  . PHE B  1 32  ? -18.369 51.389  68.341  1.00 90.70  ? 32   PHE B CZ  1 
ATOM   4433  N  N   . LEU B  1 33  ? -17.782 46.345  62.907  1.00 76.26  ? 33   LEU B N   1 
ATOM   4434  C  CA  . LEU B  1 33  ? -17.441 45.193  62.089  1.00 72.05  ? 33   LEU B CA  1 
ATOM   4435  C  C   . LEU B  1 33  ? -16.668 45.571  60.825  1.00 69.85  ? 33   LEU B C   1 
ATOM   4436  O  O   . LEU B  1 33  ? -17.230 46.143  59.895  1.00 71.56  ? 33   LEU B O   1 
ATOM   4437  C  CB  . LEU B  1 33  ? -18.722 44.440  61.698  1.00 74.78  ? 33   LEU B CB  1 
ATOM   4438  C  CG  . LEU B  1 33  ? -19.887 44.302  62.688  1.00 64.18  ? 33   LEU B CG  1 
ATOM   4439  C  CD1 . LEU B  1 33  ? -21.016 43.457  62.092  1.00 64.27  ? 33   LEU B CD1 1 
ATOM   4440  C  CD2 . LEU B  1 33  ? -19.429 43.726  64.012  1.00 64.03  ? 33   LEU B CD2 1 
ATOM   4441  N  N   . GLY B  1 34  ? -15.384 45.242  60.776  1.00 58.18  ? 34   GLY B N   1 
ATOM   4442  C  CA  . GLY B  1 34  ? -14.641 45.476  59.560  1.00 56.72  ? 34   GLY B CA  1 
ATOM   4443  C  C   . GLY B  1 34  ? -13.678 46.620  59.718  1.00 69.39  ? 34   GLY B C   1 
ATOM   4444  O  O   . GLY B  1 34  ? -13.312 47.266  58.745  1.00 56.89  ? 34   GLY B O   1 
ATOM   4445  N  N   . ILE B  1 35  ? -13.273 46.877  60.952  1.00 57.99  ? 35   ILE B N   1 
ATOM   4446  C  CA  . ILE B  1 35  ? -12.219 47.839  61.202  1.00 58.32  ? 35   ILE B CA  1 
ATOM   4447  C  C   . ILE B  1 35  ? -10.932 47.332  60.572  1.00 68.71  ? 35   ILE B C   1 
ATOM   4448  O  O   . ILE B  1 35  ? -10.448 46.264  60.927  1.00 54.39  ? 35   ILE B O   1 
ATOM   4449  C  CB  . ILE B  1 35  ? -11.957 47.999  62.703  1.00 60.68  ? 35   ILE B CB  1 
ATOM   4450  C  CG1 . ILE B  1 35  ? -13.269 48.187  63.476  1.00 62.26  ? 35   ILE B CG1 1 
ATOM   4451  C  CG2 . ILE B  1 35  ? -10.975 49.134  62.946  1.00 60.21  ? 35   ILE B CG2 1 
ATOM   4452  C  CD1 . ILE B  1 35  ? -13.083 48.338  64.980  1.00 63.05  ? 35   ILE B CD1 1 
ATOM   4453  N  N   . PRO B  1 36  ? -10.372 48.087  59.625  1.00 55.66  ? 36   PRO B N   1 
ATOM   4454  C  CA  . PRO B  1 36  ? -9.111  47.656  59.021  1.00 66.99  ? 36   PRO B CA  1 
ATOM   4455  C  C   . PRO B  1 36  ? -7.977  47.797  60.015  1.00 69.14  ? 36   PRO B C   1 
ATOM   4456  O  O   . PRO B  1 36  ? -7.929  48.794  60.730  1.00 72.31  ? 36   PRO B O   1 
ATOM   4457  C  CB  . PRO B  1 36  ? -8.933  48.631  57.853  1.00 53.82  ? 36   PRO B CB  1 
ATOM   4458  C  CG  . PRO B  1 36  ? -9.700  49.823  58.230  1.00 56.32  ? 36   PRO B CG  1 
ATOM   4459  C  CD  . PRO B  1 36  ? -10.871 49.335  59.031  1.00 57.31  ? 36   PRO B CD  1 
ATOM   4460  N  N   . PHE B  1 37  ? -7.086  46.818  60.083  1.00 51.53  ? 37   PHE B N   1 
ATOM   4461  C  CA  . PHE B  1 37  ? -6.022  46.897  61.068  1.00 51.50  ? 37   PHE B CA  1 
ATOM   4462  C  C   . PHE B  1 37  ? -4.656  46.769  60.440  1.00 56.51  ? 37   PHE B C   1 
ATOM   4463  O  O   . PHE B  1 37  ? -3.637  46.941  61.104  1.00 54.27  ? 37   PHE B O   1 
ATOM   4464  C  CB  . PHE B  1 37  ? -6.224  45.891  62.213  1.00 56.45  ? 37   PHE B CB  1 
ATOM   4465  C  CG  . PHE B  1 37  ? -5.959  44.450  61.845  1.00 55.65  ? 37   PHE B CG  1 
ATOM   4466  C  CD1 . PHE B  1 37  ? -4.677  43.908  61.970  1.00 54.01  ? 37   PHE B CD1 1 
ATOM   4467  C  CD2 . PHE B  1 37  ? -6.997  43.624  61.427  1.00 51.99  ? 37   PHE B CD2 1 
ATOM   4468  C  CE1 . PHE B  1 37  ? -4.429  42.580  61.651  1.00 48.42  ? 37   PHE B CE1 1 
ATOM   4469  C  CE2 . PHE B  1 37  ? -6.760  42.299  61.111  1.00 51.71  ? 37   PHE B CE2 1 
ATOM   4470  C  CZ  . PHE B  1 37  ? -5.470  41.774  61.222  1.00 48.82  ? 37   PHE B CZ  1 
ATOM   4471  N  N   . ALA B  1 38  ? -4.648  46.474  59.147  1.00 57.61  ? 38   ALA B N   1 
ATOM   4472  C  CA  . ALA B  1 38  ? -3.412  46.376  58.387  1.00 54.92  ? 38   ALA B CA  1 
ATOM   4473  C  C   . ALA B  1 38  ? -3.700  46.808  56.972  1.00 56.79  ? 38   ALA B C   1 
ATOM   4474  O  O   . ALA B  1 38  ? -4.841  46.714  56.508  1.00 62.28  ? 38   ALA B O   1 
ATOM   4475  C  CB  . ALA B  1 38  ? -2.898  44.962  58.391  1.00 57.56  ? 38   ALA B CB  1 
ATOM   4476  N  N   . GLU B  1 39  ? -2.676  47.294  56.284  1.00 53.63  ? 39   GLU B N   1 
ATOM   4477  C  CA  . GLU B  1 39  ? -2.833  47.599  54.878  1.00 53.68  ? 39   GLU B CA  1 
ATOM   4478  C  C   . GLU B  1 39  ? -3.118  46.276  54.175  1.00 55.32  ? 39   GLU B C   1 
ATOM   4479  O  O   . GLU B  1 39  ? -2.609  45.234  54.594  1.00 61.71  ? 39   GLU B O   1 
ATOM   4480  C  CB  . GLU B  1 39  ? -1.576  48.282  54.324  1.00 56.60  ? 39   GLU B CB  1 
ATOM   4481  C  CG  . GLU B  1 39  ? -1.399  49.750  54.753  1.00 65.72  ? 39   GLU B CG  1 
ATOM   4482  C  CD  . GLU B  1 39  ? -2.271  50.740  53.968  1.00 73.69  ? 39   GLU B CD  1 
ATOM   4483  O  OE1 . GLU B  1 39  ? -3.501  50.810  54.205  1.00 72.63  ? 39   GLU B OE1 1 
ATOM   4484  O  OE2 . GLU B  1 39  ? -1.715  51.472  53.122  1.00 79.50  ? 39   GLU B OE2 1 
ATOM   4485  N  N   . PRO B  1 40  ? -3.966  46.304  53.134  1.00 54.02  ? 40   PRO B N   1 
ATOM   4486  C  CA  . PRO B  1 40  ? -4.265  45.119  52.327  1.00 53.62  ? 40   PRO B CA  1 
ATOM   4487  C  C   . PRO B  1 40  ? -2.986  44.420  51.873  1.00 55.39  ? 40   PRO B C   1 
ATOM   4488  O  O   . PRO B  1 40  ? -2.236  45.019  51.103  1.00 55.23  ? 40   PRO B O   1 
ATOM   4489  C  CB  . PRO B  1 40  ? -4.981  45.711  51.115  1.00 51.78  ? 40   PRO B CB  1 
ATOM   4490  C  CG  . PRO B  1 40  ? -5.647  46.928  51.635  1.00 55.05  ? 40   PRO B CG  1 
ATOM   4491  C  CD  . PRO B  1 40  ? -4.722  47.486  52.678  1.00 58.60  ? 40   PRO B CD  1 
ATOM   4492  N  N   . PRO B  1 41  ? -2.752  43.172  52.333  1.00 53.08  ? 41   PRO B N   1 
ATOM   4493  C  CA  . PRO B  1 41  ? -1.506  42.429  52.108  1.00 46.24  ? 41   PRO B CA  1 
ATOM   4494  C  C   . PRO B  1 41  ? -1.479  41.832  50.704  1.00 42.58  ? 41   PRO B C   1 
ATOM   4495  O  O   . PRO B  1 41  ? -1.285  40.629  50.538  1.00 44.11  ? 41   PRO B O   1 
ATOM   4496  C  CB  . PRO B  1 41  ? -1.609  41.303  53.133  1.00 37.37  ? 41   PRO B CB  1 
ATOM   4497  C  CG  . PRO B  1 41  ? -3.071  40.988  53.155  1.00 42.62  ? 41   PRO B CG  1 
ATOM   4498  C  CD  . PRO B  1 41  ? -3.770  42.325  52.987  1.00 50.16  ? 41   PRO B CD  1 
ATOM   4499  N  N   . VAL B  1 42  ? -1.672  42.675  49.700  1.00 41.53  ? 42   VAL B N   1 
ATOM   4500  C  CA  . VAL B  1 42  ? -1.872  42.207  48.341  1.00 36.53  ? 42   VAL B CA  1 
ATOM   4501  C  C   . VAL B  1 42  ? -0.731  42.578  47.405  1.00 45.26  ? 42   VAL B C   1 
ATOM   4502  O  O   . VAL B  1 42  ? 0.230   43.245  47.792  1.00 43.08  ? 42   VAL B O   1 
ATOM   4503  C  CB  . VAL B  1 42  ? -3.167  42.773  47.754  1.00 37.69  ? 42   VAL B CB  1 
ATOM   4504  C  CG1 . VAL B  1 42  ? -4.333  42.388  48.621  1.00 38.35  ? 42   VAL B CG1 1 
ATOM   4505  C  CG2 . VAL B  1 42  ? -3.069  44.277  47.632  1.00 39.18  ? 42   VAL B CG2 1 
ATOM   4506  N  N   . GLY B  1 43  ? -0.863  42.142  46.157  1.00 45.89  ? 43   GLY B N   1 
ATOM   4507  C  CA  . GLY B  1 43  ? 0.120   42.433  45.137  1.00 45.39  ? 43   GLY B CA  1 
ATOM   4508  C  C   . GLY B  1 43  ? 1.498   41.974  45.554  1.00 39.77  ? 43   GLY B C   1 
ATOM   4509  O  O   . GLY B  1 43  ? 1.724   40.776  45.768  1.00 37.59  ? 43   GLY B O   1 
ATOM   4510  N  N   . SER B  1 44  ? 2.402   42.944  45.688  1.00 38.22  ? 44   SER B N   1 
ATOM   4511  C  CA  . SER B  1 44  ? 3.807   42.682  45.964  1.00 37.95  ? 44   SER B CA  1 
ATOM   4512  C  C   . SER B  1 44  ? 3.984   42.500  47.451  1.00 42.10  ? 44   SER B C   1 
ATOM   4513  O  O   . SER B  1 44  ? 5.080   42.164  47.927  1.00 38.60  ? 44   SER B O   1 
ATOM   4514  C  CB  . SER B  1 44  ? 4.675   43.835  45.479  1.00 38.87  ? 44   SER B CB  1 
ATOM   4515  O  OG  . SER B  1 44  ? 4.389   45.012  46.201  1.00 45.05  ? 44   SER B OG  1 
ATOM   4516  N  N   . ARG B  1 45  ? 2.893   42.726  48.178  1.00 46.44  ? 45   ARG B N   1 
ATOM   4517  C  CA  . ARG B  1 45  ? 2.874   42.535  49.618  1.00 45.05  ? 45   ARG B CA  1 
ATOM   4518  C  C   . ARG B  1 45  ? 2.471   41.093  50.016  1.00 42.07  ? 45   ARG B C   1 
ATOM   4519  O  O   . ARG B  1 45  ? 2.554   40.728  51.192  1.00 43.20  ? 45   ARG B O   1 
ATOM   4520  C  CB  . ARG B  1 45  ? 1.982   43.605  50.281  1.00 47.76  ? 45   ARG B CB  1 
ATOM   4521  C  CG  . ARG B  1 45  ? 2.722   44.542  51.245  1.00 61.59  ? 45   ARG B CG  1 
ATOM   4522  C  CD  . ARG B  1 45  ? 3.193   43.751  52.477  1.00 75.39  ? 45   ARG B CD  1 
ATOM   4523  N  NE  . ARG B  1 45  ? 4.263   44.385  53.254  1.00 79.90  ? 45   ARG B NE  1 
ATOM   4524  C  CZ  . ARG B  1 45  ? 5.523   44.521  52.841  1.00 79.89  ? 45   ARG B CZ  1 
ATOM   4525  N  NH1 . ARG B  1 45  ? 5.889   44.103  51.634  1.00 77.42  ? 45   ARG B NH1 1 
ATOM   4526  N  NH2 . ARG B  1 45  ? 6.417   45.098  53.633  1.00 81.04  ? 45   ARG B NH2 1 
ATOM   4527  N  N   . ARG B  1 46  ? 2.057   40.275  49.044  1.00 38.75  ? 46   ARG B N   1 
ATOM   4528  C  CA  . ARG B  1 46  ? 1.647   38.894  49.324  1.00 35.41  ? 46   ARG B CA  1 
ATOM   4529  C  C   . ARG B  1 46  ? 2.790   38.115  49.955  1.00 36.08  ? 46   ARG B C   1 
ATOM   4530  O  O   . ARG B  1 46  ? 3.944   38.309  49.574  1.00 41.25  ? 46   ARG B O   1 
ATOM   4531  C  CB  . ARG B  1 46  ? 1.186   38.179  48.053  1.00 31.03  ? 46   ARG B CB  1 
ATOM   4532  C  CG  . ARG B  1 46  ? 0.612   36.786  48.311  1.00 30.17  ? 46   ARG B CG  1 
ATOM   4533  C  CD  . ARG B  1 46  ? 0.336   36.002  47.030  1.00 29.31  ? 46   ARG B CD  1 
ATOM   4534  N  NE  . ARG B  1 46  ? -0.957  36.329  46.427  1.00 34.90  ? 46   ARG B NE  1 
ATOM   4535  C  CZ  . ARG B  1 46  ? -1.324  36.012  45.184  1.00 36.27  ? 46   ARG B CZ  1 
ATOM   4536  N  NH1 . ARG B  1 46  ? -0.504  35.353  44.374  1.00 28.64  ? 46   ARG B NH1 1 
ATOM   4537  N  NH2 . ARG B  1 46  ? -2.526  36.363  44.748  1.00 37.88  ? 46   ARG B NH2 1 
ATOM   4538  N  N   . PHE B  1 47  ? 2.458   37.251  50.917  1.00 31.28  ? 47   PHE B N   1 
ATOM   4539  C  CA  . PHE B  1 47  ? 3.422   36.442  51.688  1.00 35.50  ? 47   PHE B CA  1 
ATOM   4540  C  C   . PHE B  1 47  ? 4.271   37.229  52.695  1.00 43.18  ? 47   PHE B C   1 
ATOM   4541  O  O   . PHE B  1 47  ? 5.086   36.641  53.416  1.00 48.87  ? 47   PHE B O   1 
ATOM   4542  C  CB  . PHE B  1 47  ? 4.356   35.624  50.786  1.00 32.95  ? 47   PHE B CB  1 
ATOM   4543  C  CG  . PHE B  1 47  ? 3.649   34.793  49.769  1.00 32.61  ? 47   PHE B CG  1 
ATOM   4544  C  CD1 . PHE B  1 47  ? 2.664   33.899  50.150  1.00 33.34  ? 47   PHE B CD1 1 
ATOM   4545  C  CD2 . PHE B  1 47  ? 3.976   34.905  48.424  1.00 32.55  ? 47   PHE B CD2 1 
ATOM   4546  C  CE1 . PHE B  1 47  ? 2.018   33.131  49.209  1.00 35.09  ? 47   PHE B CE1 1 
ATOM   4547  C  CE2 . PHE B  1 47  ? 3.333   34.153  47.480  1.00 32.25  ? 47   PHE B CE2 1 
ATOM   4548  C  CZ  . PHE B  1 47  ? 2.350   33.264  47.868  1.00 35.70  ? 47   PHE B CZ  1 
ATOM   4549  N  N   . MET B  1 48  ? 4.092   38.545  52.747  1.00 40.71  ? 48   MET B N   1 
ATOM   4550  C  CA  . MET B  1 48  ? 4.926   39.377  53.610  1.00 39.69  ? 48   MET B CA  1 
ATOM   4551  C  C   . MET B  1 48  ? 4.206   39.743  54.907  1.00 39.21  ? 48   MET B C   1 
ATOM   4552  O  O   . MET B  1 48  ? 2.974   39.756  54.959  1.00 36.55  ? 48   MET B O   1 
ATOM   4553  C  CB  . MET B  1 48  ? 5.402   40.624  52.860  1.00 33.40  ? 48   MET B CB  1 
ATOM   4554  C  CG  . MET B  1 48  ? 5.920   40.300  51.488  1.00 33.80  ? 48   MET B CG  1 
ATOM   4555  S  SD  . MET B  1 48  ? 7.326   41.283  50.992  1.00 129.38 ? 48   MET B SD  1 
ATOM   4556  C  CE  . MET B  1 48  ? 8.453   40.904  52.319  1.00 32.62  ? 48   MET B CE  1 
ATOM   4557  N  N   . PRO B  1 49  ? 4.982   39.988  55.974  1.00 41.26  ? 49   PRO B N   1 
ATOM   4558  C  CA  . PRO B  1 49  ? 4.425   40.397  57.260  1.00 35.61  ? 49   PRO B CA  1 
ATOM   4559  C  C   . PRO B  1 49  ? 3.470   41.562  57.088  1.00 42.71  ? 49   PRO B C   1 
ATOM   4560  O  O   . PRO B  1 49  ? 3.718   42.401  56.220  1.00 47.76  ? 49   PRO B O   1 
ATOM   4561  C  CB  . PRO B  1 49  ? 5.665   40.826  58.044  1.00 36.05  ? 49   PRO B CB  1 
ATOM   4562  C  CG  . PRO B  1 49  ? 6.835   40.714  57.083  1.00 35.05  ? 49   PRO B CG  1 
ATOM   4563  C  CD  . PRO B  1 49  ? 6.431   39.749  56.066  1.00 33.66  ? 49   PRO B CD  1 
ATOM   4564  N  N   . PRO B  1 50  ? 2.382   41.605  57.877  1.00 43.51  ? 50   PRO B N   1 
ATOM   4565  C  CA  . PRO B  1 50  ? 1.382   42.668  57.712  1.00 49.02  ? 50   PRO B CA  1 
ATOM   4566  C  C   . PRO B  1 50  ? 1.971   44.016  58.073  1.00 58.89  ? 50   PRO B C   1 
ATOM   4567  O  O   . PRO B  1 50  ? 2.863   44.092  58.918  1.00 69.59  ? 50   PRO B O   1 
ATOM   4568  C  CB  . PRO B  1 50  ? 0.295   42.293  58.716  1.00 47.17  ? 50   PRO B CB  1 
ATOM   4569  C  CG  . PRO B  1 50  ? 1.032   41.535  59.774  1.00 51.73  ? 50   PRO B CG  1 
ATOM   4570  C  CD  . PRO B  1 50  ? 2.086   40.752  59.037  1.00 46.62  ? 50   PRO B CD  1 
ATOM   4571  N  N   . GLU B  1 51  ? 1.493   45.066  57.423  1.00 57.44  ? 51   GLU B N   1 
ATOM   4572  C  CA  . GLU B  1 51  ? 1.944   46.410  57.737  1.00 59.08  ? 51   GLU B CA  1 
ATOM   4573  C  C   . GLU B  1 51  ? 0.771   47.190  58.298  1.00 57.90  ? 51   GLU B C   1 
ATOM   4574  O  O   . GLU B  1 51  ? -0.376  46.990  57.883  1.00 54.18  ? 51   GLU B O   1 
ATOM   4575  C  CB  . GLU B  1 51  ? 2.501   47.097  56.496  1.00 65.20  ? 51   GLU B CB  1 
ATOM   4576  C  CG  . GLU B  1 51  ? 4.012   47.205  56.461  1.00 71.79  ? 51   GLU B CG  1 
ATOM   4577  C  CD  . GLU B  1 51  ? 4.518   47.637  55.091  1.00 83.70  ? 51   GLU B CD  1 
ATOM   4578  O  OE1 . GLU B  1 51  ? 3.714   47.621  54.123  1.00 84.72  ? 51   GLU B OE1 1 
ATOM   4579  O  OE2 . GLU B  1 51  ? 5.714   47.992  54.982  1.00 88.26  ? 51   GLU B OE2 1 
ATOM   4580  N  N   . PRO B  1 52  ? 1.053   48.079  59.256  1.00 55.80  ? 52   PRO B N   1 
ATOM   4581  C  CA  . PRO B  1 52  ? -0.017  48.784  59.965  1.00 57.97  ? 52   PRO B CA  1 
ATOM   4582  C  C   . PRO B  1 52  ? -0.848  49.642  59.019  1.00 60.89  ? 52   PRO B C   1 
ATOM   4583  O  O   . PRO B  1 52  ? -0.301  50.265  58.104  1.00 58.77  ? 52   PRO B O   1 
ATOM   4584  C  CB  . PRO B  1 52  ? 0.743   49.651  60.964  1.00 50.73  ? 52   PRO B CB  1 
ATOM   4585  C  CG  . PRO B  1 52  ? 2.079   48.968  61.121  1.00 53.83  ? 52   PRO B CG  1 
ATOM   4586  C  CD  . PRO B  1 52  ? 2.388   48.427  59.769  1.00 49.35  ? 52   PRO B CD  1 
ATOM   4587  N  N   . LYS B  1 53  ? -2.160  49.639  59.239  1.00 63.30  ? 53   LYS B N   1 
ATOM   4588  C  CA  . LYS B  1 53  ? -3.105  50.395  58.433  1.00 52.17  ? 53   LYS B CA  1 
ATOM   4589  C  C   . LYS B  1 53  ? -2.741  51.871  58.486  1.00 75.01  ? 53   LYS B C   1 
ATOM   4590  O  O   . LYS B  1 53  ? -2.677  52.462  59.565  1.00 76.04  ? 53   LYS B O   1 
ATOM   4591  C  CB  . LYS B  1 53  ? -4.530  50.157  58.956  1.00 62.30  ? 53   LYS B CB  1 
ATOM   4592  C  CG  . LYS B  1 53  ? -5.625  50.927  58.245  1.00 54.50  ? 53   LYS B CG  1 
ATOM   4593  C  CD  . LYS B  1 53  ? -5.557  50.714  56.754  1.00 61.33  ? 53   LYS B CD  1 
ATOM   4594  C  CE  . LYS B  1 53  ? -6.683  51.428  56.028  1.00 58.78  ? 53   LYS B CE  1 
ATOM   4595  N  NZ  . LYS B  1 53  ? -6.551  51.242  54.556  1.00 56.19  ? 53   LYS B NZ  1 
ATOM   4596  N  N   . ARG B  1 54  ? -2.468  52.459  57.324  1.00 72.67  ? 54   ARG B N   1 
ATOM   4597  C  CA  . ARG B  1 54  ? -2.143  53.876  57.257  1.00 72.32  ? 54   ARG B CA  1 
ATOM   4598  C  C   . ARG B  1 54  ? -3.426  54.607  57.556  1.00 77.74  ? 54   ARG B C   1 
ATOM   4599  O  O   . ARG B  1 54  ? -4.495  54.157  57.131  1.00 80.67  ? 54   ARG B O   1 
ATOM   4600  C  CB  . ARG B  1 54  ? -1.609  54.255  55.876  1.00 78.13  ? 54   ARG B CB  1 
ATOM   4601  C  CG  . ARG B  1 54  ? -0.450  53.374  55.402  1.00 86.95  ? 54   ARG B CG  1 
ATOM   4602  C  CD  . ARG B  1 54  ? 0.685   54.180  54.797  1.00 91.20  ? 54   ARG B CD  1 
ATOM   4603  N  NE  . ARG B  1 54  ? 0.232   54.992  53.677  1.00 96.64  ? 54   ARG B NE  1 
ATOM   4604  C  CZ  . ARG B  1 54  ? 0.953   55.959  53.122  1.00 103.08 ? 54   ARG B CZ  1 
ATOM   4605  N  NH1 . ARG B  1 54  ? 2.167   56.235  53.587  1.00 103.99 ? 54   ARG B NH1 1 
ATOM   4606  N  NH2 . ARG B  1 54  ? 0.460   56.654  52.106  1.00 105.59 ? 54   ARG B NH2 1 
ATOM   4607  N  N   . PRO B  1 55  ? -3.331  55.724  58.306  1.00 79.18  ? 55   PRO B N   1 
ATOM   4608  C  CA  . PRO B  1 55  ? -4.478  56.503  58.813  1.00 74.07  ? 55   PRO B CA  1 
ATOM   4609  C  C   . PRO B  1 55  ? -5.468  56.924  57.720  1.00 67.48  ? 55   PRO B C   1 
ATOM   4610  O  O   . PRO B  1 55  ? -5.087  57.056  56.555  1.00 64.28  ? 55   PRO B O   1 
ATOM   4611  C  CB  . PRO B  1 55  ? -3.815  57.736  59.432  1.00 71.98  ? 55   PRO B CB  1 
ATOM   4612  C  CG  . PRO B  1 55  ? -2.434  57.289  59.780  1.00 72.51  ? 55   PRO B CG  1 
ATOM   4613  C  CD  . PRO B  1 55  ? -2.042  56.318  58.709  1.00 73.66  ? 55   PRO B CD  1 
ATOM   4614  N  N   . TRP B  1 56  ? -6.729  57.128  58.087  1.00 68.21  ? 56   TRP B N   1 
ATOM   4615  C  CA  . TRP B  1 56  ? -7.726  57.540  57.101  1.00 76.30  ? 56   TRP B CA  1 
ATOM   4616  C  C   . TRP B  1 56  ? -8.487  58.813  57.481  1.00 85.81  ? 56   TRP B C   1 
ATOM   4617  O  O   . TRP B  1 56  ? -8.463  59.265  58.633  1.00 89.60  ? 56   TRP B O   1 
ATOM   4618  C  CB  . TRP B  1 56  ? -8.719  56.414  56.832  1.00 73.59  ? 56   TRP B CB  1 
ATOM   4619  C  CG  . TRP B  1 56  ? -9.604  56.139  57.994  1.00 76.18  ? 56   TRP B CG  1 
ATOM   4620  C  CD1 . TRP B  1 56  ? -10.831 56.687  58.244  1.00 79.42  ? 56   TRP B CD1 1 
ATOM   4621  C  CD2 . TRP B  1 56  ? -9.332  55.252  59.081  1.00 74.74  ? 56   TRP B CD2 1 
ATOM   4622  N  NE1 . TRP B  1 56  ? -11.340 56.189  59.419  1.00 78.11  ? 56   TRP B NE1 1 
ATOM   4623  C  CE2 . TRP B  1 56  ? -10.438 55.306  59.952  1.00 75.06  ? 56   TRP B CE2 1 
ATOM   4624  C  CE3 . TRP B  1 56  ? -8.263  54.408  59.398  1.00 72.57  ? 56   TRP B CE3 1 
ATOM   4625  C  CZ2 . TRP B  1 56  ? -10.503 54.555  61.116  1.00 74.91  ? 56   TRP B CZ2 1 
ATOM   4626  C  CZ3 . TRP B  1 56  ? -8.330  53.663  60.554  1.00 73.45  ? 56   TRP B CZ3 1 
ATOM   4627  C  CH2 . TRP B  1 56  ? -9.440  53.741  61.400  1.00 75.08  ? 56   TRP B CH2 1 
ATOM   4628  N  N   . SER B  1 57  ? -9.166  59.382  56.491  1.00 84.91  ? 57   SER B N   1 
ATOM   4629  C  CA  . SER B  1 57  ? -9.981  60.562  56.713  1.00 86.13  ? 57   SER B CA  1 
ATOM   4630  C  C   . SER B  1 57  ? -11.455 60.186  56.679  1.00 87.55  ? 57   SER B C   1 
ATOM   4631  O  O   . SER B  1 57  ? -11.865 59.289  55.932  1.00 82.32  ? 57   SER B O   1 
ATOM   4632  C  CB  . SER B  1 57  ? -9.688  61.629  55.656  1.00 87.70  ? 57   SER B CB  1 
ATOM   4633  O  OG  . SER B  1 57  ? -10.178 61.237  54.382  1.00 86.83  ? 57   SER B OG  1 
ATOM   4634  N  N   . GLY B  1 58  ? -12.238 60.873  57.507  1.00 93.55  ? 58   GLY B N   1 
ATOM   4635  C  CA  . GLY B  1 58  ? -13.682 60.734  57.519  1.00 92.86  ? 58   GLY B CA  1 
ATOM   4636  C  C   . GLY B  1 58  ? -14.244 59.666  58.441  1.00 92.38  ? 58   GLY B C   1 
ATOM   4637  O  O   . GLY B  1 58  ? -13.558 59.132  59.316  1.00 74.58  ? 58   GLY B O   1 
ATOM   4638  N  N   . VAL B  1 59  ? -15.528 59.389  58.249  1.00 95.03  ? 59   VAL B N   1 
ATOM   4639  C  CA  . VAL B  1 59  ? -16.192 58.271  58.889  1.00 97.29  ? 59   VAL B CA  1 
ATOM   4640  C  C   . VAL B  1 59  ? -15.857 57.041  58.069  1.00 97.71  ? 59   VAL B C   1 
ATOM   4641  O  O   . VAL B  1 59  ? -15.945 57.061  56.839  1.00 100.63 ? 59   VAL B O   1 
ATOM   4642  C  CB  . VAL B  1 59  ? -17.733 58.463  58.914  1.00 94.06  ? 59   VAL B CB  1 
ATOM   4643  C  CG1 . VAL B  1 59  ? -18.470 57.122  58.856  1.00 90.60  ? 59   VAL B CG1 1 
ATOM   4644  C  CG2 . VAL B  1 59  ? -18.160 59.263  60.130  1.00 96.38  ? 59   VAL B CG2 1 
ATOM   4645  N  N   . LEU B  1 60  ? -15.443 55.981  58.750  1.00 92.89  ? 60   LEU B N   1 
ATOM   4646  C  CA  . LEU B  1 60  ? -15.244 54.696  58.109  1.00 81.50  ? 60   LEU B CA  1 
ATOM   4647  C  C   . LEU B  1 60  ? -16.442 53.834  58.467  1.00 76.18  ? 60   LEU B C   1 
ATOM   4648  O  O   . LEU B  1 60  ? -16.832 53.760  59.628  1.00 77.71  ? 60   LEU B O   1 
ATOM   4649  C  CB  . LEU B  1 60  ? -13.947 54.061  58.600  1.00 77.94  ? 60   LEU B CB  1 
ATOM   4650  C  CG  . LEU B  1 60  ? -13.466 52.785  57.923  1.00 63.77  ? 60   LEU B CG  1 
ATOM   4651  C  CD1 . LEU B  1 60  ? -11.986 52.699  58.132  1.00 99.52  ? 60   LEU B CD1 1 
ATOM   4652  C  CD2 . LEU B  1 60  ? -14.138 51.564  58.513  1.00 63.21  ? 60   LEU B CD2 1 
ATOM   4653  N  N   . ASP B  1 61  ? -17.032 53.182  57.476  1.00 73.45  ? 61   ASP B N   1 
ATOM   4654  C  CA  . ASP B  1 61  ? -18.210 52.375  57.740  1.00 75.75  ? 61   ASP B CA  1 
ATOM   4655  C  C   . ASP B  1 61  ? -17.843 51.032  58.360  1.00 73.12  ? 61   ASP B C   1 
ATOM   4656  O  O   . ASP B  1 61  ? -17.254 50.166  57.704  1.00 64.24  ? 61   ASP B O   1 
ATOM   4657  C  CB  . ASP B  1 61  ? -19.024 52.164  56.470  1.00 82.46  ? 61   ASP B CB  1 
ATOM   4658  C  CG  . ASP B  1 61  ? -20.414 51.656  56.762  1.00 91.50  ? 61   ASP B CG  1 
ATOM   4659  O  OD1 . ASP B  1 61  ? -20.587 50.423  56.853  1.00 92.54  ? 61   ASP B OD1 1 
ATOM   4660  O  OD2 . ASP B  1 61  ? -21.330 52.491  56.919  1.00 99.22  ? 61   ASP B OD2 1 
ATOM   4661  N  N   . ALA B  1 62  ? -18.193 50.872  59.633  1.00 73.23  ? 62   ALA B N   1 
ATOM   4662  C  CA  . ALA B  1 62  ? -17.922 49.637  60.358  1.00 71.13  ? 62   ALA B CA  1 
ATOM   4663  C  C   . ALA B  1 62  ? -19.235 48.999  60.767  1.00 71.80  ? 62   ALA B C   1 
ATOM   4664  O  O   . ALA B  1 62  ? -19.426 48.651  61.928  1.00 71.87  ? 62   ALA B O   1 
ATOM   4665  C  CB  . ALA B  1 62  ? -17.065 49.915  61.582  1.00 70.21  ? 62   ALA B CB  1 
ATOM   4666  N  N   . THR B  1 63  ? -20.134 48.843  59.802  1.00 73.06  ? 63   THR B N   1 
ATOM   4667  C  CA  . THR B  1 63  ? -21.489 48.388  60.080  1.00 76.43  ? 63   THR B CA  1 
ATOM   4668  C  C   . THR B  1 63  ? -21.757 46.998  59.516  1.00 76.54  ? 63   THR B C   1 
ATOM   4669  O  O   . THR B  1 63  ? -22.791 46.384  59.805  1.00 68.33  ? 63   THR B O   1 
ATOM   4670  C  CB  . THR B  1 63  ? -22.508 49.372  59.497  1.00 79.45  ? 63   THR B CB  1 
ATOM   4671  O  OG1 . THR B  1 63  ? -22.721 49.090  58.110  1.00 70.24  ? 63   THR B OG1 1 
ATOM   4672  C  CG2 . THR B  1 63  ? -21.992 50.789  59.647  1.00 82.13  ? 63   THR B CG2 1 
ATOM   4673  N  N   . THR B  1 64  ? -20.818 46.509  58.711  1.00 74.06  ? 64   THR B N   1 
ATOM   4674  C  CA  . THR B  1 64  ? -20.962 45.204  58.082  1.00 75.79  ? 64   THR B CA  1 
ATOM   4675  C  C   . THR B  1 64  ? -19.637 44.435  58.010  1.00 72.64  ? 64   THR B C   1 
ATOM   4676  O  O   . THR B  1 64  ? -18.570 45.028  57.810  1.00 70.14  ? 64   THR B O   1 
ATOM   4677  C  CB  . THR B  1 64  ? -21.581 45.331  56.676  1.00 81.35  ? 64   THR B CB  1 
ATOM   4678  O  OG1 . THR B  1 64  ? -21.751 44.028  56.105  1.00 83.69  ? 64   THR B OG1 1 
ATOM   4679  C  CG2 . THR B  1 64  ? -20.705 46.197  55.765  1.00 62.36  ? 64   THR B CG2 1 
ATOM   4680  N  N   . PHE B  1 65  ? -19.722 43.115  58.182  1.00 69.05  ? 65   PHE B N   1 
ATOM   4681  C  CA  . PHE B  1 65  ? -18.559 42.232  58.099  1.00 65.06  ? 65   PHE B CA  1 
ATOM   4682  C  C   . PHE B  1 65  ? -17.800 42.414  56.793  1.00 66.37  ? 65   PHE B C   1 
ATOM   4683  O  O   . PHE B  1 65  ? -18.385 42.709  55.747  1.00 55.50  ? 65   PHE B O   1 
ATOM   4684  C  CB  . PHE B  1 65  ? -18.971 40.759  58.246  1.00 66.24  ? 65   PHE B CB  1 
ATOM   4685  C  CG  . PHE B  1 65  ? -19.146 40.302  59.680  1.00 70.02  ? 65   PHE B CG  1 
ATOM   4686  C  CD1 . PHE B  1 65  ? -18.211 40.630  60.655  1.00 65.86  ? 65   PHE B CD1 1 
ATOM   4687  C  CD2 . PHE B  1 65  ? -20.251 39.537  60.049  1.00 69.25  ? 65   PHE B CD2 1 
ATOM   4688  C  CE1 . PHE B  1 65  ? -18.378 40.212  61.967  1.00 61.14  ? 65   PHE B CE1 1 
ATOM   4689  C  CE2 . PHE B  1 65  ? -20.420 39.110  61.359  1.00 63.49  ? 65   PHE B CE2 1 
ATOM   4690  C  CZ  . PHE B  1 65  ? -19.484 39.450  62.317  1.00 61.89  ? 65   PHE B CZ  1 
ATOM   4691  N  N   . GLN B  1 66  ? -16.487 42.235  56.868  1.00 66.51  ? 66   GLN B N   1 
ATOM   4692  C  CA  . GLN B  1 66  ? -15.630 42.360  55.701  1.00 64.97  ? 66   GLN B CA  1 
ATOM   4693  C  C   . GLN B  1 66  ? -15.365 41.015  55.038  1.00 61.90  ? 66   GLN B C   1 
ATOM   4694  O  O   . GLN B  1 66  ? -15.867 39.974  55.473  1.00 60.30  ? 66   GLN B O   1 
ATOM   4695  C  CB  . GLN B  1 66  ? -14.310 43.025  56.075  1.00 51.27  ? 66   GLN B CB  1 
ATOM   4696  C  CG  . GLN B  1 66  ? -14.260 44.513  55.817  1.00 67.37  ? 66   GLN B CG  1 
ATOM   4697  C  CD  . GLN B  1 66  ? -14.117 44.858  54.340  1.00 71.03  ? 66   GLN B CD  1 
ATOM   4698  O  OE1 . GLN B  1 66  ? -14.483 44.072  53.463  1.00 68.26  ? 66   GLN B OE1 1 
ATOM   4699  N  NE2 . GLN B  1 66  ? -13.582 46.043  54.059  1.00 76.20  ? 66   GLN B NE2 1 
ATOM   4700  N  N   . ASN B  1 67  ? -14.571 41.048  53.978  1.00 61.42  ? 67   ASN B N   1 
ATOM   4701  C  CA  . ASN B  1 67  ? -14.239 39.844  53.229  1.00 62.33  ? 67   ASN B CA  1 
ATOM   4702  C  C   . ASN B  1 67  ? -13.545 38.776  54.055  1.00 60.34  ? 67   ASN B C   1 
ATOM   4703  O  O   . ASN B  1 67  ? -12.731 39.067  54.935  1.00 61.13  ? 67   ASN B O   1 
ATOM   4704  C  CB  . ASN B  1 67  ? -13.369 40.180  52.019  1.00 62.42  ? 67   ASN B CB  1 
ATOM   4705  C  CG  . ASN B  1 67  ? -14.035 41.148  51.080  1.00 67.93  ? 67   ASN B CG  1 
ATOM   4706  O  OD1 . ASN B  1 67  ? -15.264 41.153  50.931  1.00 75.65  ? 67   ASN B OD1 1 
ATOM   4707  N  ND2 . ASN B  1 67  ? -13.230 41.987  50.439  1.00 65.34  ? 67   ASN B ND2 1 
ATOM   4708  N  N   . VAL B  1 68  ? -13.897 37.533  53.757  1.00 57.28  ? 68   VAL B N   1 
ATOM   4709  C  CA  . VAL B  1 68  ? -13.201 36.377  54.276  1.00 53.98  ? 68   VAL B CA  1 
ATOM   4710  C  C   . VAL B  1 68  ? -11.860 36.302  53.555  1.00 40.86  ? 68   VAL B C   1 
ATOM   4711  O  O   . VAL B  1 68  ? -11.805 36.447  52.337  1.00 55.49  ? 68   VAL B O   1 
ATOM   4712  C  CB  . VAL B  1 68  ? -14.000 35.091  53.966  1.00 50.20  ? 68   VAL B CB  1 
ATOM   4713  C  CG1 . VAL B  1 68  ? -13.207 33.862  54.348  1.00 43.86  ? 68   VAL B CG1 1 
ATOM   4714  C  CG2 . VAL B  1 68  ? -15.349 35.107  54.650  1.00 44.64  ? 68   VAL B CG2 1 
ATOM   4715  N  N   . CYS B  1 69  ? -10.781 36.096  54.300  1.00 41.83  ? 69   CYS B N   1 
ATOM   4716  C  CA  . CYS B  1 69  ? -9.483  35.825  53.700  1.00 46.87  ? 69   CYS B CA  1 
ATOM   4717  C  C   . CYS B  1 69  ? -9.567  34.687  52.695  1.00 48.09  ? 69   CYS B C   1 
ATOM   4718  O  O   . CYS B  1 69  ? -10.328 33.739  52.895  1.00 51.21  ? 69   CYS B O   1 
ATOM   4719  C  CB  . CYS B  1 69  ? -8.483  35.470  54.782  1.00 37.58  ? 69   CYS B CB  1 
ATOM   4720  S  SG  . CYS B  1 69  ? -7.878  36.903  55.610  1.00 77.25  ? 69   CYS B SG  1 
ATOM   4721  N  N   . TYR B  1 70  ? -8.787  34.780  51.620  1.00 40.72  ? 70   TYR B N   1 
ATOM   4722  C  CA  . TYR B  1 70  ? -8.893  33.815  50.532  1.00 40.39  ? 70   TYR B CA  1 
ATOM   4723  C  C   . TYR B  1 70  ? -8.563  32.416  51.014  1.00 47.76  ? 70   TYR B C   1 
ATOM   4724  O  O   . TYR B  1 70  ? -7.611  32.225  51.767  1.00 54.86  ? 70   TYR B O   1 
ATOM   4725  C  CB  . TYR B  1 70  ? -8.015  34.204  49.344  1.00 41.20  ? 70   TYR B CB  1 
ATOM   4726  C  CG  . TYR B  1 70  ? -8.631  33.785  48.036  1.00 47.24  ? 70   TYR B CG  1 
ATOM   4727  C  CD1 . TYR B  1 70  ? -8.511  32.481  47.583  1.00 57.51  ? 70   TYR B CD1 1 
ATOM   4728  C  CD2 . TYR B  1 70  ? -9.370  34.677  47.275  1.00 43.59  ? 70   TYR B CD2 1 
ATOM   4729  C  CE1 . TYR B  1 70  ? -9.091  32.083  46.396  1.00 60.98  ? 70   TYR B CE1 1 
ATOM   4730  C  CE2 . TYR B  1 70  ? -9.953  34.291  46.093  1.00 46.03  ? 70   TYR B CE2 1 
ATOM   4731  C  CZ  . TYR B  1 70  ? -9.812  32.992  45.655  1.00 54.84  ? 70   TYR B CZ  1 
ATOM   4732  O  OH  . TYR B  1 70  ? -10.386 32.587  44.470  1.00 57.85  ? 70   TYR B OH  1 
ATOM   4733  N  N   . GLN B  1 71  ? -9.360  31.443  50.594  1.00 33.75  ? 71   GLN B N   1 
ATOM   4734  C  CA  . GLN B  1 71  ? -9.233  30.108  51.138  1.00 33.07  ? 71   GLN B CA  1 
ATOM   4735  C  C   . GLN B  1 71  ? -9.987  29.074  50.329  1.00 33.28  ? 71   GLN B C   1 
ATOM   4736  O  O   . GLN B  1 71  ? -10.792 29.412  49.473  1.00 34.20  ? 71   GLN B O   1 
ATOM   4737  C  CB  . GLN B  1 71  ? -9.720  30.088  52.576  1.00 34.00  ? 71   GLN B CB  1 
ATOM   4738  C  CG  . GLN B  1 71  ? -11.118 30.610  52.720  1.00 35.95  ? 71   GLN B CG  1 
ATOM   4739  C  CD  . GLN B  1 71  ? -11.555 30.706  54.156  1.00 62.50  ? 71   GLN B CD  1 
ATOM   4740  O  OE1 . GLN B  1 71  ? -12.439 29.974  54.596  1.00 63.45  ? 71   GLN B OE1 1 
ATOM   4741  N  NE2 . GLN B  1 71  ? -10.946 31.618  54.899  1.00 37.04  ? 71   GLN B NE2 1 
ATOM   4742  N  N   . TYR B  1 72  ? -9.695  27.807  50.609  1.00 32.48  ? 72   TYR B N   1 
ATOM   4743  C  CA  . TYR B  1 72  ? -10.353 26.674  49.977  1.00 45.59  ? 72   TYR B CA  1 
ATOM   4744  C  C   . TYR B  1 72  ? -11.787 26.627  50.467  1.00 56.48  ? 72   TYR B C   1 
ATOM   4745  O  O   . TYR B  1 72  ? -12.073 27.061  51.578  1.00 64.68  ? 72   TYR B O   1 
ATOM   4746  C  CB  . TYR B  1 72  ? -9.617  25.386  50.363  1.00 44.84  ? 72   TYR B CB  1 
ATOM   4747  C  CG  . TYR B  1 72  ? -10.299 24.093  49.947  1.00 52.56  ? 72   TYR B CG  1 
ATOM   4748  C  CD1 . TYR B  1 72  ? -11.250 23.491  50.762  1.00 56.14  ? 72   TYR B CD1 1 
ATOM   4749  C  CD2 . TYR B  1 72  ? -9.968  23.457  48.756  1.00 56.76  ? 72   TYR B CD2 1 
ATOM   4750  C  CE1 . TYR B  1 72  ? -11.877 22.311  50.391  1.00 59.89  ? 72   TYR B CE1 1 
ATOM   4751  C  CE2 . TYR B  1 72  ? -10.591 22.273  48.380  1.00 59.87  ? 72   TYR B CE2 1 
ATOM   4752  C  CZ  . TYR B  1 72  ? -11.546 21.708  49.203  1.00 60.02  ? 72   TYR B CZ  1 
ATOM   4753  O  OH  . TYR B  1 72  ? -12.174 20.538  48.842  1.00 61.96  ? 72   TYR B OH  1 
ATOM   4754  N  N   . VAL B  1 73  ? -12.696 26.104  49.653  1.00 57.61  ? 73   VAL B N   1 
ATOM   4755  C  CA  . VAL B  1 73  ? -14.091 25.979  50.082  1.00 60.83  ? 73   VAL B CA  1 
ATOM   4756  C  C   . VAL B  1 73  ? -14.560 24.520  50.111  1.00 66.50  ? 73   VAL B C   1 
ATOM   4757  O  O   . VAL B  1 73  ? -14.400 23.795  49.130  1.00 75.68  ? 73   VAL B O   1 
ATOM   4758  C  CB  . VAL B  1 73  ? -15.026 26.817  49.196  1.00 61.22  ? 73   VAL B CB  1 
ATOM   4759  C  CG1 . VAL B  1 73  ? -16.453 26.433  49.445  1.00 40.45  ? 73   VAL B CG1 1 
ATOM   4760  C  CG2 . VAL B  1 73  ? -14.815 28.295  49.459  1.00 38.82  ? 73   VAL B CG2 1 
ATOM   4761  N  N   . ASP B  1 74  ? -15.131 24.099  51.240  1.00 64.27  ? 74   ASP B N   1 
ATOM   4762  C  CA  . ASP B  1 74  ? -15.539 22.707  51.451  1.00 65.17  ? 74   ASP B CA  1 
ATOM   4763  C  C   . ASP B  1 74  ? -16.659 22.271  50.494  1.00 67.88  ? 74   ASP B C   1 
ATOM   4764  O  O   . ASP B  1 74  ? -17.810 22.696  50.626  1.00 64.65  ? 74   ASP B O   1 
ATOM   4765  C  CB  . ASP B  1 74  ? -15.973 22.509  52.907  1.00 67.49  ? 74   ASP B CB  1 
ATOM   4766  C  CG  . ASP B  1 74  ? -16.010 21.046  53.322  1.00 71.51  ? 74   ASP B CG  1 
ATOM   4767  O  OD1 . ASP B  1 74  ? -15.978 20.162  52.438  1.00 71.02  ? 74   ASP B OD1 1 
ATOM   4768  O  OD2 . ASP B  1 74  ? -16.085 20.782  54.543  1.00 75.00  ? 74   ASP B OD2 1 
ATOM   4769  N  N   . THR B  1 75  ? -16.306 21.409  49.541  1.00 72.49  ? 75   THR B N   1 
ATOM   4770  C  CA  . THR B  1 75  ? -17.242 20.928  48.527  1.00 71.44  ? 75   THR B CA  1 
ATOM   4771  C  C   . THR B  1 75  ? -17.813 19.562  48.899  1.00 72.68  ? 75   THR B C   1 
ATOM   4772  O  O   . THR B  1 75  ? -18.749 19.088  48.250  1.00 74.33  ? 75   THR B O   1 
ATOM   4773  C  CB  . THR B  1 75  ? -16.577 20.811  47.124  1.00 76.30  ? 75   THR B CB  1 
ATOM   4774  O  OG1 . THR B  1 75  ? -15.594 19.765  47.133  1.00 75.39  ? 75   THR B OG1 1 
ATOM   4775  C  CG2 . THR B  1 75  ? -15.920 22.127  46.706  1.00 71.66  ? 75   THR B CG2 1 
ATOM   4776  N  N   . LEU B  1 76  ? -17.251 18.948  49.945  1.00 71.06  ? 76   LEU B N   1 
ATOM   4777  C  CA  . LEU B  1 76  ? -17.608 17.581  50.361  1.00 71.73  ? 76   LEU B CA  1 
ATOM   4778  C  C   . LEU B  1 76  ? -19.112 17.263  50.485  1.00 75.30  ? 76   LEU B C   1 
ATOM   4779  O  O   . LEU B  1 76  ? -19.610 16.376  49.795  1.00 81.75  ? 76   LEU B O   1 
ATOM   4780  C  CB  . LEU B  1 76  ? -16.888 17.182  51.657  1.00 66.59  ? 76   LEU B CB  1 
ATOM   4781  C  CG  . LEU B  1 76  ? -17.315 15.800  52.183  1.00 61.59  ? 76   LEU B CG  1 
ATOM   4782  C  CD1 . LEU B  1 76  ? -17.007 14.696  51.173  1.00 56.41  ? 76   LEU B CD1 1 
ATOM   4783  C  CD2 . LEU B  1 76  ? -16.724 15.470  53.554  1.00 55.98  ? 76   LEU B CD2 1 
ATOM   4784  N  N   . TYR B  1 77  ? -19.827 17.948  51.373  1.00 69.40  ? 77   TYR B N   1 
ATOM   4785  C  CA  . TYR B  1 77  ? -21.260 17.684  51.522  1.00 76.22  ? 77   TYR B CA  1 
ATOM   4786  C  C   . TYR B  1 77  ? -22.083 18.932  51.200  1.00 77.53  ? 77   TYR B C   1 
ATOM   4787  O  O   . TYR B  1 77  ? -22.505 19.648  52.111  1.00 78.20  ? 77   TYR B O   1 
ATOM   4788  C  CB  . TYR B  1 77  ? -21.591 17.148  52.927  1.00 82.04  ? 77   TYR B CB  1 
ATOM   4789  C  CG  . TYR B  1 77  ? -21.153 15.706  53.176  1.00 86.19  ? 77   TYR B CG  1 
ATOM   4790  C  CD1 . TYR B  1 77  ? -21.462 14.694  52.271  1.00 90.15  ? 77   TYR B CD1 1 
ATOM   4791  C  CD2 . TYR B  1 77  ? -20.424 15.361  54.314  1.00 84.31  ? 77   TYR B CD2 1 
ATOM   4792  C  CE1 . TYR B  1 77  ? -21.059 13.377  52.494  1.00 89.54  ? 77   TYR B CE1 1 
ATOM   4793  C  CE2 . TYR B  1 77  ? -20.018 14.048  54.544  1.00 84.76  ? 77   TYR B CE2 1 
ATOM   4794  C  CZ  . TYR B  1 77  ? -20.339 13.062  53.631  1.00 86.84  ? 77   TYR B CZ  1 
ATOM   4795  O  OH  . TYR B  1 77  ? -19.934 11.761  53.847  1.00 85.90  ? 77   TYR B OH  1 
ATOM   4796  N  N   . PRO B  1 78  ? -22.324 19.178  49.895  1.00 73.22  ? 78   PRO B N   1 
ATOM   4797  C  CA  . PRO B  1 78  ? -22.930 20.396  49.336  1.00 66.63  ? 78   PRO B CA  1 
ATOM   4798  C  C   . PRO B  1 78  ? -24.345 20.683  49.837  1.00 62.49  ? 78   PRO B C   1 
ATOM   4799  O  O   . PRO B  1 78  ? -25.260 19.898  49.588  1.00 59.06  ? 78   PRO B O   1 
ATOM   4800  C  CB  . PRO B  1 78  ? -22.948 20.115  47.829  1.00 64.30  ? 78   PRO B CB  1 
ATOM   4801  C  CG  . PRO B  1 78  ? -22.927 18.634  47.713  1.00 63.90  ? 78   PRO B CG  1 
ATOM   4802  C  CD  . PRO B  1 78  ? -22.069 18.174  48.846  1.00 68.63  ? 78   PRO B CD  1 
ATOM   4803  N  N   . GLY B  1 79  ? -24.513 21.811  50.525  1.00 64.45  ? 79   GLY B N   1 
ATOM   4804  C  CA  . GLY B  1 79  ? -25.793 22.181  51.107  1.00 69.74  ? 79   GLY B CA  1 
ATOM   4805  C  C   . GLY B  1 79  ? -25.916 21.820  52.579  1.00 74.08  ? 79   GLY B C   1 
ATOM   4806  O  O   . GLY B  1 79  ? -26.399 22.618  53.385  1.00 75.02  ? 79   GLY B O   1 
ATOM   4807  N  N   . PHE B  1 80  ? -25.479 20.608  52.915  1.00 76.87  ? 80   PHE B N   1 
ATOM   4808  C  CA  . PHE B  1 80  ? -25.461 20.081  54.283  1.00 76.07  ? 80   PHE B CA  1 
ATOM   4809  C  C   . PHE B  1 80  ? -24.903 21.063  55.323  1.00 67.64  ? 80   PHE B C   1 
ATOM   4810  O  O   . PHE B  1 80  ? -23.759 21.518  55.225  1.00 68.07  ? 80   PHE B O   1 
ATOM   4811  C  CB  . PHE B  1 80  ? -24.665 18.769  54.293  1.00 80.98  ? 80   PHE B CB  1 
ATOM   4812  C  CG  . PHE B  1 80  ? -24.549 18.127  55.641  1.00 83.76  ? 80   PHE B CG  1 
ATOM   4813  C  CD1 . PHE B  1 80  ? -25.635 17.485  56.212  1.00 87.46  ? 80   PHE B CD1 1 
ATOM   4814  C  CD2 . PHE B  1 80  ? -23.344 18.140  56.326  1.00 79.88  ? 80   PHE B CD2 1 
ATOM   4815  C  CE1 . PHE B  1 80  ? -25.528 16.882  57.447  1.00 87.72  ? 80   PHE B CE1 1 
ATOM   4816  C  CE2 . PHE B  1 80  ? -23.232 17.537  57.555  1.00 80.24  ? 80   PHE B CE2 1 
ATOM   4817  C  CZ  . PHE B  1 80  ? -24.327 16.911  58.120  1.00 85.51  ? 80   PHE B CZ  1 
ATOM   4818  N  N   . GLU B  1 81  ? -25.729 21.369  56.318  1.00 63.02  ? 81   GLU B N   1 
ATOM   4819  C  CA  . GLU B  1 81  ? -25.414 22.355  57.351  1.00 72.73  ? 81   GLU B CA  1 
ATOM   4820  C  C   . GLU B  1 81  ? -24.100 22.071  58.079  1.00 70.09  ? 81   GLU B C   1 
ATOM   4821  O  O   . GLU B  1 81  ? -23.277 22.971  58.271  1.00 64.00  ? 81   GLU B O   1 
ATOM   4822  C  CB  . GLU B  1 81  ? -26.572 22.436  58.363  1.00 87.30  ? 81   GLU B CB  1 
ATOM   4823  C  CG  . GLU B  1 81  ? -26.346 23.378  59.546  1.00 94.56  ? 81   GLU B CG  1 
ATOM   4824  C  CD  . GLU B  1 81  ? -26.284 24.837  59.131  1.00 101.48 ? 81   GLU B CD  1 
ATOM   4825  O  OE1 . GLU B  1 81  ? -26.904 25.199  58.105  1.00 102.72 ? 81   GLU B OE1 1 
ATOM   4826  O  OE2 . GLU B  1 81  ? -25.610 25.623  59.830  1.00 104.43 ? 81   GLU B OE2 1 
ATOM   4827  N  N   . GLY B  1 82  ? -23.913 20.815  58.473  1.00 74.77  ? 82   GLY B N   1 
ATOM   4828  C  CA  . GLY B  1 82  ? -22.737 20.399  59.217  1.00 77.97  ? 82   GLY B CA  1 
ATOM   4829  C  C   . GLY B  1 82  ? -21.383 20.883  58.720  1.00 70.83  ? 82   GLY B C   1 
ATOM   4830  O  O   . GLY B  1 82  ? -20.499 21.165  59.526  1.00 69.82  ? 82   GLY B O   1 
ATOM   4831  N  N   . THR B  1 83  ? -21.198 20.978  57.408  1.00 64.23  ? 83   THR B N   1 
ATOM   4832  C  CA  . THR B  1 83  ? -19.954 21.547  56.898  1.00 60.52  ? 83   THR B CA  1 
ATOM   4833  C  C   . THR B  1 83  ? -20.149 22.990  56.420  1.00 62.96  ? 83   THR B C   1 
ATOM   4834  O  O   . THR B  1 83  ? -19.244 23.821  56.528  1.00 58.11  ? 83   THR B O   1 
ATOM   4835  C  CB  . THR B  1 83  ? -19.360 20.698  55.771  1.00 55.05  ? 83   THR B CB  1 
ATOM   4836  O  OG1 . THR B  1 83  ? -19.895 21.116  54.511  1.00 45.86  ? 83   THR B OG1 1 
ATOM   4837  C  CG2 . THR B  1 83  ? -19.693 19.255  55.991  1.00 57.05  ? 83   THR B CG2 1 
ATOM   4838  N  N   . GLU B  1 84  ? -21.342 23.282  55.909  1.00 65.74  ? 84   GLU B N   1 
ATOM   4839  C  CA  . GLU B  1 84  ? -21.651 24.599  55.372  1.00 60.82  ? 84   GLU B CA  1 
ATOM   4840  C  C   . GLU B  1 84  ? -21.469 25.691  56.420  1.00 57.94  ? 84   GLU B C   1 
ATOM   4841  O  O   . GLU B  1 84  ? -21.056 26.801  56.100  1.00 63.51  ? 84   GLU B O   1 
ATOM   4842  C  CB  . GLU B  1 84  ? -23.080 24.629  54.839  1.00 70.04  ? 84   GLU B CB  1 
ATOM   4843  C  CG  . GLU B  1 84  ? -23.296 25.572  53.659  1.00 74.97  ? 84   GLU B CG  1 
ATOM   4844  C  CD  . GLU B  1 84  ? -22.802 24.982  52.353  1.00 74.61  ? 84   GLU B CD  1 
ATOM   4845  O  OE1 . GLU B  1 84  ? -22.701 23.738  52.258  1.00 67.50  ? 84   GLU B OE1 1 
ATOM   4846  O  OE2 . GLU B  1 84  ? -22.509 25.764  51.424  1.00 80.78  ? 84   GLU B OE2 1 
ATOM   4847  N  N   . MET B  1 85  ? -21.764 25.367  57.675  1.00 55.44  ? 85   MET B N   1 
ATOM   4848  C  CA  . MET B  1 85  ? -21.630 26.319  58.780  1.00 58.33  ? 85   MET B CA  1 
ATOM   4849  C  C   . MET B  1 85  ? -20.220 26.885  58.940  1.00 56.14  ? 85   MET B C   1 
ATOM   4850  O  O   . MET B  1 85  ? -20.034 27.952  59.530  1.00 53.85  ? 85   MET B O   1 
ATOM   4851  C  CB  . MET B  1 85  ? -22.030 25.651  60.087  1.00 60.99  ? 85   MET B CB  1 
ATOM   4852  C  CG  . MET B  1 85  ? -21.287 24.377  60.365  1.00 51.58  ? 85   MET B CG  1 
ATOM   4853  S  SD  . MET B  1 85  ? -21.612 23.801  62.030  1.00 70.34  ? 85   MET B SD  1 
ATOM   4854  C  CE  . MET B  1 85  ? -21.084 25.240  62.951  1.00 53.20  ? 85   MET B CE  1 
ATOM   4855  N  N   . TRP B  1 86  ? -19.236 26.159  58.414  1.00 53.73  ? 86   TRP B N   1 
ATOM   4856  C  CA  . TRP B  1 86  ? -17.833 26.533  58.532  1.00 50.04  ? 86   TRP B CA  1 
ATOM   4857  C  C   . TRP B  1 86  ? -17.342 27.295  57.316  1.00 52.25  ? 86   TRP B C   1 
ATOM   4858  O  O   . TRP B  1 86  ? -16.338 28.009  57.390  1.00 55.32  ? 86   TRP B O   1 
ATOM   4859  C  CB  . TRP B  1 86  ? -16.982 25.281  58.705  1.00 51.92  ? 86   TRP B CB  1 
ATOM   4860  C  CG  . TRP B  1 86  ? -17.427 24.450  59.825  1.00 45.18  ? 86   TRP B CG  1 
ATOM   4861  C  CD1 . TRP B  1 86  ? -17.982 23.207  59.758  1.00 88.92  ? 86   TRP B CD1 1 
ATOM   4862  C  CD2 . TRP B  1 86  ? -17.382 24.801  61.206  1.00 61.32  ? 86   TRP B CD2 1 
ATOM   4863  N  NE1 . TRP B  1 86  ? -18.278 22.754  61.021  1.00 46.73  ? 86   TRP B NE1 1 
ATOM   4864  C  CE2 . TRP B  1 86  ? -17.921 23.717  61.929  1.00 61.20  ? 86   TRP B CE2 1 
ATOM   4865  C  CE3 . TRP B  1 86  ? -16.933 25.926  61.906  1.00 46.19  ? 86   TRP B CE3 1 
ATOM   4866  C  CZ2 . TRP B  1 86  ? -18.025 23.724  63.318  1.00 48.08  ? 86   TRP B CZ2 1 
ATOM   4867  C  CZ3 . TRP B  1 86  ? -17.037 25.936  63.285  1.00 56.38  ? 86   TRP B CZ3 1 
ATOM   4868  C  CH2 . TRP B  1 86  ? -17.578 24.839  63.977  1.00 55.99  ? 86   TRP B CH2 1 
ATOM   4869  N  N   . ASN B  1 87  ? -18.040 27.124  56.197  1.00 50.92  ? 87   ASN B N   1 
ATOM   4870  C  CA  . ASN B  1 87  ? -17.650 27.755  54.941  1.00 51.21  ? 87   ASN B CA  1 
ATOM   4871  C  C   . ASN B  1 87  ? -17.726 29.274  55.019  1.00 50.13  ? 87   ASN B C   1 
ATOM   4872  O  O   . ASN B  1 87  ? -18.362 29.815  55.926  1.00 46.59  ? 87   ASN B O   1 
ATOM   4873  C  CB  . ASN B  1 87  ? -18.506 27.222  53.790  1.00 59.75  ? 87   ASN B CB  1 
ATOM   4874  C  CG  . ASN B  1 87  ? -17.913 25.979  53.157  1.00 63.41  ? 87   ASN B CG  1 
ATOM   4875  O  OD1 . ASN B  1 87  ? -16.724 25.686  53.339  1.00 59.50  ? 87   ASN B OD1 1 
ATOM   4876  N  ND2 . ASN B  1 87  ? -18.735 25.241  52.403  1.00 65.69  ? 87   ASN B ND2 1 
ATOM   4877  N  N   . PRO B  1 88  ? -17.059 29.974  54.085  1.00 47.79  ? 88   PRO B N   1 
ATOM   4878  C  CA  . PRO B  1 88  ? -17.147 31.436  54.135  1.00 44.81  ? 88   PRO B CA  1 
ATOM   4879  C  C   . PRO B  1 88  ? -18.550 31.933  53.786  1.00 54.94  ? 88   PRO B C   1 
ATOM   4880  O  O   . PRO B  1 88  ? -19.190 31.390  52.880  1.00 52.66  ? 88   PRO B O   1 
ATOM   4881  C  CB  . PRO B  1 88  ? -16.121 31.887  53.091  1.00 43.20  ? 88   PRO B CB  1 
ATOM   4882  C  CG  . PRO B  1 88  ? -15.977 30.718  52.177  1.00 46.03  ? 88   PRO B CG  1 
ATOM   4883  C  CD  . PRO B  1 88  ? -16.124 29.514  53.045  1.00 44.39  ? 88   PRO B CD  1 
ATOM   4884  N  N   . ASN B  1 89  ? -19.015 32.945  54.520  1.00 56.57  ? 89   ASN B N   1 
ATOM   4885  C  CA  . ASN B  1 89  ? -20.336 33.529  54.322  1.00 65.36  ? 89   ASN B CA  1 
ATOM   4886  C  C   . ASN B  1 89  ? -20.277 34.901  53.644  1.00 72.29  ? 89   ASN B C   1 
ATOM   4887  O  O   . ASN B  1 89  ? -21.250 35.360  53.045  1.00 80.30  ? 89   ASN B O   1 
ATOM   4888  C  CB  . ASN B  1 89  ? -21.112 33.601  55.646  1.00 68.56  ? 89   ASN B CB  1 
ATOM   4889  C  CG  . ASN B  1 89  ? -20.362 34.356  56.740  1.00 65.57  ? 89   ASN B CG  1 
ATOM   4890  O  OD1 . ASN B  1 89  ? -19.274 34.895  56.516  1.00 61.26  ? 89   ASN B OD1 1 
ATOM   4891  N  ND2 . ASN B  1 89  ? -20.954 34.403  57.935  1.00 63.87  ? 89   ASN B ND2 1 
ATOM   4892  N  N   . ARG B  1 90  ? -19.130 35.557  53.744  1.00 66.67  ? 90   ARG B N   1 
ATOM   4893  C  CA  . ARG B  1 90  ? -18.891 36.753  52.961  1.00 66.96  ? 90   ARG B CA  1 
ATOM   4894  C  C   . ARG B  1 90  ? -18.203 36.387  51.648  1.00 64.72  ? 90   ARG B C   1 
ATOM   4895  O  O   . ARG B  1 90  ? -18.180 35.225  51.232  1.00 60.07  ? 90   ARG B O   1 
ATOM   4896  C  CB  . ARG B  1 90  ? -18.039 37.750  53.743  1.00 67.54  ? 90   ARG B CB  1 
ATOM   4897  C  CG  . ARG B  1 90  ? -18.793 38.500  54.815  1.00 71.87  ? 90   ARG B CG  1 
ATOM   4898  C  CD  . ARG B  1 90  ? -19.892 39.379  54.216  1.00 81.18  ? 90   ARG B CD  1 
ATOM   4899  N  NE  . ARG B  1 90  ? -20.570 40.182  55.235  1.00 84.96  ? 90   ARG B NE  1 
ATOM   4900  C  CZ  . ARG B  1 90  ? -21.558 39.735  56.007  1.00 81.40  ? 90   ARG B CZ  1 
ATOM   4901  N  NH1 . ARG B  1 90  ? -21.994 38.486  55.879  1.00 75.84  ? 90   ARG B NH1 1 
ATOM   4902  N  NH2 . ARG B  1 90  ? -22.107 40.536  56.914  1.00 81.52  ? 90   ARG B NH2 1 
ATOM   4903  N  N   . GLU B  1 91  ? -17.637 37.397  51.003  1.00 64.21  ? 91   GLU B N   1 
ATOM   4904  C  CA  . GLU B  1 91  ? -16.965 37.222  49.731  1.00 59.86  ? 91   GLU B CA  1 
ATOM   4905  C  C   . GLU B  1 91  ? -15.503 36.866  49.992  1.00 51.67  ? 91   GLU B C   1 
ATOM   4906  O  O   . GLU B  1 91  ? -14.944 37.225  51.025  1.00 47.95  ? 91   GLU B O   1 
ATOM   4907  C  CB  . GLU B  1 91  ? -17.068 38.527  48.946  1.00 66.56  ? 91   GLU B CB  1 
ATOM   4908  C  CG  . GLU B  1 91  ? -16.724 38.430  47.484  1.00 74.15  ? 91   GLU B CG  1 
ATOM   4909  C  CD  . GLU B  1 91  ? -16.333 39.783  46.897  1.00 81.68  ? 91   GLU B CD  1 
ATOM   4910  O  OE1 . GLU B  1 91  ? -16.722 40.829  47.479  1.00 76.95  ? 91   GLU B OE1 1 
ATOM   4911  O  OE2 . GLU B  1 91  ? -15.620 39.793  45.863  1.00 85.84  ? 91   GLU B OE2 1 
ATOM   4912  N  N   . LEU B  1 92  ? -14.878 36.153  49.068  1.00 46.98  ? 92   LEU B N   1 
ATOM   4913  C  CA  . LEU B  1 92  ? -13.460 35.869  49.212  1.00 40.86  ? 92   LEU B CA  1 
ATOM   4914  C  C   . LEU B  1 92  ? -12.609 36.975  48.602  1.00 47.29  ? 92   LEU B C   1 
ATOM   4915  O  O   . LEU B  1 92  ? -12.904 37.464  47.512  1.00 44.64  ? 92   LEU B O   1 
ATOM   4916  C  CB  . LEU B  1 92  ? -13.110 34.530  48.569  1.00 39.46  ? 92   LEU B CB  1 
ATOM   4917  C  CG  . LEU B  1 92  ? -13.453 33.283  49.377  1.00 49.61  ? 92   LEU B CG  1 
ATOM   4918  C  CD1 . LEU B  1 92  ? -13.019 32.038  48.636  1.00 37.99  ? 92   LEU B CD1 1 
ATOM   4919  C  CD2 . LEU B  1 92  ? -12.801 33.353  50.746  1.00 53.16  ? 92   LEU B CD2 1 
ATOM   4920  N  N   . SER B  1 93  ? -11.550 37.360  49.306  1.00 39.75  ? 93   SER B N   1 
ATOM   4921  C  CA  . SER B  1 93  ? -10.591 38.322  48.783  1.00 39.50  ? 93   SER B CA  1 
ATOM   4922  C  C   . SER B  1 93  ? -9.287  38.281  49.555  1.00 44.23  ? 93   SER B C   1 
ATOM   4923  O  O   . SER B  1 93  ? -9.259  37.844  50.695  1.00 43.92  ? 93   SER B O   1 
ATOM   4924  C  CB  . SER B  1 93  ? -11.149 39.728  48.871  1.00 44.28  ? 93   SER B CB  1 
ATOM   4925  O  OG  . SER B  1 93  ? -10.086 40.639  49.076  1.00 44.23  ? 93   SER B OG  1 
ATOM   4926  N  N   . GLU B  1 94  ? -8.203  38.748  48.949  1.00 37.84  ? 94   GLU B N   1 
ATOM   4927  C  CA  . GLU B  1 94  ? -6.946  38.798  49.671  1.00 37.13  ? 94   GLU B CA  1 
ATOM   4928  C  C   . GLU B  1 94  ? -6.936  40.004  50.588  1.00 51.34  ? 94   GLU B C   1 
ATOM   4929  O  O   . GLU B  1 94  ? -6.188  40.046  51.567  1.00 58.09  ? 94   GLU B O   1 
ATOM   4930  C  CB  . GLU B  1 94  ? -5.762  38.853  48.724  1.00 35.96  ? 94   GLU B CB  1 
ATOM   4931  C  CG  . GLU B  1 94  ? -5.461  37.553  48.018  1.00 39.21  ? 94   GLU B CG  1 
ATOM   4932  C  CD  . GLU B  1 94  ? -4.108  37.587  47.335  1.00 39.66  ? 94   GLU B CD  1 
ATOM   4933  O  OE1 . GLU B  1 94  ? -3.107  37.295  48.026  1.00 40.27  ? 94   GLU B OE1 1 
ATOM   4934  O  OE2 . GLU B  1 94  ? -4.042  37.924  46.125  1.00 38.88  ? 94   GLU B OE2 1 
ATOM   4935  N  N   . ASP B  1 95  ? -7.769  40.989  50.260  1.00 43.73  ? 95   ASP B N   1 
ATOM   4936  C  CA  . ASP B  1 95  ? -7.975  42.143  51.129  1.00 41.78  ? 95   ASP B CA  1 
ATOM   4937  C  C   . ASP B  1 95  ? -9.008  41.807  52.200  1.00 60.92  ? 95   ASP B C   1 
ATOM   4938  O  O   . ASP B  1 95  ? -10.223 41.846  51.952  1.00 43.79  ? 95   ASP B O   1 
ATOM   4939  C  CB  . ASP B  1 95  ? -8.433  43.350  50.327  1.00 43.08  ? 95   ASP B CB  1 
ATOM   4940  C  CG  . ASP B  1 95  ? -8.437  44.606  51.143  1.00 69.04  ? 95   ASP B CG  1 
ATOM   4941  O  OD1 . ASP B  1 95  ? -7.822  44.594  52.234  1.00 67.56  ? 95   ASP B OD1 1 
ATOM   4942  O  OD2 . ASP B  1 95  ? -9.048  45.599  50.696  1.00 71.13  ? 95   ASP B OD2 1 
ATOM   4943  N  N   . CYS B  1 96  ? -8.516  41.482  53.392  1.00 57.32  ? 96   CYS B N   1 
ATOM   4944  C  CA  . CYS B  1 96  ? -9.359  40.893  54.423  1.00 56.00  ? 96   CYS B CA  1 
ATOM   4945  C  C   . CYS B  1 96  ? -8.798  41.101  55.824  1.00 55.72  ? 96   CYS B C   1 
ATOM   4946  O  O   . CYS B  1 96  ? -9.341  40.572  56.795  1.00 54.83  ? 96   CYS B O   1 
ATOM   4947  C  CB  . CYS B  1 96  ? -9.533  39.392  54.163  1.00 57.32  ? 96   CYS B CB  1 
ATOM   4948  S  SG  . CYS B  1 96  ? -7.985  38.409  54.251  1.00 56.18  ? 96   CYS B SG  1 
ATOM   4949  N  N   . LEU B  1 97  ? -7.713  41.860  55.943  1.00 54.80  ? 97   LEU B N   1 
ATOM   4950  C  CA  . LEU B  1 97  ? -7.156  42.112  57.269  1.00 54.88  ? 97   LEU B CA  1 
ATOM   4951  C  C   . LEU B  1 97  ? -8.004  43.115  58.064  1.00 54.61  ? 97   LEU B C   1 
ATOM   4952  O  O   . LEU B  1 97  ? -7.609  44.264  58.284  1.00 47.65  ? 97   LEU B O   1 
ATOM   4953  C  CB  . LEU B  1 97  ? -5.688  42.529  57.186  1.00 43.50  ? 97   LEU B CB  1 
ATOM   4954  C  CG  . LEU B  1 97  ? -4.812  41.393  56.677  1.00 41.34  ? 97   LEU B CG  1 
ATOM   4955  C  CD1 . LEU B  1 97  ? -3.339  41.739  56.801  1.00 41.21  ? 97   LEU B CD1 1 
ATOM   4956  C  CD2 . LEU B  1 97  ? -5.137  40.133  57.430  1.00 40.69  ? 97   LEU B CD2 1 
ATOM   4957  N  N   . TYR B  1 98  ? -9.180  42.655  58.483  1.00 53.56  ? 98   TYR B N   1 
ATOM   4958  C  CA  . TYR B  1 98  ? -10.127 43.471  59.234  1.00 60.33  ? 98   TYR B CA  1 
ATOM   4959  C  C   . TYR B  1 98  ? -10.584 42.723  60.478  1.00 63.79  ? 98   TYR B C   1 
ATOM   4960  O  O   . TYR B  1 98  ? -10.796 41.507  60.443  1.00 61.02  ? 98   TYR B O   1 
ATOM   4961  C  CB  . TYR B  1 98  ? -11.352 43.809  58.383  1.00 50.55  ? 98   TYR B CB  1 
ATOM   4962  C  CG  . TYR B  1 98  ? -11.037 44.428  57.043  1.00 50.09  ? 98   TYR B CG  1 
ATOM   4963  C  CD1 . TYR B  1 98  ? -10.855 45.787  56.917  1.00 57.93  ? 98   TYR B CD1 1 
ATOM   4964  C  CD2 . TYR B  1 98  ? -10.935 43.651  55.902  1.00 52.95  ? 98   TYR B CD2 1 
ATOM   4965  C  CE1 . TYR B  1 98  ? -10.566 46.361  55.701  1.00 59.82  ? 98   TYR B CE1 1 
ATOM   4966  C  CE2 . TYR B  1 98  ? -10.651 44.213  54.677  1.00 54.58  ? 98   TYR B CE2 1 
ATOM   4967  C  CZ  . TYR B  1 98  ? -10.467 45.572  54.583  1.00 59.05  ? 98   TYR B CZ  1 
ATOM   4968  O  OH  . TYR B  1 98  ? -10.182 46.154  53.368  1.00 63.29  ? 98   TYR B OH  1 
ATOM   4969  N  N   . LEU B  1 99  ? -10.738 43.450  61.578  1.00 68.94  ? 99   LEU B N   1 
ATOM   4970  C  CA  . LEU B  1 99  ? -11.245 42.850  62.803  1.00 70.26  ? 99   LEU B CA  1 
ATOM   4971  C  C   . LEU B  1 99  ? -12.638 43.367  63.163  1.00 71.54  ? 99   LEU B C   1 
ATOM   4972  O  O   . LEU B  1 99  ? -13.204 44.243  62.496  1.00 55.93  ? 99   LEU B O   1 
ATOM   4973  C  CB  . LEU B  1 99  ? -10.252 43.024  63.960  1.00 52.68  ? 99   LEU B CB  1 
ATOM   4974  C  CG  . LEU B  1 99  ? -9.677  44.418  64.184  1.00 53.97  ? 99   LEU B CG  1 
ATOM   4975  C  CD1 . LEU B  1 99  ? -10.547 45.166  65.147  1.00 56.77  ? 99   LEU B CD1 1 
ATOM   4976  C  CD2 . LEU B  1 99  ? -8.263  44.353  64.703  1.00 53.04  ? 99   LEU B CD2 1 
ATOM   4977  N  N   . ASN B  1 100 ? -13.189 42.790  64.214  1.00 55.61  ? 100  ASN B N   1 
ATOM   4978  C  CA  . ASN B  1 100 ? -14.499 43.156  64.694  1.00 82.04  ? 100  ASN B CA  1 
ATOM   4979  C  C   . ASN B  1 100 ? -14.421 43.381  66.193  1.00 82.41  ? 100  ASN B C   1 
ATOM   4980  O  O   . ASN B  1 100 ? -13.713 42.647  66.896  1.00 80.53  ? 100  ASN B O   1 
ATOM   4981  C  CB  . ASN B  1 100 ? -15.492 42.043  64.388  1.00 57.50  ? 100  ASN B CB  1 
ATOM   4982  C  CG  . ASN B  1 100 ? -15.403 41.574  62.967  1.00 55.71  ? 100  ASN B CG  1 
ATOM   4983  O  OD1 . ASN B  1 100 ? -15.365 42.374  62.043  1.00 61.83  ? 100  ASN B OD1 1 
ATOM   4984  N  ND2 . ASN B  1 100 ? -15.350 40.268  62.782  1.00 55.62  ? 100  ASN B ND2 1 
ATOM   4985  N  N   . VAL B  1 101 ? -15.132 44.401  66.675  1.00 84.22  ? 101  VAL B N   1 
ATOM   4986  C  CA  . VAL B  1 101 ? -15.244 44.650  68.111  1.00 87.40  ? 101  VAL B CA  1 
ATOM   4987  C  C   . VAL B  1 101 ? -16.707 44.630  68.546  1.00 65.85  ? 101  VAL B C   1 
ATOM   4988  O  O   . VAL B  1 101 ? -17.579 45.101  67.825  1.00 66.81  ? 101  VAL B O   1 
ATOM   4989  C  CB  . VAL B  1 101 ? -14.604 45.997  68.508  1.00 65.02  ? 101  VAL B CB  1 
ATOM   4990  C  CG1 . VAL B  1 101 ? -14.589 46.158  70.016  1.00 66.75  ? 101  VAL B CG1 1 
ATOM   4991  C  CG2 . VAL B  1 101 ? -13.192 46.090  67.966  1.00 63.02  ? 101  VAL B CG2 1 
ATOM   4992  N  N   . TRP B  1 102 ? -16.975 44.059  69.716  1.00 66.67  ? 102  TRP B N   1 
ATOM   4993  C  CA  . TRP B  1 102 ? -18.296 44.156  70.338  1.00 79.74  ? 102  TRP B CA  1 
ATOM   4994  C  C   . TRP B  1 102 ? -18.173 44.778  71.734  1.00 85.87  ? 102  TRP B C   1 
ATOM   4995  O  O   . TRP B  1 102 ? -17.374 44.307  72.548  1.00 86.56  ? 102  TRP B O   1 
ATOM   4996  C  CB  . TRP B  1 102 ? -18.956 42.776  70.468  1.00 74.86  ? 102  TRP B CB  1 
ATOM   4997  C  CG  . TRP B  1 102 ? -19.592 42.206  69.214  1.00 75.04  ? 102  TRP B CG  1 
ATOM   4998  C  CD1 . TRP B  1 102 ? -20.887 42.359  68.808  1.00 75.40  ? 102  TRP B CD1 1 
ATOM   4999  C  CD2 . TRP B  1 102 ? -18.970 41.353  68.242  1.00 74.61  ? 102  TRP B CD2 1 
ATOM   5000  N  NE1 . TRP B  1 102 ? -21.104 41.671  67.638  1.00 71.26  ? 102  TRP B NE1 1 
ATOM   5001  C  CE2 . TRP B  1 102 ? -19.943 41.045  67.271  1.00 72.16  ? 102  TRP B CE2 1 
ATOM   5002  C  CE3 . TRP B  1 102 ? -17.682 40.825  68.096  1.00 75.81  ? 102  TRP B CE3 1 
ATOM   5003  C  CZ2 . TRP B  1 102 ? -19.667 40.241  66.170  1.00 73.70  ? 102  TRP B CZ2 1 
ATOM   5004  C  CZ3 . TRP B  1 102 ? -17.411 40.025  67.002  1.00 72.23  ? 102  TRP B CZ3 1 
ATOM   5005  C  CH2 . TRP B  1 102 ? -18.397 39.744  66.053  1.00 72.12  ? 102  TRP B CH2 1 
ATOM   5006  N  N   . THR B  1 103 ? -18.942 45.837  72.004  1.00 92.58  ? 103  THR B N   1 
ATOM   5007  C  CA  . THR B  1 103 ? -19.122 46.343  73.376  1.00 94.59  ? 103  THR B CA  1 
ATOM   5008  C  C   . THR B  1 103 ? -20.601 46.370  73.738  1.00 91.78  ? 103  THR B C   1 
ATOM   5009  O  O   . THR B  1 103 ? -21.449 46.359  72.852  1.00 79.15  ? 103  THR B O   1 
ATOM   5010  C  CB  . THR B  1 103 ? -18.515 47.747  73.610  1.00 77.82  ? 103  THR B CB  1 
ATOM   5011  O  OG1 . THR B  1 103 ? -18.090 48.324  72.372  1.00 76.58  ? 103  THR B OG1 1 
ATOM   5012  C  CG2 . THR B  1 103 ? -17.339 47.631  74.531  1.00 77.23  ? 103  THR B CG2 1 
ATOM   5013  N  N   . PRO B  1 104 ? -20.921 46.378  75.042  1.00 88.72  ? 104  PRO B N   1 
ATOM   5014  C  CA  . PRO B  1 104 ? -22.343 46.517  75.371  1.00 93.07  ? 104  PRO B CA  1 
ATOM   5015  C  C   . PRO B  1 104 ? -22.835 47.934  75.088  1.00 100.37 ? 104  PRO B C   1 
ATOM   5016  O  O   . PRO B  1 104 ? -22.022 48.851  74.952  1.00 102.99 ? 104  PRO B O   1 
ATOM   5017  C  CB  . PRO B  1 104 ? -22.387 46.218  76.872  1.00 93.80  ? 104  PRO B CB  1 
ATOM   5018  C  CG  . PRO B  1 104 ? -21.007 46.508  77.362  1.00 92.39  ? 104  PRO B CG  1 
ATOM   5019  C  CD  . PRO B  1 104 ? -20.096 46.132  76.238  1.00 87.12  ? 104  PRO B CD  1 
ATOM   5020  N  N   . TYR B  1 105 ? -24.150 48.101  74.976  1.00 104.20 ? 105  TYR B N   1 
ATOM   5021  C  CA  . TYR B  1 105 ? -24.751 49.420  74.794  1.00 105.12 ? 105  TYR B CA  1 
ATOM   5022  C  C   . TYR B  1 105 ? -25.492 49.832  76.068  1.00 107.99 ? 105  TYR B C   1 
ATOM   5023  O  O   . TYR B  1 105 ? -26.498 49.217  76.440  1.00 95.60  ? 105  TYR B O   1 
ATOM   5024  C  CB  . TYR B  1 105 ? -25.698 49.419  73.591  1.00 104.03 ? 105  TYR B CB  1 
ATOM   5025  C  CG  . TYR B  1 105 ? -26.117 50.796  73.127  1.00 106.56 ? 105  TYR B CG  1 
ATOM   5026  C  CD1 . TYR B  1 105 ? -25.220 51.636  72.479  1.00 108.12 ? 105  TYR B CD1 1 
ATOM   5027  C  CD2 . TYR B  1 105 ? -27.410 51.251  73.323  1.00 108.29 ? 105  TYR B CD2 1 
ATOM   5028  C  CE1 . TYR B  1 105 ? -25.599 52.894  72.048  1.00 107.27 ? 105  TYR B CE1 1 
ATOM   5029  C  CE2 . TYR B  1 105 ? -27.798 52.508  72.898  1.00 110.03 ? 105  TYR B CE2 1 
ATOM   5030  C  CZ  . TYR B  1 105 ? -26.887 53.323  72.264  1.00 110.62 ? 105  TYR B CZ  1 
ATOM   5031  O  OH  . TYR B  1 105 ? -27.272 54.573  71.843  1.00 118.26 ? 105  TYR B OH  1 
ATOM   5032  N  N   . PRO B  1 106 ? -24.999 50.880  76.745  1.00 106.00 ? 106  PRO B N   1 
ATOM   5033  C  CA  . PRO B  1 106 ? -23.887 51.748  76.351  1.00 102.97 ? 106  PRO B CA  1 
ATOM   5034  C  C   . PRO B  1 106 ? -22.547 51.171  76.751  1.00 104.97 ? 106  PRO B C   1 
ATOM   5035  O  O   . PRO B  1 106 ? -22.515 50.127  77.403  1.00 108.93 ? 106  PRO B O   1 
ATOM   5036  C  CB  . PRO B  1 106 ? -24.133 52.994  77.192  1.00 104.03 ? 106  PRO B CB  1 
ATOM   5037  C  CG  . PRO B  1 106 ? -24.681 52.450  78.451  1.00 107.87 ? 106  PRO B CG  1 
ATOM   5038  C  CD  . PRO B  1 106 ? -25.530 51.258  78.064  1.00 107.84 ? 106  PRO B CD  1 
ATOM   5039  N  N   . ARG B  1 107 ? -21.464 51.848  76.377  1.00 101.61 ? 107  ARG B N   1 
ATOM   5040  C  CA  . ARG B  1 107 ? -20.131 51.458  76.819  1.00 99.80  ? 107  ARG B CA  1 
ATOM   5041  C  C   . ARG B  1 107 ? -20.107 51.243  78.326  1.00 105.78 ? 107  ARG B C   1 
ATOM   5042  O  O   . ARG B  1 107 ? -20.743 51.982  79.074  1.00 102.39 ? 107  ARG B O   1 
ATOM   5043  C  CB  . ARG B  1 107 ? -19.098 52.516  76.441  1.00 97.80  ? 107  ARG B CB  1 
ATOM   5044  C  CG  . ARG B  1 107 ? -18.845 52.623  74.963  1.00 100.70 ? 107  ARG B CG  1 
ATOM   5045  C  CD  . ARG B  1 107 ? -17.563 53.379  74.686  1.00 104.68 ? 107  ARG B CD  1 
ATOM   5046  N  NE  . ARG B  1 107 ? -17.585 53.972  73.354  1.00 108.44 ? 107  ARG B NE  1 
ATOM   5047  C  CZ  . ARG B  1 107 ? -18.013 55.204  73.105  1.00 113.13 ? 107  ARG B CZ  1 
ATOM   5048  N  NH1 . ARG B  1 107 ? -18.443 55.966  74.105  1.00 118.75 ? 107  ARG B NH1 1 
ATOM   5049  N  NH2 . ARG B  1 107 ? -18.013 55.677  71.865  1.00 109.58 ? 107  ARG B NH2 1 
ATOM   5050  N  N   . PRO B  1 108 ? -19.388 50.209  78.776  1.00 114.27 ? 108  PRO B N   1 
ATOM   5051  C  CA  . PRO B  1 108 ? -19.296 49.973  80.220  1.00 119.24 ? 108  PRO B CA  1 
ATOM   5052  C  C   . PRO B  1 108 ? -18.588 51.139  80.907  1.00 117.95 ? 108  PRO B C   1 
ATOM   5053  O  O   . PRO B  1 108 ? -17.733 51.775  80.285  1.00 116.91 ? 108  PRO B O   1 
ATOM   5054  C  CB  . PRO B  1 108 ? -18.470 48.684  80.313  1.00 117.16 ? 108  PRO B CB  1 
ATOM   5055  C  CG  . PRO B  1 108 ? -17.730 48.596  79.002  1.00 111.03 ? 108  PRO B CG  1 
ATOM   5056  C  CD  . PRO B  1 108 ? -18.633 49.215  77.989  1.00 111.07 ? 108  PRO B CD  1 
ATOM   5057  N  N   . ALA B  1 109 ? -18.949 51.419  82.157  1.00 114.87 ? 109  ALA B N   1 
ATOM   5058  C  CA  . ALA B  1 109 ? -18.391 52.561  82.881  1.00 114.74 ? 109  ALA B CA  1 
ATOM   5059  C  C   . ALA B  1 109 ? -16.863 52.538  82.972  1.00 114.78 ? 109  ALA B C   1 
ATOM   5060  O  O   . ALA B  1 109 ? -16.180 53.284  82.263  1.00 112.43 ? 109  ALA B O   1 
ATOM   5061  C  CB  . ALA B  1 109 ? -19.001 52.659  84.261  1.00 117.58 ? 109  ALA B CB  1 
ATOM   5062  N  N   . SER B  1 110 ? -16.333 51.688  83.851  1.00 116.28 ? 110  SER B N   1 
ATOM   5063  C  CA  . SER B  1 110 ? -14.884 51.523  83.994  1.00 111.30 ? 110  SER B CA  1 
ATOM   5064  C  C   . SER B  1 110 ? -14.340 50.528  82.955  1.00 103.95 ? 110  SER B C   1 
ATOM   5065  O  O   . SER B  1 110 ? -15.110 49.745  82.391  1.00 96.90  ? 110  SER B O   1 
ATOM   5066  C  CB  . SER B  1 110 ? -14.516 51.110  85.435  1.00 106.47 ? 110  SER B CB  1 
ATOM   5067  O  OG  . SER B  1 110 ? -15.137 49.898  85.828  1.00 101.56 ? 110  SER B OG  1 
ATOM   5068  N  N   . PRO B  1 111 ? -13.019 50.574  82.678  1.00 104.58 ? 111  PRO B N   1 
ATOM   5069  C  CA  . PRO B  1 111 ? -12.421 49.637  81.716  1.00 102.95 ? 111  PRO B CA  1 
ATOM   5070  C  C   . PRO B  1 111 ? -12.616 48.168  82.106  1.00 107.20 ? 111  PRO B C   1 
ATOM   5071  O  O   . PRO B  1 111 ? -12.270 47.773  83.223  1.00 108.80 ? 111  PRO B O   1 
ATOM   5072  C  CB  . PRO B  1 111 ? -10.929 50.012  81.734  1.00 97.17  ? 111  PRO B CB  1 
ATOM   5073  C  CG  . PRO B  1 111 ? -10.738 50.830  82.972  1.00 98.95  ? 111  PRO B CG  1 
ATOM   5074  C  CD  . PRO B  1 111 ? -12.028 51.553  83.160  1.00 104.11 ? 111  PRO B CD  1 
ATOM   5075  N  N   . THR B  1 112 ? -13.166 47.378  81.182  1.00 105.24 ? 112  THR B N   1 
ATOM   5076  C  CA  . THR B  1 112 ? -13.470 45.968  81.428  1.00 95.75  ? 112  THR B CA  1 
ATOM   5077  C  C   . THR B  1 112 ? -12.514 45.027  80.702  1.00 86.20  ? 112  THR B C   1 
ATOM   5078  O  O   . THR B  1 112 ? -11.948 45.384  79.671  1.00 80.93  ? 112  THR B O   1 
ATOM   5079  C  CB  . THR B  1 112 ? -14.900 45.615  80.967  1.00 88.61  ? 112  THR B CB  1 
ATOM   5080  O  OG1 . THR B  1 112 ? -14.911 45.377  79.556  1.00 81.54  ? 112  THR B OG1 1 
ATOM   5081  C  CG2 . THR B  1 112 ? -15.836 46.730  81.273  1.00 89.74  ? 112  THR B CG2 1 
ATOM   5082  N  N   . PRO B  1 113 ? -12.337 43.813  81.243  1.00 83.59  ? 113  PRO B N   1 
ATOM   5083  C  CA  . PRO B  1 113 ? -11.627 42.725  80.559  1.00 80.64  ? 113  PRO B CA  1 
ATOM   5084  C  C   . PRO B  1 113 ? -12.107 42.466  79.121  1.00 78.57  ? 113  PRO B C   1 
ATOM   5085  O  O   . PRO B  1 113 ? -13.300 42.549  78.818  1.00 75.80  ? 113  PRO B O   1 
ATOM   5086  C  CB  . PRO B  1 113 ? -11.915 41.506  81.452  1.00 76.17  ? 113  PRO B CB  1 
ATOM   5087  C  CG  . PRO B  1 113 ? -12.918 41.978  82.489  1.00 74.55  ? 113  PRO B CG  1 
ATOM   5088  C  CD  . PRO B  1 113 ? -12.689 43.437  82.620  1.00 84.40  ? 113  PRO B CD  1 
ATOM   5089  N  N   . VAL B  1 114 ? -11.166 42.146  78.239  1.00 79.27  ? 114  VAL B N   1 
ATOM   5090  C  CA  . VAL B  1 114 ? -11.502 41.907  76.839  1.00 82.84  ? 114  VAL B CA  1 
ATOM   5091  C  C   . VAL B  1 114 ? -11.121 40.492  76.362  1.00 80.06  ? 114  VAL B C   1 
ATOM   5092  O  O   . VAL B  1 114 ? -10.062 39.952  76.720  1.00 76.92  ? 114  VAL B O   1 
ATOM   5093  C  CB  . VAL B  1 114 ? -10.877 42.987  75.923  1.00 86.89  ? 114  VAL B CB  1 
ATOM   5094  C  CG1 . VAL B  1 114 ? -9.358  42.905  75.954  1.00 86.07  ? 114  VAL B CG1 1 
ATOM   5095  C  CG2 . VAL B  1 114 ? -11.395 42.860  74.500  1.00 87.62  ? 114  VAL B CG2 1 
ATOM   5096  N  N   . LEU B  1 115 ? -12.013 39.898  75.569  1.00 75.81  ? 115  LEU B N   1 
ATOM   5097  C  CA  . LEU B  1 115 ? -11.803 38.574  74.998  1.00 70.83  ? 115  LEU B CA  1 
ATOM   5098  C  C   . LEU B  1 115 ? -11.483 38.668  73.511  1.00 72.17  ? 115  LEU B C   1 
ATOM   5099  O  O   . LEU B  1 115 ? -12.308 39.130  72.724  1.00 77.05  ? 115  LEU B O   1 
ATOM   5100  C  CB  . LEU B  1 115 ? -13.048 37.707  75.189  1.00 68.57  ? 115  LEU B CB  1 
ATOM   5101  C  CG  . LEU B  1 115 ? -13.330 37.158  76.586  1.00 69.02  ? 115  LEU B CG  1 
ATOM   5102  C  CD1 . LEU B  1 115 ? -14.608 36.333  76.579  1.00 67.57  ? 115  LEU B CD1 1 
ATOM   5103  C  CD2 . LEU B  1 115 ? -12.154 36.335  77.080  1.00 60.38  ? 115  LEU B CD2 1 
ATOM   5104  N  N   . ILE B  1 116 ? -10.290 38.227  73.124  1.00 64.99  ? 116  ILE B N   1 
ATOM   5105  C  CA  . ILE B  1 116 ? -9.910  38.220  71.717  1.00 57.85  ? 116  ILE B CA  1 
ATOM   5106  C  C   . ILE B  1 116 ? -9.954  36.804  71.147  1.00 55.94  ? 116  ILE B C   1 
ATOM   5107  O  O   . ILE B  1 116 ? -9.338  35.878  71.681  1.00 54.73  ? 116  ILE B O   1 
ATOM   5108  C  CB  . ILE B  1 116 ? -8.518  38.801  71.519  1.00 60.98  ? 116  ILE B CB  1 
ATOM   5109  C  CG1 . ILE B  1 116 ? -8.477  40.248  71.989  1.00 67.24  ? 116  ILE B CG1 1 
ATOM   5110  C  CG2 . ILE B  1 116 ? -8.130  38.735  70.068  1.00 63.02  ? 116  ILE B CG2 1 
ATOM   5111  C  CD1 . ILE B  1 116 ? -7.097  40.848  71.924  1.00 69.50  ? 116  ILE B CD1 1 
ATOM   5112  N  N   . TRP B  1 117 ? -10.679 36.641  70.050  1.00 56.55  ? 117  TRP B N   1 
ATOM   5113  C  CA  . TRP B  1 117 ? -10.948 35.321  69.502  1.00 56.97  ? 117  TRP B CA  1 
ATOM   5114  C  C   . TRP B  1 117 ? -10.139 35.024  68.233  1.00 58.00  ? 117  TRP B C   1 
ATOM   5115  O  O   . TRP B  1 117 ? -10.005 35.871  67.347  1.00 57.87  ? 117  TRP B O   1 
ATOM   5116  C  CB  . TRP B  1 117 ? -12.450 35.183  69.245  1.00 51.09  ? 117  TRP B CB  1 
ATOM   5117  C  CG  . TRP B  1 117 ? -12.858 33.961  68.509  1.00 58.83  ? 117  TRP B CG  1 
ATOM   5118  C  CD1 . TRP B  1 117 ? -13.243 33.880  67.198  1.00 49.28  ? 117  TRP B CD1 1 
ATOM   5119  C  CD2 . TRP B  1 117 ? -12.934 32.630  69.033  1.00 49.69  ? 117  TRP B CD2 1 
ATOM   5120  N  NE1 . TRP B  1 117 ? -13.556 32.582  66.879  1.00 53.78  ? 117  TRP B NE1 1 
ATOM   5121  C  CE2 . TRP B  1 117 ? -13.372 31.794  67.988  1.00 55.45  ? 117  TRP B CE2 1 
ATOM   5122  C  CE3 . TRP B  1 117 ? -12.669 32.063  70.282  1.00 50.15  ? 117  TRP B CE3 1 
ATOM   5123  C  CZ2 . TRP B  1 117 ? -13.559 30.424  68.162  1.00 48.34  ? 117  TRP B CZ2 1 
ATOM   5124  C  CZ3 . TRP B  1 117 ? -12.851 30.708  70.449  1.00 49.69  ? 117  TRP B CZ3 1 
ATOM   5125  C  CH2 . TRP B  1 117 ? -13.291 29.903  69.398  1.00 68.40  ? 117  TRP B CH2 1 
ATOM   5126  N  N   . ILE B  1 118 ? -9.594  33.813  68.167  1.00 58.64  ? 118  ILE B N   1 
ATOM   5127  C  CA  . ILE B  1 118 ? -8.869  33.340  66.999  1.00 43.73  ? 118  ILE B CA  1 
ATOM   5128  C  C   . ILE B  1 118 ? -9.540  32.079  66.465  1.00 55.64  ? 118  ILE B C   1 
ATOM   5129  O  O   . ILE B  1 118 ? -9.547  31.060  67.143  1.00 58.13  ? 118  ILE B O   1 
ATOM   5130  C  CB  . ILE B  1 118 ? -7.409  33.028  67.365  1.00 67.70  ? 118  ILE B CB  1 
ATOM   5131  C  CG1 . ILE B  1 118 ? -6.810  34.195  68.146  1.00 43.58  ? 118  ILE B CG1 1 
ATOM   5132  C  CG2 . ILE B  1 118 ? -6.595  32.717  66.117  1.00 40.45  ? 118  ILE B CG2 1 
ATOM   5133  C  CD1 . ILE B  1 118 ? -5.347  34.096  68.381  1.00 42.45  ? 118  ILE B CD1 1 
ATOM   5134  N  N   . TYR B  1 119 ? -10.109 32.141  65.263  1.00 53.30  ? 119  TYR B N   1 
ATOM   5135  C  CA  . TYR B  1 119 ? -10.864 31.005  64.715  1.00 55.62  ? 119  TYR B CA  1 
ATOM   5136  C  C   . TYR B  1 119 ? -10.014 29.805  64.301  1.00 52.38  ? 119  TYR B C   1 
ATOM   5137  O  O   . TYR B  1 119 ? -8.808  29.935  64.075  1.00 50.86  ? 119  TYR B O   1 
ATOM   5138  C  CB  . TYR B  1 119 ? -11.720 31.438  63.528  1.00 58.66  ? 119  TYR B CB  1 
ATOM   5139  C  CG  . TYR B  1 119 ? -10.975 32.175  62.430  1.00 62.70  ? 119  TYR B CG  1 
ATOM   5140  C  CD1 . TYR B  1 119 ? -10.110 31.508  61.564  1.00 54.22  ? 119  TYR B CD1 1 
ATOM   5141  C  CD2 . TYR B  1 119 ? -11.163 33.540  62.236  1.00 67.29  ? 119  TYR B CD2 1 
ATOM   5142  C  CE1 . TYR B  1 119 ? -9.450  32.182  60.544  1.00 47.72  ? 119  TYR B CE1 1 
ATOM   5143  C  CE2 . TYR B  1 119 ? -10.500 34.222  61.223  1.00 60.68  ? 119  TYR B CE2 1 
ATOM   5144  C  CZ  . TYR B  1 119 ? -9.647  33.540  60.385  1.00 50.33  ? 119  TYR B CZ  1 
ATOM   5145  O  OH  . TYR B  1 119 ? -8.999  34.229  59.392  1.00 39.41  ? 119  TYR B OH  1 
ATOM   5146  N  N   . GLY B  1 120 ? -10.659 28.643  64.186  1.00 45.77  ? 120  GLY B N   1 
ATOM   5147  C  CA  . GLY B  1 120 ? -9.997  27.433  63.719  1.00 39.80  ? 120  GLY B CA  1 
ATOM   5148  C  C   . GLY B  1 120 ? -9.841  27.396  62.205  1.00 40.47  ? 120  GLY B C   1 
ATOM   5149  O  O   . GLY B  1 120 ? -9.790  28.443  61.572  1.00 48.16  ? 120  GLY B O   1 
ATOM   5150  N  N   . GLY B  1 121 ? -9.754  26.206  61.616  1.00 36.37  ? 121  GLY B N   1 
ATOM   5151  C  CA  . GLY B  1 121 ? -9.713  26.090  60.170  1.00 35.44  ? 121  GLY B CA  1 
ATOM   5152  C  C   . GLY B  1 121 ? -8.459  25.420  59.649  1.00 41.67  ? 121  GLY B C   1 
ATOM   5153  O  O   . GLY B  1 121 ? -8.190  25.430  58.449  1.00 32.51  ? 121  GLY B O   1 
ATOM   5154  N  N   . GLY B  1 122 ? -7.681  24.844  60.558  1.00 40.36  ? 122  GLY B N   1 
ATOM   5155  C  CA  . GLY B  1 122 ? -6.474  24.112  60.199  1.00 37.11  ? 122  GLY B CA  1 
ATOM   5156  C  C   . GLY B  1 122 ? -5.456  24.971  59.497  1.00 33.52  ? 122  GLY B C   1 
ATOM   5157  O  O   . GLY B  1 122 ? -4.580  24.467  58.799  1.00 28.47  ? 122  GLY B O   1 
ATOM   5158  N  N   . PHE B  1 123 ? -5.595  26.276  59.690  1.00 33.06  ? 123  PHE B N   1 
ATOM   5159  C  CA  . PHE B  1 123 ? -4.800  27.270  58.994  1.00 33.65  ? 123  PHE B CA  1 
ATOM   5160  C  C   . PHE B  1 123 ? -5.058  27.292  57.484  1.00 35.84  ? 123  PHE B C   1 
ATOM   5161  O  O   . PHE B  1 123 ? -4.312  27.932  56.747  1.00 39.84  ? 123  PHE B O   1 
ATOM   5162  C  CB  . PHE B  1 123 ? -3.305  27.099  59.285  1.00 29.42  ? 123  PHE B CB  1 
ATOM   5163  C  CG  . PHE B  1 123 ? -2.952  27.107  60.754  1.00 29.93  ? 123  PHE B CG  1 
ATOM   5164  C  CD1 . PHE B  1 123 ? -2.996  28.272  61.489  1.00 39.01  ? 123  PHE B CD1 1 
ATOM   5165  C  CD2 . PHE B  1 123 ? -2.522  25.958  61.382  1.00 37.78  ? 123  PHE B CD2 1 
ATOM   5166  C  CE1 . PHE B  1 123 ? -2.648  28.278  62.827  1.00 42.67  ? 123  PHE B CE1 1 
ATOM   5167  C  CE2 . PHE B  1 123 ? -2.175  25.969  62.715  1.00 35.37  ? 123  PHE B CE2 1 
ATOM   5168  C  CZ  . PHE B  1 123 ? -2.241  27.130  63.433  1.00 30.96  ? 123  PHE B CZ  1 
ATOM   5169  N  N   . TYR B  1 124 ? -6.106  26.617  57.014  1.00 33.93  ? 124  TYR B N   1 
ATOM   5170  C  CA  . TYR B  1 124 ? -6.406  26.667  55.584  1.00 35.51  ? 124  TYR B CA  1 
ATOM   5171  C  C   . TYR B  1 124 ? -7.705  27.365  55.278  1.00 31.39  ? 124  TYR B C   1 
ATOM   5172  O  O   . TYR B  1 124 ? -8.057  27.519  54.113  1.00 39.81  ? 124  TYR B O   1 
ATOM   5173  C  CB  . TYR B  1 124 ? -6.398  25.282  54.933  1.00 29.05  ? 124  TYR B CB  1 
ATOM   5174  C  CG  . TYR B  1 124 ? -7.524  24.355  55.313  1.00 40.96  ? 124  TYR B CG  1 
ATOM   5175  C  CD1 . TYR B  1 124 ? -8.794  24.468  54.738  1.00 43.34  ? 124  TYR B CD1 1 
ATOM   5176  C  CD2 . TYR B  1 124 ? -7.315  23.335  56.208  1.00 39.80  ? 124  TYR B CD2 1 
ATOM   5177  C  CE1 . TYR B  1 124 ? -9.827  23.597  55.082  1.00 38.67  ? 124  TYR B CE1 1 
ATOM   5178  C  CE2 . TYR B  1 124 ? -8.334  22.466  56.551  1.00 43.35  ? 124  TYR B CE2 1 
ATOM   5179  C  CZ  . TYR B  1 124 ? -9.581  22.598  55.991  1.00 40.90  ? 124  TYR B CZ  1 
ATOM   5180  O  OH  . TYR B  1 124 ? -10.560 21.713  56.365  1.00 41.56  ? 124  TYR B OH  1 
ATOM   5181  N  N   . SER B  1 125 ? -8.413  27.784  56.322  1.00 49.04  ? 125  SER B N   1 
ATOM   5182  C  CA  . SER B  1 125 ? -9.788  28.257  56.177  1.00 47.85  ? 125  SER B CA  1 
ATOM   5183  C  C   . SER B  1 125 ? -10.231 29.049  57.389  1.00 41.63  ? 125  SER B C   1 
ATOM   5184  O  O   . SER B  1 125 ? -9.517  29.124  58.386  1.00 35.62  ? 125  SER B O   1 
ATOM   5185  C  CB  . SER B  1 125 ? -10.739 27.071  56.024  1.00 48.35  ? 125  SER B CB  1 
ATOM   5186  O  OG  . SER B  1 125 ? -10.956 26.428  57.272  1.00 35.65  ? 125  SER B OG  1 
ATOM   5187  N  N   . GLY B  1 126 ? -11.427 29.624  57.300  1.00 41.05  ? 126  GLY B N   1 
ATOM   5188  C  CA  . GLY B  1 126 ? -12.054 30.277  58.434  1.00 45.81  ? 126  GLY B CA  1 
ATOM   5189  C  C   . GLY B  1 126 ? -12.182 31.790  58.350  1.00 47.96  ? 126  GLY B C   1 
ATOM   5190  O  O   . GLY B  1 126 ? -11.438 32.461  57.624  1.00 39.36  ? 126  GLY B O   1 
ATOM   5191  N  N   . ALA B  1 127 ? -13.137 32.324  59.108  1.00 44.92  ? 127  ALA B N   1 
ATOM   5192  C  CA  . ALA B  1 127 ? -13.337 33.760  59.210  1.00 43.44  ? 127  ALA B CA  1 
ATOM   5193  C  C   . ALA B  1 127 ? -13.971 34.121  60.544  1.00 49.45  ? 127  ALA B C   1 
ATOM   5194  O  O   . ALA B  1 127 ? -14.613 33.288  61.178  1.00 49.51  ? 127  ALA B O   1 
ATOM   5195  C  CB  . ALA B  1 127 ? -14.202 34.249  58.081  1.00 50.45  ? 127  ALA B CB  1 
ATOM   5196  N  N   . ALA B  1 128 ? -13.790 35.370  60.961  1.00 50.42  ? 128  ALA B N   1 
ATOM   5197  C  CA  . ALA B  1 128 ? -14.457 35.890  62.145  1.00 48.31  ? 128  ALA B CA  1 
ATOM   5198  C  C   . ALA B  1 128 ? -15.914 36.274  61.852  1.00 59.08  ? 128  ALA B C   1 
ATOM   5199  O  O   . ALA B  1 128 ? -16.680 36.589  62.768  1.00 61.91  ? 128  ALA B O   1 
ATOM   5200  C  CB  . ALA B  1 128 ? -13.694 37.075  62.694  1.00 49.04  ? 128  ALA B CB  1 
ATOM   5201  N  N   . SER B  1 129 ? -16.295 36.231  60.577  1.00 57.52  ? 129  SER B N   1 
ATOM   5202  C  CA  . SER B  1 129 ? -17.654 36.580  60.160  1.00 60.06  ? 129  SER B CA  1 
ATOM   5203  C  C   . SER B  1 129 ? -18.650 35.425  60.303  1.00 64.40  ? 129  SER B C   1 
ATOM   5204  O  O   . SER B  1 129 ? -19.848 35.595  60.072  1.00 68.84  ? 129  SER B O   1 
ATOM   5205  C  CB  . SER B  1 129 ? -17.655 37.051  58.712  1.00 57.54  ? 129  SER B CB  1 
ATOM   5206  O  OG  . SER B  1 129 ? -17.512 35.952  57.832  1.00 49.82  ? 129  SER B OG  1 
ATOM   5207  N  N   . LEU B  1 130 ? -18.156 34.251  60.674  1.00 51.41  ? 130  LEU B N   1 
ATOM   5208  C  CA  . LEU B  1 130 ? -19.012 33.084  60.830  1.00 52.08  ? 130  LEU B CA  1 
ATOM   5209  C  C   . LEU B  1 130 ? -20.054 33.244  61.920  1.00 69.37  ? 130  LEU B C   1 
ATOM   5210  O  O   . LEU B  1 130 ? -19.878 34.020  62.866  1.00 55.45  ? 130  LEU B O   1 
ATOM   5211  C  CB  . LEU B  1 130 ? -18.178 31.849  61.131  1.00 54.78  ? 130  LEU B CB  1 
ATOM   5212  C  CG  . LEU B  1 130 ? -17.408 31.313  59.938  1.00 50.93  ? 130  LEU B CG  1 
ATOM   5213  C  CD1 . LEU B  1 130 ? -16.557 30.122  60.361  1.00 48.47  ? 130  LEU B CD1 1 
ATOM   5214  C  CD2 . LEU B  1 130 ? -18.406 30.949  58.839  1.00 50.50  ? 130  LEU B CD2 1 
ATOM   5215  N  N   . ASP B  1 131 ? -21.127 32.470  61.781  1.00 70.88  ? 131  ASP B N   1 
ATOM   5216  C  CA  . ASP B  1 131 ? -22.278 32.539  62.673  1.00 71.71  ? 131  ASP B CA  1 
ATOM   5217  C  C   . ASP B  1 131 ? -21.957 32.162  64.122  1.00 66.98  ? 131  ASP B C   1 
ATOM   5218  O  O   . ASP B  1 131 ? -22.257 32.916  65.045  1.00 63.72  ? 131  ASP B O   1 
ATOM   5219  C  CB  . ASP B  1 131 ? -23.418 31.666  62.130  1.00 72.00  ? 131  ASP B CB  1 
ATOM   5220  C  CG  . ASP B  1 131 ? -24.247 32.373  61.066  1.00 72.82  ? 131  ASP B CG  1 
ATOM   5221  O  OD1 . ASP B  1 131 ? -23.784 33.394  60.505  1.00 69.29  ? 131  ASP B OD1 1 
ATOM   5222  O  OD2 . ASP B  1 131 ? -25.369 31.897  60.791  1.00 76.25  ? 131  ASP B OD2 1 
ATOM   5223  N  N   . VAL B  1 132 ? -21.347 30.998  64.319  1.00 65.40  ? 132  VAL B N   1 
ATOM   5224  C  CA  . VAL B  1 132 ? -21.030 30.524  65.664  1.00 66.89  ? 132  VAL B CA  1 
ATOM   5225  C  C   . VAL B  1 132 ? -20.084 31.463  66.437  1.00 69.75  ? 132  VAL B C   1 
ATOM   5226  O  O   . VAL B  1 132 ? -19.999 31.393  67.668  1.00 70.36  ? 132  VAL B O   1 
ATOM   5227  C  CB  . VAL B  1 132 ? -20.463 29.083  65.634  1.00 63.51  ? 132  VAL B CB  1 
ATOM   5228  C  CG1 . VAL B  1 132 ? -21.497 28.127  65.067  1.00 63.47  ? 132  VAL B CG1 1 
ATOM   5229  C  CG2 . VAL B  1 132 ? -19.176 29.026  64.814  1.00 58.13  ? 132  VAL B CG2 1 
ATOM   5230  N  N   . TYR B  1 133 ? -19.384 32.339  65.715  1.00 67.07  ? 133  TYR B N   1 
ATOM   5231  C  CA  . TYR B  1 133 ? -18.498 33.311  66.349  1.00 65.48  ? 133  TYR B CA  1 
ATOM   5232  C  C   . TYR B  1 133 ? -19.170 34.672  66.434  1.00 70.13  ? 133  TYR B C   1 
ATOM   5233  O  O   . TYR B  1 133 ? -18.534 35.693  66.176  1.00 72.34  ? 133  TYR B O   1 
ATOM   5234  C  CB  . TYR B  1 133 ? -17.189 33.486  65.569  1.00 64.29  ? 133  TYR B CB  1 
ATOM   5235  C  CG  . TYR B  1 133 ? -16.440 32.226  65.166  1.00 58.49  ? 133  TYR B CG  1 
ATOM   5236  C  CD1 . TYR B  1 133 ? -16.360 31.126  66.004  1.00 57.23  ? 133  TYR B CD1 1 
ATOM   5237  C  CD2 . TYR B  1 133 ? -15.798 32.155  63.930  1.00 60.85  ? 133  TYR B CD2 1 
ATOM   5238  C  CE1 . TYR B  1 133 ? -15.671 29.987  65.616  1.00 61.31  ? 133  TYR B CE1 1 
ATOM   5239  C  CE2 . TYR B  1 133 ? -15.116 31.025  63.531  1.00 60.98  ? 133  TYR B CE2 1 
ATOM   5240  C  CZ  . TYR B  1 133 ? -15.049 29.946  64.376  1.00 62.66  ? 133  TYR B CZ  1 
ATOM   5241  O  OH  . TYR B  1 133 ? -14.353 28.829  63.979  1.00 60.22  ? 133  TYR B OH  1 
ATOM   5242  N  N   . ASP B  1 134 ? -20.456 34.687  66.772  1.00 75.24  ? 134  ASP B N   1 
ATOM   5243  C  CA  . ASP B  1 134 ? -21.204 35.931  66.954  1.00 78.81  ? 134  ASP B CA  1 
ATOM   5244  C  C   . ASP B  1 134 ? -20.954 36.414  68.376  1.00 87.26  ? 134  ASP B C   1 
ATOM   5245  O  O   . ASP B  1 134 ? -21.576 35.927  69.324  1.00 98.49  ? 134  ASP B O   1 
ATOM   5246  C  CB  . ASP B  1 134 ? -22.702 35.672  66.741  1.00 80.15  ? 134  ASP B CB  1 
ATOM   5247  C  CG  . ASP B  1 134 ? -23.512 36.949  66.558  1.00 82.74  ? 134  ASP B CG  1 
ATOM   5248  O  OD1 . ASP B  1 134 ? -23.013 38.046  66.901  1.00 86.07  ? 134  ASP B OD1 1 
ATOM   5249  O  OD2 . ASP B  1 134 ? -24.662 36.841  66.073  1.00 78.59  ? 134  ASP B OD2 1 
ATOM   5250  N  N   . GLY B  1 135 ? -20.042 37.366  68.536  1.00 85.26  ? 135  GLY B N   1 
ATOM   5251  C  CA  . GLY B  1 135 ? -19.624 37.777  69.865  1.00 89.43  ? 135  GLY B CA  1 
ATOM   5252  C  C   . GLY B  1 135 ? -20.577 38.730  70.559  1.00 98.57  ? 135  GLY B C   1 
ATOM   5253  O  O   . GLY B  1 135 ? -20.195 39.410  71.513  1.00 100.69 ? 135  GLY B O   1 
ATOM   5254  N  N   . ARG B  1 136 ? -21.822 38.765  70.089  1.00 101.83 ? 136  ARG B N   1 
ATOM   5255  C  CA  . ARG B  1 136 ? -22.821 39.715  70.574  1.00 99.01  ? 136  ARG B CA  1 
ATOM   5256  C  C   . ARG B  1 136 ? -23.472 39.313  71.904  1.00 99.44  ? 136  ARG B C   1 
ATOM   5257  O  O   . ARG B  1 136 ? -23.943 40.166  72.647  1.00 100.30 ? 136  ARG B O   1 
ATOM   5258  C  CB  . ARG B  1 136 ? -23.888 39.954  69.495  1.00 97.82  ? 136  ARG B CB  1 
ATOM   5259  C  CG  . ARG B  1 136 ? -25.256 39.337  69.782  1.00 101.32 ? 136  ARG B CG  1 
ATOM   5260  C  CD  . ARG B  1 136 ? -25.824 38.615  68.557  1.00 104.19 ? 136  ARG B CD  1 
ATOM   5261  N  NE  . ARG B  1 136 ? -25.937 39.475  67.376  1.00 106.28 ? 136  ARG B NE  1 
ATOM   5262  C  CZ  . ARG B  1 136 ? -27.053 39.631  66.664  1.00 107.84 ? 136  ARG B CZ  1 
ATOM   5263  N  NH1 . ARG B  1 136 ? -28.158 38.982  67.013  1.00 111.26 ? 136  ARG B NH1 1 
ATOM   5264  N  NH2 . ARG B  1 136 ? -27.070 40.435  65.605  1.00 104.35 ? 136  ARG B NH2 1 
ATOM   5265  N  N   . PHE B  1 137 ? -23.501 38.020  72.208  1.00 101.60 ? 137  PHE B N   1 
ATOM   5266  C  CA  . PHE B  1 137 ? -24.100 37.561  73.457  1.00 75.44  ? 137  PHE B CA  1 
ATOM   5267  C  C   . PHE B  1 137 ? -23.152 37.791  74.625  1.00 90.20  ? 137  PHE B C   1 
ATOM   5268  O  O   . PHE B  1 137 ? -23.546 38.385  75.622  1.00 77.85  ? 137  PHE B O   1 
ATOM   5269  C  CB  . PHE B  1 137 ? -24.506 36.093  73.356  1.00 74.87  ? 137  PHE B CB  1 
ATOM   5270  C  CG  . PHE B  1 137 ? -25.317 35.781  72.133  1.00 100.24 ? 137  PHE B CG  1 
ATOM   5271  C  CD1 . PHE B  1 137 ? -26.649 36.156  72.052  1.00 77.29  ? 137  PHE B CD1 1 
ATOM   5272  C  CD2 . PHE B  1 137 ? -24.748 35.121  71.054  1.00 94.95  ? 137  PHE B CD2 1 
ATOM   5273  C  CE1 . PHE B  1 137 ? -27.407 35.877  70.925  1.00 77.22  ? 137  PHE B CE1 1 
ATOM   5274  C  CE2 . PHE B  1 137 ? -25.506 34.842  69.919  1.00 93.33  ? 137  PHE B CE2 1 
ATOM   5275  C  CZ  . PHE B  1 137 ? -26.842 35.224  69.861  1.00 92.55  ? 137  PHE B CZ  1 
ATOM   5276  N  N   . LEU B  1 138 ? -21.904 37.332  74.483  1.00 84.84  ? 138  LEU B N   1 
ATOM   5277  C  CA  . LEU B  1 138 ? -20.836 37.569  75.467  1.00 77.81  ? 138  LEU B CA  1 
ATOM   5278  C  C   . LEU B  1 138 ? -20.666 39.047  75.761  1.00 73.76  ? 138  LEU B C   1 
ATOM   5279  O  O   . LEU B  1 138 ? -20.296 39.441  76.860  1.00 77.66  ? 138  LEU B O   1 
ATOM   5280  C  CB  . LEU B  1 138 ? -19.492 37.069  74.949  1.00 76.86  ? 138  LEU B CB  1 
ATOM   5281  C  CG  . LEU B  1 138 ? -19.170 35.590  74.776  1.00 78.20  ? 138  LEU B CG  1 
ATOM   5282  C  CD1 . LEU B  1 138 ? -19.516 34.826  76.037  1.00 79.62  ? 138  LEU B CD1 1 
ATOM   5283  C  CD2 . LEU B  1 138 ? -19.907 35.063  73.570  1.00 81.38  ? 138  LEU B CD2 1 
ATOM   5284  N  N   . ALA B  1 139 ? -20.897 39.867  74.750  1.00 78.38  ? 139  ALA B N   1 
ATOM   5285  C  CA  . ALA B  1 139 ? -20.920 41.296  74.953  1.00 79.80  ? 139  ALA B CA  1 
ATOM   5286  C  C   . ALA B  1 139 ? -22.168 41.680  75.750  1.00 85.94  ? 139  ALA B C   1 
ATOM   5287  O  O   . ALA B  1 139 ? -22.059 42.221  76.845  1.00 90.04  ? 139  ALA B O   1 
ATOM   5288  C  CB  . ALA B  1 139 ? -20.889 42.006  73.622  1.00 81.68  ? 139  ALA B CB  1 
ATOM   5289  N  N   . GLN B  1 140 ? -23.347 41.370  75.210  1.00 86.54  ? 140  GLN B N   1 
ATOM   5290  C  CA  . GLN B  1 140 ? -24.617 41.821  75.789  1.00 90.44  ? 140  GLN B CA  1 
ATOM   5291  C  C   . GLN B  1 140 ? -24.830 41.344  77.228  1.00 90.36  ? 140  GLN B C   1 
ATOM   5292  O  O   . GLN B  1 140 ? -24.750 42.149  78.156  1.00 93.75  ? 140  GLN B O   1 
ATOM   5293  C  CB  . GLN B  1 140 ? -25.804 41.430  74.896  1.00 92.52  ? 140  GLN B CB  1 
ATOM   5294  C  CG  . GLN B  1 140 ? -27.138 42.057  75.304  1.00 100.45 ? 140  GLN B CG  1 
ATOM   5295  C  CD  . GLN B  1 140 ? -27.797 41.356  76.482  1.00 99.01  ? 140  GLN B CD  1 
ATOM   5296  O  OE1 . GLN B  1 140 ? -28.178 40.188  76.390  1.00 92.17  ? 140  GLN B OE1 1 
ATOM   5297  N  NE2 . GLN B  1 140 ? -27.917 42.064  77.600  1.00 91.90  ? 140  GLN B NE2 1 
ATOM   5298  N  N   . VAL B  1 141 ? -25.135 40.058  77.412  1.00 85.89  ? 141  VAL B N   1 
ATOM   5299  C  CA  . VAL B  1 141 ? -25.139 39.477  78.753  1.00 88.72  ? 141  VAL B CA  1 
ATOM   5300  C  C   . VAL B  1 141 ? -23.677 39.276  79.111  1.00 83.60  ? 141  VAL B C   1 
ATOM   5301  O  O   . VAL B  1 141 ? -22.872 39.010  78.230  1.00 118.69 ? 141  VAL B O   1 
ATOM   5302  C  CB  . VAL B  1 141 ? -25.973 38.161  78.855  1.00 86.39  ? 141  VAL B CB  1 
ATOM   5303  C  CG1 . VAL B  1 141 ? -26.461 37.714  77.505  1.00 85.04  ? 141  VAL B CG1 1 
ATOM   5304  C  CG2 . VAL B  1 141 ? -25.194 37.060  79.535  1.00 84.98  ? 141  VAL B CG2 1 
ATOM   5305  N  N   . GLU B  1 142 ? -23.324 39.466  80.376  1.00 84.99  ? 142  GLU B N   1 
ATOM   5306  C  CA  . GLU B  1 142 ? -21.928 39.398  80.821  1.00 105.88 ? 142  GLU B CA  1 
ATOM   5307  C  C   . GLU B  1 142 ? -21.050 40.590  80.403  1.00 82.23  ? 142  GLU B C   1 
ATOM   5308  O  O   . GLU B  1 142 ? -19.874 40.631  80.758  1.00 80.85  ? 142  GLU B O   1 
ATOM   5309  C  CB  . GLU B  1 142 ? -21.261 38.061  80.448  1.00 80.24  ? 142  GLU B CB  1 
ATOM   5310  C  CG  . GLU B  1 142 ? -21.679 36.883  81.310  1.00 91.08  ? 142  GLU B CG  1 
ATOM   5311  C  CD  . GLU B  1 142 ? -21.088 36.950  82.712  1.00 96.04  ? 142  GLU B CD  1 
ATOM   5312  O  OE1 . GLU B  1 142 ? -19.993 37.540  82.865  1.00 97.31  ? 142  GLU B OE1 1 
ATOM   5313  O  OE2 . GLU B  1 142 ? -21.718 36.417  83.658  1.00 97.60  ? 142  GLU B OE2 1 
ATOM   5314  N  N   . GLY B  1 143 ? -21.613 41.540  79.655  1.00 85.34  ? 143  GLY B N   1 
ATOM   5315  C  CA  . GLY B  1 143 ? -20.990 42.844  79.458  1.00 87.60  ? 143  GLY B CA  1 
ATOM   5316  C  C   . GLY B  1 143 ? -19.524 42.884  79.066  1.00 89.44  ? 143  GLY B C   1 
ATOM   5317  O  O   . GLY B  1 143 ? -18.759 43.703  79.573  1.00 80.60  ? 143  GLY B O   1 
ATOM   5318  N  N   . ALA B  1 144 ? -19.118 42.010  78.157  1.00 77.34  ? 144  ALA B N   1 
ATOM   5319  C  CA  . ALA B  1 144 ? -17.701 41.921  77.838  1.00 83.12  ? 144  ALA B CA  1 
ATOM   5320  C  C   . ALA B  1 144 ? -17.380 42.606  76.529  1.00 80.31  ? 144  ALA B C   1 
ATOM   5321  O  O   . ALA B  1 144 ? -18.234 42.704  75.649  1.00 73.35  ? 144  ALA B O   1 
ATOM   5322  C  CB  . ALA B  1 144 ? -17.239 40.470  77.811  1.00 72.41  ? 144  ALA B CB  1 
ATOM   5323  N  N   . VAL B  1 145 ? -16.150 43.098  76.416  1.00 80.40  ? 145  VAL B N   1 
ATOM   5324  C  CA  . VAL B  1 145 ? -15.641 43.577  75.142  1.00 84.09  ? 145  VAL B CA  1 
ATOM   5325  C  C   . VAL B  1 145 ? -15.086 42.360  74.418  1.00 82.09  ? 145  VAL B C   1 
ATOM   5326  O  O   . VAL B  1 145 ? -14.232 41.648  74.948  1.00 85.53  ? 145  VAL B O   1 
ATOM   5327  C  CB  . VAL B  1 145 ? -14.520 44.622  75.320  1.00 87.92  ? 145  VAL B CB  1 
ATOM   5328  C  CG1 . VAL B  1 145 ? -14.193 45.292  73.987  1.00 85.57  ? 145  VAL B CG1 1 
ATOM   5329  C  CG2 . VAL B  1 145 ? -14.916 45.659  76.353  1.00 91.14  ? 145  VAL B CG2 1 
ATOM   5330  N  N   . LEU B  1 146 ? -15.581 42.101  73.216  1.00 77.33  ? 146  LEU B N   1 
ATOM   5331  C  CA  . LEU B  1 146 ? -15.142 40.921  72.485  1.00 73.81  ? 146  LEU B CA  1 
ATOM   5332  C  C   . LEU B  1 146 ? -14.629 41.249  71.073  1.00 76.84  ? 146  LEU B C   1 
ATOM   5333  O  O   . LEU B  1 146 ? -15.392 41.680  70.211  1.00 76.85  ? 146  LEU B O   1 
ATOM   5334  C  CB  . LEU B  1 146 ? -16.258 39.874  72.447  1.00 68.85  ? 146  LEU B CB  1 
ATOM   5335  C  CG  . LEU B  1 146 ? -15.844 38.504  71.911  1.00 71.48  ? 146  LEU B CG  1 
ATOM   5336  C  CD1 . LEU B  1 146 ? -16.417 37.366  72.758  1.00 71.94  ? 146  LEU B CD1 1 
ATOM   5337  C  CD2 . LEU B  1 146 ? -16.235 38.358  70.435  1.00 74.89  ? 146  LEU B CD2 1 
ATOM   5338  N  N   . VAL B  1 147 ? -13.331 41.036  70.856  1.00 74.98  ? 147  VAL B N   1 
ATOM   5339  C  CA  . VAL B  1 147 ? -12.683 41.311  69.576  1.00 70.87  ? 147  VAL B CA  1 
ATOM   5340  C  C   . VAL B  1 147 ? -12.387 40.014  68.831  1.00 72.04  ? 147  VAL B C   1 
ATOM   5341  O  O   . VAL B  1 147 ? -11.876 39.060  69.421  1.00 74.38  ? 147  VAL B O   1 
ATOM   5342  C  CB  . VAL B  1 147 ? -11.346 42.055  69.777  1.00 67.03  ? 147  VAL B CB  1 
ATOM   5343  C  CG1 . VAL B  1 147 ? -10.841 42.599  68.461  1.00 56.68  ? 147  VAL B CG1 1 
ATOM   5344  C  CG2 . VAL B  1 147 ? -11.515 43.174  70.774  1.00 60.34  ? 147  VAL B CG2 1 
ATOM   5345  N  N   . SER B  1 148 ? -12.707 39.972  67.540  1.00 67.10  ? 148  SER B N   1 
ATOM   5346  C  CA  . SER B  1 148 ? -12.311 38.829  66.715  1.00 58.86  ? 148  SER B CA  1 
ATOM   5347  C  C   . SER B  1 148 ? -11.770 39.306  65.371  1.00 56.16  ? 148  SER B C   1 
ATOM   5348  O  O   . SER B  1 148 ? -12.411 40.095  64.690  1.00 52.16  ? 148  SER B O   1 
ATOM   5349  C  CB  . SER B  1 148 ? -13.469 37.848  66.522  1.00 55.35  ? 148  SER B CB  1 
ATOM   5350  O  OG  . SER B  1 148 ? -14.404 38.334  65.579  1.00 56.26  ? 148  SER B OG  1 
ATOM   5351  N  N   . MET B  1 149 ? -10.585 38.826  64.999  1.00 54.42  ? 149  MET B N   1 
ATOM   5352  C  CA  . MET B  1 149 ? -9.911  39.320  63.805  1.00 54.95  ? 149  MET B CA  1 
ATOM   5353  C  C   . MET B  1 149 ? -9.863  38.285  62.694  1.00 55.34  ? 149  MET B C   1 
ATOM   5354  O  O   . MET B  1 149 ? -10.193 37.122  62.903  1.00 45.48  ? 149  MET B O   1 
ATOM   5355  C  CB  . MET B  1 149 ? -8.492  39.798  64.132  1.00 47.56  ? 149  MET B CB  1 
ATOM   5356  C  CG  . MET B  1 149 ? -7.390  38.776  63.876  1.00 45.32  ? 149  MET B CG  1 
ATOM   5357  S  SD  . MET B  1 149 ? -7.316  37.465  65.109  1.00 44.83  ? 149  MET B SD  1 
ATOM   5358  C  CE  . MET B  1 149 ? -7.105  38.403  66.615  1.00 46.82  ? 149  MET B CE  1 
ATOM   5359  N  N   . ASN B  1 150 ? -9.485  38.744  61.503  1.00 57.31  ? 150  ASN B N   1 
ATOM   5360  C  CA  . ASN B  1 150 ? -9.147  37.869  60.389  1.00 53.55  ? 150  ASN B CA  1 
ATOM   5361  C  C   . ASN B  1 150 ? -7.632  37.789  60.263  1.00 53.20  ? 150  ASN B C   1 
ATOM   5362  O  O   . ASN B  1 150 ? -6.927  38.754  60.543  1.00 57.00  ? 150  ASN B O   1 
ATOM   5363  C  CB  . ASN B  1 150 ? -9.758  38.377  59.076  1.00 49.49  ? 150  ASN B CB  1 
ATOM   5364  C  CG  . ASN B  1 150 ? -11.208 37.983  58.917  1.00 44.64  ? 150  ASN B CG  1 
ATOM   5365  O  OD1 . ASN B  1 150 ? -11.721 37.173  59.681  1.00 44.86  ? 150  ASN B OD1 1 
ATOM   5366  N  ND2 . ASN B  1 150 ? -11.874 38.545  57.919  1.00 45.24  ? 150  ASN B ND2 1 
ATOM   5367  N  N   . TYR B  1 151 ? -7.133  36.627  59.872  1.00 52.09  ? 151  TYR B N   1 
ATOM   5368  C  CA  . TYR B  1 151 ? -5.714  36.463  59.584  1.00 50.39  ? 151  TYR B CA  1 
ATOM   5369  C  C   . TYR B  1 151 ? -5.593  35.580  58.353  1.00 50.61  ? 151  TYR B C   1 
ATOM   5370  O  O   . TYR B  1 151 ? -6.487  34.781  58.060  1.00 49.10  ? 151  TYR B O   1 
ATOM   5371  C  CB  . TYR B  1 151 ? -4.968  35.851  60.771  1.00 50.02  ? 151  TYR B CB  1 
ATOM   5372  C  CG  . TYR B  1 151 ? -5.475  34.486  61.188  1.00 50.20  ? 151  TYR B CG  1 
ATOM   5373  C  CD1 . TYR B  1 151 ? -6.596  34.359  61.991  1.00 51.84  ? 151  TYR B CD1 1 
ATOM   5374  C  CD2 . TYR B  1 151 ? -4.827  33.323  60.784  1.00 48.66  ? 151  TYR B CD2 1 
ATOM   5375  C  CE1 . TYR B  1 151 ? -7.057  33.120  62.379  1.00 52.46  ? 151  TYR B CE1 1 
ATOM   5376  C  CE2 . TYR B  1 151 ? -5.290  32.074  61.165  1.00 44.40  ? 151  TYR B CE2 1 
ATOM   5377  C  CZ  . TYR B  1 151 ? -6.406  31.982  61.958  1.00 48.07  ? 151  TYR B CZ  1 
ATOM   5378  O  OH  . TYR B  1 151 ? -6.877  30.755  62.347  1.00 49.69  ? 151  TYR B OH  1 
ATOM   5379  N  N   . ARG B  1 152 ? -4.499  35.739  57.620  1.00 48.27  ? 152  ARG B N   1 
ATOM   5380  C  CA  . ARG B  1 152 ? -4.320  35.003  56.383  1.00 34.70  ? 152  ARG B CA  1 
ATOM   5381  C  C   . ARG B  1 152 ? -4.185  33.493  56.629  1.00 47.13  ? 152  ARG B C   1 
ATOM   5382  O  O   . ARG B  1 152 ? -3.537  33.063  57.578  1.00 33.13  ? 152  ARG B O   1 
ATOM   5383  C  CB  . ARG B  1 152 ? -3.111  35.554  55.633  1.00 50.87  ? 152  ARG B CB  1 
ATOM   5384  C  CG  . ARG B  1 152 ? -3.365  36.874  54.937  1.00 35.01  ? 152  ARG B CG  1 
ATOM   5385  C  CD  . ARG B  1 152 ? -2.087  37.456  54.419  1.00 34.50  ? 152  ARG B CD  1 
ATOM   5386  N  NE  . ARG B  1 152 ? -1.317  38.038  55.506  1.00 35.10  ? 152  ARG B NE  1 
ATOM   5387  C  CZ  . ARG B  1 152 ? -0.099  38.545  55.365  1.00 43.91  ? 152  ARG B CZ  1 
ATOM   5388  N  NH1 . ARG B  1 152 ? 0.495   38.528  54.179  1.00 33.96  ? 152  ARG B NH1 1 
ATOM   5389  N  NH2 . ARG B  1 152 ? 0.529   39.070  56.409  1.00 39.67  ? 152  ARG B NH2 1 
ATOM   5390  N  N   . VAL B  1 153 ? -4.820  32.691  55.785  1.00 32.87  ? 153  VAL B N   1 
ATOM   5391  C  CA  . VAL B  1 153 ? -4.689  31.246  55.874  1.00 31.70  ? 153  VAL B CA  1 
ATOM   5392  C  C   . VAL B  1 153 ? -4.127  30.709  54.570  1.00 44.77  ? 153  VAL B C   1 
ATOM   5393  O  O   . VAL B  1 153 ? -3.827  31.476  53.660  1.00 30.35  ? 153  VAL B O   1 
ATOM   5394  C  CB  . VAL B  1 153 ? -6.029  30.583  56.180  1.00 32.35  ? 153  VAL B CB  1 
ATOM   5395  C  CG1 . VAL B  1 153 ? -6.460  30.952  57.560  1.00 33.62  ? 153  VAL B CG1 1 
ATOM   5396  C  CG2 . VAL B  1 153 ? -7.081  31.019  55.174  1.00 33.47  ? 153  VAL B CG2 1 
ATOM   5397  N  N   . GLY B  1 154 ? -3.980  29.394  54.482  1.00 29.31  ? 154  GLY B N   1 
ATOM   5398  C  CA  . GLY B  1 154 ? -3.362  28.785  53.321  1.00 28.06  ? 154  GLY B CA  1 
ATOM   5399  C  C   . GLY B  1 154 ? -1.963  29.310  53.046  1.00 27.44  ? 154  GLY B C   1 
ATOM   5400  O  O   . GLY B  1 154 ? -1.238  29.713  53.956  1.00 27.62  ? 154  GLY B O   1 
ATOM   5401  N  N   . THR B  1 155 ? -1.595  29.307  51.770  1.00 30.39  ? 155  THR B N   1 
ATOM   5402  C  CA  . THR B  1 155 ? -0.291  29.786  51.308  1.00 31.73  ? 155  THR B CA  1 
ATOM   5403  C  C   . THR B  1 155 ? -0.105  31.267  51.626  1.00 33.77  ? 155  THR B C   1 
ATOM   5404  O  O   . THR B  1 155 ? 1.006   31.741  51.872  1.00 33.88  ? 155  THR B O   1 
ATOM   5405  C  CB  . THR B  1 155 ? -0.150  29.602  49.776  1.00 31.74  ? 155  THR B CB  1 
ATOM   5406  O  OG1 . THR B  1 155 ? -1.376  29.983  49.135  1.00 33.14  ? 155  THR B OG1 1 
ATOM   5407  C  CG2 . THR B  1 155 ? 0.135   28.157  49.428  1.00 24.53  ? 155  THR B CG2 1 
ATOM   5408  N  N   . PHE B  1 156 ? -1.215  31.995  51.610  1.00 36.64  ? 156  PHE B N   1 
ATOM   5409  C  CA  . PHE B  1 156 ? -1.198  33.430  51.841  1.00 40.18  ? 156  PHE B CA  1 
ATOM   5410  C  C   . PHE B  1 156 ? -0.677  33.758  53.234  1.00 47.81  ? 156  PHE B C   1 
ATOM   5411  O  O   . PHE B  1 156 ? 0.016   34.750  53.421  1.00 55.92  ? 156  PHE B O   1 
ATOM   5412  C  CB  . PHE B  1 156 ? -2.599  34.011  51.598  1.00 39.00  ? 156  PHE B CB  1 
ATOM   5413  C  CG  . PHE B  1 156 ? -3.209  33.566  50.293  1.00 39.11  ? 156  PHE B CG  1 
ATOM   5414  C  CD1 . PHE B  1 156 ? -2.740  34.067  49.087  1.00 42.73  ? 156  PHE B CD1 1 
ATOM   5415  C  CD2 . PHE B  1 156 ? -4.220  32.627  50.267  1.00 42.07  ? 156  PHE B CD2 1 
ATOM   5416  C  CE1 . PHE B  1 156 ? -3.267  33.648  47.882  1.00 29.71  ? 156  PHE B CE1 1 
ATOM   5417  C  CE2 . PHE B  1 156 ? -4.759  32.206  49.059  1.00 47.10  ? 156  PHE B CE2 1 
ATOM   5418  C  CZ  . PHE B  1 156 ? -4.277  32.717  47.865  1.00 46.00  ? 156  PHE B CZ  1 
ATOM   5419  N  N   . GLY B  1 157 ? -0.983  32.902  54.201  1.00 44.17  ? 157  GLY B N   1 
ATOM   5420  C  CA  . GLY B  1 157 ? -0.566  33.126  55.570  1.00 43.48  ? 157  GLY B CA  1 
ATOM   5421  C  C   . GLY B  1 157 ? 0.629   32.306  56.017  1.00 47.69  ? 157  GLY B C   1 
ATOM   5422  O  O   . GLY B  1 157 ? 1.355   32.700  56.928  1.00 47.41  ? 157  GLY B O   1 
ATOM   5423  N  N   . PHE B  1 158 ? 0.849   31.149  55.407  1.00 49.51  ? 158  PHE B N   1 
ATOM   5424  C  CA  . PHE B  1 158 ? 1.947   30.328  55.891  1.00 27.19  ? 158  PHE B CA  1 
ATOM   5425  C  C   . PHE B  1 158 ? 2.738   29.609  54.839  1.00 25.93  ? 158  PHE B C   1 
ATOM   5426  O  O   . PHE B  1 158 ? 3.423   28.659  55.184  1.00 26.38  ? 158  PHE B O   1 
ATOM   5427  C  CB  . PHE B  1 158 ? 1.476   29.285  56.907  1.00 27.09  ? 158  PHE B CB  1 
ATOM   5428  C  CG  . PHE B  1 158 ? 0.488   29.810  57.910  1.00 55.64  ? 158  PHE B CG  1 
ATOM   5429  C  CD1 . PHE B  1 158 ? -0.873  29.814  57.625  1.00 52.62  ? 158  PHE B CD1 1 
ATOM   5430  C  CD2 . PHE B  1 158 ? 0.914   30.284  59.140  1.00 29.11  ? 158  PHE B CD2 1 
ATOM   5431  C  CE1 . PHE B  1 158 ? -1.776  30.284  58.533  1.00 30.31  ? 158  PHE B CE1 1 
ATOM   5432  C  CE2 . PHE B  1 158 ? 0.009   30.752  60.058  1.00 30.41  ? 158  PHE B CE2 1 
ATOM   5433  C  CZ  . PHE B  1 158 ? -1.339  30.755  59.753  1.00 60.65  ? 158  PHE B CZ  1 
ATOM   5434  N  N   . LEU B  1 159 ? 2.660   30.009  53.573  1.00 25.78  ? 159  LEU B N   1 
ATOM   5435  C  CA  . LEU B  1 159 ? 3.657   29.498  52.636  1.00 28.08  ? 159  LEU B CA  1 
ATOM   5436  C  C   . LEU B  1 159 ? 4.958   30.160  53.015  1.00 24.84  ? 159  LEU B C   1 
ATOM   5437  O  O   . LEU B  1 159 ? 5.009   31.364  53.234  1.00 25.73  ? 159  LEU B O   1 
ATOM   5438  C  CB  . LEU B  1 159 ? 3.333   29.800  51.176  1.00 26.15  ? 159  LEU B CB  1 
ATOM   5439  C  CG  . LEU B  1 159 ? 4.387   29.357  50.148  1.00 23.68  ? 159  LEU B CG  1 
ATOM   5440  C  CD1 . LEU B  1 159 ? 3.717   28.972  48.861  1.00 23.38  ? 159  LEU B CD1 1 
ATOM   5441  C  CD2 . LEU B  1 159 ? 5.412   30.449  49.867  1.00 30.97  ? 159  LEU B CD2 1 
ATOM   5442  N  N   . ALA B  1 160 ? 6.016   29.378  53.087  1.00 24.02  ? 160  ALA B N   1 
ATOM   5443  C  CA  . ALA B  1 160 ? 7.255   29.916  53.582  1.00 31.69  ? 160  ALA B CA  1 
ATOM   5444  C  C   . ALA B  1 160 ? 8.434   29.339  52.842  1.00 30.52  ? 160  ALA B C   1 
ATOM   5445  O  O   . ALA B  1 160 ? 8.495   28.139  52.594  1.00 33.96  ? 160  ALA B O   1 
ATOM   5446  C  CB  . ALA B  1 160 ? 7.376   29.633  55.059  1.00 24.49  ? 160  ALA B CB  1 
ATOM   5447  N  N   . LEU B  1 161 ? 9.365   30.209  52.478  1.00 28.25  ? 161  LEU B N   1 
ATOM   5448  C  CA  . LEU B  1 161 ? 10.692  29.778  52.072  1.00 30.30  ? 161  LEU B CA  1 
ATOM   5449  C  C   . LEU B  1 161 ? 11.652  30.301  53.124  1.00 35.89  ? 161  LEU B C   1 
ATOM   5450  O  O   . LEU B  1 161 ? 12.153  31.406  52.991  1.00 37.11  ? 161  LEU B O   1 
ATOM   5451  C  CB  . LEU B  1 161 ? 11.042  30.371  50.722  1.00 22.94  ? 161  LEU B CB  1 
ATOM   5452  C  CG  . LEU B  1 161 ? 10.342  29.728  49.540  1.00 22.35  ? 161  LEU B CG  1 
ATOM   5453  C  CD1 . LEU B  1 161 ? 10.661  30.489  48.282  1.00 22.51  ? 161  LEU B CD1 1 
ATOM   5454  C  CD2 . LEU B  1 161 ? 10.795  28.296  49.419  1.00 21.43  ? 161  LEU B CD2 1 
ATOM   5455  N  N   . PRO B  1 162 ? 11.893  29.515  54.187  1.00 40.00  ? 162  PRO B N   1 
ATOM   5456  C  CA  . PRO B  1 162 ? 12.576  29.999  55.394  1.00 35.31  ? 162  PRO B CA  1 
ATOM   5457  C  C   . PRO B  1 162 ? 13.920  30.658  55.099  1.00 35.04  ? 162  PRO B C   1 
ATOM   5458  O  O   . PRO B  1 162 ? 14.770  30.104  54.399  1.00 23.57  ? 162  PRO B O   1 
ATOM   5459  C  CB  . PRO B  1 162 ? 12.766  28.731  56.222  1.00 28.75  ? 162  PRO B CB  1 
ATOM   5460  C  CG  . PRO B  1 162 ? 11.726  27.803  55.741  1.00 32.16  ? 162  PRO B CG  1 
ATOM   5461  C  CD  . PRO B  1 162 ? 11.571  28.082  54.285  1.00 37.52  ? 162  PRO B CD  1 
ATOM   5462  N  N   . GLY B  1 163 ? 14.085  31.861  55.634  1.00 35.35  ? 163  GLY B N   1 
ATOM   5463  C  CA  . GLY B  1 163 ? 15.275  32.649  55.398  1.00 42.43  ? 163  GLY B CA  1 
ATOM   5464  C  C   . GLY B  1 163 ? 15.065  33.741  54.369  1.00 49.07  ? 163  GLY B C   1 
ATOM   5465  O  O   . GLY B  1 163 ? 15.766  34.749  54.379  1.00 53.68  ? 163  GLY B O   1 
ATOM   5466  N  N   . SER B  1 164 ? 14.108  33.539  53.472  1.00 49.50  ? 164  SER B N   1 
ATOM   5467  C  CA  . SER B  1 164 ? 13.807  34.532  52.453  1.00 49.09  ? 164  SER B CA  1 
ATOM   5468  C  C   . SER B  1 164 ? 13.206  35.748  53.109  1.00 42.61  ? 164  SER B C   1 
ATOM   5469  O  O   . SER B  1 164 ? 12.644  35.655  54.202  1.00 38.27  ? 164  SER B O   1 
ATOM   5470  C  CB  . SER B  1 164 ? 12.796  33.991  51.454  1.00 58.73  ? 164  SER B CB  1 
ATOM   5471  O  OG  . SER B  1 164 ? 11.517  33.873  52.063  1.00 65.12  ? 164  SER B OG  1 
ATOM   5472  N  N   . ARG B  1 165 ? 13.313  36.887  52.434  1.00 44.68  ? 165  ARG B N   1 
ATOM   5473  C  CA  . ARG B  1 165 ? 12.724  38.118  52.930  1.00 48.50  ? 165  ARG B CA  1 
ATOM   5474  C  C   . ARG B  1 165 ? 11.235  38.211  52.546  1.00 51.74  ? 165  ARG B C   1 
ATOM   5475  O  O   . ARG B  1 165 ? 10.415  38.725  53.315  1.00 51.00  ? 165  ARG B O   1 
ATOM   5476  C  CB  . ARG B  1 165 ? 13.502  39.324  52.402  1.00 53.82  ? 165  ARG B CB  1 
ATOM   5477  C  CG  . ARG B  1 165 ? 13.341  40.588  53.246  1.00 70.77  ? 165  ARG B CG  1 
ATOM   5478  C  CD  . ARG B  1 165 ? 13.868  41.833  52.521  1.00 81.80  ? 165  ARG B CD  1 
ATOM   5479  N  NE  . ARG B  1 165 ? 13.177  42.073  51.252  1.00 88.27  ? 165  ARG B NE  1 
ATOM   5480  C  CZ  . ARG B  1 165 ? 12.145  42.901  51.095  1.00 93.23  ? 165  ARG B CZ  1 
ATOM   5481  N  NH1 . ARG B  1 165 ? 11.676  43.589  52.131  1.00 95.25  ? 165  ARG B NH1 1 
ATOM   5482  N  NH2 . ARG B  1 165 ? 11.582  43.044  49.899  1.00 91.99  ? 165  ARG B NH2 1 
ATOM   5483  N  N   . GLU B  1 166 ? 10.889  37.685  51.370  1.00 50.57  ? 166  GLU B N   1 
ATOM   5484  C  CA  . GLU B  1 166 ? 9.547   37.863  50.822  1.00 50.13  ? 166  GLU B CA  1 
ATOM   5485  C  C   . GLU B  1 166 ? 8.541   36.785  51.158  1.00 50.93  ? 166  GLU B C   1 
ATOM   5486  O  O   . GLU B  1 166 ? 7.360   36.941  50.853  1.00 58.42  ? 166  GLU B O   1 
ATOM   5487  C  CB  . GLU B  1 166 ? 9.589   38.045  49.311  1.00 57.36  ? 166  GLU B CB  1 
ATOM   5488  C  CG  . GLU B  1 166 ? 10.030  39.429  48.880  1.00 64.75  ? 166  GLU B CG  1 
ATOM   5489  C  CD  . GLU B  1 166 ? 11.490  39.461  48.498  1.00 66.46  ? 166  GLU B CD  1 
ATOM   5490  O  OE1 . GLU B  1 166 ? 12.138  38.387  48.590  1.00 62.58  ? 166  GLU B OE1 1 
ATOM   5491  O  OE2 . GLU B  1 166 ? 11.972  40.551  48.104  1.00 65.45  ? 166  GLU B OE2 1 
ATOM   5492  N  N   . ALA B  1 167 ? 8.999   35.689  51.751  1.00 44.48  ? 167  ALA B N   1 
ATOM   5493  C  CA  . ALA B  1 167 ? 8.080   34.715  52.336  1.00 41.30  ? 167  ALA B CA  1 
ATOM   5494  C  C   . ALA B  1 167 ? 8.740   33.989  53.499  1.00 41.03  ? 167  ALA B C   1 
ATOM   5495  O  O   . ALA B  1 167 ? 9.221   32.861  53.352  1.00 39.63  ? 167  ALA B O   1 
ATOM   5496  C  CB  . ALA B  1 167 ? 7.579   33.739  51.299  1.00 40.95  ? 167  ALA B CB  1 
ATOM   5497  N  N   . PRO B  1 168 ? 8.768   34.648  54.668  1.00 43.86  ? 168  PRO B N   1 
ATOM   5498  C  CA  . PRO B  1 168 ? 9.462   34.156  55.859  1.00 45.67  ? 168  PRO B CA  1 
ATOM   5499  C  C   . PRO B  1 168 ? 8.566   33.203  56.629  1.00 49.08  ? 168  PRO B C   1 
ATOM   5500  O  O   . PRO B  1 168 ? 9.042   32.425  57.462  1.00 50.18  ? 168  PRO B O   1 
ATOM   5501  C  CB  . PRO B  1 168 ? 9.682   35.431  56.685  1.00 40.90  ? 168  PRO B CB  1 
ATOM   5502  C  CG  . PRO B  1 168 ? 9.173   36.573  55.829  1.00 40.62  ? 168  PRO B CG  1 
ATOM   5503  C  CD  . PRO B  1 168 ? 8.174   35.967  54.916  1.00 42.19  ? 168  PRO B CD  1 
ATOM   5504  N  N   . GLY B  1 169 ? 7.269   33.282  56.346  1.00 46.74  ? 169  GLY B N   1 
ATOM   5505  C  CA  . GLY B  1 169 ? 6.299   32.416  56.969  1.00 43.76  ? 169  GLY B CA  1 
ATOM   5506  C  C   . GLY B  1 169 ? 5.748   32.952  58.268  1.00 47.51  ? 169  GLY B C   1 
ATOM   5507  O  O   . GLY B  1 169 ? 6.240   33.933  58.835  1.00 29.71  ? 169  GLY B O   1 
ATOM   5508  N  N   . ASN B  1 170 ? 4.709   32.274  58.732  1.00 28.81  ? 170  ASN B N   1 
ATOM   5509  C  CA  . ASN B  1 170 ? 3.990   32.648  59.935  1.00 35.82  ? 170  ASN B CA  1 
ATOM   5510  C  C   . ASN B  1 170 ? 3.292   34.006  59.823  1.00 39.40  ? 170  ASN B C   1 
ATOM   5511  O  O   . ASN B  1 170 ? 2.851   34.573  60.822  1.00 32.61  ? 170  ASN B O   1 
ATOM   5512  C  CB  . ASN B  1 170 ? 4.902   32.585  61.166  1.00 30.81  ? 170  ASN B CB  1 
ATOM   5513  C  CG  . ASN B  1 170 ? 5.573   31.230  61.331  1.00 35.88  ? 170  ASN B CG  1 
ATOM   5514  O  OD1 . ASN B  1 170 ? 5.116   30.223  60.796  1.00 38.39  ? 170  ASN B OD1 1 
ATOM   5515  N  ND2 . ASN B  1 170 ? 6.668   31.204  62.074  1.00 40.39  ? 170  ASN B ND2 1 
ATOM   5516  N  N   . VAL B  1 171 ? 3.167   34.518  58.606  1.00 31.22  ? 171  VAL B N   1 
ATOM   5517  C  CA  . VAL B  1 171 ? 2.558   35.827  58.442  1.00 32.56  ? 171  VAL B CA  1 
ATOM   5518  C  C   . VAL B  1 171 ? 1.085   35.868  58.901  1.00 48.86  ? 171  VAL B C   1 
ATOM   5519  O  O   . VAL B  1 171 ? 0.546   36.934  59.149  1.00 54.04  ? 171  VAL B O   1 
ATOM   5520  C  CB  . VAL B  1 171 ? 2.766   36.416  57.010  1.00 41.59  ? 171  VAL B CB  1 
ATOM   5521  C  CG1 . VAL B  1 171 ? 4.184   36.865  56.840  1.00 44.36  ? 171  VAL B CG1 1 
ATOM   5522  C  CG2 . VAL B  1 171 ? 2.450   35.405  55.934  1.00 43.11  ? 171  VAL B CG2 1 
ATOM   5523  N  N   . GLY B  1 172 ? 0.442   34.715  59.039  1.00 46.18  ? 172  GLY B N   1 
ATOM   5524  C  CA  . GLY B  1 172 ? -0.886  34.673  59.625  1.00 33.93  ? 172  GLY B CA  1 
ATOM   5525  C  C   . GLY B  1 172 ? -0.812  34.945  61.117  1.00 46.61  ? 172  GLY B C   1 
ATOM   5526  O  O   . GLY B  1 172 ? -1.646  35.654  61.698  1.00 46.51  ? 172  GLY B O   1 
ATOM   5527  N  N   . LEU B  1 173 ? 0.209   34.377  61.748  1.00 50.34  ? 173  LEU B N   1 
ATOM   5528  C  CA  . LEU B  1 173 ? 0.465   34.612  63.165  1.00 49.55  ? 173  LEU B CA  1 
ATOM   5529  C  C   . LEU B  1 173 ? 0.828   36.068  63.367  1.00 52.16  ? 173  LEU B C   1 
ATOM   5530  O  O   . LEU B  1 173 ? 0.442   36.688  64.356  1.00 59.94  ? 173  LEU B O   1 
ATOM   5531  C  CB  . LEU B  1 173 ? 1.606   33.729  63.655  1.00 42.23  ? 173  LEU B CB  1 
ATOM   5532  C  CG  . LEU B  1 173 ? 1.227   32.260  63.643  1.00 33.05  ? 173  LEU B CG  1 
ATOM   5533  C  CD1 . LEU B  1 173 ? 2.425   31.435  63.951  1.00 31.96  ? 173  LEU B CD1 1 
ATOM   5534  C  CD2 . LEU B  1 173 ? 0.134   32.031  64.656  1.00 34.09  ? 173  LEU B CD2 1 
ATOM   5535  N  N   . LEU B  1 174 ? 1.578   36.608  62.418  1.00 42.80  ? 174  LEU B N   1 
ATOM   5536  C  CA  . LEU B  1 174 ? 1.894   38.018  62.443  1.00 43.04  ? 174  LEU B CA  1 
ATOM   5537  C  C   . LEU B  1 174 ? 0.624   38.859  62.322  1.00 50.23  ? 174  LEU B C   1 
ATOM   5538  O  O   . LEU B  1 174 ? 0.493   39.870  62.999  1.00 55.13  ? 174  LEU B O   1 
ATOM   5539  C  CB  . LEU B  1 174 ? 2.897   38.354  61.349  1.00 42.23  ? 174  LEU B CB  1 
ATOM   5540  C  CG  . LEU B  1 174 ? 4.261   37.769  61.660  1.00 35.54  ? 174  LEU B CG  1 
ATOM   5541  C  CD1 . LEU B  1 174 ? 5.224   38.042  60.547  1.00 83.67  ? 174  LEU B CD1 1 
ATOM   5542  C  CD2 . LEU B  1 174 ? 4.748   38.385  62.929  1.00 36.78  ? 174  LEU B CD2 1 
ATOM   5543  N  N   . ASP B  1 175 ? -0.311  38.434  61.477  1.00 38.29  ? 175  ASP B N   1 
ATOM   5544  C  CA  . ASP B  1 175 ? -1.595  39.123  61.368  1.00 46.84  ? 175  ASP B CA  1 
ATOM   5545  C  C   . ASP B  1 175 ? -2.312  39.145  62.724  1.00 51.33  ? 175  ASP B C   1 
ATOM   5546  O  O   . ASP B  1 175 ? -2.760  40.203  63.189  1.00 58.65  ? 175  ASP B O   1 
ATOM   5547  C  CB  . ASP B  1 175 ? -2.497  38.479  60.299  1.00 44.63  ? 175  ASP B CB  1 
ATOM   5548  C  CG  . ASP B  1 175 ? -1.954  38.642  58.883  1.00 45.67  ? 175  ASP B CG  1 
ATOM   5549  O  OD1 . ASP B  1 175 ? -0.969  39.390  58.698  1.00 44.07  ? 175  ASP B OD1 1 
ATOM   5550  O  OD2 . ASP B  1 175 ? -2.520  38.022  57.950  1.00 46.40  ? 175  ASP B OD2 1 
ATOM   5551  N  N   . GLN B  1 176 ? -2.422  37.982  63.361  1.00 45.11  ? 176  GLN B N   1 
ATOM   5552  C  CA  . GLN B  1 176 ? -3.066  37.935  64.671  1.00 44.85  ? 176  GLN B CA  1 
ATOM   5553  C  C   . GLN B  1 176 ? -2.330  38.828  65.670  1.00 49.54  ? 176  GLN B C   1 
ATOM   5554  O  O   . GLN B  1 176 ? -2.948  39.476  66.509  1.00 51.95  ? 176  GLN B O   1 
ATOM   5555  C  CB  . GLN B  1 176 ? -3.123  36.509  65.209  1.00 40.69  ? 176  GLN B CB  1 
ATOM   5556  C  CG  . GLN B  1 176 ? -3.816  35.500  64.316  1.00 46.45  ? 176  GLN B CG  1 
ATOM   5557  C  CD  . GLN B  1 176 ? -3.606  34.079  64.809  1.00 44.68  ? 176  GLN B CD  1 
ATOM   5558  O  OE1 . GLN B  1 176 ? -3.017  33.864  65.865  1.00 38.74  ? 176  GLN B OE1 1 
ATOM   5559  N  NE2 . GLN B  1 176 ? -4.084  33.103  64.048  1.00 45.51  ? 176  GLN B NE2 1 
ATOM   5560  N  N   . ARG B  1 177 ? -1.008  38.867  65.577  1.00 50.75  ? 177  ARG B N   1 
ATOM   5561  C  CA  . ARG B  1 177 ? -0.234  39.691  66.483  1.00 43.16  ? 177  ARG B CA  1 
ATOM   5562  C  C   . ARG B  1 177 ? -0.585  41.147  66.291  1.00 53.44  ? 177  ARG B C   1 
ATOM   5563  O  O   . ARG B  1 177 ? -0.847  41.853  67.257  1.00 63.25  ? 177  ARG B O   1 
ATOM   5564  C  CB  . ARG B  1 177 ? 1.260   39.510  66.269  1.00 47.71  ? 177  ARG B CB  1 
ATOM   5565  C  CG  . ARG B  1 177 ? 2.092   40.458  67.111  1.00 43.25  ? 177  ARG B CG  1 
ATOM   5566  C  CD  . ARG B  1 177 ? 3.576   40.251  66.894  1.00 53.46  ? 177  ARG B CD  1 
ATOM   5567  N  NE  . ARG B  1 177 ? 4.068   39.023  67.516  1.00 49.99  ? 177  ARG B NE  1 
ATOM   5568  C  CZ  . ARG B  1 177 ? 5.286   38.536  67.310  1.00 49.48  ? 177  ARG B CZ  1 
ATOM   5569  N  NH1 . ARG B  1 177 ? 6.112   39.179  66.495  1.00 46.57  ? 177  ARG B NH1 1 
ATOM   5570  N  NH2 . ARG B  1 177 ? 5.679   37.418  67.906  1.00 38.96  ? 177  ARG B NH2 1 
ATOM   5571  N  N   . LEU B  1 178 ? -0.598  41.594  65.041  1.00 49.05  ? 178  LEU B N   1 
ATOM   5572  C  CA  . LEU B  1 178 ? -0.898  42.989  64.726  1.00 51.16  ? 178  LEU B CA  1 
ATOM   5573  C  C   . LEU B  1 178 ? -2.283  43.345  65.219  1.00 50.53  ? 178  LEU B C   1 
ATOM   5574  O  O   . LEU B  1 178 ? -2.480  44.417  65.775  1.00 51.71  ? 178  LEU B O   1 
ATOM   5575  C  CB  . LEU B  1 178 ? -0.813  43.244  63.225  1.00 51.75  ? 178  LEU B CB  1 
ATOM   5576  C  CG  . LEU B  1 178 ? -0.600  44.679  62.754  1.00 50.26  ? 178  LEU B CG  1 
ATOM   5577  C  CD1 . LEU B  1 178 ? 0.820   45.142  63.056  1.00 46.35  ? 178  LEU B CD1 1 
ATOM   5578  C  CD2 . LEU B  1 178 ? -0.864  44.727  61.273  1.00 50.01  ? 178  LEU B CD2 1 
ATOM   5579  N  N   . ALA B  1 179 ? -3.236  42.440  65.016  1.00 48.94  ? 179  ALA B N   1 
ATOM   5580  C  CA  . ALA B  1 179 ? -4.561  42.599  65.590  1.00 48.66  ? 179  ALA B CA  1 
ATOM   5581  C  C   . ALA B  1 179 ? -4.467  42.825  67.100  1.00 66.48  ? 179  ALA B C   1 
ATOM   5582  O  O   . ALA B  1 179 ? -5.110  43.733  67.647  1.00 70.90  ? 179  ALA B O   1 
ATOM   5583  C  CB  . ALA B  1 179 ? -5.406  41.391  65.290  1.00 59.34  ? 179  ALA B CB  1 
ATOM   5584  N  N   . LEU B  1 180 ? -3.651  42.017  67.772  1.00 62.99  ? 180  LEU B N   1 
ATOM   5585  C  CA  . LEU B  1 180 ? -3.473  42.172  69.217  1.00 64.14  ? 180  LEU B CA  1 
ATOM   5586  C  C   . LEU B  1 180 ? -2.943  43.554  69.590  1.00 65.66  ? 180  LEU B C   1 
ATOM   5587  O  O   . LEU B  1 180 ? -3.471  44.199  70.500  1.00 71.75  ? 180  LEU B O   1 
ATOM   5588  C  CB  . LEU B  1 180 ? -2.556  41.090  69.788  1.00 61.68  ? 180  LEU B CB  1 
ATOM   5589  C  CG  . LEU B  1 180 ? -3.073  39.659  69.672  1.00 47.65  ? 180  LEU B CG  1 
ATOM   5590  C  CD1 . LEU B  1 180 ? -2.343  38.779  70.639  1.00 55.45  ? 180  LEU B CD1 1 
ATOM   5591  C  CD2 . LEU B  1 180 ? -4.575  39.583  69.910  1.00 49.98  ? 180  LEU B CD2 1 
ATOM   5592  N  N   . GLN B  1 181 ? -1.909  44.005  68.882  1.00 61.40  ? 181  GLN B N   1 
ATOM   5593  C  CA  . GLN B  1 181 ? -1.328  45.321  69.130  1.00 64.25  ? 181  GLN B CA  1 
ATOM   5594  C  C   . GLN B  1 181 ? -2.373  46.398  68.920  1.00 65.12  ? 181  GLN B C   1 
ATOM   5595  O  O   . GLN B  1 181 ? -2.388  47.413  69.619  1.00 64.20  ? 181  GLN B O   1 
ATOM   5596  C  CB  . GLN B  1 181 ? -0.134  45.572  68.216  1.00 51.67  ? 181  GLN B CB  1 
ATOM   5597  C  CG  . GLN B  1 181 ? 1.137   44.924  68.683  1.00 79.90  ? 181  GLN B CG  1 
ATOM   5598  C  CD  . GLN B  1 181 ? 2.011   44.522  67.523  1.00 81.98  ? 181  GLN B CD  1 
ATOM   5599  O  OE1 . GLN B  1 181 ? 1.568   44.531  66.375  1.00 80.63  ? 181  GLN B OE1 1 
ATOM   5600  N  NE2 . GLN B  1 181 ? 3.258   44.162  67.809  1.00 85.77  ? 181  GLN B NE2 1 
ATOM   5601  N  N   . TRP B  1 182 ? -3.254  46.166  67.957  1.00 54.22  ? 182  TRP B N   1 
ATOM   5602  C  CA  . TRP B  1 182 ? -4.324  47.102  67.694  1.00 59.30  ? 182  TRP B CA  1 
ATOM   5603  C  C   . TRP B  1 182 ? -5.278  47.132  68.873  1.00 57.87  ? 182  TRP B C   1 
ATOM   5604  O  O   . TRP B  1 182 ? -5.772  48.199  69.237  1.00 60.08  ? 182  TRP B O   1 
ATOM   5605  C  CB  . TRP B  1 182 ? -5.066  46.740  66.414  1.00 58.02  ? 182  TRP B CB  1 
ATOM   5606  C  CG  . TRP B  1 182 ? -6.085  47.744  66.019  1.00 59.82  ? 182  TRP B CG  1 
ATOM   5607  C  CD1 . TRP B  1 182 ? -5.921  48.774  65.146  1.00 61.61  ? 182  TRP B CD1 1 
ATOM   5608  C  CD2 . TRP B  1 182 ? -7.435  47.818  66.484  1.00 61.75  ? 182  TRP B CD2 1 
ATOM   5609  N  NE1 . TRP B  1 182 ? -7.090  49.487  65.033  1.00 64.33  ? 182  TRP B NE1 1 
ATOM   5610  C  CE2 . TRP B  1 182 ? -8.035  48.920  65.848  1.00 63.54  ? 182  TRP B CE2 1 
ATOM   5611  C  CE3 . TRP B  1 182 ? -8.195  47.061  67.379  1.00 64.92  ? 182  TRP B CE3 1 
ATOM   5612  C  CZ2 . TRP B  1 182 ? -9.361  49.285  66.079  1.00 64.34  ? 182  TRP B CZ2 1 
ATOM   5613  C  CZ3 . TRP B  1 182 ? -9.511  47.427  67.610  1.00 67.96  ? 182  TRP B CZ3 1 
ATOM   5614  C  CH2 . TRP B  1 182 ? -10.080 48.527  66.961  1.00 65.43  ? 182  TRP B CH2 1 
ATOM   5615  N  N   . VAL B  1 183 ? -5.541  45.975  69.474  1.00 57.11  ? 183  VAL B N   1 
ATOM   5616  C  CA  . VAL B  1 183 ? -6.334  45.978  70.703  1.00 68.74  ? 183  VAL B CA  1 
ATOM   5617  C  C   . VAL B  1 183 ? -5.610  46.793  71.779  1.00 67.73  ? 183  VAL B C   1 
ATOM   5618  O  O   . VAL B  1 183 ? -6.228  47.604  72.459  1.00 68.21  ? 183  VAL B O   1 
ATOM   5619  C  CB  . VAL B  1 183 ? -6.702  44.556  71.209  1.00 78.83  ? 183  VAL B CB  1 
ATOM   5620  C  CG1 . VAL B  1 183 ? -6.343  44.386  72.675  1.00 78.74  ? 183  VAL B CG1 1 
ATOM   5621  C  CG2 . VAL B  1 183 ? -8.183  44.288  71.013  1.00 58.71  ? 183  VAL B CG2 1 
ATOM   5622  N  N   . GLN B  1 184 ? -4.296  46.613  71.895  1.00 65.65  ? 184  GLN B N   1 
ATOM   5623  C  CA  . GLN B  1 184 ? -3.517  47.360  72.883  1.00 68.88  ? 184  GLN B CA  1 
ATOM   5624  C  C   . GLN B  1 184 ? -3.644  48.873  72.712  1.00 76.14  ? 184  GLN B C   1 
ATOM   5625  O  O   . GLN B  1 184 ? -3.853  49.595  73.689  1.00 81.49  ? 184  GLN B O   1 
ATOM   5626  C  CB  . GLN B  1 184 ? -2.044  46.954  72.844  1.00 69.53  ? 184  GLN B CB  1 
ATOM   5627  C  CG  . GLN B  1 184 ? -1.742  45.643  73.532  1.00 73.98  ? 184  GLN B CG  1 
ATOM   5628  C  CD  . GLN B  1 184 ? -2.016  45.701  75.018  1.00 78.54  ? 184  GLN B CD  1 
ATOM   5629  O  OE1 . GLN B  1 184 ? -1.166  46.132  75.802  1.00 79.62  ? 184  GLN B OE1 1 
ATOM   5630  N  NE2 . GLN B  1 184 ? -3.207  45.268  75.416  1.00 78.62  ? 184  GLN B NE2 1 
ATOM   5631  N  N   . GLU B  1 185 ? -3.523  49.350  71.474  1.00 74.62  ? 185  GLU B N   1 
ATOM   5632  C  CA  . GLU B  1 185 ? -3.615  50.782  71.211  1.00 75.27  ? 185  GLU B CA  1 
ATOM   5633  C  C   . GLU B  1 185 ? -5.032  51.318  71.394  1.00 74.78  ? 185  GLU B C   1 
ATOM   5634  O  O   . GLU B  1 185 ? -5.232  52.343  72.038  1.00 75.72  ? 185  GLU B O   1 
ATOM   5635  C  CB  . GLU B  1 185 ? -3.159  51.121  69.792  1.00 78.24  ? 185  GLU B CB  1 
ATOM   5636  C  CG  . GLU B  1 185 ? -1.746  50.722  69.421  1.00 86.20  ? 185  GLU B CG  1 
ATOM   5637  C  CD  . GLU B  1 185 ? -1.517  50.811  67.910  1.00 100.42 ? 185  GLU B CD  1 
ATOM   5638  O  OE1 . GLU B  1 185 ? -2.074  51.738  67.270  1.00 104.74 ? 185  GLU B OE1 1 
ATOM   5639  O  OE2 . GLU B  1 185 ? -0.800  49.943  67.356  1.00 102.98 ? 185  GLU B OE2 1 
ATOM   5640  N  N   . ASN B  1 186 ? -6.019  50.637  70.826  1.00 65.40  ? 186  ASN B N   1 
ATOM   5641  C  CA  . ASN B  1 186 ? -7.323  51.271  70.659  1.00 67.26  ? 186  ASN B CA  1 
ATOM   5642  C  C   . ASN B  1 186 ? -8.510  50.667  71.395  1.00 68.21  ? 186  ASN B C   1 
ATOM   5643  O  O   . ASN B  1 186 ? -9.630  51.144  71.233  1.00 69.79  ? 186  ASN B O   1 
ATOM   5644  C  CB  . ASN B  1 186 ? -7.678  51.357  69.172  1.00 66.14  ? 186  ASN B CB  1 
ATOM   5645  C  CG  . ASN B  1 186 ? -6.577  51.984  68.344  1.00 82.20  ? 186  ASN B CG  1 
ATOM   5646  O  OD1 . ASN B  1 186 ? -6.496  53.210  68.222  1.00 84.13  ? 186  ASN B OD1 1 
ATOM   5647  N  ND2 . ASN B  1 186 ? -5.727  51.144  67.757  1.00 77.31  ? 186  ASN B ND2 1 
ATOM   5648  N  N   . ILE B  1 187 ? -8.300  49.621  72.185  1.00 72.10  ? 187  ILE B N   1 
ATOM   5649  C  CA  . ILE B  1 187 ? -9.461  48.922  72.735  1.00 72.70  ? 187  ILE B CA  1 
ATOM   5650  C  C   . ILE B  1 187 ? -10.140 49.755  73.813  1.00 74.81  ? 187  ILE B C   1 
ATOM   5651  O  O   . ILE B  1 187 ? -11.355 49.661  74.009  1.00 75.90  ? 187  ILE B O   1 
ATOM   5652  C  CB  . ILE B  1 187 ? -9.135  47.497  73.248  1.00 66.29  ? 187  ILE B CB  1 
ATOM   5653  C  CG1 . ILE B  1 187 ? -10.413 46.663  73.357  1.00 79.41  ? 187  ILE B CG1 1 
ATOM   5654  C  CG2 . ILE B  1 187 ? -8.419  47.551  74.588  1.00 86.58  ? 187  ILE B CG2 1 
ATOM   5655  C  CD1 . ILE B  1 187 ? -11.291 46.704  72.132  1.00 66.12  ? 187  ILE B CD1 1 
ATOM   5656  N  N   . ALA B  1 188 ? -9.346  50.588  74.482  1.00 76.82  ? 188  ALA B N   1 
ATOM   5657  C  CA  . ALA B  1 188 ? -9.839  51.431  75.560  1.00 84.00  ? 188  ALA B CA  1 
ATOM   5658  C  C   . ALA B  1 188 ? -11.024 52.275  75.095  1.00 86.91  ? 188  ALA B C   1 
ATOM   5659  O  O   . ALA B  1 188 ? -12.054 52.353  75.769  1.00 79.46  ? 188  ALA B O   1 
ATOM   5660  C  CB  . ALA B  1 188 ? -8.714  52.314  76.095  1.00 76.44  ? 188  ALA B CB  1 
ATOM   5661  N  N   . ALA B  1 189 ? -10.886 52.869  73.916  1.00 76.75  ? 189  ALA B N   1 
ATOM   5662  C  CA  . ALA B  1 189 ? -11.918 53.737  73.365  1.00 82.22  ? 189  ALA B CA  1 
ATOM   5663  C  C   . ALA B  1 189 ? -13.255 53.024  73.179  1.00 85.18  ? 189  ALA B C   1 
ATOM   5664  O  O   . ALA B  1 189 ? -14.279 53.660  72.915  1.00 88.71  ? 189  ALA B O   1 
ATOM   5665  C  CB  . ALA B  1 189 ? -11.449 54.332  72.054  1.00 79.66  ? 189  ALA B CB  1 
ATOM   5666  N  N   . PHE B  1 190 ? -13.243 51.704  73.313  1.00 84.14  ? 190  PHE B N   1 
ATOM   5667  C  CA  . PHE B  1 190 ? -14.456 50.918  73.174  1.00 82.04  ? 190  PHE B CA  1 
ATOM   5668  C  C   . PHE B  1 190 ? -15.016 50.586  74.537  1.00 85.54  ? 190  PHE B C   1 
ATOM   5669  O  O   . PHE B  1 190 ? -16.204 50.328  74.678  1.00 88.90  ? 190  PHE B O   1 
ATOM   5670  C  CB  . PHE B  1 190 ? -14.186 49.663  72.344  1.00 76.47  ? 190  PHE B CB  1 
ATOM   5671  C  CG  . PHE B  1 190 ? -13.895 49.963  70.902  1.00 75.80  ? 190  PHE B CG  1 
ATOM   5672  C  CD1 . PHE B  1 190 ? -12.602 50.239  70.484  1.00 73.75  ? 190  PHE B CD1 1 
ATOM   5673  C  CD2 . PHE B  1 190 ? -14.926 50.019  69.966  1.00 77.26  ? 190  PHE B CD2 1 
ATOM   5674  C  CE1 . PHE B  1 190 ? -12.336 50.543  69.146  1.00 74.18  ? 190  PHE B CE1 1 
ATOM   5675  C  CE2 . PHE B  1 190 ? -14.668 50.321  68.632  1.00 73.14  ? 190  PHE B CE2 1 
ATOM   5676  C  CZ  . PHE B  1 190 ? -13.374 50.583  68.219  1.00 71.33  ? 190  PHE B CZ  1 
ATOM   5677  N  N   . GLY B  1 191 ? -14.155 50.644  75.544  1.00 87.38  ? 191  GLY B N   1 
ATOM   5678  C  CA  . GLY B  1 191 ? -14.553 50.338  76.902  1.00 93.62  ? 191  GLY B CA  1 
ATOM   5679  C  C   . GLY B  1 191 ? -13.787 49.118  77.355  1.00 98.97  ? 191  GLY B C   1 
ATOM   5680  O  O   . GLY B  1 191 ? -14.249 48.352  78.203  1.00 106.19 ? 191  GLY B O   1 
ATOM   5681  N  N   . GLY B  1 192 ? -12.604 48.944  76.775  1.00 95.35  ? 192  GLY B N   1 
ATOM   5682  C  CA  . GLY B  1 192 ? -11.789 47.772  77.030  1.00 92.96  ? 192  GLY B CA  1 
ATOM   5683  C  C   . GLY B  1 192 ? -10.548 48.028  77.863  1.00 90.51  ? 192  GLY B C   1 
ATOM   5684  O  O   . GLY B  1 192 ? -10.013 49.137  77.902  1.00 88.73  ? 192  GLY B O   1 
ATOM   5685  N  N   . ASP B  1 193 ? -10.092 46.976  78.528  1.00 88.97  ? 193  ASP B N   1 
ATOM   5686  C  CA  . ASP B  1 193 ? -8.940  47.053  79.404  1.00 88.25  ? 193  ASP B CA  1 
ATOM   5687  C  C   . ASP B  1 193 ? -7.736  46.430  78.707  1.00 84.52  ? 193  ASP B C   1 
ATOM   5688  O  O   . ASP B  1 193 ? -7.650  45.206  78.582  1.00 79.78  ? 193  ASP B O   1 
ATOM   5689  C  CB  . ASP B  1 193 ? -9.239  46.303  80.706  1.00 90.15  ? 193  ASP B CB  1 
ATOM   5690  C  CG  . ASP B  1 193 ? -8.368  46.751  81.859  1.00 91.62  ? 193  ASP B CG  1 
ATOM   5691  O  OD1 . ASP B  1 193 ? -7.371  47.463  81.618  1.00 94.85  ? 193  ASP B OD1 1 
ATOM   5692  O  OD2 . ASP B  1 193 ? -8.682  46.378  83.011  1.00 88.52  ? 193  ASP B OD2 1 
ATOM   5693  N  N   . PRO B  1 194 ? -6.801  47.275  78.245  1.00 83.97  ? 194  PRO B N   1 
ATOM   5694  C  CA  . PRO B  1 194 ? -5.518  46.847  77.668  1.00 83.41  ? 194  PRO B CA  1 
ATOM   5695  C  C   . PRO B  1 194 ? -4.669  45.995  78.626  1.00 84.54  ? 194  PRO B C   1 
ATOM   5696  O  O   . PRO B  1 194 ? -3.654  45.428  78.215  1.00 85.15  ? 194  PRO B O   1 
ATOM   5697  C  CB  . PRO B  1 194 ? -4.807  48.176  77.387  1.00 81.11  ? 194  PRO B CB  1 
ATOM   5698  C  CG  . PRO B  1 194 ? -5.902  49.158  77.211  1.00 80.81  ? 194  PRO B CG  1 
ATOM   5699  C  CD  . PRO B  1 194 ? -6.978  48.735  78.165  1.00 82.48  ? 194  PRO B CD  1 
ATOM   5700  N  N   . MET B  1 195 ? -5.078  45.911  79.887  1.00 83.40  ? 195  MET B N   1 
ATOM   5701  C  CA  . MET B  1 195 ? -4.332  45.145  80.875  1.00 83.34  ? 195  MET B CA  1 
ATOM   5702  C  C   . MET B  1 195 ? -5.072  43.862  81.275  1.00 86.09  ? 195  MET B C   1 
ATOM   5703  O  O   . MET B  1 195 ? -4.580  43.083  82.103  1.00 81.91  ? 195  MET B O   1 
ATOM   5704  C  CB  . MET B  1 195 ? -3.994  46.020  82.085  1.00 81.68  ? 195  MET B CB  1 
ATOM   5705  C  CG  . MET B  1 195 ? -3.034  47.157  81.754  1.00 79.32  ? 195  MET B CG  1 
ATOM   5706  S  SD  . MET B  1 195 ? -3.010  48.513  82.953  1.00 174.66 ? 195  MET B SD  1 
ATOM   5707  C  CE  . MET B  1 195 ? -4.504  49.419  82.536  1.00 76.70  ? 195  MET B CE  1 
ATOM   5708  N  N   . SER B  1 196 ? -6.244  43.646  80.669  1.00 87.39  ? 196  SER B N   1 
ATOM   5709  C  CA  . SER B  1 196 ? -6.994  42.394  80.832  1.00 84.33  ? 196  SER B CA  1 
ATOM   5710  C  C   . SER B  1 196 ? -7.434  41.795  79.484  1.00 85.22  ? 196  SER B C   1 
ATOM   5711  O  O   . SER B  1 196 ? -8.630  41.749  79.166  1.00 77.76  ? 196  SER B O   1 
ATOM   5712  C  CB  . SER B  1 196 ? -8.200  42.587  81.755  1.00 77.49  ? 196  SER B CB  1 
ATOM   5713  O  OG  . SER B  1 196 ? -8.628  41.351  82.305  1.00 71.37  ? 196  SER B OG  1 
ATOM   5714  N  N   . VAL B  1 197 ? -6.447  41.343  78.705  1.00 87.83  ? 197  VAL B N   1 
ATOM   5715  C  CA  . VAL B  1 197 ? -6.673  40.675  77.421  1.00 81.64  ? 197  VAL B CA  1 
ATOM   5716  C  C   . VAL B  1 197 ? -6.586  39.163  77.586  1.00 69.85  ? 197  VAL B C   1 
ATOM   5717  O  O   . VAL B  1 197 ? -5.536  38.628  77.936  1.00 62.74  ? 197  VAL B O   1 
ATOM   5718  C  CB  . VAL B  1 197 ? -5.624  41.098  76.351  1.00 86.33  ? 197  VAL B CB  1 
ATOM   5719  C  CG1 . VAL B  1 197 ? -5.655  40.159  75.161  1.00 79.43  ? 197  VAL B CG1 1 
ATOM   5720  C  CG2 . VAL B  1 197 ? -5.851  42.530  75.892  1.00 89.69  ? 197  VAL B CG2 1 
ATOM   5721  N  N   . THR B  1 198 ? -7.693  38.476  77.333  1.00 66.21  ? 198  THR B N   1 
ATOM   5722  C  CA  . THR B  1 198 ? -7.688  37.022  77.351  1.00 64.91  ? 198  THR B CA  1 
ATOM   5723  C  C   . THR B  1 198 ? -7.920  36.479  75.941  1.00 67.02  ? 198  THR B C   1 
ATOM   5724  O  O   . THR B  1 198 ? -8.958  36.752  75.334  1.00 72.37  ? 198  THR B O   1 
ATOM   5725  C  CB  . THR B  1 198 ? -8.758  36.474  78.313  1.00 66.12  ? 198  THR B CB  1 
ATOM   5726  O  OG1 . THR B  1 198 ? -8.459  36.894  79.648  1.00 70.35  ? 198  THR B OG1 1 
ATOM   5727  C  CG2 . THR B  1 198 ? -8.787  34.960  78.274  1.00 64.31  ? 198  THR B CG2 1 
ATOM   5728  N  N   . LEU B  1 199 ? -6.952  35.728  75.411  1.00 63.16  ? 199  LEU B N   1 
ATOM   5729  C  CA  . LEU B  1 199 ? -7.096  35.151  74.069  1.00 60.88  ? 199  LEU B CA  1 
ATOM   5730  C  C   . LEU B  1 199 ? -7.826  33.835  74.162  1.00 63.90  ? 199  LEU B C   1 
ATOM   5731  O  O   . LEU B  1 199 ? -7.574  33.066  75.074  1.00 49.56  ? 199  LEU B O   1 
ATOM   5732  C  CB  . LEU B  1 199 ? -5.736  34.875  73.444  1.00 48.05  ? 199  LEU B CB  1 
ATOM   5733  C  CG  . LEU B  1 199 ? -4.759  36.037  73.366  1.00 98.51  ? 199  LEU B CG  1 
ATOM   5734  C  CD1 . LEU B  1 199 ? -3.410  35.546  72.848  1.00 46.30  ? 199  LEU B CD1 1 
ATOM   5735  C  CD2 . LEU B  1 199 ? -5.333  37.147  72.490  1.00 49.20  ? 199  LEU B CD2 1 
ATOM   5736  N  N   . PHE B  1 200 ? -8.725  33.560  73.230  1.00 49.27  ? 200  PHE B N   1 
ATOM   5737  C  CA  . PHE B  1 200 ? -9.274  32.210  73.151  1.00 61.97  ? 200  PHE B CA  1 
ATOM   5738  C  C   . PHE B  1 200 ? -9.463  31.710  71.727  1.00 47.23  ? 200  PHE B C   1 
ATOM   5739  O  O   . PHE B  1 200 ? -9.739  32.492  70.822  1.00 53.63  ? 200  PHE B O   1 
ATOM   5740  C  CB  . PHE B  1 200 ? -10.533 32.015  74.021  1.00 51.23  ? 200  PHE B CB  1 
ATOM   5741  C  CG  . PHE B  1 200 ? -11.762 32.750  73.551  1.00 58.77  ? 200  PHE B CG  1 
ATOM   5742  C  CD1 . PHE B  1 200 ? -11.692 34.039  73.042  1.00 60.92  ? 200  PHE B CD1 1 
ATOM   5743  C  CD2 . PHE B  1 200 ? -13.011 32.151  73.666  1.00 59.86  ? 200  PHE B CD2 1 
ATOM   5744  C  CE1 . PHE B  1 200 ? -12.844 34.706  72.633  1.00 64.97  ? 200  PHE B CE1 1 
ATOM   5745  C  CE2 . PHE B  1 200 ? -14.164 32.811  73.260  1.00 55.84  ? 200  PHE B CE2 1 
ATOM   5746  C  CZ  . PHE B  1 200 ? -14.079 34.089  72.741  1.00 66.85  ? 200  PHE B CZ  1 
ATOM   5747  N  N   . GLY B  1 201 ? -9.272  30.406  71.530  1.00 49.59  ? 201  GLY B N   1 
ATOM   5748  C  CA  . GLY B  1 201 ? -9.495  29.824  70.217  1.00 44.57  ? 201  GLY B CA  1 
ATOM   5749  C  C   . GLY B  1 201 ? -9.808  28.341  70.230  1.00 52.33  ? 201  GLY B C   1 
ATOM   5750  O  O   . GLY B  1 201 ? -9.591  27.658  71.231  1.00 48.29  ? 201  GLY B O   1 
ATOM   5751  N  N   . GLU B  1 202 ? -10.317 27.834  69.114  1.00 43.47  ? 202  GLU B N   1 
ATOM   5752  C  CA  . GLU B  1 202 ? -10.561 26.409  68.992  1.00 42.97  ? 202  GLU B CA  1 
ATOM   5753  C  C   . GLU B  1 202 ? -9.722  25.832  67.845  1.00 52.33  ? 202  GLU B C   1 
ATOM   5754  O  O   . GLU B  1 202 ? -9.357  26.575  66.941  1.00 45.24  ? 202  GLU B O   1 
ATOM   5755  C  CB  . GLU B  1 202 ? -12.046 26.166  68.777  1.00 52.53  ? 202  GLU B CB  1 
ATOM   5756  C  CG  . GLU B  1 202 ? -12.452 24.724  68.864  1.00 54.22  ? 202  GLU B CG  1 
ATOM   5757  C  CD  . GLU B  1 202 ? -12.451 24.059  67.513  1.00 56.11  ? 202  GLU B CD  1 
ATOM   5758  O  OE1 . GLU B  1 202 ? -12.423 24.790  66.495  1.00 55.65  ? 202  GLU B OE1 1 
ATOM   5759  O  OE2 . GLU B  1 202 ? -12.473 22.810  67.469  1.00 55.44  ? 202  GLU B OE2 1 
ATOM   5760  N  N   . SER B  1 203 ? -9.396  24.532  67.905  1.00 60.90  ? 203  SER B N   1 
ATOM   5761  C  CA  . SER B  1 203 ? -8.692  23.823  66.831  1.00 37.74  ? 203  SER B CA  1 
ATOM   5762  C  C   . SER B  1 203 ? -7.457  24.644  66.499  1.00 46.68  ? 203  SER B C   1 
ATOM   5763  O  O   . SER B  1 203 ? -6.641  24.900  67.377  1.00 54.25  ? 203  SER B O   1 
ATOM   5764  C  CB  . SER B  1 203 ? -9.636  23.651  65.602  1.00 98.76  ? 203  SER B CB  1 
ATOM   5765  O  OG  . SER B  1 203 ? -9.229  22.598  64.639  1.00 36.38  ? 203  SER B OG  1 
ATOM   5766  N  N   . ALA B  1 204 ? -7.341  25.108  65.264  1.00 38.43  ? 204  ALA B N   1 
ATOM   5767  C  CA  . ALA B  1 204 ? -6.148  25.835  64.846  1.00 37.54  ? 204  ALA B CA  1 
ATOM   5768  C  C   . ALA B  1 204 ? -6.018  27.176  65.552  1.00 43.36  ? 204  ALA B C   1 
ATOM   5769  O  O   . ALA B  1 204 ? -4.910  27.686  65.741  1.00 42.79  ? 204  ALA B O   1 
ATOM   5770  C  CB  . ALA B  1 204 ? -6.144  26.031  63.349  1.00 38.58  ? 204  ALA B CB  1 
ATOM   5771  N  N   . GLY B  1 205 ? -7.155  27.746  65.937  1.00 45.05  ? 205  GLY B N   1 
ATOM   5772  C  CA  . GLY B  1 205 ? -7.162  28.964  66.728  1.00 43.74  ? 205  GLY B CA  1 
ATOM   5773  C  C   . GLY B  1 205 ? -6.595  28.747  68.121  1.00 44.93  ? 205  GLY B C   1 
ATOM   5774  O  O   . GLY B  1 205 ? -5.879  29.600  68.655  1.00 45.07  ? 205  GLY B O   1 
ATOM   5775  N  N   . ALA B  1 206 ? -6.924  27.605  68.718  1.00 46.71  ? 206  ALA B N   1 
ATOM   5776  C  CA  . ALA B  1 206 ? -6.308  27.205  69.977  1.00 54.35  ? 206  ALA B CA  1 
ATOM   5777  C  C   . ALA B  1 206 ? -4.787  27.124  69.804  1.00 47.01  ? 206  ALA B C   1 
ATOM   5778  O  O   . ALA B  1 206 ? -4.017  27.706  70.578  1.00 44.00  ? 206  ALA B O   1 
ATOM   5779  C  CB  . ALA B  1 206 ? -6.873  25.867  70.445  1.00 56.82  ? 206  ALA B CB  1 
ATOM   5780  N  N   . ALA B  1 207 ? -4.368  26.415  68.764  1.00 38.77  ? 207  ALA B N   1 
ATOM   5781  C  CA  . ALA B  1 207 ? -2.960  26.307  68.444  1.00 46.25  ? 207  ALA B CA  1 
ATOM   5782  C  C   . ALA B  1 207 ? -2.313  27.686  68.332  1.00 52.37  ? 207  ALA B C   1 
ATOM   5783  O  O   . ALA B  1 207 ? -1.180  27.893  68.770  1.00 52.21  ? 207  ALA B O   1 
ATOM   5784  C  CB  . ALA B  1 207 ? -2.781  25.534  67.159  1.00 49.72  ? 207  ALA B CB  1 
ATOM   5785  N  N   . SER B  1 208 ? -3.045  28.633  67.760  1.00 52.40  ? 208  SER B N   1 
ATOM   5786  C  CA  . SER B  1 208 ? -2.513  29.977  67.589  1.00 47.14  ? 208  SER B CA  1 
ATOM   5787  C  C   . SER B  1 208 ? -2.354  30.665  68.935  1.00 45.32  ? 208  SER B C   1 
ATOM   5788  O  O   . SER B  1 208 ? -1.334  31.298  69.201  1.00 44.65  ? 208  SER B O   1 
ATOM   5789  C  CB  . SER B  1 208 ? -3.420  30.790  66.679  1.00 44.41  ? 208  SER B CB  1 
ATOM   5790  O  OG  . SER B  1 208 ? -3.521  30.164  65.419  1.00 35.38  ? 208  SER B OG  1 
ATOM   5791  N  N   . VAL B  1 209 ? -3.370  30.539  69.778  1.00 43.76  ? 209  VAL B N   1 
ATOM   5792  C  CA  . VAL B  1 209 ? -3.296  31.073  71.121  1.00 40.30  ? 209  VAL B CA  1 
ATOM   5793  C  C   . VAL B  1 209 ? -2.006  30.587  71.761  1.00 47.98  ? 209  VAL B C   1 
ATOM   5794  O  O   . VAL B  1 209 ? -1.196  31.377  72.282  1.00 47.54  ? 209  VAL B O   1 
ATOM   5795  C  CB  . VAL B  1 209 ? -4.479  30.580  71.945  1.00 41.69  ? 209  VAL B CB  1 
ATOM   5796  C  CG1 . VAL B  1 209 ? -4.303  30.944  73.402  1.00 42.96  ? 209  VAL B CG1 1 
ATOM   5797  C  CG2 . VAL B  1 209 ? -5.771  31.146  71.388  1.00 44.67  ? 209  VAL B CG2 1 
ATOM   5798  N  N   . GLY B  1 210 ? -1.799  29.278  71.668  1.00 49.03  ? 210  GLY B N   1 
ATOM   5799  C  CA  . GLY B  1 210 ? -0.635  28.654  72.264  1.00 50.26  ? 210  GLY B CA  1 
ATOM   5800  C  C   . GLY B  1 210 ? 0.656   29.191  71.692  1.00 48.03  ? 210  GLY B C   1 
ATOM   5801  O  O   . GLY B  1 210 ? 1.647   29.394  72.408  1.00 46.76  ? 210  GLY B O   1 
ATOM   5802  N  N   . MET B  1 211 ? 0.650   29.437  70.390  1.00 47.51  ? 211  MET B N   1 
ATOM   5803  C  CA  . MET B  1 211 ? 1.866   29.886  69.744  1.00 48.73  ? 211  MET B CA  1 
ATOM   5804  C  C   . MET B  1 211 ? 2.172   31.322  70.119  1.00 53.80  ? 211  MET B C   1 
ATOM   5805  O  O   . MET B  1 211 ? 3.322   31.748  70.086  1.00 59.42  ? 211  MET B O   1 
ATOM   5806  C  CB  . MET B  1 211 ? 1.809   29.679  68.236  1.00 47.36  ? 211  MET B CB  1 
ATOM   5807  C  CG  . MET B  1 211 ? 2.878   28.713  67.761  1.00 32.01  ? 211  MET B CG  1 
ATOM   5808  S  SD  . MET B  1 211 ? 2.411   27.858  66.274  1.00 59.13  ? 211  MET B SD  1 
ATOM   5809  C  CE  . MET B  1 211 ? 0.883   27.085  66.766  1.00 31.12  ? 211  MET B CE  1 
ATOM   5810  N  N   . HIS B  1 212 ? 1.138   32.061  70.501  1.00 55.22  ? 212  HIS B N   1 
ATOM   5811  C  CA  . HIS B  1 212 ? 1.342   33.379  71.073  1.00 56.80  ? 212  HIS B CA  1 
ATOM   5812  C  C   . HIS B  1 212 ? 1.988   33.231  72.445  1.00 61.21  ? 212  HIS B C   1 
ATOM   5813  O  O   . HIS B  1 212 ? 3.001   33.884  72.736  1.00 61.45  ? 212  HIS B O   1 
ATOM   5814  C  CB  . HIS B  1 212 ? 0.021   34.146  71.148  1.00 52.79  ? 212  HIS B CB  1 
ATOM   5815  C  CG  . HIS B  1 212 ? -0.475  34.598  69.814  1.00 44.89  ? 212  HIS B CG  1 
ATOM   5816  N  ND1 . HIS B  1 212 ? 0.257   35.431  68.997  1.00 43.79  ? 212  HIS B ND1 1 
ATOM   5817  C  CD2 . HIS B  1 212 ? -1.612  34.314  69.141  1.00 41.35  ? 212  HIS B CD2 1 
ATOM   5818  C  CE1 . HIS B  1 212 ? -0.412  35.647  67.880  1.00 42.66  ? 212  HIS B CE1 1 
ATOM   5819  N  NE2 . HIS B  1 212 ? -1.551  34.982  67.943  1.00 41.81  ? 212  HIS B NE2 1 
ATOM   5820  N  N   . ILE B  1 213 ? 1.412   32.356  73.274  1.00 58.83  ? 213  ILE B N   1 
ATOM   5821  C  CA  . ILE B  1 213 ? 2.013   32.035  74.569  1.00 53.64  ? 213  ILE B CA  1 
ATOM   5822  C  C   . ILE B  1 213 ? 3.509   31.722  74.437  1.00 52.09  ? 213  ILE B C   1 
ATOM   5823  O  O   . ILE B  1 213 ? 4.310   32.131  75.281  1.00 53.30  ? 213  ILE B O   1 
ATOM   5824  C  CB  . ILE B  1 213 ? 1.335   30.826  75.224  1.00 40.58  ? 213  ILE B CB  1 
ATOM   5825  C  CG1 . ILE B  1 213 ? -0.133  31.107  75.502  1.00 42.02  ? 213  ILE B CG1 1 
ATOM   5826  C  CG2 . ILE B  1 213 ? 2.030   30.465  76.507  1.00 43.94  ? 213  ILE B CG2 1 
ATOM   5827  C  CD1 . ILE B  1 213 ? -0.810  29.978  76.238  1.00 42.09  ? 213  ILE B CD1 1 
ATOM   5828  N  N   . LEU B  1 214 ? 3.877   31.019  73.363  1.00 47.42  ? 214  LEU B N   1 
ATOM   5829  C  CA  . LEU B  1 214 ? 5.257   30.555  73.168  1.00 46.72  ? 214  LEU B CA  1 
ATOM   5830  C  C   . LEU B  1 214 ? 6.156   31.526  72.394  1.00 49.06  ? 214  LEU B C   1 
ATOM   5831  O  O   . LEU B  1 214 ? 7.381   31.339  72.324  1.00 50.46  ? 214  LEU B O   1 
ATOM   5832  C  CB  . LEU B  1 214 ? 5.274   29.193  72.466  1.00 44.56  ? 214  LEU B CB  1 
ATOM   5833  C  CG  . LEU B  1 214 ? 5.128   27.919  73.297  1.00 46.46  ? 214  LEU B CG  1 
ATOM   5834  C  CD1 . LEU B  1 214 ? 3.872   27.960  74.132  1.00 49.16  ? 214  LEU B CD1 1 
ATOM   5835  C  CD2 . LEU B  1 214 ? 5.100   26.710  72.385  1.00 47.39  ? 214  LEU B CD2 1 
ATOM   5836  N  N   . SER B  1 215 ? 5.552   32.541  71.790  1.00 48.70  ? 215  SER B N   1 
ATOM   5837  C  CA  . SER B  1 215 ? 6.329   33.538  71.074  1.00 54.62  ? 215  SER B CA  1 
ATOM   5838  C  C   . SER B  1 215 ? 6.515   34.719  71.996  1.00 63.34  ? 215  SER B C   1 
ATOM   5839  O  O   . SER B  1 215 ? 5.543   35.269  72.523  1.00 65.02  ? 215  SER B O   1 
ATOM   5840  C  CB  . SER B  1 215 ? 5.624   33.975  69.790  1.00 54.74  ? 215  SER B CB  1 
ATOM   5841  O  OG  . SER B  1 215 ? 6.506   34.660  68.915  1.00 51.14  ? 215  SER B OG  1 
ATOM   5842  N  N   . LEU B  1 216 ? 7.772   35.093  72.194  1.00 69.99  ? 216  LEU B N   1 
ATOM   5843  C  CA  . LEU B  1 216 ? 8.134   36.128  73.157  1.00 78.64  ? 216  LEU B CA  1 
ATOM   5844  C  C   . LEU B  1 216 ? 7.414   37.470  72.911  1.00 75.68  ? 216  LEU B C   1 
ATOM   5845  O  O   . LEU B  1 216 ? 6.681   37.932  73.785  1.00 79.83  ? 216  LEU B O   1 
ATOM   5846  C  CB  . LEU B  1 216 ? 9.673   36.249  73.260  1.00 87.12  ? 216  LEU B CB  1 
ATOM   5847  C  CG  . LEU B  1 216 ? 10.413  37.356  74.023  1.00 94.91  ? 216  LEU B CG  1 
ATOM   5848  C  CD1 . LEU B  1 216 ? 10.632  38.607  73.148  1.00 98.31  ? 216  LEU B CD1 1 
ATOM   5849  C  CD2 . LEU B  1 216 ? 9.720   37.707  75.343  1.00 95.46  ? 216  LEU B CD2 1 
ATOM   5850  N  N   . PRO B  1 217 ? 7.583   38.079  71.718  1.00 66.74  ? 217  PRO B N   1 
ATOM   5851  C  CA  . PRO B  1 217 ? 6.974   39.396  71.505  1.00 61.07  ? 217  PRO B CA  1 
ATOM   5852  C  C   . PRO B  1 217 ? 5.454   39.414  71.603  1.00 63.92  ? 217  PRO B C   1 
ATOM   5853  O  O   . PRO B  1 217 ? 4.871   40.476  71.794  1.00 72.52  ? 217  PRO B O   1 
ATOM   5854  C  CB  . PRO B  1 217 ? 7.399   39.740  70.081  1.00 58.29  ? 217  PRO B CB  1 
ATOM   5855  C  CG  . PRO B  1 217 ? 8.653   38.975  69.876  1.00 60.71  ? 217  PRO B CG  1 
ATOM   5856  C  CD  . PRO B  1 217 ? 8.376   37.675  70.543  1.00 64.45  ? 217  PRO B CD  1 
ATOM   5857  N  N   . SER B  1 218 ? 4.812   38.265  71.472  1.00 62.14  ? 218  SER B N   1 
ATOM   5858  C  CA  . SER B  1 218 ? 3.362   38.235  71.580  1.00 61.49  ? 218  SER B CA  1 
ATOM   5859  C  C   . SER B  1 218 ? 2.947   38.248  73.049  1.00 62.24  ? 218  SER B C   1 
ATOM   5860  O  O   . SER B  1 218 ? 1.816   38.614  73.376  1.00 55.33  ? 218  SER B O   1 
ATOM   5861  C  CB  . SER B  1 218 ? 2.779   37.021  70.839  1.00 57.51  ? 218  SER B CB  1 
ATOM   5862  O  OG  . SER B  1 218 ? 3.046   37.079  69.440  1.00 52.10  ? 218  SER B OG  1 
ATOM   5863  N  N   . ARG B  1 219 ? 3.879   37.872  73.928  1.00 70.26  ? 219  ARG B N   1 
ATOM   5864  C  CA  . ARG B  1 219 ? 3.579   37.662  75.348  1.00 77.68  ? 219  ARG B CA  1 
ATOM   5865  C  C   . ARG B  1 219 ? 3.208   38.940  76.091  1.00 78.46  ? 219  ARG B C   1 
ATOM   5866  O  O   . ARG B  1 219 ? 2.476   38.909  77.083  1.00 81.25  ? 219  ARG B O   1 
ATOM   5867  C  CB  . ARG B  1 219 ? 4.744   36.969  76.063  1.00 83.38  ? 219  ARG B CB  1 
ATOM   5868  C  CG  . ARG B  1 219 ? 4.610   35.450  76.188  1.00 87.96  ? 219  ARG B CG  1 
ATOM   5869  C  CD  . ARG B  1 219 ? 3.393   35.028  77.031  1.00 92.69  ? 219  ARG B CD  1 
ATOM   5870  N  NE  . ARG B  1 219 ? 3.519   35.330  78.460  1.00 94.71  ? 219  ARG B NE  1 
ATOM   5871  C  CZ  . ARG B  1 219 ? 3.927   34.459  79.381  1.00 92.63  ? 219  ARG B CZ  1 
ATOM   5872  N  NH1 . ARG B  1 219 ? 4.263   33.222  79.031  1.00 88.89  ? 219  ARG B NH1 1 
ATOM   5873  N  NH2 . ARG B  1 219 ? 4.002   34.826  80.656  1.00 91.61  ? 219  ARG B NH2 1 
ATOM   5874  N  N   . SER B  1 220 ? 3.718   40.065  75.615  1.00 75.41  ? 220  SER B N   1 
ATOM   5875  C  CA  . SER B  1 220 ? 3.426   41.336  76.264  1.00 73.65  ? 220  SER B CA  1 
ATOM   5876  C  C   . SER B  1 220 ? 2.091   41.937  75.806  1.00 64.06  ? 220  SER B C   1 
ATOM   5877  O  O   . SER B  1 220 ? 1.781   43.077  76.133  1.00 58.51  ? 220  SER B O   1 
ATOM   5878  C  CB  . SER B  1 220 ? 4.562   42.329  76.006  1.00 73.80  ? 220  SER B CB  1 
ATOM   5879  O  OG  . SER B  1 220 ? 4.477   42.875  74.700  1.00 70.47  ? 220  SER B OG  1 
ATOM   5880  N  N   . LEU B  1 221 ? 1.303   41.174  75.056  1.00 64.14  ? 221  LEU B N   1 
ATOM   5881  C  CA  . LEU B  1 221 ? 0.116   41.730  74.408  1.00 68.48  ? 221  LEU B CA  1 
ATOM   5882  C  C   . LEU B  1 221 ? -1.174  41.131  74.947  1.00 67.68  ? 221  LEU B C   1 
ATOM   5883  O  O   . LEU B  1 221 ? -2.269  41.493  74.505  1.00 68.18  ? 221  LEU B O   1 
ATOM   5884  C  CB  . LEU B  1 221 ? 0.184   41.529  72.891  1.00 70.09  ? 221  LEU B CB  1 
ATOM   5885  C  CG  . LEU B  1 221 ? 1.396   42.117  72.168  1.00 69.37  ? 221  LEU B CG  1 
ATOM   5886  C  CD1 . LEU B  1 221 ? 1.384   41.719  70.704  1.00 62.96  ? 221  LEU B CD1 1 
ATOM   5887  C  CD2 . LEU B  1 221 ? 1.424   43.632  72.322  1.00 74.86  ? 221  LEU B CD2 1 
ATOM   5888  N  N   . PHE B  1 222 ? -1.035  40.214  75.899  1.00 66.47  ? 222  PHE B N   1 
ATOM   5889  C  CA  . PHE B  1 222 ? -2.180  39.556  76.516  1.00 72.24  ? 222  PHE B CA  1 
ATOM   5890  C  C   . PHE B  1 222 ? -1.788  39.022  77.895  1.00 77.17  ? 222  PHE B C   1 
ATOM   5891  O  O   . PHE B  1 222 ? -0.624  39.113  78.290  1.00 75.91  ? 222  PHE B O   1 
ATOM   5892  C  CB  . PHE B  1 222 ? -2.685  38.421  75.625  1.00 74.04  ? 222  PHE B CB  1 
ATOM   5893  C  CG  . PHE B  1 222 ? -1.766  37.240  75.575  1.00 70.96  ? 222  PHE B CG  1 
ATOM   5894  C  CD1 . PHE B  1 222 ? -0.641  37.257  74.767  1.00 68.91  ? 222  PHE B CD1 1 
ATOM   5895  C  CD2 . PHE B  1 222 ? -2.023  36.115  76.344  1.00 69.31  ? 222  PHE B CD2 1 
ATOM   5896  C  CE1 . PHE B  1 222 ? 0.212   36.175  74.726  1.00 69.38  ? 222  PHE B CE1 1 
ATOM   5897  C  CE2 . PHE B  1 222 ? -1.178  35.034  76.310  1.00 69.29  ? 222  PHE B CE2 1 
ATOM   5898  C  CZ  . PHE B  1 222 ? -0.055  35.059  75.498  1.00 69.76  ? 222  PHE B CZ  1 
ATOM   5899  N  N   . HIS B  1 223 ? -2.751  38.457  78.622  1.00 85.56  ? 223  HIS B N   1 
ATOM   5900  C  CA  . HIS B  1 223 ? -2.514  38.048  80.009  1.00 91.26  ? 223  HIS B CA  1 
ATOM   5901  C  C   . HIS B  1 223 ? -3.043  36.641  80.359  1.00 83.03  ? 223  HIS B C   1 
ATOM   5902  O  O   . HIS B  1 223 ? -2.452  35.950  81.192  1.00 79.71  ? 223  HIS B O   1 
ATOM   5903  C  CB  . HIS B  1 223 ? -3.083  39.098  80.986  1.00 104.87 ? 223  HIS B CB  1 
ATOM   5904  C  CG  . HIS B  1 223 ? -2.691  40.515  80.669  1.00 109.93 ? 223  HIS B CG  1 
ATOM   5905  N  ND1 . HIS B  1 223 ? -3.311  41.261  79.687  1.00 108.24 ? 223  HIS B ND1 1 
ATOM   5906  C  CD2 . HIS B  1 223 ? -1.754  41.327  81.218  1.00 110.65 ? 223  HIS B CD2 1 
ATOM   5907  C  CE1 . HIS B  1 223 ? -2.764  42.463  79.634  1.00 107.03 ? 223  HIS B CE1 1 
ATOM   5908  N  NE2 . HIS B  1 223 ? -1.821  42.531  80.558  1.00 108.88 ? 223  HIS B NE2 1 
ATOM   5909  N  N   . ARG B  1 224 ? -4.147  36.227  79.731  1.00 79.55  ? 224  ARG B N   1 
ATOM   5910  C  CA  . ARG B  1 224 ? -4.754  34.909  79.980  1.00 75.06  ? 224  ARG B CA  1 
ATOM   5911  C  C   . ARG B  1 224 ? -5.128  34.175  78.685  1.00 75.29  ? 224  ARG B C   1 
ATOM   5912  O  O   . ARG B  1 224 ? -5.199  34.791  77.612  1.00 77.68  ? 224  ARG B O   1 
ATOM   5913  C  CB  . ARG B  1 224 ? -5.975  35.033  80.900  1.00 71.17  ? 224  ARG B CB  1 
ATOM   5914  C  CG  . ARG B  1 224 ? -5.626  35.103  82.383  1.00 74.94  ? 224  ARG B CG  1 
ATOM   5915  C  CD  . ARG B  1 224 ? -6.748  35.721  83.218  1.00 81.82  ? 224  ARG B CD  1 
ATOM   5916  N  NE  . ARG B  1 224 ? -6.996  37.100  82.811  1.00 85.42  ? 224  ARG B NE  1 
ATOM   5917  C  CZ  . ARG B  1 224 ? -6.402  38.160  83.349  1.00 83.46  ? 224  ARG B CZ  1 
ATOM   5918  N  NH1 . ARG B  1 224 ? -5.532  38.003  84.340  1.00 76.69  ? 224  ARG B NH1 1 
ATOM   5919  N  NH2 . ARG B  1 224 ? -6.684  39.378  82.897  1.00 86.21  ? 224  ARG B NH2 1 
ATOM   5920  N  N   . ALA B  1 225 ? -5.377  32.866  78.781  1.00 75.59  ? 225  ALA B N   1 
ATOM   5921  C  CA  . ALA B  1 225 ? -5.586  32.060  77.566  1.00 73.23  ? 225  ALA B CA  1 
ATOM   5922  C  C   . ALA B  1 225 ? -6.620  30.927  77.671  1.00 68.16  ? 225  ALA B C   1 
ATOM   5923  O  O   . ALA B  1 225 ? -6.716  30.262  78.691  1.00 71.75  ? 225  ALA B O   1 
ATOM   5924  C  CB  . ALA B  1 225 ? -4.243  31.501  77.079  1.00 47.00  ? 225  ALA B CB  1 
ATOM   5925  N  N   . VAL B  1 226 ? -7.381  30.704  76.601  1.00 60.45  ? 226  VAL B N   1 
ATOM   5926  C  CA  . VAL B  1 226 ? -8.231  29.523  76.481  1.00 60.23  ? 226  VAL B CA  1 
ATOM   5927  C  C   . VAL B  1 226 ? -7.927  28.756  75.193  1.00 56.60  ? 226  VAL B C   1 
ATOM   5928  O  O   . VAL B  1 226 ? -8.084  29.276  74.069  1.00 58.60  ? 226  VAL B O   1 
ATOM   5929  C  CB  . VAL B  1 226 ? -9.728  29.852  76.516  1.00 51.61  ? 226  VAL B CB  1 
ATOM   5930  C  CG1 . VAL B  1 226 ? -10.534 28.583  76.483  1.00 51.82  ? 226  VAL B CG1 1 
ATOM   5931  C  CG2 . VAL B  1 226 ? -10.067 30.656  77.740  1.00 54.06  ? 226  VAL B CG2 1 
ATOM   5932  N  N   . LEU B  1 227 ? -7.488  27.514  75.370  1.00 51.28  ? 227  LEU B N   1 
ATOM   5933  C  CA  . LEU B  1 227 ? -7.208  26.641  74.252  1.00 44.06  ? 227  LEU B CA  1 
ATOM   5934  C  C   . LEU B  1 227 ? -8.255  25.546  74.204  1.00 45.74  ? 227  LEU B C   1 
ATOM   5935  O  O   . LEU B  1 227 ? -8.382  24.709  75.117  1.00 45.46  ? 227  LEU B O   1 
ATOM   5936  C  CB  . LEU B  1 227 ? -5.800  26.063  74.351  1.00 42.22  ? 227  LEU B CB  1 
ATOM   5937  C  CG  . LEU B  1 227 ? -4.618  27.033  74.210  1.00 58.72  ? 227  LEU B CG  1 
ATOM   5938  C  CD1 . LEU B  1 227 ? -4.343  27.769  75.505  1.00 58.27  ? 227  LEU B CD1 1 
ATOM   5939  C  CD2 . LEU B  1 227 ? -3.350  26.327  73.738  1.00 39.05  ? 227  LEU B CD2 1 
ATOM   5940  N  N   . GLN B  1 228 ? -9.021  25.568  73.130  1.00 44.56  ? 228  GLN B N   1 
ATOM   5941  C  CA  . GLN B  1 228 ? -10.164 24.697  73.019  1.00 58.54  ? 228  GLN B CA  1 
ATOM   5942  C  C   . GLN B  1 228 ? -9.951  23.639  71.963  1.00 59.20  ? 228  GLN B C   1 
ATOM   5943  O  O   . GLN B  1 228 ? -10.096 23.908  70.775  1.00 59.67  ? 228  GLN B O   1 
ATOM   5944  C  CB  . GLN B  1 228 ? -11.391 25.520  72.690  1.00 47.17  ? 228  GLN B CB  1 
ATOM   5945  C  CG  . GLN B  1 228 ? -11.609 26.642  73.673  1.00 52.71  ? 228  GLN B CG  1 
ATOM   5946  C  CD  . GLN B  1 228 ? -12.812 27.485  73.332  1.00 58.92  ? 228  GLN B CD  1 
ATOM   5947  O  OE1 . GLN B  1 228 ? -12.859 28.678  73.643  1.00 65.07  ? 228  GLN B OE1 1 
ATOM   5948  N  NE2 . GLN B  1 228 ? -13.802 26.870  72.688  1.00 56.92  ? 228  GLN B NE2 1 
ATOM   5949  N  N   . SER B  1 229 ? -9.626  22.432  72.425  1.00 58.17  ? 229  SER B N   1 
ATOM   5950  C  CA  . SER B  1 229 ? -9.330  21.272  71.578  1.00 51.22  ? 229  SER B CA  1 
ATOM   5951  C  C   . SER B  1 229 ? -8.339  21.578  70.461  1.00 39.56  ? 229  SER B C   1 
ATOM   5952  O  O   . SER B  1 229 ? -8.619  21.352  69.294  1.00 38.82  ? 229  SER B O   1 
ATOM   5953  C  CB  . SER B  1 229 ? -10.612 20.604  71.046  1.00 46.68  ? 229  SER B CB  1 
ATOM   5954  O  OG  . SER B  1 229 ? -11.388 21.470  70.239  1.00 44.78  ? 229  SER B OG  1 
ATOM   5955  N  N   . GLY B  1 230 ? -7.182  22.101  70.847  1.00 45.59  ? 230  GLY B N   1 
ATOM   5956  C  CA  . GLY B  1 230 ? -6.066  22.301  69.939  1.00 39.38  ? 230  GLY B CA  1 
ATOM   5957  C  C   . GLY B  1 230 ? -4.860  22.812  70.700  1.00 36.95  ? 230  GLY B C   1 
ATOM   5958  O  O   . GLY B  1 230 ? -4.998  23.515  71.686  1.00 44.43  ? 230  GLY B O   1 
ATOM   5959  N  N   . THR B  1 231 ? -3.666  22.465  70.254  1.00 37.11  ? 231  THR B N   1 
ATOM   5960  C  CA  . THR B  1 231 ? -2.470  22.867  70.977  1.00 33.87  ? 231  THR B CA  1 
ATOM   5961  C  C   . THR B  1 231 ? -1.427  23.366  70.008  1.00 32.20  ? 231  THR B C   1 
ATOM   5962  O  O   . THR B  1 231 ? -1.493  23.052  68.828  1.00 31.15  ? 231  THR B O   1 
ATOM   5963  C  CB  . THR B  1 231 ? -1.878  21.683  71.721  1.00 34.83  ? 231  THR B CB  1 
ATOM   5964  O  OG1 . THR B  1 231 ? -1.871  20.547  70.851  1.00 32.32  ? 231  THR B OG1 1 
ATOM   5965  C  CG2 . THR B  1 231 ? -2.695  21.380  72.946  1.00 35.36  ? 231  THR B CG2 1 
ATOM   5966  N  N   . PRO B  1 232 ? -0.450  24.141  70.503  1.00 36.15  ? 232  PRO B N   1 
ATOM   5967  C  CA  . PRO B  1 232 ? 0.655   24.558  69.647  1.00 31.38  ? 232  PRO B CA  1 
ATOM   5968  C  C   . PRO B  1 232 ? 1.557   23.375  69.438  1.00 53.87  ? 232  PRO B C   1 
ATOM   5969  O  O   . PRO B  1 232 ? 2.326   23.343  68.484  1.00 28.92  ? 232  PRO B O   1 
ATOM   5970  C  CB  . PRO B  1 232 ? 1.374   25.595  70.493  1.00 32.31  ? 232  PRO B CB  1 
ATOM   5971  C  CG  . PRO B  1 232 ? 1.113   25.173  71.874  1.00 41.89  ? 232  PRO B CG  1 
ATOM   5972  C  CD  . PRO B  1 232 ? -0.289  24.653  71.873  1.00 41.46  ? 232  PRO B CD  1 
ATOM   5973  N  N   . ASN B  1 233 ? 1.451   22.403  70.333  1.00 30.00  ? 233  ASN B N   1 
ATOM   5974  C  CA  . ASN B  1 233 ? 2.207   21.181  70.186  1.00 32.38  ? 233  ASN B CA  1 
ATOM   5975  C  C   . ASN B  1 233 ? 1.421   20.155  69.386  1.00 32.61  ? 233  ASN B C   1 
ATOM   5976  O  O   . ASN B  1 233 ? 0.556   20.513  68.602  1.00 28.25  ? 233  ASN B O   1 
ATOM   5977  C  CB  . ASN B  1 233 ? 2.636   20.639  71.544  1.00 31.43  ? 233  ASN B CB  1 
ATOM   5978  C  CG  . ASN B  1 233 ? 1.488   20.484  72.492  1.00 30.90  ? 233  ASN B CG  1 
ATOM   5979  O  OD1 . ASN B  1 233 ? 0.965   21.471  73.011  1.00 34.51  ? 233  ASN B OD1 1 
ATOM   5980  N  ND2 . ASN B  1 233 ? 1.093   19.238  72.745  1.00 31.28  ? 233  ASN B ND2 1 
ATOM   5981  N  N   . GLY B  1 234 ? 1.731   18.880  69.557  1.00 38.22  ? 234  GLY B N   1 
ATOM   5982  C  CA  . GLY B  1 234 ? 1.162   17.864  68.693  1.00 43.21  ? 234  GLY B CA  1 
ATOM   5983  C  C   . GLY B  1 234 ? 1.770   17.792  67.297  1.00 43.16  ? 234  GLY B C   1 
ATOM   5984  O  O   . GLY B  1 234 ? 2.699   18.541  66.959  1.00 42.16  ? 234  GLY B O   1 
ATOM   5985  N  N   . PRO B  1 235 ? 1.213   16.903  66.458  1.00 38.15  ? 235  PRO B N   1 
ATOM   5986  C  CA  . PRO B  1 235 ? 1.770   16.539  65.153  1.00 35.05  ? 235  PRO B CA  1 
ATOM   5987  C  C   . PRO B  1 235 ? 1.382   17.465  63.994  1.00 38.32  ? 235  PRO B C   1 
ATOM   5988  O  O   . PRO B  1 235 ? 2.226   17.678  63.122  1.00 43.74  ? 235  PRO B O   1 
ATOM   5989  C  CB  . PRO B  1 235 ? 1.182   15.156  64.925  1.00 32.84  ? 235  PRO B CB  1 
ATOM   5990  C  CG  . PRO B  1 235 ? -0.183  15.249  65.557  1.00 31.81  ? 235  PRO B CG  1 
ATOM   5991  C  CD  . PRO B  1 235 ? -0.029  16.162  66.747  1.00 30.67  ? 235  PRO B CD  1 
ATOM   5992  N  N   . TRP B  1 236 ? 0.159   18.004  63.986  1.00 36.43  ? 236  TRP B N   1 
ATOM   5993  C  CA  . TRP B  1 236 ? -0.377  18.737  62.825  1.00 28.63  ? 236  TRP B CA  1 
ATOM   5994  C  C   . TRP B  1 236 ? -0.094  20.239  62.772  1.00 30.65  ? 236  TRP B C   1 
ATOM   5995  O  O   . TRP B  1 236 ? -0.082  20.829  61.694  1.00 35.70  ? 236  TRP B O   1 
ATOM   5996  C  CB  . TRP B  1 236 ? -1.896  18.531  62.715  1.00 30.66  ? 236  TRP B CB  1 
ATOM   5997  C  CG  . TRP B  1 236 ? -2.645  18.911  63.958  1.00 31.32  ? 236  TRP B CG  1 
ATOM   5998  C  CD1 . TRP B  1 236 ? -2.969  18.092  65.000  1.00 33.79  ? 236  TRP B CD1 1 
ATOM   5999  C  CD2 . TRP B  1 236 ? -3.152  20.203  64.295  1.00 32.29  ? 236  TRP B CD2 1 
ATOM   6000  N  NE1 . TRP B  1 236 ? -3.643  18.792  65.965  1.00 29.89  ? 236  TRP B NE1 1 
ATOM   6001  C  CE2 . TRP B  1 236 ? -3.769  20.092  65.559  1.00 33.32  ? 236  TRP B CE2 1 
ATOM   6002  C  CE3 . TRP B  1 236 ? -3.148  21.443  63.653  1.00 35.53  ? 236  TRP B CE3 1 
ATOM   6003  C  CZ2 . TRP B  1 236 ? -4.380  21.170  66.191  1.00 36.56  ? 236  TRP B CZ2 1 
ATOM   6004  C  CZ3 . TRP B  1 236 ? -3.743  22.515  64.286  1.00 43.37  ? 236  TRP B CZ3 1 
ATOM   6005  C  CH2 . TRP B  1 236 ? -4.359  22.370  65.541  1.00 42.88  ? 236  TRP B CH2 1 
ATOM   6006  N  N   . ALA B  1 237 ? 0.124   20.856  63.927  1.00 26.00  ? 237  ALA B N   1 
ATOM   6007  C  CA  . ALA B  1 237 ? 0.084   22.309  64.039  1.00 26.86  ? 237  ALA B CA  1 
ATOM   6008  C  C   . ALA B  1 237 ? 1.292   23.076  63.503  1.00 32.98  ? 237  ALA B C   1 
ATOM   6009  O  O   . ALA B  1 237 ? 1.199   24.274  63.258  1.00 38.41  ? 237  ALA B O   1 
ATOM   6010  C  CB  . ALA B  1 237 ? -0.196  22.706  65.475  1.00 36.45  ? 237  ALA B CB  1 
ATOM   6011  N  N   . THR B  1 238 ? 2.430   22.410  63.351  1.00 29.51  ? 238  THR B N   1 
ATOM   6012  C  CA  . THR B  1 238 ? 3.626   23.077  62.849  1.00 31.87  ? 238  THR B CA  1 
ATOM   6013  C  C   . THR B  1 238 ? 4.352   22.172  61.863  1.00 36.65  ? 238  THR B C   1 
ATOM   6014  O  O   . THR B  1 238 ? 4.084   20.967  61.810  1.00 37.67  ? 238  THR B O   1 
ATOM   6015  C  CB  . THR B  1 238 ? 4.595   23.430  63.986  1.00 25.39  ? 238  THR B CB  1 
ATOM   6016  O  OG1 . THR B  1 238 ? 5.074   22.225  64.589  1.00 39.81  ? 238  THR B OG1 1 
ATOM   6017  C  CG2 . THR B  1 238 ? 3.909   24.257  65.045  1.00 26.72  ? 238  THR B CG2 1 
ATOM   6018  N  N   . VAL B  1 239 ? 5.257   22.749  61.075  1.00 23.38  ? 239  VAL B N   1 
ATOM   6019  C  CA  . VAL B  1 239 ? 6.161   21.952  60.242  1.00 29.19  ? 239  VAL B CA  1 
ATOM   6020  C  C   . VAL B  1 239 ? 7.571   22.473  60.387  1.00 28.98  ? 239  VAL B C   1 
ATOM   6021  O  O   . VAL B  1 239 ? 7.767   23.606  60.813  1.00 28.46  ? 239  VAL B O   1 
ATOM   6022  C  CB  . VAL B  1 239 ? 5.805   21.993  58.742  1.00 25.71  ? 239  VAL B CB  1 
ATOM   6023  C  CG1 . VAL B  1 239 ? 4.596   21.109  58.447  1.00 25.32  ? 239  VAL B CG1 1 
ATOM   6024  C  CG2 . VAL B  1 239 ? 5.596   23.428  58.284  1.00 22.48  ? 239  VAL B CG2 1 
ATOM   6025  N  N   . SER B  1 240 ? 8.547   21.643  60.024  1.00 30.76  ? 240  SER B N   1 
ATOM   6026  C  CA  . SER B  1 240 ? 9.952   22.040  60.040  1.00 37.72  ? 240  SER B CA  1 
ATOM   6027  C  C   . SER B  1 240 ? 10.246  23.080  58.955  1.00 42.58  ? 240  SER B C   1 
ATOM   6028  O  O   . SER B  1 240 ? 9.417   23.325  58.079  1.00 43.75  ? 240  SER B O   1 
ATOM   6029  C  CB  . SER B  1 240 ? 10.854  20.812  59.867  1.00 42.35  ? 240  SER B CB  1 
ATOM   6030  O  OG  . SER B  1 240 ? 10.355  19.912  58.888  1.00 45.09  ? 240  SER B OG  1 
ATOM   6031  N  N   . ALA B  1 241 ? 11.425  23.694  59.014  1.00 43.46  ? 241  ALA B N   1 
ATOM   6032  C  CA  . ALA B  1 241 ? 11.835  24.631  57.978  1.00 39.80  ? 241  ALA B CA  1 
ATOM   6033  C  C   . ALA B  1 241 ? 12.010  23.886  56.672  1.00 39.62  ? 241  ALA B C   1 
ATOM   6034  O  O   . ALA B  1 241 ? 11.469  24.287  55.638  1.00 39.81  ? 241  ALA B O   1 
ATOM   6035  C  CB  . ALA B  1 241 ? 13.102  25.299  58.357  1.00 22.11  ? 241  ALA B CB  1 
ATOM   6036  N  N   . GLY B  1 242 ? 12.764  22.795  56.728  1.00 42.77  ? 242  GLY B N   1 
ATOM   6037  C  CA  . GLY B  1 242 ? 13.004  21.977  55.554  1.00 46.84  ? 242  GLY B CA  1 
ATOM   6038  C  C   . GLY B  1 242 ? 11.723  21.541  54.869  1.00 45.79  ? 242  GLY B C   1 
ATOM   6039  O  O   . GLY B  1 242 ? 11.613  21.577  53.643  1.00 50.71  ? 242  GLY B O   1 
ATOM   6040  N  N   . GLU B  1 243 ? 10.741  21.142  55.666  1.00 39.48  ? 243  GLU B N   1 
ATOM   6041  C  CA  . GLU B  1 243 ? 9.487   20.651  55.117  1.00 37.34  ? 243  GLU B CA  1 
ATOM   6042  C  C   . GLU B  1 243 ? 8.613   21.783  54.539  1.00 36.13  ? 243  GLU B C   1 
ATOM   6043  O  O   . GLU B  1 243 ? 7.979   21.627  53.482  1.00 27.73  ? 243  GLU B O   1 
ATOM   6044  C  CB  . GLU B  1 243 ? 8.749   19.832  56.175  1.00 36.89  ? 243  GLU B CB  1 
ATOM   6045  C  CG  . GLU B  1 243 ? 7.449   19.216  55.721  1.00 36.29  ? 243  GLU B CG  1 
ATOM   6046  C  CD  . GLU B  1 243 ? 7.611   18.194  54.607  1.00 40.13  ? 243  GLU B CD  1 
ATOM   6047  O  OE1 . GLU B  1 243 ? 8.759   17.744  54.330  1.00 38.17  ? 243  GLU B OE1 1 
ATOM   6048  O  OE2 . GLU B  1 243 ? 6.562   17.844  54.009  1.00 39.54  ? 243  GLU B OE2 1 
ATOM   6049  N  N   . ALA B  1 244 ? 8.595   22.928  55.217  1.00 40.30  ? 244  ALA B N   1 
ATOM   6050  C  CA  . ALA B  1 244 ? 7.854   24.080  54.714  1.00 38.59  ? 244  ALA B CA  1 
ATOM   6051  C  C   . ALA B  1 244 ? 8.447   24.475  53.378  1.00 43.96  ? 244  ALA B C   1 
ATOM   6052  O  O   . ALA B  1 244 ? 7.724   24.756  52.418  1.00 50.10  ? 244  ALA B O   1 
ATOM   6053  C  CB  . ALA B  1 244 ? 7.927   25.243  55.687  1.00 31.97  ? 244  ALA B CB  1 
ATOM   6054  N  N   . ARG B  1 245 ? 9.772   24.474  53.318  1.00 34.42  ? 245  ARG B N   1 
ATOM   6055  C  CA  . ARG B  1 245 ? 10.452  24.895  52.114  1.00 29.52  ? 245  ARG B CA  1 
ATOM   6056  C  C   . ARG B  1 245 ? 10.177  23.878  51.017  1.00 27.33  ? 245  ARG B C   1 
ATOM   6057  O  O   . ARG B  1 245 ? 10.007  24.239  49.860  1.00 31.93  ? 245  ARG B O   1 
ATOM   6058  C  CB  . ARG B  1 245 ? 11.945  25.123  52.382  1.00 21.46  ? 245  ARG B CB  1 
ATOM   6059  C  CG  . ARG B  1 245 ? 12.888  24.241  51.609  1.00 27.31  ? 245  ARG B CG  1 
ATOM   6060  C  CD  . ARG B  1 245 ? 13.396  24.845  50.303  1.00 30.12  ? 245  ARG B CD  1 
ATOM   6061  N  NE  . ARG B  1 245 ? 13.981  26.178  50.438  1.00 34.17  ? 245  ARG B NE  1 
ATOM   6062  C  CZ  . ARG B  1 245 ? 14.524  26.856  49.426  1.00 42.91  ? 245  ARG B CZ  1 
ATOM   6063  N  NH1 . ARG B  1 245 ? 14.577  26.319  48.208  1.00 36.85  ? 245  ARG B NH1 1 
ATOM   6064  N  NH2 . ARG B  1 245 ? 15.010  28.075  49.629  1.00 48.08  ? 245  ARG B NH2 1 
ATOM   6065  N  N   . ARG B  1 246 ? 10.070  22.616  51.402  1.00 27.39  ? 246  ARG B N   1 
ATOM   6066  C  CA  . ARG B  1 246 ? 9.768   21.549  50.453  1.00 35.67  ? 246  ARG B CA  1 
ATOM   6067  C  C   . ARG B  1 246 ? 8.386   21.777  49.816  1.00 32.23  ? 246  ARG B C   1 
ATOM   6068  O  O   . ARG B  1 246 ? 8.210   21.679  48.587  1.00 34.13  ? 246  ARG B O   1 
ATOM   6069  C  CB  . ARG B  1 246 ? 9.837   20.187  51.169  1.00 43.70  ? 246  ARG B CB  1 
ATOM   6070  C  CG  . ARG B  1 246 ? 10.245  18.985  50.310  1.00 49.47  ? 246  ARG B CG  1 
ATOM   6071  C  CD  . ARG B  1 246 ? 9.036   18.182  49.801  1.00 50.04  ? 246  ARG B CD  1 
ATOM   6072  N  NE  . ARG B  1 246 ? 8.208   17.660  50.894  1.00 44.63  ? 246  ARG B NE  1 
ATOM   6073  C  CZ  . ARG B  1 246 ? 6.934   17.277  50.768  1.00 41.40  ? 246  ARG B CZ  1 
ATOM   6074  N  NH1 . ARG B  1 246 ? 6.308   17.346  49.591  1.00 32.43  ? 246  ARG B NH1 1 
ATOM   6075  N  NH2 . ARG B  1 246 ? 6.282   16.822  51.829  1.00 43.67  ? 246  ARG B NH2 1 
ATOM   6076  N  N   . ARG B  1 247 ? 7.411   22.113  50.649  1.00 31.78  ? 247  ARG B N   1 
ATOM   6077  C  CA  . ARG B  1 247 ? 6.047   22.281  50.151  1.00 34.26  ? 247  ARG B CA  1 
ATOM   6078  C  C   . ARG B  1 247 ? 5.888   23.564  49.373  1.00 35.10  ? 247  ARG B C   1 
ATOM   6079  O  O   . ARG B  1 247 ? 5.030   23.668  48.486  1.00 33.92  ? 247  ARG B O   1 
ATOM   6080  C  CB  . ARG B  1 247 ? 5.043   22.262  51.298  1.00 29.61  ? 247  ARG B CB  1 
ATOM   6081  C  CG  . ARG B  1 247 ? 4.971   20.946  51.995  1.00 19.73  ? 247  ARG B CG  1 
ATOM   6082  C  CD  . ARG B  1 247 ? 4.400   21.115  53.356  1.00 21.17  ? 247  ARG B CD  1 
ATOM   6083  N  NE  . ARG B  1 247 ? 4.657   19.931  54.155  1.00 21.98  ? 247  ARG B NE  1 
ATOM   6084  C  CZ  . ARG B  1 247 ? 3.919   19.555  55.190  1.00 27.79  ? 247  ARG B CZ  1 
ATOM   6085  N  NH1 . ARG B  1 247 ? 2.853   20.264  55.556  1.00 22.34  ? 247  ARG B NH1 1 
ATOM   6086  N  NH2 . ARG B  1 247 ? 4.254   18.459  55.850  1.00 36.96  ? 247  ARG B NH2 1 
ATOM   6087  N  N   . ALA B  1 248 ? 6.707   24.550  49.722  1.00 32.85  ? 248  ALA B N   1 
ATOM   6088  C  CA  . ALA B  1 248 ? 6.615   25.837  49.070  1.00 30.21  ? 248  ALA B CA  1 
ATOM   6089  C  C   . ALA B  1 248 ? 7.152   25.634  47.675  1.00 27.60  ? 248  ALA B C   1 
ATOM   6090  O  O   . ALA B  1 248 ? 6.488   25.946  46.694  1.00 32.80  ? 248  ALA B O   1 
ATOM   6091  C  CB  . ALA B  1 248 ? 7.408   26.866  49.813  1.00 21.33  ? 248  ALA B CB  1 
ATOM   6092  N  N   . THR B  1 249 ? 8.338   25.052  47.598  1.00 27.32  ? 249  THR B N   1 
ATOM   6093  C  CA  . THR B  1 249 ? 8.986   24.778  46.332  1.00 19.52  ? 249  THR B CA  1 
ATOM   6094  C  C   . THR B  1 249 ? 8.115   23.919  45.417  1.00 35.40  ? 249  THR B C   1 
ATOM   6095  O  O   . THR B  1 249 ? 7.995   24.186  44.214  1.00 39.34  ? 249  THR B O   1 
ATOM   6096  C  CB  . THR B  1 249 ? 10.328  24.082  46.601  1.00 41.34  ? 249  THR B CB  1 
ATOM   6097  O  OG1 . THR B  1 249 ? 11.335  25.076  46.808  1.00 35.49  ? 249  THR B OG1 1 
ATOM   6098  C  CG2 . THR B  1 249 ? 10.741  23.192  45.454  1.00 44.31  ? 249  THR B CG2 1 
ATOM   6099  N  N   . LEU B  1 250 ? 7.489   22.895  45.986  1.00 35.16  ? 250  LEU B N   1 
ATOM   6100  C  CA  . LEU B  1 250 ? 6.659   22.000  45.180  1.00 18.84  ? 250  LEU B CA  1 
ATOM   6101  C  C   . LEU B  1 250 ? 5.365   22.666  44.709  1.00 31.89  ? 250  LEU B C   1 
ATOM   6102  O  O   . LEU B  1 250 ? 4.948   22.492  43.559  1.00 27.08  ? 250  LEU B O   1 
ATOM   6103  C  CB  . LEU B  1 250 ? 6.354   20.708  45.947  1.00 19.35  ? 250  LEU B CB  1 
ATOM   6104  C  CG  . LEU B  1 250 ? 5.341   19.735  45.357  1.00 18.47  ? 250  LEU B CG  1 
ATOM   6105  C  CD1 . LEU B  1 250 ? 5.750   19.303  43.976  1.00 18.27  ? 250  LEU B CD1 1 
ATOM   6106  C  CD2 . LEU B  1 250 ? 5.220   18.554  46.267  1.00 35.14  ? 250  LEU B CD2 1 
ATOM   6107  N  N   . LEU B  1 251 ? 4.713   23.417  45.590  1.00 33.25  ? 251  LEU B N   1 
ATOM   6108  C  CA  . LEU B  1 251 ? 3.498   24.097  45.168  1.00 29.97  ? 251  LEU B CA  1 
ATOM   6109  C  C   . LEU B  1 251 ? 3.847   25.059  44.058  1.00 31.11  ? 251  LEU B C   1 
ATOM   6110  O  O   . LEU B  1 251 ? 3.103   25.201  43.088  1.00 25.82  ? 251  LEU B O   1 
ATOM   6111  C  CB  . LEU B  1 251 ? 2.859   24.877  46.306  1.00 25.35  ? 251  LEU B CB  1 
ATOM   6112  C  CG  . LEU B  1 251 ? 1.678   25.664  45.754  1.00 24.46  ? 251  LEU B CG  1 
ATOM   6113  C  CD1 . LEU B  1 251 ? 0.384   24.961  46.066  1.00 22.13  ? 251  LEU B CD1 1 
ATOM   6114  C  CD2 . LEU B  1 251 ? 1.687   27.068  46.283  1.00 34.39  ? 251  LEU B CD2 1 
ATOM   6115  N  N   . ALA B  1 252 ? 4.993   25.719  44.210  1.00 36.84  ? 252  ALA B N   1 
ATOM   6116  C  CA  . ALA B  1 252 ? 5.413   26.715  43.252  1.00 20.89  ? 252  ALA B CA  1 
ATOM   6117  C  C   . ALA B  1 252 ? 5.586   26.021  41.936  1.00 20.49  ? 252  ALA B C   1 
ATOM   6118  O  O   . ALA B  1 252 ? 5.087   26.460  40.923  1.00 24.32  ? 252  ALA B O   1 
ATOM   6119  C  CB  . ALA B  1 252 ? 6.686   27.353  43.680  1.00 45.35  ? 252  ALA B CB  1 
ATOM   6120  N  N   . ARG B  1 253 ? 6.285   24.910  41.943  1.00 27.91  ? 253  ARG B N   1 
ATOM   6121  C  CA  . ARG B  1 253 ? 6.494   24.226  40.684  1.00 31.27  ? 253  ARG B CA  1 
ATOM   6122  C  C   . ARG B  1 253 ? 5.175   23.643  40.084  1.00 19.75  ? 253  ARG B C   1 
ATOM   6123  O  O   . ARG B  1 253 ? 5.054   23.465  38.877  1.00 23.68  ? 253  ARG B O   1 
ATOM   6124  C  CB  . ARG B  1 253 ? 7.625   23.209  40.846  1.00 19.07  ? 253  ARG B CB  1 
ATOM   6125  C  CG  . ARG B  1 253 ? 7.753   22.199  39.751  1.00 18.85  ? 253  ARG B CG  1 
ATOM   6126  C  CD  . ARG B  1 253 ? 8.391   20.946  40.320  1.00 40.12  ? 253  ARG B CD  1 
ATOM   6127  N  NE  . ARG B  1 253 ? 9.607   21.310  41.032  1.00 43.91  ? 253  ARG B NE  1 
ATOM   6128  C  CZ  . ARG B  1 253 ? 9.862   21.016  42.299  1.00 46.44  ? 253  ARG B CZ  1 
ATOM   6129  N  NH1 . ARG B  1 253 ? 8.999   20.309  43.021  1.00 42.01  ? 253  ARG B NH1 1 
ATOM   6130  N  NH2 . ARG B  1 253 ? 11.003  21.424  42.831  1.00 49.18  ? 253  ARG B NH2 1 
ATOM   6131  N  N   . LEU B  1 254 ? 4.172   23.385  40.914  1.00 25.64  ? 254  LEU B N   1 
ATOM   6132  C  CA  . LEU B  1 254 ? 2.886   22.897  40.390  1.00 29.95  ? 254  LEU B CA  1 
ATOM   6133  C  C   . LEU B  1 254 ? 2.111   23.969  39.594  1.00 35.83  ? 254  LEU B C   1 
ATOM   6134  O  O   . LEU B  1 254 ? 1.424   23.667  38.605  1.00 32.77  ? 254  LEU B O   1 
ATOM   6135  C  CB  . LEU B  1 254 ? 2.030   22.325  41.512  1.00 26.38  ? 254  LEU B CB  1 
ATOM   6136  C  CG  . LEU B  1 254 ? 2.407   20.902  41.870  1.00 23.63  ? 254  LEU B CG  1 
ATOM   6137  C  CD1 . LEU B  1 254 ? 1.644   20.492  43.102  1.00 25.96  ? 254  LEU B CD1 1 
ATOM   6138  C  CD2 . LEU B  1 254 ? 2.082   19.995  40.686  1.00 19.97  ? 254  LEU B CD2 1 
ATOM   6139  N  N   . VAL B  1 255 ? 2.222   25.218  40.042  1.00 31.09  ? 255  VAL B N   1 
ATOM   6140  C  CA  . VAL B  1 255 ? 1.882   26.355  39.209  1.00 26.74  ? 255  VAL B CA  1 
ATOM   6141  C  C   . VAL B  1 255 ? 3.139   26.656  38.379  1.00 35.06  ? 255  VAL B C   1 
ATOM   6142  O  O   . VAL B  1 255 ? 4.050   25.827  38.318  1.00 40.96  ? 255  VAL B O   1 
ATOM   6143  C  CB  . VAL B  1 255 ? 1.362   27.521  40.052  1.00 27.90  ? 255  VAL B CB  1 
ATOM   6144  C  CG1 . VAL B  1 255 ? 0.229   27.013  40.937  1.00 28.10  ? 255  VAL B CG1 1 
ATOM   6145  C  CG2 . VAL B  1 255 ? 2.460   28.133  40.913  1.00 22.41  ? 255  VAL B CG2 1 
ATOM   6146  N  N   . GLY B  1 256 ? 3.228   27.795  37.718  1.00 29.34  ? 256  GLY B N   1 
ATOM   6147  C  CA  . GLY B  1 256 ? 4.320   27.912  36.764  1.00 39.01  ? 256  GLY B CA  1 
ATOM   6148  C  C   . GLY B  1 256 ? 5.762   28.090  37.248  1.00 42.64  ? 256  GLY B C   1 
ATOM   6149  O  O   . GLY B  1 256 ? 6.631   28.369  36.421  1.00 39.65  ? 256  GLY B O   1 
ATOM   6150  N  N   . CYS B  1 257 ? 6.032   27.898  38.545  1.00 44.34  ? 257  CYS B N   1 
ATOM   6151  C  CA  . CYS B  1 257 ? 7.166   28.578  39.211  1.00 42.30  ? 257  CYS B CA  1 
ATOM   6152  C  C   . CYS B  1 257 ? 8.373   27.761  39.701  1.00 46.63  ? 257  CYS B C   1 
ATOM   6153  O  O   . CYS B  1 257 ? 8.290   27.031  40.699  1.00 50.02  ? 257  CYS B O   1 
ATOM   6154  C  CB  . CYS B  1 257 ? 6.641   29.429  40.374  1.00 38.89  ? 257  CYS B CB  1 
ATOM   6155  S  SG  . CYS B  1 257 ? 5.519   30.766  39.884  1.00 48.34  ? 257  CYS B SG  1 
ATOM   6156  N  N   . PRO B  1 258 ? 9.520   27.918  39.022  1.00 51.68  ? 258  PRO B N   1 
ATOM   6157  C  CA  . PRO B  1 258 ? 9.655   28.746  37.825  1.00 51.63  ? 258  PRO B CA  1 
ATOM   6158  C  C   . PRO B  1 258 ? 9.348   27.848  36.642  1.00 52.06  ? 258  PRO B C   1 
ATOM   6159  O  O   . PRO B  1 258 ? 9.086   26.660  36.854  1.00 51.89  ? 258  PRO B O   1 
ATOM   6160  C  CB  . PRO B  1 258 ? 11.135  29.099  37.837  1.00 53.90  ? 258  PRO B CB  1 
ATOM   6161  C  CG  . PRO B  1 258 ? 11.780  27.842  38.382  1.00 54.41  ? 258  PRO B CG  1 
ATOM   6162  C  CD  . PRO B  1 258 ? 10.801  27.278  39.391  1.00 55.06  ? 258  PRO B CD  1 
ATOM   6163  N  N   . PRO B  1 259 ? 9.336   28.389  35.412  1.00 50.55  ? 259  PRO B N   1 
ATOM   6164  C  CA  . PRO B  1 259 ? 9.130   27.399  34.354  1.00 49.77  ? 259  PRO B CA  1 
ATOM   6165  C  C   . PRO B  1 259 ? 10.475  26.909  33.785  1.00 49.00  ? 259  PRO B C   1 
ATOM   6166  O  O   . PRO B  1 259 ? 11.358  27.711  33.465  1.00 55.11  ? 259  PRO B O   1 
ATOM   6167  C  CB  . PRO B  1 259 ? 8.297   28.167  33.308  1.00 38.93  ? 259  PRO B CB  1 
ATOM   6168  C  CG  . PRO B  1 259 ? 8.245   29.620  33.801  1.00 33.12  ? 259  PRO B CG  1 
ATOM   6169  C  CD  . PRO B  1 259 ? 9.272   29.760  34.882  1.00 36.66  ? 259  PRO B CD  1 
ATOM   6170  N  N   . GLY B  1 260 ? 10.648  25.598  33.716  1.00 39.09  ? 260  GLY B N   1 
ATOM   6171  C  CA  . GLY B  1 260 ? 11.822  25.032  33.080  1.00 44.57  ? 260  GLY B CA  1 
ATOM   6172  C  C   . GLY B  1 260 ? 13.096  24.980  33.896  1.00 51.70  ? 260  GLY B C   1 
ATOM   6173  O  O   . GLY B  1 260 ? 14.170  24.703  33.363  1.00 50.92  ? 260  GLY B O   1 
ATOM   6174  N  N   . GLY B  1 261 ? 12.984  25.244  35.191  1.00 65.78  ? 261  GLY B N   1 
ATOM   6175  C  CA  . GLY B  1 261 ? 14.150  25.277  36.059  1.00 74.33  ? 261  GLY B CA  1 
ATOM   6176  C  C   . GLY B  1 261 ? 15.004  26.543  35.990  1.00 72.37  ? 261  GLY B C   1 
ATOM   6177  O  O   . GLY B  1 261 ? 15.427  27.007  34.922  1.00 61.45  ? 261  GLY B O   1 
ATOM   6178  N  N   . ALA B  1 262 ? 15.253  27.102  37.166  1.00 73.93  ? 262  ALA B N   1 
ATOM   6179  C  CA  . ALA B  1 262 ? 16.097  28.271  37.316  1.00 77.41  ? 262  ALA B CA  1 
ATOM   6180  C  C   . ALA B  1 262 ? 16.581  28.300  38.763  1.00 71.69  ? 262  ALA B C   1 
ATOM   6181  O  O   . ALA B  1 262 ? 17.753  28.546  39.041  1.00 65.04  ? 262  ALA B O   1 
ATOM   6182  C  CB  . ALA B  1 262 ? 15.320  29.534  36.973  1.00 82.26  ? 262  ALA B CB  1 
ATOM   6183  N  N   . GLY B  1 263 ? 15.658  28.029  39.678  1.00 75.58  ? 263  GLY B N   1 
ATOM   6184  C  CA  . GLY B  1 263 ? 15.966  27.904  41.089  1.00 79.53  ? 263  GLY B CA  1 
ATOM   6185  C  C   . GLY B  1 263 ? 16.657  29.104  41.699  1.00 81.91  ? 263  GLY B C   1 
ATOM   6186  O  O   . GLY B  1 263 ? 16.020  30.135  41.945  1.00 76.86  ? 263  GLY B O   1 
ATOM   6187  N  N   . GLY B  1 264 ? 17.960  28.938  41.938  1.00 86.77  ? 264  GLY B N   1 
ATOM   6188  C  CA  . GLY B  1 264 ? 18.829  29.937  42.543  1.00 92.12  ? 264  GLY B CA  1 
ATOM   6189  C  C   . GLY B  1 264 ? 18.136  30.950  43.428  1.00 97.22  ? 264  GLY B C   1 
ATOM   6190  O  O   . GLY B  1 264 ? 18.211  30.899  44.661  1.00 104.71 ? 264  GLY B O   1 
ATOM   6191  N  N   . ASN B  1 265 ? 17.432  31.865  42.776  1.00 89.92  ? 265  ASN B N   1 
ATOM   6192  C  CA  . ASN B  1 265 ? 16.763  32.950  43.460  1.00 78.87  ? 265  ASN B CA  1 
ATOM   6193  C  C   . ASN B  1 265 ? 15.462  32.504  44.097  1.00 66.11  ? 265  ASN B C   1 
ATOM   6194  O  O   . ASN B  1 265 ? 14.581  31.975  43.422  1.00 63.88  ? 265  ASN B O   1 
ATOM   6195  C  CB  . ASN B  1 265 ? 16.514  34.097  42.491  1.00 80.84  ? 265  ASN B CB  1 
ATOM   6196  C  CG  . ASN B  1 265 ? 17.213  35.356  42.907  1.00 92.94  ? 265  ASN B CG  1 
ATOM   6197  O  OD1 . ASN B  1 265 ? 16.919  35.894  43.969  1.00 102.74 ? 265  ASN B OD1 1 
ATOM   6198  N  ND2 . ASN B  1 265 ? 18.151  35.839  42.079  1.00 97.85  ? 265  ASN B ND2 1 
ATOM   6199  N  N   . ASP B  1 266 ? 15.367  32.696  45.408  1.00 55.39  ? 266  ASP B N   1 
ATOM   6200  C  CA  . ASP B  1 266 ? 14.122  32.494  46.123  1.00 47.78  ? 266  ASP B CA  1 
ATOM   6201  C  C   . ASP B  1 266 ? 13.248  33.708  45.873  1.00 46.04  ? 266  ASP B C   1 
ATOM   6202  O  O   . ASP B  1 266 ? 12.033  33.600  45.726  1.00 38.28  ? 266  ASP B O   1 
ATOM   6203  C  CB  . ASP B  1 266 ? 14.380  32.355  47.621  1.00 47.96  ? 266  ASP B CB  1 
ATOM   6204  C  CG  . ASP B  1 266 ? 14.662  30.929  48.041  1.00 47.23  ? 266  ASP B CG  1 
ATOM   6205  O  OD1 . ASP B  1 266 ? 14.943  30.074  47.161  1.00 45.33  ? 266  ASP B OD1 1 
ATOM   6206  O  OD2 . ASP B  1 266 ? 14.607  30.676  49.267  1.00 44.79  ? 266  ASP B OD2 1 
ATOM   6207  N  N   . THR B  1 267 ? 13.879  34.875  45.830  1.00 51.86  ? 267  THR B N   1 
ATOM   6208  C  CA  . THR B  1 267 ? 13.135  36.105  45.590  1.00 54.76  ? 267  THR B CA  1 
ATOM   6209  C  C   . THR B  1 267 ? 12.440  36.013  44.231  1.00 46.34  ? 267  THR B C   1 
ATOM   6210  O  O   . THR B  1 267 ? 11.317  36.488  44.067  1.00 43.86  ? 267  THR B O   1 
ATOM   6211  C  CB  . THR B  1 267 ? 14.036  37.372  45.681  1.00 52.97  ? 267  THR B CB  1 
ATOM   6212  O  OG1 . THR B  1 267 ? 15.155  37.224  44.810  1.00 58.79  ? 267  THR B OG1 1 
ATOM   6213  C  CG2 . THR B  1 267 ? 14.576  37.565  47.082  1.00 49.36  ? 267  THR B CG2 1 
ATOM   6214  N  N   . GLU B  1 268 ? 13.098  35.367  43.271  1.00 45.86  ? 268  GLU B N   1 
ATOM   6215  C  CA  . GLU B  1 268 ? 12.505  35.184  41.955  1.00 51.80  ? 268  GLU B CA  1 
ATOM   6216  C  C   . GLU B  1 268 ? 11.341  34.213  42.036  1.00 52.04  ? 268  GLU B C   1 
ATOM   6217  O  O   . GLU B  1 268 ? 10.294  34.440  41.426  1.00 53.89  ? 268  GLU B O   1 
ATOM   6218  C  CB  . GLU B  1 268 ? 13.529  34.678  40.944  1.00 64.66  ? 268  GLU B CB  1 
ATOM   6219  C  CG  . GLU B  1 268 ? 13.383  35.286  39.556  1.00 84.65  ? 268  GLU B CG  1 
ATOM   6220  C  CD  . GLU B  1 268 ? 13.795  36.759  39.510  1.00 105.36 ? 268  GLU B CD  1 
ATOM   6221  O  OE1 . GLU B  1 268 ? 15.015  37.035  39.442  1.00 114.19 ? 268  GLU B OE1 1 
ATOM   6222  O  OE2 . GLU B  1 268 ? 12.905  37.642  39.534  1.00 109.62 ? 268  GLU B OE2 1 
ATOM   6223  N  N   . LEU B  1 269 ? 11.522  33.134  42.795  1.00 49.90  ? 269  LEU B N   1 
ATOM   6224  C  CA  . LEU B  1 269 ? 10.477  32.116  42.927  1.00 44.03  ? 269  LEU B CA  1 
ATOM   6225  C  C   . LEU B  1 269 ? 9.207   32.755  43.476  1.00 37.86  ? 269  LEU B C   1 
ATOM   6226  O  O   . LEU B  1 269 ? 8.110   32.588  42.936  1.00 34.74  ? 269  LEU B O   1 
ATOM   6227  C  CB  . LEU B  1 269 ? 10.951  30.963  43.821  1.00 38.47  ? 269  LEU B CB  1 
ATOM   6228  C  CG  . LEU B  1 269 ? 10.126  29.670  43.827  1.00 38.88  ? 269  LEU B CG  1 
ATOM   6229  C  CD1 . LEU B  1 269 ? 11.018  28.471  44.077  1.00 42.82  ? 269  LEU B CD1 1 
ATOM   6230  C  CD2 . LEU B  1 269 ? 9.046   29.725  44.879  1.00 38.86  ? 269  LEU B CD2 1 
ATOM   6231  N  N   . ILE B  1 270 ? 9.378   33.520  44.541  1.00 37.76  ? 270  ILE B N   1 
ATOM   6232  C  CA  . ILE B  1 270 ? 8.261   34.180  45.182  1.00 37.17  ? 270  ILE B CA  1 
ATOM   6233  C  C   . ILE B  1 270 ? 7.638   35.247  44.281  1.00 39.93  ? 270  ILE B C   1 
ATOM   6234  O  O   . ILE B  1 270 ? 6.412   35.345  44.178  1.00 37.19  ? 270  ILE B O   1 
ATOM   6235  C  CB  . ILE B  1 270 ? 8.681   34.736  46.540  1.00 29.97  ? 270  ILE B CB  1 
ATOM   6236  C  CG1 . ILE B  1 270 ? 9.004   33.561  47.455  1.00 30.23  ? 270  ILE B CG1 1 
ATOM   6237  C  CG2 . ILE B  1 270 ? 7.573   35.586  47.145  1.00 33.76  ? 270  ILE B CG2 1 
ATOM   6238  C  CD1 . ILE B  1 270 ? 9.826   33.941  48.635  1.00 42.81  ? 270  ILE B CD1 1 
ATOM   6239  N  N   . ALA B  1 271 ? 8.472   36.022  43.600  1.00 38.98  ? 271  ALA B N   1 
ATOM   6240  C  CA  . ALA B  1 271 ? 7.935   37.032  42.697  1.00 40.77  ? 271  ALA B CA  1 
ATOM   6241  C  C   . ALA B  1 271 ? 7.110   36.386  41.574  1.00 37.63  ? 271  ALA B C   1 
ATOM   6242  O  O   . ALA B  1 271 ? 6.153   36.970  41.078  1.00 37.32  ? 271  ALA B O   1 
ATOM   6243  C  CB  . ALA B  1 271 ? 9.042   37.889  42.143  1.00 41.47  ? 271  ALA B CB  1 
ATOM   6244  N  N   . CYS B  1 272 ? 7.480   35.171  41.188  1.00 37.45  ? 272  CYS B N   1 
ATOM   6245  C  CA  . CYS B  1 272 ? 6.688   34.413  40.233  1.00 31.32  ? 272  CYS B CA  1 
ATOM   6246  C  C   . CYS B  1 272 ? 5.383   34.023  40.883  1.00 33.96  ? 272  CYS B C   1 
ATOM   6247  O  O   . CYS B  1 272 ? 4.325   34.126  40.267  1.00 37.49  ? 272  CYS B O   1 
ATOM   6248  C  CB  . CYS B  1 272 ? 7.433   33.155  39.787  1.00 23.73  ? 272  CYS B CB  1 
ATOM   6249  S  SG  . CYS B  1 272 ? 6.515   32.061  38.659  1.00 47.94  ? 272  CYS B SG  1 
ATOM   6250  N  N   . LEU B  1 273 ? 5.464   33.564  42.131  1.00 36.14  ? 273  LEU B N   1 
ATOM   6251  C  CA  . LEU B  1 273 ? 4.266   33.123  42.849  1.00 38.57  ? 273  LEU B CA  1 
ATOM   6252  C  C   . LEU B  1 273 ? 3.237   34.243  42.940  1.00 41.70  ? 273  LEU B C   1 
ATOM   6253  O  O   . LEU B  1 273 ? 2.036   34.026  42.792  1.00 38.02  ? 273  LEU B O   1 
ATOM   6254  C  CB  . LEU B  1 273 ? 4.615   32.624  44.258  1.00 30.97  ? 273  LEU B CB  1 
ATOM   6255  C  CG  . LEU B  1 273 ? 5.075   31.174  44.406  1.00 27.74  ? 273  LEU B CG  1 
ATOM   6256  C  CD1 . LEU B  1 273 ? 5.396   30.877  45.856  1.00 23.42  ? 273  LEU B CD1 1 
ATOM   6257  C  CD2 . LEU B  1 273 ? 4.020   30.223  43.877  1.00 27.67  ? 273  LEU B CD2 1 
ATOM   6258  N  N   . ARG B  1 274 ? 3.727   35.451  43.165  1.00 41.15  ? 274  ARG B N   1 
ATOM   6259  C  CA  . ARG B  1 274 ? 2.859   36.565  43.457  1.00 35.53  ? 274  ARG B CA  1 
ATOM   6260  C  C   . ARG B  1 274 ? 2.024   36.958  42.258  1.00 36.49  ? 274  ARG B C   1 
ATOM   6261  O  O   . ARG B  1 274 ? 1.030   37.660  42.411  1.00 41.99  ? 274  ARG B O   1 
ATOM   6262  C  CB  . ARG B  1 274 ? 3.675   37.751  43.947  1.00 35.87  ? 274  ARG B CB  1 
ATOM   6263  C  CG  . ARG B  1 274 ? 3.984   37.701  45.420  1.00 43.51  ? 274  ARG B CG  1 
ATOM   6264  C  CD  . ARG B  1 274 ? 4.437   39.054  45.943  1.00 46.86  ? 274  ARG B CD  1 
ATOM   6265  N  NE  . ARG B  1 274 ? 5.838   39.314  45.643  1.00 50.62  ? 274  ARG B NE  1 
ATOM   6266  C  CZ  . ARG B  1 274 ? 6.828   39.209  46.527  1.00 55.23  ? 274  ARG B CZ  1 
ATOM   6267  N  NH1 . ARG B  1 274 ? 6.591   38.847  47.792  1.00 43.87  ? 274  ARG B NH1 1 
ATOM   6268  N  NH2 . ARG B  1 274 ? 8.066   39.473  46.136  1.00 63.47  ? 274  ARG B NH2 1 
ATOM   6269  N  N   . THR B  1 275 ? 2.419   36.501  41.071  1.00 27.72  ? 275  THR B N   1 
ATOM   6270  C  CA  . THR B  1 275 ? 1.682   36.819  39.849  1.00 36.03  ? 275  THR B CA  1 
ATOM   6271  C  C   . THR B  1 275 ? 0.843   35.653  39.366  1.00 34.39  ? 275  THR B C   1 
ATOM   6272  O  O   . THR B  1 275 ? 0.666   35.447  38.162  1.00 35.45  ? 275  THR B O   1 
ATOM   6273  C  CB  . THR B  1 275 ? 2.602   37.310  38.725  1.00 38.87  ? 275  THR B CB  1 
ATOM   6274  O  OG1 . THR B  1 275 ? 3.661   36.364  38.506  1.00 34.40  ? 275  THR B OG1 1 
ATOM   6275  C  CG2 . THR B  1 275 ? 3.183   38.683  39.091  1.00 44.18  ? 275  THR B CG2 1 
ATOM   6276  N  N   . ARG B  1 276 ? 0.344   34.890  40.330  1.00 34.69  ? 276  ARG B N   1 
ATOM   6277  C  CA  . ARG B  1 276 ? -0.596  33.816  40.069  1.00 32.99  ? 276  ARG B CA  1 
ATOM   6278  C  C   . ARG B  1 276 ? -1.894  34.159  40.755  1.00 36.35  ? 276  ARG B C   1 
ATOM   6279  O  O   . ARG B  1 276 ? -1.884  34.613  41.898  1.00 35.20  ? 276  ARG B O   1 
ATOM   6280  C  CB  . ARG B  1 276 ? -0.061  32.496  40.609  1.00 27.67  ? 276  ARG B CB  1 
ATOM   6281  C  CG  . ARG B  1 276 ? 1.209   32.059  39.933  1.00 37.16  ? 276  ARG B CG  1 
ATOM   6282  C  CD  . ARG B  1 276 ? 0.918   31.078  38.819  1.00 46.87  ? 276  ARG B CD  1 
ATOM   6283  N  NE  . ARG B  1 276 ? 2.093   30.843  37.991  1.00 49.36  ? 276  ARG B NE  1 
ATOM   6284  C  CZ  . ARG B  1 276 ? 2.455   31.651  37.006  1.00 55.16  ? 276  ARG B CZ  1 
ATOM   6285  N  NH1 . ARG B  1 276 ? 1.721   32.733  36.749  1.00 58.77  ? 276  ARG B NH1 1 
ATOM   6286  N  NH2 . ARG B  1 276 ? 3.538   31.380  36.282  1.00 54.88  ? 276  ARG B NH2 1 
ATOM   6287  N  N   . PRO B  1 277 ? -3.018  33.962  40.054  1.00 45.08  ? 277  PRO B N   1 
ATOM   6288  C  CA  . PRO B  1 277 ? -4.332  34.199  40.666  1.00 49.10  ? 277  PRO B CA  1 
ATOM   6289  C  C   . PRO B  1 277 ? -4.513  33.363  41.936  1.00 41.14  ? 277  PRO B C   1 
ATOM   6290  O  O   . PRO B  1 277 ? -4.076  32.222  41.964  1.00 40.76  ? 277  PRO B O   1 
ATOM   6291  C  CB  . PRO B  1 277 ? -5.315  33.762  39.570  1.00 57.29  ? 277  PRO B CB  1 
ATOM   6292  C  CG  . PRO B  1 277 ? -4.481  33.022  38.542  1.00 60.38  ? 277  PRO B CG  1 
ATOM   6293  C  CD  . PRO B  1 277 ? -3.113  33.574  38.637  1.00 28.82  ? 277  PRO B CD  1 
ATOM   6294  N  N   . ALA B  1 278 ? -5.126  33.929  42.968  1.00 39.71  ? 278  ALA B N   1 
ATOM   6295  C  CA  . ALA B  1 278 ? -5.286  33.250  44.253  1.00 42.94  ? 278  ALA B CA  1 
ATOM   6296  C  C   . ALA B  1 278 ? -5.837  31.824  44.141  1.00 40.92  ? 278  ALA B C   1 
ATOM   6297  O  O   . ALA B  1 278 ? -5.399  30.889  44.843  1.00 39.06  ? 278  ALA B O   1 
ATOM   6298  C  CB  . ALA B  1 278 ? -6.178  34.080  45.158  1.00 49.87  ? 278  ALA B CB  1 
ATOM   6299  N  N   . GLN B  1 279 ? -6.804  31.663  43.251  1.00 30.52  ? 279  GLN B N   1 
ATOM   6300  C  CA  . GLN B  1 279 ? -7.487  30.395  43.116  1.00 49.72  ? 279  GLN B CA  1 
ATOM   6301  C  C   . GLN B  1 279 ? -6.561  29.333  42.539  1.00 29.30  ? 279  GLN B C   1 
ATOM   6302  O  O   . GLN B  1 279 ? -6.833  28.145  42.645  1.00 42.10  ? 279  GLN B O   1 
ATOM   6303  C  CB  . GLN B  1 279 ? -8.763  30.553  42.283  1.00 32.09  ? 279  GLN B CB  1 
ATOM   6304  C  CG  . GLN B  1 279 ? -9.654  29.314  42.231  1.00 41.58  ? 279  GLN B CG  1 
ATOM   6305  C  CD  . GLN B  1 279 ? -9.983  28.759  43.609  1.00 45.49  ? 279  GLN B CD  1 
ATOM   6306  O  OE1 . GLN B  1 279 ? -10.092 29.505  44.587  1.00 47.62  ? 279  GLN B OE1 1 
ATOM   6307  N  NE2 . GLN B  1 279 ? -10.136 27.435  43.693  1.00 46.54  ? 279  GLN B NE2 1 
ATOM   6308  N  N   . ASP B  1 280 ? -5.451  29.754  41.948  1.00 34.74  ? 280  ASP B N   1 
ATOM   6309  C  CA  . ASP B  1 280 ? -4.449  28.795  41.500  1.00 27.21  ? 280  ASP B CA  1 
ATOM   6310  C  C   . ASP B  1 280 ? -3.793  28.135  42.698  1.00 31.04  ? 280  ASP B C   1 
ATOM   6311  O  O   . ASP B  1 280 ? -3.823  26.896  42.847  1.00 35.45  ? 280  ASP B O   1 
ATOM   6312  C  CB  . ASP B  1 280 ? -3.411  29.466  40.615  1.00 26.71  ? 280  ASP B CB  1 
ATOM   6313  C  CG  . ASP B  1 280 ? -3.947  29.776  39.228  1.00 38.85  ? 280  ASP B CG  1 
ATOM   6314  O  OD1 . ASP B  1 280 ? -5.188  29.834  39.082  1.00 41.65  ? 280  ASP B OD1 1 
ATOM   6315  O  OD2 . ASP B  1 280 ? -3.136  29.962  38.286  1.00 30.56  ? 280  ASP B OD2 1 
ATOM   6316  N  N   . LEU B  1 281 ? -3.234  28.973  43.566  1.00 25.96  ? 281  LEU B N   1 
ATOM   6317  C  CA  . LEU B  1 281 ? -2.582  28.502  44.779  1.00 36.78  ? 281  LEU B CA  1 
ATOM   6318  C  C   . LEU B  1 281 ? -3.541  27.634  45.569  1.00 32.71  ? 281  LEU B C   1 
ATOM   6319  O  O   . LEU B  1 281 ? -3.192  26.520  45.991  1.00 36.72  ? 281  LEU B O   1 
ATOM   6320  C  CB  . LEU B  1 281 ? -2.119  29.671  45.628  1.00 25.86  ? 281  LEU B CB  1 
ATOM   6321  C  CG  . LEU B  1 281 ? -1.366  30.705  44.810  1.00 25.94  ? 281  LEU B CG  1 
ATOM   6322  C  CD1 . LEU B  1 281 ? -0.901  31.822  45.696  1.00 26.57  ? 281  LEU B CD1 1 
ATOM   6323  C  CD2 . LEU B  1 281 ? -0.195  30.053  44.131  1.00 24.84  ? 281  LEU B CD2 1 
ATOM   6324  N  N   . VAL B  1 282 ? -4.765  28.119  45.737  1.00 28.53  ? 282  VAL B N   1 
ATOM   6325  C  CA  . VAL B  1 282 ? -5.762  27.312  46.438  1.00 27.60  ? 282  VAL B CA  1 
ATOM   6326  C  C   . VAL B  1 282 ? -5.981  25.956  45.760  1.00 27.65  ? 282  VAL B C   1 
ATOM   6327  O  O   . VAL B  1 282 ? -5.975  24.930  46.431  1.00 27.05  ? 282  VAL B O   1 
ATOM   6328  C  CB  . VAL B  1 282 ? -7.095  28.057  46.592  1.00 29.23  ? 282  VAL B CB  1 
ATOM   6329  C  CG1 . VAL B  1 282 ? -8.225  27.077  46.806  1.00 30.08  ? 282  VAL B CG1 1 
ATOM   6330  C  CG2 . VAL B  1 282 ? -7.004  29.051  47.729  1.00 29.97  ? 282  VAL B CG2 1 
ATOM   6331  N  N   . ASP B  1 283 ? -6.151  25.960  44.435  1.00 29.80  ? 283  ASP B N   1 
ATOM   6332  C  CA  . ASP B  1 283 ? -6.408  24.733  43.679  1.00 32.67  ? 283  ASP B CA  1 
ATOM   6333  C  C   . ASP B  1 283 ? -5.333  23.708  43.936  1.00 41.32  ? 283  ASP B C   1 
ATOM   6334  O  O   . ASP B  1 283 ? -5.617  22.516  44.048  1.00 53.09  ? 283  ASP B O   1 
ATOM   6335  C  CB  . ASP B  1 283 ? -6.432  24.990  42.174  1.00 35.86  ? 283  ASP B CB  1 
ATOM   6336  C  CG  . ASP B  1 283 ? -7.722  25.581  41.701  1.00 41.25  ? 283  ASP B CG  1 
ATOM   6337  O  OD1 . ASP B  1 283 ? -8.732  25.447  42.417  1.00 54.01  ? 283  ASP B OD1 1 
ATOM   6338  O  OD2 . ASP B  1 283 ? -7.724  26.187  40.609  1.00 41.80  ? 283  ASP B OD2 1 
ATOM   6339  N  N   . HIS B  1 284 ? -4.087  24.159  44.011  1.00 39.21  ? 284  HIS B N   1 
ATOM   6340  C  CA  . HIS B  1 284 ? -3.012  23.185  44.175  1.00 35.86  ? 284  HIS B CA  1 
ATOM   6341  C  C   . HIS B  1 284 ? -2.508  22.971  45.588  1.00 39.84  ? 284  HIS B C   1 
ATOM   6342  O  O   . HIS B  1 284 ? -1.580  22.196  45.784  1.00 44.86  ? 284  HIS B O   1 
ATOM   6343  C  CB  . HIS B  1 284 ? -1.844  23.497  43.245  1.00 38.10  ? 284  HIS B CB  1 
ATOM   6344  C  CG  . HIS B  1 284 ? -2.094  23.090  41.831  1.00 44.28  ? 284  HIS B CG  1 
ATOM   6345  N  ND1 . HIS B  1 284 ? -1.909  21.798  41.386  1.00 50.13  ? 284  HIS B ND1 1 
ATOM   6346  C  CD2 . HIS B  1 284 ? -2.548  23.794  40.769  1.00 46.55  ? 284  HIS B CD2 1 
ATOM   6347  C  CE1 . HIS B  1 284 ? -2.227  21.727  40.107  1.00 53.37  ? 284  HIS B CE1 1 
ATOM   6348  N  NE2 . HIS B  1 284 ? -2.614  22.925  39.706  1.00 53.75  ? 284  HIS B NE2 1 
ATOM   6349  N  N   . GLU B  1 285 ? -3.098  23.633  46.578  1.00 41.39  ? 285  GLU B N   1 
ATOM   6350  C  CA  . GLU B  1 285 ? -2.519  23.552  47.924  1.00 41.26  ? 285  GLU B CA  1 
ATOM   6351  C  C   . GLU B  1 285 ? -2.571  22.175  48.591  1.00 40.58  ? 285  GLU B C   1 
ATOM   6352  O  O   . GLU B  1 285 ? -1.724  21.859  49.417  1.00 37.89  ? 285  GLU B O   1 
ATOM   6353  C  CB  . GLU B  1 285 ? -3.081  24.627  48.858  1.00 42.21  ? 285  GLU B CB  1 
ATOM   6354  C  CG  . GLU B  1 285 ? -4.470  24.358  49.367  1.00 46.13  ? 285  GLU B CG  1 
ATOM   6355  C  CD  . GLU B  1 285 ? -4.942  25.448  50.292  1.00 53.88  ? 285  GLU B CD  1 
ATOM   6356  O  OE1 . GLU B  1 285 ? -4.087  26.064  50.955  1.00 50.58  ? 285  GLU B OE1 1 
ATOM   6357  O  OE2 . GLU B  1 285 ? -6.165  25.693  50.350  1.00 64.39  ? 285  GLU B OE2 1 
ATOM   6358  N  N   . TRP B  1 286 ? -3.540  21.345  48.235  1.00 46.25  ? 286  TRP B N   1 
ATOM   6359  C  CA  . TRP B  1 286 ? -3.680  20.070  48.931  1.00 50.90  ? 286  TRP B CA  1 
ATOM   6360  C  C   . TRP B  1 286 ? -2.774  18.973  48.381  1.00 49.37  ? 286  TRP B C   1 
ATOM   6361  O  O   . TRP B  1 286 ? -2.753  17.862  48.904  1.00 49.63  ? 286  TRP B O   1 
ATOM   6362  C  CB  . TRP B  1 286 ? -5.145  19.623  48.936  1.00 62.81  ? 286  TRP B CB  1 
ATOM   6363  C  CG  . TRP B  1 286 ? -5.990  20.440  49.874  1.00 68.85  ? 286  TRP B CG  1 
ATOM   6364  C  CD1 . TRP B  1 286 ? -6.740  21.536  49.559  1.00 71.66  ? 286  TRP B CD1 1 
ATOM   6365  C  CD2 . TRP B  1 286 ? -6.147  20.240  51.285  1.00 68.32  ? 286  TRP B CD2 1 
ATOM   6366  N  NE1 . TRP B  1 286 ? -7.359  22.024  50.685  1.00 70.83  ? 286  TRP B NE1 1 
ATOM   6367  C  CE2 . TRP B  1 286 ? -7.010  21.244  51.756  1.00 72.61  ? 286  TRP B CE2 1 
ATOM   6368  C  CE3 . TRP B  1 286 ? -5.643  19.306  52.195  1.00 65.63  ? 286  TRP B CE3 1 
ATOM   6369  C  CZ2 . TRP B  1 286 ? -7.382  21.337  53.095  1.00 78.92  ? 286  TRP B CZ2 1 
ATOM   6370  C  CZ3 . TRP B  1 286 ? -6.012  19.401  53.523  1.00 65.07  ? 286  TRP B CZ3 1 
ATOM   6371  C  CH2 . TRP B  1 286 ? -6.870  20.405  53.960  1.00 75.24  ? 286  TRP B CH2 1 
ATOM   6372  N  N   . HIS B  1 287 ? -2.006  19.301  47.345  1.00 49.35  ? 287  HIS B N   1 
ATOM   6373  C  CA  . HIS B  1 287 ? -1.222  18.310  46.613  1.00 41.39  ? 287  HIS B CA  1 
ATOM   6374  C  C   . HIS B  1 287 ? 0.203   18.129  47.128  1.00 38.78  ? 287  HIS B C   1 
ATOM   6375  O  O   . HIS B  1 287 ? 0.922   17.246  46.667  1.00 52.06  ? 287  HIS B O   1 
ATOM   6376  C  CB  . HIS B  1 287 ? -1.177  18.655  45.121  1.00 42.76  ? 287  HIS B CB  1 
ATOM   6377  C  CG  . HIS B  1 287 ? -2.518  18.643  44.452  1.00 59.09  ? 287  HIS B CG  1 
ATOM   6378  N  ND1 . HIS B  1 287 ? -3.703  18.567  45.154  1.00 66.49  ? 287  HIS B ND1 1 
ATOM   6379  C  CD2 . HIS B  1 287 ? -2.861  18.702  43.143  1.00 69.44  ? 287  HIS B CD2 1 
ATOM   6380  C  CE1 . HIS B  1 287 ? -4.717  18.582  44.308  1.00 71.99  ? 287  HIS B CE1 1 
ATOM   6381  N  NE2 . HIS B  1 287 ? -4.233  18.662  43.081  1.00 76.00  ? 287  HIS B NE2 1 
ATOM   6382  N  N   . VAL B  1 288 ? 0.627   18.956  48.072  1.00 29.98  ? 288  VAL B N   1 
ATOM   6383  C  CA  . VAL B  1 288 ? 2.009   18.883  48.540  1.00 31.88  ? 288  VAL B CA  1 
ATOM   6384  C  C   . VAL B  1 288 ? 2.189   18.100  49.846  1.00 40.77  ? 288  VAL B C   1 
ATOM   6385  O  O   . VAL B  1 288 ? 3.284   18.064  50.400  1.00 41.99  ? 288  VAL B O   1 
ATOM   6386  C  CB  . VAL B  1 288 ? 2.610   20.277  48.733  1.00 29.03  ? 288  VAL B CB  1 
ATOM   6387  C  CG1 . VAL B  1 288 ? 2.628   21.019  47.423  1.00 32.46  ? 288  VAL B CG1 1 
ATOM   6388  C  CG2 . VAL B  1 288 ? 1.824   21.047  49.773  1.00 29.91  ? 288  VAL B CG2 1 
ATOM   6389  N  N   . LEU B  1 289 ? 1.122   17.478  50.338  1.00 41.10  ? 289  LEU B N   1 
ATOM   6390  C  CA  . LEU B  1 289 ? 1.207   16.713  51.579  1.00 34.05  ? 289  LEU B CA  1 
ATOM   6391  C  C   . LEU B  1 289 ? 1.973   15.394  51.386  1.00 35.53  ? 289  LEU B C   1 
ATOM   6392  O  O   . LEU B  1 289 ? 1.715   14.658  50.428  1.00 35.76  ? 289  LEU B O   1 
ATOM   6393  C  CB  . LEU B  1 289 ? -0.191  16.475  52.162  1.00 31.39  ? 289  LEU B CB  1 
ATOM   6394  C  CG  . LEU B  1 289 ? -0.768  17.603  53.031  1.00 30.34  ? 289  LEU B CG  1 
ATOM   6395  C  CD1 . LEU B  1 289 ? -2.183  17.278  53.535  1.00 22.73  ? 289  LEU B CD1 1 
ATOM   6396  C  CD2 . LEU B  1 289 ? 0.158   17.893  54.203  1.00 25.21  ? 289  LEU B CD2 1 
ATOM   6397  N  N   . PRO B  1 290 ? 2.907   15.089  52.312  1.00 35.84  ? 290  PRO B N   1 
ATOM   6398  C  CA  . PRO B  1 290 ? 3.879   13.989  52.206  1.00 34.73  ? 290  PRO B CA  1 
ATOM   6399  C  C   . PRO B  1 290 ? 3.259   12.604  51.997  1.00 40.29  ? 290  PRO B C   1 
ATOM   6400  O  O   . PRO B  1 290 ? 3.734   11.864  51.134  1.00 42.58  ? 290  PRO B O   1 
ATOM   6401  C  CB  . PRO B  1 290 ? 4.632   14.054  53.538  1.00 35.26  ? 290  PRO B CB  1 
ATOM   6402  C  CG  . PRO B  1 290 ? 3.709   14.754  54.469  1.00 37.11  ? 290  PRO B CG  1 
ATOM   6403  C  CD  . PRO B  1 290 ? 3.011   15.770  53.613  1.00 37.84  ? 290  PRO B CD  1 
ATOM   6404  N  N   . GLN B  1 291 ? 2.240   12.247  52.775  1.00 46.16  ? 291  GLN B N   1 
ATOM   6405  C  CA  . GLN B  1 291 ? 1.494   11.018  52.516  1.00 51.15  ? 291  GLN B CA  1 
ATOM   6406  C  C   . GLN B  1 291 ? 0.017   11.323  52.503  1.00 46.97  ? 291  GLN B C   1 
ATOM   6407  O  O   . GLN B  1 291 ? -0.390  12.463  52.706  1.00 45.38  ? 291  GLN B O   1 
ATOM   6408  C  CB  . GLN B  1 291 ? 1.773   9.931   53.562  1.00 58.98  ? 291  GLN B CB  1 
ATOM   6409  C  CG  . GLN B  1 291 ? 3.221   9.528   53.701  1.00 64.27  ? 291  GLN B CG  1 
ATOM   6410  C  CD  . GLN B  1 291 ? 3.956   10.428  54.670  1.00 75.64  ? 291  GLN B CD  1 
ATOM   6411  O  OE1 . GLN B  1 291 ? 3.342   11.298  55.301  1.00 73.41  ? 291  GLN B OE1 1 
ATOM   6412  N  NE2 . GLN B  1 291 ? 5.276   10.228  54.801  1.00 80.00  ? 291  GLN B NE2 1 
ATOM   6413  N  N   . GLU B  1 292 ? -0.785  10.294  52.262  1.00 51.51  ? 292  GLU B N   1 
ATOM   6414  C  CA  . GLU B  1 292 ? -2.236  10.425  52.353  1.00 54.84  ? 292  GLU B CA  1 
ATOM   6415  C  C   . GLU B  1 292 ? -2.582  10.590  53.824  1.00 50.00  ? 292  GLU B C   1 
ATOM   6416  O  O   . GLU B  1 292 ? -1.979  9.945   54.688  1.00 50.08  ? 292  GLU B O   1 
ATOM   6417  C  CB  . GLU B  1 292 ? -2.922  9.189   51.772  1.00 52.10  ? 292  GLU B CB  1 
ATOM   6418  C  CG  . GLU B  1 292 ? -4.434  9.272   51.638  1.00 50.92  ? 292  GLU B CG  1 
ATOM   6419  C  CD  . GLU B  1 292 ? -5.029  7.932   51.214  1.00 54.45  ? 292  GLU B CD  1 
ATOM   6420  O  OE1 . GLU B  1 292 ? -4.241  7.034   50.826  1.00 51.27  ? 292  GLU B OE1 1 
ATOM   6421  O  OE2 . GLU B  1 292 ? -6.273  7.769   51.279  1.00 57.57  ? 292  GLU B OE2 1 
ATOM   6422  N  N   . SER B  1 293 ? -3.541  11.454  54.122  1.00 40.78  ? 293  SER B N   1 
ATOM   6423  C  CA  . SER B  1 293 ? -3.791  11.741  55.512  1.00 37.51  ? 293  SER B CA  1 
ATOM   6424  C  C   . SER B  1 293 ? -5.147  12.379  55.777  1.00 42.92  ? 293  SER B C   1 
ATOM   6425  O  O   . SER B  1 293 ? -5.889  12.709  54.851  1.00 46.21  ? 293  SER B O   1 
ATOM   6426  C  CB  . SER B  1 293 ? -2.670  12.636  56.047  1.00 35.74  ? 293  SER B CB  1 
ATOM   6427  O  OG  . SER B  1 293 ? -2.667  13.893  55.404  1.00 37.99  ? 293  SER B OG  1 
ATOM   6428  N  N   . ILE B  1 294 ? -5.456  12.505  57.066  1.00 44.23  ? 294  ILE B N   1 
ATOM   6429  C  CA  . ILE B  1 294 ? -6.512  13.371  57.578  1.00 41.36  ? 294  ILE B CA  1 
ATOM   6430  C  C   . ILE B  1 294 ? -5.933  14.095  58.784  1.00 37.82  ? 294  ILE B C   1 
ATOM   6431  O  O   . ILE B  1 294 ? -5.058  13.558  59.477  1.00 37.27  ? 294  ILE B O   1 
ATOM   6432  C  CB  . ILE B  1 294 ? -7.738  12.577  58.058  1.00 42.32  ? 294  ILE B CB  1 
ATOM   6433  C  CG1 . ILE B  1 294 ? -7.312  11.456  59.006  1.00 37.81  ? 294  ILE B CG1 1 
ATOM   6434  C  CG2 . ILE B  1 294 ? -8.479  11.989  56.890  1.00 46.99  ? 294  ILE B CG2 1 
ATOM   6435  C  CD1 . ILE B  1 294 ? -8.351  11.120  60.023  1.00 40.86  ? 294  ILE B CD1 1 
ATOM   6436  N  N   . PHE B  1 295 ? -6.421  15.304  59.040  1.00 37.70  ? 295  PHE B N   1 
ATOM   6437  C  CA  . PHE B  1 295 ? -5.956  16.086  60.182  1.00 39.70  ? 295  PHE B CA  1 
ATOM   6438  C  C   . PHE B  1 295 ? -4.472  16.390  59.976  1.00 40.71  ? 295  PHE B C   1 
ATOM   6439  O  O   . PHE B  1 295 ? -3.648  16.250  60.881  1.00 37.64  ? 295  PHE B O   1 
ATOM   6440  C  CB  . PHE B  1 295 ? -6.230  15.352  61.505  1.00 43.49  ? 295  PHE B CB  1 
ATOM   6441  C  CG  . PHE B  1 295 ? -6.592  16.258  62.656  1.00 45.90  ? 295  PHE B CG  1 
ATOM   6442  C  CD1 . PHE B  1 295 ? -5.912  17.451  62.871  1.00 51.67  ? 295  PHE B CD1 1 
ATOM   6443  C  CD2 . PHE B  1 295 ? -7.611  15.907  63.533  1.00 46.21  ? 295  PHE B CD2 1 
ATOM   6444  C  CE1 . PHE B  1 295 ? -6.244  18.282  63.936  1.00 54.49  ? 295  PHE B CE1 1 
ATOM   6445  C  CE2 . PHE B  1 295 ? -7.942  16.728  64.603  1.00 51.08  ? 295  PHE B CE2 1 
ATOM   6446  C  CZ  . PHE B  1 295 ? -7.260  17.919  64.798  1.00 55.25  ? 295  PHE B CZ  1 
ATOM   6447  N  N   . ARG B  1 296 ? -4.164  16.774  58.739  1.00 44.20  ? 296  ARG B N   1 
ATOM   6448  C  CA  . ARG B  1 296 ? -2.866  17.272  58.315  1.00 36.31  ? 296  ARG B CA  1 
ATOM   6449  C  C   . ARG B  1 296 ? -3.153  18.292  57.223  1.00 42.13  ? 296  ARG B C   1 
ATOM   6450  O  O   . ARG B  1 296 ? -3.772  17.943  56.218  1.00 52.93  ? 296  ARG B O   1 
ATOM   6451  C  CB  . ARG B  1 296 ? -2.053  16.146  57.687  1.00 27.55  ? 296  ARG B CB  1 
ATOM   6452  C  CG  . ARG B  1 296 ? -1.571  15.078  58.642  1.00 42.15  ? 296  ARG B CG  1 
ATOM   6453  C  CD  . ARG B  1 296 ? -0.632  15.649  59.706  1.00 51.87  ? 296  ARG B CD  1 
ATOM   6454  N  NE  . ARG B  1 296 ? -0.057  14.609  60.561  1.00 55.75  ? 296  ARG B NE  1 
ATOM   6455  C  CZ  . ARG B  1 296 ? -0.695  14.020  61.571  1.00 62.74  ? 296  ARG B CZ  1 
ATOM   6456  N  NH1 . ARG B  1 296 ? -1.952  14.349  61.866  1.00 64.95  ? 296  ARG B NH1 1 
ATOM   6457  N  NH2 . ARG B  1 296 ? -0.077  13.086  62.283  1.00 65.39  ? 296  ARG B NH2 1 
ATOM   6458  N  N   A PHE B  1 297 ? -2.809  19.565  57.428  0.50 37.62  ? 297  PHE B N   1 
ATOM   6459  N  N   B PHE B  1 297 ? -2.620  19.497  57.384  0.50 37.84  ? 297  PHE B N   1 
ATOM   6460  C  CA  A PHE B  1 297 ? -2.875  20.521  56.311  0.50 38.34  ? 297  PHE B CA  1 
ATOM   6461  C  CA  B PHE B  1 297 ? -2.836  20.576  56.432  0.50 38.63  ? 297  PHE B CA  1 
ATOM   6462  C  C   A PHE B  1 297 ? -1.497  20.977  55.845  0.50 37.85  ? 297  PHE B C   1 
ATOM   6463  C  C   B PHE B  1 297 ? -1.502  21.115  55.887  0.50 37.91  ? 297  PHE B C   1 
ATOM   6464  O  O   A PHE B  1 297 ? -0.535  20.989  56.610  0.50 38.82  ? 297  PHE B O   1 
ATOM   6465  O  O   B PHE B  1 297 ? -0.559  21.308  56.651  0.50 38.58  ? 297  PHE B O   1 
ATOM   6466  C  CB  A PHE B  1 297 ? -3.771  21.741  56.584  0.50 42.33  ? 297  PHE B CB  1 
ATOM   6467  C  CB  B PHE B  1 297 ? -3.616  21.672  57.139  0.50 42.05  ? 297  PHE B CB  1 
ATOM   6468  C  CG  A PHE B  1 297 ? -3.627  22.843  55.542  0.50 43.24  ? 297  PHE B CG  1 
ATOM   6469  C  CG  B PHE B  1 297 ? -4.485  21.163  58.264  0.50 39.68  ? 297  PHE B CG  1 
ATOM   6470  C  CD1 A PHE B  1 297 ? -4.027  22.634  54.222  0.50 40.85  ? 297  PHE B CD1 1 
ATOM   6471  C  CD1 B PHE B  1 297 ? -5.753  20.673  58.009  0.50 38.05  ? 297  PHE B CD1 1 
ATOM   6472  C  CD2 A PHE B  1 297 ? -3.064  24.069  55.873  0.50 26.00  ? 297  PHE B CD2 1 
ATOM   6473  C  CD2 B PHE B  1 297 ? -4.032  21.180  59.574  0.50 39.03  ? 297  PHE B CD2 1 
ATOM   6474  C  CE1 A PHE B  1 297 ? -3.867  23.628  53.266  0.50 25.46  ? 297  PHE B CE1 1 
ATOM   6475  C  CE1 B PHE B  1 297 ? -6.551  20.214  59.035  0.50 41.31  ? 297  PHE B CE1 1 
ATOM   6476  C  CE2 A PHE B  1 297 ? -2.919  25.060  54.917  0.50 26.10  ? 297  PHE B CE2 1 
ATOM   6477  C  CE2 B PHE B  1 297 ? -4.831  20.722  60.604  0.50 40.19  ? 297  PHE B CE2 1 
ATOM   6478  C  CZ  A PHE B  1 297 ? -3.313  24.837  53.618  0.50 25.79  ? 297  PHE B CZ  1 
ATOM   6479  C  CZ  B PHE B  1 297 ? -6.091  20.241  60.335  0.50 41.32  ? 297  PHE B CZ  1 
ATOM   6480  N  N   . SER B  1 298 ? -1.432  21.357  54.575  1.00 35.38  ? 298  SER B N   1 
ATOM   6481  C  CA  . SER B  1 298 ? -0.186  21.703  53.886  1.00 35.18  ? 298  SER B CA  1 
ATOM   6482  C  C   . SER B  1 298 ? 0.640   22.881  54.398  1.00 33.46  ? 298  SER B C   1 
ATOM   6483  O  O   . SER B  1 298 ? 1.860   22.754  54.569  1.00 28.82  ? 298  SER B O   1 
ATOM   6484  C  CB  . SER B  1 298 ? -0.484  21.925  52.413  1.00 40.06  ? 298  SER B CB  1 
ATOM   6485  O  OG  . SER B  1 298 ? -1.155  20.800  51.880  1.00 46.93  ? 298  SER B OG  1 
ATOM   6486  N  N   . PHE B  1 299 ? -0.016  24.022  54.614  1.00 30.94  ? 299  PHE B N   1 
ATOM   6487  C  CA  . PHE B  1 299 ? 0.672   25.252  55.013  1.00 27.96  ? 299  PHE B CA  1 
ATOM   6488  C  C   . PHE B  1 299 ? 0.283   25.771  56.399  1.00 30.29  ? 299  PHE B C   1 
ATOM   6489  O  O   . PHE B  1 299 ? -0.793  26.326  56.597  1.00 41.83  ? 299  PHE B O   1 
ATOM   6490  C  CB  . PHE B  1 299 ? 0.483   26.314  53.939  1.00 28.10  ? 299  PHE B CB  1 
ATOM   6491  C  CG  . PHE B  1 299 ? 1.049   25.908  52.617  1.00 27.70  ? 299  PHE B CG  1 
ATOM   6492  C  CD1 . PHE B  1 299 ? 2.401   26.072  52.354  1.00 27.25  ? 299  PHE B CD1 1 
ATOM   6493  C  CD2 . PHE B  1 299 ? 0.241   25.330  51.656  1.00 23.46  ? 299  PHE B CD2 1 
ATOM   6494  C  CE1 . PHE B  1 299 ? 2.936   25.679  51.155  1.00 29.80  ? 299  PHE B CE1 1 
ATOM   6495  C  CE2 . PHE B  1 299 ? 0.760   24.936  50.457  1.00 31.42  ? 299  PHE B CE2 1 
ATOM   6496  C  CZ  . PHE B  1 299 ? 2.116   25.107  50.201  1.00 34.15  ? 299  PHE B CZ  1 
ATOM   6497  N  N   . VAL B  1 300 ? 1.183   25.576  57.355  1.00 27.34  ? 300  VAL B N   1 
ATOM   6498  C  CA  . VAL B  1 300 ? 0.905   25.823  58.763  1.00 28.94  ? 300  VAL B CA  1 
ATOM   6499  C  C   . VAL B  1 300 ? 2.102   26.562  59.343  1.00 30.20  ? 300  VAL B C   1 
ATOM   6500  O  O   . VAL B  1 300 ? 3.083   26.772  58.632  1.00 29.49  ? 300  VAL B O   1 
ATOM   6501  C  CB  . VAL B  1 300 ? 0.697   24.498  59.517  1.00 29.77  ? 300  VAL B CB  1 
ATOM   6502  C  CG1 . VAL B  1 300 ? -0.640  23.872  59.147  1.00 30.39  ? 300  VAL B CG1 1 
ATOM   6503  C  CG2 . VAL B  1 300 ? 1.865   23.556  59.251  1.00 24.36  ? 300  VAL B CG2 1 
ATOM   6504  N  N   . PRO B  1 301 ? 2.018   26.990  60.618  1.00 33.22  ? 301  PRO B N   1 
ATOM   6505  C  CA  . PRO B  1 301 ? 3.171   27.674  61.209  1.00 27.23  ? 301  PRO B CA  1 
ATOM   6506  C  C   . PRO B  1 301 ? 4.459   26.866  61.107  1.00 34.59  ? 301  PRO B C   1 
ATOM   6507  O  O   . PRO B  1 301 ? 4.427   25.642  61.172  1.00 34.80  ? 301  PRO B O   1 
ATOM   6508  C  CB  . PRO B  1 301 ? 2.757   27.829  62.667  1.00 36.44  ? 301  PRO B CB  1 
ATOM   6509  C  CG  . PRO B  1 301 ? 1.270   27.989  62.610  1.00 33.43  ? 301  PRO B CG  1 
ATOM   6510  C  CD  . PRO B  1 301 ? 0.823   27.092  61.485  1.00 32.69  ? 301  PRO B CD  1 
ATOM   6511  N  N   . VAL B  1 302 ? 5.582   27.550  60.929  1.00 31.53  ? 302  VAL B N   1 
ATOM   6512  C  CA  . VAL B  1 302 ? 6.851   26.866  60.736  1.00 28.48  ? 302  VAL B CA  1 
ATOM   6513  C  C   . VAL B  1 302 ? 7.825   27.226  61.845  1.00 30.84  ? 302  VAL B C   1 
ATOM   6514  O  O   . VAL B  1 302 ? 7.886   28.371  62.284  1.00 38.03  ? 302  VAL B O   1 
ATOM   6515  C  CB  . VAL B  1 302 ? 7.473   27.214  59.364  1.00 30.24  ? 302  VAL B CB  1 
ATOM   6516  C  CG1 . VAL B  1 302 ? 7.629   28.711  59.223  1.00 25.48  ? 302  VAL B CG1 1 
ATOM   6517  C  CG2 . VAL B  1 302 ? 8.824   26.514  59.175  1.00 26.76  ? 302  VAL B CG2 1 
ATOM   6518  N  N   . VAL B  1 303 ? 8.574   26.241  62.318  1.00 31.69  ? 303  VAL B N   1 
ATOM   6519  C  CA  . VAL B  1 303 ? 9.639   26.500  63.278  1.00 43.23  ? 303  VAL B CA  1 
ATOM   6520  C  C   . VAL B  1 303 ? 10.841  27.131  62.576  1.00 46.68  ? 303  VAL B C   1 
ATOM   6521  O  O   . VAL B  1 303 ? 11.716  26.430  62.063  1.00 45.20  ? 303  VAL B O   1 
ATOM   6522  C  CB  . VAL B  1 303 ? 10.070  25.214  63.985  1.00 42.86  ? 303  VAL B CB  1 
ATOM   6523  C  CG1 . VAL B  1 303 ? 11.179  25.503  64.983  1.00 39.37  ? 303  VAL B CG1 1 
ATOM   6524  C  CG2 . VAL B  1 303 ? 8.861   24.581  64.670  1.00 44.32  ? 303  VAL B CG2 1 
ATOM   6525  N  N   . ASP B  1 304 ? 10.863  28.461  62.565  1.00 48.19  ? 304  ASP B N   1 
ATOM   6526  C  CA  . ASP B  1 304 ? 11.815  29.223  61.768  1.00 47.47  ? 304  ASP B CA  1 
ATOM   6527  C  C   . ASP B  1 304 ? 12.970  29.730  62.608  1.00 46.55  ? 304  ASP B C   1 
ATOM   6528  O  O   . ASP B  1 304 ? 14.020  30.089  62.079  1.00 47.31  ? 304  ASP B O   1 
ATOM   6529  C  CB  . ASP B  1 304 ? 11.107  30.411  61.106  1.00 48.88  ? 304  ASP B CB  1 
ATOM   6530  C  CG  . ASP B  1 304 ? 10.260  31.223  62.096  1.00 58.43  ? 304  ASP B CG  1 
ATOM   6531  O  OD1 . ASP B  1 304 ? 10.075  30.769  63.252  1.00 55.68  ? 304  ASP B OD1 1 
ATOM   6532  O  OD2 . ASP B  1 304 ? 9.767   32.311  61.708  1.00 62.60  ? 304  ASP B OD2 1 
ATOM   6533  N  N   . GLY B  1 305 ? 12.768  29.765  63.920  1.00 41.76  ? 305  GLY B N   1 
ATOM   6534  C  CA  . GLY B  1 305 ? 13.716  30.407  64.808  1.00 40.86  ? 305  GLY B CA  1 
ATOM   6535  C  C   . GLY B  1 305 ? 13.431  31.892  64.962  1.00 50.99  ? 305  GLY B C   1 
ATOM   6536  O  O   . GLY B  1 305 ? 14.198  32.618  65.583  1.00 60.54  ? 305  GLY B O   1 
ATOM   6537  N  N   . ASP B  1 306 ? 12.329  32.357  64.388  1.00 51.44  ? 306  ASP B N   1 
ATOM   6538  C  CA  . ASP B  1 306 ? 11.925  33.738  64.587  1.00 58.17  ? 306  ASP B CA  1 
ATOM   6539  C  C   . ASP B  1 306 ? 10.760  33.737  65.559  1.00 59.01  ? 306  ASP B C   1 
ATOM   6540  O  O   . ASP B  1 306 ? 10.962  33.836  66.769  1.00 63.77  ? 306  ASP B O   1 
ATOM   6541  C  CB  . ASP B  1 306 ? 11.532  34.412  63.262  1.00 69.19  ? 306  ASP B CB  1 
ATOM   6542  C  CG  . ASP B  1 306 ? 11.525  35.950  63.347  1.00 79.96  ? 306  ASP B CG  1 
ATOM   6543  O  OD1 . ASP B  1 306 ? 12.627  36.544  63.368  1.00 82.58  ? 306  ASP B OD1 1 
ATOM   6544  O  OD2 . ASP B  1 306 ? 10.428  36.568  63.368  1.00 81.47  ? 306  ASP B OD2 1 
ATOM   6545  N  N   . PHE B  1 307 ? 9.547   33.611  65.023  1.00 53.77  ? 307  PHE B N   1 
ATOM   6546  C  CA  . PHE B  1 307 ? 8.331   33.661  65.826  1.00 47.76  ? 307  PHE B CA  1 
ATOM   6547  C  C   . PHE B  1 307 ? 8.396   32.581  66.891  1.00 49.82  ? 307  PHE B C   1 
ATOM   6548  O  O   . PHE B  1 307 ? 8.066   32.817  68.053  1.00 53.26  ? 307  PHE B O   1 
ATOM   6549  C  CB  . PHE B  1 307 ? 7.109   33.471  64.932  1.00 41.01  ? 307  PHE B CB  1 
ATOM   6550  C  CG  . PHE B  1 307 ? 5.801   33.811  65.594  1.00 43.99  ? 307  PHE B CG  1 
ATOM   6551  C  CD1 . PHE B  1 307 ? 5.118   32.872  66.334  1.00 33.59  ? 307  PHE B CD1 1 
ATOM   6552  C  CD2 . PHE B  1 307 ? 5.245   35.070  65.453  1.00 48.12  ? 307  PHE B CD2 1 
ATOM   6553  C  CE1 . PHE B  1 307 ? 3.921   33.182  66.919  1.00 43.90  ? 307  PHE B CE1 1 
ATOM   6554  C  CE2 . PHE B  1 307 ? 4.033   35.389  66.047  1.00 43.33  ? 307  PHE B CE2 1 
ATOM   6555  C  CZ  . PHE B  1 307 ? 3.376   34.450  66.778  1.00 41.57  ? 307  PHE B CZ  1 
ATOM   6556  N  N   . LEU B  1 308 ? 8.851   31.400  66.482  1.00 49.09  ? 308  LEU B N   1 
ATOM   6557  C  CA  . LEU B  1 308 ? 9.120   30.295  67.399  1.00 46.50  ? 308  LEU B CA  1 
ATOM   6558  C  C   . LEU B  1 308 ? 10.626  30.076  67.508  1.00 49.62  ? 308  LEU B C   1 
ATOM   6559  O  O   . LEU B  1 308 ? 11.268  29.672  66.536  1.00 29.32  ? 308  LEU B O   1 
ATOM   6560  C  CB  . LEU B  1 308 ? 8.435   29.025  66.899  1.00 40.35  ? 308  LEU B CB  1 
ATOM   6561  C  CG  . LEU B  1 308 ? 6.912   29.120  66.915  1.00 36.91  ? 308  LEU B CG  1 
ATOM   6562  C  CD1 . LEU B  1 308 ? 6.275   28.048  66.056  1.00 32.23  ? 308  LEU B CD1 1 
ATOM   6563  C  CD2 . LEU B  1 308 ? 6.451   29.009  68.342  1.00 31.18  ? 308  LEU B CD2 1 
ATOM   6564  N  N   . SER B  1 309 ? 11.182  30.355  68.689  1.00 53.94  ? 309  SER B N   1 
ATOM   6565  C  CA  . SER B  1 309 ? 12.631  30.283  68.926  1.00 52.17  ? 309  SER B CA  1 
ATOM   6566  C  C   . SER B  1 309 ? 13.165  28.855  68.823  1.00 51.42  ? 309  SER B C   1 
ATOM   6567  O  O   . SER B  1 309 ? 14.344  28.636  68.517  1.00 46.98  ? 309  SER B O   1 
ATOM   6568  C  CB  . SER B  1 309 ? 12.972  30.875  70.295  1.00 52.60  ? 309  SER B CB  1 
ATOM   6569  O  OG  . SER B  1 309 ? 12.153  30.324  71.314  1.00 53.91  ? 309  SER B OG  1 
ATOM   6570  N  N   . ASP B  1 310 ? 12.272  27.901  69.088  1.00 51.11  ? 310  ASP B N   1 
ATOM   6571  C  CA  . ASP B  1 310 ? 12.534  26.474  68.972  1.00 47.31  ? 310  ASP B CA  1 
ATOM   6572  C  C   . ASP B  1 310 ? 11.202  25.842  68.595  1.00 45.76  ? 310  ASP B C   1 
ATOM   6573  O  O   . ASP B  1 310 ? 10.234  26.554  68.342  1.00 54.79  ? 310  ASP B O   1 
ATOM   6574  C  CB  . ASP B  1 310 ? 13.005  25.930  70.316  1.00 54.92  ? 310  ASP B CB  1 
ATOM   6575  C  CG  . ASP B  1 310 ? 13.952  24.753  70.179  1.00 58.58  ? 310  ASP B CG  1 
ATOM   6576  O  OD1 . ASP B  1 310 ? 13.666  23.830  69.383  1.00 54.65  ? 310  ASP B OD1 1 
ATOM   6577  O  OD2 . ASP B  1 310 ? 14.986  24.756  70.886  1.00 61.39  ? 310  ASP B OD2 1 
ATOM   6578  N  N   . THR B  1 311 ? 11.136  24.516  68.566  1.00 40.82  ? 311  THR B N   1 
ATOM   6579  C  CA  . THR B  1 311 ? 9.872   23.824  68.327  1.00 32.79  ? 311  THR B CA  1 
ATOM   6580  C  C   . THR B  1 311 ? 8.984   23.957  69.557  1.00 31.66  ? 311  THR B C   1 
ATOM   6581  O  O   . THR B  1 311 ? 9.486   24.064  70.666  1.00 33.82  ? 311  THR B O   1 
ATOM   6582  C  CB  . THR B  1 311 ? 10.097  22.339  68.092  1.00 25.45  ? 311  THR B CB  1 
ATOM   6583  O  OG1 . THR B  1 311 ? 10.127  21.681  69.356  1.00 26.44  ? 311  THR B OG1 1 
ATOM   6584  C  CG2 . THR B  1 311 ? 11.414  22.104  67.376  1.00 83.47  ? 311  THR B CG2 1 
ATOM   6585  N  N   . PRO B  1 312 ? 7.660   23.937  69.368  1.00 37.33  ? 312  PRO B N   1 
ATOM   6586  C  CA  . PRO B  1 312 ? 6.767   24.044  70.520  1.00 45.32  ? 312  PRO B CA  1 
ATOM   6587  C  C   . PRO B  1 312 ? 7.117   23.061  71.628  1.00 51.40  ? 312  PRO B C   1 
ATOM   6588  O  O   . PRO B  1 312 ? 7.147   23.489  72.778  1.00 56.82  ? 312  PRO B O   1 
ATOM   6589  C  CB  . PRO B  1 312 ? 5.399   23.702  69.929  1.00 42.17  ? 312  PRO B CB  1 
ATOM   6590  C  CG  . PRO B  1 312 ? 5.502   24.139  68.536  1.00 40.05  ? 312  PRO B CG  1 
ATOM   6591  C  CD  . PRO B  1 312 ? 6.902   23.798  68.116  1.00 34.40  ? 312  PRO B CD  1 
ATOM   6592  N  N   . GLU B  1 313 ? 7.383   21.797  71.301  1.00 49.11  ? 313  GLU B N   1 
ATOM   6593  C  CA  . GLU B  1 313 ? 7.661   20.806  72.336  1.00 48.40  ? 313  GLU B CA  1 
ATOM   6594  C  C   . GLU B  1 313 ? 8.791   21.331  73.213  1.00 47.79  ? 313  GLU B C   1 
ATOM   6595  O  O   . GLU B  1 313 ? 8.641   21.491  74.436  1.00 46.54  ? 313  GLU B O   1 
ATOM   6596  C  CB  . GLU B  1 313 ? 8.021   19.448  71.731  1.00 51.63  ? 313  GLU B CB  1 
ATOM   6597  C  CG  . GLU B  1 313 ? 7.581   18.262  72.601  1.00 68.21  ? 313  GLU B CG  1 
ATOM   6598  C  CD  . GLU B  1 313 ? 8.314   16.950  72.278  1.00 81.57  ? 313  GLU B CD  1 
ATOM   6599  O  OE1 . GLU B  1 313 ? 9.335   16.993  71.552  1.00 87.33  ? 313  GLU B OE1 1 
ATOM   6600  O  OE2 . GLU B  1 313 ? 7.873   15.875  72.762  1.00 81.38  ? 313  GLU B OE2 1 
ATOM   6601  N  N   . ALA B  1 314 ? 9.896   21.661  72.552  1.00 48.36  ? 314  ALA B N   1 
ATOM   6602  C  CA  . ALA B  1 314 ? 11.090  22.204  73.196  1.00 48.38  ? 314  ALA B CA  1 
ATOM   6603  C  C   . ALA B  1 314 ? 10.812  23.418  74.080  1.00 49.35  ? 314  ALA B C   1 
ATOM   6604  O  O   . ALA B  1 314 ? 11.439  23.594  75.122  1.00 52.36  ? 314  ALA B O   1 
ATOM   6605  C  CB  . ALA B  1 314 ? 12.127  22.557  72.144  1.00 44.46  ? 314  ALA B CB  1 
ATOM   6606  N  N   . LEU B  1 315 ? 9.877   24.254  73.649  1.00 49.40  ? 315  LEU B N   1 
ATOM   6607  C  CA  . LEU B  1 315 ? 9.551   25.479  74.364  1.00 49.15  ? 315  LEU B CA  1 
ATOM   6608  C  C   . LEU B  1 315 ? 8.619   25.244  75.552  1.00 50.16  ? 315  LEU B C   1 
ATOM   6609  O  O   . LEU B  1 315 ? 8.622   26.021  76.510  1.00 56.88  ? 315  LEU B O   1 
ATOM   6610  C  CB  . LEU B  1 315 ? 8.933   26.493  73.408  1.00 46.79  ? 315  LEU B CB  1 
ATOM   6611  C  CG  . LEU B  1 315 ? 9.880   26.951  72.304  1.00 45.24  ? 315  LEU B CG  1 
ATOM   6612  C  CD1 . LEU B  1 315 ? 9.165   27.924  71.381  1.00 53.92  ? 315  LEU B CD1 1 
ATOM   6613  C  CD2 . LEU B  1 315 ? 11.118  27.582  72.909  1.00 33.67  ? 315  LEU B CD2 1 
ATOM   6614  N  N   . ILE B  1 316 ? 7.818   24.186  75.499  1.00 41.41  ? 316  ILE B N   1 
ATOM   6615  C  CA  . ILE B  1 316 ? 6.925   23.930  76.613  1.00 48.20  ? 316  ILE B CA  1 
ATOM   6616  C  C   . ILE B  1 316 ? 7.636   23.091  77.671  1.00 55.81  ? 316  ILE B C   1 
ATOM   6617  O  O   . ILE B  1 316 ? 7.317   23.168  78.860  1.00 57.49  ? 316  ILE B O   1 
ATOM   6618  C  CB  . ILE B  1 316 ? 5.557   23.310  76.193  1.00 47.41  ? 316  ILE B CB  1 
ATOM   6619  C  CG1 . ILE B  1 316 ? 5.696   21.854  75.772  1.00 54.95  ? 316  ILE B CG1 1 
ATOM   6620  C  CG2 . ILE B  1 316 ? 4.923   24.092  75.076  1.00 41.31  ? 316  ILE B CG2 1 
ATOM   6621  C  CD1 . ILE B  1 316 ? 4.363   21.213  75.490  1.00 58.72  ? 316  ILE B CD1 1 
ATOM   6622  N  N   . ASN B  1 317 ? 8.617   22.300  77.254  1.00 59.41  ? 317  ASN B N   1 
ATOM   6623  C  CA  . ASN B  1 317 ? 9.367   21.536  78.244  1.00 64.56  ? 317  ASN B CA  1 
ATOM   6624  C  C   . ASN B  1 317 ? 10.264  22.419  79.112  1.00 71.93  ? 317  ASN B C   1 
ATOM   6625  O  O   . ASN B  1 317 ? 10.380  22.199  80.314  1.00 80.40  ? 317  ASN B O   1 
ATOM   6626  C  CB  . ASN B  1 317 ? 10.163  20.401  77.599  1.00 65.59  ? 317  ASN B CB  1 
ATOM   6627  C  CG  . ASN B  1 317 ? 9.318   19.163  77.352  1.00 70.70  ? 317  ASN B CG  1 
ATOM   6628  O  OD1 . ASN B  1 317 ? 8.876   18.505  78.297  1.00 77.05  ? 317  ASN B OD1 1 
ATOM   6629  N  ND2 . ASN B  1 317 ? 9.098   18.833  76.084  1.00 65.39  ? 317  ASN B ND2 1 
ATOM   6630  N  N   . THR B  1 318 ? 10.877  23.433  78.511  1.00 69.55  ? 318  THR B N   1 
ATOM   6631  C  CA  . THR B  1 318 ? 11.819  24.282  79.236  1.00 65.25  ? 318  THR B CA  1 
ATOM   6632  C  C   . THR B  1 318 ? 11.304  25.699  79.472  1.00 73.21  ? 318  THR B C   1 
ATOM   6633  O  O   . THR B  1 318 ? 12.077  26.590  79.810  1.00 75.36  ? 318  THR B O   1 
ATOM   6634  C  CB  . THR B  1 318 ? 13.182  24.353  78.515  1.00 58.92  ? 318  THR B CB  1 
ATOM   6635  O  OG1 . THR B  1 318 ? 13.032  24.995  77.239  1.00 55.51  ? 318  THR B OG1 1 
ATOM   6636  C  CG2 . THR B  1 318 ? 13.735  22.960  78.309  1.00 57.24  ? 318  THR B CG2 1 
ATOM   6637  N  N   . GLY B  1 319 ? 10.001  25.905  79.308  1.00 80.07  ? 319  GLY B N   1 
ATOM   6638  C  CA  . GLY B  1 319 ? 9.417   27.226  79.460  1.00 84.94  ? 319  GLY B CA  1 
ATOM   6639  C  C   . GLY B  1 319 ? 9.493   27.766  80.877  1.00 90.38  ? 319  GLY B C   1 
ATOM   6640  O  O   . GLY B  1 319 ? 10.103  27.156  81.753  1.00 91.54  ? 319  GLY B O   1 
ATOM   6641  N  N   . ASP B  1 320 ? 8.888   28.930  81.095  1.00 95.32  ? 320  ASP B N   1 
ATOM   6642  C  CA  . ASP B  1 320 ? 8.770   29.493  82.437  1.00 103.40 ? 320  ASP B CA  1 
ATOM   6643  C  C   . ASP B  1 320 ? 7.422   30.198  82.556  1.00 101.70 ? 320  ASP B C   1 
ATOM   6644  O  O   . ASP B  1 320 ? 7.243   31.323  82.083  1.00 103.00 ? 320  ASP B O   1 
ATOM   6645  C  CB  . ASP B  1 320 ? 9.928   30.451  82.748  1.00 110.07 ? 320  ASP B CB  1 
ATOM   6646  C  CG  . ASP B  1 320 ? 10.122  30.676  84.248  1.00 113.88 ? 320  ASP B CG  1 
ATOM   6647  O  OD1 . ASP B  1 320 ? 9.110   30.726  84.990  1.00 116.60 ? 320  ASP B OD1 1 
ATOM   6648  O  OD2 . ASP B  1 320 ? 11.291  30.798  84.683  1.00 110.89 ? 320  ASP B OD2 1 
ATOM   6649  N  N   . PHE B  1 321 ? 6.475   29.523  83.194  1.00 95.53  ? 321  PHE B N   1 
ATOM   6650  C  CA  . PHE B  1 321 ? 5.088   29.949  83.147  1.00 87.51  ? 321  PHE B CA  1 
ATOM   6651  C  C   . PHE B  1 321 ? 4.525   30.276  84.520  1.00 94.44  ? 321  PHE B C   1 
ATOM   6652  O  O   . PHE B  1 321 ? 3.352   30.015  84.780  1.00 97.22  ? 321  PHE B O   1 
ATOM   6653  C  CB  . PHE B  1 321 ? 4.243   28.857  82.490  1.00 73.97  ? 321  PHE B CB  1 
ATOM   6654  C  CG  . PHE B  1 321 ? 4.756   28.422  81.141  1.00 64.92  ? 321  PHE B CG  1 
ATOM   6655  C  CD1 . PHE B  1 321 ? 5.110   29.356  80.182  1.00 67.86  ? 321  PHE B CD1 1 
ATOM   6656  C  CD2 . PHE B  1 321 ? 4.894   27.082  80.836  1.00 58.24  ? 321  PHE B CD2 1 
ATOM   6657  C  CE1 . PHE B  1 321 ? 5.586   28.958  78.943  1.00 66.34  ? 321  PHE B CE1 1 
ATOM   6658  C  CE2 . PHE B  1 321 ? 5.371   26.680  79.602  1.00 58.84  ? 321  PHE B CE2 1 
ATOM   6659  C  CZ  . PHE B  1 321 ? 5.715   27.617  78.652  1.00 61.05  ? 321  PHE B CZ  1 
ATOM   6660  N  N   . GLN B  1 322 ? 5.348   30.858  85.392  1.00 96.15  ? 322  GLN B N   1 
ATOM   6661  C  CA  . GLN B  1 322 ? 4.915   31.154  86.759  1.00 97.91  ? 322  GLN B CA  1 
ATOM   6662  C  C   . GLN B  1 322 ? 3.828   32.225  86.836  1.00 102.61 ? 322  GLN B C   1 
ATOM   6663  O  O   . GLN B  1 322 ? 3.178   32.391  87.870  1.00 105.55 ? 322  GLN B O   1 
ATOM   6664  C  CB  . GLN B  1 322 ? 6.102   31.528  87.653  1.00 98.22  ? 322  GLN B CB  1 
ATOM   6665  C  CG  . GLN B  1 322 ? 6.587   30.389  88.560  1.00 102.51 ? 322  GLN B CG  1 
ATOM   6666  C  CD  . GLN B  1 322 ? 5.537   29.920  89.580  1.00 103.20 ? 322  GLN B CD  1 
ATOM   6667  O  OE1 . GLN B  1 322 ? 4.597   30.650  89.912  1.00 105.68 ? 322  GLN B OE1 1 
ATOM   6668  N  NE2 . GLN B  1 322 ? 5.704   28.693  90.080  1.00 98.02  ? 322  GLN B NE2 1 
ATOM   6669  N  N   . ASP B  1 323 ? 3.625   32.938  85.736  1.00 108.10 ? 323  ASP B N   1 
ATOM   6670  C  CA  . ASP B  1 323 ? 2.669   34.039  85.701  1.00 117.57 ? 323  ASP B CA  1 
ATOM   6671  C  C   . ASP B  1 323 ? 1.649   33.862  84.572  1.00 110.43 ? 323  ASP B C   1 
ATOM   6672  O  O   . ASP B  1 323 ? 1.314   34.817  83.867  1.00 114.08 ? 323  ASP B O   1 
ATOM   6673  C  CB  . ASP B  1 323 ? 3.417   35.372  85.555  1.00 129.56 ? 323  ASP B CB  1 
ATOM   6674  C  CG  . ASP B  1 323 ? 4.535   35.311  84.513  1.00 137.64 ? 323  ASP B CG  1 
ATOM   6675  O  OD1 . ASP B  1 323 ? 4.916   34.191  84.102  1.00 139.59 ? 323  ASP B OD1 1 
ATOM   6676  O  OD2 . ASP B  1 323 ? 5.041   36.384  84.109  1.00 139.91 ? 323  ASP B OD2 1 
ATOM   6677  N  N   . LEU B  1 324 ? 1.146   32.641  84.413  1.00 95.96  ? 324  LEU B N   1 
ATOM   6678  C  CA  . LEU B  1 324 ? 0.256   32.326  83.300  1.00 80.72  ? 324  LEU B CA  1 
ATOM   6679  C  C   . LEU B  1 324 ? -1.016  31.614  83.744  1.00 72.77  ? 324  LEU B C   1 
ATOM   6680  O  O   . LEU B  1 324 ? -0.971  30.702  84.564  1.00 75.50  ? 324  LEU B O   1 
ATOM   6681  C  CB  . LEU B  1 324 ? 0.995   31.455  82.290  1.00 75.58  ? 324  LEU B CB  1 
ATOM   6682  C  CG  . LEU B  1 324 ? 0.297   31.181  80.960  1.00 68.84  ? 324  LEU B CG  1 
ATOM   6683  C  CD1 . LEU B  1 324 ? 0.115   32.470  80.179  1.00 65.73  ? 324  LEU B CD1 1 
ATOM   6684  C  CD2 . LEU B  1 324 ? 1.101   30.173  80.160  1.00 63.96  ? 324  LEU B CD2 1 
ATOM   6685  N  N   . GLN B  1 325 ? -2.150  32.024  83.192  1.00 66.36  ? 325  GLN B N   1 
ATOM   6686  C  CA  . GLN B  1 325 ? -3.407  31.343  83.472  1.00 69.45  ? 325  GLN B CA  1 
ATOM   6687  C  C   . GLN B  1 325 ? -4.015  30.762  82.199  1.00 74.74  ? 325  GLN B C   1 
ATOM   6688  O  O   . GLN B  1 325 ? -4.186  31.460  81.185  1.00 87.38  ? 325  GLN B O   1 
ATOM   6689  C  CB  . GLN B  1 325 ? -4.394  32.286  84.142  1.00 75.77  ? 325  GLN B CB  1 
ATOM   6690  C  CG  . GLN B  1 325 ? -3.795  33.118  85.251  1.00 79.11  ? 325  GLN B CG  1 
ATOM   6691  C  CD  . GLN B  1 325 ? -4.846  33.606  86.217  1.00 83.83  ? 325  GLN B CD  1 
ATOM   6692  O  OE1 . GLN B  1 325 ? -5.358  34.723  86.087  1.00 85.43  ? 325  GLN B OE1 1 
ATOM   6693  N  NE2 . GLN B  1 325 ? -5.189  32.762  87.194  1.00 84.30  ? 325  GLN B NE2 1 
ATOM   6694  N  N   . VAL B  1 326 ? -4.343  29.476  82.251  1.00 68.75  ? 326  VAL B N   1 
ATOM   6695  C  CA  . VAL B  1 326 ? -4.785  28.769  81.062  1.00 64.75  ? 326  VAL B CA  1 
ATOM   6696  C  C   . VAL B  1 326 ? -6.022  27.920  81.327  1.00 66.32  ? 326  VAL B C   1 
ATOM   6697  O  O   . VAL B  1 326 ? -6.091  27.206  82.320  1.00 72.98  ? 326  VAL B O   1 
ATOM   6698  C  CB  . VAL B  1 326 ? -3.686  27.849  80.527  1.00 63.76  ? 326  VAL B CB  1 
ATOM   6699  C  CG1 . VAL B  1 326 ? -4.091  27.311  79.189  1.00 71.25  ? 326  VAL B CG1 1 
ATOM   6700  C  CG2 . VAL B  1 326 ? -2.368  28.592  80.408  1.00 59.16  ? 326  VAL B CG2 1 
ATOM   6701  N  N   . LEU B  1 327 ? -6.996  28.006  80.429  1.00 59.46  ? 327  LEU B N   1 
ATOM   6702  C  CA  . LEU B  1 327 ? -8.153  27.128  80.442  1.00 56.97  ? 327  LEU B CA  1 
ATOM   6703  C  C   . LEU B  1 327 ? -8.147  26.274  79.171  1.00 58.61  ? 327  LEU B C   1 
ATOM   6704  O  O   . LEU B  1 327 ? -8.415  26.777  78.077  1.00 64.80  ? 327  LEU B O   1 
ATOM   6705  C  CB  . LEU B  1 327 ? -9.430  27.954  80.524  1.00 58.00  ? 327  LEU B CB  1 
ATOM   6706  C  CG  . LEU B  1 327 ? -10.731 27.218  80.206  1.00 61.60  ? 327  LEU B CG  1 
ATOM   6707  C  CD1 . LEU B  1 327 ? -10.969 26.110  81.203  1.00 56.94  ? 327  LEU B CD1 1 
ATOM   6708  C  CD2 . LEU B  1 327 ? -11.909 28.180  80.179  1.00 66.30  ? 327  LEU B CD2 1 
ATOM   6709  N  N   . VAL B  1 328 ? -7.821  24.990  79.310  1.00 55.07  ? 328  VAL B N   1 
ATOM   6710  C  CA  . VAL B  1 328 ? -7.735  24.093  78.158  1.00 47.84  ? 328  VAL B CA  1 
ATOM   6711  C  C   . VAL B  1 328 ? -8.751  22.987  78.228  1.00 54.25  ? 328  VAL B C   1 
ATOM   6712  O  O   . VAL B  1 328 ? -9.199  22.597  79.307  1.00 58.29  ? 328  VAL B O   1 
ATOM   6713  C  CB  . VAL B  1 328 ? -6.380  23.380  78.078  1.00 45.77  ? 328  VAL B CB  1 
ATOM   6714  C  CG1 . VAL B  1 328 ? -5.288  24.345  77.707  1.00 54.60  ? 328  VAL B CG1 1 
ATOM   6715  C  CG2 . VAL B  1 328 ? -6.081  22.712  79.390  1.00 46.69  ? 328  VAL B CG2 1 
ATOM   6716  N  N   . GLY B  1 329 ? -9.108  22.444  77.078  1.00 54.11  ? 329  GLY B N   1 
ATOM   6717  C  CA  . GLY B  1 329 ? -9.928  21.255  77.145  1.00 48.32  ? 329  GLY B CA  1 
ATOM   6718  C  C   . GLY B  1 329 ? -10.335 20.673  75.824  1.00 47.19  ? 329  GLY B C   1 
ATOM   6719  O  O   . GLY B  1 329 ? -10.126 21.276  74.780  1.00 55.77  ? 329  GLY B O   1 
ATOM   6720  N  N   . VAL B  1 330 ? -10.915 19.483  75.863  1.00 47.67  ? 330  VAL B N   1 
ATOM   6721  C  CA  . VAL B  1 330 ? -11.332 18.835  74.626  1.00 46.76  ? 330  VAL B CA  1 
ATOM   6722  C  C   . VAL B  1 330 ? -12.818 18.525  74.680  1.00 50.70  ? 330  VAL B C   1 
ATOM   6723  O  O   . VAL B  1 330 ? -13.450 18.715  75.716  1.00 54.67  ? 330  VAL B O   1 
ATOM   6724  C  CB  . VAL B  1 330 ? -10.556 17.535  74.369  1.00 45.14  ? 330  VAL B CB  1 
ATOM   6725  C  CG1 . VAL B  1 330 ? -9.073  17.796  74.391  1.00 64.14  ? 330  VAL B CG1 1 
ATOM   6726  C  CG2 . VAL B  1 330 ? -10.918 16.502  75.395  1.00 46.52  ? 330  VAL B CG2 1 
ATOM   6727  N  N   . VAL B  1 331 ? -13.371 18.057  73.562  1.00 49.70  ? 331  VAL B N   1 
ATOM   6728  C  CA  . VAL B  1 331 ? -14.759 17.597  73.525  1.00 52.16  ? 331  VAL B CA  1 
ATOM   6729  C  C   . VAL B  1 331 ? -14.799 16.066  73.434  1.00 55.13  ? 331  VAL B C   1 
ATOM   6730  O  O   . VAL B  1 331 ? -13.760 15.426  73.243  1.00 61.29  ? 331  VAL B O   1 
ATOM   6731  C  CB  . VAL B  1 331 ? -15.560 18.263  72.386  1.00 50.55  ? 331  VAL B CB  1 
ATOM   6732  C  CG1 . VAL B  1 331 ? -15.086 19.688  72.186  1.00 49.93  ? 331  VAL B CG1 1 
ATOM   6733  C  CG2 . VAL B  1 331 ? -15.429 17.486  71.104  1.00 49.00  ? 331  VAL B CG2 1 
ATOM   6734  N  N   . LYS B  1 332 ? -15.985 15.482  73.586  1.00 54.67  ? 332  LYS B N   1 
ATOM   6735  C  CA  . LYS B  1 332 ? -16.111 14.031  73.752  1.00 57.92  ? 332  LYS B CA  1 
ATOM   6736  C  C   . LYS B  1 332 ? -15.562 13.182  72.594  1.00 55.77  ? 332  LYS B C   1 
ATOM   6737  O  O   . LYS B  1 332 ? -14.848 12.210  72.827  1.00 61.21  ? 332  LYS B O   1 
ATOM   6738  C  CB  . LYS B  1 332 ? -17.556 13.637  74.085  1.00 68.58  ? 332  LYS B CB  1 
ATOM   6739  C  CG  . LYS B  1 332 ? -17.733 12.154  74.407  1.00 73.20  ? 332  LYS B CG  1 
ATOM   6740  C  CD  . LYS B  1 332 ? -19.176 11.810  74.770  1.00 72.31  ? 332  LYS B CD  1 
ATOM   6741  C  CE  . LYS B  1 332 ? -19.434 10.309  74.632  1.00 71.98  ? 332  LYS B CE  1 
ATOM   6742  N  NZ  . LYS B  1 332 ? -19.476 9.879   73.196  1.00 71.41  ? 332  LYS B NZ  1 
ATOM   6743  N  N   . ASP B  1 333 ? -15.877 13.539  71.354  1.00 51.49  ? 333  ASP B N   1 
ATOM   6744  C  CA  . ASP B  1 333 ? -15.367 12.760  70.226  1.00 58.58  ? 333  ASP B CA  1 
ATOM   6745  C  C   . ASP B  1 333 ? -14.555 13.589  69.220  1.00 56.96  ? 333  ASP B C   1 
ATOM   6746  O  O   . ASP B  1 333 ? -15.052 13.963  68.153  1.00 47.57  ? 333  ASP B O   1 
ATOM   6747  C  CB  . ASP B  1 333 ? -16.507 12.019  69.540  1.00 66.44  ? 333  ASP B CB  1 
ATOM   6748  C  CG  . ASP B  1 333 ? -17.400 11.307  70.528  1.00 77.94  ? 333  ASP B CG  1 
ATOM   6749  O  OD1 . ASP B  1 333 ? -16.996 10.220  71.003  1.00 80.67  ? 333  ASP B OD1 1 
ATOM   6750  O  OD2 . ASP B  1 333 ? -18.491 11.842  70.840  1.00 79.95  ? 333  ASP B OD2 1 
ATOM   6751  N  N   . GLU B  1 334 ? -13.294 13.848  69.564  1.00 55.71  ? 334  GLU B N   1 
ATOM   6752  C  CA  . GLU B  1 334 ? -12.456 14.748  68.781  1.00 47.13  ? 334  GLU B CA  1 
ATOM   6753  C  C   . GLU B  1 334 ? -12.173 14.246  67.378  1.00 42.32  ? 334  GLU B C   1 
ATOM   6754  O  O   . GLU B  1 334 ? -12.065 15.041  66.446  1.00 40.05  ? 334  GLU B O   1 
ATOM   6755  C  CB  . GLU B  1 334 ? -11.149 15.022  69.513  1.00 54.73  ? 334  GLU B CB  1 
ATOM   6756  C  CG  . GLU B  1 334 ? -11.332 15.862  70.757  1.00 68.58  ? 334  GLU B CG  1 
ATOM   6757  C  CD  . GLU B  1 334 ? -11.693 17.296  70.424  1.00 72.88  ? 334  GLU B CD  1 
ATOM   6758  O  OE1 . GLU B  1 334 ? -11.355 17.733  69.305  1.00 75.04  ? 334  GLU B OE1 1 
ATOM   6759  O  OE2 . GLU B  1 334 ? -12.309 17.982  71.271  1.00 69.96  ? 334  GLU B OE2 1 
ATOM   6760  N  N   . GLY B  1 335 ? -12.072 12.931  67.220  1.00 40.60  ? 335  GLY B N   1 
ATOM   6761  C  CA  . GLY B  1 335 ? -11.671 12.364  65.945  1.00 48.82  ? 335  GLY B CA  1 
ATOM   6762  C  C   . GLY B  1 335 ? -12.752 12.102  64.909  1.00 51.93  ? 335  GLY B C   1 
ATOM   6763  O  O   . GLY B  1 335 ? -12.446 11.982  63.721  1.00 53.21  ? 335  GLY B O   1 
ATOM   6764  N  N   . SER B  1 336 ? -14.008 12.023  65.342  1.00 49.77  ? 336  SER B N   1 
ATOM   6765  C  CA  . SER B  1 336 ? -15.082 11.524  64.489  1.00 47.96  ? 336  SER B CA  1 
ATOM   6766  C  C   . SER B  1 336 ? -15.368 12.389  63.268  1.00 49.47  ? 336  SER B C   1 
ATOM   6767  O  O   . SER B  1 336 ? -15.715 11.873  62.202  1.00 56.31  ? 336  SER B O   1 
ATOM   6768  C  CB  . SER B  1 336 ? -16.361 11.352  65.296  1.00 56.29  ? 336  SER B CB  1 
ATOM   6769  O  OG  . SER B  1 336 ? -16.903 12.606  65.654  1.00 62.54  ? 336  SER B OG  1 
ATOM   6770  N  N   . TYR B  1 337 ? -15.233 13.701  63.428  1.00 45.46  ? 337  TYR B N   1 
ATOM   6771  C  CA  . TYR B  1 337 ? -15.476 14.640  62.336  1.00 46.46  ? 337  TYR B CA  1 
ATOM   6772  C  C   . TYR B  1 337 ? -14.604 14.349  61.122  1.00 50.23  ? 337  TYR B C   1 
ATOM   6773  O  O   . TYR B  1 337 ? -15.042 14.481  59.988  1.00 56.86  ? 337  TYR B O   1 
ATOM   6774  C  CB  . TYR B  1 337 ? -15.207 16.070  62.802  1.00 49.55  ? 337  TYR B CB  1 
ATOM   6775  C  CG  . TYR B  1 337 ? -15.593 17.127  61.799  1.00 55.72  ? 337  TYR B CG  1 
ATOM   6776  C  CD1 . TYR B  1 337 ? -14.720 17.520  60.786  1.00 56.45  ? 337  TYR B CD1 1 
ATOM   6777  C  CD2 . TYR B  1 337 ? -16.833 17.741  61.871  1.00 64.52  ? 337  TYR B CD2 1 
ATOM   6778  C  CE1 . TYR B  1 337 ? -15.089 18.495  59.866  1.00 66.97  ? 337  TYR B CE1 1 
ATOM   6779  C  CE2 . TYR B  1 337 ? -17.210 18.711  60.964  1.00 70.66  ? 337  TYR B CE2 1 
ATOM   6780  C  CZ  . TYR B  1 337 ? -16.345 19.086  59.964  1.00 74.42  ? 337  TYR B CZ  1 
ATOM   6781  O  OH  . TYR B  1 337 ? -16.754 20.054  59.072  1.00 78.32  ? 337  TYR B OH  1 
ATOM   6782  N  N   . PHE B  1 338 ? -13.365 13.948  61.370  1.00 38.72  ? 338  PHE B N   1 
ATOM   6783  C  CA  . PHE B  1 338 ? -12.362 13.906  60.330  1.00 39.42  ? 338  PHE B CA  1 
ATOM   6784  C  C   . PHE B  1 338 ? -12.416 12.625  59.533  1.00 49.02  ? 338  PHE B C   1 
ATOM   6785  O  O   . PHE B  1 338 ? -11.826 12.527  58.460  1.00 57.13  ? 338  PHE B O   1 
ATOM   6786  C  CB  . PHE B  1 338 ? -10.984 14.085  60.954  1.00 39.30  ? 338  PHE B CB  1 
ATOM   6787  C  CG  . PHE B  1 338 ? -10.835 15.377  61.698  1.00 49.19  ? 338  PHE B CG  1 
ATOM   6788  C  CD1 . PHE B  1 338 ? -11.227 15.478  63.024  1.00 51.85  ? 338  PHE B CD1 1 
ATOM   6789  C  CD2 . PHE B  1 338 ? -10.329 16.503  61.063  1.00 53.45  ? 338  PHE B CD2 1 
ATOM   6790  C  CE1 . PHE B  1 338 ? -11.104 16.674  63.706  1.00 54.99  ? 338  PHE B CE1 1 
ATOM   6791  C  CE2 . PHE B  1 338 ? -10.203 17.703  61.740  1.00 53.44  ? 338  PHE B CE2 1 
ATOM   6792  C  CZ  . PHE B  1 338 ? -10.591 17.790  63.064  1.00 55.48  ? 338  PHE B CZ  1 
ATOM   6793  N  N   . LEU B  1 339 ? -13.129 11.638  60.051  1.00 50.36  ? 339  LEU B N   1 
ATOM   6794  C  CA  . LEU B  1 339 ? -13.133 10.325  59.424  1.00 49.66  ? 339  LEU B CA  1 
ATOM   6795  C  C   . LEU B  1 339 ? -13.807 10.355  58.053  1.00 48.93  ? 339  LEU B C   1 
ATOM   6796  O  O   . LEU B  1 339 ? -13.417 9.631   57.131  1.00 42.49  ? 339  LEU B O   1 
ATOM   6797  C  CB  . LEU B  1 339 ? -13.787 9.301   60.352  1.00 49.72  ? 339  LEU B CB  1 
ATOM   6798  C  CG  . LEU B  1 339 ? -13.019 9.139   61.665  1.00 47.23  ? 339  LEU B CG  1 
ATOM   6799  C  CD1 . LEU B  1 339 ? -13.709 8.153   62.576  1.00 48.16  ? 339  LEU B CD1 1 
ATOM   6800  C  CD2 . LEU B  1 339 ? -11.577 8.713   61.389  1.00 44.50  ? 339  LEU B CD2 1 
ATOM   6801  N  N   . VAL B  1 340 ? -14.801 11.221  57.916  1.00 55.11  ? 340  VAL B N   1 
ATOM   6802  C  CA  . VAL B  1 340 ? -15.588 11.270  56.697  1.00 55.92  ? 340  VAL B CA  1 
ATOM   6803  C  C   . VAL B  1 340 ? -14.756 11.813  55.539  1.00 59.41  ? 340  VAL B C   1 
ATOM   6804  O  O   . VAL B  1 340 ? -15.029 11.520  54.368  1.00 62.10  ? 340  VAL B O   1 
ATOM   6805  C  CB  . VAL B  1 340 ? -16.850 12.112  56.899  1.00 52.46  ? 340  VAL B CB  1 
ATOM   6806  C  CG1 . VAL B  1 340 ? -17.578 11.665  58.170  1.00 56.07  ? 340  VAL B CG1 1 
ATOM   6807  C  CG2 . VAL B  1 340 ? -16.485 13.569  56.993  1.00 47.47  ? 340  VAL B CG2 1 
ATOM   6808  N  N   . TYR B  1 341 ? -13.726 12.585  55.876  1.00 55.60  ? 341  TYR B N   1 
ATOM   6809  C  CA  . TYR B  1 341 ? -12.872 13.186  54.868  1.00 51.69  ? 341  TYR B CA  1 
ATOM   6810  C  C   . TYR B  1 341 ? -11.780 12.226  54.441  1.00 58.70  ? 341  TYR B C   1 
ATOM   6811  O  O   . TYR B  1 341 ? -10.604 12.494  54.656  1.00 63.14  ? 341  TYR B O   1 
ATOM   6812  C  CB  . TYR B  1 341 ? -12.220 14.459  55.399  1.00 47.01  ? 341  TYR B CB  1 
ATOM   6813  C  CG  . TYR B  1 341 ? -13.158 15.623  55.580  1.00 44.70  ? 341  TYR B CG  1 
ATOM   6814  C  CD1 . TYR B  1 341 ? -13.390 16.521  54.548  1.00 48.12  ? 341  TYR B CD1 1 
ATOM   6815  C  CD2 . TYR B  1 341 ? -13.794 15.838  56.787  1.00 51.43  ? 341  TYR B CD2 1 
ATOM   6816  C  CE1 . TYR B  1 341 ? -14.243 17.597  54.713  1.00 55.40  ? 341  TYR B CE1 1 
ATOM   6817  C  CE2 . TYR B  1 341 ? -14.653 16.910  56.963  1.00 58.16  ? 341  TYR B CE2 1 
ATOM   6818  C  CZ  . TYR B  1 341 ? -14.878 17.785  55.925  1.00 58.80  ? 341  TYR B CZ  1 
ATOM   6819  O  OH  . TYR B  1 341 ? -15.735 18.851  56.105  1.00 59.24  ? 341  TYR B OH  1 
ATOM   6820  N  N   . GLY B  1 342 ? -12.162 11.103  53.850  1.00 63.69  ? 342  GLY B N   1 
ATOM   6821  C  CA  . GLY B  1 342 ? -11.190 10.252  53.195  1.00 68.24  ? 342  GLY B CA  1 
ATOM   6822  C  C   . GLY B  1 342 ? -10.604 9.119   54.011  1.00 71.87  ? 342  GLY B C   1 
ATOM   6823  O  O   . GLY B  1 342 ? -9.509  8.630   53.716  1.00 79.16  ? 342  GLY B O   1 
ATOM   6824  N  N   . VAL B  1 343 ? -11.309 8.701   55.051  1.00 63.22  ? 343  VAL B N   1 
ATOM   6825  C  CA  . VAL B  1 343 ? -11.027 7.398   55.621  1.00 55.13  ? 343  VAL B CA  1 
ATOM   6826  C  C   . VAL B  1 343 ? -12.107 6.503   55.045  1.00 57.20  ? 343  VAL B C   1 
ATOM   6827  O  O   . VAL B  1 343 ? -13.251 6.540   55.502  1.00 63.89  ? 343  VAL B O   1 
ATOM   6828  C  CB  . VAL B  1 343 ? -11.092 7.389   57.156  1.00 49.11  ? 343  VAL B CB  1 
ATOM   6829  C  CG1 . VAL B  1 343 ? -10.529 6.093   57.702  1.00 42.26  ? 343  VAL B CG1 1 
ATOM   6830  C  CG2 . VAL B  1 343 ? -10.331 8.554   57.724  1.00 48.86  ? 343  VAL B CG2 1 
ATOM   6831  N  N   . PRO B  1 344 ? -11.758 5.729   54.005  1.00 50.96  ? 344  PRO B N   1 
ATOM   6832  C  CA  . PRO B  1 344 ? -12.702 4.817   53.358  1.00 51.02  ? 344  PRO B CA  1 
ATOM   6833  C  C   . PRO B  1 344 ? -13.359 3.930   54.393  1.00 53.68  ? 344  PRO B C   1 
ATOM   6834  O  O   . PRO B  1 344 ? -12.685 3.099   55.004  1.00 59.71  ? 344  PRO B O   1 
ATOM   6835  C  CB  . PRO B  1 344 ? -11.813 3.976   52.434  1.00 48.28  ? 344  PRO B CB  1 
ATOM   6836  C  CG  . PRO B  1 344 ? -10.420 4.186   52.929  1.00 48.00  ? 344  PRO B CG  1 
ATOM   6837  C  CD  . PRO B  1 344 ? -10.400 5.580   53.463  1.00 46.94  ? 344  PRO B CD  1 
ATOM   6838  N  N   . GLY B  1 345 ? -14.655 4.138   54.598  1.00 48.95  ? 345  GLY B N   1 
ATOM   6839  C  CA  . GLY B  1 345 ? -15.418 3.383   55.563  1.00 53.32  ? 345  GLY B CA  1 
ATOM   6840  C  C   . GLY B  1 345 ? -16.464 4.281   56.183  1.00 67.01  ? 345  GLY B C   1 
ATOM   6841  O  O   . GLY B  1 345 ? -17.574 3.847   56.510  1.00 77.71  ? 345  GLY B O   1 
ATOM   6842  N  N   . PHE B  1 346 ? -16.119 5.552   56.329  1.00 64.70  ? 346  PHE B N   1 
ATOM   6843  C  CA  . PHE B  1 346 ? -16.981 6.465   57.060  1.00 66.69  ? 346  PHE B CA  1 
ATOM   6844  C  C   . PHE B  1 346 ? -17.681 7.446   56.137  1.00 68.80  ? 346  PHE B C   1 
ATOM   6845  O  O   . PHE B  1 346 ? -17.088 7.981   55.195  1.00 69.84  ? 346  PHE B O   1 
ATOM   6846  C  CB  . PHE B  1 346 ? -16.198 7.216   58.139  1.00 64.68  ? 346  PHE B CB  1 
ATOM   6847  C  CG  . PHE B  1 346 ? -15.408 6.319   59.047  1.00 60.09  ? 346  PHE B CG  1 
ATOM   6848  C  CD1 . PHE B  1 346 ? -14.189 5.771   58.628  1.00 52.05  ? 346  PHE B CD1 1 
ATOM   6849  C  CD2 . PHE B  1 346 ? -15.875 6.027   60.318  1.00 60.90  ? 346  PHE B CD2 1 
ATOM   6850  C  CE1 . PHE B  1 346 ? -13.458 4.941   59.450  1.00 49.74  ? 346  PHE B CE1 1 
ATOM   6851  C  CE2 . PHE B  1 346 ? -15.149 5.201   61.153  1.00 65.72  ? 346  PHE B CE2 1 
ATOM   6852  C  CZ  . PHE B  1 346 ? -13.928 4.656   60.714  1.00 61.21  ? 346  PHE B CZ  1 
ATOM   6853  N  N   . SER B  1 347 ? -18.958 7.653   56.425  1.00 66.60  ? 347  SER B N   1 
ATOM   6854  C  CA  . SER B  1 347 ? -19.783 8.611   55.726  1.00 67.31  ? 347  SER B CA  1 
ATOM   6855  C  C   . SER B  1 347 ? -20.709 9.202   56.774  1.00 67.04  ? 347  SER B C   1 
ATOM   6856  O  O   . SER B  1 347 ? -20.831 8.665   57.867  1.00 68.46  ? 347  SER B O   1 
ATOM   6857  C  CB  . SER B  1 347 ? -20.582 7.904   54.631  1.00 77.73  ? 347  SER B CB  1 
ATOM   6858  O  OG  . SER B  1 347 ? -21.562 8.754   54.055  1.00 86.49  ? 347  SER B OG  1 
ATOM   6859  N  N   . LYS B  1 348 ? -21.352 10.314  56.456  1.00 71.94  ? 348  LYS B N   1 
ATOM   6860  C  CA  . LYS B  1 348 ? -22.313 10.898  57.373  1.00 78.26  ? 348  LYS B CA  1 
ATOM   6861  C  C   . LYS B  1 348 ? -23.675 10.288  57.104  1.00 91.80  ? 348  LYS B C   1 
ATOM   6862  O  O   . LYS B  1 348 ? -24.648 10.550  57.813  1.00 102.10 ? 348  LYS B O   1 
ATOM   6863  C  CB  . LYS B  1 348 ? -22.392 12.413  57.192  1.00 75.89  ? 348  LYS B CB  1 
ATOM   6864  C  CG  . LYS B  1 348 ? -23.121 12.825  55.930  1.00 72.42  ? 348  LYS B CG  1 
ATOM   6865  C  CD  . LYS B  1 348 ? -23.515 14.279  55.955  1.00 70.66  ? 348  LYS B CD  1 
ATOM   6866  C  CE  . LYS B  1 348 ? -24.473 14.570  54.821  1.00 77.63  ? 348  LYS B CE  1 
ATOM   6867  N  NZ  . LYS B  1 348 ? -25.691 13.706  54.900  1.00 82.94  ? 348  LYS B NZ  1 
ATOM   6868  N  N   . ASP B  1 349 ? -23.751 9.476   56.060  1.00 94.99  ? 349  ASP B N   1 
ATOM   6869  C  CA  . ASP B  1 349 ? -25.024 8.890   55.670  1.00 102.05 ? 349  ASP B CA  1 
ATOM   6870  C  C   . ASP B  1 349 ? -25.363 7.678   56.541  1.00 104.34 ? 349  ASP B C   1 
ATOM   6871  O  O   . ASP B  1 349 ? -26.260 7.753   57.390  1.00 105.84 ? 349  ASP B O   1 
ATOM   6872  C  CB  . ASP B  1 349 ? -25.006 8.549   54.181  1.00 100.29 ? 349  ASP B CB  1 
ATOM   6873  C  CG  . ASP B  1 349 ? -24.731 9.770   53.313  1.00 94.16  ? 349  ASP B CG  1 
ATOM   6874  O  OD1 . ASP B  1 349 ? -25.207 10.873  53.673  1.00 86.18  ? 349  ASP B OD1 1 
ATOM   6875  O  OD2 . ASP B  1 349 ? -24.034 9.627   52.282  1.00 94.89  ? 349  ASP B OD2 1 
ATOM   6876  N  N   . ASN B  1 350 ? -24.632 6.580   56.348  1.00 97.95  ? 350  ASN B N   1 
ATOM   6877  C  CA  . ASN B  1 350 ? -24.801 5.389   57.175  1.00 93.67  ? 350  ASN B CA  1 
ATOM   6878  C  C   . ASN B  1 350 ? -24.150 5.545   58.550  1.00 92.92  ? 350  ASN B C   1 
ATOM   6879  O  O   . ASN B  1 350 ? -23.745 6.640   58.927  1.00 91.38  ? 350  ASN B O   1 
ATOM   6880  C  CB  . ASN B  1 350 ? -24.277 4.149   56.450  1.00 94.48  ? 350  ASN B CB  1 
ATOM   6881  C  CG  . ASN B  1 350 ? -22.868 4.329   55.914  1.00 99.13  ? 350  ASN B CG  1 
ATOM   6882  O  OD1 . ASN B  1 350 ? -22.036 4.988   56.535  1.00 98.95  ? 350  ASN B OD1 1 
ATOM   6883  N  ND2 . ASN B  1 350 ? -22.597 3.729   54.745  1.00 107.78 ? 350  ASN B ND2 1 
ATOM   6884  N  N   . GLU B  1 351 ? -24.058 4.456   59.305  1.00 97.69  ? 351  GLU B N   1 
ATOM   6885  C  CA  . GLU B  1 351 ? -23.466 4.523   60.640  1.00 97.01  ? 351  GLU B CA  1 
ATOM   6886  C  C   . GLU B  1 351 ? -22.044 3.965   60.676  1.00 85.90  ? 351  GLU B C   1 
ATOM   6887  O  O   . GLU B  1 351 ? -21.517 3.654   61.745  1.00 86.74  ? 351  GLU B O   1 
ATOM   6888  C  CB  . GLU B  1 351 ? -24.352 3.842   61.695  1.00 106.28 ? 351  GLU B CB  1 
ATOM   6889  C  CG  . GLU B  1 351 ? -25.676 3.282   61.181  1.00 110.43 ? 351  GLU B CG  1 
ATOM   6890  C  CD  . GLU B  1 351 ? -25.601 1.794   60.866  1.00 110.71 ? 351  GLU B CD  1 
ATOM   6891  O  OE1 . GLU B  1 351 ? -24.655 1.375   60.158  1.00 112.29 ? 351  GLU B OE1 1 
ATOM   6892  O  OE2 . GLU B  1 351 ? -26.486 1.043   61.334  1.00 106.65 ? 351  GLU B OE2 1 
ATOM   6893  N  N   . SER B  1 352 ? -21.438 3.839   59.498  1.00 78.70  ? 352  SER B N   1 
ATOM   6894  C  CA  . SER B  1 352 ? -20.005 3.561   59.366  1.00 68.97  ? 352  SER B CA  1 
ATOM   6895  C  C   . SER B  1 352 ? -19.525 2.333   60.134  1.00 62.07  ? 352  SER B C   1 
ATOM   6896  O  O   . SER B  1 352 ? -18.600 2.419   60.937  1.00 56.03  ? 352  SER B O   1 
ATOM   6897  C  CB  . SER B  1 352 ? -19.202 4.784   59.806  1.00 66.32  ? 352  SER B CB  1 
ATOM   6898  O  OG  . SER B  1 352 ? -19.657 5.948   59.143  1.00 64.68  ? 352  SER B OG  1 
ATOM   6899  N  N   . LEU B  1 353 ? -20.164 1.195   59.892  1.00 65.97  ? 353  LEU B N   1 
ATOM   6900  C  CA  . LEU B  1 353 ? -19.775 -0.048  60.544  1.00 64.35  ? 353  LEU B CA  1 
ATOM   6901  C  C   . LEU B  1 353 ? -18.707 -0.693  59.703  1.00 71.62  ? 353  LEU B C   1 
ATOM   6902  O  O   . LEU B  1 353 ? -18.976 -1.585  58.898  1.00 80.27  ? 353  LEU B O   1 
ATOM   6903  C  CB  . LEU B  1 353 ? -20.967 -0.980  60.700  1.00 60.49  ? 353  LEU B CB  1 
ATOM   6904  C  CG  . LEU B  1 353 ? -22.063 -0.290  61.506  1.00 66.03  ? 353  LEU B CG  1 
ATOM   6905  C  CD1 . LEU B  1 353 ? -23.312 -1.156  61.608  1.00 72.04  ? 353  LEU B CD1 1 
ATOM   6906  C  CD2 . LEU B  1 353 ? -21.524 0.078   62.878  1.00 63.61  ? 353  LEU B CD2 1 
ATOM   6907  N  N   . ILE B  1 354 ? -17.485 -0.226  59.912  1.00 64.14  ? 354  ILE B N   1 
ATOM   6908  C  CA  . ILE B  1 354 ? -16.371 -0.551  59.052  1.00 55.11  ? 354  ILE B CA  1 
ATOM   6909  C  C   . ILE B  1 354 ? -15.832 -1.979  59.222  1.00 60.56  ? 354  ILE B C   1 
ATOM   6910  O  O   . ILE B  1 354 ? -16.166 -2.694  60.176  1.00 61.67  ? 354  ILE B O   1 
ATOM   6911  C  CB  . ILE B  1 354 ? -15.266 0.459   59.281  1.00 48.40  ? 354  ILE B CB  1 
ATOM   6912  C  CG1 . ILE B  1 354 ? -14.640 0.247   60.656  1.00 49.10  ? 354  ILE B CG1 1 
ATOM   6913  C  CG2 . ILE B  1 354 ? -15.846 1.843   59.240  1.00 44.70  ? 354  ILE B CG2 1 
ATOM   6914  C  CD1 . ILE B  1 354 ? -13.286 0.907   60.814  1.00 45.21  ? 354  ILE B CD1 1 
ATOM   6915  N  N   . SER B  1 355 ? -15.003 -2.380  58.263  1.00 63.48  ? 355  SER B N   1 
ATOM   6916  C  CA  . SER B  1 355 ? -14.338 -3.676  58.269  1.00 67.27  ? 355  SER B CA  1 
ATOM   6917  C  C   . SER B  1 355 ? -13.067 -3.609  59.093  1.00 64.71  ? 355  SER B C   1 
ATOM   6918  O  O   . SER B  1 355 ? -12.588 -2.523  59.408  1.00 61.24  ? 355  SER B O   1 
ATOM   6919  C  CB  . SER B  1 355 ? -13.989 -4.082  56.833  1.00 74.11  ? 355  SER B CB  1 
ATOM   6920  O  OG  . SER B  1 355 ? -12.847 -4.920  56.797  1.00 78.12  ? 355  SER B OG  1 
ATOM   6921  N  N   . ARG B  1 356 ? -12.509 -4.770  59.425  1.00 68.14  ? 356  ARG B N   1 
ATOM   6922  C  CA  . ARG B  1 356 ? -11.228 -4.803  60.132  1.00 64.92  ? 356  ARG B CA  1 
ATOM   6923  C  C   . ARG B  1 356 ? -10.033 -4.268  59.319  1.00 58.95  ? 356  ARG B C   1 
ATOM   6924  O  O   . ARG B  1 356 ? -9.310  -3.414  59.808  1.00 53.38  ? 356  ARG B O   1 
ATOM   6925  C  CB  . ARG B  1 356 ? -10.926 -6.187  60.712  1.00 65.23  ? 356  ARG B CB  1 
ATOM   6926  C  CG  . ARG B  1 356 ? -9.513  -6.278  61.272  1.00 64.11  ? 356  ARG B CG  1 
ATOM   6927  C  CD  . ARG B  1 356 ? -9.396  -7.133  62.530  1.00 66.06  ? 356  ARG B CD  1 
ATOM   6928  N  NE  . ARG B  1 356 ? -8.107  -6.888  63.171  1.00 64.18  ? 356  ARG B NE  1 
ATOM   6929  C  CZ  . ARG B  1 356 ? -7.932  -6.083  64.215  1.00 57.64  ? 356  ARG B CZ  1 
ATOM   6930  N  NH1 . ARG B  1 356 ? -8.979  -5.468  64.757  1.00 46.82  ? 356  ARG B NH1 1 
ATOM   6931  N  NH2 . ARG B  1 356 ? -6.711  -5.900  64.719  1.00 53.63  ? 356  ARG B NH2 1 
ATOM   6932  N  N   . ALA B  1 357 ? -9.827  -4.754  58.094  1.00 58.15  ? 357  ALA B N   1 
ATOM   6933  C  CA  . ALA B  1 357 ? -8.753  -4.230  57.241  1.00 48.88  ? 357  ALA B CA  1 
ATOM   6934  C  C   . ALA B  1 357 ? -9.006  -2.772  56.874  1.00 47.48  ? 357  ALA B C   1 
ATOM   6935  O  O   . ALA B  1 357 ? -8.062  -2.009  56.594  1.00 49.70  ? 357  ALA B O   1 
ATOM   6936  C  CB  . ALA B  1 357 ? -8.580  -5.076  55.987  1.00 41.07  ? 357  ALA B CB  1 
ATOM   6937  N  N   . GLN B  1 358 ? -10.283 -2.393  56.874  1.00 40.66  ? 358  GLN B N   1 
ATOM   6938  C  CA  . GLN B  1 358 ? -10.661 -1.002  56.704  1.00 41.99  ? 358  GLN B CA  1 
ATOM   6939  C  C   . GLN B  1 358 ? -10.071 -0.194  57.846  1.00 45.26  ? 358  GLN B C   1 
ATOM   6940  O  O   . GLN B  1 358 ? -9.437  0.843   57.633  1.00 44.18  ? 358  GLN B O   1 
ATOM   6941  C  CB  . GLN B  1 358 ? -12.173 -0.852  56.711  1.00 46.00  ? 358  GLN B CB  1 
ATOM   6942  C  CG  . GLN B  1 358 ? -12.834 -1.046  55.368  1.00 47.83  ? 358  GLN B CG  1 
ATOM   6943  C  CD  . GLN B  1 358 ? -14.292 -0.622  55.385  1.00 47.47  ? 358  GLN B CD  1 
ATOM   6944  O  OE1 . GLN B  1 358 ? -15.091 -1.129  56.171  1.00 48.34  ? 358  GLN B OE1 1 
ATOM   6945  N  NE2 . GLN B  1 358 ? -14.640 0.325   54.526  1.00 42.36  ? 358  GLN B NE2 1 
ATOM   6946  N  N   . PHE B  1 359 ? -10.290 -0.678  59.064  1.00 45.55  ? 359  PHE B N   1 
ATOM   6947  C  CA  . PHE B  1 359 ? -9.694  -0.081  60.250  1.00 45.24  ? 359  PHE B CA  1 
ATOM   6948  C  C   . PHE B  1 359 ? -8.174  0.000   60.099  1.00 42.37  ? 359  PHE B C   1 
ATOM   6949  O  O   . PHE B  1 359 ? -7.581  1.068   60.232  1.00 45.99  ? 359  PHE B O   1 
ATOM   6950  C  CB  . PHE B  1 359 ? -10.071 -0.901  61.483  1.00 47.48  ? 359  PHE B CB  1 
ATOM   6951  C  CG  . PHE B  1 359 ? -9.428  -0.434  62.749  1.00 47.72  ? 359  PHE B CG  1 
ATOM   6952  C  CD1 . PHE B  1 359 ? -10.024 0.547   63.516  1.00 45.62  ? 359  PHE B CD1 1 
ATOM   6953  C  CD2 . PHE B  1 359 ? -8.232  -0.991  63.181  1.00 45.52  ? 359  PHE B CD2 1 
ATOM   6954  C  CE1 . PHE B  1 359 ? -9.439  0.968   64.680  1.00 47.70  ? 359  PHE B CE1 1 
ATOM   6955  C  CE2 . PHE B  1 359 ? -7.636  -0.573  64.347  1.00 42.10  ? 359  PHE B CE2 1 
ATOM   6956  C  CZ  . PHE B  1 359 ? -8.238  0.406   65.097  1.00 46.92  ? 359  PHE B CZ  1 
ATOM   6957  N  N   . LEU B  1 360 ? -7.553  -1.129  59.789  1.00 38.65  ? 360  LEU B N   1 
ATOM   6958  C  CA  . LEU B  1 360 ? -6.102  -1.204  59.657  1.00 42.66  ? 360  LEU B CA  1 
ATOM   6959  C  C   . LEU B  1 360 ? -5.546  -0.236  58.614  1.00 46.97  ? 360  LEU B C   1 
ATOM   6960  O  O   . LEU B  1 360 ? -4.372  0.136   58.679  1.00 49.10  ? 360  LEU B O   1 
ATOM   6961  C  CB  . LEU B  1 360 ? -5.663  -2.634  59.329  1.00 38.45  ? 360  LEU B CB  1 
ATOM   6962  C  CG  . LEU B  1 360 ? -6.285  -3.727  60.199  1.00 37.91  ? 360  LEU B CG  1 
ATOM   6963  C  CD1 . LEU B  1 360 ? -5.770  -5.108  59.825  1.00 38.73  ? 360  LEU B CD1 1 
ATOM   6964  C  CD2 . LEU B  1 360 ? -6.040  -3.440  61.664  1.00 40.51  ? 360  LEU B CD2 1 
ATOM   6965  N  N   . ALA B  1 361 ? -6.379  0.154   57.651  1.00 44.24  ? 361  ALA B N   1 
ATOM   6966  C  CA  . ALA B  1 361 ? -5.967  1.133   56.645  1.00 41.13  ? 361  ALA B CA  1 
ATOM   6967  C  C   . ALA B  1 361 ? -6.127  2.548   57.198  1.00 42.75  ? 361  ALA B C   1 
ATOM   6968  O  O   . ALA B  1 361 ? -5.268  3.453   56.998  1.00 42.35  ? 361  ALA B O   1 
ATOM   6969  C  CB  . ALA B  1 361 ? -6.798  0.964   55.402  1.00 37.76  ? 361  ALA B CB  1 
ATOM   6970  N  N   . GLY B  1 362 ? -7.248  2.714   57.897  1.00 36.83  ? 362  GLY B N   1 
ATOM   6971  C  CA  . GLY B  1 362 ? -7.617  3.958   58.531  1.00 33.13  ? 362  GLY B CA  1 
ATOM   6972  C  C   . GLY B  1 362 ? -6.587  4.398   59.543  1.00 34.79  ? 362  GLY B C   1 
ATOM   6973  O  O   . GLY B  1 362 ? -6.376  5.580   59.718  1.00 30.31  ? 362  GLY B O   1 
ATOM   6974  N  N   . VAL B  1 363 ? -5.940  3.453   60.212  1.00 39.33  ? 363  VAL B N   1 
ATOM   6975  C  CA  . VAL B  1 363 ? -4.828  3.791   61.094  1.00 39.34  ? 363  VAL B CA  1 
ATOM   6976  C  C   . VAL B  1 363 ? -3.645  4.429   60.334  1.00 38.46  ? 363  VAL B C   1 
ATOM   6977  O  O   . VAL B  1 363 ? -3.075  5.429   60.781  1.00 38.33  ? 363  VAL B O   1 
ATOM   6978  C  CB  . VAL B  1 363 ? -4.353  2.567   61.885  1.00 37.69  ? 363  VAL B CB  1 
ATOM   6979  C  CG1 . VAL B  1 363 ? -3.184  2.937   62.764  1.00 28.76  ? 363  VAL B CG1 1 
ATOM   6980  C  CG2 . VAL B  1 363 ? -5.488  2.026   62.722  1.00 43.80  ? 363  VAL B CG2 1 
ATOM   6981  N  N   . ARG B  1 364 ? -3.293  3.863   59.181  1.00 36.56  ? 364  ARG B N   1 
ATOM   6982  C  CA  . ARG B  1 364 ? -2.190  4.381   58.382  1.00 34.56  ? 364  ARG B CA  1 
ATOM   6983  C  C   . ARG B  1 364 ? -2.525  5.759   57.859  1.00 39.70  ? 364  ARG B C   1 
ATOM   6984  O  O   . ARG B  1 364 ? -1.631  6.589   57.664  1.00 45.51  ? 364  ARG B O   1 
ATOM   6985  C  CB  . ARG B  1 364 ? -1.888  3.476   57.192  1.00 41.03  ? 364  ARG B CB  1 
ATOM   6986  C  CG  . ARG B  1 364 ? -1.590  2.028   57.529  1.00 50.73  ? 364  ARG B CG  1 
ATOM   6987  C  CD  . ARG B  1 364 ? -0.723  1.896   58.753  1.00 49.84  ? 364  ARG B CD  1 
ATOM   6988  N  NE  . ARG B  1 364 ? 0.595   2.497   58.597  1.00 46.00  ? 364  ARG B NE  1 
ATOM   6989  C  CZ  . ARG B  1 364 ? 1.659   1.817   58.195  1.00 51.83  ? 364  ARG B CZ  1 
ATOM   6990  N  NH1 . ARG B  1 364 ? 1.531   0.530   57.888  1.00 54.16  ? 364  ARG B NH1 1 
ATOM   6991  N  NH2 . ARG B  1 364 ? 2.843   2.416   58.093  1.00 49.77  ? 364  ARG B NH2 1 
ATOM   6992  N  N   . ILE B  1 365 ? -3.811  5.992   57.601  1.00 36.17  ? 365  ILE B N   1 
ATOM   6993  C  CA  . ILE B  1 365 ? -4.256  7.308   57.124  1.00 32.14  ? 365  ILE B CA  1 
ATOM   6994  C  C   . ILE B  1 365 ? -4.397  8.327   58.272  1.00 31.44  ? 365  ILE B C   1 
ATOM   6995  O  O   . ILE B  1 365 ? -4.286  9.540   58.075  1.00 26.40  ? 365  ILE B O   1 
ATOM   6996  C  CB  . ILE B  1 365 ? -5.599  7.185   56.363  1.00 40.12  ? 365  ILE B CB  1 
ATOM   6997  C  CG1 . ILE B  1 365 ? -5.461  6.220   55.188  1.00 39.43  ? 365  ILE B CG1 1 
ATOM   6998  C  CG2 . ILE B  1 365 ? -6.108  8.534   55.868  1.00 39.48  ? 365  ILE B CG2 1 
ATOM   6999  C  CD1 . ILE B  1 365 ? -6.757  6.041   54.448  1.00 40.77  ? 365  ILE B CD1 1 
ATOM   7000  N  N   . GLY B  1 366 ? -4.631  7.835   59.479  1.00 32.90  ? 366  GLY B N   1 
ATOM   7001  C  CA  . GLY B  1 366 ? -4.970  8.701   60.593  1.00 37.35  ? 366  GLY B CA  1 
ATOM   7002  C  C   . GLY B  1 366 ? -3.730  9.085   61.357  1.00 38.27  ? 366  GLY B C   1 
ATOM   7003  O  O   . GLY B  1 366 ? -3.674  10.153  61.965  1.00 43.53  ? 366  GLY B O   1 
ATOM   7004  N  N   . VAL B  1 367 ? -2.740  8.196   61.307  1.00 35.22  ? 367  VAL B N   1 
ATOM   7005  C  CA  . VAL B  1 367 ? -1.433  8.388   61.922  1.00 34.76  ? 367  VAL B CA  1 
ATOM   7006  C  C   . VAL B  1 367 ? -0.372  8.304   60.820  1.00 33.42  ? 367  VAL B C   1 
ATOM   7007  O  O   . VAL B  1 367 ? 0.471   7.391   60.805  1.00 32.58  ? 367  VAL B O   1 
ATOM   7008  C  CB  . VAL B  1 367 ? -1.158  7.283   62.954  1.00 33.94  ? 367  VAL B CB  1 
ATOM   7009  C  CG1 . VAL B  1 367 ? -0.016  7.672   63.862  1.00 31.95  ? 367  VAL B CG1 1 
ATOM   7010  C  CG2 . VAL B  1 367 ? -2.397  7.001   63.770  1.00 37.13  ? 367  VAL B CG2 1 
ATOM   7011  N  N   . PRO B  1 368 ? -0.403  9.267   59.894  1.00 25.62  ? 368  PRO B N   1 
ATOM   7012  C  CA  . PRO B  1 368 ? 0.363   9.167   58.649  1.00 33.13  ? 368  PRO B CA  1 
ATOM   7013  C  C   . PRO B  1 368 ? 1.882   9.019   58.842  1.00 31.21  ? 368  PRO B C   1 
ATOM   7014  O  O   . PRO B  1 368 ? 2.511   8.327   58.037  1.00 33.10  ? 368  PRO B O   1 
ATOM   7015  C  CB  . PRO B  1 368 ? 0.037   10.483  57.923  1.00 38.71  ? 368  PRO B CB  1 
ATOM   7016  C  CG  . PRO B  1 368 ? -1.078  11.099  58.677  1.00 23.11  ? 368  PRO B CG  1 
ATOM   7017  C  CD  . PRO B  1 368 ? -0.975  10.605  60.071  1.00 23.57  ? 368  PRO B CD  1 
ATOM   7018  N  N   . GLN B  1 369 ? 2.459   9.633   59.874  1.00 28.76  ? 369  GLN B N   1 
ATOM   7019  C  CA  . GLN B  1 369 ? 3.915   9.562   60.064  1.00 38.64  ? 369  GLN B CA  1 
ATOM   7020  C  C   . GLN B  1 369 ? 4.355   8.337   60.843  1.00 49.02  ? 369  GLN B C   1 
ATOM   7021  O  O   . GLN B  1 369 ? 5.489   8.272   61.312  1.00 55.36  ? 369  GLN B O   1 
ATOM   7022  C  CB  . GLN B  1 369 ? 4.477   10.815  60.751  1.00 39.85  ? 369  GLN B CB  1 
ATOM   7023  C  CG  . GLN B  1 369 ? 4.537   12.049  59.871  1.00 44.19  ? 369  GLN B CG  1 
ATOM   7024  C  CD  . GLN B  1 369 ? 3.154   12.611  59.575  1.00 53.75  ? 369  GLN B CD  1 
ATOM   7025  O  OE1 . GLN B  1 369 ? 2.440   13.048  60.481  1.00 55.11  ? 369  GLN B OE1 1 
ATOM   7026  N  NE2 . GLN B  1 369 ? 2.766   12.591  58.304  1.00 57.97  ? 369  GLN B NE2 1 
ATOM   7027  N  N   . ALA B  1 370 ? 3.468   7.362   60.990  1.00 49.66  ? 370  ALA B N   1 
ATOM   7028  C  CA  . ALA B  1 370 ? 3.822   6.190   61.766  1.00 42.63  ? 370  ALA B CA  1 
ATOM   7029  C  C   . ALA B  1 370 ? 4.476   5.128   60.896  1.00 47.36  ? 370  ALA B C   1 
ATOM   7030  O  O   . ALA B  1 370 ? 3.903   4.692   59.893  1.00 45.09  ? 370  ALA B O   1 
ATOM   7031  C  CB  . ALA B  1 370 ? 2.606   5.631   62.458  1.00 36.64  ? 370  ALA B CB  1 
ATOM   7032  N  N   . SER B  1 371 ? 5.677   4.708   61.288  1.00 53.18  ? 371  SER B N   1 
ATOM   7033  C  CA  . SER B  1 371 ? 6.292   3.522   60.700  1.00 58.48  ? 371  SER B CA  1 
ATOM   7034  C  C   . SER B  1 371 ? 5.363   2.334   60.928  1.00 55.89  ? 371  SER B C   1 
ATOM   7035  O  O   . SER B  1 371 ? 4.481   2.397   61.783  1.00 57.05  ? 371  SER B O   1 
ATOM   7036  C  CB  . SER B  1 371 ? 7.671   3.261   61.313  1.00 66.47  ? 371  SER B CB  1 
ATOM   7037  O  OG  . SER B  1 371 ? 7.639   3.321   62.731  1.00 70.24  ? 371  SER B OG  1 
ATOM   7038  N  N   . ASP B  1 372 ? 5.551   1.255   60.171  1.00 54.50  ? 372  ASP B N   1 
ATOM   7039  C  CA  . ASP B  1 372 ? 4.657   0.107   60.278  1.00 54.06  ? 372  ASP B CA  1 
ATOM   7040  C  C   . ASP B  1 372 ? 4.604   -0.436  61.690  1.00 54.82  ? 372  ASP B C   1 
ATOM   7041  O  O   . ASP B  1 372 ? 3.582   -0.974  62.104  1.00 58.29  ? 372  ASP B O   1 
ATOM   7042  C  CB  . ASP B  1 372 ? 5.067   -1.007  59.331  1.00 58.68  ? 372  ASP B CB  1 
ATOM   7043  C  CG  . ASP B  1 372 ? 5.191   -0.537  57.921  1.00 68.92  ? 372  ASP B CG  1 
ATOM   7044  O  OD1 . ASP B  1 372 ? 4.140   -0.378  57.258  1.00 68.94  ? 372  ASP B OD1 1 
ATOM   7045  O  OD2 . ASP B  1 372 ? 6.345   -0.319  57.483  1.00 75.45  ? 372  ASP B OD2 1 
ATOM   7046  N  N   . LEU B  1 373 ? 5.706   -0.290  62.423  1.00 49.86  ? 373  LEU B N   1 
ATOM   7047  C  CA  . LEU B  1 373 ? 5.783   -0.779  63.796  1.00 42.52  ? 373  LEU B CA  1 
ATOM   7048  C  C   . LEU B  1 373 ? 4.948   0.086   64.732  1.00 42.18  ? 373  LEU B C   1 
ATOM   7049  O  O   . LEU B  1 373 ? 4.250   -0.429  65.611  1.00 53.06  ? 373  LEU B O   1 
ATOM   7050  C  CB  . LEU B  1 373 ? 7.230   -0.840  64.283  1.00 37.82  ? 373  LEU B CB  1 
ATOM   7051  C  CG  . LEU B  1 373 ? 7.354   -1.542  65.635  1.00 37.58  ? 373  LEU B CG  1 
ATOM   7052  C  CD1 . LEU B  1 373 ? 7.011   -3.013  65.503  1.00 23.00  ? 373  LEU B CD1 1 
ATOM   7053  C  CD2 . LEU B  1 373 ? 8.736   -1.371  66.210  1.00 35.77  ? 373  LEU B CD2 1 
ATOM   7054  N  N   . ALA B  1 374 ? 5.015   1.399   64.537  1.00 31.68  ? 374  ALA B N   1 
ATOM   7055  C  CA  . ALA B  1 374 ? 4.188   2.306   65.315  1.00 34.12  ? 374  ALA B CA  1 
ATOM   7056  C  C   . ALA B  1 374 ? 2.720   2.035   65.009  1.00 35.27  ? 374  ALA B C   1 
ATOM   7057  O  O   . ALA B  1 374 ? 1.902   1.921   65.911  1.00 35.77  ? 374  ALA B O   1 
ATOM   7058  C  CB  . ALA B  1 374 ? 4.542   3.738   65.016  1.00 31.58  ? 374  ALA B CB  1 
ATOM   7059  N  N   . ALA B  1 375 ? 2.405   1.923   63.727  1.00 31.43  ? 375  ALA B N   1 
ATOM   7060  C  CA  . ALA B  1 375 ? 1.086   1.514   63.295  1.00 34.34  ? 375  ALA B CA  1 
ATOM   7061  C  C   . ALA B  1 375 ? 0.644   0.221   63.989  1.00 44.16  ? 375  ALA B C   1 
ATOM   7062  O  O   . ALA B  1 375 ? -0.518  0.076   64.393  1.00 50.34  ? 375  ALA B O   1 
ATOM   7063  C  CB  . ALA B  1 375 ? 1.080   1.333   61.803  1.00 28.86  ? 375  ALA B CB  1 
ATOM   7064  N  N   . GLU B  1 376 ? 1.567   -0.717  64.143  1.00 41.37  ? 376  GLU B N   1 
ATOM   7065  C  CA  . GLU B  1 376 ? 1.202   -2.017  64.686  1.00 50.16  ? 376  GLU B CA  1 
ATOM   7066  C  C   . GLU B  1 376 ? 0.892   -1.842  66.154  1.00 44.19  ? 376  GLU B C   1 
ATOM   7067  O  O   . GLU B  1 376 ? 0.026   -2.516  66.710  1.00 54.08  ? 376  GLU B O   1 
ATOM   7068  C  CB  . GLU B  1 376 ? 2.336   -3.022  64.513  1.00 63.78  ? 376  GLU B CB  1 
ATOM   7069  C  CG  . GLU B  1 376 ? 1.887   -4.394  64.060  1.00 81.52  ? 376  GLU B CG  1 
ATOM   7070  C  CD  . GLU B  1 376 ? 2.291   -4.672  62.621  1.00 99.12  ? 376  GLU B CD  1 
ATOM   7071  O  OE1 . GLU B  1 376 ? 3.516   -4.726  62.344  1.00 103.55 ? 376  GLU B OE1 1 
ATOM   7072  O  OE2 . GLU B  1 376 ? 1.386   -4.831  61.769  1.00 104.91 ? 376  GLU B OE2 1 
ATOM   7073  N  N   . ALA B  1 377 ? 1.611   -0.919  66.778  1.00 34.78  ? 377  ALA B N   1 
ATOM   7074  C  CA  . ALA B  1 377 ? 1.414   -0.646  68.185  1.00 35.94  ? 377  ALA B CA  1 
ATOM   7075  C  C   . ALA B  1 377 ? 0.042   -0.017  68.393  1.00 40.70  ? 377  ALA B C   1 
ATOM   7076  O  O   . ALA B  1 377 ? -0.728  -0.469  69.244  1.00 49.27  ? 377  ALA B O   1 
ATOM   7077  C  CB  . ALA B  1 377 ? 2.506   0.259   68.703  1.00 27.11  ? 377  ALA B CB  1 
ATOM   7078  N  N   . VAL B  1 378 ? -0.259  1.019   67.613  1.00 30.27  ? 378  VAL B N   1 
ATOM   7079  C  CA  . VAL B  1 378 ? -1.552  1.676   67.673  1.00 32.72  ? 378  VAL B CA  1 
ATOM   7080  C  C   . VAL B  1 378 ? -2.656  0.655   67.504  1.00 43.95  ? 378  VAL B C   1 
ATOM   7081  O  O   . VAL B  1 378 ? -3.661  0.660   68.244  1.00 33.14  ? 378  VAL B O   1 
ATOM   7082  C  CB  . VAL B  1 378 ? -1.688  2.727   66.576  1.00 29.16  ? 378  VAL B CB  1 
ATOM   7083  C  CG1 . VAL B  1 378 ? -3.097  3.284   66.555  1.00 36.10  ? 378  VAL B CG1 1 
ATOM   7084  C  CG2 . VAL B  1 378 ? -0.705  3.824   66.799  1.00 27.92  ? 378  VAL B CG2 1 
ATOM   7085  N  N   . VAL B  1 379 ? -2.452  -0.238  66.542  1.00 31.13  ? 379  VAL B N   1 
ATOM   7086  C  CA  . VAL B  1 379 ? -3.475  -1.219  66.253  1.00 39.21  ? 379  VAL B CA  1 
ATOM   7087  C  C   . VAL B  1 379 ? -3.679  -2.110  67.458  1.00 40.92  ? 379  VAL B C   1 
ATOM   7088  O  O   . VAL B  1 379 ? -4.821  -2.335  67.864  1.00 43.01  ? 379  VAL B O   1 
ATOM   7089  C  CB  . VAL B  1 379 ? -3.190  -2.029  64.987  1.00 36.35  ? 379  VAL B CB  1 
ATOM   7090  C  CG1 . VAL B  1 379 ? -3.767  -3.416  65.118  1.00 42.14  ? 379  VAL B CG1 1 
ATOM   7091  C  CG2 . VAL B  1 379 ? -3.811  -1.337  63.794  1.00 31.80  ? 379  VAL B CG2 1 
ATOM   7092  N  N   . LEU B  1 380 ? -2.578  -2.572  68.051  1.00 40.13  ? 380  LEU B N   1 
ATOM   7093  C  CA  . LEU B  1 380 ? -2.646  -3.398  69.260  1.00 43.63  ? 380  LEU B CA  1 
ATOM   7094  C  C   . LEU B  1 380 ? -3.365  -2.707  70.423  1.00 46.92  ? 380  LEU B C   1 
ATOM   7095  O  O   . LEU B  1 380 ? -4.135  -3.335  71.151  1.00 44.85  ? 380  LEU B O   1 
ATOM   7096  C  CB  . LEU B  1 380 ? -1.251  -3.822  69.703  1.00 42.35  ? 380  LEU B CB  1 
ATOM   7097  C  CG  . LEU B  1 380 ? -1.138  -4.267  71.161  1.00 50.92  ? 380  LEU B CG  1 
ATOM   7098  C  CD1 . LEU B  1 380 ? -0.507  -5.631  71.201  1.00 58.37  ? 380  LEU B CD1 1 
ATOM   7099  C  CD2 . LEU B  1 380 ? -0.344  -3.281  72.029  1.00 49.83  ? 380  LEU B CD2 1 
ATOM   7100  N  N   . HIS B  1 381 ? -3.111  -1.415  70.597  1.00 45.70  ? 381  HIS B N   1 
ATOM   7101  C  CA  . HIS B  1 381 ? -3.705  -0.683  71.706  1.00 45.75  ? 381  HIS B CA  1 
ATOM   7102  C  C   . HIS B  1 381 ? -5.196  -0.465  71.523  1.00 46.64  ? 381  HIS B C   1 
ATOM   7103  O  O   . HIS B  1 381 ? -5.969  -0.527  72.484  1.00 39.66  ? 381  HIS B O   1 
ATOM   7104  C  CB  . HIS B  1 381 ? -3.031  0.674   71.905  1.00 45.21  ? 381  HIS B CB  1 
ATOM   7105  C  CG  . HIS B  1 381 ? -3.576  1.440   73.071  1.00 50.23  ? 381  HIS B CG  1 
ATOM   7106  N  ND1 . HIS B  1 381 ? -3.222  1.163   74.375  1.00 52.94  ? 381  HIS B ND1 1 
ATOM   7107  C  CD2 . HIS B  1 381 ? -4.472  2.453   73.133  1.00 46.19  ? 381  HIS B CD2 1 
ATOM   7108  C  CE1 . HIS B  1 381 ? -3.864  1.982   75.187  1.00 48.99  ? 381  HIS B CE1 1 
ATOM   7109  N  NE2 . HIS B  1 381 ? -4.625  2.778   74.458  1.00 45.78  ? 381  HIS B NE2 1 
ATOM   7110  N  N   . TYR B  1 382 ? -5.599  -0.180  70.291  1.00 51.42  ? 382  TYR B N   1 
ATOM   7111  C  CA  . TYR B  1 382 ? -6.981  0.204   70.059  1.00 38.64  ? 382  TYR B CA  1 
ATOM   7112  C  C   . TYR B  1 382 ? -7.884  -0.969  69.702  1.00 51.90  ? 382  TYR B C   1 
ATOM   7113  O  O   . TYR B  1 382 ? -9.114  -0.853  69.686  1.00 48.62  ? 382  TYR B O   1 
ATOM   7114  C  CB  . TYR B  1 382 ? -7.044  1.316   69.024  1.00 38.10  ? 382  TYR B CB  1 
ATOM   7115  C  CG  . TYR B  1 382 ? -6.631  2.652   69.598  1.00 39.41  ? 382  TYR B CG  1 
ATOM   7116  C  CD1 . TYR B  1 382 ? -7.547  3.447   70.258  1.00 44.74  ? 382  TYR B CD1 1 
ATOM   7117  C  CD2 . TYR B  1 382 ? -5.334  3.112   69.488  1.00 35.08  ? 382  TYR B CD2 1 
ATOM   7118  C  CE1 . TYR B  1 382 ? -7.185  4.662   70.792  1.00 50.27  ? 382  TYR B CE1 1 
ATOM   7119  C  CE2 . TYR B  1 382 ? -4.967  4.332   70.017  1.00 80.48  ? 382  TYR B CE2 1 
ATOM   7120  C  CZ  . TYR B  1 382 ? -5.896  5.100   70.673  1.00 36.08  ? 382  TYR B CZ  1 
ATOM   7121  O  OH  . TYR B  1 382 ? -5.551  6.318   71.213  1.00 56.27  ? 382  TYR B OH  1 
ATOM   7122  N  N   . THR B  1 383 ? -7.262  -2.109  69.441  1.00 39.67  ? 383  THR B N   1 
ATOM   7123  C  CA  . THR B  1 383 ? -8.000  -3.323  69.139  1.00 45.28  ? 383  THR B CA  1 
ATOM   7124  C  C   . THR B  1 383 ? -8.619  -3.879  70.415  1.00 51.68  ? 383  THR B C   1 
ATOM   7125  O  O   . THR B  1 383 ? -7.985  -3.895  71.468  1.00 50.96  ? 383  THR B O   1 
ATOM   7126  C  CB  . THR B  1 383 ? -7.061  -4.398  68.533  1.00 47.60  ? 383  THR B CB  1 
ATOM   7127  O  OG1 . THR B  1 383 ? -6.300  -3.835  67.452  1.00 41.44  ? 383  THR B OG1 1 
ATOM   7128  C  CG2 . THR B  1 383 ? -7.851  -5.599  68.036  1.00 49.93  ? 383  THR B CG2 1 
ATOM   7129  N  N   . ASP B  1 384 ? -9.860  -4.335  70.341  1.00 62.43  ? 384  ASP B N   1 
ATOM   7130  C  CA  . ASP B  1 384 ? -10.384 -5.114  71.449  1.00 65.86  ? 384  ASP B CA  1 
ATOM   7131  C  C   . ASP B  1 384 ? -10.126 -6.568  71.133  1.00 66.29  ? 384  ASP B C   1 
ATOM   7132  O  O   . ASP B  1 384 ? -10.887 -7.181  70.392  1.00 73.51  ? 384  ASP B O   1 
ATOM   7133  C  CB  . ASP B  1 384 ? -11.872 -4.884  71.659  1.00 65.57  ? 384  ASP B CB  1 
ATOM   7134  C  CG  . ASP B  1 384 ? -12.373 -5.523  72.934  1.00 72.60  ? 384  ASP B CG  1 
ATOM   7135  O  OD1 . ASP B  1 384 ? -12.578 -6.757  72.947  1.00 70.92  ? 384  ASP B OD1 1 
ATOM   7136  O  OD2 . ASP B  1 384 ? -12.547 -4.788  73.928  1.00 80.06  ? 384  ASP B OD2 1 
ATOM   7137  N  N   . TRP B  1 385 ? -9.057  -7.120  71.697  1.00 57.40  ? 385  TRP B N   1 
ATOM   7138  C  CA  . TRP B  1 385 ? -8.593  -8.450  71.309  1.00 53.89  ? 385  TRP B CA  1 
ATOM   7139  C  C   . TRP B  1 385 ? -9.572  -9.582  71.642  1.00 59.42  ? 385  TRP B C   1 
ATOM   7140  O  O   . TRP B  1 385 ? -9.370  -10.734 71.250  1.00 62.99  ? 385  TRP B O   1 
ATOM   7141  C  CB  . TRP B  1 385 ? -7.201  -8.713  71.880  1.00 50.35  ? 385  TRP B CB  1 
ATOM   7142  C  CG  . TRP B  1 385 ? -6.189  -7.838  71.255  1.00 51.38  ? 385  TRP B CG  1 
ATOM   7143  C  CD1 . TRP B  1 385 ? -5.642  -6.698  71.779  1.00 53.86  ? 385  TRP B CD1 1 
ATOM   7144  C  CD2 . TRP B  1 385 ? -5.623  -7.995  69.956  1.00 50.47  ? 385  TRP B CD2 1 
ATOM   7145  N  NE1 . TRP B  1 385 ? -4.754  -6.149  70.889  1.00 50.67  ? 385  TRP B NE1 1 
ATOM   7146  C  CE2 . TRP B  1 385 ? -4.727  -6.925  69.759  1.00 54.33  ? 385  TRP B CE2 1 
ATOM   7147  C  CE3 . TRP B  1 385 ? -5.781  -8.941  68.942  1.00 48.33  ? 385  TRP B CE3 1 
ATOM   7148  C  CZ2 . TRP B  1 385 ? -3.989  -6.777  68.586  1.00 59.76  ? 385  TRP B CZ2 1 
ATOM   7149  C  CZ3 . TRP B  1 385 ? -5.051  -8.795  67.782  1.00 54.47  ? 385  TRP B CZ3 1 
ATOM   7150  C  CH2 . TRP B  1 385 ? -4.165  -7.720  67.610  1.00 61.02  ? 385  TRP B CH2 1 
ATOM   7151  N  N   . LEU B  1 386 ? -10.637 -9.246  72.354  1.00 58.23  ? 386  LEU B N   1 
ATOM   7152  C  CA  . LEU B  1 386 ? -11.711 -10.188 72.567  1.00 53.58  ? 386  LEU B CA  1 
ATOM   7153  C  C   . LEU B  1 386 ? -12.680 -10.161 71.393  1.00 71.35  ? 386  LEU B C   1 
ATOM   7154  O  O   . LEU B  1 386 ? -13.278 -11.187 71.062  1.00 78.74  ? 386  LEU B O   1 
ATOM   7155  C  CB  . LEU B  1 386 ? -12.439 -9.854  73.856  1.00 55.46  ? 386  LEU B CB  1 
ATOM   7156  C  CG  . LEU B  1 386 ? -12.344 -10.932 74.919  1.00 57.05  ? 386  LEU B CG  1 
ATOM   7157  C  CD1 . LEU B  1 386 ? -12.480 -10.286 76.284  1.00 57.94  ? 386  LEU B CD1 1 
ATOM   7158  C  CD2 . LEU B  1 386 ? -13.404 -12.002 74.685  1.00 59.45  ? 386  LEU B CD2 1 
ATOM   7159  N  N   . HIS B  1 387 ? -12.826 -8.989  70.772  1.00 65.15  ? 387  HIS B N   1 
ATOM   7160  C  CA  . HIS B  1 387 ? -13.743 -8.801  69.638  1.00 71.75  ? 387  HIS B CA  1 
ATOM   7161  C  C   . HIS B  1 387 ? -13.136 -8.002  68.480  1.00 72.81  ? 387  HIS B C   1 
ATOM   7162  O  O   . HIS B  1 387 ? -13.596 -6.891  68.183  1.00 73.19  ? 387  HIS B O   1 
ATOM   7163  C  CB  . HIS B  1 387 ? -15.015 -8.081  70.091  1.00 77.08  ? 387  HIS B CB  1 
ATOM   7164  C  CG  . HIS B  1 387 ? -15.699 -8.731  71.248  1.00 80.95  ? 387  HIS B CG  1 
ATOM   7165  N  ND1 . HIS B  1 387 ? -15.796 -8.132  72.486  1.00 80.48  ? 387  HIS B ND1 1 
ATOM   7166  C  CD2 . HIS B  1 387 ? -16.313 -9.932  71.359  1.00 86.26  ? 387  HIS B CD2 1 
ATOM   7167  C  CE1 . HIS B  1 387 ? -16.443 -8.937  73.309  1.00 87.81  ? 387  HIS B CE1 1 
ATOM   7168  N  NE2 . HIS B  1 387 ? -16.766 -10.036 72.651  1.00 91.96  ? 387  HIS B NE2 1 
ATOM   7169  N  N   . PRO B  1 388 ? -12.122 -8.571  67.806  1.00 68.80  ? 388  PRO B N   1 
ATOM   7170  C  CA  . PRO B  1 388 ? -11.358 -7.816  66.800  1.00 65.73  ? 388  PRO B CA  1 
ATOM   7171  C  C   . PRO B  1 388 ? -12.141 -7.417  65.535  1.00 68.69  ? 388  PRO B C   1 
ATOM   7172  O  O   . PRO B  1 388 ? -11.754 -6.439  64.897  1.00 67.28  ? 388  PRO B O   1 
ATOM   7173  C  CB  . PRO B  1 388 ? -10.210 -8.772  66.438  1.00 59.88  ? 388  PRO B CB  1 
ATOM   7174  C  CG  . PRO B  1 388 ? -10.180 -9.800  67.549  1.00 57.26  ? 388  PRO B CG  1 
ATOM   7175  C  CD  . PRO B  1 388 ? -11.594 -9.935  67.992  1.00 62.10  ? 388  PRO B CD  1 
ATOM   7176  N  N   . GLU B  1 389 ? -13.202 -8.146  65.183  1.00 71.88  ? 389  GLU B N   1 
ATOM   7177  C  CA  . GLU B  1 389 ? -13.960 -7.880  63.951  1.00 68.15  ? 389  GLU B CA  1 
ATOM   7178  C  C   . GLU B  1 389 ? -15.155 -6.950  64.185  1.00 62.34  ? 389  GLU B C   1 
ATOM   7179  O  O   . GLU B  1 389 ? -15.705 -6.377  63.247  1.00 51.26  ? 389  GLU B O   1 
ATOM   7180  C  CB  . GLU B  1 389 ? -14.447 -9.192  63.320  1.00 74.65  ? 389  GLU B CB  1 
ATOM   7181  C  CG  . GLU B  1 389 ? -13.411 -10.319 63.265  1.00 81.42  ? 389  GLU B CG  1 
ATOM   7182  C  CD  . GLU B  1 389 ? -12.440 -10.193 62.098  1.00 81.34  ? 389  GLU B CD  1 
ATOM   7183  O  OE1 . GLU B  1 389 ? -12.859 -10.414 60.940  1.00 81.40  ? 389  GLU B OE1 1 
ATOM   7184  O  OE2 . GLU B  1 389 ? -11.253 -9.884  62.342  1.00 79.57  ? 389  GLU B OE2 1 
ATOM   7185  N  N   . ASP B  1 390 ? -15.541 -6.808  65.446  1.00 60.41  ? 390  ASP B N   1 
ATOM   7186  C  CA  . ASP B  1 390 ? -16.720 -6.047  65.833  1.00 65.69  ? 390  ASP B CA  1 
ATOM   7187  C  C   . ASP B  1 390 ? -16.752 -4.661  65.214  1.00 71.00  ? 390  ASP B C   1 
ATOM   7188  O  O   . ASP B  1 390 ? -16.032 -3.772  65.651  1.00 73.45  ? 390  ASP B O   1 
ATOM   7189  C  CB  . ASP B  1 390 ? -16.775 -5.922  67.355  1.00 70.02  ? 390  ASP B CB  1 
ATOM   7190  C  CG  . ASP B  1 390 ? -18.013 -5.195  67.836  1.00 68.13  ? 390  ASP B CG  1 
ATOM   7191  O  OD1 . ASP B  1 390 ? -19.072 -5.350  67.191  1.00 70.42  ? 390  ASP B OD1 1 
ATOM   7192  O  OD2 . ASP B  1 390 ? -17.925 -4.473  68.857  1.00 63.23  ? 390  ASP B OD2 1 
ATOM   7193  N  N   . PRO B  1 391 ? -17.618 -4.470  64.209  1.00 78.30  ? 391  PRO B N   1 
ATOM   7194  C  CA  . PRO B  1 391 ? -17.727 -3.220  63.447  1.00 79.15  ? 391  PRO B CA  1 
ATOM   7195  C  C   . PRO B  1 391 ? -17.789 -1.983  64.344  1.00 76.06  ? 391  PRO B C   1 
ATOM   7196  O  O   . PRO B  1 391 ? -16.878 -1.151  64.289  1.00 76.07  ? 391  PRO B O   1 
ATOM   7197  C  CB  . PRO B  1 391 ? -19.052 -3.387  62.689  1.00 79.90  ? 391  PRO B CB  1 
ATOM   7198  C  CG  . PRO B  1 391 ? -19.800 -4.456  63.434  1.00 79.48  ? 391  PRO B CG  1 
ATOM   7199  C  CD  . PRO B  1 391 ? -18.733 -5.386  63.914  1.00 80.42  ? 391  PRO B CD  1 
ATOM   7200  N  N   . THR B  1 392 ? -18.843 -1.881  65.153  1.00 68.41  ? 392  THR B N   1 
ATOM   7201  C  CA  . THR B  1 392 ? -19.059 -0.748  66.054  1.00 63.14  ? 392  THR B CA  1 
ATOM   7202  C  C   . THR B  1 392 ? -17.805 -0.353  66.850  1.00 65.30  ? 392  THR B C   1 
ATOM   7203  O  O   . THR B  1 392 ? -17.399 0.827   66.854  1.00 68.36  ? 392  THR B O   1 
ATOM   7204  C  CB  . THR B  1 392 ? -20.216 -1.039  67.028  1.00 59.80  ? 392  THR B CB  1 
ATOM   7205  O  OG1 . THR B  1 392 ? -20.619 -2.408  66.886  1.00 61.84  ? 392  THR B OG1 1 
ATOM   7206  C  CG2 . THR B  1 392 ? -21.414 -0.134  66.743  1.00 60.21  ? 392  THR B CG2 1 
ATOM   7207  N  N   . HIS B  1 393 ? -17.180 -1.331  67.501  1.00 63.76  ? 393  HIS B N   1 
ATOM   7208  C  CA  . HIS B  1 393 ? -15.980 -1.040  68.274  1.00 78.82  ? 393  HIS B CA  1 
ATOM   7209  C  C   . HIS B  1 393 ? -14.797 -0.552  67.414  1.00 72.89  ? 393  HIS B C   1 
ATOM   7210  O  O   . HIS B  1 393 ? -14.064 0.339   67.831  1.00 61.40  ? 393  HIS B O   1 
ATOM   7211  C  CB  . HIS B  1 393 ? -15.556 -2.215  69.155  1.00 96.61  ? 393  HIS B CB  1 
ATOM   7212  C  CG  . HIS B  1 393 ? -14.310 -1.941  69.944  1.00 113.70 ? 393  HIS B CG  1 
ATOM   7213  N  ND1 . HIS B  1 393 ? -14.330 -1.338  71.184  1.00 121.81 ? 393  HIS B ND1 1 
ATOM   7214  C  CD2 . HIS B  1 393 ? -13.004 -2.156  69.652  1.00 117.25 ? 393  HIS B CD2 1 
ATOM   7215  C  CE1 . HIS B  1 393 ? -13.092 -1.212  71.630  1.00 122.89 ? 393  HIS B CE1 1 
ATOM   7216  N  NE2 . HIS B  1 393 ? -12.268 -1.700  70.719  1.00 119.50 ? 393  HIS B NE2 1 
ATOM   7217  N  N   . LEU B  1 394 ? -14.610 -1.132  66.230  1.00 71.00  ? 394  LEU B N   1 
ATOM   7218  C  CA  . LEU B  1 394 ? -13.586 -0.651  65.306  1.00 63.14  ? 394  LEU B CA  1 
ATOM   7219  C  C   . LEU B  1 394 ? -13.842 0.802   64.890  1.00 56.43  ? 394  LEU B C   1 
ATOM   7220  O  O   . LEU B  1 394 ? -12.931 1.618   64.879  1.00 52.76  ? 394  LEU B O   1 
ATOM   7221  C  CB  . LEU B  1 394 ? -13.515 -1.531  64.060  1.00 45.02  ? 394  LEU B CB  1 
ATOM   7222  C  CG  . LEU B  1 394 ? -13.187 -2.997  64.265  1.00 59.73  ? 394  LEU B CG  1 
ATOM   7223  C  CD1 . LEU B  1 394 ? -12.971 -3.647  62.926  1.00 44.93  ? 394  LEU B CD1 1 
ATOM   7224  C  CD2 . LEU B  1 394 ? -11.967 -3.118  65.130  1.00 66.13  ? 394  LEU B CD2 1 
ATOM   7225  N  N   . ARG B  1 395 ? -15.079 1.115   64.531  1.00 57.70  ? 395  ARG B N   1 
ATOM   7226  C  CA  . ARG B  1 395 ? -15.432 2.481   64.180  1.00 63.96  ? 395  ARG B CA  1 
ATOM   7227  C  C   . ARG B  1 395 ? -15.046 3.426   65.319  1.00 62.98  ? 395  ARG B C   1 
ATOM   7228  O  O   . ARG B  1 395 ? -14.127 4.292   65.186  1.00 55.55  ? 395  ARG B O   1 
ATOM   7229  C  CB  . ARG B  1 395 ? -16.931 2.574   63.898  1.00 48.25  ? 395  ARG B CB  1 
ATOM   7230  C  CG  . ARG B  1 395 ? -17.400 3.962   63.573  1.00 61.94  ? 395  ARG B CG  1 
ATOM   7231  C  CD  . ARG B  1 395 ? -18.417 4.429   64.592  1.00 70.72  ? 395  ARG B CD  1 
ATOM   7232  N  NE  . ARG B  1 395 ? -19.708 3.756   64.441  1.00 75.97  ? 395  ARG B NE  1 
ATOM   7233  C  CZ  . ARG B  1 395 ? -20.667 3.754   65.366  1.00 83.30  ? 395  ARG B CZ  1 
ATOM   7234  N  NH1 . ARG B  1 395 ? -20.491 4.385   66.522  1.00 82.28  ? 395  ARG B NH1 1 
ATOM   7235  N  NH2 . ARG B  1 395 ? -21.808 3.114   65.141  1.00 92.49  ? 395  ARG B NH2 1 
ATOM   7236  N  N   . ASP B  1 396 ? -15.729 3.230   66.448  1.00 60.06  ? 396  ASP B N   1 
ATOM   7237  C  CA  . ASP B  1 396 ? -15.484 4.054   67.626  1.00 53.57  ? 396  ASP B CA  1 
ATOM   7238  C  C   . ASP B  1 396 ? -13.989 4.176   67.924  1.00 48.74  ? 396  ASP B C   1 
ATOM   7239  O  O   . ASP B  1 396 ? -13.513 5.251   68.295  1.00 48.52  ? 396  ASP B O   1 
ATOM   7240  C  CB  . ASP B  1 396 ? -16.274 3.534   68.831  1.00 58.26  ? 396  ASP B CB  1 
ATOM   7241  C  CG  . ASP B  1 396 ? -17.757 3.882   68.750  1.00 65.60  ? 396  ASP B CG  1 
ATOM   7242  O  OD1 . ASP B  1 396 ? -18.122 4.701   67.877  1.00 70.54  ? 396  ASP B OD1 1 
ATOM   7243  O  OD2 . ASP B  1 396 ? -18.551 3.356   69.561  1.00 63.75  ? 396  ASP B OD2 1 
ATOM   7244  N  N   . ALA B  1 397 ? -13.255 3.088   67.689  1.00 48.38  ? 397  ALA B N   1 
ATOM   7245  C  CA  . ALA B  1 397 ? -11.810 3.034   67.913  1.00 43.58  ? 397  ALA B CA  1 
ATOM   7246  C  C   . ALA B  1 397 ? -11.044 3.905   66.947  1.00 44.73  ? 397  ALA B C   1 
ATOM   7247  O  O   . ALA B  1 397 ? -10.034 4.480   67.312  1.00 48.41  ? 397  ALA B O   1 
ATOM   7248  C  CB  . ALA B  1 397 ? -11.287 1.601   67.822  1.00 42.41  ? 397  ALA B CB  1 
ATOM   7249  N  N   . MET B  1 398 ? -11.500 3.972   65.705  1.00 48.83  ? 398  MET B N   1 
ATOM   7250  C  CA  . MET B  1 398 ? -10.845 4.800   64.706  1.00 46.28  ? 398  MET B CA  1 
ATOM   7251  C  C   . MET B  1 398 ? -10.983 6.244   65.145  1.00 46.65  ? 398  MET B C   1 
ATOM   7252  O  O   . MET B  1 398 ? -9.991  7.003   65.214  1.00 47.27  ? 398  MET B O   1 
ATOM   7253  C  CB  . MET B  1 398 ? -11.514 4.607   63.350  1.00 45.63  ? 398  MET B CB  1 
ATOM   7254  C  CG  . MET B  1 398 ? -10.816 5.307   62.221  1.00 37.16  ? 398  MET B CG  1 
ATOM   7255  S  SD  . MET B  1 398 ? -9.290  4.466   61.800  1.00 41.72  ? 398  MET B SD  1 
ATOM   7256  C  CE  . MET B  1 398 ? -8.096  5.530   62.595  1.00 38.56  ? 398  MET B CE  1 
ATOM   7257  N  N   . SER B  1 399 ? -12.224 6.611   65.467  1.00 46.83  ? 399  SER B N   1 
ATOM   7258  C  CA  . SER B  1 399 ? -12.484 7.965   65.954  1.00 45.02  ? 399  SER B CA  1 
ATOM   7259  C  C   . SER B  1 399 ? -11.600 8.286   67.155  1.00 43.49  ? 399  SER B C   1 
ATOM   7260  O  O   . SER B  1 399 ? -11.080 9.401   67.294  1.00 44.42  ? 399  SER B O   1 
ATOM   7261  C  CB  . SER B  1 399 ? -13.955 8.128   66.327  1.00 48.35  ? 399  SER B CB  1 
ATOM   7262  O  OG  . SER B  1 399 ? -14.148 9.317   67.069  1.00 52.91  ? 399  SER B OG  1 
ATOM   7263  N  N   . ALA B  1 400 ? -11.426 7.285   68.010  1.00 40.94  ? 400  ALA B N   1 
ATOM   7264  C  CA  . ALA B  1 400 ? -10.563 7.411   69.173  1.00 47.42  ? 400  ALA B CA  1 
ATOM   7265  C  C   . ALA B  1 400 ? -9.110  7.657   68.788  1.00 52.36  ? 400  ALA B C   1 
ATOM   7266  O  O   . ALA B  1 400 ? -8.476  8.528   69.351  1.00 59.45  ? 400  ALA B O   1 
ATOM   7267  C  CB  . ALA B  1 400 ? -10.664 6.183   70.042  1.00 41.63  ? 400  ALA B CB  1 
ATOM   7268  N  N   . VAL B  1 401 ? -8.577  6.886   67.844  1.00 49.55  ? 401  VAL B N   1 
ATOM   7269  C  CA  . VAL B  1 401 ? -7.189  7.049   67.423  1.00 45.70  ? 401  VAL B CA  1 
ATOM   7270  C  C   . VAL B  1 401 ? -6.952  8.454   66.907  1.00 43.41  ? 401  VAL B C   1 
ATOM   7271  O  O   . VAL B  1 401 ? -5.988  9.112   67.313  1.00 44.10  ? 401  VAL B O   1 
ATOM   7272  C  CB  . VAL B  1 401 ? -6.794  6.076   66.304  1.00 42.20  ? 401  VAL B CB  1 
ATOM   7273  C  CG1 . VAL B  1 401 ? -5.358  6.343   65.864  1.00 31.85  ? 401  VAL B CG1 1 
ATOM   7274  C  CG2 . VAL B  1 401 ? -6.972  4.641   66.762  1.00 39.06  ? 401  VAL B CG2 1 
ATOM   7275  N  N   . VAL B  1 402 ? -7.834  8.921   66.025  1.00 40.97  ? 402  VAL B N   1 
ATOM   7276  C  CA  . VAL B  1 402 ? -7.615  10.236  65.441  1.00 33.67  ? 402  VAL B CA  1 
ATOM   7277  C  C   . VAL B  1 402 ? -7.745  11.336  66.476  1.00 50.83  ? 402  VAL B C   1 
ATOM   7278  O  O   . VAL B  1 402 ? -6.959  12.293  66.501  1.00 33.41  ? 402  VAL B O   1 
ATOM   7279  C  CB  . VAL B  1 402 ? -8.581  10.516  64.315  1.00 40.42  ? 402  VAL B CB  1 
ATOM   7280  C  CG1 . VAL B  1 402 ? -8.265  11.876  63.706  1.00 36.09  ? 402  VAL B CG1 1 
ATOM   7281  C  CG2 . VAL B  1 402 ? -8.485  9.412   63.278  1.00 33.62  ? 402  VAL B CG2 1 
ATOM   7282  N  N   . GLY B  1 403 ? -8.737  11.187  67.342  1.00 36.27  ? 403  GLY B N   1 
ATOM   7283  C  CA  . GLY B  1 403 ? -8.999  12.198  68.342  1.00 37.29  ? 403  GLY B CA  1 
ATOM   7284  C  C   . GLY B  1 403 ? -7.901  12.297  69.370  1.00 49.02  ? 403  GLY B C   1 
ATOM   7285  O  O   . GLY B  1 403 ? -7.488  13.390  69.742  1.00 52.55  ? 403  GLY B O   1 
ATOM   7286  N  N   . ASP B  1 404 ? -7.428  11.145  69.827  1.00 48.11  ? 404  ASP B N   1 
ATOM   7287  C  CA  . ASP B  1 404 ? -6.404  11.074  70.856  1.00 47.15  ? 404  ASP B CA  1 
ATOM   7288  C  C   . ASP B  1 404 ? -5.086  11.526  70.311  1.00 43.14  ? 404  ASP B C   1 
ATOM   7289  O  O   . ASP B  1 404 ? -4.355  12.234  70.987  1.00 46.56  ? 404  ASP B O   1 
ATOM   7290  C  CB  . ASP B  1 404 ? -6.232  9.649   71.371  1.00 47.15  ? 404  ASP B CB  1 
ATOM   7291  C  CG  . ASP B  1 404 ? -7.474  9.115   72.020  1.00 52.74  ? 404  ASP B CG  1 
ATOM   7292  O  OD1 . ASP B  1 404 ? -8.428  9.902   72.240  1.00 57.08  ? 404  ASP B OD1 1 
ATOM   7293  O  OD2 . ASP B  1 404 ? -7.492  7.900   72.303  1.00 53.02  ? 404  ASP B OD2 1 
ATOM   7294  N  N   . HIS B  1 405 ? -4.774  11.098  69.094  1.00 43.32  ? 405  HIS B N   1 
ATOM   7295  C  CA  . HIS B  1 405 ? -3.457  11.372  68.530  1.00 47.58  ? 405  HIS B CA  1 
ATOM   7296  C  C   . HIS B  1 405 ? -3.352  12.835  68.179  1.00 53.59  ? 405  HIS B C   1 
ATOM   7297  O  O   . HIS B  1 405 ? -2.326  13.473  68.454  1.00 29.55  ? 405  HIS B O   1 
ATOM   7298  C  CB  . HIS B  1 405 ? -3.210  10.512  67.291  1.00 46.75  ? 405  HIS B CB  1 
ATOM   7299  C  CG  . HIS B  1 405 ? -1.985  10.891  66.516  1.00 45.11  ? 405  HIS B CG  1 
ATOM   7300  N  ND1 . HIS B  1 405 ? -0.784  11.197  67.118  1.00 43.23  ? 405  HIS B ND1 1 
ATOM   7301  C  CD2 . HIS B  1 405 ? -1.774  10.995  65.179  1.00 38.41  ? 405  HIS B CD2 1 
ATOM   7302  C  CE1 . HIS B  1 405 ? 0.111   11.479  66.186  1.00 38.64  ? 405  HIS B CE1 1 
ATOM   7303  N  NE2 . HIS B  1 405 ? -0.466  11.367  65.002  1.00 32.09  ? 405  HIS B NE2 1 
ATOM   7304  N  N   . ASN B  1 406 ? -4.439  13.361  67.604  1.00 54.76  ? 406  ASN B N   1 
ATOM   7305  C  CA  . ASN B  1 406 ? -4.425  14.696  67.029  1.00 30.88  ? 406  ASN B CA  1 
ATOM   7306  C  C   . ASN B  1 406 ? -4.885  15.805  67.957  1.00 39.37  ? 406  ASN B C   1 
ATOM   7307  O  O   . ASN B  1 406 ? -4.556  16.966  67.743  1.00 42.02  ? 406  ASN B O   1 
ATOM   7308  C  CB  . ASN B  1 406 ? -5.228  14.721  65.736  1.00 30.91  ? 406  ASN B CB  1 
ATOM   7309  C  CG  . ASN B  1 406 ? -4.398  14.342  64.542  1.00 33.95  ? 406  ASN B CG  1 
ATOM   7310  O  OD1 . ASN B  1 406 ? -3.599  15.139  64.063  1.00 29.35  ? 406  ASN B OD1 1 
ATOM   7311  N  ND2 . ASN B  1 406 ? -4.580  13.122  64.046  1.00 34.95  ? 406  ASN B ND2 1 
ATOM   7312  N  N   . VAL B  1 407 ? -5.652  15.468  68.984  1.00 39.00  ? 407  VAL B N   1 
ATOM   7313  C  CA  . VAL B  1 407 ? -6.181  16.509  69.855  1.00 35.24  ? 407  VAL B CA  1 
ATOM   7314  C  C   . VAL B  1 407 ? -5.958  16.209  71.334  1.00 65.51  ? 407  VAL B C   1 
ATOM   7315  O  O   . VAL B  1 407 ? -5.409  17.044  72.051  1.00 36.32  ? 407  VAL B O   1 
ATOM   7316  C  CB  . VAL B  1 407 ? -7.689  16.808  69.552  1.00 52.25  ? 407  VAL B CB  1 
ATOM   7317  C  CG1 . VAL B  1 407 ? -8.321  17.725  70.603  1.00 38.69  ? 407  VAL B CG1 1 
ATOM   7318  C  CG2 . VAL B  1 407 ? -7.827  17.429  68.191  1.00 46.37  ? 407  VAL B CG2 1 
ATOM   7319  N  N   . VAL B  1 408 ? -6.352  15.022  71.790  1.00 36.90  ? 408  VAL B N   1 
ATOM   7320  C  CA  . VAL B  1 408 ? -6.465  14.802  73.228  1.00 38.33  ? 408  VAL B CA  1 
ATOM   7321  C  C   . VAL B  1 408 ? -5.129  14.751  73.937  1.00 43.80  ? 408  VAL B C   1 
ATOM   7322  O  O   . VAL B  1 408 ? -4.832  15.600  74.758  1.00 42.30  ? 408  VAL B O   1 
ATOM   7323  C  CB  . VAL B  1 408 ? -7.271  13.562  73.593  1.00 39.55  ? 408  VAL B CB  1 
ATOM   7324  C  CG1 . VAL B  1 408 ? -7.467  13.547  75.080  1.00 41.25  ? 408  VAL B CG1 1 
ATOM   7325  C  CG2 . VAL B  1 408 ? -8.626  13.575  72.895  1.00 40.64  ? 408  VAL B CG2 1 
ATOM   7326  N  N   . CYS B  1 409 ? -4.322  13.753  73.622  1.00 47.70  ? 409  CYS B N   1 
ATOM   7327  C  CA  . CYS B  1 409 ? -2.987  13.651  74.204  1.00 49.24  ? 409  CYS B CA  1 
ATOM   7328  C  C   . CYS B  1 409 ? -2.081  14.878  74.012  1.00 52.18  ? 409  CYS B C   1 
ATOM   7329  O  O   . CYS B  1 409 ? -1.229  15.135  74.859  1.00 59.62  ? 409  CYS B O   1 
ATOM   7330  C  CB  . CYS B  1 409 ? -2.289  12.387  73.712  1.00 45.30  ? 409  CYS B CB  1 
ATOM   7331  S  SG  . CYS B  1 409 ? -3.280  10.910  73.975  1.00 38.20  ? 409  CYS B SG  1 
ATOM   7332  N  N   . PRO B  1 410 ? -2.229  15.614  72.891  1.00 44.13  ? 410  PRO B N   1 
ATOM   7333  C  CA  . PRO B  1 410 ? -1.534  16.904  72.819  1.00 38.83  ? 410  PRO B CA  1 
ATOM   7334  C  C   . PRO B  1 410 ? -1.985  17.890  73.905  1.00 42.23  ? 410  PRO B C   1 
ATOM   7335  O  O   . PRO B  1 410 ? -1.146  18.516  74.565  1.00 43.55  ? 410  PRO B O   1 
ATOM   7336  C  CB  . PRO B  1 410 ? -1.925  17.417  71.438  1.00 38.61  ? 410  PRO B CB  1 
ATOM   7337  C  CG  . PRO B  1 410 ? -2.103  16.179  70.625  1.00 31.30  ? 410  PRO B CG  1 
ATOM   7338  C  CD  . PRO B  1 410 ? -2.687  15.171  71.558  1.00 44.68  ? 410  PRO B CD  1 
ATOM   7339  N  N   . VAL B  1 411 ? -3.296  18.023  74.084  1.00 45.62  ? 411  VAL B N   1 
ATOM   7340  C  CA  . VAL B  1 411 ? -3.846  18.830  75.166  1.00 37.97  ? 411  VAL B CA  1 
ATOM   7341  C  C   . VAL B  1 411 ? -3.299  18.362  76.507  1.00 45.29  ? 411  VAL B C   1 
ATOM   7342  O  O   . VAL B  1 411 ? -2.850  19.163  77.303  1.00 39.25  ? 411  VAL B O   1 
ATOM   7343  C  CB  . VAL B  1 411 ? -5.381  18.762  75.183  1.00 48.75  ? 411  VAL B CB  1 
ATOM   7344  C  CG1 . VAL B  1 411 ? -5.939  19.490  76.379  1.00 41.85  ? 411  VAL B CG1 1 
ATOM   7345  C  CG2 . VAL B  1 411 ? -5.920  19.365  73.925  1.00 39.24  ? 411  VAL B CG2 1 
ATOM   7346  N  N   . ALA B  1 412 ? -3.333  17.053  76.734  1.00 45.37  ? 412  ALA B N   1 
ATOM   7347  C  CA  . ALA B  1 412 ? -2.786  16.441  77.939  1.00 41.63  ? 412  ALA B CA  1 
ATOM   7348  C  C   . ALA B  1 412 ? -1.371  16.915  78.173  1.00 42.54  ? 412  ALA B C   1 
ATOM   7349  O  O   . ALA B  1 412 ? -1.069  17.484  79.224  1.00 45.18  ? 412  ALA B O   1 
ATOM   7350  C  CB  . ALA B  1 412 ? -2.795  14.945  77.809  1.00 43.01  ? 412  ALA B CB  1 
ATOM   7351  N  N   . GLN B  1 413 ? -0.509  16.692  77.186  1.00 44.42  ? 413  GLN B N   1 
ATOM   7352  C  CA  . GLN B  1 413 ? 0.889   17.067  77.324  1.00 50.93  ? 413  GLN B CA  1 
ATOM   7353  C  C   . GLN B  1 413 ? 1.021   18.541  77.652  1.00 49.55  ? 413  GLN B C   1 
ATOM   7354  O  O   . GLN B  1 413 ? 1.779   18.909  78.547  1.00 57.50  ? 413  GLN B O   1 
ATOM   7355  C  CB  . GLN B  1 413 ? 1.714   16.729  76.083  1.00 55.27  ? 413  GLN B CB  1 
ATOM   7356  C  CG  . GLN B  1 413 ? 3.209   16.664  76.387  1.00 61.92  ? 413  GLN B CG  1 
ATOM   7357  C  CD  . GLN B  1 413 ? 4.080   16.561  75.147  1.00 71.82  ? 413  GLN B CD  1 
ATOM   7358  O  OE1 . GLN B  1 413 ? 3.589   16.589  74.015  1.00 73.39  ? 413  GLN B OE1 1 
ATOM   7359  N  NE2 . GLN B  1 413 ? 5.390   16.449  75.358  1.00 76.30  ? 413  GLN B NE2 1 
ATOM   7360  N  N   . LEU B  1 414 ? 0.268   19.385  76.961  1.00 42.72  ? 414  LEU B N   1 
ATOM   7361  C  CA  . LEU B  1 414 ? 0.365   20.807  77.254  1.00 42.29  ? 414  LEU B CA  1 
ATOM   7362  C  C   . LEU B  1 414 ? -0.054  21.115  78.693  1.00 42.30  ? 414  LEU B C   1 
ATOM   7363  O  O   . LEU B  1 414 ? 0.604   21.880  79.374  1.00 39.14  ? 414  LEU B O   1 
ATOM   7364  C  CB  . LEU B  1 414 ? -0.436  21.646  76.264  1.00 36.54  ? 414  LEU B CB  1 
ATOM   7365  C  CG  . LEU B  1 414 ? -0.206  23.148  76.424  1.00 41.10  ? 414  LEU B CG  1 
ATOM   7366  C  CD1 . LEU B  1 414 ? 1.250   23.522  76.166  1.00 35.69  ? 414  LEU B CD1 1 
ATOM   7367  C  CD2 . LEU B  1 414 ? -1.138  23.913  75.508  1.00 37.43  ? 414  LEU B CD2 1 
ATOM   7368  N  N   . ALA B  1 415 ? -1.134  20.503  79.163  1.00 40.04  ? 415  ALA B N   1 
ATOM   7369  C  CA  . ALA B  1 415 ? -1.664  20.841  80.469  1.00 43.26  ? 415  ALA B CA  1 
ATOM   7370  C  C   . ALA B  1 415 ? -0.643  20.450  81.497  1.00 42.35  ? 415  ALA B C   1 
ATOM   7371  O  O   . ALA B  1 415 ? -0.316  21.239  82.371  1.00 56.32  ? 415  ALA B O   1 
ATOM   7372  C  CB  . ALA B  1 415 ? -2.964  20.136  80.721  1.00 43.71  ? 415  ALA B CB  1 
ATOM   7373  N  N   . GLY B  1 416 ? -0.123  19.234  81.364  1.00 50.97  ? 416  GLY B N   1 
ATOM   7374  C  CA  . GLY B  1 416 ? 0.889   18.723  82.273  1.00 49.69  ? 416  GLY B CA  1 
ATOM   7375  C  C   . GLY B  1 416 ? 2.116   19.616  82.303  1.00 57.46  ? 416  GLY B C   1 
ATOM   7376  O  O   . GLY B  1 416 ? 2.582   20.009  83.372  1.00 63.72  ? 416  GLY B O   1 
ATOM   7377  N  N   . ARG B  1 417 ? 2.632   19.954  81.126  1.00 59.58  ? 417  ARG B N   1 
ATOM   7378  C  CA  . ARG B  1 417 ? 3.843   20.760  81.040  1.00 58.92  ? 417  ARG B CA  1 
ATOM   7379  C  C   . ARG B  1 417 ? 3.656   22.173  81.597  1.00 53.83  ? 417  ARG B C   1 
ATOM   7380  O  O   . ARG B  1 417 ? 4.550   22.720  82.235  1.00 56.42  ? 417  ARG B O   1 
ATOM   7381  C  CB  . ARG B  1 417 ? 4.364   20.813  79.598  1.00 65.66  ? 417  ARG B CB  1 
ATOM   7382  C  CG  . ARG B  1 417 ? 4.758   19.454  78.994  1.00 73.12  ? 417  ARG B CG  1 
ATOM   7383  C  CD  . ARG B  1 417 ? 5.923   18.820  79.717  1.00 84.74  ? 417  ARG B CD  1 
ATOM   7384  N  NE  . ARG B  1 417 ? 6.743   19.823  80.391  1.00 98.49  ? 417  ARG B NE  1 
ATOM   7385  C  CZ  . ARG B  1 417 ? 7.781   19.545  81.172  1.00 107.90 ? 417  ARG B CZ  1 
ATOM   7386  N  NH1 . ARG B  1 417 ? 8.150   18.285  81.372  1.00 111.54 ? 417  ARG B NH1 1 
ATOM   7387  N  NH2 . ARG B  1 417 ? 8.456   20.528  81.749  1.00 110.89 ? 417  ARG B NH2 1 
ATOM   7388  N  N   . LEU B  1 418 ? 2.493   22.763  81.359  1.00 49.30  ? 418  LEU B N   1 
ATOM   7389  C  CA  . LEU B  1 418 ? 2.236   24.115  81.824  1.00 49.05  ? 418  LEU B CA  1 
ATOM   7390  C  C   . LEU B  1 418 ? 2.037   24.096  83.331  1.00 55.81  ? 418  LEU B C   1 
ATOM   7391  O  O   . LEU B  1 418 ? 2.457   25.007  84.037  1.00 62.58  ? 418  LEU B O   1 
ATOM   7392  C  CB  . LEU B  1 418 ? 1.007   24.717  81.137  1.00 48.07  ? 418  LEU B CB  1 
ATOM   7393  C  CG  . LEU B  1 418 ? 0.982   24.896  79.613  1.00 46.60  ? 418  LEU B CG  1 
ATOM   7394  C  CD1 . LEU B  1 418 ? -0.271  25.631  79.177  1.00 46.78  ? 418  LEU B CD1 1 
ATOM   7395  C  CD2 . LEU B  1 418 ? 2.204   25.616  79.116  1.00 39.30  ? 418  LEU B CD2 1 
ATOM   7396  N  N   . ALA B  1 419 ? 1.400   23.048  83.828  1.00 54.86  ? 419  ALA B N   1 
ATOM   7397  C  CA  . ALA B  1 419 ? 1.150   22.948  85.256  1.00 59.75  ? 419  ALA B CA  1 
ATOM   7398  C  C   . ALA B  1 419 ? 2.444   22.644  86.003  1.00 62.14  ? 419  ALA B C   1 
ATOM   7399  O  O   . ALA B  1 419 ? 2.582   22.962  87.183  1.00 67.18  ? 419  ALA B O   1 
ATOM   7400  C  CB  . ALA B  1 419 ? 0.091   21.890  85.543  1.00 58.89  ? 419  ALA B CB  1 
ATOM   7401  N  N   . ALA B  1 420 ? 3.395   22.040  85.298  1.00 60.77  ? 420  ALA B N   1 
ATOM   7402  C  CA  . ALA B  1 420 ? 4.667   21.646  85.896  1.00 66.56  ? 420  ALA B CA  1 
ATOM   7403  C  C   . ALA B  1 420 ? 5.710   22.750  85.811  1.00 71.35  ? 420  ALA B C   1 
ATOM   7404  O  O   . ALA B  1 420 ? 6.756   22.676  86.455  1.00 73.05  ? 420  ALA B O   1 
ATOM   7405  C  CB  . ALA B  1 420 ? 5.193   20.389  85.230  1.00 68.77  ? 420  ALA B CB  1 
ATOM   7406  N  N   . GLN B  1 421 ? 5.434   23.761  84.995  1.00 75.48  ? 421  GLN B N   1 
ATOM   7407  C  CA  . GLN B  1 421 ? 6.348   24.884  84.833  1.00 79.11  ? 421  GLN B CA  1 
ATOM   7408  C  C   . GLN B  1 421 ? 5.876   26.056  85.670  1.00 83.44  ? 421  GLN B C   1 
ATOM   7409  O  O   . GLN B  1 421 ? 6.452   27.146  85.616  1.00 80.36  ? 421  GLN B O   1 
ATOM   7410  C  CB  . GLN B  1 421 ? 6.423   25.306  83.373  1.00 80.64  ? 421  GLN B CB  1 
ATOM   7411  C  CG  . GLN B  1 421 ? 7.820   25.315  82.819  1.00 81.48  ? 421  GLN B CG  1 
ATOM   7412  C  CD  . GLN B  1 421 ? 8.401   23.926  82.702  1.00 75.99  ? 421  GLN B CD  1 
ATOM   7413  O  OE1 . GLN B  1 421 ? 7.669   22.945  82.552  1.00 71.88  ? 421  GLN B OE1 1 
ATOM   7414  N  NE2 . GLN B  1 421 ? 9.726   23.832  82.771  1.00 75.22  ? 421  GLN B NE2 1 
ATOM   7415  N  N   . GLY B  1 422 ? 4.805   25.820  86.424  1.00 88.73  ? 422  GLY B N   1 
ATOM   7416  C  CA  . GLY B  1 422 ? 4.294   26.788  87.374  1.00 87.62  ? 422  GLY B CA  1 
ATOM   7417  C  C   . GLY B  1 422 ? 3.104   27.604  86.908  1.00 81.42  ? 422  GLY B C   1 
ATOM   7418  O  O   . GLY B  1 422 ? 2.921   28.730  87.360  1.00 88.34  ? 422  GLY B O   1 
ATOM   7419  N  N   . ALA B  1 423 ? 2.281   27.055  86.023  1.00 70.69  ? 423  ALA B N   1 
ATOM   7420  C  CA  . ALA B  1 423 ? 1.111   27.801  85.564  1.00 67.98  ? 423  ALA B CA  1 
ATOM   7421  C  C   . ALA B  1 423 ? -0.188  27.272  86.152  1.00 64.26  ? 423  ALA B C   1 
ATOM   7422  O  O   . ALA B  1 423 ? -0.320  26.079  86.422  1.00 66.61  ? 423  ALA B O   1 
ATOM   7423  C  CB  . ALA B  1 423 ? 1.038   27.812  84.048  1.00 70.67  ? 423  ALA B CB  1 
ATOM   7424  N  N   . ARG B  1 424 ? -1.140  28.173  86.364  1.00 64.87  ? 424  ARG B N   1 
ATOM   7425  C  CA  . ARG B  1 424 ? -2.481  27.772  86.752  1.00 69.72  ? 424  ARG B CA  1 
ATOM   7426  C  C   . ARG B  1 424 ? -3.183  27.252  85.512  1.00 63.51  ? 424  ARG B C   1 
ATOM   7427  O  O   . ARG B  1 424 ? -3.326  27.967  84.525  1.00 66.45  ? 424  ARG B O   1 
ATOM   7428  C  CB  . ARG B  1 424 ? -3.264  28.947  87.330  1.00 81.65  ? 424  ARG B CB  1 
ATOM   7429  C  CG  . ARG B  1 424 ? -2.977  29.278  88.788  1.00 93.47  ? 424  ARG B CG  1 
ATOM   7430  C  CD  . ARG B  1 424 ? -4.123  30.131  89.333  1.00 104.72 ? 424  ARG B CD  1 
ATOM   7431  N  NE  . ARG B  1 424 ? -3.877  30.695  90.661  1.00 111.40 ? 424  ARG B NE  1 
ATOM   7432  C  CZ  . ARG B  1 424 ? -3.962  30.012  91.799  1.00 113.01 ? 424  ARG B CZ  1 
ATOM   7433  N  NH1 . ARG B  1 424 ? -4.264  28.719  91.778  1.00 111.77 ? 424  ARG B NH1 1 
ATOM   7434  N  NH2 . ARG B  1 424 ? -3.736  30.620  92.959  1.00 114.80 ? 424  ARG B NH2 1 
ATOM   7435  N  N   . VAL B  1 425 ? -3.611  25.999  85.563  1.00 58.60  ? 425  VAL B N   1 
ATOM   7436  C  CA  . VAL B  1 425 ? -4.219  25.345  84.416  1.00 57.69  ? 425  VAL B CA  1 
ATOM   7437  C  C   . VAL B  1 425 ? -5.530  24.741  84.874  1.00 63.13  ? 425  VAL B C   1 
ATOM   7438  O  O   . VAL B  1 425 ? -5.554  23.996  85.852  1.00 63.20  ? 425  VAL B O   1 
ATOM   7439  C  CB  . VAL B  1 425 ? -3.316  24.197  83.883  1.00 56.07  ? 425  VAL B CB  1 
ATOM   7440  C  CG1 . VAL B  1 425 ? -4.035  23.380  82.820  1.00 53.71  ? 425  VAL B CG1 1 
ATOM   7441  C  CG2 . VAL B  1 425 ? -1.990  24.733  83.364  1.00 48.24  ? 425  VAL B CG2 1 
ATOM   7442  N  N   . TYR B  1 426 ? -6.617  25.071  84.187  1.00 65.41  ? 426  TYR B N   1 
ATOM   7443  C  CA  . TYR B  1 426 ? -7.898  24.432  84.431  1.00 56.45  ? 426  TYR B CA  1 
ATOM   7444  C  C   . TYR B  1 426 ? -8.240  23.638  83.192  1.00 67.78  ? 426  TYR B C   1 
ATOM   7445  O  O   . TYR B  1 426 ? -7.988  24.080  82.075  1.00 70.52  ? 426  TYR B O   1 
ATOM   7446  C  CB  . TYR B  1 426 ? -8.983  25.465  84.692  1.00 62.90  ? 426  TYR B CB  1 
ATOM   7447  C  CG  . TYR B  1 426 ? -8.737  26.320  85.909  1.00 69.07  ? 426  TYR B CG  1 
ATOM   7448  C  CD1 . TYR B  1 426 ? -7.767  27.316  85.896  1.00 73.03  ? 426  TYR B CD1 1 
ATOM   7449  C  CD2 . TYR B  1 426 ? -9.479  26.143  87.068  1.00 73.57  ? 426  TYR B CD2 1 
ATOM   7450  C  CE1 . TYR B  1 426 ? -7.533  28.108  87.004  1.00 77.80  ? 426  TYR B CE1 1 
ATOM   7451  C  CE2 . TYR B  1 426 ? -9.250  26.930  88.185  1.00 81.09  ? 426  TYR B CE2 1 
ATOM   7452  C  CZ  . TYR B  1 426 ? -8.277  27.914  88.144  1.00 83.11  ? 426  TYR B CZ  1 
ATOM   7453  O  OH  . TYR B  1 426 ? -8.038  28.709  89.243  1.00 88.19  ? 426  TYR B OH  1 
ATOM   7454  N  N   . ALA B  1 427 ? -8.813  22.461  83.382  1.00 64.54  ? 427  ALA B N   1 
ATOM   7455  C  CA  . ALA B  1 427 ? -9.055  21.574  82.257  1.00 62.49  ? 427  ALA B CA  1 
ATOM   7456  C  C   . ALA B  1 427 ? -10.513 21.155  82.161  1.00 67.19  ? 427  ALA B C   1 
ATOM   7457  O  O   . ALA B  1 427 ? -11.231 21.127  83.157  1.00 70.02  ? 427  ALA B O   1 
ATOM   7458  C  CB  . ALA B  1 427 ? -8.155  20.357  82.346  1.00 60.47  ? 427  ALA B CB  1 
ATOM   7459  N  N   . TYR B  1 428 ? -10.953 20.825  80.956  1.00 68.61  ? 428  TYR B N   1 
ATOM   7460  C  CA  . TYR B  1 428 ? -12.330 20.398  80.790  1.00 55.81  ? 428  TYR B CA  1 
ATOM   7461  C  C   . TYR B  1 428 ? -12.538 19.371  79.678  1.00 61.66  ? 428  TYR B C   1 
ATOM   7462  O  O   . TYR B  1 428 ? -11.828 19.357  78.668  1.00 52.12  ? 428  TYR B O   1 
ATOM   7463  C  CB  . TYR B  1 428 ? -13.206 21.616  80.520  1.00 57.16  ? 428  TYR B CB  1 
ATOM   7464  C  CG  . TYR B  1 428 ? -12.969 22.243  79.169  1.00 55.34  ? 428  TYR B CG  1 
ATOM   7465  C  CD1 . TYR B  1 428 ? -13.616 21.762  78.034  1.00 67.15  ? 428  TYR B CD1 1 
ATOM   7466  C  CD2 . TYR B  1 428 ? -12.113 23.324  79.024  1.00 72.20  ? 428  TYR B CD2 1 
ATOM   7467  C  CE1 . TYR B  1 428 ? -13.398 22.321  76.788  1.00 66.06  ? 428  TYR B CE1 1 
ATOM   7468  C  CE2 . TYR B  1 428 ? -11.893 23.905  77.775  1.00 68.32  ? 428  TYR B CE2 1 
ATOM   7469  C  CZ  . TYR B  1 428 ? -12.538 23.395  76.661  1.00 66.09  ? 428  TYR B CZ  1 
ATOM   7470  O  OH  . TYR B  1 428 ? -12.335 23.956  75.418  1.00 62.64  ? 428  TYR B OH  1 
ATOM   7471  N  N   . ILE B  1 429 ? -13.545 18.527  79.851  1.00 61.60  ? 429  ILE B N   1 
ATOM   7472  C  CA  . ILE B  1 429 ? -14.057 17.739  78.740  1.00 62.60  ? 429  ILE B CA  1 
ATOM   7473  C  C   . ILE B  1 429 ? -15.526 18.112  78.497  1.00 68.64  ? 429  ILE B C   1 
ATOM   7474  O  O   . ILE B  1 429 ? -16.324 18.196  79.432  1.00 75.75  ? 429  ILE B O   1 
ATOM   7475  C  CB  . ILE B  1 429 ? -13.890 16.235  78.984  1.00 61.34  ? 429  ILE B CB  1 
ATOM   7476  C  CG1 . ILE B  1 429 ? -14.616 15.431  77.905  1.00 61.41  ? 429  ILE B CG1 1 
ATOM   7477  C  CG2 . ILE B  1 429 ? -14.412 15.864  80.352  1.00 66.90  ? 429  ILE B CG2 1 
ATOM   7478  C  CD1 . ILE B  1 429 ? -14.597 13.928  78.144  1.00 62.40  ? 429  ILE B CD1 1 
ATOM   7479  N  N   . PHE B  1 430 ? -15.868 18.362  77.238  1.00 64.55  ? 430  PHE B N   1 
ATOM   7480  C  CA  . PHE B  1 430 ? -17.204 18.798  76.856  1.00 63.95  ? 430  PHE B CA  1 
ATOM   7481  C  C   . PHE B  1 430 ? -17.981 17.584  76.345  1.00 64.73  ? 430  PHE B C   1 
ATOM   7482  O  O   . PHE B  1 430 ? -17.650 17.023  75.299  1.00 59.65  ? 430  PHE B O   1 
ATOM   7483  C  CB  . PHE B  1 430 ? -17.076 19.870  75.773  1.00 60.85  ? 430  PHE B CB  1 
ATOM   7484  C  CG  . PHE B  1 430 ? -18.364 20.569  75.425  1.00 67.03  ? 430  PHE B CG  1 
ATOM   7485  C  CD1 . PHE B  1 430 ? -19.211 20.059  74.447  1.00 70.41  ? 430  PHE B CD1 1 
ATOM   7486  C  CD2 . PHE B  1 430 ? -18.705 21.765  76.038  1.00 69.76  ? 430  PHE B CD2 1 
ATOM   7487  C  CE1 . PHE B  1 430 ? -20.391 20.716  74.105  1.00 71.94  ? 430  PHE B CE1 1 
ATOM   7488  C  CE2 . PHE B  1 430 ? -19.883 22.427  75.702  1.00 72.23  ? 430  PHE B CE2 1 
ATOM   7489  C  CZ  . PHE B  1 430 ? -20.726 21.898  74.734  1.00 71.60  ? 430  PHE B CZ  1 
ATOM   7490  N  N   . GLU B  1 431 ? -19.001 17.165  77.089  1.00 60.95  ? 431  GLU B N   1 
ATOM   7491  C  CA  . GLU B  1 431 ? -19.709 15.930  76.764  1.00 73.25  ? 431  GLU B CA  1 
ATOM   7492  C  C   . GLU B  1 431 ? -21.140 16.126  76.227  1.00 74.88  ? 431  GLU B C   1 
ATOM   7493  O  O   . GLU B  1 431 ? -21.876 15.152  76.052  1.00 72.05  ? 431  GLU B O   1 
ATOM   7494  C  CB  . GLU B  1 431 ? -19.749 14.999  77.981  1.00 73.90  ? 431  GLU B CB  1 
ATOM   7495  C  CG  . GLU B  1 431 ? -18.403 14.511  78.491  1.00 74.11  ? 431  GLU B CG  1 
ATOM   7496  C  CD  . GLU B  1 431 ? -18.552 13.458  79.594  1.00 81.36  ? 431  GLU B CD  1 
ATOM   7497  O  OE1 . GLU B  1 431 ? -19.691 13.278  80.086  1.00 84.41  ? 431  GLU B OE1 1 
ATOM   7498  O  OE2 . GLU B  1 431 ? -17.541 12.808  79.963  1.00 79.02  ? 431  GLU B OE2 1 
ATOM   7499  N  N   . HIS B  1 432 ? -21.544 17.365  75.964  1.00 74.56  ? 432  HIS B N   1 
ATOM   7500  C  CA  . HIS B  1 432 ? -22.913 17.595  75.497  1.00 79.77  ? 432  HIS B CA  1 
ATOM   7501  C  C   . HIS B  1 432 ? -23.057 17.716  73.976  1.00 79.66  ? 432  HIS B C   1 
ATOM   7502  O  O   . HIS B  1 432 ? -22.506 18.620  73.335  1.00 63.16  ? 432  HIS B O   1 
ATOM   7503  C  CB  . HIS B  1 432 ? -23.561 18.796  76.200  1.00 85.70  ? 432  HIS B CB  1 
ATOM   7504  C  CG  . HIS B  1 432 ? -24.923 19.146  75.675  1.00 92.44  ? 432  HIS B CG  1 
ATOM   7505  N  ND1 . HIS B  1 432 ? -25.897 18.200  75.430  1.00 96.83  ? 432  HIS B ND1 1 
ATOM   7506  C  CD2 . HIS B  1 432 ? -25.474 20.340  75.349  1.00 91.11  ? 432  HIS B CD2 1 
ATOM   7507  C  CE1 . HIS B  1 432 ? -26.985 18.795  74.973  1.00 92.01  ? 432  HIS B CE1 1 
ATOM   7508  N  NE2 . HIS B  1 432 ? -26.754 20.094  74.914  1.00 89.56  ? 432  HIS B NE2 1 
ATOM   7509  N  N   . ARG B  1 433 ? -23.815 16.782  73.412  1.00 79.95  ? 433  ARG B N   1 
ATOM   7510  C  CA  . ARG B  1 433 ? -24.209 16.838  72.013  1.00 78.43  ? 433  ARG B CA  1 
ATOM   7511  C  C   . ARG B  1 433 ? -25.422 17.754  71.825  1.00 83.01  ? 433  ARG B C   1 
ATOM   7512  O  O   . ARG B  1 433 ? -26.512 17.487  72.352  1.00 88.43  ? 433  ARG B O   1 
ATOM   7513  C  CB  . ARG B  1 433 ? -24.530 15.433  71.499  1.00 80.27  ? 433  ARG B CB  1 
ATOM   7514  C  CG  . ARG B  1 433 ? -25.316 15.425  70.203  1.00 83.72  ? 433  ARG B CG  1 
ATOM   7515  C  CD  . ARG B  1 433 ? -25.289 14.070  69.526  1.00 64.33  ? 433  ARG B CD  1 
ATOM   7516  N  NE  . ARG B  1 433 ? -25.531 14.210  68.095  1.00 63.55  ? 433  ARG B NE  1 
ATOM   7517  C  CZ  . ARG B  1 433 ? -25.271 13.267  67.199  1.00 73.87  ? 433  ARG B CZ  1 
ATOM   7518  N  NH1 . ARG B  1 433 ? -24.766 12.107  67.590  1.00 77.37  ? 433  ARG B NH1 1 
ATOM   7519  N  NH2 . ARG B  1 433 ? -25.512 13.484  65.915  1.00 71.05  ? 433  ARG B NH2 1 
ATOM   7520  N  N   . ALA B  1 434 ? -25.226 18.837  71.077  1.00 78.78  ? 434  ALA B N   1 
ATOM   7521  C  CA  . ALA B  1 434 ? -26.310 19.767  70.801  1.00 79.37  ? 434  ALA B CA  1 
ATOM   7522  C  C   . ALA B  1 434 ? -27.441 19.069  70.053  1.00 78.96  ? 434  ALA B C   1 
ATOM   7523  O  O   . ALA B  1 434 ? -27.205 18.217  69.193  1.00 75.23  ? 434  ALA B O   1 
ATOM   7524  C  CB  . ALA B  1 434 ? -25.801 20.940  70.010  1.00 79.19  ? 434  ALA B CB  1 
ATOM   7525  N  N   . SER B  1 435 ? -28.670 19.434  70.393  1.00 80.13  ? 435  SER B N   1 
ATOM   7526  C  CA  . SER B  1 435 ? -29.848 18.824  69.795  1.00 81.42  ? 435  SER B CA  1 
ATOM   7527  C  C   . SER B  1 435 ? -30.064 19.324  68.371  1.00 86.87  ? 435  SER B C   1 
ATOM   7528  O  O   . SER B  1 435 ? -30.890 18.789  67.630  1.00 89.50  ? 435  SER B O   1 
ATOM   7529  C  CB  . SER B  1 435 ? -31.076 19.136  70.642  1.00 78.66  ? 435  SER B CB  1 
ATOM   7530  O  OG  . SER B  1 435 ? -31.177 20.533  70.847  1.00 77.80  ? 435  SER B OG  1 
ATOM   7531  N  N   . THR B  1 436 ? -29.317 20.355  67.994  1.00 88.00  ? 436  THR B N   1 
ATOM   7532  C  CA  . THR B  1 436 ? -29.458 20.963  66.677  1.00 89.20  ? 436  THR B CA  1 
ATOM   7533  C  C   . THR B  1 436 ? -28.449 20.403  65.668  1.00 79.85  ? 436  THR B C   1 
ATOM   7534  O  O   . THR B  1 436 ? -28.427 20.817  64.507  1.00 78.24  ? 436  THR B O   1 
ATOM   7535  C  CB  . THR B  1 436 ? -29.306 22.495  66.763  1.00 94.92  ? 436  THR B CB  1 
ATOM   7536  O  OG1 . THR B  1 436 ? -28.312 22.818  67.746  1.00 91.79  ? 436  THR B OG1 1 
ATOM   7537  C  CG2 . THR B  1 436 ? -30.628 23.147  67.153  1.00 73.65  ? 436  THR B CG2 1 
ATOM   7538  N  N   . LEU B  1 437 ? -27.631 19.452  66.114  1.00 73.28  ? 437  LEU B N   1 
ATOM   7539  C  CA  . LEU B  1 437 ? -26.552 18.889  65.296  1.00 70.06  ? 437  LEU B CA  1 
ATOM   7540  C  C   . LEU B  1 437 ? -27.037 18.076  64.084  1.00 70.28  ? 437  LEU B C   1 
ATOM   7541  O  O   . LEU B  1 437 ? -27.822 17.138  64.225  1.00 68.37  ? 437  LEU B O   1 
ATOM   7542  C  CB  . LEU B  1 437 ? -25.629 18.033  66.177  1.00 70.52  ? 437  LEU B CB  1 
ATOM   7543  C  CG  . LEU B  1 437 ? -24.289 17.537  65.618  1.00 66.05  ? 437  LEU B CG  1 
ATOM   7544  C  CD1 . LEU B  1 437 ? -23.352 18.691  65.287  1.00 64.35  ? 437  LEU B CD1 1 
ATOM   7545  C  CD2 . LEU B  1 437 ? -23.631 16.587  66.597  1.00 63.67  ? 437  LEU B CD2 1 
ATOM   7546  N  N   . THR B  1 438 ? -26.546 18.423  62.895  1.00 74.48  ? 438  THR B N   1 
ATOM   7547  C  CA  . THR B  1 438 ? -26.960 17.735  61.668  1.00 81.30  ? 438  THR B CA  1 
ATOM   7548  C  C   . THR B  1 438 ? -26.099 16.499  61.349  1.00 82.86  ? 438  THR B C   1 
ATOM   7549  O  O   . THR B  1 438 ? -26.439 15.698  60.468  1.00 79.85  ? 438  THR B O   1 
ATOM   7550  C  CB  . THR B  1 438 ? -26.953 18.690  60.458  1.00 82.28  ? 438  THR B CB  1 
ATOM   7551  O  OG1 . THR B  1 438 ? -27.089 20.042  60.915  1.00 87.36  ? 438  THR B OG1 1 
ATOM   7552  C  CG2 . THR B  1 438 ? -28.095 18.348  59.493  1.00 79.74  ? 438  THR B CG2 1 
ATOM   7553  N  N   . TRP B  1 439 ? -24.986 16.356  62.067  1.00 81.78  ? 439  TRP B N   1 
ATOM   7554  C  CA  . TRP B  1 439 ? -24.093 15.209  61.909  1.00 75.47  ? 439  TRP B CA  1 
ATOM   7555  C  C   . TRP B  1 439 ? -24.754 13.966  62.490  1.00 74.90  ? 439  TRP B C   1 
ATOM   7556  O  O   . TRP B  1 439 ? -25.604 14.081  63.372  1.00 80.61  ? 439  TRP B O   1 
ATOM   7557  C  CB  . TRP B  1 439 ? -22.731 15.480  62.573  1.00 71.84  ? 439  TRP B CB  1 
ATOM   7558  C  CG  . TRP B  1 439 ? -21.937 16.518  61.852  1.00 52.46  ? 439  TRP B CG  1 
ATOM   7559  C  CD1 . TRP B  1 439 ? -21.756 17.815  62.225  1.00 70.25  ? 439  TRP B CD1 1 
ATOM   7560  C  CD2 . TRP B  1 439 ? -21.240 16.357  60.613  1.00 59.92  ? 439  TRP B CD2 1 
ATOM   7561  N  NE1 . TRP B  1 439 ? -20.981 18.471  61.302  1.00 50.58  ? 439  TRP B NE1 1 
ATOM   7562  C  CE2 . TRP B  1 439 ? -20.651 17.599  60.300  1.00 49.40  ? 439  TRP B CE2 1 
ATOM   7563  C  CE3 . TRP B  1 439 ? -21.045 15.278  59.742  1.00 58.00  ? 439  TRP B CE3 1 
ATOM   7564  C  CZ2 . TRP B  1 439 ? -19.876 17.795  59.152  1.00 52.11  ? 439  TRP B CZ2 1 
ATOM   7565  C  CZ3 . TRP B  1 439 ? -20.272 15.473  58.598  1.00 54.61  ? 439  TRP B CZ3 1 
ATOM   7566  C  CH2 . TRP B  1 439 ? -19.696 16.722  58.317  1.00 51.12  ? 439  TRP B CH2 1 
ATOM   7567  N  N   . PRO B  1 440 ? -24.370 12.776  61.994  1.00 69.28  ? 440  PRO B N   1 
ATOM   7568  C  CA  . PRO B  1 440 ? -25.008 11.509  62.371  1.00 70.97  ? 440  PRO B CA  1 
ATOM   7569  C  C   . PRO B  1 440 ? -24.945 11.204  63.852  1.00 72.22  ? 440  PRO B C   1 
ATOM   7570  O  O   . PRO B  1 440 ? -24.216 11.850  64.611  1.00 68.04  ? 440  PRO B O   1 
ATOM   7571  C  CB  . PRO B  1 440 ? -24.181 10.462  61.632  1.00 56.97  ? 440  PRO B CB  1 
ATOM   7572  C  CG  . PRO B  1 440 ? -23.571 11.175  60.532  1.00 64.06  ? 440  PRO B CG  1 
ATOM   7573  C  CD  . PRO B  1 440 ? -23.334 12.574  60.970  1.00 63.99  ? 440  PRO B CD  1 
ATOM   7574  N  N   . LEU B  1 441 ? -25.711 10.194  64.245  1.00 78.31  ? 441  LEU B N   1 
ATOM   7575  C  CA  . LEU B  1 441 ? -25.760 9.755   65.627  1.00 81.74  ? 441  LEU B CA  1 
ATOM   7576  C  C   . LEU B  1 441 ? -24.424 9.158   66.107  1.00 78.46  ? 441  LEU B C   1 
ATOM   7577  O  O   . LEU B  1 441 ? -24.083 9.237   67.289  1.00 78.92  ? 441  LEU B O   1 
ATOM   7578  C  CB  . LEU B  1 441 ? -26.908 8.758   65.802  1.00 83.22  ? 441  LEU B CB  1 
ATOM   7579  C  CG  . LEU B  1 441 ? -27.372 8.466   67.230  1.00 80.80  ? 441  LEU B CG  1 
ATOM   7580  C  CD1 . LEU B  1 441 ? -27.249 9.711   68.103  1.00 77.88  ? 441  LEU B CD1 1 
ATOM   7581  C  CD2 . LEU B  1 441 ? -28.810 7.948   67.218  1.00 78.67  ? 441  LEU B CD2 1 
ATOM   7582  N  N   . TRP B  1 442 ? -23.658 8.580   65.190  1.00 71.93  ? 442  TRP B N   1 
ATOM   7583  C  CA  . TRP B  1 442 ? -22.429 7.908   65.586  1.00 68.95  ? 442  TRP B CA  1 
ATOM   7584  C  C   . TRP B  1 442 ? -21.294 8.858   65.957  1.00 66.57  ? 442  TRP B C   1 
ATOM   7585  O  O   . TRP B  1 442 ? -20.477 8.549   66.822  1.00 69.24  ? 442  TRP B O   1 
ATOM   7586  C  CB  . TRP B  1 442 ? -21.978 6.894   64.526  1.00 70.73  ? 442  TRP B CB  1 
ATOM   7587  C  CG  . TRP B  1 442 ? -21.435 7.463   63.234  1.00 72.32  ? 442  TRP B CG  1 
ATOM   7588  C  CD1 . TRP B  1 442 ? -22.122 7.641   62.065  1.00 74.80  ? 442  TRP B CD1 1 
ATOM   7589  C  CD2 . TRP B  1 442 ? -20.084 7.878   62.970  1.00 64.65  ? 442  TRP B CD2 1 
ATOM   7590  N  NE1 . TRP B  1 442 ? -21.288 8.158   61.099  1.00 70.17  ? 442  TRP B NE1 1 
ATOM   7591  C  CE2 . TRP B  1 442 ? -20.034 8.313   61.629  1.00 65.46  ? 442  TRP B CE2 1 
ATOM   7592  C  CE3 . TRP B  1 442 ? -18.920 7.937   63.740  1.00 58.25  ? 442  TRP B CE3 1 
ATOM   7593  C  CZ2 . TRP B  1 442 ? -18.867 8.797   61.044  1.00 65.79  ? 442  TRP B CZ2 1 
ATOM   7594  C  CZ3 . TRP B  1 442 ? -17.763 8.419   63.156  1.00 60.21  ? 442  TRP B CZ3 1 
ATOM   7595  C  CH2 . TRP B  1 442 ? -17.744 8.841   61.821  1.00 63.46  ? 442  TRP B CH2 1 
ATOM   7596  N  N   . MET B  1 443 ? -21.252 10.017  65.314  1.00 65.33  ? 443  MET B N   1 
ATOM   7597  C  CA  . MET B  1 443 ? -20.146 10.949  65.499  1.00 65.27  ? 443  MET B CA  1 
ATOM   7598  C  C   . MET B  1 443 ? -20.160 11.609  66.878  1.00 69.27  ? 443  MET B C   1 
ATOM   7599  O  O   . MET B  1 443 ? -19.195 12.273  67.262  1.00 65.79  ? 443  MET B O   1 
ATOM   7600  C  CB  . MET B  1 443 ? -20.131 11.998  64.380  1.00 62.73  ? 443  MET B CB  1 
ATOM   7601  C  CG  . MET B  1 443 ? -19.979 11.378  62.996  1.00 60.25  ? 443  MET B CG  1 
ATOM   7602  S  SD  . MET B  1 443 ? -19.715 12.540  61.646  1.00 54.26  ? 443  MET B SD  1 
ATOM   7603  C  CE  . MET B  1 443 ? -18.936 13.880  62.531  1.00 72.38  ? 443  MET B CE  1 
ATOM   7604  N  N   . GLY B  1 444 ? -21.253 11.421  67.615  1.00 73.90  ? 444  GLY B N   1 
ATOM   7605  C  CA  . GLY B  1 444 ? -21.366 11.912  68.980  1.00 76.97  ? 444  GLY B CA  1 
ATOM   7606  C  C   . GLY B  1 444 ? -21.207 13.415  69.166  1.00 73.44  ? 444  GLY B C   1 
ATOM   7607  O  O   . GLY B  1 444 ? -21.940 14.212  68.577  1.00 63.08  ? 444  GLY B O   1 
ATOM   7608  N  N   . VAL B  1 445 ? -20.251 13.801  70.007  1.00 74.01  ? 445  VAL B N   1 
ATOM   7609  C  CA  . VAL B  1 445 ? -19.927 15.209  70.199  1.00 69.06  ? 445  VAL B CA  1 
ATOM   7610  C  C   . VAL B  1 445 ? -18.656 15.526  69.439  1.00 62.08  ? 445  VAL B C   1 
ATOM   7611  O  O   . VAL B  1 445 ? -17.562 15.300  69.946  1.00 61.62  ? 445  VAL B O   1 
ATOM   7612  C  CB  . VAL B  1 445 ? -19.705 15.538  71.666  1.00 68.06  ? 445  VAL B CB  1 
ATOM   7613  C  CG1 . VAL B  1 445 ? -19.381 17.018  71.822  1.00 63.38  ? 445  VAL B CG1 1 
ATOM   7614  C  CG2 . VAL B  1 445 ? -20.936 15.155  72.467  1.00 75.35  ? 445  VAL B CG2 1 
ATOM   7615  N  N   . PRO B  1 446 ? -18.803 16.057  68.216  1.00 58.86  ? 446  PRO B N   1 
ATOM   7616  C  CA  . PRO B  1 446 ? -17.701 16.166  67.266  1.00 56.91  ? 446  PRO B CA  1 
ATOM   7617  C  C   . PRO B  1 446 ? -16.828 17.387  67.528  1.00 60.83  ? 446  PRO B C   1 
ATOM   7618  O  O   . PRO B  1 446 ? -17.178 18.236  68.351  1.00 67.76  ? 446  PRO B O   1 
ATOM   7619  C  CB  . PRO B  1 446 ? -18.419 16.315  65.913  1.00 49.29  ? 446  PRO B CB  1 
ATOM   7620  C  CG  . PRO B  1 446 ? -19.891 16.285  66.208  1.00 56.67  ? 446  PRO B CG  1 
ATOM   7621  C  CD  . PRO B  1 446 ? -20.037 16.617  67.650  1.00 58.38  ? 446  PRO B CD  1 
ATOM   7622  N  N   . HIS B  1 447 ? -15.701 17.455  66.824  1.00 55.33  ? 447  HIS B N   1 
ATOM   7623  C  CA  . HIS B  1 447 ? -14.777 18.577  66.906  1.00 54.43  ? 447  HIS B CA  1 
ATOM   7624  C  C   . HIS B  1 447 ? -15.474 19.903  66.611  1.00 59.50  ? 447  HIS B C   1 
ATOM   7625  O  O   . HIS B  1 447 ? -16.103 20.059  65.565  1.00 61.66  ? 447  HIS B O   1 
ATOM   7626  C  CB  . HIS B  1 447 ? -13.657 18.364  65.893  1.00 50.47  ? 447  HIS B CB  1 
ATOM   7627  C  CG  . HIS B  1 447 ? -12.477 19.265  66.083  1.00 51.00  ? 447  HIS B CG  1 
ATOM   7628  N  ND1 . HIS B  1 447 ? -11.627 19.164  67.163  1.00 53.93  ? 447  HIS B ND1 1 
ATOM   7629  C  CD2 . HIS B  1 447 ? -11.987 20.263  65.313  1.00 46.56  ? 447  HIS B CD2 1 
ATOM   7630  C  CE1 . HIS B  1 447 ? -10.669 20.069  67.055  1.00 48.78  ? 447  HIS B CE1 1 
ATOM   7631  N  NE2 . HIS B  1 447 ? -10.860 20.743  65.937  1.00 44.26  ? 447  HIS B NE2 1 
ATOM   7632  N  N   . GLY B  1 448 ? -15.367 20.849  67.539  1.00 58.79  ? 448  GLY B N   1 
ATOM   7633  C  CA  . GLY B  1 448 ? -15.827 22.205  67.304  1.00 56.42  ? 448  GLY B CA  1 
ATOM   7634  C  C   . GLY B  1 448 ? -17.307 22.434  67.537  1.00 61.52  ? 448  GLY B C   1 
ATOM   7635  O  O   . GLY B  1 448 ? -17.905 23.322  66.932  1.00 65.23  ? 448  GLY B O   1 
ATOM   7636  N  N   . TYR B  1 449 ? -17.912 21.645  68.415  1.00 61.33  ? 449  TYR B N   1 
ATOM   7637  C  CA  . TYR B  1 449 ? -19.328 21.835  68.698  1.00 63.81  ? 449  TYR B CA  1 
ATOM   7638  C  C   . TYR B  1 449 ? -19.590 22.262  70.126  1.00 64.48  ? 449  TYR B C   1 
ATOM   7639  O  O   . TYR B  1 449 ? -20.713 22.169  70.629  1.00 66.50  ? 449  TYR B O   1 
ATOM   7640  C  CB  . TYR B  1 449 ? -20.145 20.622  68.263  1.00 54.57  ? 449  TYR B CB  1 
ATOM   7641  C  CG  . TYR B  1 449 ? -20.210 20.593  66.770  1.00 58.92  ? 449  TYR B CG  1 
ATOM   7642  C  CD1 . TYR B  1 449 ? -21.154 21.350  66.087  1.00 57.79  ? 449  TYR B CD1 1 
ATOM   7643  C  CD2 . TYR B  1 449 ? -19.274 19.882  66.033  1.00 56.80  ? 449  TYR B CD2 1 
ATOM   7644  C  CE1 . TYR B  1 449 ? -21.192 21.361  64.704  1.00 61.47  ? 449  TYR B CE1 1 
ATOM   7645  C  CE2 . TYR B  1 449 ? -19.301 19.885  64.654  1.00 57.34  ? 449  TYR B CE2 1 
ATOM   7646  C  CZ  . TYR B  1 449 ? -20.259 20.625  63.992  1.00 60.36  ? 449  TYR B CZ  1 
ATOM   7647  O  OH  . TYR B  1 449 ? -20.279 20.623  62.617  1.00 50.50  ? 449  TYR B OH  1 
ATOM   7648  N  N   . GLU B  1 450 ? -18.538 22.760  70.763  1.00 60.58  ? 450  GLU B N   1 
ATOM   7649  C  CA  . GLU B  1 450 ? -18.689 23.443  72.033  1.00 64.83  ? 450  GLU B CA  1 
ATOM   7650  C  C   . GLU B  1 450 ? -18.794 24.945  71.762  1.00 71.17  ? 450  GLU B C   1 
ATOM   7651  O  O   . GLU B  1 450 ? -19.365 25.704  72.557  1.00 72.31  ? 450  GLU B O   1 
ATOM   7652  C  CB  . GLU B  1 450 ? -17.507 23.140  72.951  1.00 56.63  ? 450  GLU B CB  1 
ATOM   7653  C  CG  . GLU B  1 450 ? -16.350 24.114  72.835  1.00 55.99  ? 450  GLU B CG  1 
ATOM   7654  C  CD  . GLU B  1 450 ? -15.420 23.798  71.682  1.00 57.05  ? 450  GLU B CD  1 
ATOM   7655  O  OE1 . GLU B  1 450 ? -15.829 23.069  70.755  1.00 59.22  ? 450  GLU B OE1 1 
ATOM   7656  O  OE2 . GLU B  1 450 ? -14.271 24.280  71.706  1.00 49.68  ? 450  GLU B OE2 1 
ATOM   7657  N  N   . ILE B  1 451 ? -18.264 25.351  70.610  1.00 68.55  ? 451  ILE B N   1 
ATOM   7658  C  CA  . ILE B  1 451 ? -18.144 26.760  70.257  1.00 64.12  ? 451  ILE B CA  1 
ATOM   7659  C  C   . ILE B  1 451 ? -19.456 27.516  70.364  1.00 64.83  ? 451  ILE B C   1 
ATOM   7660  O  O   . ILE B  1 451 ? -19.521 28.521  71.067  1.00 67.96  ? 451  ILE B O   1 
ATOM   7661  C  CB  . ILE B  1 451 ? -17.580 26.940  68.848  1.00 58.82  ? 451  ILE B CB  1 
ATOM   7662  C  CG1 . ILE B  1 451 ? -16.612 25.797  68.536  1.00 59.84  ? 451  ILE B CG1 1 
ATOM   7663  C  CG2 . ILE B  1 451 ? -16.940 28.323  68.711  1.00 55.22  ? 451  ILE B CG2 1 
ATOM   7664  C  CD1 . ILE B  1 451 ? -15.686 26.058  67.367  1.00 59.88  ? 451  ILE B CD1 1 
ATOM   7665  N  N   . GLU B  1 452 ? -20.496 27.036  69.686  1.00 63.43  ? 452  GLU B N   1 
ATOM   7666  C  CA  . GLU B  1 452 ? -21.801 27.699  69.752  1.00 70.17  ? 452  GLU B CA  1 
ATOM   7667  C  C   . GLU B  1 452 ? -22.267 27.879  71.196  1.00 72.49  ? 452  GLU B C   1 
ATOM   7668  O  O   . GLU B  1 452 ? -22.927 28.861  71.532  1.00 72.38  ? 452  GLU B O   1 
ATOM   7669  C  CB  . GLU B  1 452 ? -22.863 26.979  68.904  1.00 67.14  ? 452  GLU B CB  1 
ATOM   7670  C  CG  . GLU B  1 452 ? -23.146 25.525  69.258  1.00 64.35  ? 452  GLU B CG  1 
ATOM   7671  C  CD  . GLU B  1 452 ? -23.563 24.715  68.039  1.00 66.58  ? 452  GLU B CD  1 
ATOM   7672  O  OE1 . GLU B  1 452 ? -22.696 24.450  67.171  1.00 68.23  ? 452  GLU B OE1 1 
ATOM   7673  O  OE2 . GLU B  1 452 ? -24.754 24.350  67.938  1.00 66.68  ? 452  GLU B OE2 1 
ATOM   7674  N  N   . PHE B  1 453 ? -21.881 26.950  72.060  1.00 69.11  ? 453  PHE B N   1 
ATOM   7675  C  CA  . PHE B  1 453 ? -22.236 27.075  73.457  1.00 70.89  ? 453  PHE B CA  1 
ATOM   7676  C  C   . PHE B  1 453 ? -21.374 28.115  74.181  1.00 70.02  ? 453  PHE B C   1 
ATOM   7677  O  O   . PHE B  1 453 ? -21.907 28.978  74.877  1.00 67.46  ? 453  PHE B O   1 
ATOM   7678  C  CB  . PHE B  1 453 ? -22.200 25.711  74.141  1.00 72.66  ? 453  PHE B CB  1 
ATOM   7679  C  CG  . PHE B  1 453 ? -23.231 24.750  73.615  1.00 75.15  ? 453  PHE B CG  1 
ATOM   7680  C  CD1 . PHE B  1 453 ? -24.566 24.923  73.908  1.00 73.68  ? 453  PHE B CD1 1 
ATOM   7681  C  CD2 . PHE B  1 453 ? -22.866 23.676  72.824  1.00 79.83  ? 453  PHE B CD2 1 
ATOM   7682  C  CE1 . PHE B  1 453 ? -25.520 24.048  73.425  1.00 70.83  ? 453  PHE B CE1 1 
ATOM   7683  C  CE2 . PHE B  1 453 ? -23.823 22.794  72.342  1.00 77.40  ? 453  PHE B CE2 1 
ATOM   7684  C  CZ  . PHE B  1 453 ? -25.150 22.987  72.646  1.00 68.56  ? 453  PHE B CZ  1 
ATOM   7685  N  N   . ILE B  1 454 ? -20.054 28.053  74.003  1.00 63.83  ? 454  ILE B N   1 
ATOM   7686  C  CA  . ILE B  1 454 ? -19.169 29.057  74.604  1.00 62.90  ? 454  ILE B CA  1 
ATOM   7687  C  C   . ILE B  1 454 ? -19.550 30.470  74.139  1.00 68.17  ? 454  ILE B C   1 
ATOM   7688  O  O   . ILE B  1 454 ? -19.469 31.421  74.914  1.00 68.81  ? 454  ILE B O   1 
ATOM   7689  C  CB  . ILE B  1 454 ? -17.651 28.746  74.366  1.00 66.74  ? 454  ILE B CB  1 
ATOM   7690  C  CG1 . ILE B  1 454 ? -17.049 28.038  75.573  1.00 68.43  ? 454  ILE B CG1 1 
ATOM   7691  C  CG2 . ILE B  1 454 ? -16.834 30.007  74.170  1.00 63.80  ? 454  ILE B CG2 1 
ATOM   7692  C  CD1 . ILE B  1 454 ? -17.665 26.706  75.878  1.00 73.82  ? 454  ILE B CD1 1 
ATOM   7693  N  N   . PHE B  1 455 ? -20.003 30.593  72.891  1.00 72.37  ? 455  PHE B N   1 
ATOM   7694  C  CA  . PHE B  1 455 ? -20.454 31.884  72.345  1.00 74.13  ? 455  PHE B CA  1 
ATOM   7695  C  C   . PHE B  1 455 ? -21.909 32.251  72.697  1.00 72.58  ? 455  PHE B C   1 
ATOM   7696  O  O   . PHE B  1 455 ? -22.373 33.375  72.449  1.00 68.14  ? 455  PHE B O   1 
ATOM   7697  C  CB  . PHE B  1 455 ? -20.210 31.967  70.828  1.00 69.52  ? 455  PHE B CB  1 
ATOM   7698  C  CG  . PHE B  1 455 ? -18.829 32.434  70.468  1.00 66.62  ? 455  PHE B CG  1 
ATOM   7699  C  CD1 . PHE B  1 455 ? -18.544 33.787  70.375  1.00 68.76  ? 455  PHE B CD1 1 
ATOM   7700  C  CD2 . PHE B  1 455 ? -17.807 31.524  70.245  1.00 65.11  ? 455  PHE B CD2 1 
ATOM   7701  C  CE1 . PHE B  1 455 ? -17.263 34.226  70.056  1.00 66.78  ? 455  PHE B CE1 1 
ATOM   7702  C  CE2 . PHE B  1 455 ? -16.526 31.954  69.928  1.00 60.81  ? 455  PHE B CE2 1 
ATOM   7703  C  CZ  . PHE B  1 455 ? -16.255 33.308  69.832  1.00 60.75  ? 455  PHE B CZ  1 
ATOM   7704  N  N   . GLY B  1 456 ? -22.617 31.294  73.279  1.00 68.72  ? 456  GLY B N   1 
ATOM   7705  C  CA  . GLY B  1 456 ? -23.954 31.546  73.777  1.00 78.57  ? 456  GLY B CA  1 
ATOM   7706  C  C   . GLY B  1 456 ? -25.044 31.656  72.730  1.00 80.44  ? 456  GLY B C   1 
ATOM   7707  O  O   . GLY B  1 456 ? -25.972 32.437  72.888  1.00 79.99  ? 456  GLY B O   1 
ATOM   7708  N  N   . LEU B  1 457 ? -24.938 30.870  71.667  1.00 83.59  ? 457  LEU B N   1 
ATOM   7709  C  CA  . LEU B  1 457 ? -25.988 30.815  70.656  1.00 71.05  ? 457  LEU B CA  1 
ATOM   7710  C  C   . LEU B  1 457 ? -27.386 30.365  71.113  1.00 76.25  ? 457  LEU B C   1 
ATOM   7711  O  O   . LEU B  1 457 ? -28.378 30.871  70.591  1.00 76.95  ? 457  LEU B O   1 
ATOM   7712  C  CB  . LEU B  1 457 ? -25.549 29.988  69.454  1.00 68.56  ? 457  LEU B CB  1 
ATOM   7713  C  CG  . LEU B  1 457 ? -25.308 30.889  68.255  1.00 67.42  ? 457  LEU B CG  1 
ATOM   7714  C  CD1 . LEU B  1 457 ? -24.162 31.831  68.576  1.00 68.99  ? 457  LEU B CD1 1 
ATOM   7715  C  CD2 . LEU B  1 457 ? -25.054 30.071  66.999  1.00 65.35  ? 457  LEU B CD2 1 
ATOM   7716  N  N   . PRO B  1 458 ? -27.483 29.409  72.060  1.00 78.47  ? 458  PRO B N   1 
ATOM   7717  C  CA  . PRO B  1 458 ? -28.839 29.012  72.475  1.00 85.19  ? 458  PRO B CA  1 
ATOM   7718  C  C   . PRO B  1 458 ? -29.663 30.122  73.149  1.00 94.24  ? 458  PRO B C   1 
ATOM   7719  O  O   . PRO B  1 458 ? -30.878 29.960  73.311  1.00 96.20  ? 458  PRO B O   1 
ATOM   7720  C  CB  . PRO B  1 458 ? -28.582 27.869  73.459  1.00 77.63  ? 458  PRO B CB  1 
ATOM   7721  C  CG  . PRO B  1 458 ? -27.277 27.316  73.051  1.00 96.06  ? 458  PRO B CG  1 
ATOM   7722  C  CD  . PRO B  1 458 ? -26.466 28.474  72.572  1.00 72.81  ? 458  PRO B CD  1 
ATOM   7723  N  N   . LEU B  1 459 ? -29.019 31.227  73.522  1.00 98.13  ? 459  LEU B N   1 
ATOM   7724  C  CA  . LEU B  1 459 ? -29.724 32.386  74.077  1.00 99.95  ? 459  LEU B CA  1 
ATOM   7725  C  C   . LEU B  1 459 ? -30.623 33.079  73.053  1.00 105.85 ? 459  LEU B C   1 
ATOM   7726  O  O   . LEU B  1 459 ? -31.379 33.985  73.396  1.00 110.67 ? 459  LEU B O   1 
ATOM   7727  C  CB  . LEU B  1 459 ? -28.747 33.400  74.686  1.00 93.20  ? 459  LEU B CB  1 
ATOM   7728  C  CG  . LEU B  1 459 ? -28.445 33.235  76.178  1.00 89.89  ? 459  LEU B CG  1 
ATOM   7729  C  CD1 . LEU B  1 459 ? -27.539 32.042  76.400  1.00 89.81  ? 459  LEU B CD1 1 
ATOM   7730  C  CD2 . LEU B  1 459 ? -27.841 34.499  76.784  1.00 85.86  ? 459  LEU B CD2 1 
ATOM   7731  N  N   . ASP B  1 460 ? -30.528 32.665  71.795  1.00 109.54 ? 460  ASP B N   1 
ATOM   7732  C  CA  . ASP B  1 460 ? -31.459 33.127  70.776  1.00 116.04 ? 460  ASP B CA  1 
ATOM   7733  C  C   . ASP B  1 460 ? -32.555 32.083  70.577  1.00 119.50 ? 460  ASP B C   1 
ATOM   7734  O  O   . ASP B  1 460 ? -32.274 30.914  70.287  1.00 117.00 ? 460  ASP B O   1 
ATOM   7735  C  CB  . ASP B  1 460 ? -30.739 33.423  69.459  1.00 117.42 ? 460  ASP B CB  1 
ATOM   7736  C  CG  . ASP B  1 460 ? -31.672 33.980  68.397  1.00 122.86 ? 460  ASP B CG  1 
ATOM   7737  O  OD1 . ASP B  1 460 ? -32.005 35.182  68.460  1.00 126.87 ? 460  ASP B OD1 1 
ATOM   7738  O  OD2 . ASP B  1 460 ? -32.070 33.215  67.494  1.00 123.80 ? 460  ASP B OD2 1 
ATOM   7739  N  N   . PRO B  1 461 ? -33.814 32.505  70.746  1.00 124.19 ? 461  PRO B N   1 
ATOM   7740  C  CA  . PRO B  1 461 ? -34.942 31.570  70.711  1.00 127.33 ? 461  PRO B CA  1 
ATOM   7741  C  C   . PRO B  1 461 ? -35.235 31.084  69.295  1.00 124.93 ? 461  PRO B C   1 
ATOM   7742  O  O   . PRO B  1 461 ? -35.660 29.942  69.112  1.00 124.77 ? 461  PRO B O   1 
ATOM   7743  C  CB  . PRO B  1 461 ? -36.102 32.409  71.251  1.00 130.97 ? 461  PRO B CB  1 
ATOM   7744  C  CG  . PRO B  1 461 ? -35.742 33.815  70.891  1.00 130.47 ? 461  PRO B CG  1 
ATOM   7745  C  CD  . PRO B  1 461 ? -34.244 33.898  70.963  1.00 125.50 ? 461  PRO B CD  1 
ATOM   7746  N  N   . SER B  1 462 ? -34.989 31.938  68.305  1.00 122.77 ? 462  SER B N   1 
ATOM   7747  C  CA  . SER B  1 462 ? -35.290 31.607  66.915  1.00 121.17 ? 462  SER B CA  1 
ATOM   7748  C  C   . SER B  1 462 ? -34.376 30.513  66.371  1.00 116.28 ? 462  SER B C   1 
ATOM   7749  O  O   . SER B  1 462 ? -34.624 29.968  65.288  1.00 115.63 ? 462  SER B O   1 
ATOM   7750  C  CB  . SER B  1 462 ? -35.226 32.860  66.031  1.00 120.53 ? 462  SER B CB  1 
ATOM   7751  O  OG  . SER B  1 462 ? -34.002 33.553  66.200  1.00 119.42 ? 462  SER B OG  1 
ATOM   7752  N  N   . LEU B  1 463 ? -33.330 30.191  67.133  1.00 109.96 ? 463  LEU B N   1 
ATOM   7753  C  CA  . LEU B  1 463 ? -32.360 29.171  66.742  1.00 100.07 ? 463  LEU B CA  1 
ATOM   7754  C  C   . LEU B  1 463 ? -32.811 27.771  67.137  1.00 98.72  ? 463  LEU B C   1 
ATOM   7755  O  O   . LEU B  1 463 ? -32.142 26.787  66.827  1.00 99.70  ? 463  LEU B O   1 
ATOM   7756  C  CB  . LEU B  1 463 ? -30.987 29.475  67.338  1.00 92.60  ? 463  LEU B CB  1 
ATOM   7757  C  CG  . LEU B  1 463 ? -30.027 30.259  66.441  1.00 83.02  ? 463  LEU B CG  1 
ATOM   7758  C  CD1 . LEU B  1 463 ? -28.964 30.938  67.282  1.00 77.02  ? 463  LEU B CD1 1 
ATOM   7759  C  CD2 . LEU B  1 463 ? -29.393 29.346  65.394  1.00 80.47  ? 463  LEU B CD2 1 
ATOM   7760  N  N   . ASN B  1 464 ? -33.944 27.697  67.827  1.00 95.82  ? 464  ASN B N   1 
ATOM   7761  C  CA  . ASN B  1 464 ? -34.615 26.429  68.095  1.00 94.45  ? 464  ASN B CA  1 
ATOM   7762  C  C   . ASN B  1 464 ? -33.787 25.469  68.945  1.00 91.59  ? 464  ASN B C   1 
ATOM   7763  O  O   . ASN B  1 464 ? -33.825 24.253  68.738  1.00 88.89  ? 464  ASN B O   1 
ATOM   7764  C  CB  . ASN B  1 464 ? -35.062 25.739  66.787  1.00 98.54  ? 464  ASN B CB  1 
ATOM   7765  C  CG  . ASN B  1 464 ? -36.088 26.566  65.984  1.00 105.95 ? 464  ASN B CG  1 
ATOM   7766  O  OD1 . ASN B  1 464 ? -36.451 26.205  64.859  1.00 105.15 ? 464  ASN B OD1 1 
ATOM   7767  N  ND2 . ASN B  1 464 ? -36.545 27.676  66.559  1.00 107.30 ? 464  ASN B ND2 1 
ATOM   7768  N  N   . TYR B  1 465 ? -33.031 26.009  69.897  1.00 94.80  ? 465  TYR B N   1 
ATOM   7769  C  CA  . TYR B  1 465 ? -32.338 25.159  70.865  1.00 99.24  ? 465  TYR B CA  1 
ATOM   7770  C  C   . TYR B  1 465 ? -33.340 24.749  71.931  1.00 107.16 ? 465  TYR B C   1 
ATOM   7771  O  O   . TYR B  1 465 ? -34.539 24.987  71.788  1.00 112.00 ? 465  TYR B O   1 
ATOM   7772  C  CB  . TYR B  1 465 ? -31.163 25.893  71.526  1.00 99.28  ? 465  TYR B CB  1 
ATOM   7773  C  CG  . TYR B  1 465 ? -29.909 25.993  70.682  1.00 96.72  ? 465  TYR B CG  1 
ATOM   7774  C  CD1 . TYR B  1 465 ? -29.804 26.943  69.675  1.00 98.83  ? 465  TYR B CD1 1 
ATOM   7775  C  CD2 . TYR B  1 465 ? -28.824 25.149  70.900  1.00 89.04  ? 465  TYR B CD2 1 
ATOM   7776  C  CE1 . TYR B  1 465 ? -28.666 27.049  68.901  1.00 92.13  ? 465  TYR B CE1 1 
ATOM   7777  C  CE2 . TYR B  1 465 ? -27.677 25.251  70.131  1.00 82.91  ? 465  TYR B CE2 1 
ATOM   7778  C  CZ  . TYR B  1 465 ? -27.607 26.206  69.134  1.00 83.44  ? 465  TYR B CZ  1 
ATOM   7779  O  OH  . TYR B  1 465 ? -26.484 26.328  68.354  1.00 77.54  ? 465  TYR B OH  1 
ATOM   7780  N  N   . THR B  1 466 ? -32.854 24.142  73.007  1.00 107.89 ? 466  THR B N   1 
ATOM   7781  C  CA  . THR B  1 466 ? -33.720 23.867  74.150  1.00 107.02 ? 466  THR B CA  1 
ATOM   7782  C  C   . THR B  1 466 ? -33.361 24.746  75.354  1.00 107.70 ? 466  THR B C   1 
ATOM   7783  O  O   . THR B  1 466 ? -32.268 25.308  75.428  1.00 104.27 ? 466  THR B O   1 
ATOM   7784  C  CB  . THR B  1 466 ? -33.741 22.367  74.538  1.00 102.52 ? 466  THR B CB  1 
ATOM   7785  O  OG1 . THR B  1 466 ? -34.834 22.119  75.436  1.00 109.13 ? 466  THR B OG1 1 
ATOM   7786  C  CG2 . THR B  1 466 ? -32.425 21.943  75.189  1.00 92.76  ? 466  THR B CG2 1 
ATOM   7787  N  N   . THR B  1 467 ? -34.302 24.858  76.286  1.00 112.02 ? 467  THR B N   1 
ATOM   7788  C  CA  . THR B  1 467 ? -34.169 25.731  77.450  1.00 115.59 ? 467  THR B CA  1 
ATOM   7789  C  C   . THR B  1 467 ? -32.940 25.403  78.325  1.00 115.79 ? 467  THR B C   1 
ATOM   7790  O  O   . THR B  1 467 ? -32.181 26.299  78.741  1.00 111.20 ? 467  THR B O   1 
ATOM   7791  C  CB  . THR B  1 467 ? -35.481 25.718  78.281  1.00 113.02 ? 467  THR B CB  1 
ATOM   7792  O  OG1 . THR B  1 467 ? -36.055 24.404  78.242  1.00 98.22  ? 467  THR B OG1 1 
ATOM   7793  C  CG2 . THR B  1 467 ? -36.492 26.706  77.702  1.00 99.34  ? 467  THR B CG2 1 
ATOM   7794  N  N   . GLU B  1 468 ? -32.742 24.114  78.586  1.00 122.01 ? 468  GLU B N   1 
ATOM   7795  C  CA  . GLU B  1 468 ? -31.598 23.656  79.370  1.00 122.62 ? 468  GLU B CA  1 
ATOM   7796  C  C   . GLU B  1 468 ? -30.277 23.907  78.636  1.00 117.41 ? 468  GLU B C   1 
ATOM   7797  O  O   . GLU B  1 468 ? -29.246 24.150  79.266  1.00 119.41 ? 468  GLU B O   1 
ATOM   7798  C  CB  . GLU B  1 468 ? -31.754 22.179  79.781  1.00 125.75 ? 468  GLU B CB  1 
ATOM   7799  C  CG  . GLU B  1 468 ? -32.190 21.220  78.664  1.00 130.97 ? 468  GLU B CG  1 
ATOM   7800  C  CD  . GLU B  1 468 ? -33.708 21.168  78.448  1.00 139.01 ? 468  GLU B CD  1 
ATOM   7801  O  OE1 . GLU B  1 468 ? -34.397 22.188  78.674  1.00 141.16 ? 468  GLU B OE1 1 
ATOM   7802  O  OE2 . GLU B  1 468 ? -34.216 20.096  78.047  1.00 140.50 ? 468  GLU B OE2 1 
ATOM   7803  N  N   . GLU B  1 469 ? -30.310 23.865  77.306  1.00 108.90 ? 469  GLU B N   1 
ATOM   7804  C  CA  . GLU B  1 469 ? -29.141 24.231  76.515  1.00 99.62  ? 469  GLU B CA  1 
ATOM   7805  C  C   . GLU B  1 469 ? -28.815 25.721  76.682  1.00 98.22  ? 469  GLU B C   1 
ATOM   7806  O  O   . GLU B  1 469 ? -27.651 26.122  76.616  1.00 94.49  ? 469  GLU B O   1 
ATOM   7807  C  CB  . GLU B  1 469 ? -29.350 23.868  75.043  1.00 94.80  ? 469  GLU B CB  1 
ATOM   7808  C  CG  . GLU B  1 469 ? -29.044 22.411  74.719  1.00 88.76  ? 469  GLU B CG  1 
ATOM   7809  C  CD  . GLU B  1 469 ? -29.522 22.002  73.337  1.00 85.94  ? 469  GLU B CD  1 
ATOM   7810  O  OE1 . GLU B  1 469 ? -30.319 22.749  72.729  1.00 84.05  ? 469  GLU B OE1 1 
ATOM   7811  O  OE2 . GLU B  1 469 ? -29.097 20.931  72.858  1.00 86.76  ? 469  GLU B OE2 1 
ATOM   7812  N  N   . ARG B  1 470 ? -29.853 26.527  76.908  1.00 100.83 ? 470  ARG B N   1 
ATOM   7813  C  CA  . ARG B  1 470 ? -29.702 27.962  77.176  1.00 100.13 ? 470  ARG B CA  1 
ATOM   7814  C  C   . ARG B  1 470 ? -29.097 28.198  78.567  1.00 100.64 ? 470  ARG B C   1 
ATOM   7815  O  O   . ARG B  1 470 ? -28.195 29.031  78.735  1.00 91.51  ? 470  ARG B O   1 
ATOM   7816  C  CB  . ARG B  1 470 ? -31.055 28.683  77.030  1.00 98.89  ? 470  ARG B CB  1 
ATOM   7817  C  CG  . ARG B  1 470 ? -31.044 30.163  77.388  1.00 100.28 ? 470  ARG B CG  1 
ATOM   7818  C  CD  . ARG B  1 470 ? -32.263 30.540  78.237  1.00 109.93 ? 470  ARG B CD  1 
ATOM   7819  N  NE  . ARG B  1 470 ? -33.538 30.348  77.535  1.00 114.82 ? 470  ARG B NE  1 
ATOM   7820  C  CZ  . ARG B  1 470 ? -34.695 30.060  78.134  1.00 112.42 ? 470  ARG B CZ  1 
ATOM   7821  N  NH1 . ARG B  1 470 ? -34.747 29.920  79.454  1.00 99.33  ? 470  ARG B NH1 1 
ATOM   7822  N  NH2 . ARG B  1 470 ? -35.798 29.900  77.411  1.00 105.01 ? 470  ARG B NH2 1 
ATOM   7823  N  N   . ILE B  1 471 ? -29.594 27.459  79.560  1.00 109.64 ? 471  ILE B N   1 
ATOM   7824  C  CA  . ILE B  1 471 ? -29.001 27.495  80.902  1.00 111.00 ? 471  ILE B CA  1 
ATOM   7825  C  C   . ILE B  1 471 ? -27.512 27.140  80.822  1.00 104.59 ? 471  ILE B C   1 
ATOM   7826  O  O   . ILE B  1 471 ? -26.648 27.816  81.407  1.00 103.41 ? 471  ILE B O   1 
ATOM   7827  C  CB  . ILE B  1 471 ? -29.695 26.497  81.868  1.00 95.77  ? 471  ILE B CB  1 
ATOM   7828  C  CG1 . ILE B  1 471 ? -31.224 26.631  81.805  1.00 99.29  ? 471  ILE B CG1 1 
ATOM   7829  C  CG2 . ILE B  1 471 ? -29.179 26.681  83.294  1.00 93.13  ? 471  ILE B CG2 1 
ATOM   7830  C  CD1 . ILE B  1 471 ? -31.970 25.565  82.602  1.00 95.73  ? 471  ILE B CD1 1 
ATOM   7831  N  N   . PHE B  1 472 ? -27.237 26.068  80.083  1.00 97.73  ? 472  PHE B N   1 
ATOM   7832  C  CA  . PHE B  1 472 ? -25.886 25.597  79.838  1.00 90.58  ? 472  PHE B CA  1 
ATOM   7833  C  C   . PHE B  1 472 ? -25.065 26.749  79.289  1.00 86.25  ? 472  PHE B C   1 
ATOM   7834  O  O   . PHE B  1 472 ? -24.059 27.131  79.882  1.00 83.29  ? 472  PHE B O   1 
ATOM   7835  C  CB  . PHE B  1 472 ? -25.917 24.438  78.835  1.00 93.01  ? 472  PHE B CB  1 
ATOM   7836  C  CG  . PHE B  1 472 ? -24.638 23.636  78.769  1.00 96.22  ? 472  PHE B CG  1 
ATOM   7837  C  CD1 . PHE B  1 472 ? -23.554 23.935  79.583  1.00 97.29  ? 472  PHE B CD1 1 
ATOM   7838  C  CD2 . PHE B  1 472 ? -24.522 22.579  77.882  1.00 95.38  ? 472  PHE B CD2 1 
ATOM   7839  C  CE1 . PHE B  1 472 ? -22.385 23.192  79.513  1.00 93.07  ? 472  PHE B CE1 1 
ATOM   7840  C  CE2 . PHE B  1 472 ? -23.357 21.840  77.810  1.00 92.58  ? 472  PHE B CE2 1 
ATOM   7841  C  CZ  . PHE B  1 472 ? -22.288 22.148  78.626  1.00 90.23  ? 472  PHE B CZ  1 
ATOM   7842  N  N   . ALA B  1 473 ? -25.517 27.312  78.170  1.00 77.24  ? 473  ALA B N   1 
ATOM   7843  C  CA  . ALA B  1 473 ? -24.799 28.390  77.505  1.00 82.68  ? 473  ALA B CA  1 
ATOM   7844  C  C   . ALA B  1 473 ? -24.467 29.501  78.484  1.00 76.85  ? 473  ALA B C   1 
ATOM   7845  O  O   . ALA B  1 473 ? -23.332 29.978  78.543  1.00 75.15  ? 473  ALA B O   1 
ATOM   7846  C  CB  . ALA B  1 473 ? -25.600 28.929  76.338  1.00 75.87  ? 473  ALA B CB  1 
ATOM   7847  N  N   . GLN B  1 474 ? -25.455 29.888  79.279  1.00 90.36  ? 474  GLN B N   1 
ATOM   7848  C  CA  . GLN B  1 474 ? -25.233 30.945  80.254  1.00 93.44  ? 474  GLN B CA  1 
ATOM   7849  C  C   . GLN B  1 474 ? -24.112 30.554  81.223  1.00 95.48  ? 474  GLN B C   1 
ATOM   7850  O  O   . GLN B  1 474 ? -23.226 31.359  81.520  1.00 91.24  ? 474  GLN B O   1 
ATOM   7851  C  CB  . GLN B  1 474 ? -26.529 31.278  80.992  1.00 96.02  ? 474  GLN B CB  1 
ATOM   7852  C  CG  . GLN B  1 474 ? -26.861 32.760  81.005  1.00 97.65  ? 474  GLN B CG  1 
ATOM   7853  C  CD  . GLN B  1 474 ? -28.333 33.024  81.243  1.00 100.15 ? 474  GLN B CD  1 
ATOM   7854  O  OE1 . GLN B  1 474 ? -29.189 32.225  80.858  1.00 99.99  ? 474  GLN B OE1 1 
ATOM   7855  N  NE2 . GLN B  1 474 ? -28.637 34.150  81.880  1.00 100.84 ? 474  GLN B NE2 1 
ATOM   7856  N  N   . ARG B  1 475 ? -24.138 29.305  81.681  1.00 98.70  ? 475  ARG B N   1 
ATOM   7857  C  CA  . ARG B  1 475 ? -23.139 28.822  82.637  1.00 95.75  ? 475  ARG B CA  1 
ATOM   7858  C  C   . ARG B  1 475 ? -21.725 28.797  82.051  1.00 87.35  ? 475  ARG B C   1 
ATOM   7859  O  O   . ARG B  1 475 ? -20.744 29.108  82.739  1.00 84.17  ? 475  ARG B O   1 
ATOM   7860  C  CB  . ARG B  1 475 ? -23.536 27.439  83.137  1.00 97.41  ? 475  ARG B CB  1 
ATOM   7861  C  CG  . ARG B  1 475 ? -22.644 26.881  84.204  1.00 80.22  ? 475  ARG B CG  1 
ATOM   7862  C  CD  . ARG B  1 475 ? -23.299 25.655  84.792  1.00 96.80  ? 475  ARG B CD  1 
ATOM   7863  N  NE  . ARG B  1 475 ? -22.404 24.503  84.824  1.00 93.60  ? 475  ARG B NE  1 
ATOM   7864  C  CZ  . ARG B  1 475 ? -22.709 23.307  84.334  1.00 89.81  ? 475  ARG B CZ  1 
ATOM   7865  N  NH1 . ARG B  1 475 ? -23.890 23.099  83.764  1.00 80.12  ? 475  ARG B NH1 1 
ATOM   7866  N  NH2 . ARG B  1 475 ? -21.830 22.317  84.418  1.00 84.20  ? 475  ARG B NH2 1 
ATOM   7867  N  N   . LEU B  1 476 ? -21.630 28.432  80.775  1.00 85.17  ? 476  LEU B N   1 
ATOM   7868  C  CA  . LEU B  1 476 ? -20.354 28.401  80.066  1.00 82.10  ? 476  LEU B CA  1 
ATOM   7869  C  C   . LEU B  1 476 ? -19.797 29.810  79.870  1.00 81.31  ? 476  LEU B C   1 
ATOM   7870  O  O   . LEU B  1 476 ? -18.598 30.056  80.085  1.00 77.11  ? 476  LEU B O   1 
ATOM   7871  C  CB  . LEU B  1 476 ? -20.503 27.697  78.712  1.00 78.24  ? 476  LEU B CB  1 
ATOM   7872  C  CG  . LEU B  1 476 ? -20.772 26.191  78.763  1.00 76.29  ? 476  LEU B CG  1 
ATOM   7873  C  CD1 . LEU B  1 476 ? -20.826 25.599  77.374  1.00 75.28  ? 476  LEU B CD1 1 
ATOM   7874  C  CD2 . LEU B  1 476 ? -19.723 25.484  79.590  1.00 73.03  ? 476  LEU B CD2 1 
ATOM   7875  N  N   . MET B  1 477 ? -20.672 30.730  79.460  1.00 81.61  ? 477  MET B N   1 
ATOM   7876  C  CA  . MET B  1 477 ? -20.290 32.129  79.321  1.00 72.30  ? 477  MET B CA  1 
ATOM   7877  C  C   . MET B  1 477 ? -19.814 32.662  80.670  1.00 86.20  ? 477  MET B C   1 
ATOM   7878  O  O   . MET B  1 477 ? -18.856 33.431  80.736  1.00 72.84  ? 477  MET B O   1 
ATOM   7879  C  CB  . MET B  1 477 ? -21.454 32.958  78.774  1.00 74.11  ? 477  MET B CB  1 
ATOM   7880  C  CG  . MET B  1 477 ? -21.930 32.486  77.407  1.00 75.95  ? 477  MET B CG  1 
ATOM   7881  S  SD  . MET B  1 477 ? -23.526 33.120  76.845  1.00 99.12  ? 477  MET B SD  1 
ATOM   7882  C  CE  . MET B  1 477 ? -23.105 34.810  76.441  1.00 115.86 ? 477  MET B CE  1 
ATOM   7883  N  N   . LYS B  1 478 ? -20.473 32.220  81.741  1.00 86.82  ? 478  LYS B N   1 
ATOM   7884  C  CA  . LYS B  1 478 ? -20.075 32.562  83.103  1.00 91.73  ? 478  LYS B CA  1 
ATOM   7885  C  C   . LYS B  1 478 ? -18.657 32.081  83.399  1.00 89.74  ? 478  LYS B C   1 
ATOM   7886  O  O   . LYS B  1 478 ? -17.831 32.850  83.887  1.00 88.70  ? 478  LYS B O   1 
ATOM   7887  C  CB  . LYS B  1 478 ? -21.051 31.957  84.120  1.00 101.52 ? 478  LYS B CB  1 
ATOM   7888  C  CG  . LYS B  1 478 ? -21.903 32.970  84.894  1.00 109.20 ? 478  LYS B CG  1 
ATOM   7889  C  CD  . LYS B  1 478 ? -21.167 33.566  86.095  1.00 109.62 ? 478  LYS B CD  1 
ATOM   7890  C  CE  . LYS B  1 478 ? -22.072 34.505  86.886  1.00 108.21 ? 478  LYS B CE  1 
ATOM   7891  N  NZ  . LYS B  1 478 ? -22.696 35.544  86.009  1.00 103.86 ? 478  LYS B NZ  1 
ATOM   7892  N  N   . TYR B  1 479 ? -18.383 30.809  83.107  1.00 89.72  ? 479  TYR B N   1 
ATOM   7893  C  CA  . TYR B  1 479 ? -17.057 30.222  83.349  1.00 84.13  ? 479  TYR B CA  1 
ATOM   7894  C  C   . TYR B  1 479 ? -15.946 30.960  82.587  1.00 76.74  ? 479  TYR B C   1 
ATOM   7895  O  O   . TYR B  1 479 ? -14.895 31.327  83.151  1.00 73.18  ? 479  TYR B O   1 
ATOM   7896  C  CB  . TYR B  1 479 ? -17.047 28.738  82.948  1.00 81.19  ? 479  TYR B CB  1 
ATOM   7897  C  CG  . TYR B  1 479 ? -17.774 27.786  83.887  1.00 79.77  ? 479  TYR B CG  1 
ATOM   7898  C  CD1 . TYR B  1 479 ? -17.856 28.038  85.251  1.00 83.46  ? 479  TYR B CD1 1 
ATOM   7899  C  CD2 . TYR B  1 479 ? -18.369 26.624  83.404  1.00 74.38  ? 479  TYR B CD2 1 
ATOM   7900  C  CE1 . TYR B  1 479 ? -18.515 27.163  86.107  1.00 84.10  ? 479  TYR B CE1 1 
ATOM   7901  C  CE2 . TYR B  1 479 ? -19.027 25.744  84.251  1.00 76.18  ? 479  TYR B CE2 1 
ATOM   7902  C  CZ  . TYR B  1 479 ? -19.097 26.018  85.601  1.00 81.57  ? 479  TYR B CZ  1 
ATOM   7903  O  OH  . TYR B  1 479 ? -19.747 25.145  86.447  1.00 84.94  ? 479  TYR B OH  1 
ATOM   7904  N  N   . TRP B  1 480 ? -16.193 31.173  81.297  1.00 73.09  ? 480  TRP B N   1 
ATOM   7905  C  CA  . TRP B  1 480 ? -15.219 31.814  80.426  1.00 71.59  ? 480  TRP B CA  1 
ATOM   7906  C  C   . TRP B  1 480 ? -14.958 33.271  80.820  1.00 73.69  ? 480  TRP B C   1 
ATOM   7907  O  O   . TRP B  1 480 ? -13.810 33.705  80.912  1.00 65.59  ? 480  TRP B O   1 
ATOM   7908  C  CB  . TRP B  1 480 ? -15.678 31.710  78.971  1.00 70.00  ? 480  TRP B CB  1 
ATOM   7909  C  CG  . TRP B  1 480 ? -15.040 30.581  78.201  1.00 72.38  ? 480  TRP B CG  1 
ATOM   7910  C  CD1 . TRP B  1 480 ? -14.252 30.690  77.093  1.00 69.30  ? 480  TRP B CD1 1 
ATOM   7911  C  CD2 . TRP B  1 480 ? -15.131 29.178  78.488  1.00 76.21  ? 480  TRP B CD2 1 
ATOM   7912  N  NE1 . TRP B  1 480 ? -13.854 29.448  76.673  1.00 64.94  ? 480  TRP B NE1 1 
ATOM   7913  C  CE2 . TRP B  1 480 ? -14.376 28.503  77.515  1.00 66.50  ? 480  TRP B CE2 1 
ATOM   7914  C  CE3 . TRP B  1 480 ? -15.779 28.427  79.472  1.00 85.25  ? 480  TRP B CE3 1 
ATOM   7915  C  CZ2 . TRP B  1 480 ? -14.258 27.116  77.494  1.00 65.25  ? 480  TRP B CZ2 1 
ATOM   7916  C  CZ3 . TRP B  1 480 ? -15.651 27.045  79.449  1.00 85.45  ? 480  TRP B CZ3 1 
ATOM   7917  C  CH2 . TRP B  1 480 ? -14.900 26.408  78.469  1.00 59.18  ? 480  TRP B CH2 1 
ATOM   7918  N  N   . THR B  1 481 ? -16.030 34.019  81.061  1.00 74.93  ? 481  THR B N   1 
ATOM   7919  C  CA  . THR B  1 481 ? -15.913 35.404  81.501  1.00 77.16  ? 481  THR B CA  1 
ATOM   7920  C  C   . THR B  1 481 ? -15.185 35.504  82.847  1.00 76.95  ? 481  THR B C   1 
ATOM   7921  O  O   . THR B  1 481 ? -14.314 36.363  83.034  1.00 76.84  ? 481  THR B O   1 
ATOM   7922  C  CB  . THR B  1 481 ? -17.299 36.073  81.613  1.00 85.58  ? 481  THR B CB  1 
ATOM   7923  O  OG1 . THR B  1 481 ? -18.205 35.176  82.265  1.00 91.77  ? 481  THR B OG1 1 
ATOM   7924  C  CG2 . THR B  1 481 ? -17.850 36.414  80.234  1.00 82.34  ? 481  THR B CG2 1 
ATOM   7925  N  N   . ASN B  1 482 ? -15.549 34.629  83.783  1.00 75.70  ? 482  ASN B N   1 
ATOM   7926  C  CA  . ASN B  1 482 ? -14.881 34.569  85.079  1.00 78.73  ? 482  ASN B CA  1 
ATOM   7927  C  C   . ASN B  1 482 ? -13.371 34.350  84.915  1.00 80.93  ? 482  ASN B C   1 
ATOM   7928  O  O   . ASN B  1 482 ? -12.570 35.062  85.528  1.00 77.89  ? 482  ASN B O   1 
ATOM   7929  C  CB  . ASN B  1 482 ? -15.501 33.486  85.980  1.00 82.53  ? 482  ASN B CB  1 
ATOM   7930  C  CG  . ASN B  1 482 ? -16.685 33.997  86.808  1.00 91.86  ? 482  ASN B CG  1 
ATOM   7931  O  OD1 . ASN B  1 482 ? -16.708 35.147  87.256  1.00 93.38  ? 482  ASN B OD1 1 
ATOM   7932  N  ND2 . ASN B  1 482 ? -17.668 33.127  87.025  1.00 96.34  ? 482  ASN B ND2 1 
ATOM   7933  N  N   . PHE B  1 483 ? -12.988 33.379  84.081  1.00 83.44  ? 483  PHE B N   1 
ATOM   7934  C  CA  . PHE B  1 483 ? -11.567 33.161  83.778  1.00 81.09  ? 483  PHE B CA  1 
ATOM   7935  C  C   . PHE B  1 483 ? -10.931 34.432  83.210  1.00 79.84  ? 483  PHE B C   1 
ATOM   7936  O  O   . PHE B  1 483 ? -9.842  34.845  83.620  1.00 65.04  ? 483  PHE B O   1 
ATOM   7937  C  CB  . PHE B  1 483 ? -11.398 31.996  82.794  1.00 76.10  ? 483  PHE B CB  1 
ATOM   7938  C  CG  . PHE B  1 483 ? -9.956  31.648  82.488  1.00 69.78  ? 483  PHE B CG  1 
ATOM   7939  C  CD1 . PHE B  1 483 ? -9.165  31.008  83.424  1.00 67.02  ? 483  PHE B CD1 1 
ATOM   7940  C  CD2 . PHE B  1 483 ? -9.403  31.941  81.252  1.00 68.55  ? 483  PHE B CD2 1 
ATOM   7941  C  CE1 . PHE B  1 483 ? -7.849  30.684  83.139  1.00 64.40  ? 483  PHE B CE1 1 
ATOM   7942  C  CE2 . PHE B  1 483 ? -8.087  31.624  80.967  1.00 65.20  ? 483  PHE B CE2 1 
ATOM   7943  C  CZ  . PHE B  1 483 ? -7.315  30.993  81.911  1.00 56.32  ? 483  PHE B CZ  1 
ATOM   7944  N  N   . ALA B  1 484 ? -11.639 35.052  82.273  1.00 77.50  ? 484  ALA B N   1 
ATOM   7945  C  CA  . ALA B  1 484 ? -11.192 36.285  81.634  1.00 78.06  ? 484  ALA B CA  1 
ATOM   7946  C  C   . ALA B  1 484 ? -10.847 37.388  82.636  1.00 88.47  ? 484  ALA B C   1 
ATOM   7947  O  O   . ALA B  1 484 ? -9.758  37.963  82.573  1.00 87.12  ? 484  ALA B O   1 
ATOM   7948  C  CB  . ALA B  1 484 ? -12.240 36.777  80.642  1.00 72.17  ? 484  ALA B CB  1 
ATOM   7949  N  N   . ARG B  1 485 ? -11.764 37.684  83.558  1.00 97.38  ? 485  ARG B N   1 
ATOM   7950  C  CA  . ARG B  1 485 ? -11.529 38.779  84.506  1.00 99.86  ? 485  ARG B CA  1 
ATOM   7951  C  C   . ARG B  1 485 ? -10.582 38.406  85.652  1.00 97.02  ? 485  ARG B C   1 
ATOM   7952  O  O   . ARG B  1 485 ? -9.591  39.101  85.892  1.00 93.87  ? 485  ARG B O   1 
ATOM   7953  C  CB  . ARG B  1 485 ? -12.844 39.407  85.017  1.00 104.87 ? 485  ARG B CB  1 
ATOM   7954  C  CG  . ARG B  1 485 ? -13.932 38.428  85.425  1.00 109.37 ? 485  ARG B CG  1 
ATOM   7955  C  CD  . ARG B  1 485 ? -15.227 39.151  85.802  1.00 112.51 ? 485  ARG B CD  1 
ATOM   7956  N  NE  . ARG B  1 485 ? -16.274 38.222  86.237  1.00 113.40 ? 485  ARG B NE  1 
ATOM   7957  C  CZ  . ARG B  1 485 ? -17.334 37.875  85.506  1.00 108.29 ? 485  ARG B CZ  1 
ATOM   7958  N  NH1 . ARG B  1 485 ? -17.505 38.389  84.291  1.00 102.67 ? 485  ARG B NH1 1 
ATOM   7959  N  NH2 . ARG B  1 485 ? -18.228 37.019  85.996  1.00 106.50 ? 485  ARG B NH2 1 
ATOM   7960  N  N   . THR B  1 486 ? -10.875 37.306  86.343  1.00 97.43  ? 486  THR B N   1 
ATOM   7961  C  CA  . THR B  1 486 ? -10.049 36.874  87.468  1.00 95.22  ? 486  THR B CA  1 
ATOM   7962  C  C   . THR B  1 486 ? -8.964  35.894  87.037  1.00 100.77 ? 486  THR B C   1 
ATOM   7963  O  O   . THR B  1 486 ? -7.772  36.158  87.211  1.00 104.39 ? 486  THR B O   1 
ATOM   7964  C  CB  . THR B  1 486 ? -10.888 36.196  88.564  1.00 86.88  ? 486  THR B CB  1 
ATOM   7965  O  OG1 . THR B  1 486 ? -11.399 34.948  88.075  1.00 77.57  ? 486  THR B OG1 1 
ATOM   7966  C  CG2 . THR B  1 486 ? -12.041 37.097  89.001  1.00 89.01  ? 486  THR B CG2 1 
ATOM   7967  N  N   . GLY B  1 487 ? -9.389  34.764  86.476  1.00 98.86  ? 487  GLY B N   1 
ATOM   7968  C  CA  . GLY B  1 487 ? -8.492  33.669  86.146  1.00 90.56  ? 487  GLY B CA  1 
ATOM   7969  C  C   . GLY B  1 487 ? -9.026  32.358  86.694  1.00 86.27  ? 487  GLY B C   1 
ATOM   7970  O  O   . GLY B  1 487 ? -8.553  31.280  86.350  1.00 83.92  ? 487  GLY B O   1 
ATOM   7971  N  N   . ASP B  1 488 ? -10.012 32.465  87.576  1.00 85.58  ? 488  ASP B N   1 
ATOM   7972  C  CA  . ASP B  1 488 ? -10.720 31.313  88.102  1.00 82.58  ? 488  ASP B CA  1 
ATOM   7973  C  C   . ASP B  1 488 ? -12.012 31.261  87.305  1.00 80.92  ? 488  ASP B C   1 
ATOM   7974  O  O   . ASP B  1 488 ? -12.693 32.276  87.179  1.00 84.57  ? 488  ASP B O   1 
ATOM   7975  C  CB  . ASP B  1 488 ? -11.021 31.542  89.589  1.00 88.25  ? 488  ASP B CB  1 
ATOM   7976  C  CG  . ASP B  1 488 ? -11.421 30.264  90.332  1.00 88.31  ? 488  ASP B CG  1 
ATOM   7977  O  OD1 . ASP B  1 488 ? -12.103 29.392  89.754  1.00 87.43  ? 488  ASP B OD1 1 
ATOM   7978  O  OD2 . ASP B  1 488 ? -11.056 30.143  91.519  1.00 87.43  ? 488  ASP B OD2 1 
ATOM   7979  N  N   . PRO B  1 489 ? -12.340 30.096  86.728  1.00 76.50  ? 489  PRO B N   1 
ATOM   7980  C  CA  . PRO B  1 489 ? -13.624 29.947  86.036  1.00 70.10  ? 489  PRO B CA  1 
ATOM   7981  C  C   . PRO B  1 489 ? -14.776 29.912  87.023  1.00 82.39  ? 489  PRO B C   1 
ATOM   7982  O  O   . PRO B  1 489 ? -15.916 30.124  86.622  1.00 83.63  ? 489  PRO B O   1 
ATOM   7983  C  CB  . PRO B  1 489 ? -13.500 28.594  85.330  1.00 67.91  ? 489  PRO B CB  1 
ATOM   7984  C  CG  . PRO B  1 489 ? -12.446 27.866  86.080  1.00 75.31  ? 489  PRO B CG  1 
ATOM   7985  C  CD  . PRO B  1 489 ? -11.483 28.914  86.561  1.00 74.48  ? 489  PRO B CD  1 
ATOM   7986  N  N   . ASN B  1 490 ? -14.482 29.655  88.293  1.00 87.17  ? 490  ASN B N   1 
ATOM   7987  C  CA  . ASN B  1 490 ? -15.507 29.679  89.334  1.00 96.34  ? 490  ASN B CA  1 
ATOM   7988  C  C   . ASN B  1 490 ? -15.869 31.069  89.825  1.00 102.96 ? 490  ASN B C   1 
ATOM   7989  O  O   . ASN B  1 490 ? -15.022 31.959  89.919  1.00 100.88 ? 490  ASN B O   1 
ATOM   7990  C  CB  . ASN B  1 490 ? -15.088 28.842  90.535  1.00 98.11  ? 490  ASN B CB  1 
ATOM   7991  C  CG  . ASN B  1 490 ? -15.406 27.393  90.358  1.00 94.95  ? 490  ASN B CG  1 
ATOM   7992  O  OD1 . ASN B  1 490 ? -14.522 26.542  90.453  1.00 86.09  ? 490  ASN B OD1 1 
ATOM   7993  N  ND2 . ASN B  1 490 ? -16.678 27.093  90.092  1.00 79.57  ? 490  ASN B ND2 1 
ATOM   7994  N  N   . ASP B  1 491 ? -17.143 31.240  90.149  1.00 112.07 ? 491  ASP B N   1 
ATOM   7995  C  CA  . ASP B  1 491 ? -17.577 32.434  90.832  1.00 123.05 ? 491  ASP B CA  1 
ATOM   7996  C  C   . ASP B  1 491 ? -16.941 32.417  92.219  1.00 131.07 ? 491  ASP B C   1 
ATOM   7997  O  O   . ASP B  1 491 ? -16.841 31.356  92.839  1.00 134.95 ? 491  ASP B O   1 
ATOM   7998  C  CB  . ASP B  1 491 ? -19.092 32.445  90.940  1.00 128.80 ? 491  ASP B CB  1 
ATOM   7999  C  CG  . ASP B  1 491 ? -19.623 33.795  91.325  1.00 138.64 ? 491  ASP B CG  1 
ATOM   8000  O  OD1 . ASP B  1 491 ? -19.777 34.644  90.419  1.00 141.49 ? 491  ASP B OD1 1 
ATOM   8001  O  OD2 . ASP B  1 491 ? -19.870 34.011  92.531  1.00 143.19 ? 491  ASP B OD2 1 
ATOM   8002  N  N   . PRO B  1 492 ? -16.480 33.585  92.700  1.00 131.65 ? 492  PRO B N   1 
ATOM   8003  C  CA  . PRO B  1 492 ? -15.791 33.676  93.997  1.00 133.24 ? 492  PRO B CA  1 
ATOM   8004  C  C   . PRO B  1 492 ? -16.719 33.481  95.199  1.00 141.30 ? 492  PRO B C   1 
ATOM   8005  O  O   . PRO B  1 492 ? -16.578 32.512  95.957  1.00 138.37 ? 492  PRO B O   1 
ATOM   8006  C  CB  . PRO B  1 492 ? -15.235 35.109  94.001  1.00 127.31 ? 492  PRO B CB  1 
ATOM   8007  C  CG  . PRO B  1 492 ? -15.254 35.548  92.566  1.00 123.65 ? 492  PRO B CG  1 
ATOM   8008  C  CD  . PRO B  1 492 ? -16.435 34.860  91.963  1.00 126.31 ? 492  PRO B CD  1 
ATOM   8009  N  N   . ARG B  1 493 ? -17.659 34.412  95.356  1.00 150.19 ? 493  ARG B N   1 
ATOM   8010  C  CA  . ARG B  1 493 ? -18.567 34.459  96.503  1.00 157.74 ? 493  ARG B CA  1 
ATOM   8011  C  C   . ARG B  1 493 ? -19.531 33.271  96.569  1.00 165.51 ? 493  ARG B C   1 
ATOM   8012  O  O   . ARG B  1 493 ? -20.055 32.946  97.641  1.00 168.83 ? 493  ARG B O   1 
ATOM   8013  C  CB  . ARG B  1 493 ? -19.371 35.765  96.475  1.00 153.34 ? 493  ARG B CB  1 
ATOM   8014  C  CG  . ARG B  1 493 ? -20.194 35.943  95.206  1.00 146.39 ? 493  ARG B CG  1 
ATOM   8015  C  CD  . ARG B  1 493 ? -21.126 37.131  95.300  1.00 147.08 ? 493  ARG B CD  1 
ATOM   8016  N  NE  . ARG B  1 493 ? -20.703 38.240  94.447  1.00 144.02 ? 493  ARG B NE  1 
ATOM   8017  C  CZ  . ARG B  1 493 ? -20.197 39.383  94.900  1.00 142.37 ? 493  ARG B CZ  1 
ATOM   8018  N  NH1 . ARG B  1 493 ? -20.047 39.574  96.205  1.00 145.02 ? 493  ARG B NH1 1 
ATOM   8019  N  NH2 . ARG B  1 493 ? -19.844 40.337  94.049  1.00 137.95 ? 493  ARG B NH2 1 
ATOM   8020  N  N   . ASP B  1 494 ? -19.765 32.635  95.421  1.00 164.98 ? 494  ASP B N   1 
ATOM   8021  C  CA  . ASP B  1 494 ? -20.732 31.542  95.314  1.00 161.82 ? 494  ASP B CA  1 
ATOM   8022  C  C   . ASP B  1 494 ? -20.334 30.330  96.168  1.00 161.52 ? 494  ASP B C   1 
ATOM   8023  O  O   . ASP B  1 494 ? -19.202 29.832  96.093  1.00 155.31 ? 494  ASP B O   1 
ATOM   8024  C  CB  . ASP B  1 494 ? -20.938 31.145  93.845  1.00 151.23 ? 494  ASP B CB  1 
ATOM   8025  C  CG  . ASP B  1 494 ? -22.153 30.261  93.640  1.00 142.59 ? 494  ASP B CG  1 
ATOM   8026  O  OD1 . ASP B  1 494 ? -23.065 30.287  94.494  1.00 138.43 ? 494  ASP B OD1 1 
ATOM   8027  O  OD2 . ASP B  1 494 ? -22.195 29.543  92.618  1.00 139.70 ? 494  ASP B OD2 1 
ATOM   8028  N  N   . SER B  1 495 ? -21.284 29.878  96.984  1.00 164.64 ? 495  SER B N   1 
ATOM   8029  C  CA  . SER B  1 495 ? -21.059 28.806  97.947  1.00 165.20 ? 495  SER B CA  1 
ATOM   8030  C  C   . SER B  1 495 ? -20.795 27.474  97.253  1.00 161.60 ? 495  SER B C   1 
ATOM   8031  O  O   . SER B  1 495 ? -19.686 27.227  96.776  1.00 157.53 ? 495  SER B O   1 
ATOM   8032  C  CB  . SER B  1 495 ? -22.263 28.684  98.884  1.00 169.15 ? 495  SER B CB  1 
ATOM   8033  O  OG  . SER B  1 495 ? -22.656 29.954  99.379  1.00 170.84 ? 495  SER B OG  1 
ATOM   8034  N  N   . LYS B  1 496 ? -21.812 26.615  97.212  1.00 163.71 ? 496  LYS B N   1 
ATOM   8035  C  CA  . LYS B  1 496 ? -21.720 25.363  96.468  1.00 163.49 ? 496  LYS B CA  1 
ATOM   8036  C  C   . LYS B  1 496 ? -21.692 25.659  94.972  1.00 169.05 ? 496  LYS B C   1 
ATOM   8037  O  O   . LYS B  1 496 ? -22.515 26.431  94.465  1.00 170.00 ? 496  LYS B O   1 
ATOM   8038  C  CB  . LYS B  1 496 ? -22.893 24.431  96.791  1.00 158.86 ? 496  LYS B CB  1 
ATOM   8039  C  CG  . LYS B  1 496 ? -22.870 23.123  95.999  1.00 151.36 ? 496  LYS B CG  1 
ATOM   8040  C  CD  . LYS B  1 496 ? -24.209 22.844  95.319  1.00 148.75 ? 496  LYS B CD  1 
ATOM   8041  C  CE  . LYS B  1 496 ? -24.545 23.863  94.227  1.00 143.38 ? 496  LYS B CE  1 
ATOM   8042  N  NZ  . LYS B  1 496 ? -23.991 23.494  92.888  1.00 135.11 ? 496  LYS B NZ  1 
ATOM   8043  N  N   . SER B  1 497 ? -20.744 25.046  94.268  1.00 169.20 ? 497  SER B N   1 
ATOM   8044  C  CA  . SER B  1 497 ? -20.616 25.275  92.833  1.00 164.89 ? 497  SER B CA  1 
ATOM   8045  C  C   . SER B  1 497 ? -20.936 24.040  91.958  1.00 159.52 ? 497  SER B C   1 
ATOM   8046  O  O   . SER B  1 497 ? -21.870 24.099  91.154  1.00 163.84 ? 497  SER B O   1 
ATOM   8047  C  CB  . SER B  1 497 ? -19.269 25.933  92.489  1.00 162.32 ? 497  SER B CB  1 
ATOM   8048  O  OG  . SER B  1 497 ? -18.529 26.231  93.664  1.00 161.92 ? 497  SER B OG  1 
ATOM   8049  N  N   . PRO B  1 498 ? -20.196 22.915  92.105  1.00 146.29 ? 498  PRO B N   1 
ATOM   8050  C  CA  . PRO B  1 498 ? -19.019 22.542  92.905  1.00 137.16 ? 498  PRO B CA  1 
ATOM   8051  C  C   . PRO B  1 498 ? -17.729 23.088  92.298  1.00 128.25 ? 498  PRO B C   1 
ATOM   8052  O  O   . PRO B  1 498 ? -17.706 23.442  91.119  1.00 126.45 ? 498  PRO B O   1 
ATOM   8053  C  CB  . PRO B  1 498 ? -19.009 21.008  92.827  1.00 133.95 ? 498  PRO B CB  1 
ATOM   8054  C  CG  . PRO B  1 498 ? -20.345 20.623  92.297  1.00 136.59 ? 498  PRO B CG  1 
ATOM   8055  C  CD  . PRO B  1 498 ? -20.744 21.742  91.406  1.00 140.48 ? 498  PRO B CD  1 
ATOM   8056  N  N   . GLN B  1 499 ? -16.668 23.146  93.097  1.00 121.78 ? 499  GLN B N   1 
ATOM   8057  C  CA  . GLN B  1 499 ? -15.448 23.839  92.696  1.00 113.68 ? 499  GLN B CA  1 
ATOM   8058  C  C   . GLN B  1 499 ? -14.719 23.179  91.523  1.00 108.65 ? 499  GLN B C   1 
ATOM   8059  O  O   . GLN B  1 499 ? -14.651 21.952  91.419  1.00 108.63 ? 499  GLN B O   1 
ATOM   8060  C  CB  . GLN B  1 499 ? -14.506 24.012  93.896  1.00 109.84 ? 499  GLN B CB  1 
ATOM   8061  C  CG  . GLN B  1 499 ? -13.723 25.327  93.902  1.00 105.66 ? 499  GLN B CG  1 
ATOM   8062  C  CD  . GLN B  1 499 ? -14.614 26.557  94.055  1.00 105.30 ? 499  GLN B CD  1 
ATOM   8063  O  OE1 . GLN B  1 499 ? -15.785 26.454  94.427  1.00 107.45 ? 499  GLN B OE1 1 
ATOM   8064  N  NE2 . GLN B  1 499 ? -14.056 27.730  93.766  1.00 101.82 ? 499  GLN B NE2 1 
ATOM   8065  N  N   . TRP B  1 500 ? -14.190 24.024  90.640  1.00 100.88 ? 500  TRP B N   1 
ATOM   8066  C  CA  . TRP B  1 500 ? -13.378 23.607  89.505  1.00 89.34  ? 500  TRP B CA  1 
ATOM   8067  C  C   . TRP B  1 500 ? -11.907 23.809  89.876  1.00 82.27  ? 500  TRP B C   1 
ATOM   8068  O  O   . TRP B  1 500 ? -11.427 24.941  89.951  1.00 78.61  ? 500  TRP B O   1 
ATOM   8069  C  CB  . TRP B  1 500 ? -13.768 24.449  88.288  1.00 87.32  ? 500  TRP B CB  1 
ATOM   8070  C  CG  . TRP B  1 500 ? -13.035 24.174  87.001  1.00 84.10  ? 500  TRP B CG  1 
ATOM   8071  C  CD1 . TRP B  1 500 ? -11.798 23.616  86.844  1.00 79.95  ? 500  TRP B CD1 1 
ATOM   8072  C  CD2 . TRP B  1 500 ? -13.514 24.457  85.686  1.00 82.23  ? 500  TRP B CD2 1 
ATOM   8073  N  NE1 . TRP B  1 500 ? -11.481 23.534  85.513  1.00 76.37  ? 500  TRP B NE1 1 
ATOM   8074  C  CE2 . TRP B  1 500 ? -12.518 24.046  84.782  1.00 79.85  ? 500  TRP B CE2 1 
ATOM   8075  C  CE3 . TRP B  1 500 ? -14.692 25.021  85.185  1.00 83.91  ? 500  TRP B CE3 1 
ATOM   8076  C  CZ2 . TRP B  1 500 ? -12.665 24.178  83.407  1.00 83.72  ? 500  TRP B CZ2 1 
ATOM   8077  C  CZ3 . TRP B  1 500 ? -14.836 25.155  83.822  1.00 83.90  ? 500  TRP B CZ3 1 
ATOM   8078  C  CH2 . TRP B  1 500 ? -13.829 24.736  82.947  1.00 85.29  ? 500  TRP B CH2 1 
ATOM   8079  N  N   . PRO B  1 501 ? -11.192 22.704  90.118  1.00 68.81  ? 501  PRO B N   1 
ATOM   8080  C  CA  . PRO B  1 501 ? -9.817  22.709  90.634  1.00 85.36  ? 501  PRO B CA  1 
ATOM   8081  C  C   . PRO B  1 501 ? -8.738  22.830  89.561  1.00 80.84  ? 501  PRO B C   1 
ATOM   8082  O  O   . PRO B  1 501 ? -8.957  22.423  88.426  1.00 79.88  ? 501  PRO B O   1 
ATOM   8083  C  CB  . PRO B  1 501 ? -9.708  21.347  91.310  1.00 82.97  ? 501  PRO B CB  1 
ATOM   8084  C  CG  . PRO B  1 501 ? -10.613 20.479  90.513  1.00 83.85  ? 501  PRO B CG  1 
ATOM   8085  C  CD  . PRO B  1 501 ? -11.752 21.345  90.041  1.00 68.87  ? 501  PRO B CD  1 
ATOM   8086  N  N   . PRO B  1 502 ? -7.572  23.383  89.918  1.00 78.86  ? 502  PRO B N   1 
ATOM   8087  C  CA  . PRO B  1 502 ? -6.479  23.495  88.946  1.00 78.29  ? 502  PRO B CA  1 
ATOM   8088  C  C   . PRO B  1 502 ? -5.842  22.149  88.603  1.00 75.69  ? 502  PRO B C   1 
ATOM   8089  O  O   . PRO B  1 502 ? -5.608  21.313  89.475  1.00 76.41  ? 502  PRO B O   1 
ATOM   8090  C  CB  . PRO B  1 502 ? -5.461  24.400  89.659  1.00 76.63  ? 502  PRO B CB  1 
ATOM   8091  C  CG  . PRO B  1 502 ? -6.250  25.105  90.712  1.00 77.43  ? 502  PRO B CG  1 
ATOM   8092  C  CD  . PRO B  1 502 ? -7.264  24.100  91.163  1.00 65.91  ? 502  PRO B CD  1 
ATOM   8093  N  N   . TYR B  1 503 ? -5.575  21.947  87.324  1.00 56.56  ? 503  TYR B N   1 
ATOM   8094  C  CA  . TYR B  1 503 ? -4.892  20.754  86.881  1.00 67.06  ? 503  TYR B CA  1 
ATOM   8095  C  C   . TYR B  1 503 ? -3.477  20.858  87.432  1.00 75.74  ? 503  TYR B C   1 
ATOM   8096  O  O   . TYR B  1 503 ? -2.821  21.891  87.280  1.00 84.34  ? 503  TYR B O   1 
ATOM   8097  C  CB  . TYR B  1 503 ? -4.891  20.695  85.346  1.00 60.64  ? 503  TYR B CB  1 
ATOM   8098  C  CG  . TYR B  1 503 ? -4.471  19.371  84.741  1.00 61.26  ? 503  TYR B CG  1 
ATOM   8099  C  CD1 . TYR B  1 503 ? -5.406  18.377  84.482  1.00 63.99  ? 503  TYR B CD1 1 
ATOM   8100  C  CD2 . TYR B  1 503 ? -3.139  19.123  84.403  1.00 59.92  ? 503  TYR B CD2 1 
ATOM   8101  C  CE1 . TYR B  1 503 ? -5.022  17.159  83.920  1.00 65.79  ? 503  TYR B CE1 1 
ATOM   8102  C  CE2 . TYR B  1 503 ? -2.748  17.911  83.841  1.00 57.96  ? 503  TYR B CE2 1 
ATOM   8103  C  CZ  . TYR B  1 503 ? -3.693  16.930  83.602  1.00 58.48  ? 503  TYR B CZ  1 
ATOM   8104  O  OH  . TYR B  1 503 ? -3.317  15.722  83.043  1.00 49.80  ? 503  TYR B OH  1 
ATOM   8105  N  N   . THR B  1 504 ? -3.029  19.815  88.124  1.00 71.77  ? 504  THR B N   1 
ATOM   8106  C  CA  . THR B  1 504 ? -1.646  19.731  88.575  1.00 63.40  ? 504  THR B CA  1 
ATOM   8107  C  C   . THR B  1 504 ? -1.123  18.386  88.133  1.00 57.38  ? 504  THR B C   1 
ATOM   8108  O  O   . THR B  1 504 ? -1.904  17.505  87.769  1.00 55.69  ? 504  THR B O   1 
ATOM   8109  C  CB  . THR B  1 504 ? -1.521  19.813  90.099  1.00 67.57  ? 504  THR B CB  1 
ATOM   8110  O  OG1 . THR B  1 504 ? -2.116  18.651  90.695  1.00 67.99  ? 504  THR B OG1 1 
ATOM   8111  C  CG2 . THR B  1 504 ? -2.199  21.067  90.632  1.00 73.12  ? 504  THR B CG2 1 
ATOM   8112  N  N   . THR B  1 505 ? 0.194   18.221  88.167  1.00 55.64  ? 505  THR B N   1 
ATOM   8113  C  CA  . THR B  1 505 ? 0.805   16.984  87.703  1.00 56.15  ? 505  THR B CA  1 
ATOM   8114  C  C   . THR B  1 505 ? 0.423   15.832  88.619  1.00 60.59  ? 505  THR B C   1 
ATOM   8115  O  O   . THR B  1 505 ? 0.374   14.675  88.191  1.00 55.00  ? 505  THR B O   1 
ATOM   8116  C  CB  . THR B  1 505 ? 2.333   17.100  87.656  1.00 55.25  ? 505  THR B CB  1 
ATOM   8117  O  OG1 . THR B  1 505 ? 2.823   17.420  88.964  1.00 61.63  ? 505  THR B OG1 1 
ATOM   8118  C  CG2 . THR B  1 505 ? 2.745   18.187  86.684  1.00 49.44  ? 505  THR B CG2 1 
ATOM   8119  N  N   . ALA B  1 506 ? 0.131   16.171  89.875  1.00 67.35  ? 506  ALA B N   1 
ATOM   8120  C  CA  . ALA B  1 506 ? -0.157  15.191  90.923  1.00 64.45  ? 506  ALA B CA  1 
ATOM   8121  C  C   . ALA B  1 506 ? -1.546  14.555  90.812  1.00 60.73  ? 506  ALA B C   1 
ATOM   8122  O  O   . ALA B  1 506 ? -1.676  13.324  90.760  1.00 54.68  ? 506  ALA B O   1 
ATOM   8123  C  CB  . ALA B  1 506 ? 0.030   15.823  92.307  1.00 62.77  ? 506  ALA B CB  1 
ATOM   8124  N  N   . ALA B  1 507 ? -2.578  15.392  90.782  1.00 61.96  ? 507  ALA B N   1 
ATOM   8125  C  CA  . ALA B  1 507 ? -3.946  14.894  90.856  1.00 69.49  ? 507  ALA B CA  1 
ATOM   8126  C  C   . ALA B  1 507 ? -4.613  14.786  89.485  1.00 75.50  ? 507  ALA B C   1 
ATOM   8127  O  O   . ALA B  1 507 ? -5.528  13.973  89.297  1.00 79.31  ? 507  ALA B O   1 
ATOM   8128  C  CB  . ALA B  1 507 ? -4.777  15.760  91.798  1.00 71.48  ? 507  ALA B CB  1 
ATOM   8129  N  N   . GLN B  1 508 ? -4.156  15.613  88.544  1.00 72.61  ? 508  GLN B N   1 
ATOM   8130  C  CA  . GLN B  1 508 ? -4.684  15.631  87.181  1.00 67.25  ? 508  GLN B CA  1 
ATOM   8131  C  C   . GLN B  1 508 ? -6.186  15.819  87.127  1.00 65.63  ? 508  GLN B C   1 
ATOM   8132  O  O   . GLN B  1 508 ? -6.879  15.080  86.432  1.00 61.30  ? 508  GLN B O   1 
ATOM   8133  C  CB  . GLN B  1 508 ? -4.353  14.330  86.471  1.00 64.97  ? 508  GLN B CB  1 
ATOM   8134  C  CG  . GLN B  1 508 ? -2.917  14.175  86.089  1.00 61.39  ? 508  GLN B CG  1 
ATOM   8135  C  CD  . GLN B  1 508 ? -2.722  12.975  85.205  1.00 57.46  ? 508  GLN B CD  1 
ATOM   8136  O  OE1 . GLN B  1 508 ? -2.319  11.917  85.684  1.00 52.64  ? 508  GLN B OE1 1 
ATOM   8137  N  NE2 . GLN B  1 508 ? -3.030  13.120  83.902  1.00 46.00  ? 508  GLN B NE2 1 
ATOM   8138  N  N   . GLN B  1 509 ? -6.691  16.800  87.860  1.00 56.82  ? 509  GLN B N   1 
ATOM   8139  C  CA  . GLN B  1 509 ? -8.128  17.014  87.923  1.00 65.52  ? 509  GLN B CA  1 
ATOM   8140  C  C   . GLN B  1 509 ? -8.649  17.837  86.750  1.00 64.07  ? 509  GLN B C   1 
ATOM   8141  O  O   . GLN B  1 509 ? -8.092  18.882  86.425  1.00 57.19  ? 509  GLN B O   1 
ATOM   8142  C  CB  . GLN B  1 509 ? -8.494  17.691  89.240  1.00 69.79  ? 509  GLN B CB  1 
ATOM   8143  C  CG  . GLN B  1 509 ? -8.041  16.925  90.472  1.00 62.69  ? 509  GLN B CG  1 
ATOM   8144  C  CD  . GLN B  1 509 ? -8.521  17.569  91.757  1.00 69.58  ? 509  GLN B CD  1 
ATOM   8145  O  OE1 . GLN B  1 509 ? -8.223  18.731  92.028  1.00 71.07  ? 509  GLN B OE1 1 
ATOM   8146  N  NE2 . GLN B  1 509 ? -9.279  16.821  92.551  1.00 67.79  ? 509  GLN B NE2 1 
ATOM   8147  N  N   . TYR B  1 510 ? -9.717  17.355  86.118  1.00 67.78  ? 510  TYR B N   1 
ATOM   8148  C  CA  . TYR B  1 510 ? -10.413 18.104  85.066  1.00 70.69  ? 510  TYR B CA  1 
ATOM   8149  C  C   . TYR B  1 510 ? -11.912 18.022  85.266  1.00 69.44  ? 510  TYR B C   1 
ATOM   8150  O  O   . TYR B  1 510 ? -12.396 17.060  85.848  1.00 61.87  ? 510  TYR B O   1 
ATOM   8151  C  CB  . TYR B  1 510 ? -10.064 17.579  83.670  1.00 71.90  ? 510  TYR B CB  1 
ATOM   8152  C  CG  . TYR B  1 510 ? -10.434 16.130  83.382  1.00 68.58  ? 510  TYR B CG  1 
ATOM   8153  C  CD1 . TYR B  1 510 ? -9.586  15.099  83.753  1.00 70.81  ? 510  TYR B CD1 1 
ATOM   8154  C  CD2 . TYR B  1 510 ? -11.608 15.798  82.706  1.00 60.63  ? 510  TYR B CD2 1 
ATOM   8155  C  CE1 . TYR B  1 510 ? -9.894  13.781  83.481  1.00 70.29  ? 510  TYR B CE1 1 
ATOM   8156  C  CE2 . TYR B  1 510 ? -11.925 14.476  82.430  1.00 58.39  ? 510  TYR B CE2 1 
ATOM   8157  C  CZ  . TYR B  1 510 ? -11.056 13.473  82.820  1.00 67.14  ? 510  TYR B CZ  1 
ATOM   8158  O  OH  . TYR B  1 510 ? -11.325 12.148  82.566  1.00 71.25  ? 510  TYR B OH  1 
ATOM   8159  N  N   . VAL B  1 511 ? -12.648 19.017  84.776  1.00 71.02  ? 511  VAL B N   1 
ATOM   8160  C  CA  . VAL B  1 511 ? -14.100 19.027  84.966  1.00 73.06  ? 511  VAL B CA  1 
ATOM   8161  C  C   . VAL B  1 511 ? -14.866 18.540  83.753  1.00 71.41  ? 511  VAL B C   1 
ATOM   8162  O  O   . VAL B  1 511 ? -14.379 18.591  82.620  1.00 60.74  ? 511  VAL B O   1 
ATOM   8163  C  CB  . VAL B  1 511 ? -14.653 20.411  85.374  1.00 72.51  ? 511  VAL B CB  1 
ATOM   8164  C  CG1 . VAL B  1 511 ? -13.865 20.965  86.536  1.00 75.14  ? 511  VAL B CG1 1 
ATOM   8165  C  CG2 . VAL B  1 511 ? -14.627 21.365  84.202  1.00 72.63  ? 511  VAL B CG2 1 
ATOM   8166  N  N   . SER B  1 512 ? -16.079 18.073  84.019  1.00 73.94  ? 512  SER B N   1 
ATOM   8167  C  CA  . SER B  1 512 ? -16.959 17.559  82.992  1.00 75.30  ? 512  SER B CA  1 
ATOM   8168  C  C   . SER B  1 512 ? -18.052 18.581  82.700  1.00 78.96  ? 512  SER B C   1 
ATOM   8169  O  O   . SER B  1 512 ? -18.997 18.711  83.474  1.00 90.88  ? 512  SER B O   1 
ATOM   8170  C  CB  . SER B  1 512 ? -17.577 16.249  83.472  1.00 66.53  ? 512  SER B CB  1 
ATOM   8171  O  OG  . SER B  1 512 ? -18.429 15.701  82.489  1.00 86.76  ? 512  SER B OG  1 
ATOM   8172  N  N   . LEU B  1 513 ? -17.914 19.319  81.601  1.00 74.49  ? 513  LEU B N   1 
ATOM   8173  C  CA  . LEU B  1 513 ? -18.935 20.291  81.202  1.00 76.39  ? 513  LEU B CA  1 
ATOM   8174  C  C   . LEU B  1 513 ? -19.992 19.598  80.375  1.00 76.69  ? 513  LEU B C   1 
ATOM   8175  O  O   . LEU B  1 513 ? -19.742 19.250  79.223  1.00 76.72  ? 513  LEU B O   1 
ATOM   8176  C  CB  . LEU B  1 513 ? -18.339 21.412  80.356  1.00 64.92  ? 513  LEU B CB  1 
ATOM   8177  C  CG  . LEU B  1 513 ? -17.210 22.231  80.957  1.00 64.16  ? 513  LEU B CG  1 
ATOM   8178  C  CD1 . LEU B  1 513 ? -16.785 23.294  79.968  1.00 79.45  ? 513  LEU B CD1 1 
ATOM   8179  C  CD2 . LEU B  1 513 ? -17.649 22.845  82.267  1.00 77.65  ? 513  LEU B CD2 1 
ATOM   8180  N  N   . ASN B  1 514 ? -21.172 19.399  80.947  1.00 79.67  ? 514  ASN B N   1 
ATOM   8181  C  CA  . ASN B  1 514 ? -22.229 18.739  80.194  1.00 85.14  ? 514  ASN B CA  1 
ATOM   8182  C  C   . ASN B  1 514 ? -23.660 19.008  80.645  1.00 92.42  ? 514  ASN B C   1 
ATOM   8183  O  O   . ASN B  1 514 ? -23.986 20.040  81.248  1.00 86.50  ? 514  ASN B O   1 
ATOM   8184  C  CB  . ASN B  1 514 ? -21.974 17.218  80.082  1.00 83.01  ? 514  ASN B CB  1 
ATOM   8185  C  CG  . ASN B  1 514 ? -21.977 16.500  81.437  1.00 84.11  ? 514  ASN B CG  1 
ATOM   8186  O  OD1 . ASN B  1 514 ? -21.896 17.128  82.496  1.00 83.43  ? 514  ASN B OD1 1 
ATOM   8187  N  ND2 . ASN B  1 514 ? -22.055 15.169  81.397  1.00 83.35  ? 514  ASN B ND2 1 
ATOM   8188  N  N   . LEU B  1 515 ? -24.502 18.043  80.308  1.00 100.69 ? 515  LEU B N   1 
ATOM   8189  C  CA  . LEU B  1 515 ? -25.922 18.071  80.580  1.00 105.36 ? 515  LEU B CA  1 
ATOM   8190  C  C   . LEU B  1 515 ? -26.184 18.280  82.076  1.00 106.81 ? 515  LEU B C   1 
ATOM   8191  O  O   . LEU B  1 515 ? -26.881 19.223  82.470  1.00 101.73 ? 515  LEU B O   1 
ATOM   8192  C  CB  . LEU B  1 515 ? -26.536 16.763  80.054  1.00 104.78 ? 515  LEU B CB  1 
ATOM   8193  C  CG  . LEU B  1 515 ? -25.707 16.101  78.931  1.00 96.88  ? 515  LEU B CG  1 
ATOM   8194  C  CD1 . LEU B  1 515 ? -24.984 14.859  79.447  1.00 91.32  ? 515  LEU B CD1 1 
ATOM   8195  C  CD2 . LEU B  1 515 ? -26.512 15.773  77.670  1.00 75.30  ? 515  LEU B CD2 1 
ATOM   8196  N  N   . LYS B  1 516 ? -25.584 17.405  82.890  1.00 108.90 ? 516  LYS B N   1 
ATOM   8197  C  CA  . LYS B  1 516 ? -25.665 17.433  84.357  1.00 104.32 ? 516  LYS B CA  1 
ATOM   8198  C  C   . LYS B  1 516 ? -24.797 18.572  84.937  1.00 104.05 ? 516  LYS B C   1 
ATOM   8199  O  O   . LYS B  1 516 ? -24.178 19.322  84.174  1.00 103.03 ? 516  LYS B O   1 
ATOM   8200  C  CB  . LYS B  1 516 ? -25.225 16.070  84.923  1.00 94.01  ? 516  LYS B CB  1 
ATOM   8201  C  CG  . LYS B  1 516 ? -25.913 14.846  84.312  1.00 93.71  ? 516  LYS B CG  1 
ATOM   8202  C  CD  . LYS B  1 516 ? -24.996 14.128  83.313  1.00 93.80  ? 516  LYS B CD  1 
ATOM   8203  C  CE  . LYS B  1 516 ? -25.368 12.654  83.114  1.00 93.21  ? 516  LYS B CE  1 
ATOM   8204  N  NZ  . LYS B  1 516 ? -24.448 11.972  82.143  1.00 87.03  ? 516  LYS B NZ  1 
ATOM   8205  N  N   . PRO B  1 517 ? -24.764 18.728  86.282  1.00 101.47 ? 517  PRO B N   1 
ATOM   8206  C  CA  . PRO B  1 517 ? -23.864 19.744  86.845  1.00 95.98  ? 517  PRO B CA  1 
ATOM   8207  C  C   . PRO B  1 517 ? -22.380 19.416  86.756  1.00 90.70  ? 517  PRO B C   1 
ATOM   8208  O  O   . PRO B  1 517 ? -21.956 18.418  86.167  1.00 81.92  ? 517  PRO B O   1 
ATOM   8209  C  CB  . PRO B  1 517 ? -24.266 19.794  88.320  1.00 93.08  ? 517  PRO B CB  1 
ATOM   8210  C  CG  . PRO B  1 517 ? -25.658 19.352  88.333  1.00 98.06  ? 517  PRO B CG  1 
ATOM   8211  C  CD  . PRO B  1 517 ? -25.760 18.296  87.279  1.00 100.57 ? 517  PRO B CD  1 
ATOM   8212  N  N   . LEU B  1 518 ? -21.597 20.295  87.368  1.00 93.18  ? 518  LEU B N   1 
ATOM   8213  C  CA  . LEU B  1 518 ? -20.148 20.207  87.352  1.00 90.30  ? 518  LEU B CA  1 
ATOM   8214  C  C   . LEU B  1 518 ? -19.699 18.940  88.074  1.00 88.33  ? 518  LEU B C   1 
ATOM   8215  O  O   . LEU B  1 518 ? -20.076 18.700  89.217  1.00 91.34  ? 518  LEU B O   1 
ATOM   8216  C  CB  . LEU B  1 518 ? -19.568 21.454  88.027  1.00 93.06  ? 518  LEU B CB  1 
ATOM   8217  C  CG  . LEU B  1 518 ? -18.282 22.104  87.521  1.00 89.49  ? 518  LEU B CG  1 
ATOM   8218  C  CD1 . LEU B  1 518 ? -17.063 21.444  88.149  1.00 74.14  ? 518  LEU B CD1 1 
ATOM   8219  C  CD2 . LEU B  1 518 ? -18.237 22.052  86.000  1.00 72.99  ? 518  LEU B CD2 1 
ATOM   8220  N  N   . GLU B  1 519 ? -18.903 18.127  87.392  1.00 87.22  ? 519  GLU B N   1 
ATOM   8221  C  CA  . GLU B  1 519 ? -18.406 16.875  87.953  1.00 87.30  ? 519  GLU B CA  1 
ATOM   8222  C  C   . GLU B  1 519 ? -16.879 16.781  87.775  1.00 80.90  ? 519  GLU B C   1 
ATOM   8223  O  O   . GLU B  1 519 ? -16.352 17.144  86.723  1.00 73.20  ? 519  GLU B O   1 
ATOM   8224  C  CB  . GLU B  1 519 ? -19.114 15.696  87.283  1.00 88.57  ? 519  GLU B CB  1 
ATOM   8225  C  CG  . GLU B  1 519 ? -18.964 14.373  88.001  1.00 92.94  ? 519  GLU B CG  1 
ATOM   8226  C  CD  . GLU B  1 519 ? -18.844 13.220  87.030  1.00 96.40  ? 519  GLU B CD  1 
ATOM   8227  O  OE1 . GLU B  1 519 ? -19.306 13.377  85.877  1.00 100.59 ? 519  GLU B OE1 1 
ATOM   8228  O  OE2 . GLU B  1 519 ? -18.274 12.172  87.406  1.00 94.35  ? 519  GLU B OE2 1 
ATOM   8229  N  N   . VAL B  1 520 ? -16.171 16.311  88.802  1.00 72.10  ? 520  VAL B N   1 
ATOM   8230  C  CA  . VAL B  1 520 ? -14.708 16.307  88.778  1.00 76.80  ? 520  VAL B CA  1 
ATOM   8231  C  C   . VAL B  1 520 ? -14.121 14.932  88.492  1.00 74.17  ? 520  VAL B C   1 
ATOM   8232  O  O   . VAL B  1 520 ? -14.462 13.950  89.148  1.00 77.30  ? 520  VAL B O   1 
ATOM   8233  C  CB  . VAL B  1 520 ? -14.099 16.863  90.077  1.00 70.93  ? 520  VAL B CB  1 
ATOM   8234  C  CG1 . VAL B  1 520 ? -12.600 16.588  90.124  1.00 68.60  ? 520  VAL B CG1 1 
ATOM   8235  C  CG2 . VAL B  1 520 ? -14.364 18.354  90.180  1.00 71.95  ? 520  VAL B CG2 1 
ATOM   8236  N  N   . ARG B  1 521 ? -13.231 14.884  87.504  1.00 67.16  ? 521  ARG B N   1 
ATOM   8237  C  CA  . ARG B  1 521 ? -12.615 13.643  87.065  1.00 66.69  ? 521  ARG B CA  1 
ATOM   8238  C  C   . ARG B  1 521 ? -11.081 13.691  87.111  1.00 69.23  ? 521  ARG B C   1 
ATOM   8239  O  O   . ARG B  1 521 ? -10.469 14.762  87.183  1.00 70.58  ? 521  ARG B O   1 
ATOM   8240  C  CB  . ARG B  1 521 ? -13.131 13.243  85.679  1.00 64.32  ? 521  ARG B CB  1 
ATOM   8241  C  CG  . ARG B  1 521 ? -14.551 12.702  85.704  1.00 69.28  ? 521  ARG B CG  1 
ATOM   8242  C  CD  . ARG B  1 521 ? -15.029 12.273  84.328  1.00 73.55  ? 521  ARG B CD  1 
ATOM   8243  N  NE  . ARG B  1 521 ? -16.316 12.882  84.001  1.00 77.90  ? 521  ARG B NE  1 
ATOM   8244  C  CZ  . ARG B  1 521 ? -17.063 12.555  82.952  1.00 78.88  ? 521  ARG B CZ  1 
ATOM   8245  N  NH1 . ARG B  1 521 ? -16.667 11.610  82.111  1.00 77.70  ? 521  ARG B NH1 1 
ATOM   8246  N  NH2 . ARG B  1 521 ? -18.215 13.173  82.750  1.00 81.13  ? 521  ARG B NH2 1 
ATOM   8247  N  N   . ARG B  1 522 ? -10.480 12.509  87.076  1.00 66.48  ? 522  ARG B N   1 
ATOM   8248  C  CA  . ARG B  1 522 ? -9.070  12.340  87.358  1.00 65.95  ? 522  ARG B CA  1 
ATOM   8249  C  C   . ARG B  1 522 ? -8.367  11.698  86.160  1.00 65.05  ? 522  ARG B C   1 
ATOM   8250  O  O   . ARG B  1 522 ? -8.822  10.675  85.641  1.00 65.32  ? 522  ARG B O   1 
ATOM   8251  C  CB  . ARG B  1 522 ? -8.915  11.437  88.585  1.00 73.21  ? 522  ARG B CB  1 
ATOM   8252  C  CG  . ARG B  1 522 ? -10.189 11.286  89.456  1.00 115.08 ? 522  ARG B CG  1 
ATOM   8253  C  CD  . ARG B  1 522 ? -10.909 9.927   89.264  1.00 115.49 ? 522  ARG B CD  1 
ATOM   8254  N  NE  . ARG B  1 522 ? -11.394 9.702   87.896  1.00 111.88 ? 522  ARG B NE  1 
ATOM   8255  C  CZ  . ARG B  1 522 ? -12.664 9.822   87.505  1.00 108.85 ? 522  ARG B CZ  1 
ATOM   8256  N  NH1 . ARG B  1 522 ? -13.607 10.164  88.378  1.00 113.61 ? 522  ARG B NH1 1 
ATOM   8257  N  NH2 . ARG B  1 522 ? -12.996 9.595   86.238  1.00 100.40 ? 522  ARG B NH2 1 
ATOM   8258  N  N   . GLY B  1 523 ? -7.266  12.299  85.715  1.00 59.21  ? 523  GLY B N   1 
ATOM   8259  C  CA  . GLY B  1 523 ? -6.460  11.707  84.667  1.00 51.04  ? 523  GLY B CA  1 
ATOM   8260  C  C   . GLY B  1 523 ? -7.023  11.822  83.260  1.00 57.86  ? 523  GLY B C   1 
ATOM   8261  O  O   . GLY B  1 523 ? -7.822  10.989  82.828  1.00 59.95  ? 523  GLY B O   1 
ATOM   8262  N  N   . LEU B  1 524 ? -6.590  12.853  82.537  1.00 54.36  ? 524  LEU B N   1 
ATOM   8263  C  CA  . LEU B  1 524 ? -6.954  13.021  81.136  1.00 53.13  ? 524  LEU B CA  1 
ATOM   8264  C  C   . LEU B  1 524 ? -6.215  11.981  80.335  1.00 53.68  ? 524  LEU B C   1 
ATOM   8265  O  O   . LEU B  1 524 ? -5.044  12.187  79.974  1.00 45.37  ? 524  LEU B O   1 
ATOM   8266  C  CB  . LEU B  1 524 ? -6.582  14.411  80.630  1.00 52.25  ? 524  LEU B CB  1 
ATOM   8267  C  CG  . LEU B  1 524 ? -7.770  15.208  80.093  1.00 56.68  ? 524  LEU B CG  1 
ATOM   8268  C  CD1 . LEU B  1 524 ? -7.300  16.543  79.562  1.00 46.39  ? 524  LEU B CD1 1 
ATOM   8269  C  CD2 . LEU B  1 524 ? -8.527  14.415  79.027  1.00 54.51  ? 524  LEU B CD2 1 
ATOM   8270  N  N   . ARG B  1 525 ? -6.925  10.881  80.071  1.00 58.81  ? 525  ARG B N   1 
ATOM   8271  C  CA  . ARG B  1 525 ? -6.375  9.664   79.476  1.00 60.52  ? 525  ARG B CA  1 
ATOM   8272  C  C   . ARG B  1 525 ? -4.945  9.443   79.940  1.00 66.15  ? 525  ARG B C   1 
ATOM   8273  O  O   . ARG B  1 525 ? -4.012  9.700   79.197  1.00 69.75  ? 525  ARG B O   1 
ATOM   8274  C  CB  . ARG B  1 525 ? -6.419  9.722   77.944  1.00 55.24  ? 525  ARG B CB  1 
ATOM   8275  C  CG  . ARG B  1 525 ? -7.706  10.258  77.371  1.00 57.23  ? 525  ARG B CG  1 
ATOM   8276  C  CD  . ARG B  1 525 ? -8.821  9.250   77.457  1.00 67.19  ? 525  ARG B CD  1 
ATOM   8277  N  NE  . ARG B  1 525 ? -8.588  8.123   76.565  1.00 74.45  ? 525  ARG B NE  1 
ATOM   8278  C  CZ  . ARG B  1 525 ? -9.116  8.001   75.350  1.00 80.29  ? 525  ARG B CZ  1 
ATOM   8279  N  NH1 . ARG B  1 525 ? -9.926  8.947   74.866  1.00 77.80  ? 525  ARG B NH1 1 
ATOM   8280  N  NH2 . ARG B  1 525 ? -8.835  6.924   74.619  1.00 81.61  ? 525  ARG B NH2 1 
ATOM   8281  N  N   . ALA B  1 526 ? -4.762  9.011   81.178  1.00 65.33  ? 526  ALA B N   1 
ATOM   8282  C  CA  . ALA B  1 526 ? -3.411  8.842   81.689  1.00 60.03  ? 526  ALA B CA  1 
ATOM   8283  C  C   . ALA B  1 526 ? -2.699  7.754   80.884  1.00 53.91  ? 526  ALA B C   1 
ATOM   8284  O  O   . ALA B  1 526 ? -1.677  8.015   80.242  1.00 48.81  ? 526  ALA B O   1 
ATOM   8285  C  CB  . ALA B  1 526 ? -3.443  8.511   83.157  1.00 65.04  ? 526  ALA B CB  1 
ATOM   8286  N  N   . GLN B  1 527 ? -3.261  6.544   80.913  1.00 58.72  ? 527  GLN B N   1 
ATOM   8287  C  CA  . GLN B  1 527 ? -2.933  5.488   79.956  1.00 61.83  ? 527  GLN B CA  1 
ATOM   8288  C  C   . GLN B  1 527 ? -3.301  6.049   78.598  1.00 70.58  ? 527  GLN B C   1 
ATOM   8289  O  O   . GLN B  1 527 ? -3.969  7.080   78.526  1.00 82.65  ? 527  GLN B O   1 
ATOM   8290  C  CB  . GLN B  1 527 ? -3.804  4.250   80.215  1.00 59.82  ? 527  GLN B CB  1 
ATOM   8291  C  CG  . GLN B  1 527 ? -3.243  3.205   81.172  1.00 53.83  ? 527  GLN B CG  1 
ATOM   8292  C  CD  . GLN B  1 527 ? -3.008  3.739   82.568  1.00 57.01  ? 527  GLN B CD  1 
ATOM   8293  O  OE1 . GLN B  1 527 ? -1.902  3.628   83.101  1.00 61.87  ? 527  GLN B OE1 1 
ATOM   8294  N  NE2 . GLN B  1 527 ? -4.045  4.310   83.178  1.00 56.09  ? 527  GLN B NE2 1 
ATOM   8295  N  N   . THR B  1 528 ? -2.915  5.371   77.523  1.00 61.31  ? 528  THR B N   1 
ATOM   8296  C  CA  . THR B  1 528 ? -3.210  5.858   76.167  1.00 61.06  ? 528  THR B CA  1 
ATOM   8297  C  C   . THR B  1 528 ? -2.368  7.093   75.863  1.00 59.51  ? 528  THR B C   1 
ATOM   8298  O  O   . THR B  1 528 ? -1.553  7.071   74.958  1.00 61.29  ? 528  THR B O   1 
ATOM   8299  C  CB  . THR B  1 528 ? -4.736  6.168   75.890  1.00 38.97  ? 528  THR B CB  1 
ATOM   8300  O  OG1 . THR B  1 528 ? -5.536  4.990   76.049  1.00 52.69  ? 528  THR B OG1 1 
ATOM   8301  C  CG2 . THR B  1 528 ? -4.931  6.705   74.480  1.00 41.24  ? 528  THR B CG2 1 
ATOM   8302  N  N   . CYS B  1 529 ? -2.554  8.179   76.601  1.00 55.58  ? 529  CYS B N   1 
ATOM   8303  C  CA  . CYS B  1 529 ? -1.689  9.322   76.378  1.00 35.64  ? 529  CYS B CA  1 
ATOM   8304  C  C   . CYS B  1 529 ? -0.281  9.069   76.881  1.00 51.21  ? 529  CYS B C   1 
ATOM   8305  O  O   . CYS B  1 529 ? 0.662   9.734   76.463  1.00 50.68  ? 529  CYS B O   1 
ATOM   8306  C  CB  . CYS B  1 529 ? -2.263  10.587  76.968  1.00 36.85  ? 529  CYS B CB  1 
ATOM   8307  S  SG  . CYS B  1 529 ? -3.607  11.192  75.964  1.00 47.34  ? 529  CYS B SG  1 
ATOM   8308  N  N   . ALA B  1 530 ? -0.126  8.098   77.767  1.00 50.43  ? 530  ALA B N   1 
ATOM   8309  C  CA  . ALA B  1 530 ? 1.212   7.697   78.151  1.00 48.91  ? 530  ALA B CA  1 
ATOM   8310  C  C   . ALA B  1 530 ? 1.840   7.076   76.919  1.00 44.29  ? 530  ALA B C   1 
ATOM   8311  O  O   . ALA B  1 530 ? 2.977   7.372   76.575  1.00 44.21  ? 530  ALA B O   1 
ATOM   8312  C  CB  . ALA B  1 530 ? 1.168   6.712   79.295  1.00 52.68  ? 530  ALA B CB  1 
ATOM   8313  N  N   . PHE B  1 531 ? 1.066   6.223   76.258  1.00 42.11  ? 531  PHE B N   1 
ATOM   8314  C  CA  . PHE B  1 531 ? 1.439   5.602   74.990  1.00 42.48  ? 531  PHE B CA  1 
ATOM   8315  C  C   . PHE B  1 531 ? 1.902   6.667   73.982  1.00 45.61  ? 531  PHE B C   1 
ATOM   8316  O  O   . PHE B  1 531 ? 3.037   6.641   73.493  1.00 43.32  ? 531  PHE B O   1 
ATOM   8317  C  CB  . PHE B  1 531 ? 0.211   4.843   74.458  1.00 37.57  ? 531  PHE B CB  1 
ATOM   8318  C  CG  . PHE B  1 531 ? 0.411   4.141   73.145  1.00 36.24  ? 531  PHE B CG  1 
ATOM   8319  C  CD1 . PHE B  1 531 ? 0.690   4.843   71.978  1.00 34.45  ? 531  PHE B CD1 1 
ATOM   8320  C  CD2 . PHE B  1 531 ? 0.236   2.774   73.065  1.00 44.09  ? 531  PHE B CD2 1 
ATOM   8321  C  CE1 . PHE B  1 531 ? 0.856   4.195   70.774  1.00 32.74  ? 531  PHE B CE1 1 
ATOM   8322  C  CE2 . PHE B  1 531 ? 0.394   2.116   71.857  1.00 47.51  ? 531  PHE B CE2 1 
ATOM   8323  C  CZ  . PHE B  1 531 ? 0.707   2.837   70.704  1.00 38.79  ? 531  PHE B CZ  1 
ATOM   8324  N  N   . TRP B  1 532 ? 0.995   7.585   73.669  1.00 45.90  ? 532  TRP B N   1 
ATOM   8325  C  CA  . TRP B  1 532 ? 1.205   8.568   72.621  1.00 38.54  ? 532  TRP B CA  1 
ATOM   8326  C  C   . TRP B  1 532 ? 2.327   9.526   72.942  1.00 37.05  ? 532  TRP B C   1 
ATOM   8327  O  O   . TRP B  1 532 ? 3.078   9.892   72.053  1.00 40.92  ? 532  TRP B O   1 
ATOM   8328  C  CB  . TRP B  1 532 ? -0.076  9.363   72.347  1.00 39.40  ? 532  TRP B CB  1 
ATOM   8329  C  CG  . TRP B  1 532 ? -1.127  8.595   71.624  1.00 30.82  ? 532  TRP B CG  1 
ATOM   8330  C  CD1 . TRP B  1 532 ? -2.257  8.067   72.156  1.00 44.90  ? 532  TRP B CD1 1 
ATOM   8331  C  CD2 . TRP B  1 532 ? -1.149  8.266   70.227  1.00 38.98  ? 532  TRP B CD2 1 
ATOM   8332  N  NE1 . TRP B  1 532 ? -2.983  7.428   71.187  1.00 39.94  ? 532  TRP B NE1 1 
ATOM   8333  C  CE2 . TRP B  1 532 ? -2.323  7.533   69.991  1.00 37.24  ? 532  TRP B CE2 1 
ATOM   8334  C  CE3 . TRP B  1 532 ? -0.285  8.517   69.153  1.00 40.04  ? 532  TRP B CE3 1 
ATOM   8335  C  CZ2 . TRP B  1 532 ? -2.661  7.047   68.727  1.00 37.81  ? 532  TRP B CZ2 1 
ATOM   8336  C  CZ3 . TRP B  1 532 ? -0.622  8.032   67.896  1.00 36.53  ? 532  TRP B CZ3 1 
ATOM   8337  C  CH2 . TRP B  1 532 ? -1.797  7.305   67.697  1.00 36.74  ? 532  TRP B CH2 1 
ATOM   8338  N  N   . ASN B  1 533 ? 2.452   9.937   74.196  1.00 29.43  ? 533  ASN B N   1 
ATOM   8339  C  CA  . ASN B  1 533 ? 3.431   10.964  74.512  1.00 28.86  ? 533  ASN B CA  1 
ATOM   8340  C  C   . ASN B  1 533 ? 4.812   10.450  74.914  1.00 43.86  ? 533  ASN B C   1 
ATOM   8341  O  O   . ASN B  1 533 ? 5.833   10.990  74.499  1.00 38.79  ? 533  ASN B O   1 
ATOM   8342  C  CB  . ASN B  1 533 ? 2.895   11.897  75.576  1.00 30.38  ? 533  ASN B CB  1 
ATOM   8343  C  CG  . ASN B  1 533 ? 1.634   12.575  75.151  1.00 43.70  ? 533  ASN B CG  1 
ATOM   8344  O  OD1 . ASN B  1 533 ? 1.318   12.629  73.961  1.00 42.81  ? 533  ASN B OD1 1 
ATOM   8345  N  ND2 . ASN B  1 533 ? 0.890   13.104  76.118  1.00 49.30  ? 533  ASN B ND2 1 
ATOM   8346  N  N   . ARG B  1 534 ? 4.846   9.409   75.730  1.00 51.22  ? 534  ARG B N   1 
ATOM   8347  C  CA  . ARG B  1 534 ? 6.114   8.902   76.231  1.00 54.02  ? 534  ARG B CA  1 
ATOM   8348  C  C   . ARG B  1 534 ? 6.708   7.835   75.317  1.00 46.70  ? 534  ARG B C   1 
ATOM   8349  O  O   . ARG B  1 534 ? 7.883   7.900   74.960  1.00 52.06  ? 534  ARG B O   1 
ATOM   8350  C  CB  . ARG B  1 534 ? 5.951   8.349   77.656  1.00 62.27  ? 534  ARG B CB  1 
ATOM   8351  C  CG  . ARG B  1 534 ? 6.151   9.367   78.782  1.00 67.31  ? 534  ARG B CG  1 
ATOM   8352  C  CD  . ARG B  1 534 ? 5.909   8.695   80.130  1.00 75.07  ? 534  ARG B CD  1 
ATOM   8353  N  NE  . ARG B  1 534 ? 6.489   9.416   81.262  1.00 80.63  ? 534  ARG B NE  1 
ATOM   8354  C  CZ  . ARG B  1 534 ? 5.881   10.402  81.917  1.00 86.08  ? 534  ARG B CZ  1 
ATOM   8355  N  NH1 . ARG B  1 534 ? 4.671   10.804  81.545  1.00 86.90  ? 534  ARG B NH1 1 
ATOM   8356  N  NH2 . ARG B  1 534 ? 6.487   10.995  82.942  1.00 87.59  ? 534  ARG B NH2 1 
ATOM   8357  N  N   . PHE B  1 535 ? 5.890   6.862   74.934  1.00 41.90  ? 535  PHE B N   1 
ATOM   8358  C  CA  . PHE B  1 535 ? 6.390   5.652   74.292  1.00 42.77  ? 535  PHE B CA  1 
ATOM   8359  C  C   . PHE B  1 535 ? 6.677   5.789   72.806  1.00 45.28  ? 535  PHE B C   1 
ATOM   8360  O  O   . PHE B  1 535 ? 7.800   5.523   72.359  1.00 44.42  ? 535  PHE B O   1 
ATOM   8361  C  CB  . PHE B  1 535 ? 5.406   4.509   74.476  1.00 46.49  ? 535  PHE B CB  1 
ATOM   8362  C  CG  . PHE B  1 535 ? 5.855   3.240   73.841  1.00 51.84  ? 535  PHE B CG  1 
ATOM   8363  C  CD1 . PHE B  1 535 ? 7.079   2.693   74.172  1.00 26.35  ? 535  PHE B CD1 1 
ATOM   8364  C  CD2 . PHE B  1 535 ? 5.063   2.594   72.906  1.00 55.36  ? 535  PHE B CD2 1 
ATOM   8365  C  CE1 . PHE B  1 535 ? 7.504   1.522   73.590  1.00 25.86  ? 535  PHE B CE1 1 
ATOM   8366  C  CE2 . PHE B  1 535 ? 5.490   1.413   72.316  1.00 51.58  ? 535  PHE B CE2 1 
ATOM   8367  C  CZ  . PHE B  1 535 ? 6.714   0.879   72.659  1.00 40.31  ? 535  PHE B CZ  1 
ATOM   8368  N  N   . LEU B  1 536 ? 5.645   6.172   72.050  1.00 42.21  ? 536  LEU B N   1 
ATOM   8369  C  CA  . LEU B  1 536 ? 5.723   6.267   70.590  1.00 34.77  ? 536  LEU B CA  1 
ATOM   8370  C  C   . LEU B  1 536 ? 6.940   6.997   70.023  1.00 40.40  ? 536  LEU B C   1 
ATOM   8371  O  O   . LEU B  1 536 ? 7.517   6.519   69.063  1.00 53.15  ? 536  LEU B O   1 
ATOM   8372  C  CB  . LEU B  1 536 ? 4.450   6.866   69.996  1.00 32.35  ? 536  LEU B CB  1 
ATOM   8373  C  CG  . LEU B  1 536 ? 3.393   5.947   69.391  1.00 34.53  ? 536  LEU B CG  1 
ATOM   8374  C  CD1 . LEU B  1 536 ? 2.758   6.645   68.196  1.00 39.35  ? 536  LEU B CD1 1 
ATOM   8375  C  CD2 . LEU B  1 536 ? 3.943   4.589   69.009  1.00 31.79  ? 536  LEU B CD2 1 
ATOM   8376  N  N   . PRO B  1 537 ? 7.310   8.170   70.574  1.00 37.23  ? 537  PRO B N   1 
ATOM   8377  C  CA  . PRO B  1 537 ? 8.557   8.797   70.108  1.00 38.59  ? 537  PRO B CA  1 
ATOM   8378  C  C   . PRO B  1 537 ? 9.794   7.892   70.208  1.00 48.51  ? 537  PRO B C   1 
ATOM   8379  O  O   . PRO B  1 537 ? 10.535  7.775   69.224  1.00 52.50  ? 537  PRO B O   1 
ATOM   8380  C  CB  . PRO B  1 537 ? 8.708   10.013  71.028  1.00 33.20  ? 537  PRO B CB  1 
ATOM   8381  C  CG  . PRO B  1 537 ? 7.632   9.875   72.072  1.00 35.72  ? 537  PRO B CG  1 
ATOM   8382  C  CD  . PRO B  1 537 ? 6.550   9.086   71.438  1.00 36.55  ? 537  PRO B CD  1 
ATOM   8383  N  N   . LYS B  1 538 ? 9.989   7.235   71.353  1.00 47.08  ? 538  LYS B N   1 
ATOM   8384  C  CA  . LYS B  1 538 ? 11.082  6.276   71.533  1.00 42.30  ? 538  LYS B CA  1 
ATOM   8385  C  C   . LYS B  1 538 ? 11.065  5.171   70.474  1.00 41.07  ? 538  LYS B C   1 
ATOM   8386  O  O   . LYS B  1 538 ? 12.001  4.378   70.377  1.00 49.37  ? 538  LYS B O   1 
ATOM   8387  C  CB  . LYS B  1 538 ? 11.023  5.650   72.932  1.00 43.26  ? 538  LYS B CB  1 
ATOM   8388  C  CG  . LYS B  1 538 ? 11.088  6.657   74.076  1.00 55.29  ? 538  LYS B CG  1 
ATOM   8389  C  CD  . LYS B  1 538 ? 10.995  5.965   75.440  1.00 66.48  ? 538  LYS B CD  1 
ATOM   8390  C  CE  . LYS B  1 538 ? 10.988  6.970   76.603  1.00 72.14  ? 538  LYS B CE  1 
ATOM   8391  N  NZ  . LYS B  1 538 ? 10.566  6.357   77.911  1.00 72.85  ? 538  LYS B NZ  1 
ATOM   8392  N  N   . LEU B  1 539 ? 9.998   5.146   69.681  1.00 31.06  ? 539  LEU B N   1 
ATOM   8393  C  CA  . LEU B  1 539 ? 9.728   4.099   68.710  1.00 34.45  ? 539  LEU B CA  1 
ATOM   8394  C  C   . LEU B  1 539 ? 9.670   4.642   67.280  1.00 57.84  ? 539  LEU B C   1 
ATOM   8395  O  O   . LEU B  1 539 ? 9.736   3.876   66.312  1.00 59.69  ? 539  LEU B O   1 
ATOM   8396  C  CB  . LEU B  1 539 ? 8.387   3.472   69.042  1.00 31.81  ? 539  LEU B CB  1 
ATOM   8397  C  CG  . LEU B  1 539 ? 8.038   2.239   68.239  1.00 33.84  ? 539  LEU B CG  1 
ATOM   8398  C  CD1 . LEU B  1 539 ? 9.079   1.191   68.574  1.00 36.66  ? 539  LEU B CD1 1 
ATOM   8399  C  CD2 . LEU B  1 539 ? 6.624   1.774   68.561  1.00 36.04  ? 539  LEU B CD2 1 
ATOM   8400  N  N   . LEU B  1 540 ? 9.516   5.961   67.143  1.00 76.51  ? 540  LEU B N   1 
ATOM   8401  C  CA  . LEU B  1 540 ? 9.620   6.601   65.826  1.00 86.75  ? 540  LEU B CA  1 
ATOM   8402  C  C   . LEU B  1 540 ? 11.090  6.983   65.657  1.00 97.02  ? 540  LEU B C   1 
ATOM   8403  O  O   . LEU B  1 540 ? 11.590  7.186   64.542  1.00 98.33  ? 540  LEU B O   1 
ATOM   8404  C  CB  . LEU B  1 540 ? 8.673   7.808   65.698  1.00 82.24  ? 540  LEU B CB  1 
ATOM   8405  C  CG  . LEU B  1 540 ? 7.335   7.609   64.947  1.00 73.45  ? 540  LEU B CG  1 
ATOM   8406  C  CD1 . LEU B  1 540 ? 7.146   6.161   64.485  1.00 61.90  ? 540  LEU B CD1 1 
ATOM   8407  C  CD2 . LEU B  1 540 ? 6.102   8.116   65.752  1.00 20.76  ? 540  LEU B CD2 1 
ATOM   8408  N  N   . SER B  1 541 ? 11.760  7.069   66.806  1.00 101.73 ? 541  SER B N   1 
ATOM   8409  C  CA  . SER B  1 541 ? 13.210  7.009   66.922  1.00 100.53 ? 541  SER B CA  1 
ATOM   8410  C  C   . SER B  1 541 ? 13.569  5.525   66.934  1.00 109.41 ? 541  SER B C   1 
ATOM   8411  O  O   . SER B  1 541 ? 12.697  4.687   66.707  1.00 112.42 ? 541  SER B O   1 
ATOM   8412  C  CB  . SER B  1 541 ? 13.654  7.681   68.225  1.00 93.00  ? 541  SER B CB  1 
ATOM   8413  O  OG  . SER B  1 541 ? 14.997  7.374   68.540  1.00 89.74  ? 541  SER B OG  1 
ATOM   8414  N  N   . ALA B  1 542 ? 14.829  5.194   67.213  1.00 114.88 ? 542  ALA B N   1 
ATOM   8415  C  CA  . ALA B  1 542 ? 15.298  3.802   67.160  1.00 117.46 ? 542  ALA B CA  1 
ATOM   8416  C  C   . ALA B  1 542 ? 14.855  3.091   65.874  1.00 123.27 ? 542  ALA B C   1 
ATOM   8417  O  O   . ALA B  1 542 ? 15.642  2.941   64.936  1.00 120.80 ? 542  ALA B O   1 
ATOM   8418  C  CB  . ALA B  1 542 ? 14.852  3.018   68.406  1.00 112.48 ? 542  ALA B CB  1 
ATOM   8419  N  N   . THR B  1 543 ? 13.588  2.678   65.836  1.00 131.35 ? 543  THR B N   1 
ATOM   8420  C  CA  . THR B  1 543 ? 13.021  1.984   64.673  1.00 137.50 ? 543  THR B CA  1 
ATOM   8421  C  C   . THR B  1 543 ? 11.866  2.742   63.984  1.00 137.21 ? 543  THR B C   1 
ATOM   8422  O  O   . THR B  1 543 ? 10.815  2.176   63.661  1.00 136.31 ? 543  THR B O   1 
ATOM   8423  C  CB  . THR B  1 543 ? 12.580  0.543   65.039  1.00 134.19 ? 543  THR B CB  1 
ATOM   8424  O  OG1 . THR B  1 543 ? 11.612  0.077   64.090  1.00 136.08 ? 543  THR B OG1 1 
ATOM   8425  C  CG2 . THR B  1 543 ? 11.980  0.504   66.438  1.00 130.67 ? 543  THR B CG2 1 
ATOM   8426  O  OXT . THR B  1 543 ? 11.958  3.946   63.716  1.00 135.14 ? 543  THR B OXT 1 
ATOM   8427  N  N   . GLU C  1 4   ? 23.142  18.423  -11.654 1.00 36.65  ? 4    GLU C N   1 
ATOM   8428  C  CA  . GLU C  1 4   ? 23.599  17.505  -12.681 1.00 37.09  ? 4    GLU C CA  1 
ATOM   8429  C  C   . GLU C  1 4   ? 24.698  16.615  -12.136 1.00 40.93  ? 4    GLU C C   1 
ATOM   8430  O  O   . GLU C  1 4   ? 25.039  15.612  -12.758 1.00 50.44  ? 4    GLU C O   1 
ATOM   8431  C  CB  . GLU C  1 4   ? 24.139  18.273  -13.889 1.00 42.72  ? 4    GLU C CB  1 
ATOM   8432  C  CG  . GLU C  1 4   ? 23.107  18.988  -14.711 1.00 35.04  ? 4    GLU C CG  1 
ATOM   8433  C  CD  . GLU C  1 4   ? 22.536  18.126  -15.814 1.00 51.87  ? 4    GLU C CD  1 
ATOM   8434  O  OE1 . GLU C  1 4   ? 21.870  17.110  -15.504 1.00 54.35  ? 4    GLU C OE1 1 
ATOM   8435  O  OE2 . GLU C  1 4   ? 22.754  18.470  -16.999 1.00 48.13  ? 4    GLU C OE2 1 
ATOM   8436  N  N   . ASP C  1 5   ? 25.274  17.002  -10.998 1.00 35.75  ? 5    ASP C N   1 
ATOM   8437  C  CA  . ASP C  1 5   ? 26.394  16.269  -10.407 1.00 38.43  ? 5    ASP C CA  1 
ATOM   8438  C  C   . ASP C  1 5   ? 25.994  14.806  -10.217 1.00 42.98  ? 5    ASP C C   1 
ATOM   8439  O  O   . ASP C  1 5   ? 25.032  14.503  -9.492  1.00 41.45  ? 5    ASP C O   1 
ATOM   8440  C  CB  . ASP C  1 5   ? 26.794  16.896  -9.069  1.00 40.73  ? 5    ASP C CB  1 
ATOM   8441  C  CG  . ASP C  1 5   ? 28.156  16.427  -8.568  1.00 45.49  ? 5    ASP C CG  1 
ATOM   8442  O  OD1 . ASP C  1 5   ? 28.659  15.390  -9.038  1.00 42.19  ? 5    ASP C OD1 1 
ATOM   8443  O  OD2 . ASP C  1 5   ? 28.728  17.107  -7.685  1.00 52.64  ? 5    ASP C OD2 1 
ATOM   8444  N  N   . PRO C  1 6   ? 26.718  13.896  -10.894 1.00 38.58  ? 6    PRO C N   1 
ATOM   8445  C  CA  . PRO C  1 6   ? 26.422  12.462  -10.948 1.00 38.21  ? 6    PRO C CA  1 
ATOM   8446  C  C   . PRO C  1 6   ? 26.879  11.739  -9.697  1.00 39.07  ? 6    PRO C C   1 
ATOM   8447  O  O   . PRO C  1 6   ? 26.671  10.535  -9.582  1.00 44.80  ? 6    PRO C O   1 
ATOM   8448  C  CB  . PRO C  1 6   ? 27.260  11.988  -12.127 1.00 37.44  ? 6    PRO C CB  1 
ATOM   8449  C  CG  . PRO C  1 6   ? 28.419  12.873  -12.087 1.00 41.92  ? 6    PRO C CG  1 
ATOM   8450  C  CD  . PRO C  1 6   ? 27.883  14.223  -11.724 1.00 38.78  ? 6    PRO C CD  1 
ATOM   8451  N  N   . GLN C  1 7   ? 27.492  12.467  -8.773  1.00 31.66  ? 7    GLN C N   1 
ATOM   8452  C  CA  . GLN C  1 7   ? 27.938  11.885  -7.518  1.00 31.70  ? 7    GLN C CA  1 
ATOM   8453  C  C   . GLN C  1 7   ? 26.973  12.168  -6.356  1.00 26.85  ? 7    GLN C C   1 
ATOM   8454  O  O   . GLN C  1 7   ? 27.164  11.681  -5.240  1.00 30.24  ? 7    GLN C O   1 
ATOM   8455  C  CB  . GLN C  1 7   ? 29.348  12.385  -7.189  1.00 36.80  ? 7    GLN C CB  1 
ATOM   8456  C  CG  . GLN C  1 7   ? 30.449  11.803  -8.065  1.00 45.51  ? 7    GLN C CG  1 
ATOM   8457  C  CD  . GLN C  1 7   ? 31.185  10.667  -7.373  1.00 59.92  ? 7    GLN C CD  1 
ATOM   8458  O  OE1 . GLN C  1 7   ? 30.993  10.419  -6.173  1.00 61.48  ? 7    GLN C OE1 1 
ATOM   8459  N  NE2 . GLN C  1 7   ? 32.035  9.969   -8.124  1.00 67.63  ? 7    GLN C NE2 1 
ATOM   8460  N  N   . LEU C  1 8   ? 25.935  12.950  -6.610  1.00 26.49  ? 8    LEU C N   1 
ATOM   8461  C  CA  . LEU C  1 8   ? 25.062  13.353  -5.526  1.00 24.95  ? 8    LEU C CA  1 
ATOM   8462  C  C   . LEU C  1 8   ? 23.661  12.792  -5.655  1.00 34.23  ? 8    LEU C C   1 
ATOM   8463  O  O   . LEU C  1 8   ? 22.808  13.060  -4.816  1.00 27.03  ? 8    LEU C O   1 
ATOM   8464  C  CB  . LEU C  1 8   ? 25.005  14.867  -5.431  1.00 24.91  ? 8    LEU C CB  1 
ATOM   8465  C  CG  . LEU C  1 8   ? 26.358  15.514  -5.176  1.00 26.56  ? 8    LEU C CG  1 
ATOM   8466  C  CD1 . LEU C  1 8   ? 26.234  17.029  -5.180  1.00 26.72  ? 8    LEU C CD1 1 
ATOM   8467  C  CD2 . LEU C  1 8   ? 26.955  15.000  -3.867  1.00 24.53  ? 8    LEU C CD2 1 
ATOM   8468  N  N   . LEU C  1 9   ? 23.408  12.021  -6.705  1.00 37.74  ? 9    LEU C N   1 
ATOM   8469  C  CA  . LEU C  1 9   ? 22.089  11.426  -6.878  1.00 25.00  ? 9    LEU C CA  1 
ATOM   8470  C  C   . LEU C  1 9   ? 22.138  9.960   -6.469  1.00 27.21  ? 9    LEU C C   1 
ATOM   8471  O  O   . LEU C  1 9   ? 22.654  9.126   -7.199  1.00 30.33  ? 9    LEU C O   1 
ATOM   8472  C  CB  . LEU C  1 9   ? 21.590  11.606  -8.319  1.00 26.29  ? 9    LEU C CB  1 
ATOM   8473  C  CG  . LEU C  1 9   ? 20.167  11.182  -8.715  1.00 39.34  ? 9    LEU C CG  1 
ATOM   8474  C  CD1 . LEU C  1 9   ? 20.097  9.768   -9.324  1.00 41.18  ? 9    LEU C CD1 1 
ATOM   8475  C  CD2 . LEU C  1 9   ? 19.261  11.277  -7.523  1.00 24.78  ? 9    LEU C CD2 1 
ATOM   8476  N  N   . VAL C  1 10  ? 21.604  9.655   -5.289  1.00 29.41  ? 10   VAL C N   1 
ATOM   8477  C  CA  . VAL C  1 10  ? 21.599  8.290   -4.764  1.00 29.48  ? 10   VAL C CA  1 
ATOM   8478  C  C   . VAL C  1 10  ? 20.178  7.768   -4.564  1.00 31.18  ? 10   VAL C C   1 
ATOM   8479  O  O   . VAL C  1 10  ? 19.249  8.539   -4.331  1.00 34.94  ? 10   VAL C O   1 
ATOM   8480  C  CB  . VAL C  1 10  ? 22.351  8.223   -3.439  1.00 26.45  ? 10   VAL C CB  1 
ATOM   8481  C  CG1 . VAL C  1 10  ? 22.587  6.780   -3.025  1.00 28.12  ? 10   VAL C CG1 1 
ATOM   8482  C  CG2 . VAL C  1 10  ? 23.673  8.951   -3.570  1.00 26.64  ? 10   VAL C CG2 1 
ATOM   8483  N  N   . ARG C  1 11  ? 20.011  6.458   -4.692  1.00 29.39  ? 11   ARG C N   1 
ATOM   8484  C  CA  . ARG C  1 11  ? 18.715  5.826   -4.490  1.00 31.79  ? 11   ARG C CA  1 
ATOM   8485  C  C   . ARG C  1 11  ? 18.794  4.935   -3.265  1.00 36.14  ? 11   ARG C C   1 
ATOM   8486  O  O   . ARG C  1 11  ? 19.749  4.163   -3.105  1.00 33.95  ? 11   ARG C O   1 
ATOM   8487  C  CB  . ARG C  1 11  ? 18.295  4.996   -5.717  1.00 24.03  ? 11   ARG C CB  1 
ATOM   8488  C  CG  . ARG C  1 11  ? 17.482  3.763   -5.369  1.00 23.99  ? 11   ARG C CG  1 
ATOM   8489  C  CD  . ARG C  1 11  ? 16.859  3.131   -6.579  1.00 25.33  ? 11   ARG C CD  1 
ATOM   8490  N  NE  . ARG C  1 11  ? 15.513  3.625   -6.798  1.00 25.23  ? 11   ARG C NE  1 
ATOM   8491  C  CZ  . ARG C  1 11  ? 15.126  4.236   -7.908  1.00 39.81  ? 11   ARG C CZ  1 
ATOM   8492  N  NH1 . ARG C  1 11  ? 15.993  4.408   -8.892  1.00 27.13  ? 11   ARG C NH1 1 
ATOM   8493  N  NH2 . ARG C  1 11  ? 13.876  4.669   -8.035  1.00 38.93  ? 11   ARG C NH2 1 
ATOM   8494  N  N   . VAL C  1 12  ? 17.802  5.064   -2.394  1.00 20.91  ? 12   VAL C N   1 
ATOM   8495  C  CA  . VAL C  1 12  ? 17.688  4.195   -1.247  1.00 31.22  ? 12   VAL C CA  1 
ATOM   8496  C  C   . VAL C  1 12  ? 16.401  3.390   -1.371  1.00 45.54  ? 12   VAL C C   1 
ATOM   8497  O  O   . VAL C  1 12  ? 15.864  3.249   -2.468  1.00 54.38  ? 12   VAL C O   1 
ATOM   8498  C  CB  . VAL C  1 12  ? 17.741  4.983   0.066   1.00 23.31  ? 12   VAL C CB  1 
ATOM   8499  C  CG1 . VAL C  1 12  ? 19.123  5.567   0.252   1.00 23.00  ? 12   VAL C CG1 1 
ATOM   8500  C  CG2 . VAL C  1 12  ? 16.689  6.086   0.085   1.00 18.48  ? 12   VAL C CG2 1 
ATOM   8501  N  N   . ARG C  1 13  ? 15.917  2.854   -0.259  1.00 46.06  ? 13   ARG C N   1 
ATOM   8502  C  CA  . ARG C  1 13  ? 14.789  1.945   -0.291  1.00 20.17  ? 13   ARG C CA  1 
ATOM   8503  C  C   . ARG C  1 13  ? 13.521  2.693   -0.638  1.00 41.06  ? 13   ARG C C   1 
ATOM   8504  O  O   . ARG C  1 13  ? 12.688  2.208   -1.403  1.00 43.29  ? 13   ARG C O   1 
ATOM   8505  C  CB  . ARG C  1 13  ? 14.672  1.228   1.048   1.00 34.21  ? 13   ARG C CB  1 
ATOM   8506  C  CG  . ARG C  1 13  ? 13.387  0.450   1.297   1.00 37.02  ? 13   ARG C CG  1 
ATOM   8507  C  CD  . ARG C  1 13  ? 13.151  -0.710  0.334   1.00 29.53  ? 13   ARG C CD  1 
ATOM   8508  N  NE  . ARG C  1 13  ? 12.019  -0.429  -0.550  1.00 27.12  ? 13   ARG C NE  1 
ATOM   8509  C  CZ  . ARG C  1 13  ? 11.019  -1.265  -0.792  1.00 22.55  ? 13   ARG C CZ  1 
ATOM   8510  N  NH1 . ARG C  1 13  ? 10.983  -2.456  -0.221  1.00 22.84  ? 13   ARG C NH1 1 
ATOM   8511  N  NH2 . ARG C  1 13  ? 10.062  -0.912  -1.628  1.00 23.20  ? 13   ARG C NH2 1 
ATOM   8512  N  N   . GLY C  1 14  ? 13.380  3.893   -0.099  1.00 39.71  ? 14   GLY C N   1 
ATOM   8513  C  CA  . GLY C  1 14  ? 12.129  4.623   -0.234  1.00 44.49  ? 14   GLY C CA  1 
ATOM   8514  C  C   . GLY C  1 14  ? 12.005  5.408   -1.525  1.00 42.12  ? 14   GLY C C   1 
ATOM   8515  O  O   . GLY C  1 14  ? 10.937  5.961   -1.824  1.00 27.17  ? 14   GLY C O   1 
ATOM   8516  N  N   . GLY C  1 15  ? 13.102  5.468   -2.284  1.00 45.58  ? 15   GLY C N   1 
ATOM   8517  C  CA  . GLY C  1 15  ? 13.128  6.205   -3.538  1.00 44.49  ? 15   GLY C CA  1 
ATOM   8518  C  C   . GLY C  1 15  ? 14.399  7.000   -3.755  1.00 38.03  ? 15   GLY C C   1 
ATOM   8519  O  O   . GLY C  1 15  ? 15.390  6.775   -3.074  1.00 41.05  ? 15   GLY C O   1 
ATOM   8520  N  N   . GLN C  1 16  ? 14.364  7.939   -4.699  1.00 36.00  ? 16   GLN C N   1 
ATOM   8521  C  CA  . GLN C  1 16  ? 15.545  8.721   -5.078  1.00 35.95  ? 16   GLN C CA  1 
ATOM   8522  C  C   . GLN C  1 16  ? 15.781  9.942   -4.201  1.00 33.99  ? 16   GLN C C   1 
ATOM   8523  O  O   . GLN C  1 16  ? 14.831  10.533  -3.683  1.00 32.60  ? 16   GLN C O   1 
ATOM   8524  C  CB  . GLN C  1 16  ? 15.420  9.213   -6.516  1.00 41.71  ? 16   GLN C CB  1 
ATOM   8525  C  CG  . GLN C  1 16  ? 15.079  8.155   -7.524  1.00 47.31  ? 16   GLN C CG  1 
ATOM   8526  C  CD  . GLN C  1 16  ? 15.669  8.465   -8.878  1.00 52.52  ? 16   GLN C CD  1 
ATOM   8527  O  OE1 . GLN C  1 16  ? 16.852  8.198   -9.124  1.00 54.57  ? 16   GLN C OE1 1 
ATOM   8528  N  NE2 . GLN C  1 16  ? 14.852  9.033   -9.769  1.00 53.19  ? 16   GLN C NE2 1 
ATOM   8529  N  N   . LEU C  1 17  ? 17.050  10.324  -4.054  1.00 29.58  ? 17   LEU C N   1 
ATOM   8530  C  CA  . LEU C  1 17  ? 17.397  11.569  -3.376  1.00 30.26  ? 17   LEU C CA  1 
ATOM   8531  C  C   . LEU C  1 17  ? 18.682  12.205  -3.871  1.00 37.02  ? 17   LEU C C   1 
ATOM   8532  O  O   . LEU C  1 17  ? 19.584  11.512  -4.340  1.00 35.89  ? 17   LEU C O   1 
ATOM   8533  C  CB  . LEU C  1 17  ? 17.415  11.410  -1.854  1.00 26.69  ? 17   LEU C CB  1 
ATOM   8534  C  CG  . LEU C  1 17  ? 18.107  10.234  -1.183  1.00 29.66  ? 17   LEU C CG  1 
ATOM   8535  C  CD1 . LEU C  1 17  ? 19.602  10.507  -0.934  1.00 29.39  ? 17   LEU C CD1 1 
ATOM   8536  C  CD2 . LEU C  1 17  ? 17.353  9.919   0.108   1.00 17.78  ? 17   LEU C CD2 1 
ATOM   8537  N  N   . ARG C  1 18  ? 18.734  13.535  -3.756  1.00 40.75  ? 18   ARG C N   1 
ATOM   8538  C  CA  . ARG C  1 18  ? 19.829  14.369  -4.259  1.00 38.30  ? 18   ARG C CA  1 
ATOM   8539  C  C   . ARG C  1 18  ? 20.511  15.081  -3.100  1.00 29.98  ? 18   ARG C C   1 
ATOM   8540  O  O   . ARG C  1 18  ? 19.850  15.717  -2.287  1.00 30.14  ? 18   ARG C O   1 
ATOM   8541  C  CB  . ARG C  1 18  ? 19.268  15.403  -5.242  1.00 41.05  ? 18   ARG C CB  1 
ATOM   8542  C  CG  . ARG C  1 18  ? 20.212  16.522  -5.656  1.00 45.13  ? 18   ARG C CG  1 
ATOM   8543  C  CD  . ARG C  1 18  ? 20.565  16.425  -7.142  1.00 57.14  ? 18   ARG C CD  1 
ATOM   8544  N  NE  . ARG C  1 18  ? 19.401  16.099  -7.972  1.00 68.46  ? 18   ARG C NE  1 
ATOM   8545  C  CZ  . ARG C  1 18  ? 19.478  15.599  -9.205  1.00 70.54  ? 18   ARG C CZ  1 
ATOM   8546  N  NH1 . ARG C  1 18  ? 20.673  15.368  -9.747  1.00 74.33  ? 18   ARG C NH1 1 
ATOM   8547  N  NH2 . ARG C  1 18  ? 18.368  15.322  -9.893  1.00 60.08  ? 18   ARG C NH2 1 
ATOM   8548  N  N   . GLY C  1 19  ? 21.830  14.975  -3.022  1.00 28.86  ? 19   GLY C N   1 
ATOM   8549  C  CA  . GLY C  1 19  ? 22.575  15.570  -1.930  1.00 20.73  ? 19   GLY C CA  1 
ATOM   8550  C  C   . GLY C  1 19  ? 23.338  16.766  -2.416  1.00 29.90  ? 19   GLY C C   1 
ATOM   8551  O  O   . GLY C  1 19  ? 23.135  17.219  -3.534  1.00 25.80  ? 19   GLY C O   1 
ATOM   8552  N  N   . ILE C  1 20  ? 24.234  17.255  -1.574  1.00 25.95  ? 20   ILE C N   1 
ATOM   8553  C  CA  . ILE C  1 20  ? 24.974  18.473  -1.844  1.00 22.24  ? 20   ILE C CA  1 
ATOM   8554  C  C   . ILE C  1 20  ? 26.474  18.262  -1.636  1.00 34.08  ? 20   ILE C C   1 
ATOM   8555  O  O   . ILE C  1 20  ? 26.893  17.482  -0.788  1.00 34.61  ? 20   ILE C O   1 
ATOM   8556  C  CB  . ILE C  1 20  ? 24.498  19.591  -0.914  1.00 32.30  ? 20   ILE C CB  1 
ATOM   8557  C  CG1 . ILE C  1 20  ? 25.174  20.911  -1.263  1.00 36.50  ? 20   ILE C CG1 1 
ATOM   8558  C  CG2 . ILE C  1 20  ? 24.796  19.235  0.511   1.00 20.48  ? 20   ILE C CG2 1 
ATOM   8559  C  CD1 . ILE C  1 20  ? 24.975  21.982  -0.233  1.00 39.69  ? 20   ILE C CD1 1 
ATOM   8560  N  N   . ARG C  1 21  ? 27.292  18.946  -2.421  1.00 33.96  ? 21   ARG C N   1 
ATOM   8561  C  CA  . ARG C  1 21  ? 28.726  18.878  -2.219  1.00 24.88  ? 21   ARG C CA  1 
ATOM   8562  C  C   . ARG C  1 21  ? 29.142  19.991  -1.273  1.00 30.04  ? 21   ARG C C   1 
ATOM   8563  O  O   . ARG C  1 21  ? 29.184  21.149  -1.676  1.00 35.36  ? 21   ARG C O   1 
ATOM   8564  C  CB  . ARG C  1 21  ? 29.465  19.014  -3.558  1.00 30.41  ? 21   ARG C CB  1 
ATOM   8565  C  CG  . ARG C  1 21  ? 30.974  19.042  -3.418  1.00 39.09  ? 21   ARG C CG  1 
ATOM   8566  C  CD  . ARG C  1 21  ? 31.674  19.311  -4.740  1.00 53.43  ? 21   ARG C CD  1 
ATOM   8567  N  NE  . ARG C  1 21  ? 32.785  20.250  -4.576  1.00 64.68  ? 21   ARG C NE  1 
ATOM   8568  C  CZ  . ARG C  1 21  ? 33.892  20.251  -5.318  1.00 74.39  ? 21   ARG C CZ  1 
ATOM   8569  N  NH1 . ARG C  1 21  ? 34.047  19.354  -6.285  1.00 79.84  ? 21   ARG C NH1 1 
ATOM   8570  N  NH2 . ARG C  1 21  ? 34.850  21.147  -5.088  1.00 73.99  ? 21   ARG C NH2 1 
ATOM   8571  N  N   . LEU C  1 22  ? 29.440  19.654  -0.019  1.00 25.06  ? 22   LEU C N   1 
ATOM   8572  C  CA  . LEU C  1 22  ? 29.970  20.649  0.924   1.00 23.74  ? 22   LEU C CA  1 
ATOM   8573  C  C   . LEU C  1 22  ? 31.488  20.820  0.774   1.00 36.27  ? 22   LEU C C   1 
ATOM   8574  O  O   . LEU C  1 22  ? 32.187  19.895  0.348   1.00 29.66  ? 22   LEU C O   1 
ATOM   8575  C  CB  . LEU C  1 22  ? 29.698  20.227  2.361   1.00 22.36  ? 22   LEU C CB  1 
ATOM   8576  C  CG  . LEU C  1 22  ? 28.279  20.083  2.852   1.00 37.34  ? 22   LEU C CG  1 
ATOM   8577  C  CD1 . LEU C  1 22  ? 28.302  19.933  4.369   1.00 41.00  ? 22   LEU C CD1 1 
ATOM   8578  C  CD2 . LEU C  1 22  ? 27.470  21.282  2.427   1.00 37.57  ? 22   LEU C CD2 1 
ATOM   8579  N  N   . LYS C  1 23  ? 32.002  21.988  1.160   1.00 43.65  ? 23   LYS C N   1 
ATOM   8580  C  CA  . LYS C  1 23  ? 33.449  22.198  1.239   1.00 52.91  ? 23   LYS C CA  1 
ATOM   8581  C  C   . LYS C  1 23  ? 33.984  21.998  2.658   1.00 50.65  ? 23   LYS C C   1 
ATOM   8582  O  O   . LYS C  1 23  ? 33.562  22.681  3.592   1.00 54.00  ? 23   LYS C O   1 
ATOM   8583  C  CB  . LYS C  1 23  ? 33.826  23.601  0.761   1.00 65.90  ? 23   LYS C CB  1 
ATOM   8584  C  CG  . LYS C  1 23  ? 35.298  23.954  1.003   1.00 79.49  ? 23   LYS C CG  1 
ATOM   8585  C  CD  . LYS C  1 23  ? 35.588  25.433  0.733   1.00 90.53  ? 23   LYS C CD  1 
ATOM   8586  C  CE  . LYS C  1 23  ? 37.075  25.778  0.897   1.00 97.08  ? 23   LYS C CE  1 
ATOM   8587  N  NZ  . LYS C  1 23  ? 37.368  27.218  0.577   1.00 100.66 ? 23   LYS C NZ  1 
ATOM   8588  N  N   . ALA C  1 24  ? 34.915  21.064  2.818   1.00 43.51  ? 24   ALA C N   1 
ATOM   8589  C  CA  . ALA C  1 24  ? 35.615  20.894  4.089   1.00 38.85  ? 24   ALA C CA  1 
ATOM   8590  C  C   . ALA C  1 24  ? 36.954  21.579  3.923   1.00 44.79  ? 24   ALA C C   1 
ATOM   8591  O  O   . ALA C  1 24  ? 37.329  21.907  2.798   1.00 54.13  ? 24   ALA C O   1 
ATOM   8592  C  CB  . ALA C  1 24  ? 35.796  19.424  4.412   1.00 37.15  ? 24   ALA C CB  1 
ATOM   8593  N  N   . PRO C  1 25  ? 37.689  21.802  5.027   1.00 41.02  ? 25   PRO C N   1 
ATOM   8594  C  CA  . PRO C  1 25  ? 38.919  22.574  4.874   1.00 40.83  ? 25   PRO C CA  1 
ATOM   8595  C  C   . PRO C  1 25  ? 39.927  21.891  3.964   1.00 55.57  ? 25   PRO C C   1 
ATOM   8596  O  O   . PRO C  1 25  ? 40.847  22.540  3.466   1.00 72.02  ? 25   PRO C O   1 
ATOM   8597  C  CB  . PRO C  1 25  ? 39.466  22.622  6.298   1.00 29.87  ? 25   PRO C CB  1 
ATOM   8598  C  CG  . PRO C  1 25  ? 38.315  22.399  7.166   1.00 27.96  ? 25   PRO C CG  1 
ATOM   8599  C  CD  . PRO C  1 25  ? 37.444  21.454  6.435   1.00 27.06  ? 25   PRO C CD  1 
ATOM   8600  N  N   . GLY C  1 26  ? 39.755  20.597  3.738   1.00 31.09  ? 26   GLY C N   1 
ATOM   8601  C  CA  . GLY C  1 26  ? 40.741  19.840  2.999   1.00 36.94  ? 26   GLY C CA  1 
ATOM   8602  C  C   . GLY C  1 26  ? 40.180  19.140  1.784   1.00 35.84  ? 26   GLY C C   1 
ATOM   8603  O  O   . GLY C  1 26  ? 40.633  18.058  1.409   1.00 36.49  ? 26   GLY C O   1 
ATOM   8604  N  N   . GLY C  1 27  ? 39.194  19.761  1.152   1.00 42.09  ? 27   GLY C N   1 
ATOM   8605  C  CA  . GLY C  1 27  ? 38.527  19.139  0.021   1.00 45.63  ? 27   GLY C CA  1 
ATOM   8606  C  C   . GLY C  1 27  ? 37.071  18.833  0.312   1.00 41.16  ? 27   GLY C C   1 
ATOM   8607  O  O   . GLY C  1 27  ? 36.632  18.914  1.456   1.00 36.56  ? 27   GLY C O   1 
ATOM   8608  N  N   . PRO C  1 28  ? 36.319  18.447  -0.722  1.00 38.19  ? 28   PRO C N   1 
ATOM   8609  C  CA  . PRO C  1 28  ? 34.870  18.392  -0.616  1.00 38.40  ? 28   PRO C CA  1 
ATOM   8610  C  C   . PRO C  1 28  ? 34.417  17.129  0.104   1.00 39.44  ? 28   PRO C C   1 
ATOM   8611  O  O   . PRO C  1 28  ? 35.202  16.175  0.227   1.00 36.31  ? 28   PRO C O   1 
ATOM   8612  C  CB  . PRO C  1 28  ? 34.448  18.338  -2.077  1.00 29.31  ? 28   PRO C CB  1 
ATOM   8613  C  CG  . PRO C  1 28  ? 35.486  17.490  -2.683  1.00 40.37  ? 28   PRO C CG  1 
ATOM   8614  C  CD  . PRO C  1 28  ? 36.778  17.854  -1.986  1.00 41.60  ? 28   PRO C CD  1 
ATOM   8615  N  N   . VAL C  1 29  ? 33.180  17.153  0.603   1.00 25.67  ? 29   VAL C N   1 
ATOM   8616  C  CA  . VAL C  1 29  ? 32.515  15.957  1.086   1.00 33.01  ? 29   VAL C CA  1 
ATOM   8617  C  C   . VAL C  1 29  ? 31.117  15.929  0.494   1.00 34.57  ? 29   VAL C C   1 
ATOM   8618  O  O   . VAL C  1 29  ? 30.634  16.947  -0.009  1.00 41.44  ? 29   VAL C O   1 
ATOM   8619  C  CB  . VAL C  1 29  ? 32.387  15.936  2.609   1.00 30.82  ? 29   VAL C CB  1 
ATOM   8620  C  CG1 . VAL C  1 29  ? 33.747  15.923  3.261   1.00 24.01  ? 29   VAL C CG1 1 
ATOM   8621  C  CG2 . VAL C  1 29  ? 31.593  17.126  3.068   1.00 33.20  ? 29   VAL C CG2 1 
ATOM   8622  N  N   . SER C  1 30  ? 30.482  14.762  0.551   1.00 31.04  ? 30   SER C N   1 
ATOM   8623  C  CA  . SER C  1 30  ? 29.098  14.580  0.129   1.00 35.10  ? 30   SER C CA  1 
ATOM   8624  C  C   . SER C  1 30  ? 28.181  14.616  1.345   1.00 35.86  ? 30   SER C C   1 
ATOM   8625  O  O   . SER C  1 30  ? 28.373  13.869  2.302   1.00 49.33  ? 30   SER C O   1 
ATOM   8626  C  CB  . SER C  1 30  ? 28.913  13.241  -0.587  1.00 35.38  ? 30   SER C CB  1 
ATOM   8627  O  OG  . SER C  1 30  ? 29.991  12.950  -1.454  1.00 34.70  ? 30   SER C OG  1 
ATOM   8628  N  N   . ALA C  1 31  ? 27.182  15.483  1.313   1.00 23.75  ? 31   ALA C N   1 
ATOM   8629  C  CA  . ALA C  1 31  ? 26.245  15.565  2.418   1.00 21.08  ? 31   ALA C CA  1 
ATOM   8630  C  C   . ALA C  1 31  ? 24.849  15.324  1.903   1.00 22.62  ? 31   ALA C C   1 
ATOM   8631  O  O   . ALA C  1 31  ? 24.400  15.968  0.960   1.00 26.24  ? 31   ALA C O   1 
ATOM   8632  C  CB  . ALA C  1 31  ? 26.329  16.913  3.081   1.00 27.30  ? 31   ALA C CB  1 
ATOM   8633  N  N   . PHE C  1 32  ? 24.172  14.373  2.524   1.00 21.61  ? 32   PHE C N   1 
ATOM   8634  C  CA  . PHE C  1 32  ? 22.790  14.069  2.230   1.00 25.42  ? 32   PHE C CA  1 
ATOM   8635  C  C   . PHE C  1 32  ? 22.058  14.339  3.517   1.00 29.00  ? 32   PHE C C   1 
ATOM   8636  O  O   . PHE C  1 32  ? 22.007  13.476  4.383   1.00 32.16  ? 32   PHE C O   1 
ATOM   8637  C  CB  . PHE C  1 32  ? 22.651  12.594  1.865   1.00 29.74  ? 32   PHE C CB  1 
ATOM   8638  C  CG  . PHE C  1 32  ? 23.465  12.189  0.685   1.00 18.85  ? 32   PHE C CG  1 
ATOM   8639  C  CD1 . PHE C  1 32  ? 22.949  12.273  -0.583  1.00 53.89  ? 32   PHE C CD1 1 
ATOM   8640  C  CD2 . PHE C  1 32  ? 24.756  11.742  0.842   1.00 39.85  ? 32   PHE C CD2 1 
ATOM   8641  C  CE1 . PHE C  1 32  ? 23.702  11.914  -1.665  1.00 20.83  ? 32   PHE C CE1 1 
ATOM   8642  C  CE2 . PHE C  1 32  ? 25.513  11.384  -0.244  1.00 31.00  ? 32   PHE C CE2 1 
ATOM   8643  C  CZ  . PHE C  1 32  ? 24.977  11.467  -1.497  1.00 21.30  ? 32   PHE C CZ  1 
ATOM   8644  N  N   . LEU C  1 33  ? 21.522  15.543  3.669   1.00 28.06  ? 33   LEU C N   1 
ATOM   8645  C  CA  . LEU C  1 33  ? 20.873  15.904  4.921   1.00 28.85  ? 33   LEU C CA  1 
ATOM   8646  C  C   . LEU C  1 33  ? 19.355  15.888  4.824   1.00 31.62  ? 33   LEU C C   1 
ATOM   8647  O  O   . LEU C  1 33  ? 18.789  16.313  3.827   1.00 15.58  ? 33   LEU C O   1 
ATOM   8648  C  CB  . LEU C  1 33  ? 21.312  17.286  5.344   1.00 15.45  ? 33   LEU C CB  1 
ATOM   8649  C  CG  . LEU C  1 33  ? 22.638  17.761  4.813   1.00 58.74  ? 33   LEU C CG  1 
ATOM   8650  C  CD1 . LEU C  1 33  ? 22.629  19.252  4.933   1.00 16.60  ? 33   LEU C CD1 1 
ATOM   8651  C  CD2 . LEU C  1 33  ? 23.727  17.147  5.651   1.00 16.11  ? 33   LEU C CD2 1 
ATOM   8652  N  N   . GLY C  1 34  ? 18.710  15.394  5.875   1.00 14.24  ? 34   GLY C N   1 
ATOM   8653  C  CA  . GLY C  1 34  ? 17.274  15.521  6.017   1.00 31.06  ? 34   GLY C CA  1 
ATOM   8654  C  C   . GLY C  1 34  ? 16.473  14.505  5.224   1.00 25.57  ? 34   GLY C C   1 
ATOM   8655  O  O   . GLY C  1 34  ? 15.512  14.871  4.533   1.00 15.77  ? 34   GLY C O   1 
ATOM   8656  N  N   . ILE C  1 35  ? 16.888  13.241  5.327   1.00 22.27  ? 35   ILE C N   1 
ATOM   8657  C  CA  . ILE C  1 35  ? 16.229  12.106  4.705   1.00 14.46  ? 35   ILE C CA  1 
ATOM   8658  C  C   . ILE C  1 35  ? 15.164  11.565  5.662   1.00 27.30  ? 35   ILE C C   1 
ATOM   8659  O  O   . ILE C  1 35  ? 15.471  11.255  6.808   1.00 28.31  ? 35   ILE C O   1 
ATOM   8660  C  CB  . ILE C  1 35  ? 17.256  10.988  4.499   1.00 30.99  ? 35   ILE C CB  1 
ATOM   8661  C  CG1 . ILE C  1 35  ? 18.553  11.557  3.909   1.00 29.05  ? 35   ILE C CG1 1 
ATOM   8662  C  CG2 . ILE C  1 35  ? 16.673  9.854   3.680   1.00 15.26  ? 35   ILE C CG2 1 
ATOM   8663  C  CD1 . ILE C  1 35  ? 19.568  10.526  3.584   1.00 15.69  ? 35   ILE C CD1 1 
ATOM   8664  N  N   . PRO C  1 36  ? 13.904  11.446  5.208   1.00 22.08  ? 36   PRO C N   1 
ATOM   8665  C  CA  . PRO C  1 36  ? 12.890  10.906  6.118   1.00 23.89  ? 36   PRO C CA  1 
ATOM   8666  C  C   . PRO C  1 36  ? 13.136  9.433   6.398   1.00 23.30  ? 36   PRO C C   1 
ATOM   8667  O  O   . PRO C  1 36  ? 13.372  8.684   5.466   1.00 28.26  ? 36   PRO C O   1 
ATOM   8668  C  CB  . PRO C  1 36  ? 11.595  11.066  5.321   1.00 23.50  ? 36   PRO C CB  1 
ATOM   8669  C  CG  . PRO C  1 36  ? 12.024  11.022  3.916   1.00 24.53  ? 36   PRO C CG  1 
ATOM   8670  C  CD  . PRO C  1 36  ? 13.338  11.746  3.883   1.00 19.57  ? 36   PRO C CD  1 
ATOM   8671  N  N   . PHE C  1 37  ? 13.080  9.019   7.657   1.00 21.36  ? 37   PHE C N   1 
ATOM   8672  C  CA  . PHE C  1 37  ? 13.295  7.612   7.983   1.00 15.97  ? 37   PHE C CA  1 
ATOM   8673  C  C   . PHE C  1 37  ? 12.085  7.031   8.638   1.00 17.96  ? 37   PHE C C   1 
ATOM   8674  O  O   . PHE C  1 37  ? 11.981  5.821   8.767   1.00 25.50  ? 37   PHE C O   1 
ATOM   8675  C  CB  . PHE C  1 37  ? 14.550  7.386   8.847   1.00 22.81  ? 37   PHE C CB  1 
ATOM   8676  C  CG  . PHE C  1 37  ? 14.458  7.923   10.260  1.00 26.12  ? 37   PHE C CG  1 
ATOM   8677  C  CD1 . PHE C  1 37  ? 13.970  7.130   11.291  1.00 23.44  ? 37   PHE C CD1 1 
ATOM   8678  C  CD2 . PHE C  1 37  ? 14.923  9.201   10.566  1.00 26.98  ? 37   PHE C CD2 1 
ATOM   8679  C  CE1 . PHE C  1 37  ? 13.916  7.613   12.595  1.00 23.07  ? 37   PHE C CE1 1 
ATOM   8680  C  CE2 . PHE C  1 37  ? 14.861  9.693   11.863  1.00 23.46  ? 37   PHE C CE2 1 
ATOM   8681  C  CZ  . PHE C  1 37  ? 14.358  8.898   12.881  1.00 21.85  ? 37   PHE C CZ  1 
ATOM   8682  N  N   . ALA C  1 38  ? 11.171  7.908   9.044   1.00 25.45  ? 38   ALA C N   1 
ATOM   8683  C  CA  . ALA C  1 38  ? 9.852   7.502   9.532   1.00 27.14  ? 38   ALA C CA  1 
ATOM   8684  C  C   . ALA C  1 38  ? 8.767   8.436   9.027   1.00 23.86  ? 38   ALA C C   1 
ATOM   8685  O  O   . ALA C  1 38  ? 9.037   9.571   8.657   1.00 25.03  ? 38   ALA C O   1 
ATOM   8686  C  CB  . ALA C  1 38  ? 9.825   7.464   11.055  1.00 27.03  ? 38   ALA C CB  1 
ATOM   8687  N  N   . GLU C  1 39  ? 7.533   7.950   9.018   1.00 29.30  ? 39   GLU C N   1 
ATOM   8688  C  CA  . GLU C  1 39  ? 6.370   8.797   8.789   1.00 24.32  ? 39   GLU C CA  1 
ATOM   8689  C  C   . GLU C  1 39  ? 6.299   9.738   9.973   1.00 30.27  ? 39   GLU C C   1 
ATOM   8690  O  O   . GLU C  1 39  ? 6.700   9.364   11.071  1.00 41.36  ? 39   GLU C O   1 
ATOM   8691  C  CB  . GLU C  1 39  ? 5.117   7.942   8.726   1.00 22.76  ? 39   GLU C CB  1 
ATOM   8692  C  CG  . GLU C  1 39  ? 5.049   7.058   7.504   1.00 24.58  ? 39   GLU C CG  1 
ATOM   8693  C  CD  . GLU C  1 39  ? 4.801   7.858   6.244   1.00 34.05  ? 39   GLU C CD  1 
ATOM   8694  O  OE1 . GLU C  1 39  ? 4.023   8.834   6.313   1.00 34.16  ? 39   GLU C OE1 1 
ATOM   8695  O  OE2 . GLU C  1 39  ? 5.392   7.520   5.192   1.00 40.42  ? 39   GLU C OE2 1 
ATOM   8696  N  N   . PRO C  1 40  ? 5.808   10.967  9.763   1.00 24.72  ? 40   PRO C N   1 
ATOM   8697  C  CA  . PRO C  1 40  ? 5.909   11.970  10.828  1.00 21.79  ? 40   PRO C CA  1 
ATOM   8698  C  C   . PRO C  1 40  ? 4.975   11.639  11.982  1.00 23.12  ? 40   PRO C C   1 
ATOM   8699  O  O   . PRO C  1 40  ? 3.795   11.371  11.751  1.00 31.31  ? 40   PRO C O   1 
ATOM   8700  C  CB  . PRO C  1 40  ? 5.457   13.263  10.137  1.00 23.16  ? 40   PRO C CB  1 
ATOM   8701  C  CG  . PRO C  1 40  ? 5.452   12.969  8.674   1.00 18.85  ? 40   PRO C CG  1 
ATOM   8702  C  CD  . PRO C  1 40  ? 5.146   11.508  8.568   1.00 23.90  ? 40   PRO C CD  1 
ATOM   8703  N  N   . PRO C  1 41  ? 5.498   11.653  13.213  1.00 22.07  ? 41   PRO C N   1 
ATOM   8704  C  CA  . PRO C  1 41  ? 4.744   11.271  14.413  1.00 24.48  ? 41   PRO C CA  1 
ATOM   8705  C  C   . PRO C  1 41  ? 3.812   12.384  14.867  1.00 25.91  ? 41   PRO C C   1 
ATOM   8706  O  O   . PRO C  1 41  ? 3.912   12.875  15.991  1.00 32.81  ? 41   PRO C O   1 
ATOM   8707  C  CB  . PRO C  1 41  ? 5.846   11.062  15.450  1.00 25.56  ? 41   PRO C CB  1 
ATOM   8708  C  CG  . PRO C  1 41  ? 6.933   11.982  15.000  1.00 23.88  ? 41   PRO C CG  1 
ATOM   8709  C  CD  . PRO C  1 41  ? 6.912   11.929  13.515  1.00 21.74  ? 41   PRO C CD  1 
ATOM   8710  N  N   . VAL C  1 42  ? 2.903   12.776  13.991  1.00 21.30  ? 42   VAL C N   1 
ATOM   8711  C  CA  . VAL C  1 42  ? 2.058   13.931  14.245  1.00 17.53  ? 42   VAL C CA  1 
ATOM   8712  C  C   . VAL C  1 42  ? 0.614   13.504  14.409  1.00 17.63  ? 42   VAL C C   1 
ATOM   8713  O  O   . VAL C  1 42  ? 0.214   12.435  13.940  1.00 19.11  ? 42   VAL C O   1 
ATOM   8714  C  CB  . VAL C  1 42  ? 2.158   14.926  13.094  1.00 17.28  ? 42   VAL C CB  1 
ATOM   8715  C  CG1 . VAL C  1 42  ? 3.420   15.762  13.231  1.00 15.13  ? 42   VAL C CG1 1 
ATOM   8716  C  CG2 . VAL C  1 42  ? 2.173   14.176  11.787  1.00 15.59  ? 42   VAL C CG2 1 
ATOM   8717  N  N   . GLY C  1 43  ? -0.159  14.345  15.088  1.00 21.45  ? 43   GLY C N   1 
ATOM   8718  C  CA  . GLY C  1 43  ? -1.554  14.053  15.385  1.00 27.22  ? 43   GLY C CA  1 
ATOM   8719  C  C   . GLY C  1 43  ? -1.728  12.770  16.163  1.00 28.46  ? 43   GLY C C   1 
ATOM   8720  O  O   . GLY C  1 43  ? -1.228  12.640  17.279  1.00 32.76  ? 43   GLY C O   1 
ATOM   8721  N  N   . SER C  1 44  ? -2.421  11.809  15.563  1.00 29.47  ? 44   SER C N   1 
ATOM   8722  C  CA  . SER C  1 44  ? -2.657  10.522  16.214  1.00 30.95  ? 44   SER C CA  1 
ATOM   8723  C  C   . SER C  1 44  ? -1.390  9.672   16.399  1.00 30.68  ? 44   SER C C   1 
ATOM   8724  O  O   . SER C  1 44  ? -1.416  8.659   17.093  1.00 38.10  ? 44   SER C O   1 
ATOM   8725  C  CB  . SER C  1 44  ? -3.674  9.719   15.424  1.00 29.60  ? 44   SER C CB  1 
ATOM   8726  O  OG  . SER C  1 44  ? -3.083  9.222   14.239  1.00 19.24  ? 44   SER C OG  1 
ATOM   8727  N  N   . ARG C  1 45  ? -0.292  10.058  15.766  1.00 22.92  ? 45   ARG C N   1 
ATOM   8728  C  CA  . ARG C  1 45  ? 0.907   9.252   15.855  1.00 27.69  ? 45   ARG C CA  1 
ATOM   8729  C  C   . ARG C  1 45  ? 1.732   9.717   17.050  1.00 34.55  ? 45   ARG C C   1 
ATOM   8730  O  O   . ARG C  1 45  ? 2.680   9.048   17.479  1.00 41.42  ? 45   ARG C O   1 
ATOM   8731  C  CB  . ARG C  1 45  ? 1.706   9.331   14.553  1.00 36.34  ? 45   ARG C CB  1 
ATOM   8732  C  CG  . ARG C  1 45  ? 1.117   8.525   13.408  1.00 47.28  ? 45   ARG C CG  1 
ATOM   8733  C  CD  . ARG C  1 45  ? 0.560   7.183   13.902  1.00 62.80  ? 45   ARG C CD  1 
ATOM   8734  N  NE  . ARG C  1 45  ? 1.583   6.202   14.299  1.00 64.39  ? 45   ARG C NE  1 
ATOM   8735  C  CZ  . ARG C  1 45  ? 1.311   4.984   14.782  1.00 54.03  ? 45   ARG C CZ  1 
ATOM   8736  N  NH1 . ARG C  1 45  ? 0.042   4.594   14.938  1.00 48.45  ? 45   ARG C NH1 1 
ATOM   8737  N  NH2 . ARG C  1 45  ? 2.307   4.155   15.112  1.00 41.20  ? 45   ARG C NH2 1 
ATOM   8738  N  N   . ARG C  1 46  ? 1.346   10.867  17.590  1.00 30.43  ? 46   ARG C N   1 
ATOM   8739  C  CA  . ARG C  1 46  ? 2.034   11.455  18.721  1.00 27.41  ? 46   ARG C CA  1 
ATOM   8740  C  C   . ARG C  1 46  ? 2.017   10.482  19.894  1.00 33.59  ? 46   ARG C C   1 
ATOM   8741  O  O   . ARG C  1 46  ? 0.960   9.934   20.236  1.00 32.52  ? 46   ARG C O   1 
ATOM   8742  C  CB  . ARG C  1 46  ? 1.346   12.763  19.112  1.00 24.53  ? 46   ARG C CB  1 
ATOM   8743  C  CG  . ARG C  1 46  ? 1.919   13.414  20.344  1.00 23.09  ? 46   ARG C CG  1 
ATOM   8744  C  CD  . ARG C  1 46  ? 1.036   14.515  20.875  1.00 17.44  ? 46   ARG C CD  1 
ATOM   8745  N  NE  . ARG C  1 46  ? 1.127   15.736  20.082  1.00 16.48  ? 46   ARG C NE  1 
ATOM   8746  C  CZ  . ARG C  1 46  ? 0.631   16.904  20.471  1.00 20.62  ? 46   ARG C CZ  1 
ATOM   8747  N  NH1 . ARG C  1 46  ? 0.028   17.004  21.648  1.00 16.45  ? 46   ARG C NH1 1 
ATOM   8748  N  NH2 . ARG C  1 46  ? 0.735   17.966  19.685  1.00 22.20  ? 46   ARG C NH2 1 
ATOM   8749  N  N   . PHE C  1 47  ? 3.198   10.288  20.483  1.00 13.74  ? 47   PHE C N   1 
ATOM   8750  C  CA  . PHE C  1 47  ? 3.458   9.423   21.650  1.00 27.66  ? 47   PHE C CA  1 
ATOM   8751  C  C   . PHE C  1 47  ? 3.711   7.974   21.250  1.00 24.96  ? 47   PHE C C   1 
ATOM   8752  O  O   . PHE C  1 47  ? 4.277   7.192   22.028  1.00 20.55  ? 47   PHE C O   1 
ATOM   8753  C  CB  . PHE C  1 47  ? 2.372   9.503   22.739  1.00 14.46  ? 47   PHE C CB  1 
ATOM   8754  C  CG  . PHE C  1 47  ? 2.147   10.890  23.288  1.00 24.77  ? 47   PHE C CG  1 
ATOM   8755  C  CD1 . PHE C  1 47  ? 3.213   11.648  23.768  1.00 16.13  ? 47   PHE C CD1 1 
ATOM   8756  C  CD2 . PHE C  1 47  ? 0.855   11.445  23.317  1.00 27.55  ? 47   PHE C CD2 1 
ATOM   8757  C  CE1 . PHE C  1 47  ? 3.002   12.936  24.269  1.00 14.10  ? 47   PHE C CE1 1 
ATOM   8758  C  CE2 . PHE C  1 47  ? 0.631   12.729  23.818  1.00 15.71  ? 47   PHE C CE2 1 
ATOM   8759  C  CZ  . PHE C  1 47  ? 1.702   13.472  24.292  1.00 48.37  ? 47   PHE C CZ  1 
ATOM   8760  N  N   . MET C  1 48  ? 3.315   7.636   20.024  1.00 26.52  ? 48   MET C N   1 
ATOM   8761  C  CA  . MET C  1 48  ? 3.393   6.263   19.523  1.00 24.77  ? 48   MET C CA  1 
ATOM   8762  C  C   . MET C  1 48  ? 4.716   5.972   18.853  1.00 28.45  ? 48   MET C C   1 
ATOM   8763  O  O   . MET C  1 48  ? 5.416   6.892   18.429  1.00 29.21  ? 48   MET C O   1 
ATOM   8764  C  CB  . MET C  1 48  ? 2.265   5.995   18.533  1.00 20.32  ? 48   MET C CB  1 
ATOM   8765  C  CG  . MET C  1 48  ? 0.942   6.482   19.026  1.00 27.26  ? 48   MET C CG  1 
ATOM   8766  S  SD  . MET C  1 48  ? -0.406  5.413   18.548  1.00 57.60  ? 48   MET C SD  1 
ATOM   8767  C  CE  . MET C  1 48  ? 0.126   3.943   19.391  1.00 17.23  ? 48   MET C CE  1 
ATOM   8768  N  N   . PRO C  1 49  ? 5.059   4.678   18.757  1.00 30.78  ? 49   PRO C N   1 
ATOM   8769  C  CA  . PRO C  1 49  ? 6.235   4.209   18.028  1.00 25.63  ? 49   PRO C CA  1 
ATOM   8770  C  C   . PRO C  1 49  ? 6.314   4.766   16.607  1.00 23.04  ? 49   PRO C C   1 
ATOM   8771  O  O   . PRO C  1 49  ? 5.287   4.979   15.967  1.00 25.82  ? 49   PRO C O   1 
ATOM   8772  C  CB  . PRO C  1 49  ? 6.003   2.702   17.971  1.00 14.07  ? 49   PRO C CB  1 
ATOM   8773  C  CG  . PRO C  1 49  ? 5.294   2.409   19.218  1.00 14.45  ? 49   PRO C CG  1 
ATOM   8774  C  CD  . PRO C  1 49  ? 4.357   3.558   19.411  1.00 35.58  ? 49   PRO C CD  1 
ATOM   8775  N  N   . PRO C  1 50  ? 7.532   4.996   16.113  1.00 19.67  ? 50   PRO C N   1 
ATOM   8776  C  CA  . PRO C  1 50  ? 7.630   5.498   14.749  1.00 18.45  ? 50   PRO C CA  1 
ATOM   8777  C  C   . PRO C  1 50  ? 7.183   4.405   13.774  1.00 25.32  ? 50   PRO C C   1 
ATOM   8778  O  O   . PRO C  1 50  ? 7.281   3.221   14.111  1.00 22.98  ? 50   PRO C O   1 
ATOM   8779  C  CB  . PRO C  1 50  ? 9.128   5.733   14.601  1.00 22.79  ? 50   PRO C CB  1 
ATOM   8780  C  CG  . PRO C  1 50  ? 9.752   4.666   15.465  1.00 12.27  ? 50   PRO C CG  1 
ATOM   8781  C  CD  . PRO C  1 50  ? 8.838   4.545   16.642  1.00 20.90  ? 50   PRO C CD  1 
ATOM   8782  N  N   . GLU C  1 51  ? 6.694   4.798   12.596  1.00 30.89  ? 51   GLU C N   1 
ATOM   8783  C  CA  . GLU C  1 51  ? 6.438   3.868   11.490  1.00 33.84  ? 51   GLU C CA  1 
ATOM   8784  C  C   . GLU C  1 51  ? 7.424   4.136   10.379  1.00 36.87  ? 51   GLU C C   1 
ATOM   8785  O  O   . GLU C  1 51  ? 7.721   5.283   10.094  1.00 46.39  ? 51   GLU C O   1 
ATOM   8786  C  CB  . GLU C  1 51  ? 5.043   4.067   10.919  1.00 40.52  ? 51   GLU C CB  1 
ATOM   8787  C  CG  . GLU C  1 51  ? 3.915   3.636   11.813  1.00 51.53  ? 51   GLU C CG  1 
ATOM   8788  C  CD  . GLU C  1 51  ? 2.606   4.234   11.354  1.00 68.93  ? 51   GLU C CD  1 
ATOM   8789  O  OE1 . GLU C  1 51  ? 2.593   5.464   11.080  1.00 69.22  ? 51   GLU C OE1 1 
ATOM   8790  O  OE2 . GLU C  1 51  ? 1.607   3.476   11.250  1.00 78.31  ? 51   GLU C OE2 1 
ATOM   8791  N  N   . PRO C  1 52  ? 7.921   3.079   9.729   1.00 38.28  ? 52   PRO C N   1 
ATOM   8792  C  CA  . PRO C  1 52  ? 8.920   3.257   8.671   1.00 39.80  ? 52   PRO C CA  1 
ATOM   8793  C  C   . PRO C  1 52  ? 8.362   4.144   7.574   1.00 40.70  ? 52   PRO C C   1 
ATOM   8794  O  O   . PRO C  1 52  ? 7.167   4.039   7.256   1.00 40.07  ? 52   PRO C O   1 
ATOM   8795  C  CB  . PRO C  1 52  ? 9.120   1.842   8.130   1.00 42.81  ? 52   PRO C CB  1 
ATOM   8796  C  CG  . PRO C  1 52  ? 8.614   0.936   9.204   1.00 41.43  ? 52   PRO C CG  1 
ATOM   8797  C  CD  . PRO C  1 52  ? 7.515   1.674   9.884   1.00 40.32  ? 52   PRO C CD  1 
ATOM   8798  N  N   . LYS C  1 53  ? 9.214   5.008   7.028   1.00 36.00  ? 53   LYS C N   1 
ATOM   8799  C  CA  . LYS C  1 53  ? 8.814   5.993   6.029   1.00 31.89  ? 53   LYS C CA  1 
ATOM   8800  C  C   . LYS C  1 53  ? 8.369   5.303   4.745   1.00 33.67  ? 53   LYS C C   1 
ATOM   8801  O  O   . LYS C  1 53  ? 9.123   4.525   4.151   1.00 32.09  ? 53   LYS C O   1 
ATOM   8802  C  CB  . LYS C  1 53  ? 9.964   6.971   5.760   1.00 28.85  ? 53   LYS C CB  1 
ATOM   8803  C  CG  . LYS C  1 53  ? 9.745   7.950   4.624   1.00 27.40  ? 53   LYS C CG  1 
ATOM   8804  C  CD  . LYS C  1 53  ? 8.412   8.656   4.750   1.00 30.81  ? 53   LYS C CD  1 
ATOM   8805  C  CE  . LYS C  1 53  ? 8.310   9.818   3.783   1.00 36.79  ? 53   LYS C CE  1 
ATOM   8806  N  NZ  . LYS C  1 53  ? 7.007   10.515  3.937   1.00 43.33  ? 53   LYS C NZ  1 
ATOM   8807  N  N   . ARG C  1 54  ? 7.129   5.579   4.339   1.00 30.18  ? 54   ARG C N   1 
ATOM   8808  C  CA  . ARG C  1 54  ? 6.581   5.021   3.112   1.00 26.40  ? 54   ARG C CA  1 
ATOM   8809  C  C   . ARG C  1 54  ? 7.273   5.643   1.908   1.00 26.26  ? 54   ARG C C   1 
ATOM   8810  O  O   . ARG C  1 54  ? 7.544   6.843   1.893   1.00 29.79  ? 54   ARG C O   1 
ATOM   8811  C  CB  . ARG C  1 54  ? 5.066   5.245   3.035   1.00 34.59  ? 54   ARG C CB  1 
ATOM   8812  C  CG  . ARG C  1 54  ? 4.218   3.988   3.267   1.00 52.01  ? 54   ARG C CG  1 
ATOM   8813  C  CD  . ARG C  1 54  ? 2.702   4.271   3.196   1.00 70.83  ? 54   ARG C CD  1 
ATOM   8814  N  NE  . ARG C  1 54  ? 2.198   4.997   4.369   1.00 81.88  ? 54   ARG C NE  1 
ATOM   8815  C  CZ  . ARG C  1 54  ? 1.722   6.244   4.353   1.00 80.22  ? 54   ARG C CZ  1 
ATOM   8816  N  NH1 . ARG C  1 54  ? 1.663   6.926   3.210   1.00 83.92  ? 54   ARG C NH1 1 
ATOM   8817  N  NH2 . ARG C  1 54  ? 1.299   6.808   5.484   1.00 69.71  ? 54   ARG C NH2 1 
ATOM   8818  N  N   . PRO C  1 55  ? 7.582   4.818   0.902   1.00 19.44  ? 55   PRO C N   1 
ATOM   8819  C  CA  . PRO C  1 55  ? 8.179   5.230   -0.363  1.00 20.02  ? 55   PRO C CA  1 
ATOM   8820  C  C   . PRO C  1 55  ? 7.584   6.509   -0.930  1.00 25.73  ? 55   PRO C C   1 
ATOM   8821  O  O   . PRO C  1 55  ? 6.371   6.646   -0.972  1.00 25.40  ? 55   PRO C O   1 
ATOM   8822  C  CB  . PRO C  1 55  ? 7.856   4.061   -1.284  1.00 21.21  ? 55   PRO C CB  1 
ATOM   8823  C  CG  . PRO C  1 55  ? 7.389   2.932   -0.386  1.00 29.15  ? 55   PRO C CG  1 
ATOM   8824  C  CD  . PRO C  1 55  ? 7.571   3.355   1.018   1.00 30.51  ? 55   PRO C CD  1 
ATOM   8825  N  N   . TRP C  1 56  ? 8.453   7.426   -1.350  1.00 35.35  ? 56   TRP C N   1 
ATOM   8826  C  CA  . TRP C  1 56  ? 8.070   8.673   -2.010  1.00 36.86  ? 56   TRP C CA  1 
ATOM   8827  C  C   . TRP C  1 56  ? 8.344   8.595   -3.510  1.00 41.30  ? 56   TRP C C   1 
ATOM   8828  O  O   . TRP C  1 56  ? 9.069   7.705   -3.985  1.00 46.51  ? 56   TRP C O   1 
ATOM   8829  C  CB  . TRP C  1 56  ? 8.878   9.834   -1.427  1.00 34.30  ? 56   TRP C CB  1 
ATOM   8830  C  CG  . TRP C  1 56  ? 10.367  9.686   -1.630  1.00 27.21  ? 56   TRP C CG  1 
ATOM   8831  C  CD1 . TRP C  1 56  ? 11.076  10.054  -2.727  1.00 29.02  ? 56   TRP C CD1 1 
ATOM   8832  C  CD2 . TRP C  1 56  ? 11.315  9.129   -0.710  1.00 25.78  ? 56   TRP C CD2 1 
ATOM   8833  N  NE1 . TRP C  1 56  ? 12.405  9.765   -2.553  1.00 34.40  ? 56   TRP C NE1 1 
ATOM   8834  C  CE2 . TRP C  1 56  ? 12.579  9.196   -1.322  1.00 30.36  ? 56   TRP C CE2 1 
ATOM   8835  C  CE3 . TRP C  1 56  ? 11.217  8.581   0.570   1.00 30.09  ? 56   TRP C CE3 1 
ATOM   8836  C  CZ2 . TRP C  1 56  ? 13.737  8.733   -0.705  1.00 28.52  ? 56   TRP C CZ2 1 
ATOM   8837  C  CZ3 . TRP C  1 56  ? 12.372  8.126   1.186   1.00 33.59  ? 56   TRP C CZ3 1 
ATOM   8838  C  CH2 . TRP C  1 56  ? 13.613  8.201   0.545   1.00 29.93  ? 56   TRP C CH2 1 
ATOM   8839  N  N   . SER C  1 57  ? 7.785   9.536   -4.260  1.00 39.97  ? 57   SER C N   1 
ATOM   8840  C  CA  . SER C  1 57  ? 8.045   9.575   -5.694  1.00 43.58  ? 57   SER C CA  1 
ATOM   8841  C  C   . SER C  1 57  ? 8.938   10.764  -6.035  1.00 41.44  ? 57   SER C C   1 
ATOM   8842  O  O   . SER C  1 57  ? 8.981   11.748  -5.287  1.00 43.21  ? 57   SER C O   1 
ATOM   8843  C  CB  . SER C  1 57  ? 6.734   9.627   -6.483  1.00 42.01  ? 57   SER C CB  1 
ATOM   8844  O  OG  . SER C  1 57  ? 5.817   10.498  -5.850  1.00 43.13  ? 57   SER C OG  1 
ATOM   8845  N  N   . GLY C  1 58  ? 9.657   10.661  -7.151  1.00 34.78  ? 58   GLY C N   1 
ATOM   8846  C  CA  . GLY C  1 58  ? 10.545  11.725  -7.600  1.00 39.62  ? 58   GLY C CA  1 
ATOM   8847  C  C   . GLY C  1 58  ? 11.864  11.816  -6.847  1.00 33.96  ? 58   GLY C C   1 
ATOM   8848  O  O   . GLY C  1 58  ? 12.160  10.958  -6.021  1.00 27.37  ? 58   GLY C O   1 
ATOM   8849  N  N   . VAL C  1 59  ? 12.659  12.846  -7.126  1.00 23.75  ? 59   VAL C N   1 
ATOM   8850  C  CA  . VAL C  1 59  ? 13.921  13.002  -6.416  1.00 33.66  ? 59   VAL C CA  1 
ATOM   8851  C  C   . VAL C  1 59  ? 13.817  13.919  -5.193  1.00 32.26  ? 59   VAL C C   1 
ATOM   8852  O  O   . VAL C  1 59  ? 13.507  15.109  -5.317  1.00 35.03  ? 59   VAL C O   1 
ATOM   8853  C  CB  . VAL C  1 59  ? 15.059  13.462  -7.343  1.00 30.80  ? 59   VAL C CB  1 
ATOM   8854  C  CG1 . VAL C  1 59  ? 16.266  13.869  -6.538  1.00 23.24  ? 59   VAL C CG1 1 
ATOM   8855  C  CG2 . VAL C  1 59  ? 15.441  12.343  -8.269  1.00 24.90  ? 59   VAL C CG2 1 
ATOM   8856  N  N   . LEU C  1 60  ? 14.115  13.346  -4.024  1.00 28.69  ? 60   LEU C N   1 
ATOM   8857  C  CA  . LEU C  1 60  ? 14.004  14.022  -2.727  1.00 29.13  ? 60   LEU C CA  1 
ATOM   8858  C  C   . LEU C  1 60  ? 15.134  14.992  -2.456  1.00 37.02  ? 60   LEU C C   1 
ATOM   8859  O  O   . LEU C  1 60  ? 16.307  14.633  -2.566  1.00 46.25  ? 60   LEU C O   1 
ATOM   8860  C  CB  . LEU C  1 60  ? 13.972  12.999  -1.589  1.00 27.13  ? 60   LEU C CB  1 
ATOM   8861  C  CG  . LEU C  1 60  ? 13.868  13.629  -0.198  1.00 28.96  ? 60   LEU C CG  1 
ATOM   8862  C  CD1 . LEU C  1 60  ? 12.613  13.187  0.540   1.00 22.78  ? 60   LEU C CD1 1 
ATOM   8863  C  CD2 . LEU C  1 60  ? 15.097  13.299  0.596   1.00 35.25  ? 60   LEU C CD2 1 
ATOM   8864  N  N   . ASP C  1 61  ? 14.792  16.219  -2.081  1.00 35.57  ? 61   ASP C N   1 
ATOM   8865  C  CA  . ASP C  1 61  ? 15.826  17.201  -1.794  1.00 35.75  ? 61   ASP C CA  1 
ATOM   8866  C  C   . ASP C  1 61  ? 16.473  16.920  -0.446  1.00 35.36  ? 61   ASP C C   1 
ATOM   8867  O  O   . ASP C  1 61  ? 15.863  17.133  0.615   1.00 39.81  ? 61   ASP C O   1 
ATOM   8868  C  CB  . ASP C  1 61  ? 15.270  18.618  -1.840  1.00 43.91  ? 61   ASP C CB  1 
ATOM   8869  C  CG  . ASP C  1 61  ? 16.343  19.666  -1.646  1.00 51.81  ? 61   ASP C CG  1 
ATOM   8870  O  OD1 . ASP C  1 61  ? 17.533  19.316  -1.747  1.00 54.53  ? 61   ASP C OD1 1 
ATOM   8871  O  OD2 . ASP C  1 61  ? 15.998  20.840  -1.397  1.00 58.71  ? 61   ASP C OD2 1 
ATOM   8872  N  N   . ALA C  1 62  ? 17.711  16.436  -0.500  1.00 28.97  ? 62   ALA C N   1 
ATOM   8873  C  CA  . ALA C  1 62  ? 18.485  16.181  0.706   1.00 25.77  ? 62   ALA C CA  1 
ATOM   8874  C  C   . ALA C  1 62  ? 19.716  17.073  0.767   1.00 32.31  ? 62   ALA C C   1 
ATOM   8875  O  O   . ALA C  1 62  ? 20.811  16.610  1.065   1.00 44.54  ? 62   ALA C O   1 
ATOM   8876  C  CB  . ALA C  1 62  ? 18.885  14.742  0.765   1.00 17.47  ? 62   ALA C CB  1 
ATOM   8877  N  N   . THR C  1 63  ? 19.535  18.359  0.499   1.00 26.38  ? 63   THR C N   1 
ATOM   8878  C  CA  . THR C  1 63  ? 20.667  19.262  0.418   1.00 25.37  ? 63   THR C CA  1 
ATOM   8879  C  C   . THR C  1 63  ? 20.756  20.196  1.623   1.00 30.30  ? 63   THR C C   1 
ATOM   8880  O  O   . THR C  1 63  ? 21.784  20.862  1.821   1.00 31.91  ? 63   THR C O   1 
ATOM   8881  C  CB  . THR C  1 63  ? 20.599  20.085  -0.852  1.00 20.15  ? 63   THR C CB  1 
ATOM   8882  O  OG1 . THR C  1 63  ? 19.338  20.755  -0.906  1.00 20.11  ? 63   THR C OG1 1 
ATOM   8883  C  CG2 . THR C  1 63  ? 20.711  19.185  -2.050  1.00 32.75  ? 63   THR C CG2 1 
ATOM   8884  N  N   . THR C  1 64  ? 19.683  20.254  2.418   1.00 22.42  ? 64   THR C N   1 
ATOM   8885  C  CA  . THR C  1 64  ? 19.691  21.020  3.667   1.00 19.60  ? 64   THR C CA  1 
ATOM   8886  C  C   . THR C  1 64  ? 19.176  20.180  4.824   1.00 19.32  ? 64   THR C C   1 
ATOM   8887  O  O   . THR C  1 64  ? 18.782  19.037  4.626   1.00 25.88  ? 64   THR C O   1 
ATOM   8888  C  CB  . THR C  1 64  ? 18.812  22.245  3.567   1.00 29.55  ? 64   THR C CB  1 
ATOM   8889  O  OG1 . THR C  1 64  ? 17.451  21.830  3.365   1.00 40.49  ? 64   THR C OG1 1 
ATOM   8890  C  CG2 . THR C  1 64  ? 19.257  23.099  2.416   1.00 33.36  ? 64   THR C CG2 1 
ATOM   8891  N  N   . PHE C  1 65  ? 19.171  20.750  6.027   1.00 17.02  ? 65   PHE C N   1 
ATOM   8892  C  CA  . PHE C  1 65  ? 18.648  20.056  7.203   1.00 19.47  ? 65   PHE C CA  1 
ATOM   8893  C  C   . PHE C  1 65  ? 17.126  20.135  7.344   1.00 27.82  ? 65   PHE C C   1 
ATOM   8894  O  O   . PHE C  1 65  ? 16.462  21.003  6.774   1.00 36.36  ? 65   PHE C O   1 
ATOM   8895  C  CB  . PHE C  1 65  ? 19.259  20.632  8.465   1.00 18.77  ? 65   PHE C CB  1 
ATOM   8896  C  CG  . PHE C  1 65  ? 20.635  20.155  8.737   1.00 23.58  ? 65   PHE C CG  1 
ATOM   8897  C  CD1 . PHE C  1 65  ? 20.868  18.838  9.038   1.00 33.71  ? 65   PHE C CD1 1 
ATOM   8898  C  CD2 . PHE C  1 65  ? 21.700  21.030  8.713   1.00 21.04  ? 65   PHE C CD2 1 
ATOM   8899  C  CE1 . PHE C  1 65  ? 22.157  18.398  9.301   1.00 37.75  ? 65   PHE C CE1 1 
ATOM   8900  C  CE2 . PHE C  1 65  ? 22.964  20.603  8.991   1.00 24.72  ? 65   PHE C CE2 1 
ATOM   8901  C  CZ  . PHE C  1 65  ? 23.199  19.283  9.283   1.00 31.38  ? 65   PHE C CZ  1 
ATOM   8902  N  N   . GLN C  1 66  ? 16.570  19.232  8.133   1.00 20.70  ? 66   GLN C N   1 
ATOM   8903  C  CA  . GLN C  1 66  ? 15.154  19.291  8.420   1.00 23.34  ? 66   GLN C CA  1 
ATOM   8904  C  C   . GLN C  1 66  ? 14.859  19.894  9.790   1.00 23.36  ? 66   GLN C C   1 
ATOM   8905  O  O   . GLN C  1 66  ? 15.770  20.243  10.554  1.00 14.03  ? 66   GLN C O   1 
ATOM   8906  C  CB  . GLN C  1 66  ? 14.538  17.898  8.319   1.00 30.17  ? 66   GLN C CB  1 
ATOM   8907  C  CG  . GLN C  1 66  ? 14.055  17.564  6.941   1.00 34.26  ? 66   GLN C CG  1 
ATOM   8908  C  CD  . GLN C  1 66  ? 12.808  18.328  6.595   1.00 33.12  ? 66   GLN C CD  1 
ATOM   8909  O  OE1 . GLN C  1 66  ? 12.192  18.951  7.460   1.00 27.13  ? 66   GLN C OE1 1 
ATOM   8910  N  NE2 . GLN C  1 66  ? 12.422  18.288  5.324   1.00 35.48  ? 66   GLN C NE2 1 
ATOM   8911  N  N   . ASN C  1 67  ? 13.566  19.997  10.090  1.00 27.88  ? 67   ASN C N   1 
ATOM   8912  C  CA  . ASN C  1 67  ? 13.096  20.550  11.350  1.00 20.44  ? 67   ASN C CA  1 
ATOM   8913  C  C   . ASN C  1 67  ? 13.734  19.873  12.544  1.00 15.68  ? 67   ASN C C   1 
ATOM   8914  O  O   . ASN C  1 67  ? 14.132  18.707  12.465  1.00 17.66  ? 67   ASN C O   1 
ATOM   8915  C  CB  . ASN C  1 67  ? 11.578  20.424  11.423  1.00 16.43  ? 67   ASN C CB  1 
ATOM   8916  C  CG  . ASN C  1 67  ? 10.899  21.093  10.260  1.00 28.59  ? 67   ASN C CG  1 
ATOM   8917  O  OD1 . ASN C  1 67  ? 11.454  22.011  9.647   1.00 31.94  ? 67   ASN C OD1 1 
ATOM   8918  N  ND2 . ASN C  1 67  ? 9.693   20.641  9.938   1.00 38.69  ? 67   ASN C ND2 1 
ATOM   8919  N  N   . VAL C  1 68  ? 13.845  20.614  13.642  1.00 15.60  ? 68   VAL C N   1 
ATOM   8920  C  CA  . VAL C  1 68  ? 14.307  20.054  14.907  1.00 17.53  ? 68   VAL C CA  1 
ATOM   8921  C  C   . VAL C  1 68  ? 13.096  19.557  15.696  1.00 25.09  ? 68   VAL C C   1 
ATOM   8922  O  O   . VAL C  1 68  ? 12.086  20.271  15.789  1.00 30.28  ? 68   VAL C O   1 
ATOM   8923  C  CB  . VAL C  1 68  ? 15.005  21.126  15.751  1.00 17.98  ? 68   VAL C CB  1 
ATOM   8924  C  CG1 . VAL C  1 68  ? 15.325  20.578  17.125  1.00 20.55  ? 68   VAL C CG1 1 
ATOM   8925  C  CG2 . VAL C  1 68  ? 16.262  21.625  15.059  1.00 19.01  ? 68   VAL C CG2 1 
ATOM   8926  N  N   . CYS C  1 69  ? 13.185  18.349  16.256  1.00 21.39  ? 69   CYS C N   1 
ATOM   8927  C  CA  . CYS C  1 69  ? 12.103  17.823  17.095  1.00 10.91  ? 69   CYS C CA  1 
ATOM   8928  C  C   . CYS C  1 69  ? 11.610  18.817  18.156  1.00 27.11  ? 69   CYS C C   1 
ATOM   8929  O  O   . CYS C  1 69  ? 12.416  19.392  18.908  1.00 18.64  ? 69   CYS C O   1 
ATOM   8930  C  CB  . CYS C  1 69  ? 12.496  16.495  17.721  1.00 10.49  ? 69   CYS C CB  1 
ATOM   8931  S  SG  . CYS C  1 69  ? 12.643  15.210  16.480  1.00 32.79  ? 69   CYS C SG  1 
ATOM   8932  N  N   . TYR C  1 70  ? 10.284  19.017  18.197  1.00 28.10  ? 70   TYR C N   1 
ATOM   8933  C  CA  . TYR C  1 70  ? 9.703   20.087  18.991  1.00 21.73  ? 70   TYR C CA  1 
ATOM   8934  C  C   . TYR C  1 70  ? 10.122  19.965  20.429  1.00 30.13  ? 70   TYR C C   1 
ATOM   8935  O  O   . TYR C  1 70  ? 9.859   18.957  21.070  1.00 39.05  ? 70   TYR C O   1 
ATOM   8936  C  CB  . TYR C  1 70  ? 8.190   20.124  18.905  1.00 16.56  ? 70   TYR C CB  1 
ATOM   8937  C  CG  . TYR C  1 70  ? 7.694   21.519  19.170  1.00 21.87  ? 70   TYR C CG  1 
ATOM   8938  C  CD1 . TYR C  1 70  ? 7.508   21.978  20.460  1.00 13.43  ? 70   TYR C CD1 1 
ATOM   8939  C  CD2 . TYR C  1 70  ? 7.480   22.402  18.122  1.00 13.70  ? 70   TYR C CD2 1 
ATOM   8940  C  CE1 . TYR C  1 70  ? 7.094   23.264  20.695  1.00 27.16  ? 70   TYR C CE1 1 
ATOM   8941  C  CE2 . TYR C  1 70  ? 7.067   23.681  18.341  1.00 17.88  ? 70   TYR C CE2 1 
ATOM   8942  C  CZ  . TYR C  1 70  ? 6.868   24.116  19.629  1.00 25.32  ? 70   TYR C CZ  1 
ATOM   8943  O  OH  . TYR C  1 70  ? 6.440   25.410  19.839  1.00 26.71  ? 70   TYR C OH  1 
ATOM   8944  N  N   . GLN C  1 71  ? 10.782  20.998  20.934  1.00 25.32  ? 71   GLN C N   1 
ATOM   8945  C  CA  . GLN C  1 71  ? 11.439  20.879  22.213  1.00 17.33  ? 71   GLN C CA  1 
ATOM   8946  C  C   . GLN C  1 71  ? 11.504  22.182  23.001  1.00 22.68  ? 71   GLN C C   1 
ATOM   8947  O  O   . GLN C  1 71  ? 11.198  23.259  22.490  1.00 20.59  ? 71   GLN C O   1 
ATOM   8948  C  CB  . GLN C  1 71  ? 12.850  20.356  21.979  1.00 17.03  ? 71   GLN C CB  1 
ATOM   8949  C  CG  . GLN C  1 71  ? 13.687  21.215  21.051  1.00 21.94  ? 71   GLN C CG  1 
ATOM   8950  C  CD  . GLN C  1 71  ? 15.166  20.855  21.099  1.00 24.13  ? 71   GLN C CD  1 
ATOM   8951  O  OE1 . GLN C  1 71  ? 15.957  21.531  21.761  1.00 23.14  ? 71   GLN C OE1 1 
ATOM   8952  N  NE2 . GLN C  1 71  ? 15.546  19.788  20.394  1.00 10.81  ? 71   GLN C NE2 1 
ATOM   8953  N  N   . TYR C  1 72  ? 11.903  22.050  24.261  1.00 25.77  ? 72   TYR C N   1 
ATOM   8954  C  CA  . TYR C  1 72  ? 12.281  23.164  25.128  1.00 29.35  ? 72   TYR C CA  1 
ATOM   8955  C  C   . TYR C  1 72  ? 13.561  23.881  24.659  1.00 23.80  ? 72   TYR C C   1 
ATOM   8956  O  O   . TYR C  1 72  ? 14.477  23.266  24.086  1.00 12.41  ? 72   TYR C O   1 
ATOM   8957  C  CB  . TYR C  1 72  ? 12.468  22.631  26.558  1.00 34.46  ? 72   TYR C CB  1 
ATOM   8958  C  CG  . TYR C  1 72  ? 12.864  23.663  27.597  1.00 32.29  ? 72   TYR C CG  1 
ATOM   8959  C  CD1 . TYR C  1 72  ? 11.884  24.376  28.315  1.00 21.85  ? 72   TYR C CD1 1 
ATOM   8960  C  CD2 . TYR C  1 72  ? 14.216  23.913  27.875  1.00 26.96  ? 72   TYR C CD2 1 
ATOM   8961  C  CE1 . TYR C  1 72  ? 12.239  25.319  29.271  1.00 25.80  ? 72   TYR C CE1 1 
ATOM   8962  C  CE2 . TYR C  1 72  ? 14.590  24.853  28.829  1.00 35.02  ? 72   TYR C CE2 1 
ATOM   8963  C  CZ  . TYR C  1 72  ? 13.600  25.559  29.533  1.00 36.65  ? 72   TYR C CZ  1 
ATOM   8964  O  OH  . TYR C  1 72  ? 13.976  26.499  30.486  1.00 34.43  ? 72   TYR C OH  1 
ATOM   8965  N  N   . VAL C  1 73  ? 13.599  25.189  24.909  1.00 17.72  ? 73   VAL C N   1 
ATOM   8966  C  CA  . VAL C  1 73  ? 14.716  26.052  24.537  1.00 13.92  ? 73   VAL C CA  1 
ATOM   8967  C  C   . VAL C  1 73  ? 15.328  26.738  25.758  1.00 25.46  ? 73   VAL C C   1 
ATOM   8968  O  O   . VAL C  1 73  ? 14.651  27.433  26.502  1.00 22.64  ? 73   VAL C O   1 
ATOM   8969  C  CB  . VAL C  1 73  ? 14.282  27.114  23.501  1.00 22.10  ? 73   VAL C CB  1 
ATOM   8970  C  CG1 . VAL C  1 73  ? 15.353  28.142  23.302  1.00 15.06  ? 73   VAL C CG1 1 
ATOM   8971  C  CG2 . VAL C  1 73  ? 13.968  26.453  22.185  1.00 21.75  ? 73   VAL C CG2 1 
ATOM   8972  N  N   . ASP C  1 74  ? 16.624  26.523  25.950  1.00 34.46  ? 74   ASP C N   1 
ATOM   8973  C  CA  . ASP C  1 74  ? 17.365  27.047  27.088  1.00 35.78  ? 74   ASP C CA  1 
ATOM   8974  C  C   . ASP C  1 74  ? 17.320  28.569  27.082  1.00 31.92  ? 74   ASP C C   1 
ATOM   8975  O  O   . ASP C  1 74  ? 17.731  29.213  26.121  1.00 32.58  ? 74   ASP C O   1 
ATOM   8976  C  CB  . ASP C  1 74  ? 18.807  26.549  26.992  1.00 44.41  ? 74   ASP C CB  1 
ATOM   8977  C  CG  . ASP C  1 74  ? 19.663  26.934  28.189  1.00 49.63  ? 74   ASP C CG  1 
ATOM   8978  O  OD1 . ASP C  1 74  ? 19.742  28.135  28.564  1.00 52.14  ? 74   ASP C OD1 1 
ATOM   8979  O  OD2 . ASP C  1 74  ? 20.293  26.008  28.737  1.00 48.58  ? 74   ASP C OD2 1 
ATOM   8980  N  N   . THR C  1 75  ? 16.826  29.145  28.170  1.00 29.80  ? 75   THR C N   1 
ATOM   8981  C  CA  . THR C  1 75  ? 16.643  30.593  28.250  1.00 29.98  ? 75   THR C CA  1 
ATOM   8982  C  C   . THR C  1 75  ? 17.519  31.208  29.345  1.00 35.83  ? 75   THR C C   1 
ATOM   8983  O  O   . THR C  1 75  ? 17.308  32.362  29.742  1.00 37.98  ? 75   THR C O   1 
ATOM   8984  C  CB  . THR C  1 75  ? 15.145  30.955  28.480  1.00 51.83  ? 75   THR C CB  1 
ATOM   8985  O  OG1 . THR C  1 75  ? 14.628  30.227  29.606  1.00 54.18  ? 75   THR C OG1 1 
ATOM   8986  C  CG2 . THR C  1 75  ? 14.316  30.604  27.256  1.00 46.89  ? 75   THR C CG2 1 
ATOM   8987  N  N   . LEU C  1 76  ? 18.515  30.443  29.805  1.00 37.22  ? 76   LEU C N   1 
ATOM   8988  C  CA  . LEU C  1 76  ? 19.286  30.808  30.998  1.00 34.17  ? 76   LEU C CA  1 
ATOM   8989  C  C   . LEU C  1 76  ? 20.189  32.013  30.802  1.00 40.84  ? 76   LEU C C   1 
ATOM   8990  O  O   . LEU C  1 76  ? 20.339  32.845  31.702  1.00 46.45  ? 76   LEU C O   1 
ATOM   8991  C  CB  . LEU C  1 76  ? 20.102  29.627  31.535  1.00 23.91  ? 76   LEU C CB  1 
ATOM   8992  C  CG  . LEU C  1 76  ? 20.853  29.878  32.858  1.00 24.03  ? 76   LEU C CG  1 
ATOM   8993  C  CD1 . LEU C  1 76  ? 19.946  30.329  33.985  1.00 19.66  ? 76   LEU C CD1 1 
ATOM   8994  C  CD2 . LEU C  1 76  ? 21.615  28.644  33.287  1.00 26.30  ? 76   LEU C CD2 1 
ATOM   8995  N  N   . TYR C  1 77  ? 20.789  32.121  29.630  1.00 32.46  ? 77   TYR C N   1 
ATOM   8996  C  CA  . TYR C  1 77  ? 21.645  33.258  29.382  1.00 28.25  ? 77   TYR C CA  1 
ATOM   8997  C  C   . TYR C  1 77  ? 21.478  33.694  27.956  1.00 35.27  ? 77   TYR C C   1 
ATOM   8998  O  O   . TYR C  1 77  ? 22.341  33.404  27.129  1.00 37.57  ? 77   TYR C O   1 
ATOM   8999  C  CB  . TYR C  1 77  ? 23.098  32.867  29.604  1.00 32.02  ? 77   TYR C CB  1 
ATOM   9000  C  CG  . TYR C  1 77  ? 23.474  32.620  31.035  1.00 28.13  ? 77   TYR C CG  1 
ATOM   9001  C  CD1 . TYR C  1 77  ? 23.473  33.655  31.949  1.00 33.03  ? 77   TYR C CD1 1 
ATOM   9002  C  CD2 . TYR C  1 77  ? 23.849  31.362  31.470  1.00 25.51  ? 77   TYR C CD2 1 
ATOM   9003  C  CE1 . TYR C  1 77  ? 23.825  33.452  33.263  1.00 31.19  ? 77   TYR C CE1 1 
ATOM   9004  C  CE2 . TYR C  1 77  ? 24.203  31.147  32.784  1.00 30.07  ? 77   TYR C CE2 1 
ATOM   9005  C  CZ  . TYR C  1 77  ? 24.190  32.204  33.675  1.00 32.22  ? 77   TYR C CZ  1 
ATOM   9006  O  OH  . TYR C  1 77  ? 24.536  32.027  34.988  1.00 39.71  ? 77   TYR C OH  1 
ATOM   9007  N  N   . PRO C  1 78  ? 20.365  34.383  27.649  1.00 39.06  ? 78   PRO C N   1 
ATOM   9008  C  CA  . PRO C  1 78  ? 20.045  34.694  26.250  1.00 39.57  ? 78   PRO C CA  1 
ATOM   9009  C  C   . PRO C  1 78  ? 21.179  35.453  25.558  1.00 37.86  ? 78   PRO C C   1 
ATOM   9010  O  O   . PRO C  1 78  ? 21.741  36.376  26.150  1.00 43.89  ? 78   PRO C O   1 
ATOM   9011  C  CB  . PRO C  1 78  ? 18.771  35.546  26.362  1.00 37.55  ? 78   PRO C CB  1 
ATOM   9012  C  CG  . PRO C  1 78  ? 18.131  35.086  27.617  1.00 38.94  ? 78   PRO C CG  1 
ATOM   9013  C  CD  . PRO C  1 78  ? 19.294  34.817  28.560  1.00 40.41  ? 78   PRO C CD  1 
ATOM   9014  N  N   . GLY C  1 79  ? 21.528  35.026  24.343  1.00 27.41  ? 79   GLY C N   1 
ATOM   9015  C  CA  . GLY C  1 79  ? 22.616  35.632  23.595  1.00 37.13  ? 79   GLY C CA  1 
ATOM   9016  C  C   . GLY C  1 79  ? 24.008  35.110  23.929  1.00 41.59  ? 79   GLY C C   1 
ATOM   9017  O  O   . GLY C  1 79  ? 24.985  35.407  23.235  1.00 45.24  ? 79   GLY C O   1 
ATOM   9018  N  N   . PHE C  1 80  ? 24.108  34.342  25.006  1.00 39.33  ? 80   PHE C N   1 
ATOM   9019  C  CA  . PHE C  1 80  ? 25.389  33.800  25.416  1.00 35.41  ? 80   PHE C CA  1 
ATOM   9020  C  C   . PHE C  1 80  ? 25.697  32.549  24.612  1.00 34.44  ? 80   PHE C C   1 
ATOM   9021  O  O   . PHE C  1 80  ? 24.961  31.569  24.658  1.00 36.14  ? 80   PHE C O   1 
ATOM   9022  C  CB  . PHE C  1 80  ? 25.393  33.523  26.921  1.00 32.55  ? 80   PHE C CB  1 
ATOM   9023  C  CG  . PHE C  1 80  ? 26.600  32.788  27.400  1.00 33.36  ? 80   PHE C CG  1 
ATOM   9024  C  CD1 . PHE C  1 80  ? 27.874  33.285  27.157  1.00 28.88  ? 80   PHE C CD1 1 
ATOM   9025  C  CD2 . PHE C  1 80  ? 26.465  31.599  28.100  1.00 41.30  ? 80   PHE C CD2 1 
ATOM   9026  C  CE1 . PHE C  1 80  ? 28.994  32.609  27.594  1.00 29.75  ? 80   PHE C CE1 1 
ATOM   9027  C  CE2 . PHE C  1 80  ? 27.585  30.912  28.546  1.00 46.01  ? 80   PHE C CE2 1 
ATOM   9028  C  CZ  . PHE C  1 80  ? 28.856  31.423  28.288  1.00 39.69  ? 80   PHE C CZ  1 
ATOM   9029  N  N   . GLU C  1 81  ? 26.790  32.595  23.866  1.00 37.23  ? 81   GLU C N   1 
ATOM   9030  C  CA  . GLU C  1 81  ? 27.152  31.492  22.990  1.00 46.68  ? 81   GLU C CA  1 
ATOM   9031  C  C   . GLU C  1 81  ? 27.265  30.149  23.717  1.00 44.69  ? 81   GLU C C   1 
ATOM   9032  O  O   . GLU C  1 81  ? 26.833  29.132  23.193  1.00 47.69  ? 81   GLU C O   1 
ATOM   9033  C  CB  . GLU C  1 81  ? 28.450  31.799  22.244  1.00 58.78  ? 81   GLU C CB  1 
ATOM   9034  C  CG  . GLU C  1 81  ? 28.908  30.667  21.349  1.00 70.80  ? 81   GLU C CG  1 
ATOM   9035  C  CD  . GLU C  1 81  ? 30.412  30.605  21.205  1.00 86.88  ? 81   GLU C CD  1 
ATOM   9036  O  OE1 . GLU C  1 81  ? 31.040  31.682  21.040  1.00 90.08  ? 81   GLU C OE1 1 
ATOM   9037  O  OE2 . GLU C  1 81  ? 30.960  29.476  21.273  1.00 90.70  ? 81   GLU C OE2 1 
ATOM   9038  N  N   . GLY C  1 82  ? 27.832  30.153  24.920  1.00 40.55  ? 82   GLY C N   1 
ATOM   9039  C  CA  . GLY C  1 82  ? 28.039  28.932  25.685  1.00 37.12  ? 82   GLY C CA  1 
ATOM   9040  C  C   . GLY C  1 82  ? 26.794  28.094  25.961  1.00 33.80  ? 82   GLY C C   1 
ATOM   9041  O  O   . GLY C  1 82  ? 26.897  26.870  26.152  1.00 25.98  ? 82   GLY C O   1 
ATOM   9042  N  N   . THR C  1 83  ? 25.623  28.742  26.000  1.00 29.48  ? 83   THR C N   1 
ATOM   9043  C  CA  . THR C  1 83  ? 24.350  28.013  26.092  1.00 24.47  ? 83   THR C CA  1 
ATOM   9044  C  C   . THR C  1 83  ? 23.656  27.939  24.743  1.00 24.59  ? 83   THR C C   1 
ATOM   9045  O  O   . THR C  1 83  ? 22.993  26.949  24.424  1.00 31.98  ? 83   THR C O   1 
ATOM   9046  C  CB  . THR C  1 83  ? 23.350  28.623  27.106  1.00 20.28  ? 83   THR C CB  1 
ATOM   9047  O  OG1 . THR C  1 83  ? 23.142  30.015  26.827  1.00 21.78  ? 83   THR C OG1 1 
ATOM   9048  C  CG2 . THR C  1 83  ? 23.829  28.440  28.542  1.00 19.34  ? 83   THR C CG2 1 
ATOM   9049  N  N   . GLU C  1 84  ? 23.806  28.995  23.954  1.00 21.26  ? 84   GLU C N   1 
ATOM   9050  C  CA  . GLU C  1 84  ? 23.057  29.118  22.717  1.00 23.32  ? 84   GLU C CA  1 
ATOM   9051  C  C   . GLU C  1 84  ? 23.499  28.061  21.720  1.00 24.98  ? 84   GLU C C   1 
ATOM   9052  O  O   . GLU C  1 84  ? 22.700  27.577  20.932  1.00 31.83  ? 84   GLU C O   1 
ATOM   9053  C  CB  . GLU C  1 84  ? 23.237  30.511  22.129  1.00 33.87  ? 84   GLU C CB  1 
ATOM   9054  C  CG  . GLU C  1 84  ? 21.952  31.159  21.655  1.00 39.20  ? 84   GLU C CG  1 
ATOM   9055  C  CD  . GLU C  1 84  ? 21.178  31.811  22.782  1.00 43.76  ? 84   GLU C CD  1 
ATOM   9056  O  OE1 . GLU C  1 84  ? 20.578  31.069  23.584  1.00 53.03  ? 84   GLU C OE1 1 
ATOM   9057  O  OE2 . GLU C  1 84  ? 21.162  33.061  22.867  1.00 37.44  ? 84   GLU C OE2 1 
ATOM   9058  N  N   . MET C  1 85  ? 24.771  27.688  21.772  1.00 28.74  ? 85   MET C N   1 
ATOM   9059  C  CA  . MET C  1 85  ? 25.328  26.693  20.853  1.00 28.23  ? 85   MET C CA  1 
ATOM   9060  C  C   . MET C  1 85  ? 24.589  25.364  20.908  1.00 29.36  ? 85   MET C C   1 
ATOM   9061  O  O   . MET C  1 85  ? 24.706  24.571  19.980  1.00 41.90  ? 85   MET C O   1 
ATOM   9062  C  CB  . MET C  1 85  ? 26.828  26.462  21.110  1.00 22.76  ? 85   MET C CB  1 
ATOM   9063  C  CG  . MET C  1 85  ? 27.137  26.149  22.561  1.00 28.24  ? 85   MET C CG  1 
ATOM   9064  S  SD  . MET C  1 85  ? 28.652  25.259  22.896  1.00 28.75  ? 85   MET C SD  1 
ATOM   9065  C  CE  . MET C  1 85  ? 28.502  23.916  21.751  1.00 31.31  ? 85   MET C CE  1 
ATOM   9066  N  N   . TRP C  1 86  ? 23.847  25.112  21.987  1.00 21.39  ? 86   TRP C N   1 
ATOM   9067  C  CA  . TRP C  1 86  ? 23.082  23.868  22.101  1.00 26.71  ? 86   TRP C CA  1 
ATOM   9068  C  C   . TRP C  1 86  ? 21.607  24.061  21.746  1.00 24.22  ? 86   TRP C C   1 
ATOM   9069  O  O   . TRP C  1 86  ? 20.861  23.087  21.616  1.00 17.73  ? 86   TRP C O   1 
ATOM   9070  C  CB  . TRP C  1 86  ? 23.179  23.274  23.505  1.00 23.25  ? 86   TRP C CB  1 
ATOM   9071  C  CG  . TRP C  1 86  ? 24.542  23.220  24.045  1.00 18.31  ? 86   TRP C CG  1 
ATOM   9072  C  CD1 . TRP C  1 86  ? 25.092  24.051  24.979  1.00 18.84  ? 86   TRP C CD1 1 
ATOM   9073  C  CD2 . TRP C  1 86  ? 25.551  22.270  23.707  1.00 23.50  ? 86   TRP C CD2 1 
ATOM   9074  N  NE1 . TRP C  1 86  ? 26.390  23.681  25.236  1.00 23.75  ? 86   TRP C NE1 1 
ATOM   9075  C  CE2 . TRP C  1 86  ? 26.695  22.585  24.470  1.00 25.32  ? 86   TRP C CE2 1 
ATOM   9076  C  CE3 . TRP C  1 86  ? 25.601  21.175  22.835  1.00 21.62  ? 86   TRP C CE3 1 
ATOM   9077  C  CZ2 . TRP C  1 86  ? 27.881  21.851  24.377  1.00 23.96  ? 86   TRP C CZ2 1 
ATOM   9078  C  CZ3 . TRP C  1 86  ? 26.785  20.443  22.749  1.00 17.39  ? 86   TRP C CZ3 1 
ATOM   9079  C  CH2 . TRP C  1 86  ? 27.905  20.786  23.514  1.00 17.69  ? 86   TRP C CH2 1 
ATOM   9080  N  N   . ASN C  1 87  ? 21.188  25.317  21.619  1.00 24.93  ? 87   ASN C N   1 
ATOM   9081  C  CA  . ASN C  1 87  ? 19.819  25.622  21.212  1.00 33.01  ? 87   ASN C CA  1 
ATOM   9082  C  C   . ASN C  1 87  ? 19.574  25.284  19.743  1.00 33.30  ? 87   ASN C C   1 
ATOM   9083  O  O   . ASN C  1 87  ? 20.502  25.337  18.931  1.00 37.76  ? 87   ASN C O   1 
ATOM   9084  C  CB  . ASN C  1 87  ? 19.471  27.088  21.504  1.00 38.79  ? 87   ASN C CB  1 
ATOM   9085  C  CG  . ASN C  1 87  ? 18.859  27.284  22.889  1.00 42.93  ? 87   ASN C CG  1 
ATOM   9086  O  OD1 . ASN C  1 87  ? 18.126  26.432  23.395  1.00 40.14  ? 87   ASN C OD1 1 
ATOM   9087  N  ND2 . ASN C  1 87  ? 19.161  28.416  23.505  1.00 46.34  ? 87   ASN C ND2 1 
ATOM   9088  N  N   . PRO C  1 88  ? 18.324  24.916  19.411  1.00 26.03  ? 88   PRO C N   1 
ATOM   9089  C  CA  . PRO C  1 88  ? 17.869  24.514  18.076  1.00 24.40  ? 88   PRO C CA  1 
ATOM   9090  C  C   . PRO C  1 88  ? 18.292  25.486  16.996  1.00 25.51  ? 88   PRO C C   1 
ATOM   9091  O  O   . PRO C  1 88  ? 18.289  26.679  17.260  1.00 36.61  ? 88   PRO C O   1 
ATOM   9092  C  CB  . PRO C  1 88  ? 16.346  24.584  18.205  1.00 30.30  ? 88   PRO C CB  1 
ATOM   9093  C  CG  . PRO C  1 88  ? 16.082  24.273  19.618  1.00 33.49  ? 88   PRO C CG  1 
ATOM   9094  C  CD  . PRO C  1 88  ? 17.237  24.824  20.404  1.00 31.20  ? 88   PRO C CD  1 
ATOM   9095  N  N   . ASN C  1 89  ? 18.623  24.999  15.802  1.00 24.05  ? 89   ASN C N   1 
ATOM   9096  C  CA  . ASN C  1 89  ? 18.944  25.903  14.695  1.00 25.23  ? 89   ASN C CA  1 
ATOM   9097  C  C   . ASN C  1 89  ? 18.110  25.711  13.438  1.00 29.50  ? 89   ASN C C   1 
ATOM   9098  O  O   . ASN C  1 89  ? 18.539  26.077  12.356  1.00 41.26  ? 89   ASN C O   1 
ATOM   9099  C  CB  . ASN C  1 89  ? 20.440  25.884  14.341  1.00 23.68  ? 89   ASN C CB  1 
ATOM   9100  C  CG  . ASN C  1 89  ? 20.948  24.502  13.962  1.00 28.95  ? 89   ASN C CG  1 
ATOM   9101  O  OD1 . ASN C  1 89  ? 20.176  23.598  13.628  1.00 24.26  ? 89   ASN C OD1 1 
ATOM   9102  N  ND2 . ASN C  1 89  ? 22.272  24.332  14.021  1.00 35.87  ? 89   ASN C ND2 1 
ATOM   9103  N  N   . ARG C  1 90  ? 16.925  25.137  13.586  1.00 25.74  ? 90   ARG C N   1 
ATOM   9104  C  CA  . ARG C  1 90  ? 15.988  24.965  12.482  1.00 25.05  ? 90   ARG C CA  1 
ATOM   9105  C  C   . ARG C  1 90  ? 14.569  24.957  13.065  1.00 23.50  ? 90   ARG C C   1 
ATOM   9106  O  O   . ARG C  1 90  ? 14.373  24.570  14.223  1.00 17.58  ? 90   ARG C O   1 
ATOM   9107  C  CB  . ARG C  1 90  ? 16.250  23.642  11.745  1.00 27.04  ? 90   ARG C CB  1 
ATOM   9108  C  CG  . ARG C  1 90  ? 17.533  23.551  10.922  1.00 29.22  ? 90   ARG C CG  1 
ATOM   9109  C  CD  . ARG C  1 90  ? 17.521  24.515  9.756   1.00 32.15  ? 90   ARG C CD  1 
ATOM   9110  N  NE  . ARG C  1 90  ? 18.638  24.314  8.834   1.00 35.61  ? 90   ARG C NE  1 
ATOM   9111  C  CZ  . ARG C  1 90  ? 19.879  24.748  9.048   1.00 33.51  ? 90   ARG C CZ  1 
ATOM   9112  N  NH1 . ARG C  1 90  ? 20.170  25.383  10.175  1.00 22.52  ? 90   ARG C NH1 1 
ATOM   9113  N  NH2 . ARG C  1 90  ? 20.834  24.541  8.139   1.00 35.17  ? 90   ARG C NH2 1 
ATOM   9114  N  N   . GLU C  1 91  ? 13.593  25.375  12.259  1.00 22.68  ? 91   GLU C N   1 
ATOM   9115  C  CA  . GLU C  1 91  ? 12.177  25.420  12.661  1.00 30.25  ? 91   GLU C CA  1 
ATOM   9116  C  C   . GLU C  1 91  ? 11.728  24.226  13.533  1.00 34.86  ? 91   GLU C C   1 
ATOM   9117  O  O   . GLU C  1 91  ? 11.976  23.068  13.199  1.00 34.96  ? 91   GLU C O   1 
ATOM   9118  C  CB  . GLU C  1 91  ? 11.297  25.581  11.412  1.00 32.28  ? 91   GLU C CB  1 
ATOM   9119  C  CG  . GLU C  1 91  ? 9.886   25.038  11.529  1.00 43.36  ? 91   GLU C CG  1 
ATOM   9120  C  CD  . GLU C  1 91  ? 9.027   25.343  10.303  1.00 53.72  ? 91   GLU C CD  1 
ATOM   9121  O  OE1 . GLU C  1 91  ? 9.174   26.449  9.736   1.00 58.58  ? 91   GLU C OE1 1 
ATOM   9122  O  OE2 . GLU C  1 91  ? 8.197   24.482  9.918   1.00 54.71  ? 91   GLU C OE2 1 
ATOM   9123  N  N   . LEU C  1 92  ? 11.118  24.507  14.679  1.00 14.00  ? 92   LEU C N   1 
ATOM   9124  C  CA  . LEU C  1 92  ? 10.757  23.428  15.576  1.00 13.39  ? 92   LEU C CA  1 
ATOM   9125  C  C   . LEU C  1 92  ? 9.496   22.824  15.047  1.00 30.88  ? 92   LEU C C   1 
ATOM   9126  O  O   . LEU C  1 92  ? 8.528   23.550  14.787  1.00 40.74  ? 92   LEU C O   1 
ATOM   9127  C  CB  . LEU C  1 92  ? 10.468  23.932  16.989  1.00 13.49  ? 92   LEU C CB  1 
ATOM   9128  C  CG  . LEU C  1 92  ? 11.571  24.474  17.884  1.00 24.13  ? 92   LEU C CG  1 
ATOM   9129  C  CD1 . LEU C  1 92  ? 10.989  24.655  19.275  1.00 31.14  ? 92   LEU C CD1 1 
ATOM   9130  C  CD2 . LEU C  1 92  ? 12.799  23.567  17.913  1.00 21.07  ? 92   LEU C CD2 1 
ATOM   9131  N  N   . SER C  1 93  ? 9.476   21.504  14.908  1.00 19.97  ? 93   SER C N   1 
ATOM   9132  C  CA  . SER C  1 93  ? 8.226   20.837  14.558  1.00 23.41  ? 93   SER C CA  1 
ATOM   9133  C  C   . SER C  1 93  ? 8.155   19.404  15.066  1.00 21.30  ? 93   SER C C   1 
ATOM   9134  O  O   . SER C  1 93  ? 9.174   18.809  15.390  1.00 26.75  ? 93   SER C O   1 
ATOM   9135  C  CB  . SER C  1 93  ? 8.014   20.883  13.051  1.00 27.53  ? 93   SER C CB  1 
ATOM   9136  O  OG  . SER C  1 93  ? 7.248   19.781  12.624  1.00 27.90  ? 93   SER C OG  1 
ATOM   9137  N  N   . GLU C  1 94  ? 6.945   18.862  15.156  1.00 17.98  ? 94   GLU C N   1 
ATOM   9138  C  CA  . GLU C  1 94  ? 6.778   17.456  15.493  1.00 12.73  ? 94   GLU C CA  1 
ATOM   9139  C  C   . GLU C  1 94  ? 7.181   16.591  14.302  1.00 23.69  ? 94   GLU C C   1 
ATOM   9140  O  O   . GLU C  1 94  ? 7.507   15.421  14.468  1.00 20.68  ? 94   GLU C O   1 
ATOM   9141  C  CB  . GLU C  1 94  ? 5.331   17.156  15.921  1.00 13.28  ? 94   GLU C CB  1 
ATOM   9142  C  CG  . GLU C  1 94  ? 5.010   17.419  17.393  1.00 13.33  ? 94   GLU C CG  1 
ATOM   9143  C  CD  . GLU C  1 94  ? 3.509   17.447  17.687  1.00 19.38  ? 94   GLU C CD  1 
ATOM   9144  O  OE1 . GLU C  1 94  ? 2.886   18.527  17.562  1.00 16.65  ? 94   GLU C OE1 1 
ATOM   9145  O  OE2 . GLU C  1 94  ? 2.951   16.399  18.061  1.00 16.57  ? 94   GLU C OE2 1 
ATOM   9146  N  N   . ASP C  1 95  ? 7.153   17.178  13.106  1.00 13.02  ? 95   ASP C N   1 
ATOM   9147  C  CA  . ASP C  1 95  ? 7.623   16.530  11.885  1.00 29.41  ? 95   ASP C CA  1 
ATOM   9148  C  C   . ASP C  1 95  ? 9.129   16.736  11.781  1.00 35.24  ? 95   ASP C C   1 
ATOM   9149  O  O   . ASP C  1 95  ? 9.589   17.778  11.327  1.00 35.49  ? 95   ASP C O   1 
ATOM   9150  C  CB  . ASP C  1 95  ? 6.950   17.151  10.680  1.00 13.81  ? 95   ASP C CB  1 
ATOM   9151  C  CG  . ASP C  1 95  ? 7.304   16.455  9.400   1.00 32.10  ? 95   ASP C CG  1 
ATOM   9152  O  OD1 . ASP C  1 95  ? 7.809   15.321  9.448   1.00 28.44  ? 95   ASP C OD1 1 
ATOM   9153  O  OD2 . ASP C  1 95  ? 7.075   17.039  8.331   1.00 38.06  ? 95   ASP C OD2 1 
ATOM   9154  N  N   . CYS C  1 96  ? 9.898   15.736  12.187  1.00 12.08  ? 96   CYS C N   1 
ATOM   9155  C  CA  . CYS C  1 96  ? 11.256  15.995  12.558  1.00 16.62  ? 96   CYS C CA  1 
ATOM   9156  C  C   . CYS C  1 96  ? 12.136  14.741  12.487  1.00 20.86  ? 96   CYS C C   1 
ATOM   9157  O  O   . CYS C  1 96  ? 13.390  14.818  12.599  1.00 12.68  ? 96   CYS C O   1 
ATOM   9158  C  CB  . CYS C  1 96  ? 11.244  16.561  13.967  1.00 14.77  ? 96   CYS C CB  1 
ATOM   9159  S  SG  . CYS C  1 96  ? 10.980  15.333  15.262  1.00 14.74  ? 96   CYS C SG  1 
ATOM   9160  N  N   . LEU C  1 97  ? 11.479  13.594  12.302  1.00 15.91  ? 97   LEU C N   1 
ATOM   9161  C  CA  . LEU C  1 97  ? 12.190  12.332  12.184  1.00 18.93  ? 97   LEU C CA  1 
ATOM   9162  C  C   . LEU C  1 97  ? 12.836  12.212  10.814  1.00 24.88  ? 97   LEU C C   1 
ATOM   9163  O  O   . LEU C  1 97  ? 12.261  11.603  9.885   1.00 19.14  ? 97   LEU C O   1 
ATOM   9164  C  CB  . LEU C  1 97  ? 11.272  11.152  12.449  1.00 11.46  ? 97   LEU C CB  1 
ATOM   9165  C  CG  . LEU C  1 97  ? 10.796  11.029  13.884  1.00 15.61  ? 97   LEU C CG  1 
ATOM   9166  C  CD1 . LEU C  1 97  ? 10.452  9.604   14.129  1.00 19.11  ? 97   LEU C CD1 1 
ATOM   9167  C  CD2 . LEU C  1 97  ? 11.875  11.455  14.839  1.00 23.31  ? 97   LEU C CD2 1 
ATOM   9168  N  N   . TYR C  1 98  ? 14.027  12.814  10.711  1.00 21.54  ? 98   TYR C N   1 
ATOM   9169  C  CA  . TYR C  1 98  ? 14.845  12.802  9.508   1.00 12.93  ? 98   TYR C CA  1 
ATOM   9170  C  C   . TYR C  1 98  ? 16.239  12.516  9.955   1.00 16.92  ? 98   TYR C C   1 
ATOM   9171  O  O   . TYR C  1 98  ? 16.559  12.719  11.123  1.00 22.96  ? 98   TYR C O   1 
ATOM   9172  C  CB  . TYR C  1 98  ? 14.818  14.168  8.813   1.00 17.54  ? 98   TYR C CB  1 
ATOM   9173  C  CG  . TYR C  1 98  ? 13.448  14.550  8.337   1.00 15.23  ? 98   TYR C CG  1 
ATOM   9174  C  CD1 . TYR C  1 98  ? 12.556  15.160  9.196   1.00 12.52  ? 98   TYR C CD1 1 
ATOM   9175  C  CD2 . TYR C  1 98  ? 13.026  14.255  7.050   1.00 15.27  ? 98   TYR C CD2 1 
ATOM   9176  C  CE1 . TYR C  1 98  ? 11.273  15.487  8.797   1.00 32.80  ? 98   TYR C CE1 1 
ATOM   9177  C  CE2 . TYR C  1 98  ? 11.740  14.582  6.633   1.00 27.39  ? 98   TYR C CE2 1 
ATOM   9178  C  CZ  . TYR C  1 98  ? 10.864  15.206  7.520   1.00 31.45  ? 98   TYR C CZ  1 
ATOM   9179  O  OH  . TYR C  1 98  ? 9.577   15.558  7.153   1.00 36.21  ? 98   TYR C OH  1 
ATOM   9180  N  N   . LEU C  1 99  ? 17.076  12.051  9.031   1.00 22.99  ? 99   LEU C N   1 
ATOM   9181  C  CA  . LEU C  1 99  ? 18.490  11.803  9.324   1.00 19.07  ? 99   LEU C CA  1 
ATOM   9182  C  C   . LEU C  1 99  ? 19.398  12.360  8.245   1.00 23.04  ? 99   LEU C C   1 
ATOM   9183  O  O   . LEU C  1 99  ? 18.932  12.758  7.168   1.00 26.67  ? 99   LEU C O   1 
ATOM   9184  C  CB  . LEU C  1 99  ? 18.762  10.318  9.545   1.00 21.66  ? 99   LEU C CB  1 
ATOM   9185  C  CG  . LEU C  1 99  ? 18.380  9.318   8.465   1.00 12.90  ? 99   LEU C CG  1 
ATOM   9186  C  CD1 . LEU C  1 99  ? 19.481  9.176   7.452   1.00 17.88  ? 99   LEU C CD1 1 
ATOM   9187  C  CD2 . LEU C  1 99  ? 18.064  7.988   9.112   1.00 43.85  ? 99   LEU C CD2 1 
ATOM   9188  N  N   . ASN C  1 100 ? 20.691  12.381  8.556   1.00 13.12  ? 100  ASN C N   1 
ATOM   9189  C  CA  . ASN C  1 100 ? 21.714  12.991  7.722   1.00 24.80  ? 100  ASN C CA  1 
ATOM   9190  C  C   . ASN C  1 100 ? 22.865  12.037  7.526   1.00 25.01  ? 100  ASN C C   1 
ATOM   9191  O  O   . ASN C  1 100 ? 23.234  11.344  8.475   1.00 21.59  ? 100  ASN C O   1 
ATOM   9192  C  CB  . ASN C  1 100 ? 22.262  14.220  8.426   1.00 24.25  ? 100  ASN C CB  1 
ATOM   9193  C  CG  . ASN C  1 100 ? 21.178  15.094  8.973   1.00 21.75  ? 100  ASN C CG  1 
ATOM   9194  O  OD1 . ASN C  1 100 ? 20.383  15.655  8.219   1.00 21.61  ? 100  ASN C OD1 1 
ATOM   9195  N  ND2 . ASN C  1 100 ? 21.132  15.224  10.291  1.00 20.12  ? 100  ASN C ND2 1 
ATOM   9196  N  N   . VAL C  1 101 ? 23.442  12.025  6.318   1.00 28.37  ? 101  VAL C N   1 
ATOM   9197  C  CA  . VAL C  1 101 ? 24.666  11.263  6.006   1.00 27.02  ? 101  VAL C CA  1 
ATOM   9198  C  C   . VAL C  1 101 ? 25.793  12.091  5.376   1.00 25.45  ? 101  VAL C C   1 
ATOM   9199  O  O   . VAL C  1 101 ? 25.572  12.792  4.412   1.00 33.12  ? 101  VAL C O   1 
ATOM   9200  C  CB  . VAL C  1 101 ? 24.386  10.145  5.010   1.00 23.84  ? 101  VAL C CB  1 
ATOM   9201  C  CG1 . VAL C  1 101 ? 25.512  9.166   5.068   1.00 17.05  ? 101  VAL C CG1 1 
ATOM   9202  C  CG2 . VAL C  1 101 ? 23.078  9.476   5.311   1.00 15.79  ? 101  VAL C CG2 1 
ATOM   9203  N  N   . TRP C  1 102 ? 27.005  11.995  5.901   1.00 25.56  ? 102  TRP C N   1 
ATOM   9204  C  CA  . TRP C  1 102 ? 28.178  12.612  5.272   1.00 23.15  ? 102  TRP C CA  1 
ATOM   9205  C  C   . TRP C  1 102 ? 29.137  11.528  4.822   1.00 22.28  ? 102  TRP C C   1 
ATOM   9206  O  O   . TRP C  1 102 ? 29.546  10.702  5.632   1.00 23.20  ? 102  TRP C O   1 
ATOM   9207  C  CB  . TRP C  1 102 ? 28.950  13.432  6.281   1.00 23.84  ? 102  TRP C CB  1 
ATOM   9208  C  CG  . TRP C  1 102 ? 28.347  14.715  6.697   1.00 26.83  ? 102  TRP C CG  1 
ATOM   9209  C  CD1 . TRP C  1 102 ? 28.522  15.931  6.105   1.00 34.16  ? 102  TRP C CD1 1 
ATOM   9210  C  CD2 . TRP C  1 102 ? 27.531  14.942  7.846   1.00 19.39  ? 102  TRP C CD2 1 
ATOM   9211  N  NE1 . TRP C  1 102 ? 27.854  16.900  6.807   1.00 17.52  ? 102  TRP C NE1 1 
ATOM   9212  C  CE2 . TRP C  1 102 ? 27.231  16.318  7.880   1.00 20.57  ? 102  TRP C CE2 1 
ATOM   9213  C  CE3 . TRP C  1 102 ? 27.019  14.114  8.850   1.00 24.78  ? 102  TRP C CE3 1 
ATOM   9214  C  CZ2 . TRP C  1 102 ? 26.427  16.887  8.872   1.00 25.23  ? 102  TRP C CZ2 1 
ATOM   9215  C  CZ3 . TRP C  1 102 ? 26.228  14.679  9.840   1.00 29.43  ? 102  TRP C CZ3 1 
ATOM   9216  C  CH2 . TRP C  1 102 ? 25.941  16.054  9.843   1.00 29.66  ? 102  TRP C CH2 1 
ATOM   9217  N  N   . THR C  1 103 ? 29.513  11.526  3.548   1.00 23.45  ? 103  THR C N   1 
ATOM   9218  C  CA  . THR C  1 103 ? 30.545  10.608  3.058   1.00 28.15  ? 103  THR C CA  1 
ATOM   9219  C  C   . THR C  1 103 ? 31.624  11.406  2.339   1.00 29.27  ? 103  THR C C   1 
ATOM   9220  O  O   . THR C  1 103 ? 31.410  12.565  2.028   1.00 28.26  ? 103  THR C O   1 
ATOM   9221  C  CB  . THR C  1 103 ? 29.986  9.627   2.038   1.00 27.94  ? 103  THR C CB  1 
ATOM   9222  O  OG1 . THR C  1 103 ? 29.969  10.265  0.759   1.00 31.13  ? 103  THR C OG1 1 
ATOM   9223  C  CG2 . THR C  1 103 ? 28.594  9.180   2.423   1.00 32.56  ? 103  THR C CG2 1 
ATOM   9224  N  N   . PRO C  1 104 ? 32.787  10.794  2.071   1.00 27.79  ? 104  PRO C N   1 
ATOM   9225  C  CA  . PRO C  1 104 ? 33.792  11.515  1.286   1.00 30.66  ? 104  PRO C CA  1 
ATOM   9226  C  C   . PRO C  1 104 ? 33.287  11.844  -0.117  1.00 38.60  ? 104  PRO C C   1 
ATOM   9227  O  O   . PRO C  1 104 ? 32.336  11.198  -0.558  1.00 25.49  ? 104  PRO C O   1 
ATOM   9228  C  CB  . PRO C  1 104 ? 34.942  10.515  1.205   1.00 34.27  ? 104  PRO C CB  1 
ATOM   9229  C  CG  . PRO C  1 104 ? 34.791  9.670   2.413   1.00 31.88  ? 104  PRO C CG  1 
ATOM   9230  C  CD  . PRO C  1 104 ? 33.318  9.538   2.625   1.00 24.02  ? 104  PRO C CD  1 
ATOM   9231  N  N   . TYR C  1 105 ? 33.890  12.846  -0.768  1.00 45.47  ? 105  TYR C N   1 
ATOM   9232  C  CA  . TYR C  1 105 ? 33.606  13.204  -2.162  1.00 27.94  ? 105  TYR C CA  1 
ATOM   9233  C  C   . TYR C  1 105 ? 34.914  13.131  -2.929  1.00 33.26  ? 105  TYR C C   1 
ATOM   9234  O  O   . TYR C  1 105 ? 35.825  13.923  -2.684  1.00 40.02  ? 105  TYR C O   1 
ATOM   9235  C  CB  . TYR C  1 105 ? 33.026  14.619  -2.284  1.00 39.86  ? 105  TYR C CB  1 
ATOM   9236  C  CG  . TYR C  1 105 ? 32.540  14.997  -3.680  1.00 28.47  ? 105  TYR C CG  1 
ATOM   9237  C  CD1 . TYR C  1 105 ? 33.432  15.351  -4.680  1.00 30.26  ? 105  TYR C CD1 1 
ATOM   9238  C  CD2 . TYR C  1 105 ? 31.187  15.018  -3.985  1.00 45.53  ? 105  TYR C CD2 1 
ATOM   9239  C  CE1 . TYR C  1 105 ? 32.999  15.691  -5.952  1.00 51.71  ? 105  TYR C CE1 1 
ATOM   9240  C  CE2 . TYR C  1 105 ? 30.738  15.361  -5.250  1.00 48.67  ? 105  TYR C CE2 1 
ATOM   9241  C  CZ  . TYR C  1 105 ? 31.649  15.695  -6.238  1.00 53.30  ? 105  TYR C CZ  1 
ATOM   9242  O  OH  . TYR C  1 105 ? 31.207  16.032  -7.512  1.00 54.45  ? 105  TYR C OH  1 
ATOM   9243  N  N   . PRO C  1 106 ? 35.013  12.201  -3.885  1.00 31.61  ? 106  PRO C N   1 
ATOM   9244  C  CA  . PRO C  1 106 ? 33.942  11.323  -4.345  1.00 33.95  ? 106  PRO C CA  1 
ATOM   9245  C  C   . PRO C  1 106 ? 33.667  10.223  -3.352  1.00 43.45  ? 106  PRO C C   1 
ATOM   9246  O  O   . PRO C  1 106 ? 34.530  9.939   -2.501  1.00 29.26  ? 106  PRO C O   1 
ATOM   9247  C  CB  . PRO C  1 106 ? 34.536  10.707  -5.600  1.00 32.16  ? 106  PRO C CB  1 
ATOM   9248  C  CG  . PRO C  1 106 ? 35.972  10.647  -5.319  1.00 40.03  ? 106  PRO C CG  1 
ATOM   9249  C  CD  . PRO C  1 106 ? 36.283  11.902  -4.563  1.00 40.38  ? 106  PRO C CD  1 
ATOM   9250  N  N   . ARG C  1 107 ? 32.476  9.633   -3.465  1.00 50.70  ? 107  ARG C N   1 
ATOM   9251  C  CA  . ARG C  1 107 ? 32.055  8.535   -2.602  1.00 54.76  ? 107  ARG C CA  1 
ATOM   9252  C  C   . ARG C  1 107 ? 33.051  7.378   -2.666  1.00 56.31  ? 107  ARG C C   1 
ATOM   9253  O  O   . ARG C  1 107 ? 33.655  7.126   -3.706  1.00 57.43  ? 107  ARG C O   1 
ATOM   9254  C  CB  . ARG C  1 107 ? 30.640  8.075   -2.970  1.00 55.23  ? 107  ARG C CB  1 
ATOM   9255  C  CG  . ARG C  1 107 ? 29.571  8.587   -2.014  1.00 52.37  ? 107  ARG C CG  1 
ATOM   9256  C  CD  . ARG C  1 107 ? 28.610  9.595   -2.672  1.00 53.07  ? 107  ARG C CD  1 
ATOM   9257  N  NE  . ARG C  1 107 ? 27.847  9.069   -3.814  1.00 59.78  ? 107  ARG C NE  1 
ATOM   9258  C  CZ  . ARG C  1 107 ? 27.158  7.920   -3.838  1.00 60.98  ? 107  ARG C CZ  1 
ATOM   9259  N  NH1 . ARG C  1 107 ? 27.121  7.114   -2.778  1.00 66.52  ? 107  ARG C NH1 1 
ATOM   9260  N  NH2 . ARG C  1 107 ? 26.501  7.562   -4.940  1.00 51.36  ? 107  ARG C NH2 1 
ATOM   9261  N  N   . PRO C  1 108 ? 33.230  6.674   -1.543  1.00 55.90  ? 108  PRO C N   1 
ATOM   9262  C  CA  . PRO C  1 108 ? 34.253  5.627   -1.462  1.00 55.73  ? 108  PRO C CA  1 
ATOM   9263  C  C   . PRO C  1 108 ? 33.940  4.408   -2.335  1.00 50.44  ? 108  PRO C C   1 
ATOM   9264  O  O   . PRO C  1 108 ? 32.801  3.920   -2.360  1.00 47.89  ? 108  PRO C O   1 
ATOM   9265  C  CB  . PRO C  1 108 ? 34.201  5.222   0.016   1.00 58.24  ? 108  PRO C CB  1 
ATOM   9266  C  CG  . PRO C  1 108 ? 32.785  5.510   0.440   1.00 48.85  ? 108  PRO C CG  1 
ATOM   9267  C  CD  . PRO C  1 108 ? 32.413  6.753   -0.314  1.00 50.54  ? 108  PRO C CD  1 
ATOM   9268  N  N   . ALA C  1 109 ? 34.940  3.920   -3.055  1.00 39.68  ? 109  ALA C N   1 
ATOM   9269  C  CA  . ALA C  1 109 ? 34.802  2.627   -3.694  1.00 41.52  ? 109  ALA C CA  1 
ATOM   9270  C  C   . ALA C  1 109 ? 35.324  1.679   -2.649  1.00 52.63  ? 109  ALA C C   1 
ATOM   9271  O  O   . ALA C  1 109 ? 36.359  1.965   -2.054  1.00 67.83  ? 109  ALA C O   1 
ATOM   9272  C  CB  . ALA C  1 109 ? 35.638  2.567   -4.922  1.00 49.11  ? 109  ALA C CB  1 
ATOM   9273  N  N   . SER C  1 110 ? 34.603  0.581   -2.414  1.00 54.10  ? 110  SER C N   1 
ATOM   9274  C  CA  . SER C  1 110 ? 34.828  -0.326  -1.263  1.00 59.01  ? 110  SER C CA  1 
ATOM   9275  C  C   . SER C  1 110 ? 34.199  0.168   0.060   1.00 57.26  ? 110  SER C C   1 
ATOM   9276  O  O   . SER C  1 110 ? 34.358  1.332   0.436   1.00 57.78  ? 110  SER C O   1 
ATOM   9277  C  CB  . SER C  1 110 ? 36.313  -0.669  -1.048  1.00 53.47  ? 110  SER C CB  1 
ATOM   9278  O  OG  . SER C  1 110 ? 36.747  -0.170  0.206   1.00 49.63  ? 110  SER C OG  1 
ATOM   9279  N  N   . PRO C  1 111 ? 33.515  -0.737  0.784   1.00 53.71  ? 111  PRO C N   1 
ATOM   9280  C  CA  . PRO C  1 111 ? 32.717  -0.424  1.977   1.00 54.03  ? 111  PRO C CA  1 
ATOM   9281  C  C   . PRO C  1 111 ? 33.514  0.244   3.096   1.00 52.63  ? 111  PRO C C   1 
ATOM   9282  O  O   . PRO C  1 111 ? 34.679  -0.096  3.324   1.00 49.41  ? 111  PRO C O   1 
ATOM   9283  C  CB  . PRO C  1 111 ? 32.228  -1.800  2.433   1.00 53.71  ? 111  PRO C CB  1 
ATOM   9284  C  CG  . PRO C  1 111 ? 33.253  -2.742  1.917   1.00 55.55  ? 111  PRO C CG  1 
ATOM   9285  C  CD  . PRO C  1 111 ? 33.612  -2.190  0.575   1.00 53.76  ? 111  PRO C CD  1 
ATOM   9286  N  N   . THR C  1 112 ? 32.869  1.180   3.786   1.00 50.19  ? 112  THR C N   1 
ATOM   9287  C  CA  . THR C  1 112 ? 33.527  1.988   4.802   1.00 46.76  ? 112  THR C CA  1 
ATOM   9288  C  C   . THR C  1 112 ? 32.772  1.881   6.108   1.00 44.79  ? 112  THR C C   1 
ATOM   9289  O  O   . THR C  1 112 ? 31.546  1.865   6.111   1.00 43.02  ? 112  THR C O   1 
ATOM   9290  C  CB  . THR C  1 112 ? 33.540  3.462   4.400   1.00 41.96  ? 112  THR C CB  1 
ATOM   9291  O  OG1 . THR C  1 112 ? 33.697  3.568   2.983   1.00 45.98  ? 112  THR C OG1 1 
ATOM   9292  C  CG2 . THR C  1 112 ? 34.665  4.193   5.085   1.00 40.77  ? 112  THR C CG2 1 
ATOM   9293  N  N   . PRO C  1 113 ? 33.506  1.802   7.224   1.00 45.09  ? 113  PRO C N   1 
ATOM   9294  C  CA  . PRO C  1 113 ? 32.929  1.742   8.566   1.00 40.95  ? 113  PRO C CA  1 
ATOM   9295  C  C   . PRO C  1 113 ? 32.090  2.963   8.855   1.00 31.19  ? 113  PRO C C   1 
ATOM   9296  O  O   . PRO C  1 113 ? 32.522  4.072   8.548   1.00 24.47  ? 113  PRO C O   1 
ATOM   9297  C  CB  . PRO C  1 113 ? 34.157  1.741   9.460   1.00 48.01  ? 113  PRO C CB  1 
ATOM   9298  C  CG  . PRO C  1 113 ? 35.192  1.076   8.637   1.00 54.48  ? 113  PRO C CG  1 
ATOM   9299  C  CD  . PRO C  1 113 ? 34.957  1.560   7.249   1.00 52.80  ? 113  PRO C CD  1 
ATOM   9300  N  N   . VAL C  1 114 ? 30.913  2.747   9.442   1.00 29.59  ? 114  VAL C N   1 
ATOM   9301  C  CA  . VAL C  1 114 ? 29.946  3.809   9.662   1.00 18.51  ? 114  VAL C CA  1 
ATOM   9302  C  C   . VAL C  1 114 ? 29.938  4.253   11.117  1.00 18.35  ? 114  VAL C C   1 
ATOM   9303  O  O   . VAL C  1 114 ? 29.980  3.426   12.021  1.00 19.43  ? 114  VAL C O   1 
ATOM   9304  C  CB  . VAL C  1 114 ? 28.544  3.354   9.264   1.00 17.94  ? 114  VAL C CB  1 
ATOM   9305  C  CG1 . VAL C  1 114 ? 27.575  4.525   9.253   1.00 47.64  ? 114  VAL C CG1 1 
ATOM   9306  C  CG2 . VAL C  1 114 ? 28.563  2.731   7.913   1.00 20.06  ? 114  VAL C CG2 1 
ATOM   9307  N  N   . LEU C  1 115 ? 29.905  5.565   11.329  1.00 17.19  ? 115  LEU C N   1 
ATOM   9308  C  CA  . LEU C  1 115 ? 29.786  6.145   12.657  1.00 16.43  ? 115  LEU C CA  1 
ATOM   9309  C  C   . LEU C  1 115 ? 28.440  6.800   12.762  1.00 35.34  ? 115  LEU C C   1 
ATOM   9310  O  O   . LEU C  1 115 ? 28.110  7.671   11.971  1.00 33.59  ? 115  LEU C O   1 
ATOM   9311  C  CB  . LEU C  1 115 ? 30.851  7.208   12.885  1.00 16.85  ? 115  LEU C CB  1 
ATOM   9312  C  CG  . LEU C  1 115 ? 32.262  6.663   13.093  1.00 26.22  ? 115  LEU C CG  1 
ATOM   9313  C  CD1 . LEU C  1 115 ? 33.249  7.749   13.439  1.00 20.95  ? 115  LEU C CD1 1 
ATOM   9314  C  CD2 . LEU C  1 115 ? 32.191  5.680   14.209  1.00 32.90  ? 115  LEU C CD2 1 
ATOM   9315  N  N   . ILE C  1 116 ? 27.661  6.378   13.741  1.00 14.68  ? 116  ILE C N   1 
ATOM   9316  C  CA  . ILE C  1 116 ? 26.377  6.991   14.006  1.00 22.74  ? 116  ILE C CA  1 
ATOM   9317  C  C   . ILE C  1 116 ? 26.447  7.802   15.306  1.00 24.73  ? 116  ILE C C   1 
ATOM   9318  O  O   . ILE C  1 116 ? 26.677  7.250   16.391  1.00 28.40  ? 116  ILE C O   1 
ATOM   9319  C  CB  . ILE C  1 116 ? 25.259  5.920   14.131  1.00 26.48  ? 116  ILE C CB  1 
ATOM   9320  C  CG1 . ILE C  1 116 ? 25.281  4.955   12.939  1.00 20.95  ? 116  ILE C CG1 1 
ATOM   9321  C  CG2 . ILE C  1 116 ? 23.894  6.562   14.307  1.00 12.66  ? 116  ILE C CG2 1 
ATOM   9322  C  CD1 . ILE C  1 116 ? 24.011  4.130   12.832  1.00 25.53  ? 116  ILE C CD1 1 
ATOM   9323  N  N   . TRP C  1 117 ? 26.256  9.112   15.195  1.00 18.35  ? 117  TRP C N   1 
ATOM   9324  C  CA  . TRP C  1 117 ? 26.121  9.962   16.367  1.00 12.56  ? 117  TRP C CA  1 
ATOM   9325  C  C   . TRP C  1 117 ? 24.672  9.959   16.877  1.00 25.01  ? 117  TRP C C   1 
ATOM   9326  O  O   . TRP C  1 117 ? 23.728  10.038  16.088  1.00 11.59  ? 117  TRP C O   1 
ATOM   9327  C  CB  . TRP C  1 117 ? 26.550  11.371  16.005  1.00 12.78  ? 117  TRP C CB  1 
ATOM   9328  C  CG  . TRP C  1 117 ? 26.325  12.381  17.049  1.00 26.60  ? 117  TRP C CG  1 
ATOM   9329  C  CD1 . TRP C  1 117 ? 25.343  13.314  17.075  1.00 23.92  ? 117  TRP C CD1 1 
ATOM   9330  C  CD2 . TRP C  1 117 ? 27.114  12.595  18.219  1.00 33.70  ? 117  TRP C CD2 1 
ATOM   9331  N  NE1 . TRP C  1 117 ? 25.458  14.091  18.193  1.00 29.47  ? 117  TRP C NE1 1 
ATOM   9332  C  CE2 . TRP C  1 117 ? 26.545  13.670  18.913  1.00 34.80  ? 117  TRP C CE2 1 
ATOM   9333  C  CE3 . TRP C  1 117 ? 28.236  11.972  18.756  1.00 13.17  ? 117  TRP C CE3 1 
ATOM   9334  C  CZ2 . TRP C  1 117 ? 27.066  14.137  20.117  1.00 37.88  ? 117  TRP C CZ2 1 
ATOM   9335  C  CZ3 . TRP C  1 117 ? 28.747  12.435  19.956  1.00 13.33  ? 117  TRP C CZ3 1 
ATOM   9336  C  CH2 . TRP C  1 117 ? 28.168  13.504  20.620  1.00 34.97  ? 117  TRP C CH2 1 
ATOM   9337  N  N   . ILE C  1 118 ? 24.506  9.816   18.190  1.00 17.09  ? 118  ILE C N   1 
ATOM   9338  C  CA  . ILE C  1 118 ? 23.232  10.084  18.826  1.00 17.16  ? 118  ILE C CA  1 
ATOM   9339  C  C   . ILE C  1 118 ? 23.476  11.249  19.760  1.00 22.64  ? 118  ILE C C   1 
ATOM   9340  O  O   . ILE C  1 118 ? 24.375  11.183  20.599  1.00 28.47  ? 118  ILE C O   1 
ATOM   9341  C  CB  . ILE C  1 118 ? 22.675  8.894   19.640  1.00 23.11  ? 118  ILE C CB  1 
ATOM   9342  C  CG1 . ILE C  1 118 ? 22.594  7.624   18.800  1.00 24.85  ? 118  ILE C CG1 1 
ATOM   9343  C  CG2 . ILE C  1 118 ? 21.277  9.209   20.171  1.00 10.33  ? 118  ILE C CG2 1 
ATOM   9344  C  CD1 . ILE C  1 118 ? 21.760  6.534   19.454  1.00 21.64  ? 118  ILE C CD1 1 
ATOM   9345  N  N   . TYR C  1 119 ? 22.687  12.315  19.603  1.00 20.59  ? 119  TYR C N   1 
ATOM   9346  C  CA  . TYR C  1 119 ? 22.876  13.524  20.390  1.00 15.95  ? 119  TYR C CA  1 
ATOM   9347  C  C   . TYR C  1 119 ? 22.338  13.383  21.804  1.00 12.81  ? 119  TYR C C   1 
ATOM   9348  O  O   . TYR C  1 119 ? 21.677  12.414  22.108  1.00 22.23  ? 119  TYR C O   1 
ATOM   9349  C  CB  . TYR C  1 119 ? 22.297  14.759  19.692  1.00 16.91  ? 119  TYR C CB  1 
ATOM   9350  C  CG  . TYR C  1 119 ? 20.817  14.728  19.403  1.00 18.49  ? 119  TYR C CG  1 
ATOM   9351  C  CD1 . TYR C  1 119 ? 19.876  14.846  20.420  1.00 20.37  ? 119  TYR C CD1 1 
ATOM   9352  C  CD2 . TYR C  1 119 ? 20.363  14.638  18.102  1.00 21.84  ? 119  TYR C CD2 1 
ATOM   9353  C  CE1 . TYR C  1 119 ? 18.526  14.838  20.144  1.00 26.07  ? 119  TYR C CE1 1 
ATOM   9354  C  CE2 . TYR C  1 119 ? 19.014  14.629  17.810  1.00 29.68  ? 119  TYR C CE2 1 
ATOM   9355  C  CZ  . TYR C  1 119 ? 18.092  14.724  18.831  1.00 30.03  ? 119  TYR C CZ  1 
ATOM   9356  O  OH  . TYR C  1 119 ? 16.740  14.707  18.519  1.00 27.50  ? 119  TYR C OH  1 
ATOM   9357  N  N   . GLY C  1 120 ? 22.666  14.351  22.655  1.00 16.20  ? 120  GLY C N   1 
ATOM   9358  C  CA  . GLY C  1 120 ? 22.259  14.398  24.043  1.00 10.55  ? 120  GLY C CA  1 
ATOM   9359  C  C   . GLY C  1 120 ? 21.476  15.690  24.224  1.00 30.99  ? 120  GLY C C   1 
ATOM   9360  O  O   . GLY C  1 120 ? 21.107  16.330  23.231  1.00 29.03  ? 120  GLY C O   1 
ATOM   9361  N  N   . GLY C  1 121 ? 21.209  16.073  25.472  1.00 25.21  ? 121  GLY C N   1 
ATOM   9362  C  CA  . GLY C  1 121 ? 20.285  17.158  25.759  1.00 22.20  ? 121  GLY C CA  1 
ATOM   9363  C  C   . GLY C  1 121 ? 19.150  16.663  26.646  1.00 34.00  ? 121  GLY C C   1 
ATOM   9364  O  O   . GLY C  1 121 ? 17.986  17.041  26.466  1.00 38.80  ? 121  GLY C O   1 
ATOM   9365  N  N   . GLY C  1 122 ? 19.496  15.777  27.581  1.00 33.09  ? 122  GLY C N   1 
ATOM   9366  C  CA  . GLY C  1 122 ? 18.618  15.361  28.669  1.00 26.74  ? 122  GLY C CA  1 
ATOM   9367  C  C   . GLY C  1 122 ? 17.299  14.719  28.304  1.00 25.25  ? 122  GLY C C   1 
ATOM   9368  O  O   . GLY C  1 122 ? 16.390  14.645  29.131  1.00 31.94  ? 122  GLY C O   1 
ATOM   9369  N  N   . PHE C  1 123 ? 17.205  14.254  27.065  1.00 19.63  ? 123  PHE C N   1 
ATOM   9370  C  CA  . PHE C  1 123 ? 15.968  13.709  26.517  1.00 14.66  ? 123  PHE C CA  1 
ATOM   9371  C  C   . PHE C  1 123 ? 14.869  14.772  26.405  1.00 25.86  ? 123  PHE C C   1 
ATOM   9372  O  O   . PHE C  1 123 ? 13.684  14.446  26.270  1.00 35.13  ? 123  PHE C O   1 
ATOM   9373  C  CB  . PHE C  1 123 ? 15.492  12.500  27.328  1.00 14.52  ? 123  PHE C CB  1 
ATOM   9374  C  CG  . PHE C  1 123 ? 16.486  11.374  27.376  1.00 26.88  ? 123  PHE C CG  1 
ATOM   9375  C  CD1 . PHE C  1 123 ? 16.762  10.623  26.245  1.00 30.87  ? 123  PHE C CD1 1 
ATOM   9376  C  CD2 . PHE C  1 123 ? 17.143  11.053  28.548  1.00 24.80  ? 123  PHE C CD2 1 
ATOM   9377  C  CE1 . PHE C  1 123 ? 17.695  9.587   26.284  1.00 23.43  ? 123  PHE C CE1 1 
ATOM   9378  C  CE2 . PHE C  1 123 ? 18.061  10.013  28.582  1.00 21.34  ? 123  PHE C CE2 1 
ATOM   9379  C  CZ  . PHE C  1 123 ? 18.330  9.285   27.449  1.00 10.30  ? 123  PHE C CZ  1 
ATOM   9380  N  N   . TYR C  1 124 ? 15.254  16.044  26.447  1.00 20.89  ? 124  TYR C N   1 
ATOM   9381  C  CA  . TYR C  1 124 ? 14.271  17.115  26.321  1.00 17.04  ? 124  TYR C CA  1 
ATOM   9382  C  C   . TYR C  1 124 ? 14.693  18.121  25.291  1.00 18.79  ? 124  TYR C C   1 
ATOM   9383  O  O   . TYR C  1 124 ? 14.015  19.124  25.107  1.00 11.00  ? 124  TYR C O   1 
ATOM   9384  C  CB  . TYR C  1 124 ? 14.066  17.847  27.650  1.00 18.65  ? 124  TYR C CB  1 
ATOM   9385  C  CG  . TYR C  1 124 ? 15.224  18.715  28.078  1.00 19.23  ? 124  TYR C CG  1 
ATOM   9386  C  CD1 . TYR C  1 124 ? 16.294  18.183  28.779  1.00 14.28  ? 124  TYR C CD1 1 
ATOM   9387  C  CD2 . TYR C  1 124 ? 15.239  20.065  27.801  1.00 20.12  ? 124  TYR C CD2 1 
ATOM   9388  C  CE1 . TYR C  1 124 ? 17.343  18.967  29.171  1.00 17.92  ? 124  TYR C CE1 1 
ATOM   9389  C  CE2 . TYR C  1 124 ? 16.307  20.860  28.186  1.00 25.59  ? 124  TYR C CE2 1 
ATOM   9390  C  CZ  . TYR C  1 124 ? 17.357  20.308  28.868  1.00 24.66  ? 124  TYR C CZ  1 
ATOM   9391  O  OH  . TYR C  1 124 ? 18.423  21.105  29.252  1.00 28.04  ? 124  TYR C OH  1 
ATOM   9392  N  N   . SER C  1 125 ? 15.839  17.875  24.655  1.00 21.49  ? 125  SER C N   1 
ATOM   9393  C  CA  . SER C  1 125 ? 16.422  18.816  23.691  1.00 16.10  ? 125  SER C CA  1 
ATOM   9394  C  C   . SER C  1 125 ? 17.400  18.100  22.807  1.00 17.66  ? 125  SER C C   1 
ATOM   9395  O  O   . SER C  1 125 ? 17.537  16.889  22.907  1.00 19.18  ? 125  SER C O   1 
ATOM   9396  C  CB  . SER C  1 125 ? 17.148  19.964  24.400  1.00 15.67  ? 125  SER C CB  1 
ATOM   9397  O  OG  . SER C  1 125 ? 17.898  19.494  25.501  1.00 18.68  ? 125  SER C OG  1 
ATOM   9398  N  N   . GLY C  1 126 ? 18.100  18.861  21.963  1.00 24.09  ? 126  GLY C N   1 
ATOM   9399  C  CA  . GLY C  1 126 ? 19.091  18.312  21.054  1.00 17.31  ? 126  GLY C CA  1 
ATOM   9400  C  C   . GLY C  1 126 ? 18.600  18.406  19.629  1.00 14.59  ? 126  GLY C C   1 
ATOM   9401  O  O   . GLY C  1 126 ? 17.467  18.816  19.409  1.00 26.20  ? 126  GLY C O   1 
ATOM   9402  N  N   . ALA C  1 127 ? 19.432  17.970  18.686  1.00 12.97  ? 127  ALA C N   1 
ATOM   9403  C  CA  . ALA C  1 127 ? 19.253  18.178  17.251  1.00 10.86  ? 127  ALA C CA  1 
ATOM   9404  C  C   . ALA C  1 127 ? 20.514  17.709  16.502  1.00 26.10  ? 127  ALA C C   1 
ATOM   9405  O  O   . ALA C  1 127 ? 21.643  18.049  16.888  1.00 24.32  ? 127  ALA C O   1 
ATOM   9406  C  CB  . ALA C  1 127 ? 19.009  19.642  16.961  1.00 11.28  ? 127  ALA C CB  1 
ATOM   9407  N  N   . ALA C  1 128 ? 20.339  16.950  15.424  1.00 22.39  ? 128  ALA C N   1 
ATOM   9408  C  CA  . ALA C  1 128 ? 21.479  16.510  14.623  1.00 21.72  ? 128  ALA C CA  1 
ATOM   9409  C  C   . ALA C  1 128 ? 22.174  17.673  13.889  1.00 28.84  ? 128  ALA C C   1 
ATOM   9410  O  O   . ALA C  1 128 ? 23.331  17.561  13.455  1.00 29.48  ? 128  ALA C O   1 
ATOM   9411  C  CB  . ALA C  1 128 ? 21.035  15.462  13.636  1.00 18.40  ? 128  ALA C CB  1 
ATOM   9412  N  N   . SER C  1 129 ? 21.463  18.790  13.757  1.00 25.85  ? 129  SER C N   1 
ATOM   9413  C  CA  . SER C  1 129 ? 21.896  19.882  12.893  1.00 20.48  ? 129  SER C CA  1 
ATOM   9414  C  C   . SER C  1 129 ? 22.779  20.914  13.565  1.00 25.33  ? 129  SER C C   1 
ATOM   9415  O  O   . SER C  1 129 ? 23.231  21.845  12.915  1.00 34.05  ? 129  SER C O   1 
ATOM   9416  C  CB  . SER C  1 129 ? 20.674  20.570  12.304  1.00 22.05  ? 129  SER C CB  1 
ATOM   9417  O  OG  . SER C  1 129 ? 19.738  20.807  13.325  1.00 28.01  ? 129  SER C OG  1 
ATOM   9418  N  N   . LEU C  1 130 ? 23.021  20.760  14.863  1.00 26.80  ? 130  LEU C N   1 
ATOM   9419  C  CA  . LEU C  1 130 ? 23.974  21.611  15.584  1.00 22.36  ? 130  LEU C CA  1 
ATOM   9420  C  C   . LEU C  1 130 ? 25.384  21.572  14.988  1.00 24.41  ? 130  LEU C C   1 
ATOM   9421  O  O   . LEU C  1 130 ? 25.860  20.530  14.538  1.00 24.04  ? 130  LEU C O   1 
ATOM   9422  C  CB  . LEU C  1 130 ? 24.036  21.214  17.056  1.00 21.15  ? 130  LEU C CB  1 
ATOM   9423  C  CG  . LEU C  1 130 ? 22.683  21.236  17.762  1.00 19.46  ? 130  LEU C CG  1 
ATOM   9424  C  CD1 . LEU C  1 130 ? 22.882  20.929  19.224  1.00 21.73  ? 130  LEU C CD1 1 
ATOM   9425  C  CD2 . LEU C  1 130 ? 22.034  22.588  17.585  1.00 16.90  ? 130  LEU C CD2 1 
ATOM   9426  N  N   . ASP C  1 131 ? 26.053  22.716  14.997  1.00 15.08  ? 131  ASP C N   1 
ATOM   9427  C  CA  . ASP C  1 131 ? 27.331  22.838  14.324  1.00 22.18  ? 131  ASP C CA  1 
ATOM   9428  C  C   . ASP C  1 131 ? 28.419  21.972  14.960  1.00 32.11  ? 131  ASP C C   1 
ATOM   9429  O  O   . ASP C  1 131 ? 29.380  21.571  14.302  1.00 34.22  ? 131  ASP C O   1 
ATOM   9430  C  CB  . ASP C  1 131 ? 27.748  24.302  14.269  1.00 23.77  ? 131  ASP C CB  1 
ATOM   9431  C  CG  . ASP C  1 131 ? 26.762  25.153  13.499  1.00 27.39  ? 131  ASP C CG  1 
ATOM   9432  O  OD1 . ASP C  1 131 ? 25.943  24.584  12.735  1.00 31.91  ? 131  ASP C OD1 1 
ATOM   9433  O  OD2 . ASP C  1 131 ? 26.811  26.390  13.651  1.00 25.15  ? 131  ASP C OD2 1 
ATOM   9434  N  N   . VAL C  1 132 ? 28.247  21.665  16.238  1.00 36.21  ? 132  VAL C N   1 
ATOM   9435  C  CA  . VAL C  1 132 ? 29.194  20.828  16.962  1.00 31.27  ? 132  VAL C CA  1 
ATOM   9436  C  C   . VAL C  1 132 ? 29.167  19.387  16.486  1.00 36.32  ? 132  VAL C C   1 
ATOM   9437  O  O   . VAL C  1 132 ? 30.107  18.642  16.722  1.00 54.03  ? 132  VAL C O   1 
ATOM   9438  C  CB  . VAL C  1 132 ? 28.884  20.840  18.448  1.00 29.74  ? 132  VAL C CB  1 
ATOM   9439  C  CG1 . VAL C  1 132 ? 30.164  20.963  19.227  1.00 37.79  ? 132  VAL C CG1 1 
ATOM   9440  C  CG2 . VAL C  1 132 ? 27.984  22.013  18.760  1.00 35.59  ? 132  VAL C CG2 1 
ATOM   9441  N  N   . TYR C  1 133 ? 28.087  18.996  15.816  1.00 28.95  ? 133  TYR C N   1 
ATOM   9442  C  CA  . TYR C  1 133 ? 27.919  17.622  15.340  1.00 20.62  ? 133  TYR C CA  1 
ATOM   9443  C  C   . TYR C  1 133 ? 28.072  17.514  13.823  1.00 20.22  ? 133  TYR C C   1 
ATOM   9444  O  O   . TYR C  1 133 ? 27.593  16.553  13.223  1.00 15.82  ? 133  TYR C O   1 
ATOM   9445  C  CB  . TYR C  1 133 ? 26.543  17.088  15.735  1.00 26.21  ? 133  TYR C CB  1 
ATOM   9446  C  CG  . TYR C  1 133 ? 26.157  17.263  17.194  1.00 28.69  ? 133  TYR C CG  1 
ATOM   9447  C  CD1 . TYR C  1 133 ? 27.113  17.197  18.197  1.00 28.15  ? 133  TYR C CD1 1 
ATOM   9448  C  CD2 . TYR C  1 133 ? 24.821  17.478  17.563  1.00 22.95  ? 133  TYR C CD2 1 
ATOM   9449  C  CE1 . TYR C  1 133 ? 26.760  17.349  19.516  1.00 31.91  ? 133  TYR C CE1 1 
ATOM   9450  C  CE2 . TYR C  1 133 ? 24.461  17.635  18.885  1.00 11.96  ? 133  TYR C CE2 1 
ATOM   9451  C  CZ  . TYR C  1 133 ? 25.439  17.567  19.855  1.00 31.99  ? 133  TYR C CZ  1 
ATOM   9452  O  OH  . TYR C  1 133 ? 25.118  17.706  21.178  1.00 27.84  ? 133  TYR C OH  1 
ATOM   9453  N  N   . ASP C  1 134 ? 28.725  18.510  13.215  1.00 26.16  ? 134  ASP C N   1 
ATOM   9454  C  CA  . ASP C  1 134 ? 28.999  18.520  11.774  1.00 24.88  ? 134  ASP C CA  1 
ATOM   9455  C  C   . ASP C  1 134 ? 29.967  17.407  11.422  1.00 23.46  ? 134  ASP C C   1 
ATOM   9456  O  O   . ASP C  1 134 ? 31.094  17.367  11.923  1.00 24.26  ? 134  ASP C O   1 
ATOM   9457  C  CB  . ASP C  1 134 ? 29.579  19.869  11.325  1.00 32.54  ? 134  ASP C CB  1 
ATOM   9458  C  CG  . ASP C  1 134 ? 29.458  20.103  9.808   1.00 40.82  ? 134  ASP C CG  1 
ATOM   9459  O  OD1 . ASP C  1 134 ? 29.488  19.124  9.028   1.00 44.96  ? 134  ASP C OD1 1 
ATOM   9460  O  OD2 . ASP C  1 134 ? 29.328  21.280  9.395   1.00 39.26  ? 134  ASP C OD2 1 
ATOM   9461  N  N   . GLY C  1 135 ? 29.517  16.516  10.546  1.00 16.69  ? 135  GLY C N   1 
ATOM   9462  C  CA  . GLY C  1 135 ? 30.262  15.336  10.168  1.00 17.20  ? 135  GLY C CA  1 
ATOM   9463  C  C   . GLY C  1 135 ? 31.201  15.542  8.989   1.00 30.67  ? 135  GLY C C   1 
ATOM   9464  O  O   . GLY C  1 135 ? 31.803  14.594  8.504   1.00 35.93  ? 135  GLY C O   1 
ATOM   9465  N  N   . ARG C  1 136 ? 31.367  16.772  8.526   1.00 29.03  ? 136  ARG C N   1 
ATOM   9466  C  CA  . ARG C  1 136 ? 32.207  16.965  7.353   1.00 33.99  ? 136  ARG C CA  1 
ATOM   9467  C  C   . ARG C  1 136 ? 33.687  16.710  7.617   1.00 34.15  ? 136  ARG C C   1 
ATOM   9468  O  O   . ARG C  1 136 ? 34.411  16.305  6.719   1.00 22.48  ? 136  ARG C O   1 
ATOM   9469  C  CB  . ARG C  1 136 ? 31.981  18.332  6.695   1.00 30.74  ? 136  ARG C CB  1 
ATOM   9470  C  CG  . ARG C  1 136 ? 32.746  19.471  7.297   1.00 26.16  ? 136  ARG C CG  1 
ATOM   9471  C  CD  . ARG C  1 136 ? 31.867  20.698  7.398   1.00 27.15  ? 136  ARG C CD  1 
ATOM   9472  N  NE  . ARG C  1 136 ? 31.863  21.537  6.198   1.00 32.05  ? 136  ARG C NE  1 
ATOM   9473  C  CZ  . ARG C  1 136 ? 30.824  22.288  5.832   1.00 40.81  ? 136  ARG C CZ  1 
ATOM   9474  N  NH1 . ARG C  1 136 ? 29.710  22.267  6.556   1.00 44.75  ? 136  ARG C NH1 1 
ATOM   9475  N  NH2 . ARG C  1 136 ? 30.882  23.038  4.735   1.00 41.93  ? 136  ARG C NH2 1 
ATOM   9476  N  N   . PHE C  1 137 ? 34.142  16.906  8.840   1.00 21.20  ? 137  PHE C N   1 
ATOM   9477  C  CA  . PHE C  1 137 ? 35.573  16.730  9.073   1.00 36.34  ? 137  PHE C CA  1 
ATOM   9478  C  C   . PHE C  1 137 ? 35.973  15.262  9.196   1.00 33.93  ? 137  PHE C C   1 
ATOM   9479  O  O   . PHE C  1 137 ? 37.013  14.862  8.683   1.00 26.99  ? 137  PHE C O   1 
ATOM   9480  C  CB  . PHE C  1 137 ? 36.080  17.542  10.268  1.00 27.54  ? 137  PHE C CB  1 
ATOM   9481  C  CG  . PHE C  1 137 ? 35.621  18.964  10.260  1.00 27.44  ? 137  PHE C CG  1 
ATOM   9482  C  CD1 . PHE C  1 137 ? 36.152  19.870  9.371   1.00 28.93  ? 137  PHE C CD1 1 
ATOM   9483  C  CD2 . PHE C  1 137 ? 34.637  19.397  11.140  1.00 30.07  ? 137  PHE C CD2 1 
ATOM   9484  C  CE1 . PHE C  1 137 ? 35.713  21.186  9.364   1.00 33.38  ? 137  PHE C CE1 1 
ATOM   9485  C  CE2 . PHE C  1 137 ? 34.202  20.713  11.137  1.00 26.69  ? 137  PHE C CE2 1 
ATOM   9486  C  CZ  . PHE C  1 137 ? 34.743  21.604  10.250  1.00 22.44  ? 137  PHE C CZ  1 
ATOM   9487  N  N   . LEU C  1 138 ? 35.149  14.458  9.862   1.00 32.51  ? 138  LEU C N   1 
ATOM   9488  C  CA  . LEU C  1 138 ? 35.458  13.039  10.000  1.00 28.08  ? 138  LEU C CA  1 
ATOM   9489  C  C   . LEU C  1 138 ? 35.362  12.346  8.639   1.00 31.97  ? 138  LEU C C   1 
ATOM   9490  O  O   . LEU C  1 138 ? 36.169  11.466  8.322   1.00 29.15  ? 138  LEU C O   1 
ATOM   9491  C  CB  . LEU C  1 138 ? 34.545  12.379  11.031  1.00 24.54  ? 138  LEU C CB  1 
ATOM   9492  C  CG  . LEU C  1 138 ? 34.831  12.658  12.506  1.00 21.80  ? 138  LEU C CG  1 
ATOM   9493  C  CD1 . LEU C  1 138 ? 33.554  12.635  13.311  1.00 20.48  ? 138  LEU C CD1 1 
ATOM   9494  C  CD2 . LEU C  1 138 ? 35.751  11.617  13.032  1.00 20.43  ? 138  LEU C CD2 1 
ATOM   9495  N  N   . ALA C  1 139 ? 34.390  12.766  7.828   1.00 33.73  ? 139  ALA C N   1 
ATOM   9496  C  CA  . ALA C  1 139 ? 34.267  12.250  6.471   1.00 30.70  ? 139  ALA C CA  1 
ATOM   9497  C  C   . ALA C  1 139 ? 35.450  12.688  5.612   1.00 34.24  ? 139  ALA C C   1 
ATOM   9498  O  O   . ALA C  1 139 ? 36.058  11.858  4.941   1.00 44.43  ? 139  ALA C O   1 
ATOM   9499  C  CB  . ALA C  1 139 ? 32.965  12.674  5.834   1.00 21.40  ? 139  ALA C CB  1 
ATOM   9500  N  N   . GLN C  1 140 ? 35.788  13.975  5.621   1.00 26.99  ? 140  GLN C N   1 
ATOM   9501  C  CA  . GLN C  1 140 ? 36.878  14.423  4.751   1.00 29.19  ? 140  GLN C CA  1 
ATOM   9502  C  C   . GLN C  1 140 ? 38.181  13.781  5.170   1.00 30.30  ? 140  GLN C C   1 
ATOM   9503  O  O   . GLN C  1 140 ? 38.820  13.090  4.379   1.00 32.58  ? 140  GLN C O   1 
ATOM   9504  C  CB  . GLN C  1 140 ? 37.046  15.943  4.748   1.00 27.11  ? 140  GLN C CB  1 
ATOM   9505  C  CG  . GLN C  1 140 ? 37.620  16.495  3.449   1.00 31.47  ? 140  GLN C CG  1 
ATOM   9506  C  CD  . GLN C  1 140 ? 39.104  16.164  3.244   1.00 39.10  ? 140  GLN C CD  1 
ATOM   9507  O  OE1 . GLN C  1 140 ? 39.982  16.621  4.000   1.00 34.35  ? 140  GLN C OE1 1 
ATOM   9508  N  NE2 . GLN C  1 140 ? 39.390  15.380  2.200   1.00 38.05  ? 140  GLN C NE2 1 
ATOM   9509  N  N   . VAL C  1 141 ? 38.556  14.003  6.425   1.00 29.14  ? 141  VAL C N   1 
ATOM   9510  C  CA  . VAL C  1 141 ? 39.857  13.588  6.931   1.00 31.57  ? 141  VAL C CA  1 
ATOM   9511  C  C   . VAL C  1 141 ? 39.981  12.097  7.173   1.00 30.19  ? 141  VAL C C   1 
ATOM   9512  O  O   . VAL C  1 141 ? 40.888  11.457  6.637   1.00 31.66  ? 141  VAL C O   1 
ATOM   9513  C  CB  . VAL C  1 141 ? 40.227  14.314  8.229   1.00 34.91  ? 141  VAL C CB  1 
ATOM   9514  C  CG1 . VAL C  1 141 ? 41.612  13.911  8.651   1.00 42.01  ? 141  VAL C CG1 1 
ATOM   9515  C  CG2 . VAL C  1 141 ? 40.178  15.800  8.024   1.00 39.80  ? 141  VAL C CG2 1 
ATOM   9516  N  N   . GLU C  1 142 ? 39.101  11.533  7.993   1.00 26.29  ? 142  GLU C N   1 
ATOM   9517  C  CA  . GLU C  1 142 ? 39.275  10.130  8.330   1.00 29.05  ? 142  GLU C CA  1 
ATOM   9518  C  C   . GLU C  1 142 ? 38.568  9.191   7.355   1.00 28.35  ? 142  GLU C C   1 
ATOM   9519  O  O   . GLU C  1 142 ? 38.602  7.972   7.513   1.00 31.71  ? 142  GLU C O   1 
ATOM   9520  C  CB  . GLU C  1 142 ? 38.876  9.854   9.774   1.00 25.21  ? 142  GLU C CB  1 
ATOM   9521  C  CG  . GLU C  1 142 ? 39.774  10.504  10.796  1.00 38.02  ? 142  GLU C CG  1 
ATOM   9522  C  CD  . GLU C  1 142 ? 41.242  10.043  10.715  1.00 42.97  ? 142  GLU C CD  1 
ATOM   9523  O  OE1 . GLU C  1 142 ? 41.522  8.888   10.289  1.00 37.32  ? 142  GLU C OE1 1 
ATOM   9524  O  OE2 . GLU C  1 142 ? 42.117  10.858  11.099  1.00 42.42  ? 142  GLU C OE2 1 
ATOM   9525  N  N   . GLY C  1 143 ? 37.944  9.763   6.333   1.00 29.92  ? 143  GLY C N   1 
ATOM   9526  C  CA  . GLY C  1 143 ? 37.220  8.980   5.349   1.00 30.98  ? 143  GLY C CA  1 
ATOM   9527  C  C   . GLY C  1 143 ? 35.985  8.266   5.875   1.00 33.45  ? 143  GLY C C   1 
ATOM   9528  O  O   . GLY C  1 143 ? 35.574  7.264   5.311   1.00 43.33  ? 143  GLY C O   1 
ATOM   9529  N  N   . ALA C  1 144 ? 35.376  8.768   6.940   1.00 23.21  ? 144  ALA C N   1 
ATOM   9530  C  CA  . ALA C  1 144 ? 34.239  8.061   7.517   1.00 39.24  ? 144  ALA C CA  1 
ATOM   9531  C  C   . ALA C  1 144 ? 32.873  8.306   6.847   1.00 32.54  ? 144  ALA C C   1 
ATOM   9532  O  O   . ALA C  1 144 ? 32.670  9.257   6.091   1.00 21.20  ? 144  ALA C O   1 
ATOM   9533  C  CB  . ALA C  1 144 ? 34.159  8.329   8.992   1.00 42.23  ? 144  ALA C CB  1 
ATOM   9534  N  N   . VAL C  1 145 ? 31.939  7.418   7.126   1.00 20.31  ? 145  VAL C N   1 
ATOM   9535  C  CA  . VAL C  1 145 ? 30.578  7.634   6.689   1.00 36.70  ? 145  VAL C CA  1 
ATOM   9536  C  C   . VAL C  1 145 ? 29.755  7.948   7.921   1.00 34.10  ? 145  VAL C C   1 
ATOM   9537  O  O   . VAL C  1 145 ? 29.448  7.069   8.708   1.00 34.56  ? 145  VAL C O   1 
ATOM   9538  C  CB  . VAL C  1 145 ? 30.027  6.408   5.985   1.00 42.25  ? 145  VAL C CB  1 
ATOM   9539  C  CG1 . VAL C  1 145 ? 28.612  6.671   5.482   1.00 19.04  ? 145  VAL C CG1 1 
ATOM   9540  C  CG2 . VAL C  1 145 ? 30.974  6.001   4.856   1.00 21.26  ? 145  VAL C CG2 1 
ATOM   9541  N  N   . LEU C  1 146 ? 29.418  9.216   8.097   1.00 17.62  ? 146  LEU C N   1 
ATOM   9542  C  CA  . LEU C  1 146 ? 28.806  9.649   9.324   1.00 22.83  ? 146  LEU C CA  1 
ATOM   9543  C  C   . LEU C  1 146 ? 27.300  9.874   9.209   1.00 25.23  ? 146  LEU C C   1 
ATOM   9544  O  O   . LEU C  1 146 ? 26.832  10.584  8.333   1.00 30.88  ? 146  LEU C O   1 
ATOM   9545  C  CB  . LEU C  1 146 ? 29.474  10.914  9.782   1.00 16.67  ? 146  LEU C CB  1 
ATOM   9546  C  CG  . LEU C  1 146 ? 29.472  10.889  11.290  1.00 31.33  ? 146  LEU C CG  1 
ATOM   9547  C  CD1 . LEU C  1 146 ? 30.858  11.206  11.760  1.00 32.66  ? 146  LEU C CD1 1 
ATOM   9548  C  CD2 . LEU C  1 146 ? 28.465  11.876  11.804  1.00 26.54  ? 146  LEU C CD2 1 
ATOM   9549  N  N   . VAL C  1 147 ? 26.541  9.269   10.112  1.00 29.77  ? 147  VAL C N   1 
ATOM   9550  C  CA  . VAL C  1 147 ? 25.094  9.379   10.102  1.00 14.19  ? 147  VAL C CA  1 
ATOM   9551  C  C   . VAL C  1 147 ? 24.621  9.959   11.422  1.00 28.22  ? 147  VAL C C   1 
ATOM   9552  O  O   . VAL C  1 147 ? 25.069  9.535   12.486  1.00 23.39  ? 147  VAL C O   1 
ATOM   9553  C  CB  . VAL C  1 147 ? 24.471  8.000   9.914   1.00 14.20  ? 147  VAL C CB  1 
ATOM   9554  C  CG1 . VAL C  1 147 ? 22.964  8.051   9.989   1.00 13.56  ? 147  VAL C CG1 1 
ATOM   9555  C  CG2 . VAL C  1 147 ? 24.927  7.418   8.594   1.00 17.30  ? 147  VAL C CG2 1 
ATOM   9556  N  N   . SER C  1 148 ? 23.735  10.944  11.361  1.00 12.95  ? 148  SER C N   1 
ATOM   9557  C  CA  . SER C  1 148 ? 23.055  11.386  12.572  1.00 16.84  ? 148  SER C CA  1 
ATOM   9558  C  C   . SER C  1 148 ? 21.536  11.437  12.380  1.00 18.65  ? 148  SER C C   1 
ATOM   9559  O  O   . SER C  1 148 ? 21.057  11.773  11.300  1.00 18.55  ? 148  SER C O   1 
ATOM   9560  C  CB  . SER C  1 148 ? 23.571  12.747  12.991  1.00 15.00  ? 148  SER C CB  1 
ATOM   9561  O  OG  . SER C  1 148 ? 23.344  13.710  11.978  1.00 17.68  ? 148  SER C OG  1 
ATOM   9562  N  N   . MET C  1 149 ? 20.769  11.105  13.414  1.00 16.95  ? 149  MET C N   1 
ATOM   9563  C  CA  . MET C  1 149 ? 19.315  11.189  13.282  1.00 21.19  ? 149  MET C CA  1 
ATOM   9564  C  C   . MET C  1 149 ? 18.756  12.115  14.317  1.00 21.10  ? 149  MET C C   1 
ATOM   9565  O  O   . MET C  1 149 ? 19.335  12.283  15.383  1.00 23.75  ? 149  MET C O   1 
ATOM   9566  C  CB  . MET C  1 149 ? 18.636  9.820   13.436  1.00 24.64  ? 149  MET C CB  1 
ATOM   9567  C  CG  . MET C  1 149 ? 18.421  9.397   14.876  1.00 10.62  ? 149  MET C CG  1 
ATOM   9568  S  SD  . MET C  1 149 ? 19.976  9.133   15.770  1.00 28.49  ? 149  MET C SD  1 
ATOM   9569  C  CE  . MET C  1 149 ? 20.407  7.475   15.282  1.00 11.16  ? 149  MET C CE  1 
ATOM   9570  N  N   . ASN C  1 150 ? 17.627  12.726  13.997  1.00 10.60  ? 150  ASN C N   1 
ATOM   9571  C  CA  . ASN C  1 150 ? 16.841  13.389  15.009  1.00 10.32  ? 150  ASN C CA  1 
ATOM   9572  C  C   . ASN C  1 150 ? 15.949  12.346  15.698  1.00 23.37  ? 150  ASN C C   1 
ATOM   9573  O  O   . ASN C  1 150 ? 15.525  11.374  15.077  1.00 20.03  ? 150  ASN C O   1 
ATOM   9574  C  CB  . ASN C  1 150 ? 16.037  14.532  14.391  1.00 11.29  ? 150  ASN C CB  1 
ATOM   9575  C  CG  . ASN C  1 150 ? 16.914  15.719  14.032  1.00 17.70  ? 150  ASN C CG  1 
ATOM   9576  O  OD1 . ASN C  1 150 ? 17.969  15.913  14.627  1.00 29.95  ? 150  ASN C OD1 1 
ATOM   9577  N  ND2 . ASN C  1 150 ? 16.494  16.506  13.053  1.00 12.22  ? 150  ASN C ND2 1 
ATOM   9578  N  N   . TYR C  1 151 ? 15.700  12.509  16.992  1.00 20.84  ? 151  TYR C N   1 
ATOM   9579  C  CA  . TYR C  1 151 ? 14.780  11.613  17.669  1.00 19.16  ? 151  TYR C CA  1 
ATOM   9580  C  C   . TYR C  1 151 ? 13.927  12.443  18.587  1.00 30.24  ? 151  TYR C C   1 
ATOM   9581  O  O   . TYR C  1 151 ? 14.421  13.415  19.161  1.00 33.60  ? 151  TYR C O   1 
ATOM   9582  C  CB  . TYR C  1 151 ? 15.512  10.527  18.451  1.00 9.76   ? 151  TYR C CB  1 
ATOM   9583  C  CG  . TYR C  1 151 ? 16.421  11.018  19.559  1.00 10.46  ? 151  TYR C CG  1 
ATOM   9584  C  CD1 . TYR C  1 151 ? 15.940  11.252  20.841  1.00 13.06  ? 151  TYR C CD1 1 
ATOM   9585  C  CD2 . TYR C  1 151 ? 17.780  11.200  19.331  1.00 14.44  ? 151  TYR C CD2 1 
ATOM   9586  C  CE1 . TYR C  1 151 ? 16.785  11.680  21.852  1.00 21.56  ? 151  TYR C CE1 1 
ATOM   9587  C  CE2 . TYR C  1 151 ? 18.637  11.622  20.328  1.00 13.16  ? 151  TYR C CE2 1 
ATOM   9588  C  CZ  . TYR C  1 151 ? 18.144  11.866  21.581  1.00 23.67  ? 151  TYR C CZ  1 
ATOM   9589  O  OH  . TYR C  1 151 ? 19.014  12.307  22.555  1.00 9.71   ? 151  TYR C OH  1 
ATOM   9590  N  N   . ARG C  1 152 ? 12.656  12.069  18.716  1.00 9.96   ? 152  ARG C N   1 
ATOM   9591  C  CA  . ARG C  1 152 ? 11.735  12.810  19.550  1.00 15.47  ? 152  ARG C CA  1 
ATOM   9592  C  C   . ARG C  1 152 ? 12.204  12.910  20.999  1.00 16.24  ? 152  ARG C C   1 
ATOM   9593  O  O   . ARG C  1 152 ? 12.444  11.896  21.653  1.00 11.58  ? 152  ARG C O   1 
ATOM   9594  C  CB  . ARG C  1 152 ? 10.358  12.161  19.518  1.00 21.55  ? 152  ARG C CB  1 
ATOM   9595  C  CG  . ARG C  1 152 ? 9.612   12.315  18.225  1.00 23.04  ? 152  ARG C CG  1 
ATOM   9596  C  CD  . ARG C  1 152 ? 8.374   11.486  18.268  1.00 11.17  ? 152  ARG C CD  1 
ATOM   9597  N  NE  . ARG C  1 152 ? 8.629   10.120  17.848  1.00 11.19  ? 152  ARG C NE  1 
ATOM   9598  C  CZ  . ARG C  1 152 ? 7.734   9.149   17.958  1.00 23.38  ? 152  ARG C CZ  1 
ATOM   9599  N  NH1 . ARG C  1 152 ? 6.542   9.420   18.476  1.00 20.27  ? 152  ARG C NH1 1 
ATOM   9600  N  NH2 . ARG C  1 152 ? 8.024   7.913   17.562  1.00 18.40  ? 152  ARG C NH2 1 
ATOM   9601  N  N   . VAL C  1 153 ? 12.329  14.139  21.494  1.00 14.41  ? 153  VAL C N   1 
ATOM   9602  C  CA  . VAL C  1 153 ? 12.627  14.376  22.898  1.00 13.50  ? 153  VAL C CA  1 
ATOM   9603  C  C   . VAL C  1 153 ? 11.390  14.919  23.623  1.00 23.77  ? 153  VAL C C   1 
ATOM   9604  O  O   . VAL C  1 153 ? 10.305  15.048  23.022  1.00 14.59  ? 153  VAL C O   1 
ATOM   9605  C  CB  . VAL C  1 153 ? 13.770  15.369  23.045  1.00 9.98   ? 153  VAL C CB  1 
ATOM   9606  C  CG1 . VAL C  1 153 ? 15.036  14.797  22.419  1.00 9.75   ? 153  VAL C CG1 1 
ATOM   9607  C  CG2 . VAL C  1 153 ? 13.396  16.676  22.405  1.00 10.22  ? 153  VAL C CG2 1 
ATOM   9608  N  N   . GLY C  1 154 ? 11.561  15.234  24.909  1.00 25.72  ? 154  GLY C N   1 
ATOM   9609  C  CA  . GLY C  1 154 ? 10.477  15.748  25.733  1.00 11.06  ? 154  GLY C CA  1 
ATOM   9610  C  C   . GLY C  1 154 ? 9.307   14.790  25.862  1.00 13.83  ? 154  GLY C C   1 
ATOM   9611  O  O   . GLY C  1 154 ? 9.489   13.587  25.791  1.00 11.14  ? 154  GLY C O   1 
ATOM   9612  N  N   . THR C  1 155 ? 8.101   15.321  26.051  1.00 13.72  ? 155  THR C N   1 
ATOM   9613  C  CA  . THR C  1 155 ? 6.928   14.459  26.147  1.00 22.21  ? 155  THR C CA  1 
ATOM   9614  C  C   . THR C  1 155 ? 6.732   13.670  24.855  1.00 25.11  ? 155  THR C C   1 
ATOM   9615  O  O   . THR C  1 155 ? 6.424   12.473  24.888  1.00 18.55  ? 155  THR C O   1 
ATOM   9616  C  CB  . THR C  1 155 ? 5.631   15.240  26.459  1.00 22.24  ? 155  THR C CB  1 
ATOM   9617  O  OG1 . THR C  1 155 ? 5.496   16.317  25.541  1.00 17.87  ? 155  THR C OG1 1 
ATOM   9618  C  CG2 . THR C  1 155 ? 5.650   15.800  27.853  1.00 23.61  ? 155  THR C CG2 1 
ATOM   9619  N  N   . PHE C  1 156 ? 6.928   14.347  23.726  1.00 11.94  ? 156  PHE C N   1 
ATOM   9620  C  CA  . PHE C  1 156 ? 6.644   13.768  22.421  1.00 21.35  ? 156  PHE C CA  1 
ATOM   9621  C  C   . PHE C  1 156 ? 7.408   12.480  22.252  1.00 23.83  ? 156  PHE C C   1 
ATOM   9622  O  O   . PHE C  1 156 ? 6.887   11.508  21.696  1.00 22.24  ? 156  PHE C O   1 
ATOM   9623  C  CB  . PHE C  1 156 ? 6.988   14.754  21.306  1.00 11.79  ? 156  PHE C CB  1 
ATOM   9624  C  CG  . PHE C  1 156 ? 6.415   16.112  21.521  1.00 12.25  ? 156  PHE C CG  1 
ATOM   9625  C  CD1 . PHE C  1 156 ? 5.105   16.390  21.152  1.00 22.00  ? 156  PHE C CD1 1 
ATOM   9626  C  CD2 . PHE C  1 156 ? 7.166   17.097  22.135  1.00 12.12  ? 156  PHE C CD2 1 
ATOM   9627  C  CE1 . PHE C  1 156 ? 4.572   17.633  21.374  1.00 25.98  ? 156  PHE C CE1 1 
ATOM   9628  C  CE2 . PHE C  1 156 ? 6.660   18.329  22.352  1.00 12.66  ? 156  PHE C CE2 1 
ATOM   9629  C  CZ  . PHE C  1 156 ? 5.358   18.610  21.975  1.00 30.56  ? 156  PHE C CZ  1 
ATOM   9630  N  N   . GLY C  1 157 ? 8.638   12.484  22.768  1.00 24.57  ? 157  GLY C N   1 
ATOM   9631  C  CA  . GLY C  1 157 ? 9.510   11.335  22.719  1.00 10.72  ? 157  GLY C CA  1 
ATOM   9632  C  C   . GLY C  1 157 ? 9.426   10.355  23.872  1.00 30.72  ? 157  GLY C C   1 
ATOM   9633  O  O   . GLY C  1 157 ? 9.627   9.175   23.638  1.00 28.96  ? 157  GLY C O   1 
ATOM   9634  N  N   . PHE C  1 158 ? 9.141   10.808  25.096  1.00 11.12  ? 158  PHE C N   1 
ATOM   9635  C  CA  . PHE C  1 158 ? 9.252   9.935   26.276  1.00 23.40  ? 158  PHE C CA  1 
ATOM   9636  C  C   . PHE C  1 158 ? 8.122   9.908   27.310  1.00 27.90  ? 158  PHE C C   1 
ATOM   9637  O  O   . PHE C  1 158 ? 8.235   9.240   28.353  1.00 21.17  ? 158  PHE C O   1 
ATOM   9638  C  CB  . PHE C  1 158 ? 10.570  10.199  26.967  1.00 11.01  ? 158  PHE C CB  1 
ATOM   9639  C  CG  . PHE C  1 158 ? 11.723  9.881   26.110  1.00 17.09  ? 158  PHE C CG  1 
ATOM   9640  C  CD1 . PHE C  1 158 ? 12.105  8.573   25.922  1.00 19.06  ? 158  PHE C CD1 1 
ATOM   9641  C  CD2 . PHE C  1 158 ? 12.382  10.878  25.419  1.00 17.69  ? 158  PHE C CD2 1 
ATOM   9642  C  CE1 . PHE C  1 158 ? 13.161  8.273   25.096  1.00 30.42  ? 158  PHE C CE1 1 
ATOM   9643  C  CE2 . PHE C  1 158 ? 13.425  10.581  24.597  1.00 20.20  ? 158  PHE C CE2 1 
ATOM   9644  C  CZ  . PHE C  1 158 ? 13.831  9.285   24.440  1.00 23.42  ? 158  PHE C CZ  1 
ATOM   9645  N  N   . LEU C  1 159 ? 7.037   10.622  27.036  1.00 27.81  ? 159  LEU C N   1 
ATOM   9646  C  CA  . LEU C  1 159 ? 5.873   10.484  27.871  1.00 24.67  ? 159  LEU C CA  1 
ATOM   9647  C  C   . LEU C  1 159 ? 5.424   9.037   27.789  1.00 31.94  ? 159  LEU C C   1 
ATOM   9648  O  O   . LEU C  1 159 ? 5.388   8.447   26.709  1.00 32.66  ? 159  LEU C O   1 
ATOM   9649  C  CB  . LEU C  1 159 ? 4.759   11.395  27.400  1.00 19.04  ? 159  LEU C CB  1 
ATOM   9650  C  CG  . LEU C  1 159 ? 3.617   11.414  28.400  1.00 19.24  ? 159  LEU C CG  1 
ATOM   9651  C  CD1 . LEU C  1 159 ? 3.196   12.829  28.630  1.00 14.93  ? 159  LEU C CD1 1 
ATOM   9652  C  CD2 . LEU C  1 159 ? 2.471   10.576  27.890  1.00 27.30  ? 159  LEU C CD2 1 
ATOM   9653  N  N   . ALA C  1 160 ? 5.093   8.467   28.939  1.00 34.92  ? 160  ALA C N   1 
ATOM   9654  C  CA  . ALA C  1 160 ? 4.709   7.068   29.012  1.00 28.88  ? 160  ALA C CA  1 
ATOM   9655  C  C   . ALA C  1 160 ? 3.553   6.836   29.969  1.00 24.33  ? 160  ALA C C   1 
ATOM   9656  O  O   . ALA C  1 160 ? 3.541   7.354   31.079  1.00 21.07  ? 160  ALA C O   1 
ATOM   9657  C  CB  . ALA C  1 160 ? 5.892   6.231   29.442  1.00 18.40  ? 160  ALA C CB  1 
ATOM   9658  N  N   . LEU C  1 161 ? 2.584   6.051   29.526  1.00 16.28  ? 161  LEU C N   1 
ATOM   9659  C  CA  . LEU C  1 161 ? 1.613   5.431   30.422  1.00 24.13  ? 161  LEU C CA  1 
ATOM   9660  C  C   . LEU C  1 161 ? 1.888   3.960   30.236  1.00 26.70  ? 161  LEU C C   1 
ATOM   9661  O  O   . LEU C  1 161 ? 1.326   3.334   29.330  1.00 27.61  ? 161  LEU C O   1 
ATOM   9662  C  CB  . LEU C  1 161 ? 0.173   5.759   30.016  1.00 18.33  ? 161  LEU C CB  1 
ATOM   9663  C  CG  . LEU C  1 161 ? -0.223  7.213   30.161  1.00 18.39  ? 161  LEU C CG  1 
ATOM   9664  C  CD1 . LEU C  1 161 ? -1.692  7.363   29.945  1.00 83.37  ? 161  LEU C CD1 1 
ATOM   9665  C  CD2 . LEU C  1 161 ? 0.126   7.645   31.533  1.00 18.54  ? 161  LEU C CD2 1 
ATOM   9666  N  N   . PRO C  1 162 ? 2.806   3.413   31.048  1.00 29.69  ? 162  PRO C N   1 
ATOM   9667  C  CA  . PRO C  1 162 ? 3.354   2.101   30.709  1.00 31.71  ? 162  PRO C CA  1 
ATOM   9668  C  C   . PRO C  1 162 ? 2.265   1.043   30.639  1.00 28.49  ? 162  PRO C C   1 
ATOM   9669  O  O   . PRO C  1 162 ? 1.402   0.986   31.508  1.00 23.53  ? 162  PRO C O   1 
ATOM   9670  C  CB  . PRO C  1 162 ? 4.347   1.842   31.837  1.00 17.30  ? 162  PRO C CB  1 
ATOM   9671  C  CG  . PRO C  1 162 ? 4.780   3.182   32.243  1.00 16.69  ? 162  PRO C CG  1 
ATOM   9672  C  CD  . PRO C  1 162 ? 3.553   4.041   32.146  1.00 31.82  ? 162  PRO C CD  1 
ATOM   9673  N  N   . GLY C  1 163 ? 2.277   0.258   29.569  1.00 29.69  ? 163  GLY C N   1 
ATOM   9674  C  CA  . GLY C  1 163 ? 1.289   -0.782  29.403  1.00 32.35  ? 163  GLY C CA  1 
ATOM   9675  C  C   . GLY C  1 163 ? 0.191   -0.408  28.436  1.00 41.55  ? 163  GLY C C   1 
ATOM   9676  O  O   . GLY C  1 163 ? -0.565  -1.273  28.005  1.00 52.95  ? 163  GLY C O   1 
ATOM   9677  N  N   . SER C  1 164 ? 0.080   0.870   28.096  1.00 38.60  ? 164  SER C N   1 
ATOM   9678  C  CA  . SER C  1 164 ? -0.959  1.284   27.158  1.00 39.24  ? 164  SER C CA  1 
ATOM   9679  C  C   . SER C  1 164 ? -0.436  1.237   25.735  1.00 44.99  ? 164  SER C C   1 
ATOM   9680  O  O   . SER C  1 164 ? 0.784   1.338   25.491  1.00 41.42  ? 164  SER C O   1 
ATOM   9681  C  CB  . SER C  1 164 ? -1.467  2.684   27.457  1.00 38.36  ? 164  SER C CB  1 
ATOM   9682  O  OG  . SER C  1 164 ? -0.445  3.629   27.229  1.00 40.45  ? 164  SER C OG  1 
ATOM   9683  N  N   . ARG C  1 165 ? -1.371  1.085   24.800  1.00 40.62  ? 165  ARG C N   1 
ATOM   9684  C  CA  . ARG C  1 165 ? -1.036  0.971   23.393  1.00 32.91  ? 165  ARG C CA  1 
ATOM   9685  C  C   . ARG C  1 165 ? -0.547  2.323   22.867  1.00 32.68  ? 165  ARG C C   1 
ATOM   9686  O  O   . ARG C  1 165 ? 0.426   2.382   22.115  1.00 34.35  ? 165  ARG C O   1 
ATOM   9687  C  CB  . ARG C  1 165 ? -2.250  0.470   22.610  1.00 45.16  ? 165  ARG C CB  1 
ATOM   9688  C  CG  . ARG C  1 165 ? -1.985  0.106   21.147  1.00 65.94  ? 165  ARG C CG  1 
ATOM   9689  C  CD  . ARG C  1 165 ? -3.274  0.181   20.300  1.00 81.77  ? 165  ARG C CD  1 
ATOM   9690  N  NE  . ARG C  1 165 ? -3.822  1.540   20.260  1.00 92.86  ? 165  ARG C NE  1 
ATOM   9691  C  CZ  . ARG C  1 165 ? -3.747  2.364   19.215  1.00 96.71  ? 165  ARG C CZ  1 
ATOM   9692  N  NH1 . ARG C  1 165 ? -3.162  1.970   18.087  1.00 96.18  ? 165  ARG C NH1 1 
ATOM   9693  N  NH2 . ARG C  1 165 ? -4.269  3.586   19.293  1.00 97.44  ? 165  ARG C NH2 1 
ATOM   9694  N  N   . GLU C  1 166 ? -1.185  3.406   23.313  1.00 31.06  ? 166  GLU C N   1 
ATOM   9695  C  CA  . GLU C  1 166 ? -1.018  4.707   22.676  1.00 30.72  ? 166  GLU C CA  1 
ATOM   9696  C  C   . GLU C  1 166 ? 0.111   5.574   23.204  1.00 35.62  ? 166  GLU C C   1 
ATOM   9697  O  O   . GLU C  1 166 ? 0.457   6.571   22.585  1.00 50.24  ? 166  GLU C O   1 
ATOM   9698  C  CB  . GLU C  1 166 ? -2.324  5.490   22.688  1.00 35.70  ? 166  GLU C CB  1 
ATOM   9699  C  CG  . GLU C  1 166 ? -3.546  4.650   22.362  1.00 48.10  ? 166  GLU C CG  1 
ATOM   9700  C  CD  . GLU C  1 166 ? -4.099  3.926   23.596  1.00 72.56  ? 166  GLU C CD  1 
ATOM   9701  O  OE1 . GLU C  1 166 ? -3.296  3.471   24.459  1.00 74.03  ? 166  GLU C OE1 1 
ATOM   9702  O  OE2 . GLU C  1 166 ? -5.344  3.821   23.706  1.00 83.24  ? 166  GLU C OE2 1 
ATOM   9703  N  N   . ALA C  1 167 ? 0.683   5.220   24.342  1.00 28.39  ? 167  ALA C N   1 
ATOM   9704  C  CA  . ALA C  1 167 ? 1.920   5.866   24.780  1.00 15.67  ? 167  ALA C CA  1 
ATOM   9705  C  C   . ALA C  1 167 ? 2.661   4.870   25.610  1.00 22.40  ? 167  ALA C C   1 
ATOM   9706  O  O   . ALA C  1 167 ? 2.586   4.913   26.842  1.00 19.09  ? 167  ALA C O   1 
ATOM   9707  C  CB  . ALA C  1 167 ? 1.674   7.116   25.590  1.00 15.70  ? 167  ALA C CB  1 
ATOM   9708  N  N   . PRO C  1 168 ? 3.397   3.978   24.935  1.00 21.43  ? 168  PRO C N   1 
ATOM   9709  C  CA  . PRO C  1 168 ? 4.064   2.854   25.574  1.00 15.34  ? 168  PRO C CA  1 
ATOM   9710  C  C   . PRO C  1 168 ? 5.273   3.340   26.311  1.00 24.69  ? 168  PRO C C   1 
ATOM   9711  O  O   . PRO C  1 168 ? 5.797   2.588   27.127  1.00 30.82  ? 168  PRO C O   1 
ATOM   9712  C  CB  . PRO C  1 168 ? 4.521   2.005   24.394  1.00 15.23  ? 168  PRO C CB  1 
ATOM   9713  C  CG  . PRO C  1 168 ? 3.954   2.662   23.160  1.00 25.26  ? 168  PRO C CG  1 
ATOM   9714  C  CD  . PRO C  1 168 ? 3.742   4.071   23.511  1.00 16.82  ? 168  PRO C CD  1 
ATOM   9715  N  N   . GLY C  1 169 ? 5.706   4.566   26.038  1.00 13.90  ? 169  GLY C N   1 
ATOM   9716  C  CA  . GLY C  1 169 ? 7.024   4.996   26.473  1.00 29.42  ? 169  GLY C CA  1 
ATOM   9717  C  C   . GLY C  1 169 ? 8.157   4.568   25.553  1.00 19.27  ? 169  GLY C C   1 
ATOM   9718  O  O   . GLY C  1 169 ? 7.961   3.736   24.654  1.00 12.88  ? 169  GLY C O   1 
ATOM   9719  N  N   . ASN C  1 170 ? 9.328   5.170   25.785  1.00 15.53  ? 170  ASN C N   1 
ATOM   9720  C  CA  . ASN C  1 170 ? 10.618  4.929   25.059  1.00 11.62  ? 170  ASN C CA  1 
ATOM   9721  C  C   . ASN C  1 170 ? 10.626  5.183   23.568  1.00 17.94  ? 170  ASN C C   1 
ATOM   9722  O  O   . ASN C  1 170 ? 11.483  4.678   22.870  1.00 13.74  ? 170  ASN C O   1 
ATOM   9723  C  CB  . ASN C  1 170 ? 11.165  3.538   25.303  1.00 11.94  ? 170  ASN C CB  1 
ATOM   9724  C  CG  . ASN C  1 170 ? 11.448  3.298   26.742  1.00 30.85  ? 170  ASN C CG  1 
ATOM   9725  O  OD1 . ASN C  1 170 ? 11.811  4.214   27.467  1.00 11.93  ? 170  ASN C OD1 1 
ATOM   9726  N  ND2 . ASN C  1 170 ? 11.257  2.064   27.187  1.00 21.62  ? 170  ASN C ND2 1 
ATOM   9727  N  N   . VAL C  1 171 ? 9.671   5.951   23.059  1.00 22.85  ? 171  VAL C N   1 
ATOM   9728  C  CA  . VAL C  1 171 ? 9.579   6.054   21.613  1.00 21.24  ? 171  VAL C CA  1 
ATOM   9729  C  C   . VAL C  1 171 ? 10.740  6.830   20.954  1.00 18.73  ? 171  VAL C C   1 
ATOM   9730  O  O   . VAL C  1 171 ? 11.055  6.573   19.811  1.00 16.25  ? 171  VAL C O   1 
ATOM   9731  C  CB  . VAL C  1 171 ? 8.159   6.480   21.125  1.00 11.79  ? 171  VAL C CB  1 
ATOM   9732  C  CG1 . VAL C  1 171 ? 7.108   5.657   21.835  1.00 12.45  ? 171  VAL C CG1 1 
ATOM   9733  C  CG2 . VAL C  1 171 ? 7.923   7.947   21.346  1.00 11.59  ? 171  VAL C CG2 1 
ATOM   9734  N  N   . GLY C  1 172 ? 11.391  7.749   21.654  1.00 10.51  ? 172  GLY C N   1 
ATOM   9735  C  CA  . GLY C  1 172 ? 12.538  8.409   21.054  1.00 20.96  ? 172  GLY C CA  1 
ATOM   9736  C  C   . GLY C  1 172 ? 13.657  7.399   20.797  1.00 19.37  ? 172  GLY C C   1 
ATOM   9737  O  O   . GLY C  1 172 ? 14.372  7.441   19.764  1.00 23.70  ? 172  GLY C O   1 
ATOM   9738  N  N   . LEU C  1 173 ? 13.795  6.478   21.753  1.00 13.42  ? 173  LEU C N   1 
ATOM   9739  C  CA  . LEU C  1 173 ? 14.671  5.338   21.621  1.00 16.79  ? 173  LEU C CA  1 
ATOM   9740  C  C   . LEU C  1 173 ? 14.327  4.543   20.367  1.00 22.55  ? 173  LEU C C   1 
ATOM   9741  O  O   . LEU C  1 173 ? 15.213  4.187   19.584  1.00 32.18  ? 173  LEU C O   1 
ATOM   9742  C  CB  . LEU C  1 173 ? 14.557  4.463   22.848  1.00 10.81  ? 173  LEU C CB  1 
ATOM   9743  C  CG  . LEU C  1 173 ? 15.194  5.094   24.073  1.00 18.82  ? 173  LEU C CG  1 
ATOM   9744  C  CD1 . LEU C  1 173 ? 14.830  4.274   25.308  1.00 15.56  ? 173  LEU C CD1 1 
ATOM   9745  C  CD2 . LEU C  1 173 ? 16.719  5.168   23.898  1.00 16.68  ? 173  LEU C CD2 1 
ATOM   9746  N  N   . LEU C  1 174 ? 13.040  4.285   20.166  1.00 13.46  ? 174  LEU C N   1 
ATOM   9747  C  CA  . LEU C  1 174 ? 12.586  3.562   18.985  1.00 16.79  ? 174  LEU C CA  1 
ATOM   9748  C  C   . LEU C  1 174 ? 12.879  4.305   17.680  1.00 19.67  ? 174  LEU C C   1 
ATOM   9749  O  O   . LEU C  1 174 ? 13.167  3.682   16.666  1.00 20.30  ? 174  LEU C O   1 
ATOM   9750  C  CB  . LEU C  1 174 ? 11.092  3.256   19.093  1.00 22.85  ? 174  LEU C CB  1 
ATOM   9751  C  CG  . LEU C  1 174 ? 10.723  2.236   20.166  1.00 21.70  ? 174  LEU C CG  1 
ATOM   9752  C  CD1 . LEU C  1 174 ? 9.241   1.906   20.067  1.00 17.08  ? 174  LEU C CD1 1 
ATOM   9753  C  CD2 . LEU C  1 174 ? 11.572  0.989   20.033  1.00 12.65  ? 174  LEU C CD2 1 
ATOM   9754  N  N   . ASP C  1 175 ? 12.782  5.630   17.712  1.00 19.29  ? 175  ASP C N   1 
ATOM   9755  C  CA  . ASP C  1 175 ? 13.106  6.475   16.568  1.00 18.98  ? 175  ASP C CA  1 
ATOM   9756  C  C   . ASP C  1 175 ? 14.516  6.195   16.195  1.00 17.34  ? 175  ASP C C   1 
ATOM   9757  O  O   . ASP C  1 175 ? 14.820  5.894   15.036  1.00 23.23  ? 175  ASP C O   1 
ATOM   9758  C  CB  . ASP C  1 175 ? 12.984  7.955   16.924  1.00 20.37  ? 175  ASP C CB  1 
ATOM   9759  C  CG  . ASP C  1 175 ? 11.566  8.352   17.192  1.00 17.81  ? 175  ASP C CG  1 
ATOM   9760  O  OD1 . ASP C  1 175 ? 10.700  7.511   16.918  1.00 19.06  ? 175  ASP C OD1 1 
ATOM   9761  O  OD2 . ASP C  1 175 ? 11.314  9.479   17.657  1.00 13.00  ? 175  ASP C OD2 1 
ATOM   9762  N  N   . GLN C  1 176 ? 15.377  6.295   17.200  1.00 16.77  ? 176  GLN C N   1 
ATOM   9763  C  CA  . GLN C  1 176 ? 16.770  5.919   17.023  1.00 13.24  ? 176  GLN C CA  1 
ATOM   9764  C  C   . GLN C  1 176 ? 16.875  4.575   16.342  1.00 17.31  ? 176  GLN C C   1 
ATOM   9765  O  O   . GLN C  1 176 ? 17.364  4.485   15.212  1.00 21.06  ? 176  GLN C O   1 
ATOM   9766  C  CB  . GLN C  1 176 ? 17.471  5.881   18.364  1.00 14.69  ? 176  GLN C CB  1 
ATOM   9767  C  CG  . GLN C  1 176 ? 17.579  7.248   18.973  1.00 17.29  ? 176  GLN C CG  1 
ATOM   9768  C  CD  . GLN C  1 176 ? 17.984  7.188   20.401  1.00 19.37  ? 176  GLN C CD  1 
ATOM   9769  O  OE1 . GLN C  1 176 ? 18.103  6.111   20.963  1.00 24.36  ? 176  GLN C OE1 1 
ATOM   9770  N  NE2 . GLN C  1 176 ? 18.199  8.343   21.008  1.00 22.79  ? 176  GLN C NE2 1 
ATOM   9771  N  N   . ARG C  1 177 ? 16.376  3.545   17.010  1.00 11.42  ? 177  ARG C N   1 
ATOM   9772  C  CA  . ARG C  1 177 ? 16.452  2.187   16.490  1.00 17.79  ? 177  ARG C CA  1 
ATOM   9773  C  C   . ARG C  1 177 ? 16.077  2.125   15.019  1.00 12.38  ? 177  ARG C C   1 
ATOM   9774  O  O   . ARG C  1 177 ? 16.726  1.457   14.222  1.00 40.39  ? 177  ARG C O   1 
ATOM   9775  C  CB  . ARG C  1 177 ? 15.560  1.239   17.303  1.00 12.31  ? 177  ARG C CB  1 
ATOM   9776  C  CG  . ARG C  1 177 ? 15.614  -0.216  16.833  1.00 14.93  ? 177  ARG C CG  1 
ATOM   9777  C  CD  . ARG C  1 177 ? 14.778  -1.140  17.693  1.00 13.48  ? 177  ARG C CD  1 
ATOM   9778  N  NE  . ARG C  1 177 ? 15.437  -1.438  18.956  1.00 18.89  ? 177  ARG C NE  1 
ATOM   9779  C  CZ  . ARG C  1 177 ? 14.851  -2.013  19.998  1.00 31.21  ? 177  ARG C CZ  1 
ATOM   9780  N  NH1 . ARG C  1 177 ? 13.573  -2.356  19.942  1.00 41.51  ? 177  ARG C NH1 1 
ATOM   9781  N  NH2 . ARG C  1 177 ? 15.541  -2.237  21.102  1.00 37.88  ? 177  ARG C NH2 1 
ATOM   9782  N  N   . LEU C  1 178 ? 15.027  2.848   14.660  1.00 22.59  ? 178  LEU C N   1 
ATOM   9783  C  CA  . LEU C  1 178 ? 14.505  2.806   13.306  1.00 19.34  ? 178  LEU C CA  1 
ATOM   9784  C  C   . LEU C  1 178 ? 15.533  3.399   12.380  1.00 22.57  ? 178  LEU C C   1 
ATOM   9785  O  O   . LEU C  1 178 ? 15.746  2.869   11.298  1.00 25.96  ? 178  LEU C O   1 
ATOM   9786  C  CB  . LEU C  1 178 ? 13.189  3.571   13.198  1.00 16.00  ? 178  LEU C CB  1 
ATOM   9787  C  CG  . LEU C  1 178 ? 12.554  3.604   11.812  1.00 12.98  ? 178  LEU C CG  1 
ATOM   9788  C  CD1 . LEU C  1 178 ? 12.618  2.226   11.219  1.00 13.72  ? 178  LEU C CD1 1 
ATOM   9789  C  CD2 . LEU C  1 178 ? 11.103  4.098   11.870  1.00 13.06  ? 178  LEU C CD2 1 
ATOM   9790  N  N   . ALA C  1 179 ? 16.171  4.488   12.811  1.00 22.00  ? 179  ALA C N   1 
ATOM   9791  C  CA  . ALA C  1 179 ? 17.231  5.086   12.016  1.00 12.24  ? 179  ALA C CA  1 
ATOM   9792  C  C   . ALA C  1 179 ? 18.356  4.074   11.810  1.00 16.85  ? 179  ALA C C   1 
ATOM   9793  O  O   . ALA C  1 179 ? 18.939  3.985   10.733  1.00 14.57  ? 179  ALA C O   1 
ATOM   9794  C  CB  . ALA C  1 179 ? 17.738  6.352   12.663  1.00 11.73  ? 179  ALA C CB  1 
ATOM   9795  N  N   . LEU C  1 180 ? 18.630  3.284   12.840  1.00 20.06  ? 180  LEU C N   1 
ATOM   9796  C  CA  . LEU C  1 180 ? 19.636  2.219   12.746  1.00 20.40  ? 180  LEU C CA  1 
ATOM   9797  C  C   . LEU C  1 180 ? 19.273  1.122   11.749  1.00 21.33  ? 180  LEU C C   1 
ATOM   9798  O  O   . LEU C  1 180 ? 20.134  0.599   11.041  1.00 22.03  ? 180  LEU C O   1 
ATOM   9799  C  CB  . LEU C  1 180 ? 19.919  1.611   14.126  1.00 22.51  ? 180  LEU C CB  1 
ATOM   9800  C  CG  . LEU C  1 180 ? 20.928  2.446   14.919  1.00 27.49  ? 180  LEU C CG  1 
ATOM   9801  C  CD1 . LEU C  1 180 ? 20.295  3.713   15.475  1.00 12.12  ? 180  LEU C CD1 1 
ATOM   9802  C  CD2 . LEU C  1 180 ? 21.539  1.616   16.017  1.00 27.57  ? 180  LEU C CD2 1 
ATOM   9803  N  N   . GLN C  1 181 ? 17.996  0.765   11.698  1.00 28.82  ? 181  GLN C N   1 
ATOM   9804  C  CA  . GLN C  1 181 ? 17.526  -0.212  10.720  1.00 31.54  ? 181  GLN C CA  1 
ATOM   9805  C  C   . GLN C  1 181 ? 17.640  0.389   9.319   1.00 31.86  ? 181  GLN C C   1 
ATOM   9806  O  O   . GLN C  1 181 ? 17.984  -0.298  8.337   1.00 30.63  ? 181  GLN C O   1 
ATOM   9807  C  CB  . GLN C  1 181 ? 16.098  -0.648  11.058  1.00 28.56  ? 181  GLN C CB  1 
ATOM   9808  C  CG  . GLN C  1 181 ? 16.022  -1.249  12.461  1.00 31.29  ? 181  GLN C CG  1 
ATOM   9809  C  CD  . GLN C  1 181 ? 14.604  -1.561  12.954  1.00 35.33  ? 181  GLN C CD  1 
ATOM   9810  O  OE1 . GLN C  1 181 ? 13.681  -0.752  12.826  1.00 42.34  ? 181  GLN C OE1 1 
ATOM   9811  N  NE2 . GLN C  1 181 ? 14.441  -2.741  13.544  1.00 33.14  ? 181  GLN C NE2 1 
ATOM   9812  N  N   . TRP C  1 182 ? 17.392  1.691   9.247   1.00 26.90  ? 182  TRP C N   1 
ATOM   9813  C  CA  . TRP C  1 182 ? 17.438  2.388   7.986   1.00 22.23  ? 182  TRP C CA  1 
ATOM   9814  C  C   . TRP C  1 182 ? 18.855  2.346   7.473   1.00 29.49  ? 182  TRP C C   1 
ATOM   9815  O  O   . TRP C  1 182 ? 19.087  2.101   6.293   1.00 31.31  ? 182  TRP C O   1 
ATOM   9816  C  CB  . TRP C  1 182 ? 16.987  3.835   8.121   1.00 19.57  ? 182  TRP C CB  1 
ATOM   9817  C  CG  . TRP C  1 182 ? 16.972  4.488   6.791   1.00 27.36  ? 182  TRP C CG  1 
ATOM   9818  C  CD1 . TRP C  1 182 ? 15.942  4.509   5.896   1.00 33.29  ? 182  TRP C CD1 1 
ATOM   9819  C  CD2 . TRP C  1 182 ? 18.061  5.168   6.168   1.00 26.53  ? 182  TRP C CD2 1 
ATOM   9820  N  NE1 . TRP C  1 182 ? 16.314  5.194   4.765   1.00 34.43  ? 182  TRP C NE1 1 
ATOM   9821  C  CE2 . TRP C  1 182 ? 17.616  5.601   4.905   1.00 32.38  ? 182  TRP C CE2 1 
ATOM   9822  C  CE3 . TRP C  1 182 ? 19.364  5.469   6.561   1.00 21.27  ? 182  TRP C CE3 1 
ATOM   9823  C  CZ2 . TRP C  1 182 ? 18.431  6.312   4.033   1.00 28.67  ? 182  TRP C CZ2 1 
ATOM   9824  C  CZ3 . TRP C  1 182 ? 20.172  6.176   5.691   1.00 23.68  ? 182  TRP C CZ3 1 
ATOM   9825  C  CH2 . TRP C  1 182 ? 19.704  6.586   4.443   1.00 23.95  ? 182  TRP C CH2 1 
ATOM   9826  N  N   . VAL C  1 183 ? 19.796  2.603   8.378   1.00 29.70  ? 183  VAL C N   1 
ATOM   9827  C  CA  . VAL C  1 183 ? 21.213  2.447   8.104   1.00 23.52  ? 183  VAL C CA  1 
ATOM   9828  C  C   . VAL C  1 183 ? 21.495  1.038   7.607   1.00 16.50  ? 183  VAL C C   1 
ATOM   9829  O  O   . VAL C  1 183 ? 22.077  0.890   6.561   1.00 28.75  ? 183  VAL C O   1 
ATOM   9830  C  CB  . VAL C  1 183 ? 22.072  2.762   9.337   1.00 19.27  ? 183  VAL C CB  1 
ATOM   9831  C  CG1 . VAL C  1 183 ? 23.466  2.161   9.182   1.00 21.10  ? 183  VAL C CG1 1 
ATOM   9832  C  CG2 . VAL C  1 183 ? 22.148  4.263   9.560   1.00 14.45  ? 183  VAL C CG2 1 
ATOM   9833  N  N   . GLN C  1 184 ? 21.067  0.003   8.330   1.00 46.62  ? 184  GLN C N   1 
ATOM   9834  C  CA  . GLN C  1 184 ? 21.304  -1.377  7.869   1.00 17.57  ? 184  GLN C CA  1 
ATOM   9835  C  C   . GLN C  1 184 ? 20.869  -1.622  6.428   1.00 28.38  ? 184  GLN C C   1 
ATOM   9836  O  O   . GLN C  1 184 ? 21.677  -2.060  5.615   1.00 24.05  ? 184  GLN C O   1 
ATOM   9837  C  CB  . GLN C  1 184 ? 20.666  -2.413  8.792   1.00 17.56  ? 184  GLN C CB  1 
ATOM   9838  C  CG  . GLN C  1 184 ? 21.412  -2.620  10.084  1.00 33.29  ? 184  GLN C CG  1 
ATOM   9839  C  CD  . GLN C  1 184 ? 22.860  -3.033  9.864   1.00 38.33  ? 184  GLN C CD  1 
ATOM   9840  O  OE1 . GLN C  1 184 ? 23.142  -4.131  9.385   1.00 39.62  ? 184  GLN C OE1 1 
ATOM   9841  N  NE2 . GLN C  1 184 ? 23.787  -2.153  10.220  1.00 17.74  ? 184  GLN C NE2 1 
ATOM   9842  N  N   . GLU C  1 185 ? 19.612  -1.315  6.094   1.00 31.69  ? 185  GLU C N   1 
ATOM   9843  C  CA  . GLU C  1 185 ? 19.160  -1.546  4.715   1.00 26.09  ? 185  GLU C CA  1 
ATOM   9844  C  C   . GLU C  1 185 ? 19.845  -0.664  3.680   1.00 27.81  ? 185  GLU C C   1 
ATOM   9845  O  O   . GLU C  1 185 ? 20.188  -1.125  2.589   1.00 25.41  ? 185  GLU C O   1 
ATOM   9846  C  CB  . GLU C  1 185 ? 17.653  -1.395  4.556   1.00 24.39  ? 185  GLU C CB  1 
ATOM   9847  C  CG  . GLU C  1 185 ? 17.204  -1.769  3.158   1.00 32.40  ? 185  GLU C CG  1 
ATOM   9848  C  CD  . GLU C  1 185 ? 15.723  -1.988  3.022   1.00 47.93  ? 185  GLU C CD  1 
ATOM   9849  O  OE1 . GLU C  1 185 ? 14.975  -1.651  3.972   1.00 57.02  ? 185  GLU C OE1 1 
ATOM   9850  O  OE2 . GLU C  1 185 ? 15.305  -2.491  1.953   1.00 51.33  ? 185  GLU C OE2 1 
ATOM   9851  N  N   . ASN C  1 186 ? 20.060  0.598   4.028   1.00 26.76  ? 186  ASN C N   1 
ATOM   9852  C  CA  . ASN C  1 186 ? 20.378  1.603   3.027   1.00 19.62  ? 186  ASN C CA  1 
ATOM   9853  C  C   . ASN C  1 186 ? 21.766  2.192   2.951   1.00 20.83  ? 186  ASN C C   1 
ATOM   9854  O  O   . ASN C  1 186 ? 22.076  2.826   1.946   1.00 20.52  ? 186  ASN C O   1 
ATOM   9855  C  CB  . ASN C  1 186 ? 19.390  2.743   3.130   1.00 17.87  ? 186  ASN C CB  1 
ATOM   9856  C  CG  . ASN C  1 186 ? 18.038  2.319   2.771   1.00 21.68  ? 186  ASN C CG  1 
ATOM   9857  O  OD1 . ASN C  1 186 ? 17.803  1.906   1.641   1.00 23.10  ? 186  ASN C OD1 1 
ATOM   9858  N  ND2 . ASN C  1 186 ? 17.122  2.380   3.727   1.00 24.07  ? 186  ASN C ND2 1 
ATOM   9859  N  N   . ILE C  1 187 ? 22.590  2.013   3.982   1.00 25.20  ? 187  ILE C N   1 
ATOM   9860  C  CA  . ILE C  1 187 ? 23.855  2.752   4.069   1.00 28.02  ? 187  ILE C CA  1 
ATOM   9861  C  C   . ILE C  1 187 ? 24.812  2.328   2.975   1.00 35.17  ? 187  ILE C C   1 
ATOM   9862  O  O   . ILE C  1 187 ? 25.584  3.141   2.477   1.00 20.39  ? 187  ILE C O   1 
ATOM   9863  C  CB  . ILE C  1 187 ? 24.543  2.638   5.438   1.00 18.14  ? 187  ILE C CB  1 
ATOM   9864  C  CG1 . ILE C  1 187 ? 25.534  3.786   5.621   1.00 18.06  ? 187  ILE C CG1 1 
ATOM   9865  C  CG2 . ILE C  1 187 ? 25.223  1.293   5.594   1.00 18.95  ? 187  ILE C CG2 1 
ATOM   9866  C  CD1 . ILE C  1 187 ? 24.881  5.148   5.596   1.00 17.31  ? 187  ILE C CD1 1 
ATOM   9867  N  N   . ALA C  1 188 ? 24.707  1.071   2.558   1.00 42.47  ? 188  ALA C N   1 
ATOM   9868  C  CA  . ALA C  1 188 ? 25.584  0.549   1.522   1.00 51.65  ? 188  ALA C CA  1 
ATOM   9869  C  C   . ALA C  1 188 ? 25.410  1.259   0.185   1.00 46.03  ? 188  ALA C C   1 
ATOM   9870  O  O   . ALA C  1 188 ? 26.276  1.171   -0.679  1.00 52.45  ? 188  ALA C O   1 
ATOM   9871  C  CB  . ALA C  1 188 ? 25.386  -0.941  1.362   1.00 61.15  ? 188  ALA C CB  1 
ATOM   9872  N  N   . ALA C  1 189 ? 24.297  1.961   0.009   1.00 31.55  ? 189  ALA C N   1 
ATOM   9873  C  CA  . ALA C  1 189 ? 24.120  2.770   -1.186  1.00 25.26  ? 189  ALA C CA  1 
ATOM   9874  C  C   . ALA C  1 189 ? 25.071  3.950   -1.159  1.00 26.61  ? 189  ALA C C   1 
ATOM   9875  O  O   . ALA C  1 189 ? 25.325  4.563   -2.191  1.00 30.06  ? 189  ALA C O   1 
ATOM   9876  C  CB  . ALA C  1 189 ? 22.713  3.266   -1.279  1.00 25.36  ? 189  ALA C CB  1 
ATOM   9877  N  N   . PHE C  1 190 ? 25.574  4.277   0.031   1.00 24.94  ? 190  PHE C N   1 
ATOM   9878  C  CA  . PHE C  1 190 ? 26.454  5.430   0.205   1.00 29.60  ? 190  PHE C CA  1 
ATOM   9879  C  C   . PHE C  1 190 ? 27.892  5.010   0.435   1.00 33.48  ? 190  PHE C C   1 
ATOM   9880  O  O   . PHE C  1 190 ? 28.717  5.832   0.810   1.00 35.74  ? 190  PHE C O   1 
ATOM   9881  C  CB  . PHE C  1 190 ? 26.029  6.258   1.414   1.00 20.37  ? 190  PHE C CB  1 
ATOM   9882  C  CG  . PHE C  1 190 ? 24.650  6.810   1.323   1.00 29.03  ? 190  PHE C CG  1 
ATOM   9883  C  CD1 . PHE C  1 190 ? 23.551  6.018   1.591   1.00 33.47  ? 190  PHE C CD1 1 
ATOM   9884  C  CD2 . PHE C  1 190 ? 24.444  8.135   1.007   1.00 28.86  ? 190  PHE C CD2 1 
ATOM   9885  C  CE1 . PHE C  1 190 ? 22.280  6.534   1.521   1.00 18.55  ? 190  PHE C CE1 1 
ATOM   9886  C  CE2 . PHE C  1 190 ? 23.171  8.651   0.938   1.00 25.20  ? 190  PHE C CE2 1 
ATOM   9887  C  CZ  . PHE C  1 190 ? 22.095  7.847   1.188   1.00 25.15  ? 190  PHE C CZ  1 
ATOM   9888  N  N   . GLY C  1 191 ? 28.181  3.731   0.255   1.00 23.33  ? 191  GLY C N   1 
ATOM   9889  C  CA  . GLY C  1 191 ? 29.505  3.221   0.542   1.00 34.91  ? 191  GLY C CA  1 
ATOM   9890  C  C   . GLY C  1 191 ? 29.652  2.787   1.983   1.00 37.42  ? 191  GLY C C   1 
ATOM   9891  O  O   . GLY C  1 191 ? 30.746  2.428   2.436   1.00 38.92  ? 191  GLY C O   1 
ATOM   9892  N  N   . GLY C  1 192 ? 28.543  2.823   2.708   1.00 22.07  ? 192  GLY C N   1 
ATOM   9893  C  CA  . GLY C  1 192 ? 28.526  2.365   4.081   1.00 30.79  ? 192  GLY C CA  1 
ATOM   9894  C  C   . GLY C  1 192 ? 28.679  0.859   4.167   1.00 35.57  ? 192  GLY C C   1 
ATOM   9895  O  O   . GLY C  1 192 ? 28.305  0.138   3.246   1.00 48.13  ? 192  GLY C O   1 
ATOM   9896  N  N   . ASP C  1 193 ? 29.227  0.382   5.278   1.00 27.04  ? 193  ASP C N   1 
ATOM   9897  C  CA  . ASP C  1 193 ? 29.449  -1.031  5.499   1.00 22.66  ? 193  ASP C CA  1 
ATOM   9898  C  C   . ASP C  1 193 ? 28.648  -1.422  6.707   1.00 21.62  ? 193  ASP C C   1 
ATOM   9899  O  O   . ASP C  1 193 ? 29.079  -1.164  7.827   1.00 46.97  ? 193  ASP C O   1 
ATOM   9900  C  CB  . ASP C  1 193 ? 30.924  -1.251  5.798   1.00 44.99  ? 193  ASP C CB  1 
ATOM   9901  C  CG  . ASP C  1 193 ? 31.252  -2.692  6.125   1.00 41.73  ? 193  ASP C CG  1 
ATOM   9902  O  OD1 . ASP C  1 193 ? 30.418  -3.598  5.855   1.00 28.77  ? 193  ASP C OD1 1 
ATOM   9903  O  OD2 . ASP C  1 193 ? 32.377  -2.908  6.632   1.00 49.51  ? 193  ASP C OD2 1 
ATOM   9904  N  N   . PRO C  1 194 ? 27.489  -2.067  6.502   1.00 21.41  ? 194  PRO C N   1 
ATOM   9905  C  CA  . PRO C  1 194 ? 26.601  -2.255  7.651   1.00 28.12  ? 194  PRO C CA  1 
ATOM   9906  C  C   . PRO C  1 194 ? 27.213  -3.182  8.694   1.00 20.75  ? 194  PRO C C   1 
ATOM   9907  O  O   . PRO C  1 194 ? 27.021  -2.982  9.883   1.00 19.94  ? 194  PRO C O   1 
ATOM   9908  C  CB  . PRO C  1 194 ? 25.330  -2.847  7.023   1.00 29.48  ? 194  PRO C CB  1 
ATOM   9909  C  CG  . PRO C  1 194 ? 25.394  -2.469  5.570   1.00 21.09  ? 194  PRO C CG  1 
ATOM   9910  C  CD  . PRO C  1 194 ? 26.864  -2.535  5.256   1.00 26.33  ? 194  PRO C CD  1 
ATOM   9911  N  N   . MET C  1 195 ? 27.994  -4.155  8.258   1.00 39.39  ? 195  MET C N   1 
ATOM   9912  C  CA  . MET C  1 195 ? 28.697  -5.020  9.203   1.00 39.89  ? 195  MET C CA  1 
ATOM   9913  C  C   . MET C  1 195 ? 29.838  -4.336  10.000  1.00 45.18  ? 195  MET C C   1 
ATOM   9914  O  O   . MET C  1 195 ? 30.516  -4.995  10.788  1.00 46.95  ? 195  MET C O   1 
ATOM   9915  C  CB  . MET C  1 195 ? 29.194  -6.281  8.494   1.00 43.84  ? 195  MET C CB  1 
ATOM   9916  C  CG  . MET C  1 195 ? 28.078  -7.118  7.879   1.00 41.97  ? 195  MET C CG  1 
ATOM   9917  S  SD  . MET C  1 195 ? 28.694  -8.288  6.655   1.00 83.60  ? 195  MET C SD  1 
ATOM   9918  C  CE  . MET C  1 195 ? 27.192  -8.638  5.740   1.00 88.68  ? 195  MET C CE  1 
ATOM   9919  N  N   . SER C  1 196 ? 30.042  -3.029  9.811   1.00 43.69  ? 196  SER C N   1 
ATOM   9920  C  CA  . SER C  1 196 ? 30.938  -2.263  10.684  1.00 21.64  ? 196  SER C CA  1 
ATOM   9921  C  C   . SER C  1 196 ? 30.343  -0.940  11.163  1.00 29.29  ? 196  SER C C   1 
ATOM   9922  O  O   . SER C  1 196 ? 30.735  0.123   10.695  1.00 26.26  ? 196  SER C O   1 
ATOM   9923  C  CB  . SER C  1 196 ? 32.272  -1.980  9.999   1.00 32.87  ? 196  SER C CB  1 
ATOM   9924  O  OG  . SER C  1 196 ? 33.247  -1.554  10.941  1.00 26.11  ? 196  SER C OG  1 
ATOM   9925  N  N   . VAL C  1 197 ? 29.409  -1.005  12.107  1.00 34.23  ? 197  VAL C N   1 
ATOM   9926  C  CA  . VAL C  1 197 ? 28.724  0.186   12.597  1.00 18.00  ? 197  VAL C CA  1 
ATOM   9927  C  C   . VAL C  1 197 ? 29.087  0.449   14.048  1.00 26.83  ? 197  VAL C C   1 
ATOM   9928  O  O   . VAL C  1 197 ? 28.959  -0.430  14.909  1.00 29.72  ? 197  VAL C O   1 
ATOM   9929  C  CB  . VAL C  1 197 ? 27.182  0.055   12.470  1.00 47.52  ? 197  VAL C CB  1 
ATOM   9930  C  CG1 . VAL C  1 197 ? 26.493  1.274   13.016  1.00 16.06  ? 197  VAL C CG1 1 
ATOM   9931  C  CG2 . VAL C  1 197 ? 26.794  -0.112  11.042  1.00 17.65  ? 197  VAL C CG2 1 
ATOM   9932  N  N   . THR C  1 198 ? 29.543  1.668   14.312  1.00 21.49  ? 198  THR C N   1 
ATOM   9933  C  CA  . THR C  1 198 ? 29.884  2.096   15.660  1.00 20.81  ? 198  THR C CA  1 
ATOM   9934  C  C   . THR C  1 198 ? 28.933  3.200   16.058  1.00 25.05  ? 198  THR C C   1 
ATOM   9935  O  O   . THR C  1 198 ? 28.831  4.194   15.347  1.00 32.25  ? 198  THR C O   1 
ATOM   9936  C  CB  . THR C  1 198 ? 31.285  2.705   15.695  1.00 21.31  ? 198  THR C CB  1 
ATOM   9937  O  OG1 . THR C  1 198 ? 32.264  1.713   15.374  1.00 23.07  ? 198  THR C OG1 1 
ATOM   9938  C  CG2 . THR C  1 198 ? 31.574  3.274   17.054  1.00 17.28  ? 198  THR C CG2 1 
ATOM   9939  N  N   . LEU C  1 199 ? 28.230  3.037   17.175  1.00 26.42  ? 199  LEU C N   1 
ATOM   9940  C  CA  . LEU C  1 199 ? 27.398  4.117   17.709  1.00 28.65  ? 199  LEU C CA  1 
ATOM   9941  C  C   . LEU C  1 199 ? 28.289  4.963   18.598  1.00 29.41  ? 199  LEU C C   1 
ATOM   9942  O  O   . LEU C  1 199 ? 29.237  4.454   19.191  1.00 23.29  ? 199  LEU C O   1 
ATOM   9943  C  CB  . LEU C  1 199 ? 26.237  3.564   18.538  1.00 13.62  ? 199  LEU C CB  1 
ATOM   9944  C  CG  . LEU C  1 199 ? 25.345  2.542   17.838  1.00 17.16  ? 199  LEU C CG  1 
ATOM   9945  C  CD1 . LEU C  1 199 ? 24.378  1.897   18.819  1.00 15.48  ? 199  LEU C CD1 1 
ATOM   9946  C  CD2 . LEU C  1 199 ? 24.579  3.209   16.705  1.00 15.96  ? 199  LEU C CD2 1 
ATOM   9947  N  N   . PHE C  1 200 ? 28.015  6.253   18.687  1.00 13.74  ? 200  PHE C N   1 
ATOM   9948  C  CA  . PHE C  1 200 ? 28.725  7.054   19.666  1.00 24.39  ? 200  PHE C CA  1 
ATOM   9949  C  C   . PHE C  1 200 ? 27.897  8.273   20.004  1.00 24.18  ? 200  PHE C C   1 
ATOM   9950  O  O   . PHE C  1 200 ? 27.278  8.858   19.107  1.00 15.97  ? 200  PHE C O   1 
ATOM   9951  C  CB  . PHE C  1 200 ? 30.147  7.410   19.210  1.00 14.74  ? 200  PHE C CB  1 
ATOM   9952  C  CG  . PHE C  1 200 ? 30.232  8.522   18.194  1.00 14.77  ? 200  PHE C CG  1 
ATOM   9953  C  CD1 . PHE C  1 200 ? 29.786  8.345   16.901  1.00 30.96  ? 200  PHE C CD1 1 
ATOM   9954  C  CD2 . PHE C  1 200 ? 30.839  9.715   18.513  1.00 19.21  ? 200  PHE C CD2 1 
ATOM   9955  C  CE1 . PHE C  1 200 ? 29.894  9.355   15.960  1.00 14.90  ? 200  PHE C CE1 1 
ATOM   9956  C  CE2 . PHE C  1 200 ? 30.954  10.722  17.570  1.00 23.87  ? 200  PHE C CE2 1 
ATOM   9957  C  CZ  . PHE C  1 200 ? 30.465  10.541  16.299  1.00 20.46  ? 200  PHE C CZ  1 
ATOM   9958  N  N   . GLY C  1 201 ? 27.867  8.623   21.297  1.00 28.41  ? 201  GLY C N   1 
ATOM   9959  C  CA  . GLY C  1 201 ? 27.055  9.729   21.785  1.00 12.36  ? 201  GLY C CA  1 
ATOM   9960  C  C   . GLY C  1 201 ? 27.383  10.213  23.187  1.00 16.89  ? 201  GLY C C   1 
ATOM   9961  O  O   . GLY C  1 201 ? 27.899  9.468   24.026  1.00 24.78  ? 201  GLY C O   1 
ATOM   9962  N  N   . GLU C  1 202 ? 27.033  11.464  23.454  1.00 17.38  ? 202  GLU C N   1 
ATOM   9963  C  CA  . GLU C  1 202 ? 27.450  12.163  24.665  1.00 27.53  ? 202  GLU C CA  1 
ATOM   9964  C  C   . GLU C  1 202 ? 26.248  12.545  25.560  1.00 26.73  ? 202  GLU C C   1 
ATOM   9965  O  O   . GLU C  1 202 ? 25.179  12.828  25.029  1.00 24.86  ? 202  GLU C O   1 
ATOM   9966  C  CB  . GLU C  1 202 ? 28.253  13.404  24.227  1.00 31.49  ? 202  GLU C CB  1 
ATOM   9967  C  CG  . GLU C  1 202 ? 28.923  14.200  25.330  1.00 27.80  ? 202  GLU C CG  1 
ATOM   9968  C  CD  . GLU C  1 202 ? 28.012  15.246  25.912  1.00 24.86  ? 202  GLU C CD  1 
ATOM   9969  O  OE1 . GLU C  1 202 ? 26.857  15.352  25.434  1.00 24.44  ? 202  GLU C OE1 1 
ATOM   9970  O  OE2 . GLU C  1 202 ? 28.437  15.945  26.857  1.00 24.37  ? 202  GLU C OE2 1 
ATOM   9971  N  N   . SER C  1 203 ? 26.437  12.581  26.891  1.00 25.68  ? 203  SER C N   1 
ATOM   9972  C  CA  . SER C  1 203 ? 25.360  12.890  27.874  1.00 16.26  ? 203  SER C CA  1 
ATOM   9973  C  C   . SER C  1 203 ? 24.218  11.928  27.581  1.00 17.53  ? 203  SER C C   1 
ATOM   9974  O  O   . SER C  1 203 ? 24.472  10.718  27.524  1.00 11.56  ? 203  SER C O   1 
ATOM   9975  C  CB  . SER C  1 203 ? 24.942  14.409  27.829  1.00 24.73  ? 203  SER C CB  1 
ATOM   9976  O  OG  . SER C  1 203 ? 23.944  14.816  28.854  1.00 29.00  ? 203  SER C OG  1 
ATOM   9977  N  N   . ALA C  1 204 ? 23.005  12.430  27.347  1.00 18.86  ? 204  ALA C N   1 
ATOM   9978  C  CA  . ALA C  1 204 ? 21.863  11.546  27.105  1.00 16.39  ? 204  ALA C CA  1 
ATOM   9979  C  C   . ALA C  1 204 ? 22.152  10.601  25.950  1.00 20.32  ? 204  ALA C C   1 
ATOM   9980  O  O   . ALA C  1 204 ? 21.799  9.423   26.016  1.00 24.91  ? 204  ALA C O   1 
ATOM   9981  C  CB  . ALA C  1 204 ? 20.601  12.332  26.851  1.00 19.48  ? 204  ALA C CB  1 
ATOM   9982  N  N   . GLY C  1 205 ? 22.827  11.115  24.920  1.00 18.17  ? 205  GLY C N   1 
ATOM   9983  C  CA  . GLY C  1 205 ? 23.316  10.302  23.814  1.00 17.48  ? 205  GLY C CA  1 
ATOM   9984  C  C   . GLY C  1 205 ? 23.942  8.994   24.254  1.00 18.39  ? 205  GLY C C   1 
ATOM   9985  O  O   . GLY C  1 205 ? 23.557  7.915   23.796  1.00 19.08  ? 205  GLY C O   1 
ATOM   9986  N  N   . ALA C  1 206 ? 24.875  9.068   25.193  1.00 19.22  ? 206  ALA C N   1 
ATOM   9987  C  CA  . ALA C  1 206 ? 25.502  7.846   25.677  1.00 18.98  ? 206  ALA C CA  1 
ATOM   9988  C  C   . ALA C  1 206 ? 24.471  6.943   26.366  1.00 16.16  ? 206  ALA C C   1 
ATOM   9989  O  O   . ALA C  1 206 ? 24.387  5.751   26.048  1.00 12.04  ? 206  ALA C O   1 
ATOM   9990  C  CB  . ALA C  1 206 ? 26.691  8.146   26.577  1.00 22.72  ? 206  ALA C CB  1 
ATOM   9991  N  N   . ALA C  1 207 ? 23.665  7.504   27.266  1.00 11.59  ? 207  ALA C N   1 
ATOM   9992  C  CA  . ALA C  1 207 ? 22.546  6.733   27.817  1.00 15.93  ? 207  ALA C CA  1 
ATOM   9993  C  C   . ALA C  1 207 ? 21.849  5.978   26.694  1.00 19.68  ? 207  ALA C C   1 
ATOM   9994  O  O   . ALA C  1 207 ? 21.678  4.744   26.767  1.00 26.16  ? 207  ALA C O   1 
ATOM   9995  C  CB  . ALA C  1 207 ? 21.564  7.637   28.510  1.00 17.74  ? 207  ALA C CB  1 
ATOM   9996  N  N   . SER C  1 208 ? 21.531  6.711   25.622  1.00 10.91  ? 208  SER C N   1 
ATOM   9997  C  CA  . SER C  1 208 ? 20.833  6.131   24.479  1.00 19.05  ? 208  SER C CA  1 
ATOM   9998  C  C   . SER C  1 208 ? 21.632  4.969   23.917  1.00 18.93  ? 208  SER C C   1 
ATOM   9999  O  O   . SER C  1 208 ? 21.109  3.850   23.814  1.00 15.97  ? 208  SER C O   1 
ATOM   10000 C  CB  . SER C  1 208 ? 20.553  7.176   23.404  1.00 19.52  ? 208  SER C CB  1 
ATOM   10001 O  OG  . SER C  1 208 ? 19.814  8.240   23.963  1.00 27.57  ? 208  SER C OG  1 
ATOM   10002 N  N   . VAL C  1 209 ? 22.908  5.223   23.603  1.00 14.60  ? 209  VAL C N   1 
ATOM   10003 C  CA  . VAL C  1 209 ? 23.784  4.178   23.107  1.00 12.08  ? 209  VAL C CA  1 
ATOM   10004 C  C   . VAL C  1 209 ? 23.720  3.025   24.084  1.00 25.73  ? 209  VAL C C   1 
ATOM   10005 O  O   . VAL C  1 209 ? 23.403  1.890   23.704  1.00 12.80  ? 209  VAL C O   1 
ATOM   10006 C  CB  . VAL C  1 209 ? 25.214  4.687   22.960  1.00 23.48  ? 209  VAL C CB  1 
ATOM   10007 C  CG1 . VAL C  1 209 ? 26.167  3.552   22.618  1.00 13.26  ? 209  VAL C CG1 1 
ATOM   10008 C  CG2 . VAL C  1 209 ? 25.259  5.791   21.903  1.00 17.79  ? 209  VAL C CG2 1 
ATOM   10009 N  N   . GLY C  1 210 ? 23.912  3.344   25.360  1.00 22.67  ? 210  GLY C N   1 
ATOM   10010 C  CA  . GLY C  1 210 ? 23.871  2.328   26.392  1.00 30.05  ? 210  GLY C CA  1 
ATOM   10011 C  C   . GLY C  1 210 ? 22.616  1.484   26.296  1.00 38.54  ? 210  GLY C C   1 
ATOM   10012 O  O   . GLY C  1 210 ? 22.694  0.250   26.304  1.00 13.52  ? 210  GLY C O   1 
ATOM   10013 N  N   . MET C  1 211 ? 21.462  2.142   26.166  1.00 12.36  ? 211  MET C N   1 
ATOM   10014 C  CA  . MET C  1 211 ? 20.220  1.392   26.119  1.00 15.13  ? 211  MET C CA  1 
ATOM   10015 C  C   . MET C  1 211 ? 20.162  0.423   24.951  1.00 15.51  ? 211  MET C C   1 
ATOM   10016 O  O   . MET C  1 211 ? 19.745  -0.720  25.119  1.00 13.25  ? 211  MET C O   1 
ATOM   10017 C  CB  . MET C  1 211 ? 19.002  2.299   26.185  1.00 17.58  ? 211  MET C CB  1 
ATOM   10018 C  CG  . MET C  1 211 ? 18.466  2.386   27.592  1.00 20.54  ? 211  MET C CG  1 
ATOM   10019 S  SD  . MET C  1 211 ? 18.196  4.083   27.973  1.00 36.64  ? 211  MET C SD  1 
ATOM   10020 C  CE  . MET C  1 211 ? 18.976  4.182   29.562  1.00 23.23  ? 211  MET C CE  1 
ATOM   10021 N  N   . HIS C  1 212 ? 20.652  0.840   23.791  1.00 12.55  ? 212  HIS C N   1 
ATOM   10022 C  CA  . HIS C  1 212 ? 20.760  -0.101  22.691  1.00 22.98  ? 212  HIS C CA  1 
ATOM   10023 C  C   . HIS C  1 212 ? 21.697  -1.280  23.004  1.00 28.52  ? 212  HIS C C   1 
ATOM   10024 O  O   . HIS C  1 212 ? 21.394  -2.395  22.602  1.00 23.72  ? 212  HIS C O   1 
ATOM   10025 C  CB  . HIS C  1 212 ? 21.196  0.600   21.425  1.00 12.77  ? 212  HIS C CB  1 
ATOM   10026 C  CG  . HIS C  1 212 ? 20.232  1.628   20.961  1.00 43.84  ? 212  HIS C CG  1 
ATOM   10027 N  ND1 . HIS C  1 212 ? 19.051  1.300   20.339  1.00 12.12  ? 212  HIS C ND1 1 
ATOM   10028 C  CD2 . HIS C  1 212 ? 20.267  2.976   21.029  1.00 11.59  ? 212  HIS C CD2 1 
ATOM   10029 C  CE1 . HIS C  1 212 ? 18.399  2.408   20.042  1.00 21.55  ? 212  HIS C CE1 1 
ATOM   10030 N  NE2 . HIS C  1 212 ? 19.117  3.439   20.446  1.00 16.60  ? 212  HIS C NE2 1 
ATOM   10031 N  N   . ILE C  1 213 ? 22.815  -1.060  23.706  1.00 14.02  ? 213  ILE C N   1 
ATOM   10032 C  CA  . ILE C  1 213 ? 23.588  -2.207  24.167  1.00 14.92  ? 213  ILE C CA  1 
ATOM   10033 C  C   . ILE C  1 213 ? 22.667  -3.106  25.002  1.00 15.74  ? 213  ILE C C   1 
ATOM   10034 O  O   . ILE C  1 213 ? 22.566  -4.312  24.770  1.00 15.96  ? 213  ILE C O   1 
ATOM   10035 C  CB  . ILE C  1 213 ? 24.856  -1.837  24.989  1.00 15.22  ? 213  ILE C CB  1 
ATOM   10036 C  CG1 . ILE C  1 213 ? 25.875  -1.087  24.140  1.00 15.65  ? 213  ILE C CG1 1 
ATOM   10037 C  CG2 . ILE C  1 213 ? 25.508  -3.080  25.493  1.00 16.25  ? 213  ILE C CG2 1 
ATOM   10038 C  CD1 . ILE C  1 213 ? 26.686  -0.084  24.888  1.00 15.08  ? 213  ILE C CD1 1 
ATOM   10039 N  N   . LEU C  1 214 ? 21.946  -2.520  25.939  1.00 14.77  ? 214  LEU C N   1 
ATOM   10040 C  CA  . LEU C  1 214 ? 21.115  -3.347  26.811  1.00 26.43  ? 214  LEU C CA  1 
ATOM   10041 C  C   . LEU C  1 214 ? 19.765  -3.840  26.230  1.00 28.38  ? 214  LEU C C   1 
ATOM   10042 O  O   . LEU C  1 214 ? 19.087  -4.631  26.863  1.00 15.73  ? 214  LEU C O   1 
ATOM   10043 C  CB  . LEU C  1 214 ? 20.879  -2.623  28.127  1.00 24.05  ? 214  LEU C CB  1 
ATOM   10044 C  CG  . LEU C  1 214 ? 22.197  -2.246  28.770  1.00 15.12  ? 214  LEU C CG  1 
ATOM   10045 C  CD1 . LEU C  1 214 ? 21.972  -1.261  29.876  1.00 57.90  ? 214  LEU C CD1 1 
ATOM   10046 C  CD2 . LEU C  1 214 ? 22.820  -3.487  29.314  1.00 32.10  ? 214  LEU C CD2 1 
ATOM   10047 N  N   . SER C  1 215 ? 19.372  -3.382  25.044  1.00 14.72  ? 215  SER C N   1 
ATOM   10048 C  CA  . SER C  1 215 ? 18.131  -3.857  24.429  1.00 26.63  ? 215  SER C CA  1 
ATOM   10049 C  C   . SER C  1 215 ? 18.409  -4.790  23.262  1.00 30.04  ? 215  SER C C   1 
ATOM   10050 O  O   . SER C  1 215 ? 19.182  -4.470  22.359  1.00 38.31  ? 215  SER C O   1 
ATOM   10051 C  CB  . SER C  1 215 ? 17.259  -2.684  23.971  1.00 30.01  ? 215  SER C CB  1 
ATOM   10052 O  OG  . SER C  1 215 ? 15.964  -3.107  23.572  1.00 28.33  ? 215  SER C OG  1 
ATOM   10053 N  N   . LEU C  1 216 ? 17.761  -5.944  23.273  1.00 31.01  ? 216  LEU C N   1 
ATOM   10054 C  CA  . LEU C  1 216 ? 18.126  -7.030  22.359  1.00 36.80  ? 216  LEU C CA  1 
ATOM   10055 C  C   . LEU C  1 216 ? 17.905  -6.777  20.854  1.00 31.98  ? 216  LEU C C   1 
ATOM   10056 O  O   . LEU C  1 216 ? 18.801  -7.051  20.048  1.00 40.80  ? 216  LEU C O   1 
ATOM   10057 C  CB  . LEU C  1 216 ? 17.466  -8.335  22.807  1.00 41.97  ? 216  LEU C CB  1 
ATOM   10058 C  CG  . LEU C  1 216 ? 18.359  -9.565  22.788  1.00 39.01  ? 216  LEU C CG  1 
ATOM   10059 C  CD1 . LEU C  1 216 ? 18.013  -10.466 23.974  1.00 31.44  ? 216  LEU C CD1 1 
ATOM   10060 C  CD2 . LEU C  1 216 ? 18.223  -10.298 21.437  1.00 41.50  ? 216  LEU C CD2 1 
ATOM   10061 N  N   . PRO C  1 217 ? 16.730  -6.249  20.470  1.00 23.42  ? 217  PRO C N   1 
ATOM   10062 C  CA  . PRO C  1 217 ? 16.521  -5.979  19.044  1.00 22.10  ? 217  PRO C CA  1 
ATOM   10063 C  C   . PRO C  1 217 ? 17.489  -4.955  18.483  1.00 28.40  ? 217  PRO C C   1 
ATOM   10064 O  O   . PRO C  1 217 ? 17.672  -4.897  17.266  1.00 35.81  ? 217  PRO C O   1 
ATOM   10065 C  CB  . PRO C  1 217 ? 15.103  -5.403  18.996  1.00 18.48  ? 217  PRO C CB  1 
ATOM   10066 C  CG  . PRO C  1 217 ? 14.444  -5.913  20.228  1.00 20.76  ? 217  PRO C CG  1 
ATOM   10067 C  CD  . PRO C  1 217 ? 15.524  -5.942  21.262  1.00 23.91  ? 217  PRO C CD  1 
ATOM   10068 N  N   . SER C  1 218 ? 18.089  -4.142  19.342  1.00 28.25  ? 218  SER C N   1 
ATOM   10069 C  CA  . SER C  1 218 ? 19.066  -3.178  18.858  1.00 31.77  ? 218  SER C CA  1 
ATOM   10070 C  C   . SER C  1 218 ? 20.423  -3.826  18.613  1.00 33.38  ? 218  SER C C   1 
ATOM   10071 O  O   . SER C  1 218 ? 21.206  -3.333  17.789  1.00 32.50  ? 218  SER C O   1 
ATOM   10072 C  CB  . SER C  1 218 ? 19.205  -1.989  19.811  1.00 30.48  ? 218  SER C CB  1 
ATOM   10073 O  OG  . SER C  1 218 ? 18.129  -1.078  19.668  1.00 16.60  ? 218  SER C OG  1 
ATOM   10074 N  N   . ARG C  1 219 ? 20.691  -4.943  19.289  1.00 38.53  ? 219  ARG C N   1 
ATOM   10075 C  CA  . ARG C  1 219 ? 22.048  -5.501  19.272  1.00 45.77  ? 219  ARG C CA  1 
ATOM   10076 C  C   . ARG C  1 219 ? 22.551  -5.933  17.884  1.00 45.33  ? 219  ARG C C   1 
ATOM   10077 O  O   . ARG C  1 219 ? 23.761  -5.884  17.603  1.00 44.33  ? 219  ARG C O   1 
ATOM   10078 C  CB  . ARG C  1 219 ? 22.223  -6.604  20.326  1.00 50.39  ? 219  ARG C CB  1 
ATOM   10079 C  CG  . ARG C  1 219 ? 22.633  -6.082  21.730  1.00 61.06  ? 219  ARG C CG  1 
ATOM   10080 C  CD  . ARG C  1 219 ? 24.003  -5.347  21.752  1.00 54.24  ? 219  ARG C CD  1 
ATOM   10081 N  NE  . ARG C  1 219 ? 25.171  -6.237  21.762  1.00 63.96  ? 219  ARG C NE  1 
ATOM   10082 C  CZ  . ARG C  1 219 ? 25.626  -6.891  22.834  1.00 71.80  ? 219  ARG C CZ  1 
ATOM   10083 N  NH1 . ARG C  1 219 ? 25.009  -6.776  24.005  1.00 74.25  ? 219  ARG C NH1 1 
ATOM   10084 N  NH2 . ARG C  1 219 ? 26.695  -7.679  22.737  1.00 70.40  ? 219  ARG C NH2 1 
ATOM   10085 N  N   . SER C  1 220 ? 21.619  -6.305  17.010  1.00 43.20  ? 220  SER C N   1 
ATOM   10086 C  CA  . SER C  1 220 ? 21.967  -6.724  15.648  1.00 43.77  ? 220  SER C CA  1 
ATOM   10087 C  C   . SER C  1 220 ? 22.002  -5.578  14.645  1.00 39.94  ? 220  SER C C   1 
ATOM   10088 O  O   . SER C  1 220 ? 22.001  -5.815  13.434  1.00 33.71  ? 220  SER C O   1 
ATOM   10089 C  CB  . SER C  1 220 ? 20.958  -7.746  15.147  1.00 45.82  ? 220  SER C CB  1 
ATOM   10090 O  OG  . SER C  1 220 ? 19.662  -7.186  15.094  1.00 40.18  ? 220  SER C OG  1 
ATOM   10091 N  N   . LEU C  1 221 ? 22.012  -4.346  15.146  1.00 40.36  ? 221  LEU C N   1 
ATOM   10092 C  CA  . LEU C  1 221 ? 21.992  -3.189  14.280  1.00 16.27  ? 221  LEU C CA  1 
ATOM   10093 C  C   . LEU C  1 221 ? 23.273  -2.353  14.406  1.00 25.98  ? 221  LEU C C   1 
ATOM   10094 O  O   . LEU C  1 221 ? 23.384  -1.281  13.802  1.00 21.48  ? 221  LEU C O   1 
ATOM   10095 C  CB  . LEU C  1 221 ? 20.787  -2.324  14.617  1.00 28.87  ? 221  LEU C CB  1 
ATOM   10096 C  CG  . LEU C  1 221 ? 19.382  -2.933  14.651  1.00 24.32  ? 221  LEU C CG  1 
ATOM   10097 C  CD1 . LEU C  1 221 ? 18.386  -1.929  15.210  1.00 18.99  ? 221  LEU C CD1 1 
ATOM   10098 C  CD2 . LEU C  1 221 ? 18.954  -3.375  13.271  1.00 24.90  ? 221  LEU C CD2 1 
ATOM   10099 N  N   . PHE C  1 222 ? 24.234  -2.827  15.197  1.00 22.56  ? 222  PHE C N   1 
ATOM   10100 C  CA  . PHE C  1 222 ? 25.520  -2.141  15.351  1.00 25.08  ? 222  PHE C CA  1 
ATOM   10101 C  C   . PHE C  1 222 ? 26.527  -3.083  15.981  1.00 30.33  ? 222  PHE C C   1 
ATOM   10102 O  O   . PHE C  1 222 ? 26.163  -4.184  16.411  1.00 35.83  ? 222  PHE C O   1 
ATOM   10103 C  CB  . PHE C  1 222 ? 25.388  -0.903  16.224  1.00 25.91  ? 222  PHE C CB  1 
ATOM   10104 C  CG  . PHE C  1 222 ? 25.191  -1.213  17.674  1.00 24.81  ? 222  PHE C CG  1 
ATOM   10105 C  CD1 . PHE C  1 222 ? 23.951  -1.587  18.148  1.00 23.55  ? 222  PHE C CD1 1 
ATOM   10106 C  CD2 . PHE C  1 222 ? 26.245  -1.136  18.564  1.00 25.42  ? 222  PHE C CD2 1 
ATOM   10107 C  CE1 . PHE C  1 222 ? 23.761  -1.873  19.472  1.00 21.81  ? 222  PHE C CE1 1 
ATOM   10108 C  CE2 . PHE C  1 222 ? 26.056  -1.431  19.892  1.00 25.56  ? 222  PHE C CE2 1 
ATOM   10109 C  CZ  . PHE C  1 222 ? 24.804  -1.796  20.343  1.00 15.23  ? 222  PHE C CZ  1 
ATOM   10110 N  N   . HIS C  1 223 ? 27.783  -2.651  16.064  1.00 17.93  ? 223  HIS C N   1 
ATOM   10111 C  CA  . HIS C  1 223 ? 28.853  -3.575  16.429  1.00 26.73  ? 223  HIS C CA  1 
ATOM   10112 C  C   . HIS C  1 223 ? 29.787  -3.082  17.515  1.00 28.89  ? 223  HIS C C   1 
ATOM   10113 O  O   . HIS C  1 223 ? 30.310  -3.880  18.287  1.00 30.62  ? 223  HIS C O   1 
ATOM   10114 C  CB  . HIS C  1 223 ? 29.664  -3.930  15.202  1.00 30.14  ? 223  HIS C CB  1 
ATOM   10115 C  CG  . HIS C  1 223 ? 28.835  -4.433  14.062  1.00 42.54  ? 223  HIS C CG  1 
ATOM   10116 N  ND1 . HIS C  1 223 ? 28.552  -5.772  13.879  1.00 45.93  ? 223  HIS C ND1 1 
ATOM   10117 C  CD2 . HIS C  1 223 ? 28.228  -3.775  13.044  1.00 45.31  ? 223  HIS C CD2 1 
ATOM   10118 C  CE1 . HIS C  1 223 ? 27.814  -5.917  12.792  1.00 50.75  ? 223  HIS C CE1 1 
ATOM   10119 N  NE2 . HIS C  1 223 ? 27.605  -4.721  12.267  1.00 52.08  ? 223  HIS C NE2 1 
ATOM   10120 N  N   . ARG C  1 224 ? 30.000  -1.771  17.561  1.00 29.36  ? 224  ARG C N   1 
ATOM   10121 C  CA  . ARG C  1 224 ? 30.823  -1.153  18.593  1.00 26.67  ? 224  ARG C CA  1 
ATOM   10122 C  C   . ARG C  1 224 ? 30.118  0.072   19.164  1.00 29.96  ? 224  ARG C C   1 
ATOM   10123 O  O   . ARG C  1 224 ? 29.236  0.664   18.521  1.00 27.79  ? 224  ARG C O   1 
ATOM   10124 C  CB  . ARG C  1 224 ? 32.180  -0.748  18.021  1.00 27.64  ? 224  ARG C CB  1 
ATOM   10125 C  CG  . ARG C  1 224 ? 33.026  -1.921  17.614  1.00 39.46  ? 224  ARG C CG  1 
ATOM   10126 C  CD  . ARG C  1 224 ? 34.240  -1.492  16.822  1.00 53.59  ? 224  ARG C CD  1 
ATOM   10127 N  NE  . ARG C  1 224 ? 34.820  -2.631  16.126  1.00 67.92  ? 224  ARG C NE  1 
ATOM   10128 C  CZ  . ARG C  1 224 ? 34.338  -3.128  14.989  1.00 81.18  ? 224  ARG C CZ  1 
ATOM   10129 N  NH1 . ARG C  1 224 ? 33.270  -2.573  14.416  1.00 77.36  ? 224  ARG C NH1 1 
ATOM   10130 N  NH2 . ARG C  1 224 ? 34.923  -4.181  14.423  1.00 91.19  ? 224  ARG C NH2 1 
ATOM   10131 N  N   . ALA C  1 225 ? 30.510  0.473   20.369  1.00 28.78  ? 225  ALA C N   1 
ATOM   10132 C  CA  . ALA C  1 225 ? 29.837  1.615   20.968  1.00 23.32  ? 225  ALA C CA  1 
ATOM   10133 C  C   . ALA C  1 225 ? 30.754  2.583   21.707  1.00 24.39  ? 225  ALA C C   1 
ATOM   10134 O  O   . ALA C  1 225 ? 31.801  2.194   22.251  1.00 35.47  ? 225  ALA C O   1 
ATOM   10135 C  CB  . ALA C  1 225 ? 28.723  1.136   21.869  1.00 30.46  ? 225  ALA C CB  1 
ATOM   10136 N  N   . VAL C  1 226 ? 30.367  3.857   21.716  1.00 20.73  ? 226  VAL C N   1 
ATOM   10137 C  CA  . VAL C  1 226 ? 31.140  4.862   22.432  1.00 23.61  ? 226  VAL C CA  1 
ATOM   10138 C  C   . VAL C  1 226 ? 30.269  5.773   23.268  1.00 21.89  ? 226  VAL C C   1 
ATOM   10139 O  O   . VAL C  1 226 ? 29.456  6.535   22.746  1.00 27.85  ? 226  VAL C O   1 
ATOM   10140 C  CB  . VAL C  1 226 ? 32.061  5.706   21.525  1.00 22.16  ? 226  VAL C CB  1 
ATOM   10141 C  CG1 . VAL C  1 226 ? 32.876  6.658   22.360  1.00 16.59  ? 226  VAL C CG1 1 
ATOM   10142 C  CG2 . VAL C  1 226 ? 32.981  4.828   20.759  1.00 17.26  ? 226  VAL C CG2 1 
ATOM   10143 N  N   . LEU C  1 227 ? 30.499  5.689   24.574  1.00 15.10  ? 227  LEU C N   1 
ATOM   10144 C  CA  . LEU C  1 227 ? 29.770  6.448   25.566  1.00 26.34  ? 227  LEU C CA  1 
ATOM   10145 C  C   . LEU C  1 227 ? 30.591  7.596   26.153  1.00 23.90  ? 227  LEU C C   1 
ATOM   10146 O  O   . LEU C  1 227 ? 31.460  7.394   27.024  1.00 27.81  ? 227  LEU C O   1 
ATOM   10147 C  CB  . LEU C  1 227 ? 29.289  5.519   26.673  1.00 25.66  ? 227  LEU C CB  1 
ATOM   10148 C  CG  . LEU C  1 227 ? 28.111  4.616   26.297  1.00 20.07  ? 227  LEU C CG  1 
ATOM   10149 C  CD1 . LEU C  1 227 ? 28.557  3.459   25.452  1.00 24.56  ? 227  LEU C CD1 1 
ATOM   10150 C  CD2 . LEU C  1 227 ? 27.485  4.093   27.535  1.00 19.68  ? 227  LEU C CD2 1 
ATOM   10151 N  N   . GLN C  1 228 ? 30.306  8.802   25.670  1.00 14.45  ? 228  GLN C N   1 
ATOM   10152 C  CA  . GLN C  1 228 ? 30.974  10.004  26.141  1.00 14.83  ? 228  GLN C CA  1 
ATOM   10153 C  C   . GLN C  1 228 ? 30.195  10.644  27.278  1.00 35.83  ? 228  GLN C C   1 
ATOM   10154 O  O   . GLN C  1 228 ? 29.097  11.159  27.057  1.00 32.53  ? 228  GLN C O   1 
ATOM   10155 C  CB  . GLN C  1 228 ? 31.067  11.003  24.993  1.00 14.75  ? 228  GLN C CB  1 
ATOM   10156 C  CG  . GLN C  1 228 ? 31.157  10.369  23.630  1.00 30.96  ? 228  GLN C CG  1 
ATOM   10157 C  CD  . GLN C  1 228 ? 31.822  11.272  22.617  1.00 36.78  ? 228  GLN C CD  1 
ATOM   10158 O  OE1 . GLN C  1 228 ? 32.333  10.809  21.601  1.00 41.44  ? 228  GLN C OE1 1 
ATOM   10159 N  NE2 . GLN C  1 228 ? 31.829  12.570  22.893  1.00 36.87  ? 228  GLN C NE2 1 
ATOM   10160 N  N   . SER C  1 229 ? 30.750  10.619  28.484  1.00 14.98  ? 229  SER C N   1 
ATOM   10161 C  CA  . SER C  1 229 ? 30.127  11.285  29.634  1.00 22.72  ? 229  SER C CA  1 
ATOM   10162 C  C   . SER C  1 229 ? 28.613  11.043  29.761  1.00 25.16  ? 229  SER C C   1 
ATOM   10163 O  O   . SER C  1 229 ? 27.806  11.972  29.654  1.00 17.73  ? 229  SER C O   1 
ATOM   10164 C  CB  . SER C  1 229 ? 30.361  12.791  29.581  1.00 18.78  ? 229  SER C CB  1 
ATOM   10165 O  OG  . SER C  1 229 ? 31.481  13.121  28.798  1.00 17.01  ? 229  SER C OG  1 
ATOM   10166 N  N   . GLY C  1 230 ? 28.238  9.792   29.972  1.00 29.13  ? 230  GLY C N   1 
ATOM   10167 C  CA  . GLY C  1 230 ? 26.849  9.421   30.041  1.00 13.18  ? 230  GLY C CA  1 
ATOM   10168 C  C   . GLY C  1 230 ? 26.797  7.914   30.046  1.00 17.71  ? 230  GLY C C   1 
ATOM   10169 O  O   . GLY C  1 230 ? 27.656  7.251   29.464  1.00 15.33  ? 230  GLY C O   1 
ATOM   10170 N  N   . THR C  1 231 ? 25.799  7.369   30.727  1.00 19.08  ? 231  THR C N   1 
ATOM   10171 C  CA  . THR C  1 231 ? 25.625  5.929   30.838  1.00 24.13  ? 231  THR C CA  1 
ATOM   10172 C  C   . THR C  1 231 ? 24.119  5.639   30.854  1.00 27.03  ? 231  THR C C   1 
ATOM   10173 O  O   . THR C  1 231 ? 23.326  6.551   31.060  1.00 21.32  ? 231  THR C O   1 
ATOM   10174 C  CB  . THR C  1 231 ? 26.195  5.450   32.154  1.00 24.83  ? 231  THR C CB  1 
ATOM   10175 O  OG1 . THR C  1 231 ? 25.530  6.151   33.212  1.00 29.57  ? 231  THR C OG1 1 
ATOM   10176 C  CG2 . THR C  1 231 ? 27.696  5.706   32.234  1.00 19.80  ? 231  THR C CG2 1 
ATOM   10177 N  N   . PRO C  1 232 ? 23.725  4.375   30.620  1.00 30.12  ? 232  PRO C N   1 
ATOM   10178 C  CA  . PRO C  1 232 ? 22.339  3.922   30.819  1.00 12.89  ? 232  PRO C CA  1 
ATOM   10179 C  C   . PRO C  1 232 ? 21.955  3.751   32.296  1.00 17.58  ? 232  PRO C C   1 
ATOM   10180 O  O   . PRO C  1 232 ? 20.816  4.004   32.693  1.00 24.20  ? 232  PRO C O   1 
ATOM   10181 C  CB  . PRO C  1 232 ? 22.314  2.554   30.129  1.00 13.17  ? 232  PRO C CB  1 
ATOM   10182 C  CG  . PRO C  1 232 ? 23.723  2.096   30.148  1.00 29.11  ? 232  PRO C CG  1 
ATOM   10183 C  CD  . PRO C  1 232 ? 24.556  3.341   29.975  1.00 27.89  ? 232  PRO C CD  1 
ATOM   10184 N  N   . ASN C  1 233 ? 22.893  3.294   33.106  1.00 15.86  ? 233  ASN C N   1 
ATOM   10185 C  CA  . ASN C  1 233 ? 22.686  3.245   34.541  1.00 23.15  ? 233  ASN C CA  1 
ATOM   10186 C  C   . ASN C  1 233 ? 22.760  4.656   35.120  1.00 27.00  ? 233  ASN C C   1 
ATOM   10187 O  O   . ASN C  1 233 ? 23.053  5.610   34.406  1.00 29.64  ? 233  ASN C O   1 
ATOM   10188 C  CB  . ASN C  1 233 ? 23.756  2.360   35.187  1.00 27.82  ? 233  ASN C CB  1 
ATOM   10189 C  CG  . ASN C  1 233 ? 25.167  2.689   34.699  1.00 29.65  ? 233  ASN C CG  1 
ATOM   10190 O  OD1 . ASN C  1 233 ? 25.416  2.748   33.500  1.00 34.21  ? 233  ASN C OD1 1 
ATOM   10191 N  ND2 . ASN C  1 233 ? 26.089  2.912   35.633  1.00 30.66  ? 233  ASN C ND2 1 
ATOM   10192 N  N   . GLY C  1 234 ? 22.519  4.800   36.415  1.00 25.04  ? 234  GLY C N   1 
ATOM   10193 C  CA  . GLY C  1 234 ? 22.719  6.092   37.033  1.00 23.32  ? 234  GLY C CA  1 
ATOM   10194 C  C   . GLY C  1 234 ? 21.428  6.739   37.461  1.00 30.94  ? 234  GLY C C   1 
ATOM   10195 O  O   . GLY C  1 234 ? 20.346  6.200   37.230  1.00 42.21  ? 234  GLY C O   1 
ATOM   10196 N  N   . PRO C  1 235 ? 21.532  7.900   38.106  1.00 24.18  ? 235  PRO C N   1 
ATOM   10197 C  CA  . PRO C  1 235 ? 20.376  8.553   38.722  1.00 24.35  ? 235  PRO C CA  1 
ATOM   10198 C  C   . PRO C  1 235 ? 19.398  9.227   37.763  1.00 30.60  ? 235  PRO C C   1 
ATOM   10199 O  O   . PRO C  1 235 ? 18.232  9.359   38.135  1.00 29.46  ? 235  PRO C O   1 
ATOM   10200 C  CB  . PRO C  1 235 ? 21.020  9.593   39.640  1.00 20.26  ? 235  PRO C CB  1 
ATOM   10201 C  CG  . PRO C  1 235 ? 22.371  9.815   39.082  1.00 22.86  ? 235  PRO C CG  1 
ATOM   10202 C  CD  . PRO C  1 235 ? 22.802  8.516   38.518  1.00 24.28  ? 235  PRO C CD  1 
ATOM   10203 N  N   . TRP C  1 236 ? 19.844  9.640   36.574  1.00 34.98  ? 236  TRP C N   1 
ATOM   10204 C  CA  . TRP C  1 236 ? 19.009  10.465  35.679  1.00 29.14  ? 236  TRP C CA  1 
ATOM   10205 C  C   . TRP C  1 236 ? 18.487  9.784   34.407  1.00 25.52  ? 236  TRP C C   1 
ATOM   10206 O  O   . TRP C  1 236 ? 17.437  10.156  33.890  1.00 25.86  ? 236  TRP C O   1 
ATOM   10207 C  CB  . TRP C  1 236 ? 19.749  11.751  35.284  1.00 22.06  ? 236  TRP C CB  1 
ATOM   10208 C  CG  . TRP C  1 236 ? 21.061  11.478  34.668  1.00 19.05  ? 236  TRP C CG  1 
ATOM   10209 C  CD1 . TRP C  1 236 ? 22.260  11.326  35.314  1.00 20.37  ? 236  TRP C CD1 1 
ATOM   10210 C  CD2 . TRP C  1 236 ? 21.329  11.303  33.278  1.00 22.56  ? 236  TRP C CD2 1 
ATOM   10211 N  NE1 . TRP C  1 236 ? 23.262  11.079  34.404  1.00 20.28  ? 236  TRP C NE1 1 
ATOM   10212 C  CE2 . TRP C  1 236 ? 22.721  11.048  33.147  1.00 23.99  ? 236  TRP C CE2 1 
ATOM   10213 C  CE3 . TRP C  1 236 ? 20.534  11.337  32.127  1.00 18.00  ? 236  TRP C CE3 1 
ATOM   10214 C  CZ2 . TRP C  1 236 ? 23.333  10.821  31.908  1.00 19.86  ? 236  TRP C CZ2 1 
ATOM   10215 C  CZ3 . TRP C  1 236 ? 21.140  11.110  30.891  1.00 19.66  ? 236  TRP C CZ3 1 
ATOM   10216 C  CH2 . TRP C  1 236 ? 22.535  10.856  30.796  1.00 21.99  ? 236  TRP C CH2 1 
ATOM   10217 N  N   . ALA C  1 237 ? 19.211  8.795   33.897  1.00 24.80  ? 237  ALA C N   1 
ATOM   10218 C  CA  . ALA C  1 237 ? 18.909  8.265   32.568  1.00 25.05  ? 237  ALA C CA  1 
ATOM   10219 C  C   . ALA C  1 237 ? 17.590  7.492   32.409  1.00 22.71  ? 237  ALA C C   1 
ATOM   10220 O  O   . ALA C  1 237 ? 17.080  7.371   31.291  1.00 18.47  ? 237  ALA C O   1 
ATOM   10221 C  CB  . ALA C  1 237 ? 20.078  7.448   32.040  1.00 11.97  ? 237  ALA C CB  1 
ATOM   10222 N  N   . THR C  1 238 ? 17.058  6.940   33.498  1.00 12.42  ? 238  THR C N   1 
ATOM   10223 C  CA  . THR C  1 238 ? 15.776  6.233   33.431  1.00 14.89  ? 238  THR C CA  1 
ATOM   10224 C  C   . THR C  1 238 ? 14.887  6.496   34.622  1.00 17.06  ? 238  THR C C   1 
ATOM   10225 O  O   . THR C  1 238 ? 15.349  6.833   35.718  1.00 18.55  ? 238  THR C O   1 
ATOM   10226 C  CB  . THR C  1 238 ? 15.924  4.704   33.352  1.00 19.08  ? 238  THR C CB  1 
ATOM   10227 O  OG1 . THR C  1 238 ? 16.237  4.178   34.644  1.00 21.90  ? 238  THR C OG1 1 
ATOM   10228 C  CG2 . THR C  1 238 ? 17.017  4.316   32.412  1.00 29.34  ? 238  THR C CG2 1 
ATOM   10229 N  N   . VAL C  1 239 ? 13.594  6.316   34.398  1.00 18.32  ? 239  VAL C N   1 
ATOM   10230 C  CA  . VAL C  1 239 ? 12.643  6.269   35.499  1.00 18.66  ? 239  VAL C CA  1 
ATOM   10231 C  C   . VAL C  1 239 ? 11.888  4.954   35.479  1.00 27.69  ? 239  VAL C C   1 
ATOM   10232 O  O   . VAL C  1 239 ? 11.699  4.339   34.424  1.00 28.91  ? 239  VAL C O   1 
ATOM   10233 C  CB  . VAL C  1 239 ? 11.618  7.413   35.446  1.00 15.94  ? 239  VAL C CB  1 
ATOM   10234 C  CG1 . VAL C  1 239 ? 12.294  8.738   35.708  1.00 21.48  ? 239  VAL C CG1 1 
ATOM   10235 C  CG2 . VAL C  1 239 ? 10.900  7.422   34.115  1.00 13.59  ? 239  VAL C CG2 1 
ATOM   10236 N  N   . SER C  1 240 ? 11.467  4.527   36.662  1.00 31.44  ? 240  SER C N   1 
ATOM   10237 C  CA  . SER C  1 240 ? 10.566  3.397   36.817  1.00 23.94  ? 240  SER C CA  1 
ATOM   10238 C  C   . SER C  1 240 ? 9.266   3.644   36.096  1.00 23.65  ? 240  SER C C   1 
ATOM   10239 O  O   . SER C  1 240 ? 8.902   4.786   35.805  1.00 21.03  ? 240  SER C O   1 
ATOM   10240 C  CB  . SER C  1 240 ? 10.227  3.245   38.273  1.00 17.04  ? 240  SER C CB  1 
ATOM   10241 O  OG  . SER C  1 240 ? 9.813   4.502   38.756  1.00 17.09  ? 240  SER C OG  1 
ATOM   10242 N  N   . ALA C  1 241 ? 8.550   2.559   35.839  1.00 30.44  ? 241  ALA C N   1 
ATOM   10243 C  CA  . ALA C  1 241 ? 7.239   2.635   35.220  1.00 30.94  ? 241  ALA C CA  1 
ATOM   10244 C  C   . ALA C  1 241 ? 6.310   3.451   36.102  1.00 31.10  ? 241  ALA C C   1 
ATOM   10245 O  O   . ALA C  1 241 ? 5.509   4.247   35.613  1.00 28.28  ? 241  ALA C O   1 
ATOM   10246 C  CB  . ALA C  1 241 ? 6.695   1.254   35.011  1.00 17.60  ? 241  ALA C CB  1 
ATOM   10247 N  N   . GLY C  1 242 ? 6.445   3.267   37.408  1.00 18.23  ? 242  GLY C N   1 
ATOM   10248 C  CA  . GLY C  1 242 ? 5.594   3.952   38.356  1.00 25.53  ? 242  GLY C CA  1 
ATOM   10249 C  C   . GLY C  1 242 ? 5.754   5.451   38.305  1.00 27.11  ? 242  GLY C C   1 
ATOM   10250 O  O   . GLY C  1 242 ? 4.775   6.201   38.229  1.00 37.52  ? 242  GLY C O   1 
ATOM   10251 N  N   . GLU C  1 243 ? 7.005   5.885   38.344  1.00 26.10  ? 243  GLU C N   1 
ATOM   10252 C  CA  . GLU C  1 243 ? 7.316   7.294   38.340  1.00 28.38  ? 243  GLU C CA  1 
ATOM   10253 C  C   . GLU C  1 243 ? 6.834   7.863   37.024  1.00 26.13  ? 243  GLU C C   1 
ATOM   10254 O  O   . GLU C  1 243 ? 6.142   8.883   37.005  1.00 22.41  ? 243  GLU C O   1 
ATOM   10255 C  CB  . GLU C  1 243 ? 8.821   7.522   38.560  1.00 16.69  ? 243  GLU C CB  1 
ATOM   10256 C  CG  . GLU C  1 243 ? 9.260   8.988   38.666  1.00 39.98  ? 243  GLU C CG  1 
ATOM   10257 C  CD  . GLU C  1 243 ? 8.435   9.852   39.632  1.00 45.57  ? 243  GLU C CD  1 
ATOM   10258 O  OE1 . GLU C  1 243 ? 7.708   9.322   40.503  1.00 49.57  ? 243  GLU C OE1 1 
ATOM   10259 O  OE2 . GLU C  1 243 ? 8.528   11.092  39.521  1.00 46.99  ? 243  GLU C OE2 1 
ATOM   10260 N  N   . ALA C  1 244 ? 7.162   7.183   35.929  1.00 21.41  ? 244  ALA C N   1 
ATOM   10261 C  CA  . ALA C  1 244 ? 6.781   7.677   34.616  1.00 24.88  ? 244  ALA C CA  1 
ATOM   10262 C  C   . ALA C  1 244 ? 5.266   7.881   34.533  1.00 26.73  ? 244  ALA C C   1 
ATOM   10263 O  O   . ALA C  1 244 ? 4.788   8.905   34.040  1.00 16.13  ? 244  ALA C O   1 
ATOM   10264 C  CB  . ALA C  1 244 ? 7.278   6.757   33.525  1.00 14.88  ? 244  ALA C CB  1 
ATOM   10265 N  N   . ARG C  1 245 ? 4.509   6.924   35.050  1.00 17.10  ? 245  ARG C N   1 
ATOM   10266 C  CA  . ARG C  1 245 ? 3.044   7.038   35.024  1.00 28.39  ? 245  ARG C CA  1 
ATOM   10267 C  C   . ARG C  1 245 ? 2.526   8.180   35.901  1.00 28.31  ? 245  ARG C C   1 
ATOM   10268 O  O   . ARG C  1 245 ? 1.594   8.891   35.514  1.00 19.05  ? 245  ARG C O   1 
ATOM   10269 C  CB  . ARG C  1 245 ? 2.400   5.722   35.433  1.00 23.96  ? 245  ARG C CB  1 
ATOM   10270 C  CG  . ARG C  1 245 ? 0.936   5.798   35.729  1.00 23.70  ? 245  ARG C CG  1 
ATOM   10271 C  CD  . ARG C  1 245 ? 0.367   4.394   35.899  1.00 31.48  ? 245  ARG C CD  1 
ATOM   10272 N  NE  . ARG C  1 245 ? 0.152   3.738   34.615  1.00 34.63  ? 245  ARG C NE  1 
ATOM   10273 C  CZ  . ARG C  1 245 ? -0.920  3.957   33.859  1.00 37.02  ? 245  ARG C CZ  1 
ATOM   10274 N  NH1 . ARG C  1 245 ? -1.861  4.812   34.265  1.00 22.14  ? 245  ARG C NH1 1 
ATOM   10275 N  NH2 . ARG C  1 245 ? -1.043  3.333   32.697  1.00 32.33  ? 245  ARG C NH2 1 
ATOM   10276 N  N   . ARG C  1 246 ? 3.136   8.341   37.077  1.00 25.10  ? 246  ARG C N   1 
ATOM   10277 C  CA  . ARG C  1 246 ? 2.870   9.493   37.937  1.00 25.38  ? 246  ARG C CA  1 
ATOM   10278 C  C   . ARG C  1 246 ? 3.010   10.765  37.121  1.00 30.66  ? 246  ARG C C   1 
ATOM   10279 O  O   . ARG C  1 246 ? 2.099   11.579  37.071  1.00 43.51  ? 246  ARG C O   1 
ATOM   10280 C  CB  . ARG C  1 246 ? 3.853   9.534   39.117  1.00 26.96  ? 246  ARG C CB  1 
ATOM   10281 C  CG  . ARG C  1 246 ? 3.297   10.116  40.420  1.00 34.01  ? 246  ARG C CG  1 
ATOM   10282 C  CD  . ARG C  1 246 ? 3.710   11.551  40.676  1.00 35.02  ? 246  ARG C CD  1 
ATOM   10283 N  NE  . ARG C  1 246 ? 5.152   11.699  40.573  1.00 45.52  ? 246  ARG C NE  1 
ATOM   10284 C  CZ  . ARG C  1 246 ? 5.789   12.865  40.590  1.00 50.60  ? 246  ARG C CZ  1 
ATOM   10285 N  NH1 . ARG C  1 246 ? 5.108   14.003  40.733  1.00 56.36  ? 246  ARG C NH1 1 
ATOM   10286 N  NH2 . ARG C  1 246 ? 7.109   12.888  40.464  1.00 40.47  ? 246  ARG C NH2 1 
ATOM   10287 N  N   . ARG C  1 247 ? 4.145   10.905  36.448  1.00 20.99  ? 247  ARG C N   1 
ATOM   10288 C  CA  . ARG C  1 247 ? 4.478   12.142  35.781  1.00 21.60  ? 247  ARG C CA  1 
ATOM   10289 C  C   . ARG C  1 247 ? 3.572   12.400  34.622  1.00 19.30  ? 247  ARG C C   1 
ATOM   10290 O  O   . ARG C  1 247 ? 3.026   13.480  34.495  1.00 23.58  ? 247  ARG C O   1 
ATOM   10291 C  CB  . ARG C  1 247 ? 5.916   12.105  35.297  1.00 35.24  ? 247  ARG C CB  1 
ATOM   10292 C  CG  . ARG C  1 247 ? 6.876   12.037  36.420  1.00 16.04  ? 247  ARG C CG  1 
ATOM   10293 C  CD  . ARG C  1 247 ? 8.255   12.055  35.915  1.00 22.95  ? 247  ARG C CD  1 
ATOM   10294 N  NE  . ARG C  1 247 ? 9.155   11.932  37.049  1.00 36.09  ? 247  ARG C NE  1 
ATOM   10295 C  CZ  . ARG C  1 247 ? 10.474  12.007  36.979  1.00 14.82  ? 247  ARG C CZ  1 
ATOM   10296 N  NH1 . ARG C  1 247 ? 11.076  12.206  35.822  1.00 17.35  ? 247  ARG C NH1 1 
ATOM   10297 N  NH2 . ARG C  1 247 ? 11.181  11.875  38.079  1.00 27.94  ? 247  ARG C NH2 1 
ATOM   10298 N  N   . ALA C  1 248 ? 3.433   11.409  33.759  1.00 19.90  ? 248  ALA C N   1 
ATOM   10299 C  CA  . ALA C  1 248 ? 2.559   11.529  32.605  1.00 24.05  ? 248  ALA C CA  1 
ATOM   10300 C  C   . ALA C  1 248 ? 1.130   11.901  33.038  1.00 28.33  ? 248  ALA C C   1 
ATOM   10301 O  O   . ALA C  1 248 ? 0.482   12.785  32.442  1.00 31.41  ? 248  ALA C O   1 
ATOM   10302 C  CB  . ALA C  1 248 ? 2.586   10.245  31.798  1.00 21.67  ? 248  ALA C CB  1 
ATOM   10303 N  N   . THR C  1 249 ? 0.659   11.266  34.105  1.00 18.91  ? 249  THR C N   1 
ATOM   10304 C  CA  . THR C  1 249 ? -0.657  11.592  34.640  1.00 28.06  ? 249  THR C CA  1 
ATOM   10305 C  C   . THR C  1 249 ? -0.754  13.043  35.127  1.00 27.08  ? 249  THR C C   1 
ATOM   10306 O  O   . THR C  1 249 ? -1.627  13.793  34.690  1.00 24.21  ? 249  THR C O   1 
ATOM   10307 C  CB  . THR C  1 249 ? -1.080  10.620  35.761  1.00 25.29  ? 249  THR C CB  1 
ATOM   10308 O  OG1 . THR C  1 249 ? -1.330  9.321   35.202  1.00 21.28  ? 249  THR C OG1 1 
ATOM   10309 C  CG2 . THR C  1 249 ? -2.343  11.114  36.430  1.00 22.80  ? 249  THR C CG2 1 
ATOM   10310 N  N   . LEU C  1 250 ? 0.135   13.432  36.034  1.00 20.42  ? 250  LEU C N   1 
ATOM   10311 C  CA  . LEU C  1 250 ? 0.191   14.809  36.526  1.00 25.31  ? 250  LEU C CA  1 
ATOM   10312 C  C   . LEU C  1 250 ? 0.245   15.840  35.403  1.00 29.71  ? 250  LEU C C   1 
ATOM   10313 O  O   . LEU C  1 250 ? -0.461  16.835  35.437  1.00 29.44  ? 250  LEU C O   1 
ATOM   10314 C  CB  . LEU C  1 250 ? 1.409   15.016  37.416  1.00 21.76  ? 250  LEU C CB  1 
ATOM   10315 C  CG  . LEU C  1 250 ? 1.430   16.423  37.976  1.00 22.96  ? 250  LEU C CG  1 
ATOM   10316 C  CD1 . LEU C  1 250 ? 0.180   16.553  38.815  1.00 32.69  ? 250  LEU C CD1 1 
ATOM   10317 C  CD2 . LEU C  1 250 ? 2.668   16.688  38.794  1.00 20.61  ? 250  LEU C CD2 1 
ATOM   10318 N  N   . LEU C  1 251 ? 1.101   15.604  34.419  1.00 29.40  ? 251  LEU C N   1 
ATOM   10319 C  CA  . LEU C  1 251 ? 1.189   16.487  33.271  1.00 29.22  ? 251  LEU C CA  1 
ATOM   10320 C  C   . LEU C  1 251 ? -0.160  16.586  32.572  1.00 25.23  ? 251  LEU C C   1 
ATOM   10321 O  O   . LEU C  1 251 ? -0.605  17.672  32.243  1.00 19.82  ? 251  LEU C O   1 
ATOM   10322 C  CB  . LEU C  1 251 ? 2.245   16.018  32.275  1.00 17.25  ? 251  LEU C CB  1 
ATOM   10323 C  CG  . LEU C  1 251 ? 2.232   17.022  31.129  1.00 16.99  ? 251  LEU C CG  1 
ATOM   10324 C  CD1 . LEU C  1 251 ? 3.275   18.069  31.404  1.00 16.63  ? 251  LEU C CD1 1 
ATOM   10325 C  CD2 . LEU C  1 251 ? 2.424   16.383  29.785  1.00 16.23  ? 251  LEU C CD2 1 
ATOM   10326 N  N   . ALA C  1 252 ? -0.813  15.452  32.345  1.00 26.63  ? 252  ALA C N   1 
ATOM   10327 C  CA  . ALA C  1 252 ? -2.170  15.521  31.797  1.00 31.59  ? 252  ALA C CA  1 
ATOM   10328 C  C   . ALA C  1 252 ? -3.098  16.357  32.682  1.00 32.55  ? 252  ALA C C   1 
ATOM   10329 O  O   . ALA C  1 252 ? -3.959  17.058  32.173  1.00 34.78  ? 252  ALA C O   1 
ATOM   10330 C  CB  . ALA C  1 252 ? -2.754  14.138  31.569  1.00 32.14  ? 252  ALA C CB  1 
ATOM   10331 N  N   . ARG C  1 253 ? -2.918  16.305  33.998  1.00 31.54  ? 253  ARG C N   1 
ATOM   10332 C  CA  . ARG C  1 253 ? -3.762  17.113  34.867  1.00 39.05  ? 253  ARG C CA  1 
ATOM   10333 C  C   . ARG C  1 253 ? -3.470  18.578  34.599  1.00 33.54  ? 253  ARG C C   1 
ATOM   10334 O  O   . ARG C  1 253 ? -4.370  19.395  34.467  1.00 31.29  ? 253  ARG C O   1 
ATOM   10335 C  CB  . ARG C  1 253 ? -3.512  16.803  36.347  1.00 49.50  ? 253  ARG C CB  1 
ATOM   10336 C  CG  . ARG C  1 253 ? -4.760  16.965  37.241  1.00 57.74  ? 253  ARG C CG  1 
ATOM   10337 C  CD  . ARG C  1 253 ? -4.460  17.499  38.665  1.00 98.11  ? 253  ARG C CD  1 
ATOM   10338 N  NE  . ARG C  1 253 ? -5.584  17.230  39.564  1.00 100.17 ? 253  ARG C NE  1 
ATOM   10339 C  CZ  . ARG C  1 253 ? -6.732  17.909  39.566  1.00 100.30 ? 253  ARG C CZ  1 
ATOM   10340 N  NH1 . ARG C  1 253 ? -6.916  18.924  38.727  1.00 98.37  ? 253  ARG C NH1 1 
ATOM   10341 N  NH2 . ARG C  1 253 ? -7.700  17.575  40.415  1.00 99.02  ? 253  ARG C NH2 1 
ATOM   10342 N  N   . LEU C  1 254 ? -2.191  18.889  34.490  1.00 30.77  ? 254  LEU C N   1 
ATOM   10343 C  CA  . LEU C  1 254 ? -1.722  20.256  34.503  1.00 27.27  ? 254  LEU C CA  1 
ATOM   10344 C  C   . LEU C  1 254 ? -2.116  21.014  33.251  1.00 22.69  ? 254  LEU C C   1 
ATOM   10345 O  O   . LEU C  1 254 ? -2.262  22.232  33.289  1.00 30.36  ? 254  LEU C O   1 
ATOM   10346 C  CB  . LEU C  1 254 ? -0.202  20.269  34.688  1.00 24.86  ? 254  LEU C CB  1 
ATOM   10347 C  CG  . LEU C  1 254 ? 0.250   19.909  36.099  1.00 25.49  ? 254  LEU C CG  1 
ATOM   10348 C  CD1 . LEU C  1 254 ? 1.742   20.128  36.301  1.00 20.74  ? 254  LEU C CD1 1 
ATOM   10349 C  CD2 . LEU C  1 254 ? -0.562  20.730  37.085  1.00 23.29  ? 254  LEU C CD2 1 
ATOM   10350 N  N   . VAL C  1 255 ? -2.267  20.303  32.140  1.00 22.05  ? 255  VAL C N   1 
ATOM   10351 C  CA  . VAL C  1 255 ? -2.649  20.956  30.899  1.00 41.42  ? 255  VAL C CA  1 
ATOM   10352 C  C   . VAL C  1 255 ? -4.110  20.690  30.638  1.00 36.23  ? 255  VAL C C   1 
ATOM   10353 O  O   . VAL C  1 255 ? -4.573  20.714  29.501  1.00 23.40  ? 255  VAL C O   1 
ATOM   10354 C  CB  . VAL C  1 255 ? -1.760  20.574  29.687  1.00 20.70  ? 255  VAL C CB  1 
ATOM   10355 C  CG1 . VAL C  1 255 ? -0.337  20.897  29.986  1.00 35.68  ? 255  VAL C CG1 1 
ATOM   10356 C  CG2 . VAL C  1 255 ? -1.890  19.120  29.336  1.00 20.21  ? 255  VAL C CG2 1 
ATOM   10357 N  N   . GLY C  1 256 ? -4.827  20.436  31.720  1.00 24.46  ? 256  GLY C N   1 
ATOM   10358 C  CA  . GLY C  1 256 ? -6.278  20.459  31.702  1.00 48.99  ? 256  GLY C CA  1 
ATOM   10359 C  C   . GLY C  1 256 ? -6.871  19.254  31.027  1.00 39.53  ? 256  GLY C C   1 
ATOM   10360 O  O   . GLY C  1 256 ? -7.976  19.280  30.516  1.00 40.89  ? 256  GLY C O   1 
ATOM   10361 N  N   . CYS C  1 257 ? -6.116  18.175  31.034  1.00 42.51  ? 257  CYS C N   1 
ATOM   10362 C  CA  . CYS C  1 257 ? -6.529  16.985  30.336  1.00 48.47  ? 257  CYS C CA  1 
ATOM   10363 C  C   . CYS C  1 257 ? -6.852  15.833  31.274  1.00 65.88  ? 257  CYS C C   1 
ATOM   10364 O  O   . CYS C  1 257 ? -6.354  14.735  31.077  1.00 77.52  ? 257  CYS C O   1 
ATOM   10365 C  CB  . CYS C  1 257 ? -5.427  16.565  29.361  1.00 23.08  ? 257  CYS C CB  1 
ATOM   10366 S  SG  . CYS C  1 257 ? -5.977  16.541  27.687  1.00 71.91  ? 257  CYS C SG  1 
ATOM   10367 N  N   . PRO C  1 258 ? -7.651  16.065  32.324  1.00 76.40  ? 258  PRO C N   1 
ATOM   10368 C  CA  . PRO C  1 258 ? -8.149  14.772  32.802  1.00 84.61  ? 258  PRO C CA  1 
ATOM   10369 C  C   . PRO C  1 258 ? -9.130  14.121  31.805  1.00 96.46  ? 258  PRO C C   1 
ATOM   10370 O  O   . PRO C  1 258 ? -8.951  12.929  31.535  1.00 93.87  ? 258  PRO C O   1 
ATOM   10371 C  CB  . PRO C  1 258 ? -8.800  15.112  34.145  1.00 87.27  ? 258  PRO C CB  1 
ATOM   10372 C  CG  . PRO C  1 258 ? -8.076  16.348  34.598  1.00 85.79  ? 258  PRO C CG  1 
ATOM   10373 C  CD  . PRO C  1 258 ? -7.782  17.122  33.346  1.00 81.72  ? 258  PRO C CD  1 
ATOM   10374 N  N   . PRO C  1 259 ? -10.121 14.869  31.246  1.00 109.41 ? 259  PRO C N   1 
ATOM   10375 C  CA  . PRO C  1 259 ? -10.581 16.256  31.466  1.00 112.82 ? 259  PRO C CA  1 
ATOM   10376 C  C   . PRO C  1 259 ? -11.535 16.400  32.658  1.00 117.00 ? 259  PRO C C   1 
ATOM   10377 O  O   . PRO C  1 259 ? -12.473 15.610  32.788  1.00 118.11 ? 259  PRO C O   1 
ATOM   10378 C  CB  . PRO C  1 259 ? -11.308 16.597  30.158  1.00 110.99 ? 259  PRO C CB  1 
ATOM   10379 C  CG  . PRO C  1 259 ? -11.819 15.293  29.669  1.00 110.13 ? 259  PRO C CG  1 
ATOM   10380 C  CD  . PRO C  1 259 ? -10.781 14.269  30.067  1.00 110.34 ? 259  PRO C CD  1 
ATOM   10381 N  N   . GLY C  1 260 ? -11.284 17.385  33.522  1.00 118.04 ? 260  GLY C N   1 
ATOM   10382 C  CA  . GLY C  1 260 ? -12.192 17.689  34.619  1.00 121.69 ? 260  GLY C CA  1 
ATOM   10383 C  C   . GLY C  1 260 ? -11.691 17.413  36.030  1.00 124.09 ? 260  GLY C C   1 
ATOM   10384 O  O   . GLY C  1 260 ? -11.436 18.346  36.798  1.00 122.48 ? 260  GLY C O   1 
ATOM   10385 N  N   . GLY C  1 261 ? -11.569 16.131  36.376  1.00 127.59 ? 261  GLY C N   1 
ATOM   10386 C  CA  . GLY C  1 261 ? -11.140 15.720  37.706  1.00 129.31 ? 261  GLY C CA  1 
ATOM   10387 C  C   . GLY C  1 261 ? -10.139 14.573  37.709  1.00 129.55 ? 261  GLY C C   1 
ATOM   10388 O  O   . GLY C  1 261 ? -8.968  14.770  38.046  1.00 129.78 ? 261  GLY C O   1 
ATOM   10389 N  N   . ALA C  1 262 ? -10.600 13.377  37.337  1.00 128.08 ? 262  ALA C N   1 
ATOM   10390 C  CA  . ALA C  1 262 ? -9.744  12.190  37.290  1.00 124.01 ? 262  ALA C CA  1 
ATOM   10391 C  C   . ALA C  1 262 ? -9.444  11.740  35.856  1.00 126.43 ? 262  ALA C C   1 
ATOM   10392 O  O   . ALA C  1 262 ? -8.437  12.141  35.263  1.00 123.95 ? 262  ALA C O   1 
ATOM   10393 C  CB  . ALA C  1 262 ? -10.363 11.045  38.096  1.00 118.34 ? 262  ALA C CB  1 
ATOM   10394 N  N   . GLY C  1 263 ? -10.319 10.902  35.306  1.00 128.98 ? 263  GLY C N   1 
ATOM   10395 C  CA  . GLY C  1 263 ? -10.129 10.376  33.964  1.00 127.05 ? 263  GLY C CA  1 
ATOM   10396 C  C   . GLY C  1 263 ? -9.607  8.949   33.964  1.00 124.43 ? 263  GLY C C   1 
ATOM   10397 O  O   . GLY C  1 263 ? -8.391  8.721   33.985  1.00 118.55 ? 263  GLY C O   1 
ATOM   10398 N  N   . GLY C  1 264 ? -10.535 7.993   33.926  1.00 126.31 ? 264  GLY C N   1 
ATOM   10399 C  CA  . GLY C  1 264 ? -10.224 6.575   34.036  1.00 121.99 ? 264  GLY C CA  1 
ATOM   10400 C  C   . GLY C  1 264 ? -9.300  5.999   32.973  1.00 112.41 ? 264  GLY C C   1 
ATOM   10401 O  O   . GLY C  1 264 ? -8.143  5.680   33.257  1.00 113.87 ? 264  GLY C O   1 
ATOM   10402 N  N   . ASN C  1 265 ? -9.822  5.854   31.758  1.00 99.54  ? 265  ASN C N   1 
ATOM   10403 C  CA  . ASN C  1 265 ? -9.071  5.304   30.632  1.00 87.34  ? 265  ASN C CA  1 
ATOM   10404 C  C   . ASN C  1 265 ? -7.668  5.893   30.460  1.00 71.17  ? 265  ASN C C   1 
ATOM   10405 O  O   . ASN C  1 265 ? -7.416  7.038   30.828  1.00 69.96  ? 265  ASN C O   1 
ATOM   10406 C  CB  . ASN C  1 265 ? -9.863  5.520   29.342  1.00 94.70  ? 265  ASN C CB  1 
ATOM   10407 C  CG  . ASN C  1 265 ? -10.603 4.282   28.896  1.00 103.43 ? 265  ASN C CG  1 
ATOM   10408 O  OD1 . ASN C  1 265 ? -9.989  3.344   28.385  1.00 105.22 ? 265  ASN C OD1 1 
ATOM   10409 N  ND2 . ASN C  1 265 ? -11.929 4.268   29.086  1.00 111.55 ? 265  ASN C ND2 1 
ATOM   10410 N  N   . ASP C  1 266 ? -6.750  5.102   29.917  1.00 58.77  ? 266  ASP C N   1 
ATOM   10411 C  CA  . ASP C  1 266 ? -5.490  5.653   29.440  1.00 51.02  ? 266  ASP C CA  1 
ATOM   10412 C  C   . ASP C  1 266 ? -5.725  6.087   28.016  1.00 57.25  ? 266  ASP C C   1 
ATOM   10413 O  O   . ASP C  1 266 ? -5.039  6.963   27.488  1.00 62.53  ? 266  ASP C O   1 
ATOM   10414 C  CB  . ASP C  1 266 ? -4.374  4.613   29.448  1.00 40.06  ? 266  ASP C CB  1 
ATOM   10415 C  CG  . ASP C  1 266 ? -3.731  4.464   30.792  1.00 41.64  ? 266  ASP C CG  1 
ATOM   10416 O  OD1 . ASP C  1 266 ? -3.844  5.388   31.620  1.00 44.30  ? 266  ASP C OD1 1 
ATOM   10417 O  OD2 . ASP C  1 266 ? -3.104  3.416   31.019  1.00 44.86  ? 266  ASP C OD2 1 
ATOM   10418 N  N   . THR C  1 267 ? -6.692  5.445   27.381  1.00 53.77  ? 267  THR C N   1 
ATOM   10419 C  CA  . THR C  1 267 ? -7.005  5.795   26.019  1.00 51.57  ? 267  THR C CA  1 
ATOM   10420 C  C   . THR C  1 267 ? -7.586  7.193   26.007  1.00 55.03  ? 267  THR C C   1 
ATOM   10421 O  O   . THR C  1 267 ? -7.105  8.064   25.290  1.00 62.32  ? 267  THR C O   1 
ATOM   10422 C  CB  . THR C  1 267 ? -7.974  4.804   25.391  1.00 47.81  ? 267  THR C CB  1 
ATOM   10423 O  OG1 . THR C  1 267 ? -7.282  3.577   25.138  1.00 43.49  ? 267  THR C OG1 1 
ATOM   10424 C  CG2 . THR C  1 267 ? -8.504  5.351   24.083  1.00 49.73  ? 267  THR C CG2 1 
ATOM   10425 N  N   . GLU C  1 268 ? -8.588  7.422   26.842  1.00 51.60  ? 268  GLU C N   1 
ATOM   10426 C  CA  . GLU C  1 268 ? -9.271  8.699   26.824  1.00 58.22  ? 268  GLU C CA  1 
ATOM   10427 C  C   . GLU C  1 268 ? -8.426  9.780   27.469  1.00 54.89  ? 268  GLU C C   1 
ATOM   10428 O  O   . GLU C  1 268 ? -8.743  10.962  27.364  1.00 62.35  ? 268  GLU C O   1 
ATOM   10429 C  CB  . GLU C  1 268 ? -10.657 8.600   27.470  1.00 74.51  ? 268  GLU C CB  1 
ATOM   10430 C  CG  . GLU C  1 268 ? -11.773 9.328   26.682  1.00 89.74  ? 268  GLU C CG  1 
ATOM   10431 C  CD  . GLU C  1 268 ? -11.881 8.903   25.203  1.00 96.57  ? 268  GLU C CD  1 
ATOM   10432 O  OE1 . GLU C  1 268 ? -12.403 7.797   24.928  1.00 98.38  ? 268  GLU C OE1 1 
ATOM   10433 O  OE2 . GLU C  1 268 ? -11.465 9.685   24.313  1.00 95.80  ? 268  GLU C OE2 1 
ATOM   10434 N  N   . LEU C  1 269 ? -7.333  9.391   28.115  1.00 44.97  ? 269  LEU C N   1 
ATOM   10435 C  CA  . LEU C  1 269 ? -6.405  10.394  28.624  1.00 31.47  ? 269  LEU C CA  1 
ATOM   10436 C  C   . LEU C  1 269 ? -5.552  10.845  27.482  1.00 26.96  ? 269  LEU C C   1 
ATOM   10437 O  O   . LEU C  1 269 ? -5.606  11.989  27.073  1.00 27.40  ? 269  LEU C O   1 
ATOM   10438 C  CB  . LEU C  1 269 ? -5.506  9.837   29.720  1.00 30.30  ? 269  LEU C CB  1 
ATOM   10439 C  CG  . LEU C  1 269 ? -4.856  10.898  30.610  1.00 29.98  ? 269  LEU C CG  1 
ATOM   10440 C  CD1 . LEU C  1 269 ? -5.676  11.050  31.872  1.00 37.42  ? 269  LEU C CD1 1 
ATOM   10441 C  CD2 . LEU C  1 269 ? -3.408  10.571  30.952  1.00 24.10  ? 269  LEU C CD2 1 
ATOM   10442 N  N   . ILE C  1 270 ? -4.768  9.913   26.962  1.00 34.83  ? 270  ILE C N   1 
ATOM   10443 C  CA  . ILE C  1 270 ? -3.781  10.193  25.926  1.00 35.16  ? 270  ILE C CA  1 
ATOM   10444 C  C   . ILE C  1 270 ? -4.426  10.825  24.703  1.00 36.48  ? 270  ILE C C   1 
ATOM   10445 O  O   . ILE C  1 270 ? -3.827  11.683  24.057  1.00 37.59  ? 270  ILE C O   1 
ATOM   10446 C  CB  . ILE C  1 270 ? -3.030  8.902   25.534  1.00 30.24  ? 270  ILE C CB  1 
ATOM   10447 C  CG1 . ILE C  1 270 ? -2.096  8.479   26.656  1.00 22.77  ? 270  ILE C CG1 1 
ATOM   10448 C  CG2 . ILE C  1 270 ? -2.244  9.058   24.243  1.00 27.37  ? 270  ILE C CG2 1 
ATOM   10449 C  CD1 . ILE C  1 270 ? -1.600  7.100   26.462  1.00 28.30  ? 270  ILE C CD1 1 
ATOM   10450 N  N   . ALA C  1 271 ? -5.653  10.414  24.400  1.00 21.61  ? 271  ALA C N   1 
ATOM   10451 C  CA  . ALA C  1 271 ? -6.367  10.974  23.262  1.00 40.91  ? 271  ALA C CA  1 
ATOM   10452 C  C   . ALA C  1 271 ? -6.456  12.458  23.495  1.00 37.90  ? 271  ALA C C   1 
ATOM   10453 O  O   . ALA C  1 271 ? -6.208  13.265  22.599  1.00 40.67  ? 271  ALA C O   1 
ATOM   10454 C  CB  . ALA C  1 271 ? -7.759  10.374  23.139  1.00 43.80  ? 271  ALA C CB  1 
ATOM   10455 N  N   . CYS C  1 272 ? -6.777  12.806  24.730  1.00 37.37  ? 272  CYS C N   1 
ATOM   10456 C  CA  . CYS C  1 272 ? -6.893  14.194  25.111  1.00 42.34  ? 272  CYS C CA  1 
ATOM   10457 C  C   . CYS C  1 272 ? -5.502  14.852  25.066  1.00 33.03  ? 272  CYS C C   1 
ATOM   10458 O  O   . CYS C  1 272 ? -5.360  15.969  24.572  1.00 27.14  ? 272  CYS C O   1 
ATOM   10459 C  CB  . CYS C  1 272 ? -7.594  14.314  26.481  1.00 48.11  ? 272  CYS C CB  1 
ATOM   10460 S  SG  . CYS C  1 272 ? -7.877  15.993  27.140  1.00 58.02  ? 272  CYS C SG  1 
ATOM   10461 N  N   . LEU C  1 273 ? -4.472  14.164  25.549  1.00 31.24  ? 273  LEU C N   1 
ATOM   10462 C  CA  . LEU C  1 273 ? -3.112  14.720  25.500  1.00 25.45  ? 273  LEU C CA  1 
ATOM   10463 C  C   . LEU C  1 273 ? -2.702  15.081  24.082  1.00 24.16  ? 273  LEU C C   1 
ATOM   10464 O  O   . LEU C  1 273 ? -1.922  15.997  23.877  1.00 30.28  ? 273  LEU C O   1 
ATOM   10465 C  CB  . LEU C  1 273 ? -2.080  13.777  26.116  1.00 18.45  ? 273  LEU C CB  1 
ATOM   10466 C  CG  . LEU C  1 273 ? -1.674  13.989  27.572  1.00 28.08  ? 273  LEU C CG  1 
ATOM   10467 C  CD1 . LEU C  1 273 ? -0.350  13.284  27.881  1.00 28.69  ? 273  LEU C CD1 1 
ATOM   10468 C  CD2 . LEU C  1 273 ? -1.551  15.461  27.857  1.00 23.95  ? 273  LEU C CD2 1 
ATOM   10469 N  N   . ARG C  1 274 ? -3.250  14.378  23.099  1.00 29.72  ? 274  ARG C N   1 
ATOM   10470 C  CA  . ARG C  1 274 ? -2.950  14.684  21.703  1.00 30.20  ? 274  ARG C CA  1 
ATOM   10471 C  C   . ARG C  1 274 ? -3.629  15.953  21.171  1.00 40.53  ? 274  ARG C C   1 
ATOM   10472 O  O   . ARG C  1 274 ? -3.140  16.535  20.212  1.00 45.39  ? 274  ARG C O   1 
ATOM   10473 C  CB  . ARG C  1 274 ? -3.266  13.487  20.806  1.00 24.87  ? 274  ARG C CB  1 
ATOM   10474 C  CG  . ARG C  1 274 ? -2.593  12.203  21.246  1.00 21.50  ? 274  ARG C CG  1 
ATOM   10475 C  CD  . ARG C  1 274 ? -2.715  11.123  20.197  1.00 26.95  ? 274  ARG C CD  1 
ATOM   10476 N  NE  . ARG C  1 274 ? -4.102  10.734  19.999  1.00 41.53  ? 274  ARG C NE  1 
ATOM   10477 C  CZ  . ARG C  1 274 ? -4.626  9.600   20.451  1.00 56.42  ? 274  ARG C CZ  1 
ATOM   10478 N  NH1 . ARG C  1 274 ? -3.854  8.746   21.112  1.00 57.35  ? 274  ARG C NH1 1 
ATOM   10479 N  NH2 . ARG C  1 274 ? -5.915  9.318   20.241  1.00 63.15  ? 274  ARG C NH2 1 
ATOM   10480 N  N   . THR C  1 275 ? -4.739  16.385  21.775  1.00 20.64  ? 275  THR C N   1 
ATOM   10481 C  CA  . THR C  1 275 ? -5.366  17.659  21.380  1.00 23.86  ? 275  THR C CA  1 
ATOM   10482 C  C   . THR C  1 275 ? -4.538  18.894  21.767  1.00 25.49  ? 275  THR C C   1 
ATOM   10483 O  O   . THR C  1 275 ? -4.647  19.954  21.160  1.00 30.37  ? 275  THR C O   1 
ATOM   10484 C  CB  . THR C  1 275 ? -6.799  17.843  21.959  1.00 31.18  ? 275  THR C CB  1 
ATOM   10485 O  OG1 . THR C  1 275 ? -6.736  18.058  23.375  1.00 23.31  ? 275  THR C OG1 1 
ATOM   10486 C  CG2 . THR C  1 275 ? -7.692  16.646  21.636  1.00 27.78  ? 275  THR C CG2 1 
ATOM   10487 N  N   . ARG C  1 276 ? -3.717  18.743  22.793  1.00 22.09  ? 276  ARG C N   1 
ATOM   10488 C  CA  . ARG C  1 276 ? -2.835  19.803  23.264  1.00 22.35  ? 276  ARG C CA  1 
ATOM   10489 C  C   . ARG C  1 276 ? -1.796  20.297  22.232  1.00 24.47  ? 276  ARG C C   1 
ATOM   10490 O  O   . ARG C  1 276 ? -1.110  19.499  21.594  1.00 21.91  ? 276  ARG C O   1 
ATOM   10491 C  CB  . ARG C  1 276 ? -2.091  19.308  24.510  1.00 19.17  ? 276  ARG C CB  1 
ATOM   10492 C  CG  . ARG C  1 276 ? -2.802  19.577  25.818  1.00 20.18  ? 276  ARG C CG  1 
ATOM   10493 C  CD  . ARG C  1 276 ? -4.261  19.340  25.678  1.00 21.49  ? 276  ARG C CD  1 
ATOM   10494 N  NE  . ARG C  1 276 ? -5.031  20.129  26.623  1.00 35.97  ? 276  ARG C NE  1 
ATOM   10495 C  CZ  . ARG C  1 276 ? -6.331  20.363  26.498  1.00 35.52  ? 276  ARG C CZ  1 
ATOM   10496 N  NH1 . ARG C  1 276 ? -6.992  19.875  25.459  1.00 24.53  ? 276  ARG C NH1 1 
ATOM   10497 N  NH2 . ARG C  1 276 ? -6.962  21.092  27.406  1.00 34.30  ? 276  ARG C NH2 1 
ATOM   10498 N  N   . PRO C  1 277 ? -1.670  21.627  22.087  1.00 28.71  ? 277  PRO C N   1 
ATOM   10499 C  CA  . PRO C  1 277 ? -0.58