data_4BHZ
# 
_entry.id   4BHZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BHZ         
PDBE  EBI-56431    
WWPDB D_1290056431 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4BI0 unspecified 'SCAFFOLD FOCUSED VIRTUAL SCREENING: PROSPECTIVE APPLICATION TO THE DISCOVERY OF TTK INHIBITOR' 
PDB 4BI1 unspecified 'SCAFFOLD FOCUSED VIRTUAL SCREENING: PROSPECTIVE APPLICATION TO THE DISCOVERY OF TTK INHIBITOR' 
PDB 4BI2 unspecified 'SCAFFOLD FOCUSED VIRTUAL SCREENING: PROSPECTIVE APPLICATION TO THE DISCOVERY OF TTK INHIBITOR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BHZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Langdon, S.R.'        1 
'Westwood, I.M.'       2 
'van Montfort, R.L.M.' 3 
'Brown, N.'            4 
'Blagg, J.'            5 
# 
_citation.id                        primary 
_citation.title                     
'Scaffold-Focused Virtual Screening: Prospective Application to the Discovery of Ttk Inhibitors.' 
_citation.journal_abbrev            J.Chem.Inf.Model 
_citation.journal_volume            53 
_citation.page_first                1100 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1549-9596 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23672464 
_citation.pdbx_database_id_DOI      10.1021/CI400100C 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Langdon, S.R.'        1 ? 
primary 'Westwood, I.M.'       2 ? 
primary 'Van Montfort, R.L.M.' 3 ? 
primary 'Brown, N.'            4 ? 
primary 'Blagg, J.'            5 ? 
# 
_cell.entry_id           4BHZ 
_cell.length_a           71.160 
_cell.length_b           111.680 
_cell.length_c           113.280 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BHZ 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DUAL SPECIFICITY PROTEIN KINASE TTK'                               36115.258 1 2.7.12.1 ? 
'KINASE DOMAIN, RESIDUES 518-807' ? 
2 non-polymer syn '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 310.384   2 ?        ? ? ? 
3 non-polymer syn 'thieno[2,3-c][2,6]naphthyridine'                                   186.233   1 ?        ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                                                      62.068    1 ?        ? ? ? 
5 water       nat water                                                               18.015    7 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PHOSPHOTYROSINE PICKED THREONINE-PROTEIN KINASE, PYT, MONOPOLAR SPINDLE KINASE 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYL
NKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLI
VDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQ
QIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYL
NKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLI
VDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQ
QIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  SER n 
1 25  VAL n 
1 26  LYS n 
1 27  GLY n 
1 28  ARG n 
1 29  ILE n 
1 30  TYR n 
1 31  SER n 
1 32  ILE n 
1 33  LEU n 
1 34  LYS n 
1 35  GLN n 
1 36  ILE n 
1 37  GLY n 
1 38  SER n 
1 39  GLY n 
1 40  GLY n 
1 41  SER n 
1 42  SER n 
1 43  LYS n 
1 44  VAL n 
1 45  PHE n 
1 46  GLN n 
1 47  VAL n 
1 48  LEU n 
1 49  ASN n 
1 50  GLU n 
1 51  LYS n 
1 52  LYS n 
1 53  GLN n 
1 54  ILE n 
1 55  TYR n 
1 56  ALA n 
1 57  ILE n 
1 58  LYS n 
1 59  TYR n 
1 60  VAL n 
1 61  ASN n 
1 62  LEU n 
1 63  GLU n 
1 64  GLU n 
1 65  ALA n 
1 66  ASP n 
1 67  ASN n 
1 68  GLN n 
1 69  THR n 
1 70  LEU n 
1 71  ASP n 
1 72  SER n 
1 73  TYR n 
1 74  ARG n 
1 75  ASN n 
1 76  GLU n 
1 77  ILE n 
1 78  ALA n 
1 79  TYR n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  LEU n 
1 84  GLN n 
1 85  GLN n 
1 86  HIS n 
1 87  SER n 
1 88  ASP n 
1 89  LYS n 
1 90  ILE n 
1 91  ILE n 
1 92  ARG n 
1 93  LEU n 
1 94  TYR n 
1 95  ASP n 
1 96  TYR n 
1 97  GLU n 
1 98  ILE n 
1 99  THR n 
1 100 ASP n 
1 101 GLN n 
1 102 TYR n 
1 103 ILE n 
1 104 TYR n 
1 105 MET n 
1 106 VAL n 
1 107 MET n 
1 108 GLU n 
1 109 CYS n 
1 110 GLY n 
1 111 ASN n 
1 112 ILE n 
1 113 ASP n 
1 114 LEU n 
1 115 ASN n 
1 116 SER n 
1 117 TRP n 
1 118 LEU n 
1 119 LYS n 
1 120 LYS n 
1 121 LYS n 
1 122 LYS n 
1 123 SER n 
1 124 ILE n 
1 125 ASP n 
1 126 PRO n 
1 127 TRP n 
1 128 GLU n 
1 129 ARG n 
1 130 LYS n 
1 131 SER n 
1 132 TYR n 
1 133 TRP n 
1 134 LYS n 
1 135 ASN n 
1 136 MET n 
1 137 LEU n 
1 138 GLU n 
1 139 ALA n 
1 140 VAL n 
1 141 HIS n 
1 142 THR n 
1 143 ILE n 
1 144 HIS n 
1 145 GLN n 
1 146 HIS n 
1 147 GLY n 
1 148 ILE n 
1 149 VAL n 
1 150 HIS n 
1 151 SER n 
1 152 ASP n 
1 153 LEU n 
1 154 LYS n 
1 155 PRO n 
1 156 ALA n 
1 157 ASN n 
1 158 PHE n 
1 159 LEU n 
1 160 ILE n 
1 161 VAL n 
1 162 ASP n 
1 163 GLY n 
1 164 MET n 
1 165 LEU n 
1 166 LYS n 
1 167 LEU n 
1 168 ILE n 
1 169 ASP n 
1 170 PHE n 
1 171 GLY n 
1 172 ILE n 
1 173 ALA n 
1 174 ASN n 
1 175 GLN n 
1 176 MET n 
1 177 GLN n 
1 178 PRO n 
1 179 ASP n 
1 180 THR n 
1 181 THR n 
1 182 SER n 
1 183 VAL n 
1 184 VAL n 
1 185 LYS n 
1 186 ASP n 
1 187 SER n 
1 188 GLN n 
1 189 VAL n 
1 190 GLY n 
1 191 THR n 
1 192 VAL n 
1 193 ASN n 
1 194 TYR n 
1 195 MET n 
1 196 PRO n 
1 197 PRO n 
1 198 GLU n 
1 199 ALA n 
1 200 ILE n 
1 201 LYS n 
1 202 ASP n 
1 203 MET n 
1 204 SER n 
1 205 SER n 
1 206 SER n 
1 207 ARG n 
1 208 GLU n 
1 209 ASN n 
1 210 GLY n 
1 211 LYS n 
1 212 SER n 
1 213 LYS n 
1 214 SER n 
1 215 LYS n 
1 216 ILE n 
1 217 SER n 
1 218 PRO n 
1 219 LYS n 
1 220 SER n 
1 221 ASP n 
1 222 VAL n 
1 223 TRP n 
1 224 SER n 
1 225 LEU n 
1 226 GLY n 
1 227 CYS n 
1 228 ILE n 
1 229 LEU n 
1 230 TYR n 
1 231 TYR n 
1 232 MET n 
1 233 THR n 
1 234 TYR n 
1 235 GLY n 
1 236 LYS n 
1 237 THR n 
1 238 PRO n 
1 239 PHE n 
1 240 GLN n 
1 241 GLN n 
1 242 ILE n 
1 243 ILE n 
1 244 ASN n 
1 245 GLN n 
1 246 ILE n 
1 247 SER n 
1 248 LYS n 
1 249 LEU n 
1 250 HIS n 
1 251 ALA n 
1 252 ILE n 
1 253 ILE n 
1 254 ASP n 
1 255 PRO n 
1 256 ASN n 
1 257 HIS n 
1 258 GLU n 
1 259 ILE n 
1 260 GLU n 
1 261 PHE n 
1 262 PRO n 
1 263 ASP n 
1 264 ILE n 
1 265 PRO n 
1 266 GLU n 
1 267 LYS n 
1 268 ASP n 
1 269 LEU n 
1 270 GLN n 
1 271 ASP n 
1 272 VAL n 
1 273 LEU n 
1 274 LYS n 
1 275 CYS n 
1 276 CYS n 
1 277 LEU n 
1 278 LYS n 
1 279 ARG n 
1 280 ASP n 
1 281 PRO n 
1 282 LYS n 
1 283 GLN n 
1 284 ARG n 
1 285 ILE n 
1 286 SER n 
1 287 ILE n 
1 288 PRO n 
1 289 GLU n 
1 290 LEU n 
1 291 LEU n 
1 292 ALA n 
1 293 HIS n 
1 294 PRO n 
1 295 TYR n 
1 296 VAL n 
1 297 GLN n 
1 298 ILE n 
1 299 GLN n 
1 300 THR n 
1 301 HIS n 
1 302 PRO n 
1 303 VAL n 
1 304 ASN n 
1 305 GLN n 
1 306 MET n 
1 307 ALA n 
1 308 LYS n 
1 309 GLY n 
1 310 THR n 
1 311 THR n 
1 312 GLU n 
1 313 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              AI 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TTK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P33981 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4BHZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 313 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P33981 
_struct_ref_seq.db_align_beg                  518 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  807 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       519 
_struct_ref_seq.pdbx_auth_seq_align_end       808 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4BHZ MET A 1  ? UNP P33981 ? ? 'expression tag' 496 1  
1 4BHZ HIS A 2  ? UNP P33981 ? ? 'expression tag' 497 2  
1 4BHZ HIS A 3  ? UNP P33981 ? ? 'expression tag' 498 3  
1 4BHZ HIS A 4  ? UNP P33981 ? ? 'expression tag' 499 4  
1 4BHZ HIS A 5  ? UNP P33981 ? ? 'expression tag' 500 5  
1 4BHZ HIS A 6  ? UNP P33981 ? ? 'expression tag' 501 6  
1 4BHZ HIS A 7  ? UNP P33981 ? ? 'expression tag' 502 7  
1 4BHZ SER A 8  ? UNP P33981 ? ? 'expression tag' 503 8  
1 4BHZ SER A 9  ? UNP P33981 ? ? 'expression tag' 504 9  
1 4BHZ GLY A 10 ? UNP P33981 ? ? 'expression tag' 505 10 
1 4BHZ VAL A 11 ? UNP P33981 ? ? 'expression tag' 506 11 
1 4BHZ ASP A 12 ? UNP P33981 ? ? 'expression tag' 507 12 
1 4BHZ LEU A 13 ? UNP P33981 ? ? 'expression tag' 508 13 
1 4BHZ GLY A 14 ? UNP P33981 ? ? 'expression tag' 509 14 
1 4BHZ THR A 15 ? UNP P33981 ? ? 'expression tag' 510 15 
1 4BHZ GLU A 16 ? UNP P33981 ? ? 'expression tag' 511 16 
1 4BHZ ASN A 17 ? UNP P33981 ? ? 'expression tag' 512 17 
1 4BHZ LEU A 18 ? UNP P33981 ? ? 'expression tag' 513 18 
1 4BHZ TYR A 19 ? UNP P33981 ? ? 'expression tag' 514 19 
1 4BHZ PHE A 20 ? UNP P33981 ? ? 'expression tag' 515 20 
1 4BHZ GLN A 21 ? UNP P33981 ? ? 'expression tag' 516 21 
1 4BHZ SER A 22 ? UNP P33981 ? ? 'expression tag' 517 22 
1 4BHZ MET A 23 ? UNP P33981 ? ? 'expression tag' 518 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
7PE non-polymer         . '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 'POLYETHYLENE GLYCOL FRAGMENT' 
'C14 H30 O7'     310.384 
ALA 'L-peptide linking' y ALANINE                                                             ?                              
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                            ?                              
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                          ?                              
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                     ?                              
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                            ?                              
'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                      'ETHYLENE GLYCOL'              
'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                           ?                              
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                     ?                              
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                             ?                              
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                           ?                              
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                               ?                              
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                          ?                              
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                             ?                              
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                              ?                              
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                          ?                              
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                       ?                              
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                             ?                              
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                              ?                              
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                           ?                              
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                          ?                              
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                            ?                              
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                              ?                              
'C5 H11 N O2'    117.146 
Z0B non-polymer         . 'thieno[2,3-c][2,6]naphthyridine'                                   ?                              
'C10 H6 N2 S'    186.233 
# 
_exptl.entry_id          4BHZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.12 
_exptl_crystal.density_percent_sol   60.66 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30-45% (V/V) PEG300, SITTING DROP VAPOUR DIFFUSION, 291K, pH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2011-04-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87260 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             0.87260 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BHZ 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             56.64 
_reflns.d_resolution_high            2.85 
_reflns.number_obs                   10886 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.90 
_reflns.B_iso_Wilson_estimate        88.28 
_reflns.pdbx_redundancy              4.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.85 
_reflns_shell.d_res_low              3.00 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.52 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.80 
_reflns_shell.pdbx_redundancy        4.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BHZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     10885 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             56.64 
_refine.ls_d_res_high                            2.85 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.1888 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1868 
_refine.ls_R_factor_R_free                       0.2300 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.62 
_refine.ls_number_reflns_R_free                  503 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9365 
_refine.correlation_coeff_Fo_to_Fc_free          0.9097 
_refine.B_iso_mean                               77.99 
_refine.aniso_B[1][1]                            11.5272 
_refine.aniso_B[2][2]                            3.7545 
_refine.aniso_B[3][3]                            -15.2817 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2ZMC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.451 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.282 
_refine.pdbx_overall_SU_R_Blow_DPI               0.444 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.277 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4BHZ 
_refine_analyze.Luzzati_coordinate_error_obs    0.389 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1971 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             7 
_refine_hist.number_atoms_total               2021 
_refine_hist.d_res_high                       2.85 
_refine_hist.d_res_low                        56.64 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  2057 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.15  ? 2.00  2785 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  697  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  53   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  305  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 2057 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           2.64  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           21.86 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  275  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  2291 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   5 
_refine_ls_shell.d_res_high                       2.85 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             2890 
_refine_ls_shell.R_factor_R_work                  0.2071 
_refine_ls_shell.percent_reflns_obs               99.99 
_refine_ls_shell.R_factor_R_free                  0.2636 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.78 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                3035 
_refine_ls_shell.R_factor_all                     0.2099 
# 
_struct.entry_id                  4BHZ 
_struct.title                     'Scaffold Focused Virtual Screening: Prospective Application to the Discovery of TTK Inhibitor' 
_struct.pdbx_descriptor           'DUAL SPECIFICITY PROTEIN KINASE TTK (E.C.2.7.12.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BHZ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, MITOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 66  ? GLN A 84  ? ASP A 561 GLN A 579 1 ? 19 
HELX_P HELX_P2  2  LEU A 114 ? LYS A 121 ? LEU A 609 LYS A 616 1 ? 8  
HELX_P HELX_P3  3  ASP A 125 ? HIS A 146 ? ASP A 620 HIS A 641 1 ? 22 
HELX_P HELX_P4  4  LYS A 154 ? ALA A 156 ? LYS A 649 ALA A 651 5 ? 3  
HELX_P HELX_P5  5  PRO A 196 ? ASP A 202 ? PRO A 691 ASP A 697 1 ? 7  
HELX_P HELX_P6  6  SER A 217 ? GLY A 235 ? SER A 712 GLY A 730 1 ? 19 
HELX_P HELX_P7  7  ASN A 244 ? ASP A 254 ? ASN A 739 ASP A 749 1 ? 11 
HELX_P HELX_P8  8  GLU A 266 ? LEU A 277 ? GLU A 761 LEU A 772 1 ? 12 
HELX_P HELX_P9  9  ASP A 280 ? ARG A 284 ? ASP A 775 ARG A 779 5 ? 5  
HELX_P HELX_P10 10 SER A 286 ? LEU A 291 ? SER A 781 LEU A 786 1 ? 6  
HELX_P HELX_P11 11 HIS A 293 ? ILE A 298 ? HIS A 788 ILE A 793 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 SER A 22  ? VAL A 25  ? SER A 517 VAL A 520 
AA 2 ARG A 28  ? GLN A 35  ? ARG A 523 GLN A 530 
AA 3 SER A 42  ? ASN A 49  ? SER A 537 ASN A 544 
AA 4 ILE A 54  ? ASN A 61  ? ILE A 549 ASN A 556 
AA 5 TYR A 102 ? MET A 107 ? TYR A 597 MET A 602 
AA 6 LEU A 93  ? ILE A 98  ? LEU A 588 ILE A 593 
AB 1 ILE A 112 ? ASP A 113 ? ILE A 607 ASP A 608 
AB 2 PHE A 158 ? ILE A 160 ? PHE A 653 ILE A 655 
AB 3 LEU A 165 ? LEU A 167 ? LEU A 660 LEU A 662 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 25  ? N VAL A 520 O ARG A 28  ? O ARG A 523 
AA 2 3 N LEU A 33  ? N LEU A 528 O GLN A 46  ? O GLN A 541 
AA 3 4 N VAL A 47  ? N VAL A 542 O TYR A 55  ? O TYR A 550 
AA 4 5 N VAL A 60  ? N VAL A 555 O ILE A 103 ? O ILE A 598 
AA 5 6 O VAL A 106 ? O VAL A 601 N TYR A 94  ? N TYR A 589 
AB 1 2 O ILE A 112 ? O ILE A 607 N ILE A 160 ? N ILE A 655 
AB 2 3 N LEU A 159 ? N LEU A 654 O LYS A 166 ? O LYS A 661 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE 7PE A 1795' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE 7PE A 1796' 
AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE Z0B A 1797' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 1798' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 SER A 42  ? SER A 537  . ? 1_555 ? 
2  AC1 9 VAL A 44  ? VAL A 539  . ? 1_555 ? 
3  AC1 9 LYS A 58  ? LYS A 553  . ? 1_555 ? 
4  AC1 9 VAL A 60  ? VAL A 555  . ? 1_555 ? 
5  AC1 9 TYR A 73  ? TYR A 568  . ? 1_555 ? 
6  AC1 9 GLU A 76  ? GLU A 571  . ? 1_555 ? 
7  AC1 9 MET A 105 ? MET A 600  . ? 1_555 ? 
8  AC1 9 ILE A 168 ? ILE A 663  . ? 1_555 ? 
9  AC1 9 Z0B D .   ? Z0B A 1797 . ? 1_555 ? 
10 AC2 6 TRP A 127 ? TRP A 622  . ? 1_555 ? 
11 AC2 6 LYS A 130 ? LYS A 625  . ? 1_555 ? 
12 AC2 6 SER A 131 ? SER A 626  . ? 1_555 ? 
13 AC2 6 LYS A 134 ? LYS A 629  . ? 1_555 ? 
14 AC2 6 VAL A 296 ? VAL A 791  . ? 1_555 ? 
15 AC2 6 GLN A 297 ? GLN A 792  . ? 1_555 ? 
16 AC3 8 ILE A 36  ? ILE A 531  . ? 1_555 ? 
17 AC3 8 ALA A 56  ? ALA A 551  . ? 1_555 ? 
18 AC3 8 ILE A 91  ? ILE A 586  . ? 1_555 ? 
19 AC3 8 GLU A 108 ? GLU A 603  . ? 1_555 ? 
20 AC3 8 GLY A 110 ? GLY A 605  . ? 1_555 ? 
21 AC3 8 LEU A 159 ? LEU A 654  . ? 1_555 ? 
22 AC3 8 7PE B .   ? 7PE A 1795 . ? 1_555 ? 
23 AC3 8 EDO E .   ? EDO A 1798 . ? 1_555 ? 
24 AC4 4 LYS A 34  ? LYS A 529  . ? 1_555 ? 
25 AC4 4 GLN A 46  ? GLN A 541  . ? 1_555 ? 
26 AC4 4 ASN A 111 ? ASN A 606  . ? 1_555 ? 
27 AC4 4 Z0B D .   ? Z0B A 1797 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BHZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BHZ 
_atom_sites.fract_transf_matrix[1][1]   0.014053 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008954 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008828 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 21  ? 13.613  -57.739 16.941 1.00 109.53 ? 516  GLN A N   1 
ATOM   2    C CA  . GLN A 1 21  ? 14.048  -56.345 17.070 1.00 105.90 ? 516  GLN A CA  1 
ATOM   3    C C   . GLN A 1 21  ? 13.700  -55.806 18.463 1.00 107.48 ? 516  GLN A C   1 
ATOM   4    O O   . GLN A 1 21  ? 12.568  -55.991 18.925 1.00 108.06 ? 516  GLN A O   1 
ATOM   5    C CB  . GLN A 1 21  ? 13.434  -55.475 15.960 1.00 105.84 ? 516  GLN A CB  1 
ATOM   6    N N   . SER A 1 22  ? 14.673  -55.158 19.140 1.00 100.28 ? 517  SER A N   1 
ATOM   7    C CA  . SER A 1 22  ? 14.485  -54.661 20.504 1.00 96.87  ? 517  SER A CA  1 
ATOM   8    C C   . SER A 1 22  ? 15.028  -53.240 20.748 1.00 97.17  ? 517  SER A C   1 
ATOM   9    O O   . SER A 1 22  ? 15.686  -52.672 19.872 1.00 98.06  ? 517  SER A O   1 
ATOM   10   C CB  . SER A 1 22  ? 15.104  -55.644 21.494 1.00 100.67 ? 517  SER A CB  1 
ATOM   11   O OG  . SER A 1 22  ? 14.806  -55.289 22.833 1.00 105.17 ? 517  SER A OG  1 
ATOM   12   N N   . MET A 1 23  ? 14.718  -52.661 21.944 1.00 88.72  ? 518  MET A N   1 
ATOM   13   C CA  . MET A 1 23  ? 15.167  -51.340 22.421 1.00 84.35  ? 518  MET A CA  1 
ATOM   14   C C   . MET A 1 23  ? 14.975  -51.090 23.931 1.00 84.34  ? 518  MET A C   1 
ATOM   15   O O   . MET A 1 23  ? 14.024  -51.602 24.534 1.00 83.96  ? 518  MET A O   1 
ATOM   16   C CB  . MET A 1 23  ? 14.690  -50.166 21.551 1.00 84.39  ? 518  MET A CB  1 
ATOM   17   C CG  . MET A 1 23  ? 13.209  -50.039 21.414 1.00 86.86  ? 518  MET A CG  1 
ATOM   18   S SD  . MET A 1 23  ? 12.882  -48.322 20.970 1.00 88.74  ? 518  MET A SD  1 
ATOM   19   C CE  . MET A 1 23  ? 12.167  -48.525 19.367 1.00 86.19  ? 518  MET A CE  1 
ATOM   20   N N   . SER A 1 24  ? 15.912  -50.331 24.539 1.00 78.35  ? 519  SER A N   1 
ATOM   21   C CA  . SER A 1 24  ? 15.921  -50.026 25.970 1.00 77.16  ? 519  SER A CA  1 
ATOM   22   C C   . SER A 1 24  ? 15.652  -48.553 26.345 1.00 77.73  ? 519  SER A C   1 
ATOM   23   O O   . SER A 1 24  ? 16.495  -47.670 26.120 1.00 77.44  ? 519  SER A O   1 
ATOM   24   C CB  . SER A 1 24  ? 17.205  -50.536 26.624 1.00 82.06  ? 519  SER A CB  1 
ATOM   25   O OG  . SER A 1 24  ? 17.490  -49.883 27.854 1.00 92.93  ? 519  SER A OG  1 
ATOM   26   N N   . VAL A 1 25  ? 14.502  -48.318 26.981 1.00 71.27  ? 520  VAL A N   1 
ATOM   27   C CA  . VAL A 1 25  ? 14.141  -47.002 27.495 1.00 69.42  ? 520  VAL A CA  1 
ATOM   28   C C   . VAL A 1 25  ? 14.174  -47.127 29.023 1.00 74.39  ? 520  VAL A C   1 
ATOM   29   O O   . VAL A 1 25  ? 13.497  -48.007 29.562 1.00 76.21  ? 520  VAL A O   1 
ATOM   30   C CB  . VAL A 1 25  ? 12.784  -46.450 26.965 1.00 71.47  ? 520  VAL A CB  1 
ATOM   31   C CG1 . VAL A 1 25  ? 12.619  -44.975 27.315 1.00 68.65  ? 520  VAL A CG1 1 
ATOM   32   C CG2 . VAL A 1 25  ? 12.663  -46.646 25.457 1.00 71.66  ? 520  VAL A CG2 1 
ATOM   33   N N   . LYS A 1 26  ? 14.993  -46.272 29.708 1.00 68.94  ? 521  LYS A N   1 
ATOM   34   C CA  . LYS A 1 26  ? 15.201  -46.217 31.169 1.00 68.58  ? 521  LYS A CA  1 
ATOM   35   C C   . LYS A 1 26  ? 15.276  -47.617 31.810 1.00 76.91  ? 521  LYS A C   1 
ATOM   36   O O   . LYS A 1 26  ? 14.418  -47.980 32.626 1.00 78.36  ? 521  LYS A O   1 
ATOM   37   C CB  . LYS A 1 26  ? 14.183  -45.284 31.871 1.00 67.53  ? 521  LYS A CB  1 
ATOM   38   C CG  . LYS A 1 26  ? 14.386  -43.794 31.545 1.00 68.19  ? 521  LYS A CG  1 
ATOM   39   C CD  . LYS A 1 26  ? 15.078  -43.008 32.672 1.00 63.07  ? 521  LYS A CD  1 
ATOM   40   C CE  . LYS A 1 26  ? 14.338  -41.742 33.048 1.00 82.65  ? 521  LYS A CE  1 
ATOM   41   N NZ  . LYS A 1 26  ? 12.955  -41.979 33.579 1.00 88.88  ? 521  LYS A NZ  1 
ATOM   42   N N   . GLY A 1 27  ? 16.243  -48.420 31.355 1.00 74.24  ? 522  GLY A N   1 
ATOM   43   C CA  . GLY A 1 27  ? 16.451  -49.772 31.857 1.00 76.90  ? 522  GLY A CA  1 
ATOM   44   C C   . GLY A 1 27  ? 15.414  -50.826 31.490 1.00 83.38  ? 522  GLY A C   1 
ATOM   45   O O   . GLY A 1 27  ? 15.656  -52.015 31.723 1.00 86.74  ? 522  GLY A O   1 
ATOM   46   N N   . ARG A 1 28  ? 14.256  -50.431 30.914 1.00 76.87  ? 523  ARG A N   1 
ATOM   47   C CA  . ARG A 1 28  ? 13.213  -51.387 30.534 1.00 76.60  ? 523  ARG A CA  1 
ATOM   48   C C   . ARG A 1 28  ? 13.309  -51.780 29.053 1.00 80.35  ? 523  ARG A C   1 
ATOM   49   O O   . ARG A 1 28  ? 13.498  -50.922 28.203 1.00 77.31  ? 523  ARG A O   1 
ATOM   50   C CB  . ARG A 1 28  ? 11.818  -50.868 30.918 1.00 74.14  ? 523  ARG A CB  1 
ATOM   51   C CG  . ARG A 1 28  ? 11.595  -50.715 32.430 1.00 80.09  ? 523  ARG A CG  1 
ATOM   52   N N   . ILE A 1 29  ? 13.242  -53.092 28.761 1.00 81.74  ? 524  ILE A N   1 
ATOM   53   C CA  . ILE A 1 29  ? 13.333  -53.664 27.408 1.00 81.93  ? 524  ILE A CA  1 
ATOM   54   C C   . ILE A 1 29  ? 11.966  -53.682 26.699 1.00 84.85  ? 524  ILE A C   1 
ATOM   55   O O   . ILE A 1 29  ? 10.951  -54.076 27.296 1.00 84.69  ? 524  ILE A O   1 
ATOM   56   C CB  . ILE A 1 29  ? 14.027  -55.049 27.421 1.00 87.57  ? 524  ILE A CB  1 
ATOM   57   N N   . TYR A 1 30  ? 11.951  -53.188 25.436 1.00 79.36  ? 525  TYR A N   1 
ATOM   58   C CA  . TYR A 1 30  ? 10.775  -53.078 24.562 1.00 77.35  ? 525  TYR A CA  1 
ATOM   59   C C   . TYR A 1 30  ? 11.033  -53.747 23.224 1.00 83.21  ? 525  TYR A C   1 
ATOM   60   O O   . TYR A 1 30  ? 12.053  -53.478 22.578 1.00 82.69  ? 525  TYR A O   1 
ATOM   61   C CB  . TYR A 1 30  ? 10.403  -51.607 24.314 1.00 74.05  ? 525  TYR A CB  1 
ATOM   62   C CG  . TYR A 1 30  ? 9.929   -50.874 25.544 1.00 72.35  ? 525  TYR A CG  1 
ATOM   63   C CD1 . TYR A 1 30  ? 8.580   -50.859 25.896 1.00 72.12  ? 525  TYR A CD1 1 
ATOM   64   C CD2 . TYR A 1 30  ? 10.824  -50.169 26.347 1.00 73.09  ? 525  TYR A CD2 1 
ATOM   65   C CE1 . TYR A 1 30  ? 8.136   -50.179 27.030 1.00 71.79  ? 525  TYR A CE1 1 
ATOM   66   C CE2 . TYR A 1 30  ? 10.391  -49.475 27.477 1.00 72.81  ? 525  TYR A CE2 1 
ATOM   67   C CZ  . TYR A 1 30  ? 9.046   -49.486 27.816 1.00 79.53  ? 525  TYR A CZ  1 
ATOM   68   O OH  . TYR A 1 30  ? 8.629   -48.811 28.935 1.00 80.87  ? 525  TYR A OH  1 
ATOM   69   N N   . SER A 1 31  ? 10.095  -54.594 22.797 1.00 81.82  ? 526  SER A N   1 
ATOM   70   C CA  . SER A 1 31  ? 10.181  -55.327 21.536 1.00 83.85  ? 526  SER A CA  1 
ATOM   71   C C   . SER A 1 31  ? 9.351   -54.595 20.487 1.00 87.32  ? 526  SER A C   1 
ATOM   72   O O   . SER A 1 31  ? 8.180   -54.310 20.746 1.00 86.43  ? 526  SER A O   1 
ATOM   73   C CB  . SER A 1 31  ? 9.655   -56.749 21.720 1.00 89.60  ? 526  SER A CB  1 
ATOM   74   O OG  . SER A 1 31  ? 10.102  -57.313 22.942 1.00 98.21  ? 526  SER A OG  1 
ATOM   75   N N   . ILE A 1 32  ? 9.949   -54.282 19.315 1.00 83.63  ? 527  ILE A N   1 
ATOM   76   C CA  . ILE A 1 32  ? 9.244   -53.589 18.227 1.00 82.65  ? 527  ILE A CA  1 
ATOM   77   C C   . ILE A 1 32  ? 8.259   -54.554 17.533 1.00 88.89  ? 527  ILE A C   1 
ATOM   78   O O   . ILE A 1 32  ? 8.600   -55.717 17.351 1.00 92.34  ? 527  ILE A O   1 
ATOM   79   C CB  . ILE A 1 32  ? 10.231  -52.897 17.220 1.00 85.57  ? 527  ILE A CB  1 
ATOM   80   C CG1 . ILE A 1 32  ? 11.115  -51.837 17.916 1.00 83.93  ? 527  ILE A CG1 1 
ATOM   81   C CG2 . ILE A 1 32  ? 9.479   -52.246 16.045 1.00 86.39  ? 527  ILE A CG2 1 
ATOM   82   C CD1 . ILE A 1 32  ? 12.400  -51.467 17.168 1.00 94.40  ? 527  ILE A CD1 1 
ATOM   83   N N   . LEU A 1 33  ? 7.041   -54.090 17.183 1.00 83.80  ? 528  LEU A N   1 
ATOM   84   C CA  . LEU A 1 33  ? 6.057   -54.906 16.456 1.00 85.84  ? 528  LEU A CA  1 
ATOM   85   C C   . LEU A 1 33  ? 5.945   -54.370 15.032 1.00 92.26  ? 528  LEU A C   1 
ATOM   86   O O   . LEU A 1 33  ? 5.982   -55.153 14.079 1.00 96.58  ? 528  LEU A O   1 
ATOM   87   C CB  . LEU A 1 33  ? 4.656   -54.921 17.103 1.00 84.78  ? 528  LEU A CB  1 
ATOM   88   C CG  . LEU A 1 33  ? 4.523   -55.349 18.556 1.00 88.73  ? 528  LEU A CG  1 
ATOM   89   C CD1 . LEU A 1 33  ? 3.133   -55.037 19.079 1.00 87.79  ? 528  LEU A CD1 1 
ATOM   90   C CD2 . LEU A 1 33  ? 4.825   -56.809 18.739 1.00 91.94  ? 528  LEU A CD2 1 
ATOM   91   N N   . LYS A 1 34  ? 5.790   -53.038 14.891 1.00 85.08  ? 529  LYS A N   1 
ATOM   92   C CA  . LYS A 1 34  ? 5.668   -52.352 13.604 1.00 84.60  ? 529  LYS A CA  1 
ATOM   93   C C   . LYS A 1 34  ? 6.001   -50.867 13.739 1.00 86.17  ? 529  LYS A C   1 
ATOM   94   O O   . LYS A 1 34  ? 5.962   -50.327 14.841 1.00 84.52  ? 529  LYS A O   1 
ATOM   95   C CB  . LYS A 1 34  ? 4.267   -52.564 12.969 1.00 87.50  ? 529  LYS A CB  1 
ATOM   96   C CG  . LYS A 1 34  ? 3.074   -51.960 13.715 1.00 84.25  ? 529  LYS A CG  1 
ATOM   97   C CD  . LYS A 1 34  ? 1.750   -52.340 13.041 1.00 85.58  ? 529  LYS A CD  1 
ATOM   98   C CE  . LYS A 1 34  ? 0.586   -51.411 13.366 1.00 79.80  ? 529  LYS A CE  1 
ATOM   99   N N   . GLN A 1 35  ? 6.342   -50.217 12.629 1.00 82.55  ? 530  GLN A N   1 
ATOM   100  C CA  . GLN A 1 35  ? 6.615   -48.796 12.629 1.00 80.74  ? 530  GLN A CA  1 
ATOM   101  C C   . GLN A 1 35  ? 5.299   -48.085 12.336 1.00 87.12  ? 530  GLN A C   1 
ATOM   102  O O   . GLN A 1 35  ? 4.543   -48.530 11.465 1.00 89.81  ? 530  GLN A O   1 
ATOM   103  C CB  . GLN A 1 35  ? 7.636   -48.451 11.549 1.00 83.53  ? 530  GLN A CB  1 
ATOM   104  C CG  . GLN A 1 35  ? 8.291   -47.095 11.761 1.00 109.23 ? 530  GLN A CG  1 
ATOM   105  C CD  . GLN A 1 35  ? 8.577   -46.413 10.456 1.00 136.22 ? 530  GLN A CD  1 
ATOM   106  O OE1 . GLN A 1 35  ? 9.685   -46.508 9.917  1.00 134.15 ? 530  GLN A OE1 1 
ATOM   107  N NE2 . GLN A 1 35  ? 7.574   -45.727 9.910  1.00 130.17 ? 530  GLN A NE2 1 
ATOM   108  N N   . ILE A 1 36  ? 5.008   -46.998 13.058 1.00 81.24  ? 531  ILE A N   1 
ATOM   109  C CA  . ILE A 1 36  ? 3.788   -46.235 12.789 1.00 80.35  ? 531  ILE A CA  1 
ATOM   110  C C   . ILE A 1 36  ? 4.140   -45.010 11.878 1.00 88.51  ? 531  ILE A C   1 
ATOM   111  O O   . ILE A 1 36  ? 3.809   -45.022 10.687 1.00 90.16  ? 531  ILE A O   1 
ATOM   112  C CB  . ILE A 1 36  ? 2.992   -45.899 14.082 1.00 79.78  ? 531  ILE A CB  1 
ATOM   113  C CG1 . ILE A 1 36  ? 2.559   -47.197 14.824 1.00 79.84  ? 531  ILE A CG1 1 
ATOM   114  C CG2 . ILE A 1 36  ? 1.805   -44.999 13.755 1.00 78.19  ? 531  ILE A CG2 1 
ATOM   115  C CD1 . ILE A 1 36  ? 2.265   -47.014 16.359 1.00 77.79  ? 531  ILE A CD1 1 
ATOM   116  N N   . GLY A 1 37  ? 4.879   -44.037 12.424 1.00 84.90  ? 532  GLY A N   1 
ATOM   117  C CA  . GLY A 1 37  ? 5.311   -42.845 11.705 1.00 107.80 ? 532  GLY A CA  1 
ATOM   118  C C   . GLY A 1 37  ? 6.775   -42.883 11.328 1.00 118.93 ? 532  GLY A C   1 
ATOM   119  O O   . GLY A 1 37  ? 7.333   -41.868 10.915 1.00 84.58  ? 532  GLY A O   1 
ATOM   120  N N   . SER A 1 41  ? 14.340  -37.622 10.836 1.00 98.94  ? 536  SER A N   1 
ATOM   121  C CA  . SER A 1 41  ? 14.554  -37.151 12.209 1.00 96.63  ? 536  SER A CA  1 
ATOM   122  C C   . SER A 1 41  ? 13.797  -37.983 13.259 1.00 96.88  ? 536  SER A C   1 
ATOM   123  O O   . SER A 1 41  ? 14.406  -38.408 14.242 1.00 96.25  ? 536  SER A O   1 
ATOM   124  C CB  . SER A 1 41  ? 14.182  -35.675 12.348 1.00 98.96  ? 536  SER A CB  1 
ATOM   125  O OG  . SER A 1 41  ? 12.774  -35.485 12.343 1.00 108.03 ? 536  SER A OG  1 
ATOM   126  N N   . SER A 1 42  ? 12.468  -38.191 13.063 1.00 89.92  ? 537  SER A N   1 
ATOM   127  C CA  . SER A 1 42  ? 11.636  -38.931 14.011 1.00 86.39  ? 537  SER A CA  1 
ATOM   128  C C   . SER A 1 42  ? 10.845  -40.095 13.431 1.00 87.73  ? 537  SER A C   1 
ATOM   129  O O   . SER A 1 42  ? 10.152  -39.938 12.421 1.00 88.85  ? 537  SER A O   1 
ATOM   130  C CB  . SER A 1 42  ? 10.713  -37.996 14.780 1.00 86.77  ? 537  SER A CB  1 
ATOM   131  O OG  . SER A 1 42  ? 10.118  -37.069 13.890 1.00 98.45  ? 537  SER A OG  1 
ATOM   132  N N   . LYS A 1 43  ? 10.944  -41.258 14.108 1.00 79.90  ? 538  LYS A N   1 
ATOM   133  C CA  . LYS A 1 43  ? 10.256  -42.508 13.810 1.00 78.55  ? 538  LYS A CA  1 
ATOM   134  C C   . LYS A 1 43  ? 9.378   -42.890 15.022 1.00 78.05  ? 538  LYS A C   1 
ATOM   135  O O   . LYS A 1 43  ? 9.830   -42.762 16.155 1.00 77.25  ? 538  LYS A O   1 
ATOM   136  C CB  . LYS A 1 43  ? 11.289  -43.615 13.517 1.00 82.11  ? 538  LYS A CB  1 
ATOM   137  N N   . VAL A 1 44  ? 8.123   -43.310 14.793 1.00 71.79  ? 539  VAL A N   1 
ATOM   138  C CA  . VAL A 1 44  ? 7.212   -43.757 15.863 1.00 69.18  ? 539  VAL A CA  1 
ATOM   139  C C   . VAL A 1 44  ? 6.987   -45.266 15.635 1.00 73.80  ? 539  VAL A C   1 
ATOM   140  O O   . VAL A 1 44  ? 6.802   -45.690 14.492 1.00 74.82  ? 539  VAL A O   1 
ATOM   141  C CB  . VAL A 1 44  ? 5.871   -42.955 15.945 1.00 70.75  ? 539  VAL A CB  1 
ATOM   142  C CG1 . VAL A 1 44  ? 5.027   -43.378 17.153 1.00 69.19  ? 539  VAL A CG1 1 
ATOM   143  C CG2 . VAL A 1 44  ? 6.121   -41.449 15.982 1.00 69.01  ? 539  VAL A CG2 1 
ATOM   144  N N   . PHE A 1 45  ? 7.020   -46.068 16.707 1.00 69.78  ? 540  PHE A N   1 
ATOM   145  C CA  . PHE A 1 45  ? 6.846   -47.522 16.609 1.00 71.72  ? 540  PHE A CA  1 
ATOM   146  C C   . PHE A 1 45  ? 5.811   -48.058 17.576 1.00 73.87  ? 540  PHE A C   1 
ATOM   147  O O   . PHE A 1 45  ? 5.619   -47.495 18.650 1.00 72.51  ? 540  PHE A O   1 
ATOM   148  C CB  . PHE A 1 45  ? 8.163   -48.258 16.928 1.00 74.79  ? 540  PHE A CB  1 
ATOM   149  C CG  . PHE A 1 45  ? 9.374   -47.793 16.172 1.00 77.40  ? 540  PHE A CG  1 
ATOM   150  C CD1 . PHE A 1 45  ? 9.721   -48.377 14.958 1.00 83.03  ? 540  PHE A CD1 1 
ATOM   151  C CD2 . PHE A 1 45  ? 10.210  -46.811 16.700 1.00 78.35  ? 540  PHE A CD2 1 
ATOM   152  C CE1 . PHE A 1 45  ? 10.870  -47.969 14.270 1.00 84.47  ? 540  PHE A CE1 1 
ATOM   153  C CE2 . PHE A 1 45  ? 11.354  -46.398 16.008 1.00 81.93  ? 540  PHE A CE2 1 
ATOM   154  C CZ  . PHE A 1 45  ? 11.683  -46.990 14.804 1.00 82.07  ? 540  PHE A CZ  1 
ATOM   155  N N   . GLN A 1 46  ? 5.225   -49.207 17.235 1.00 70.14  ? 541  GLN A N   1 
ATOM   156  C CA  . GLN A 1 46  ? 4.336   -49.942 18.107 1.00 70.04  ? 541  GLN A CA  1 
ATOM   157  C C   . GLN A 1 46  ? 5.215   -51.013 18.780 1.00 77.26  ? 541  GLN A C   1 
ATOM   158  O O   . GLN A 1 46  ? 5.906   -51.785 18.094 1.00 78.99  ? 541  GLN A O   1 
ATOM   159  C CB  . GLN A 1 46  ? 3.219   -50.578 17.308 1.00 72.63  ? 541  GLN A CB  1 
ATOM   160  C CG  . GLN A 1 46  ? 2.089   -51.037 18.192 1.00 80.85  ? 541  GLN A CG  1 
ATOM   161  C CD  . GLN A 1 46  ? 1.153   -51.914 17.427 1.00 92.96  ? 541  GLN A CD  1 
ATOM   162  O OE1 . GLN A 1 46  ? 1.564   -52.733 16.604 1.00 90.98  ? 541  GLN A OE1 1 
ATOM   163  N NE2 . GLN A 1 46  ? -0.124  -51.779 17.707 1.00 80.48  ? 541  GLN A NE2 1 
ATOM   164  N N   . VAL A 1 47  ? 5.247   -51.008 20.126 1.00 72.39  ? 542  VAL A N   1 
ATOM   165  C CA  . VAL A 1 47  ? 6.117   -51.905 20.899 1.00 72.21  ? 542  VAL A CA  1 
ATOM   166  C C   . VAL A 1 47  ? 5.398   -52.717 22.008 1.00 75.96  ? 542  VAL A C   1 
ATOM   167  O O   . VAL A 1 47  ? 4.274   -52.385 22.384 1.00 75.10  ? 542  VAL A O   1 
ATOM   168  C CB  . VAL A 1 47  ? 7.337   -51.119 21.463 1.00 72.95  ? 542  VAL A CB  1 
ATOM   169  C CG1 . VAL A 1 47  ? 8.127   -50.432 20.349 1.00 71.44  ? 542  VAL A CG1 1 
ATOM   170  C CG2 . VAL A 1 47  ? 6.898   -50.112 22.515 1.00 70.38  ? 542  VAL A CG2 1 
ATOM   171  N N   . LEU A 1 48  ? 6.072   -53.761 22.538 1.00 72.54  ? 543  LEU A N   1 
ATOM   172  C CA  . LEU A 1 48  ? 5.609   -54.575 23.660 1.00 73.34  ? 543  LEU A CA  1 
ATOM   173  C C   . LEU A 1 48  ? 6.665   -54.525 24.767 1.00 75.98  ? 543  LEU A C   1 
ATOM   174  O O   . LEU A 1 48  ? 7.844   -54.731 24.469 1.00 76.06  ? 543  LEU A O   1 
ATOM   175  C CB  . LEU A 1 48  ? 5.456   -56.049 23.250 1.00 77.18  ? 543  LEU A CB  1 
ATOM   176  C CG  . LEU A 1 48  ? 4.188   -56.538 22.574 1.00 82.25  ? 543  LEU A CG  1 
ATOM   177  C CD1 . LEU A 1 48  ? 4.311   -57.977 22.304 1.00 83.88  ? 543  LEU A CD1 1 
ATOM   178  C CD2 . LEU A 1 48  ? 2.939   -56.278 23.430 1.00 86.05  ? 543  LEU A CD2 1 
ATOM   179  N N   . ASN A 1 49  ? 6.259   -54.318 26.038 1.00 71.88  ? 544  ASN A N   1 
ATOM   180  C CA  . ASN A 1 49  ? 7.212   -54.345 27.154 1.00 72.81  ? 544  ASN A CA  1 
ATOM   181  C C   . ASN A 1 49  ? 7.443   -55.796 27.688 1.00 83.14  ? 544  ASN A C   1 
ATOM   182  O O   . ASN A 1 49  ? 6.901   -56.765 27.122 1.00 84.67  ? 544  ASN A O   1 
ATOM   183  C CB  . ASN A 1 49  ? 6.806   -53.362 28.271 1.00 71.62  ? 544  ASN A CB  1 
ATOM   184  C CG  . ASN A 1 49  ? 5.633   -53.751 29.144 1.00 88.43  ? 544  ASN A CG  1 
ATOM   185  O OD1 . ASN A 1 49  ? 4.935   -54.731 28.921 1.00 87.89  ? 544  ASN A OD1 1 
ATOM   186  N ND2 . ASN A 1 49  ? 5.377   -52.968 30.169 1.00 78.84  ? 544  ASN A ND2 1 
ATOM   187  N N   . GLU A 1 50  ? 8.257   -55.938 28.771 1.00 81.70  ? 545  GLU A N   1 
ATOM   188  C CA  . GLU A 1 50  ? 8.574   -57.223 29.417 1.00 84.55  ? 545  GLU A CA  1 
ATOM   189  C C   . GLU A 1 50  ? 7.292   -57.910 29.973 1.00 91.59  ? 545  GLU A C   1 
ATOM   190  O O   . GLU A 1 50  ? 7.180   -59.141 29.907 1.00 95.34  ? 545  GLU A O   1 
ATOM   191  C CB  . GLU A 1 50  ? 9.653   -57.041 30.500 1.00 85.76  ? 545  GLU A CB  1 
ATOM   192  N N   . LYS A 1 51  ? 6.312   -57.105 30.458 1.00 85.56  ? 546  LYS A N   1 
ATOM   193  C CA  . LYS A 1 51  ? 5.005   -57.560 30.956 1.00 86.76  ? 546  LYS A CA  1 
ATOM   194  C C   . LYS A 1 51  ? 3.980   -57.791 29.798 1.00 89.92  ? 546  LYS A C   1 
ATOM   195  O O   . LYS A 1 51  ? 2.792   -57.967 30.066 1.00 90.65  ? 546  LYS A O   1 
ATOM   196  C CB  . LYS A 1 51  ? 4.452   -56.563 31.996 1.00 87.42  ? 546  LYS A CB  1 
ATOM   197  N N   . LYS A 1 52  ? 4.455   -57.810 28.522 1.00 85.07  ? 547  LYS A N   1 
ATOM   198  C CA  . LYS A 1 52  ? 3.690   -58.044 27.286 1.00 84.95  ? 547  LYS A CA  1 
ATOM   199  C C   . LYS A 1 52  ? 2.571   -57.028 27.007 1.00 89.23  ? 547  LYS A C   1 
ATOM   200  O O   . LYS A 1 52  ? 1.568   -57.355 26.370 1.00 89.95  ? 547  LYS A O   1 
ATOM   201  C CB  . LYS A 1 52  ? 3.228   -59.512 27.166 1.00 90.91  ? 547  LYS A CB  1 
ATOM   202  N N   . GLN A 1 53  ? 2.774   -55.776 27.448 1.00 85.29  ? 548  GLN A N   1 
ATOM   203  C CA  . GLN A 1 53  ? 1.847   -54.652 27.245 1.00 83.24  ? 548  GLN A CA  1 
ATOM   204  C C   . GLN A 1 53  ? 2.253   -53.814 26.030 1.00 83.22  ? 548  GLN A C   1 
ATOM   205  O O   . GLN A 1 53  ? 3.443   -53.568 25.810 1.00 81.12  ? 548  GLN A O   1 
ATOM   206  C CB  . GLN A 1 53  ? 1.775   -53.745 28.482 1.00 83.48  ? 548  GLN A CB  1 
ATOM   207  C CG  . GLN A 1 53  ? 1.267   -54.423 29.738 1.00 103.53 ? 548  GLN A CG  1 
ATOM   208  C CD  . GLN A 1 53  ? 1.277   -53.447 30.878 1.00 119.29 ? 548  GLN A CD  1 
ATOM   209  O OE1 . GLN A 1 53  ? 2.342   -53.102 31.436 1.00 113.14 ? 548  GLN A OE1 1 
ATOM   210  N NE2 . GLN A 1 53  ? 0.087   -52.952 31.211 1.00 103.04 ? 548  GLN A NE2 1 
ATOM   211  N N   . ILE A 1 54  ? 1.244   -53.349 25.277 1.00 78.24  ? 549  ILE A N   1 
ATOM   212  C CA  . ILE A 1 54  ? 1.397   -52.568 24.059 1.00 75.69  ? 549  ILE A CA  1 
ATOM   213  C C   . ILE A 1 54  ? 1.588   -51.054 24.306 1.00 76.12  ? 549  ILE A C   1 
ATOM   214  O O   . ILE A 1 54  ? 0.847   -50.445 25.082 1.00 75.70  ? 549  ILE A O   1 
ATOM   215  C CB  . ILE A 1 54  ? 0.256   -52.934 23.082 1.00 79.97  ? 549  ILE A CB  1 
ATOM   216  C CG1 . ILE A 1 54  ? 0.713   -52.895 21.627 1.00 79.82  ? 549  ILE A CG1 1 
ATOM   217  C CG2 . ILE A 1 54  ? -1.038  -52.138 23.333 1.00 80.26  ? 549  ILE A CG2 1 
ATOM   218  C CD1 . ILE A 1 54  ? -0.047  -53.871 20.715 1.00 86.69  ? 549  ILE A CD1 1 
ATOM   219  N N   . TYR A 1 55  ? 2.612   -50.465 23.677 1.00 69.91  ? 550  TYR A N   1 
ATOM   220  C CA  . TYR A 1 55  ? 2.922   -49.039 23.804 1.00 66.31  ? 550  TYR A CA  1 
ATOM   221  C C   . TYR A 1 55  ? 3.325   -48.463 22.457 1.00 68.77  ? 550  TYR A C   1 
ATOM   222  O O   . TYR A 1 55  ? 3.467   -49.207 21.481 1.00 69.14  ? 550  TYR A O   1 
ATOM   223  C CB  . TYR A 1 55  ? 4.076   -48.810 24.808 1.00 67.29  ? 550  TYR A CB  1 
ATOM   224  C CG  . TYR A 1 55  ? 3.741   -49.154 26.239 1.00 70.67  ? 550  TYR A CG  1 
ATOM   225  C CD1 . TYR A 1 55  ? 3.018   -48.270 27.039 1.00 71.80  ? 550  TYR A CD1 1 
ATOM   226  C CD2 . TYR A 1 55  ? 4.171   -50.349 26.808 1.00 73.55  ? 550  TYR A CD2 1 
ATOM   227  C CE1 . TYR A 1 55  ? 2.690   -48.589 28.356 1.00 74.84  ? 550  TYR A CE1 1 
ATOM   228  C CE2 . TYR A 1 55  ? 3.861   -50.674 28.128 1.00 75.86  ? 550  TYR A CE2 1 
ATOM   229  C CZ  . TYR A 1 55  ? 3.116   -49.793 28.899 1.00 84.23  ? 550  TYR A CZ  1 
ATOM   230  O OH  . TYR A 1 55  ? 2.791   -50.114 30.198 1.00 87.72  ? 550  TYR A OH  1 
ATOM   231  N N   . ALA A 1 56  ? 3.545   -47.130 22.422 1.00 63.90  ? 551  ALA A N   1 
ATOM   232  C CA  . ALA A 1 56  ? 4.051   -46.392 21.268 1.00 62.72  ? 551  ALA A CA  1 
ATOM   233  C C   . ALA A 1 56  ? 5.380   -45.796 21.666 1.00 65.21  ? 551  ALA A C   1 
ATOM   234  O O   . ALA A 1 56  ? 5.471   -45.219 22.741 1.00 65.37  ? 551  ALA A O   1 
ATOM   235  C CB  . ALA A 1 56  ? 3.095   -45.287 20.892 1.00 62.27  ? 551  ALA A CB  1 
ATOM   236  N N   . ILE A 1 57  ? 6.424   -45.974 20.866 1.00 61.63  ? 552  ILE A N   1 
ATOM   237  C CA  . ILE A 1 57  ? 7.700   -45.348 21.204 1.00 60.67  ? 552  ILE A CA  1 
ATOM   238  C C   . ILE A 1 57  ? 8.047   -44.322 20.164 1.00 63.65  ? 552  ILE A C   1 
ATOM   239  O O   . ILE A 1 57  ? 8.239   -44.659 18.995 1.00 64.95  ? 552  ILE A O   1 
ATOM   240  C CB  . ILE A 1 57  ? 8.897   -46.293 21.522 1.00 65.09  ? 552  ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 57  ? 8.716   -46.986 22.879 1.00 66.25  ? 552  ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 57  ? 10.222  -45.507 21.526 1.00 64.56  ? 552  ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 57  ? 9.838   -48.044 23.226 1.00 68.17  ? 552  ILE A CD1 1 
ATOM   244  N N   . LYS A 1 58  ? 8.143   -43.073 20.576 1.00 57.76  ? 553  LYS A N   1 
ATOM   245  C CA  . LYS A 1 58  ? 8.582   -42.069 19.625 1.00 56.79  ? 553  LYS A CA  1 
ATOM   246  C C   . LYS A 1 58  ? 10.126  -41.934 19.728 1.00 63.31  ? 553  LYS A C   1 
ATOM   247  O O   . LYS A 1 58  ? 10.657  -41.660 20.809 1.00 61.99  ? 553  LYS A O   1 
ATOM   248  C CB  . LYS A 1 58  ? 7.875   -40.736 19.865 1.00 54.56  ? 553  LYS A CB  1 
ATOM   249  C CG  . LYS A 1 58  ? 8.059   -39.744 18.742 1.00 49.43  ? 553  LYS A CG  1 
ATOM   250  C CD  . LYS A 1 58  ? 7.700   -38.356 19.233 1.00 60.30  ? 553  LYS A CD  1 
ATOM   251  C CE  . LYS A 1 58  ? 7.857   -37.336 18.155 1.00 66.38  ? 553  LYS A CE  1 
ATOM   252  N NZ  . LYS A 1 58  ? 7.182   -36.082 18.525 1.00 76.36  ? 553  LYS A NZ  1 
ATOM   253  N N   . TYR A 1 59  ? 10.834  -42.186 18.617 1.00 61.97  ? 554  TYR A N   1 
ATOM   254  C CA  . TYR A 1 59  ? 12.280  -42.006 18.552 1.00 63.35  ? 554  TYR A CA  1 
ATOM   255  C C   . TYR A 1 59  ? 12.555  -40.698 17.793 1.00 69.72  ? 554  TYR A C   1 
ATOM   256  O O   . TYR A 1 59  ? 11.968  -40.464 16.743 1.00 70.79  ? 554  TYR A O   1 
ATOM   257  C CB  . TYR A 1 59  ? 12.996  -43.202 17.901 1.00 66.37  ? 554  TYR A CB  1 
ATOM   258  C CG  . TYR A 1 59  ? 14.383  -42.860 17.394 1.00 70.74  ? 554  TYR A CG  1 
ATOM   259  C CD1 . TYR A 1 59  ? 15.433  -42.617 18.279 1.00 72.57  ? 554  TYR A CD1 1 
ATOM   260  C CD2 . TYR A 1 59  ? 14.636  -42.726 16.029 1.00 73.30  ? 554  TYR A CD2 1 
ATOM   261  C CE1 . TYR A 1 59  ? 16.709  -42.298 17.819 1.00 73.45  ? 554  TYR A CE1 1 
ATOM   262  C CE2 . TYR A 1 59  ? 15.908  -42.395 15.559 1.00 75.54  ? 554  TYR A CE2 1 
ATOM   263  C CZ  . TYR A 1 59  ? 16.938  -42.178 16.460 1.00 81.88  ? 554  TYR A CZ  1 
ATOM   264  O OH  . TYR A 1 59  ? 18.187  -41.849 16.003 1.00 87.08  ? 554  TYR A OH  1 
ATOM   265  N N   . VAL A 1 60  ? 13.432  -39.846 18.337 1.00 66.14  ? 555  VAL A N   1 
ATOM   266  C CA  . VAL A 1 60  ? 13.818  -38.564 17.745 1.00 65.59  ? 555  VAL A CA  1 
ATOM   267  C C   . VAL A 1 60  ? 15.348  -38.494 17.728 1.00 72.59  ? 555  VAL A C   1 
ATOM   268  O O   . VAL A 1 60  ? 15.997  -38.730 18.745 1.00 72.49  ? 555  VAL A O   1 
ATOM   269  C CB  . VAL A 1 60  ? 13.182  -37.370 18.507 1.00 66.84  ? 555  VAL A CB  1 
ATOM   270  C CG1 . VAL A 1 60  ? 13.577  -36.016 17.898 1.00 66.58  ? 555  VAL A CG1 1 
ATOM   271  C CG2 . VAL A 1 60  ? 11.665  -37.517 18.579 1.00 65.21  ? 555  VAL A CG2 1 
ATOM   272  N N   . ASN A 1 61  ? 15.917  -38.192 16.572 1.00 71.67  ? 556  ASN A N   1 
ATOM   273  C CA  . ASN A 1 61  ? 17.353  -38.058 16.430 1.00 73.95  ? 556  ASN A CA  1 
ATOM   274  C C   . ASN A 1 61  ? 17.736  -36.579 16.618 1.00 78.60  ? 556  ASN A C   1 
ATOM   275  O O   . ASN A 1 61  ? 17.255  -35.706 15.880 1.00 78.01  ? 556  ASN A O   1 
ATOM   276  C CB  . ASN A 1 61  ? 17.795  -38.598 15.074 1.00 78.55  ? 556  ASN A CB  1 
ATOM   277  C CG  . ASN A 1 61  ? 19.277  -38.583 14.871 1.00 104.28 ? 556  ASN A CG  1 
ATOM   278  O OD1 . ASN A 1 61  ? 19.825  -37.669 14.260 1.00 101.56 ? 556  ASN A OD1 1 
ATOM   279  N ND2 . ASN A 1 61  ? 19.950  -39.591 15.394 1.00 99.12  ? 556  ASN A ND2 1 
ATOM   280  N N   . LEU A 1 62  ? 18.586  -36.305 17.628 1.00 75.03  ? 557  LEU A N   1 
ATOM   281  C CA  . LEU A 1 62  ? 19.028  -34.946 17.962 1.00 74.48  ? 557  LEU A CA  1 
ATOM   282  C C   . LEU A 1 62  ? 20.321  -34.567 17.279 1.00 84.59  ? 557  LEU A C   1 
ATOM   283  O O   . LEU A 1 62  ? 20.746  -33.419 17.432 1.00 86.79  ? 557  LEU A O   1 
ATOM   284  C CB  . LEU A 1 62  ? 19.190  -34.776 19.490 1.00 72.28  ? 557  LEU A CB  1 
ATOM   285  C CG  . LEU A 1 62  ? 17.987  -35.089 20.378 1.00 72.69  ? 557  LEU A CG  1 
ATOM   286  C CD1 . LEU A 1 62  ? 18.282  -34.719 21.793 1.00 72.26  ? 557  LEU A CD1 1 
ATOM   287  C CD2 . LEU A 1 62  ? 16.720  -34.391 19.899 1.00 69.17  ? 557  LEU A CD2 1 
ATOM   288  N N   . GLU A 1 63  ? 20.955  -35.518 16.539 1.00 83.93  ? 558  GLU A N   1 
ATOM   289  C CA  . GLU A 1 63  ? 22.264  -35.371 15.871 1.00 87.13  ? 558  GLU A CA  1 
ATOM   290  C C   . GLU A 1 63  ? 22.498  -34.087 15.064 1.00 93.74  ? 558  GLU A C   1 
ATOM   291  O O   . GLU A 1 63  ? 23.525  -33.445 15.265 1.00 94.84  ? 558  GLU A O   1 
ATOM   292  C CB  . GLU A 1 63  ? 22.660  -36.630 15.082 1.00 90.08  ? 558  GLU A CB  1 
ATOM   293  C CG  . GLU A 1 63  ? 22.797  -37.879 15.945 1.00 101.05 ? 558  GLU A CG  1 
ATOM   294  C CD  . GLU A 1 63  ? 24.195  -38.218 16.430 1.00 128.18 ? 558  GLU A CD  1 
ATOM   295  O OE1 . GLU A 1 63  ? 24.837  -37.356 17.076 1.00 130.17 ? 558  GLU A OE1 1 
ATOM   296  O OE2 . GLU A 1 63  ? 24.636  -39.365 16.190 1.00 118.91 ? 558  GLU A OE2 1 
ATOM   297  N N   . GLU A 1 64  ? 21.544  -33.690 14.197 1.00 91.16  ? 559  GLU A N   1 
ATOM   298  C CA  . GLU A 1 64  ? 21.662  -32.465 13.394 1.00 93.21  ? 559  GLU A CA  1 
ATOM   299  C C   . GLU A 1 64  ? 20.670  -31.366 13.846 1.00 94.91  ? 559  GLU A C   1 
ATOM   300  O O   . GLU A 1 64  ? 20.208  -30.567 13.027 1.00 94.75  ? 559  GLU A O   1 
ATOM   301  C CB  . GLU A 1 64  ? 21.524  -32.787 11.891 1.00 96.89  ? 559  GLU A CB  1 
ATOM   302  N N   . ALA A 1 65  ? 20.381  -31.306 15.163 1.00 89.77  ? 560  ALA A N   1 
ATOM   303  C CA  . ALA A 1 65  ? 19.430  -30.350 15.744 1.00 87.60  ? 560  ALA A CA  1 
ATOM   304  C C   . ALA A 1 65  ? 20.091  -29.249 16.570 1.00 90.20  ? 560  ALA A C   1 
ATOM   305  O O   . ALA A 1 65  ? 20.966  -29.520 17.396 1.00 88.49  ? 560  ALA A O   1 
ATOM   306  C CB  . ALA A 1 65  ? 18.377  -31.080 16.570 1.00 85.14  ? 560  ALA A CB  1 
ATOM   307  N N   . ASP A 1 66  ? 19.632  -28.008 16.341 1.00 87.63  ? 561  ASP A N   1 
ATOM   308  C CA  . ASP A 1 66  ? 20.081  -26.771 16.981 1.00 89.08  ? 561  ASP A CA  1 
ATOM   309  C C   . ASP A 1 66  ? 19.446  -26.557 18.353 1.00 89.82  ? 561  ASP A C   1 
ATOM   310  O O   . ASP A 1 66  ? 18.560  -27.312 18.746 1.00 86.93  ? 561  ASP A O   1 
ATOM   311  C CB  . ASP A 1 66  ? 19.801  -25.561 16.060 1.00 93.90  ? 561  ASP A CB  1 
ATOM   312  C CG  . ASP A 1 66  ? 18.341  -25.424 15.652 1.00 111.63 ? 561  ASP A CG  1 
ATOM   313  O OD1 . ASP A 1 66  ? 17.900  -26.177 14.743 1.00 112.81 ? 561  ASP A OD1 1 
ATOM   314  O OD2 . ASP A 1 66  ? 17.629  -24.589 16.259 1.00 118.91 ? 561  ASP A OD2 1 
ATOM   315  N N   . ASN A 1 67  ? 19.891  -25.511 19.070 1.00 87.49  ? 562  ASN A N   1 
ATOM   316  C CA  . ASN A 1 67  ? 19.393  -25.166 20.399 1.00 85.99  ? 562  ASN A CA  1 
ATOM   317  C C   . ASN A 1 67  ? 17.933  -24.702 20.393 1.00 89.64  ? 562  ASN A C   1 
ATOM   318  O O   . ASN A 1 67  ? 17.178  -25.130 21.269 1.00 88.43  ? 562  ASN A O   1 
ATOM   319  C CB  . ASN A 1 67  ? 20.301  -24.170 21.079 1.00 87.50  ? 562  ASN A CB  1 
ATOM   320  C CG  . ASN A 1 67  ? 21.739  -24.623 21.080 1.00 124.03 ? 562  ASN A CG  1 
ATOM   321  O OD1 . ASN A 1 67  ? 22.510  -24.338 20.146 1.00 122.31 ? 562  ASN A OD1 1 
ATOM   322  N ND2 . ASN A 1 67  ? 22.110  -25.400 22.093 1.00 116.92 ? 562  ASN A ND2 1 
ATOM   323  N N   . GLN A 1 68  ? 17.516  -23.881 19.395 1.00 86.19  ? 563  GLN A N   1 
ATOM   324  C CA  . GLN A 1 68  ? 16.121  -23.442 19.279 1.00 84.34  ? 563  GLN A CA  1 
ATOM   325  C C   . GLN A 1 68  ? 15.224  -24.678 19.052 1.00 85.15  ? 563  GLN A C   1 
ATOM   326  O O   . GLN A 1 68  ? 14.148  -24.772 19.649 1.00 83.80  ? 563  GLN A O   1 
ATOM   327  C CB  . GLN A 1 68  ? 15.934  -22.373 18.182 1.00 87.76  ? 563  GLN A CB  1 
ATOM   328  N N   . THR A 1 69  ? 15.725  -25.665 18.274 1.00 79.93  ? 564  THR A N   1 
ATOM   329  C CA  . THR A 1 69  ? 15.055  -26.946 18.009 1.00 76.43  ? 564  THR A CA  1 
ATOM   330  C C   . THR A 1 69  ? 14.991  -27.789 19.308 1.00 73.31  ? 564  THR A C   1 
ATOM   331  O O   . THR A 1 69  ? 13.918  -28.282 19.637 1.00 71.42  ? 564  THR A O   1 
ATOM   332  C CB  . THR A 1 69  ? 15.717  -27.648 16.807 1.00 86.72  ? 564  THR A CB  1 
ATOM   333  O OG1 . THR A 1 69  ? 15.579  -26.804 15.666 1.00 90.49  ? 564  THR A OG1 1 
ATOM   334  C CG2 . THR A 1 69  ? 15.103  -28.989 16.492 1.00 82.82  ? 564  THR A CG2 1 
ATOM   335  N N   . LEU A 1 70  ? 16.115  -27.911 20.052 1.00 66.33  ? 565  LEU A N   1 
ATOM   336  C CA  . LEU A 1 70  ? 16.170  -28.641 21.321 1.00 63.41  ? 565  LEU A CA  1 
ATOM   337  C C   . LEU A 1 70  ? 15.236  -28.037 22.346 1.00 66.05  ? 565  LEU A C   1 
ATOM   338  O O   . LEU A 1 70  ? 14.563  -28.767 23.060 1.00 63.26  ? 565  LEU A O   1 
ATOM   339  C CB  . LEU A 1 70  ? 17.600  -28.681 21.897 1.00 64.53  ? 565  LEU A CB  1 
ATOM   340  C CG  . LEU A 1 70  ? 18.607  -29.592 21.191 1.00 69.43  ? 565  LEU A CG  1 
ATOM   341  C CD1 . LEU A 1 70  ? 20.025  -29.347 21.682 1.00 70.77  ? 565  LEU A CD1 1 
ATOM   342  C CD2 . LEU A 1 70  ? 18.236  -31.041 21.329 1.00 69.54  ? 565  LEU A CD2 1 
ATOM   343  N N   . ASP A 1 71  ? 15.197  -26.702 22.432 1.00 65.75  ? 566  ASP A N   1 
ATOM   344  C CA  . ASP A 1 71  ? 14.314  -26.027 23.376 1.00 65.02  ? 566  ASP A CA  1 
ATOM   345  C C   . ASP A 1 71  ? 12.872  -26.266 23.037 1.00 63.97  ? 566  ASP A C   1 
ATOM   346  O O   . ASP A 1 71  ? 12.099  -26.592 23.942 1.00 62.07  ? 566  ASP A O   1 
ATOM   347  C CB  . ASP A 1 71  ? 14.628  -24.541 23.523 1.00 69.20  ? 566  ASP A CB  1 
ATOM   348  C CG  . ASP A 1 71  ? 15.618  -24.268 24.640 1.00 92.71  ? 566  ASP A CG  1 
ATOM   349  O OD1 . ASP A 1 71  ? 15.546  -24.961 25.692 1.00 92.58  ? 566  ASP A OD1 1 
ATOM   350  O OD2 . ASP A 1 71  ? 16.443  -23.338 24.485 1.00 109.91 ? 566  ASP A OD2 1 
ATOM   351  N N   . SER A 1 72  ? 12.531  -26.215 21.727 1.00 57.55  ? 567  SER A N   1 
ATOM   352  C CA  . SER A 1 72  ? 11.173  -26.478 21.280 1.00 55.22  ? 567  SER A CA  1 
ATOM   353  C C   . SER A 1 72  ? 10.719  -27.902 21.695 1.00 60.30  ? 567  SER A C   1 
ATOM   354  O O   . SER A 1 72  ? 9.591   -28.054 22.188 1.00 60.21  ? 567  SER A O   1 
ATOM   355  C CB  . SER A 1 72  ? 11.017  -26.194 19.786 1.00 57.46  ? 567  SER A CB  1 
ATOM   356  O OG  . SER A 1 72  ? 11.341  -27.277 18.929 1.00 68.26  ? 567  SER A OG  1 
ATOM   357  N N   . TYR A 1 73  ? 11.656  -28.899 21.607 1.00 56.51  ? 568  TYR A N   1 
ATOM   358  C CA  . TYR A 1 73  ? 11.508  -30.320 21.947 1.00 55.53  ? 568  TYR A CA  1 
ATOM   359  C C   . TYR A 1 73  ? 11.383  -30.564 23.456 1.00 61.27  ? 568  TYR A C   1 
ATOM   360  O O   . TYR A 1 73  ? 10.580  -31.396 23.865 1.00 61.36  ? 568  TYR A O   1 
ATOM   361  C CB  . TYR A 1 73  ? 12.680  -31.147 21.371 1.00 57.64  ? 568  TYR A CB  1 
ATOM   362  C CG  . TYR A 1 73  ? 12.685  -31.274 19.863 1.00 60.69  ? 568  TYR A CG  1 
ATOM   363  C CD1 . TYR A 1 73  ? 11.637  -30.773 19.097 1.00 63.47  ? 568  TYR A CD1 1 
ATOM   364  C CD2 . TYR A 1 73  ? 13.719  -31.932 19.201 1.00 62.16  ? 568  TYR A CD2 1 
ATOM   365  C CE1 . TYR A 1 73  ? 11.619  -30.910 17.713 1.00 66.61  ? 568  TYR A CE1 1 
ATOM   366  C CE2 . TYR A 1 73  ? 13.718  -32.065 17.811 1.00 64.20  ? 568  TYR A CE2 1 
ATOM   367  C CZ  . TYR A 1 73  ? 12.664  -31.545 17.072 1.00 75.22  ? 568  TYR A CZ  1 
ATOM   368  O OH  . TYR A 1 73  ? 12.604  -31.652 15.705 1.00 81.41  ? 568  TYR A OH  1 
ATOM   369  N N   . ARG A 1 74  ? 12.177  -29.859 24.279 1.00 58.37  ? 569  ARG A N   1 
ATOM   370  C CA  . ARG A 1 74  ? 12.131  -29.992 25.734 1.00 57.85  ? 569  ARG A CA  1 
ATOM   371  C C   . ARG A 1 74  ? 10.889  -29.270 26.263 1.00 61.03  ? 569  ARG A C   1 
ATOM   372  O O   . ARG A 1 74  ? 10.345  -29.642 27.315 1.00 60.82  ? 569  ARG A O   1 
ATOM   373  C CB  . ARG A 1 74  ? 13.365  -29.352 26.374 1.00 58.50  ? 569  ARG A CB  1 
ATOM   374  C CG  . ARG A 1 74  ? 14.659  -30.045 26.106 1.00 61.47  ? 569  ARG A CG  1 
ATOM   375  C CD  . ARG A 1 74  ? 15.713  -29.196 26.721 1.00 59.69  ? 569  ARG A CD  1 
ATOM   376  N NE  . ARG A 1 74  ? 17.048  -29.511 26.231 1.00 69.07  ? 569  ARG A NE  1 
ATOM   377  C CZ  . ARG A 1 74  ? 17.897  -28.590 25.795 1.00 80.69  ? 569  ARG A CZ  1 
ATOM   378  N NH1 . ARG A 1 74  ? 17.539  -27.311 25.757 1.00 79.48  ? 569  ARG A NH1 1 
ATOM   379  N NH2 . ARG A 1 74  ? 19.112  -28.937 25.395 1.00 50.32  ? 569  ARG A NH2 1 
ATOM   380  N N   . ASN A 1 75  ? 10.471  -28.204 25.563 1.00 56.14  ? 570  ASN A N   1 
ATOM   381  C CA  . ASN A 1 75  ? 9.299   -27.464 25.985 1.00 55.41  ? 570  ASN A CA  1 
ATOM   382  C C   . ASN A 1 75  ? 8.023   -28.266 25.743 1.00 59.72  ? 570  ASN A C   1 
ATOM   383  O O   . ASN A 1 75  ? 7.169   -28.310 26.625 1.00 60.45  ? 570  ASN A O   1 
ATOM   384  C CB  . ASN A 1 75  ? 9.220   -26.118 25.303 1.00 53.12  ? 570  ASN A CB  1 
ATOM   385  C CG  . ASN A 1 75  ? 8.360   -25.162 26.071 1.00 64.33  ? 570  ASN A CG  1 
ATOM   386  O OD1 . ASN A 1 75  ? 7.222   -24.889 25.680 1.00 63.47  ? 570  ASN A OD1 1 
ATOM   387  N ND2 . ASN A 1 75  ? 8.853   -24.699 27.229 1.00 47.16  ? 570  ASN A ND2 1 
ATOM   388  N N   . GLU A 1 76  ? 7.904   -28.919 24.571 1.00 54.28  ? 571  GLU A N   1 
ATOM   389  C CA  . GLU A 1 76  ? 6.729   -29.709 24.258 1.00 52.55  ? 571  GLU A CA  1 
ATOM   390  C C   . GLU A 1 76  ? 6.598   -30.934 25.212 1.00 55.35  ? 571  GLU A C   1 
ATOM   391  O O   . GLU A 1 76  ? 5.492   -31.184 25.697 1.00 54.98  ? 571  GLU A O   1 
ATOM   392  C CB  . GLU A 1 76  ? 6.703   -30.074 22.762 1.00 53.84  ? 571  GLU A CB  1 
ATOM   393  C CG  . GLU A 1 76  ? 5.563   -31.008 22.396 1.00 60.61  ? 571  GLU A CG  1 
ATOM   394  C CD  . GLU A 1 76  ? 4.467   -30.591 21.439 1.00 74.86  ? 571  GLU A CD  1 
ATOM   395  O OE1 . GLU A 1 76  ? 4.750   -30.019 20.359 1.00 68.86  ? 571  GLU A OE1 1 
ATOM   396  O OE2 . GLU A 1 76  ? 3.335   -31.047 21.691 1.00 72.64  ? 571  GLU A OE2 1 
ATOM   397  N N   . ILE A 1 77  ? 7.723   -31.655 25.506 1.00 49.51  ? 572  ILE A N   1 
ATOM   398  C CA  . ILE A 1 77  ? 7.769   -32.799 26.423 1.00 48.04  ? 572  ILE A CA  1 
ATOM   399  C C   . ILE A 1 77  ? 7.288   -32.388 27.822 1.00 56.99  ? 572  ILE A C   1 
ATOM   400  O O   . ILE A 1 77  ? 6.413   -33.051 28.377 1.00 57.65  ? 572  ILE A O   1 
ATOM   401  C CB  . ILE A 1 77  ? 9.174   -33.444 26.463 1.00 50.42  ? 572  ILE A CB  1 
ATOM   402  C CG1 . ILE A 1 77  ? 9.516   -34.118 25.115 1.00 49.95  ? 572  ILE A CG1 1 
ATOM   403  C CG2 . ILE A 1 77  ? 9.305   -34.425 27.642 1.00 50.07  ? 572  ILE A CG2 1 
ATOM   404  C CD1 . ILE A 1 77  ? 11.029  -34.400 24.892 1.00 48.24  ? 572  ILE A CD1 1 
ATOM   405  N N   . ALA A 1 78  ? 7.838   -31.291 28.382 1.00 57.04  ? 573  ALA A N   1 
ATOM   406  C CA  . ALA A 1 78  ? 7.457   -30.784 29.710 1.00 58.46  ? 573  ALA A CA  1 
ATOM   407  C C   . ALA A 1 78  ? 5.971   -30.439 29.787 1.00 62.79  ? 573  ALA A C   1 
ATOM   408  O O   . ALA A 1 78  ? 5.340   -30.746 30.810 1.00 64.35  ? 573  ALA A O   1 
ATOM   409  C CB  . ALA A 1 78  ? 8.286   -29.572 30.082 1.00 60.28  ? 573  ALA A CB  1 
ATOM   410  N N   . TYR A 1 79  ? 5.405   -29.826 28.706 1.00 56.29  ? 574  TYR A N   1 
ATOM   411  C CA  . TYR A 1 79  ? 3.984   -29.504 28.650 1.00 54.58  ? 574  TYR A CA  1 
ATOM   412  C C   . TYR A 1 79  ? 3.132   -30.757 28.598 1.00 59.03  ? 574  TYR A C   1 
ATOM   413  O O   . TYR A 1 79  ? 2.194   -30.876 29.394 1.00 59.07  ? 574  TYR A O   1 
ATOM   414  C CB  . TYR A 1 79  ? 3.647   -28.471 27.578 1.00 55.17  ? 574  TYR A CB  1 
ATOM   415  C CG  . TYR A 1 79  ? 3.723   -27.066 28.145 1.00 59.64  ? 574  TYR A CG  1 
ATOM   416  C CD1 . TYR A 1 79  ? 2.726   -26.579 28.988 1.00 62.53  ? 574  TYR A CD1 1 
ATOM   417  C CD2 . TYR A 1 79  ? 4.837   -26.261 27.922 1.00 60.77  ? 574  TYR A CD2 1 
ATOM   418  C CE1 . TYR A 1 79  ? 2.816   -25.318 29.563 1.00 65.16  ? 574  TYR A CE1 1 
ATOM   419  C CE2 . TYR A 1 79  ? 4.939   -24.996 28.493 1.00 63.04  ? 574  TYR A CE2 1 
ATOM   420  C CZ  . TYR A 1 79  ? 3.928   -24.528 29.320 1.00 74.88  ? 574  TYR A CZ  1 
ATOM   421  O OH  . TYR A 1 79  ? 4.004   -23.269 29.880 1.00 77.77  ? 574  TYR A OH  1 
ATOM   422  N N   . LEU A 1 80  ? 3.527   -31.747 27.746 1.00 55.05  ? 575  LEU A N   1 
ATOM   423  C CA  . LEU A 1 80  ? 2.864   -33.062 27.616 1.00 53.45  ? 575  LEU A CA  1 
ATOM   424  C C   . LEU A 1 80  ? 2.892   -33.840 28.957 1.00 58.20  ? 575  LEU A C   1 
ATOM   425  O O   . LEU A 1 80  ? 1.884   -34.421 29.372 1.00 56.61  ? 575  LEU A O   1 
ATOM   426  C CB  . LEU A 1 80  ? 3.502   -33.883 26.482 1.00 52.11  ? 575  LEU A CB  1 
ATOM   427  C CG  . LEU A 1 80  ? 2.920   -35.269 26.224 1.00 55.69  ? 575  LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 80  ? 1.399   -35.240 26.124 1.00 54.45  ? 575  LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 80  ? 3.546   -35.897 25.010 1.00 57.34  ? 575  LEU A CD2 1 
ATOM   430  N N   . ASN A 1 81  ? 4.041   -33.826 29.625 1.00 56.51  ? 576  ASN A N   1 
ATOM   431  C CA  . ASN A 1 81  ? 4.202   -34.476 30.915 1.00 58.10  ? 576  ASN A CA  1 
ATOM   432  C C   . ASN A 1 81  ? 3.245   -33.852 31.976 1.00 63.33  ? 576  ASN A C   1 
ATOM   433  O O   . ASN A 1 81  ? 2.555   -34.614 32.661 1.00 63.74  ? 576  ASN A O   1 
ATOM   434  C CB  . ASN A 1 81  ? 5.671   -34.424 31.340 1.00 58.69  ? 576  ASN A CB  1 
ATOM   435  C CG  . ASN A 1 81  ? 5.991   -35.157 32.603 1.00 88.45  ? 576  ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 81  ? 5.269   -36.066 33.030 1.00 86.82  ? 576  ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 81  ? 7.098   -34.777 33.225 1.00 84.97  ? 576  ASN A ND2 1 
ATOM   438  N N   . LYS A 1 82  ? 3.158   -32.486 32.053 1.00 59.38  ? 577  LYS A N   1 
ATOM   439  C CA  . LYS A 1 82  ? 2.284   -31.759 32.995 1.00 60.48  ? 577  LYS A CA  1 
ATOM   440  C C   . LYS A 1 82  ? 0.791   -31.885 32.685 1.00 65.56  ? 577  LYS A C   1 
ATOM   441  O O   . LYS A 1 82  ? 0.013   -32.227 33.577 1.00 66.46  ? 577  LYS A O   1 
ATOM   442  C CB  . LYS A 1 82  ? 2.656   -30.273 33.091 1.00 63.21  ? 577  LYS A CB  1 
ATOM   443  N N   . LEU A 1 83  ? 0.394   -31.642 31.419 1.00 61.09  ? 578  LEU A N   1 
ATOM   444  C CA  . LEU A 1 83  ? -1.009  -31.662 31.006 1.00 60.20  ? 578  LEU A CA  1 
ATOM   445  C C   . LEU A 1 83  ? -1.671  -33.035 31.040 1.00 66.99  ? 578  LEU A C   1 
ATOM   446  O O   . LEU A 1 83  ? -2.896  -33.132 30.925 1.00 68.40  ? 578  LEU A O   1 
ATOM   447  C CB  . LEU A 1 83  ? -1.256  -30.904 29.678 1.00 58.26  ? 578  LEU A CB  1 
ATOM   448  C CG  . LEU A 1 83  ? -0.717  -29.473 29.563 1.00 61.44  ? 578  LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 83  ? -1.340  -28.751 28.422 1.00 61.20  ? 578  LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 83  ? -0.938  -28.690 30.810 1.00 61.86  ? 578  LEU A CD2 1 
ATOM   451  N N   . GLN A 1 84  ? -0.875  -34.078 31.257 1.00 64.10  ? 579  GLN A N   1 
ATOM   452  C CA  . GLN A 1 84  ? -1.321  -35.462 31.363 1.00 65.04  ? 579  GLN A CA  1 
ATOM   453  C C   . GLN A 1 84  ? -2.221  -35.613 32.576 1.00 73.98  ? 579  GLN A C   1 
ATOM   454  O O   . GLN A 1 84  ? -3.282  -36.228 32.470 1.00 74.80  ? 579  GLN A O   1 
ATOM   455  C CB  . GLN A 1 84  ? -0.106  -36.362 31.540 1.00 66.04  ? 579  GLN A CB  1 
ATOM   456  C CG  . GLN A 1 84  ? 0.385   -37.002 30.271 1.00 57.39  ? 579  GLN A CG  1 
ATOM   457  C CD  . GLN A 1 84  ? 1.159   -38.179 30.717 1.00 81.21  ? 579  GLN A CD  1 
ATOM   458  O OE1 . GLN A 1 84  ? 0.664   -39.296 30.706 1.00 81.18  ? 579  GLN A OE1 1 
ATOM   459  N NE2 . GLN A 1 84  ? 2.324   -37.943 31.289 1.00 79.40  ? 579  GLN A NE2 1 
ATOM   460  N N   . GLN A 1 85  ? -1.805  -35.016 33.725 1.00 72.70  ? 580  GLN A N   1 
ATOM   461  C CA  . GLN A 1 85  ? -2.545  -35.021 34.988 1.00 74.31  ? 580  GLN A CA  1 
ATOM   462  C C   . GLN A 1 85  ? -3.884  -34.268 34.886 1.00 78.61  ? 580  GLN A C   1 
ATOM   463  O O   . GLN A 1 85  ? -4.813  -34.586 35.629 1.00 81.06  ? 580  GLN A O   1 
ATOM   464  C CB  . GLN A 1 85  ? -1.682  -34.430 36.111 1.00 76.61  ? 580  GLN A CB  1 
ATOM   465  N N   . HIS A 1 86  ? -3.996  -33.294 33.961 1.00 72.05  ? 581  HIS A N   1 
ATOM   466  C CA  . HIS A 1 86  ? -5.215  -32.489 33.812 1.00 71.30  ? 581  HIS A CA  1 
ATOM   467  C C   . HIS A 1 86  ? -6.326  -33.058 32.939 1.00 71.55  ? 581  HIS A C   1 
ATOM   468  O O   . HIS A 1 86  ? -7.472  -32.627 33.106 1.00 72.46  ? 581  HIS A O   1 
ATOM   469  C CB  . HIS A 1 86  ? -4.895  -31.040 33.429 1.00 71.63  ? 581  HIS A CB  1 
ATOM   470  C CG  . HIS A 1 86  ? -4.009  -30.373 34.426 1.00 76.85  ? 581  HIS A CG  1 
ATOM   471  N ND1 . HIS A 1 86  ? -4.520  -29.518 35.385 1.00 80.82  ? 581  HIS A ND1 1 
ATOM   472  C CD2 . HIS A 1 86  ? -2.674  -30.510 34.625 1.00 78.89  ? 581  HIS A CD2 1 
ATOM   473  C CE1 . HIS A 1 86  ? -3.482  -29.145 36.118 1.00 81.39  ? 581  HIS A CE1 1 
ATOM   474  N NE2 . HIS A 1 86  ? -2.347  -29.716 35.696 1.00 80.39  ? 581  HIS A NE2 1 
ATOM   475  N N   . SER A 1 87  ? -6.016  -33.978 31.993 1.00 63.26  ? 582  SER A N   1 
ATOM   476  C CA  . SER A 1 87  ? -7.050  -34.532 31.120 1.00 61.59  ? 582  SER A CA  1 
ATOM   477  C C   . SER A 1 87  ? -6.705  -35.866 30.486 1.00 65.95  ? 582  SER A C   1 
ATOM   478  O O   . SER A 1 87  ? -5.564  -36.097 30.064 1.00 64.55  ? 582  SER A O   1 
ATOM   479  C CB  . SER A 1 87  ? -7.456  -33.541 30.036 1.00 61.47  ? 582  SER A CB  1 
ATOM   480  O OG  . SER A 1 87  ? -8.549  -34.051 29.292 1.00 68.45  ? 582  SER A OG  1 
ATOM   481  N N   . ASP A 1 88  ? -7.725  -36.732 30.367 1.00 63.39  ? 583  ASP A N   1 
ATOM   482  C CA  . ASP A 1 88  ? -7.549  -38.024 29.726 1.00 63.61  ? 583  ASP A CA  1 
ATOM   483  C C   . ASP A 1 88  ? -7.618  -37.898 28.204 1.00 66.89  ? 583  ASP A C   1 
ATOM   484  O O   . ASP A 1 88  ? -7.281  -38.850 27.518 1.00 67.34  ? 583  ASP A O   1 
ATOM   485  C CB  . ASP A 1 88  ? -8.543  -39.057 30.257 1.00 67.96  ? 583  ASP A CB  1 
ATOM   486  C CG  . ASP A 1 88  ? -10.010 -38.735 30.062 1.00 83.56  ? 583  ASP A CG  1 
ATOM   487  O OD1 . ASP A 1 88  ? -10.370 -37.522 30.089 1.00 84.67  ? 583  ASP A OD1 1 
ATOM   488  O OD2 . ASP A 1 88  ? -10.813 -39.690 29.950 1.00 90.57  ? 583  ASP A OD2 1 
ATOM   489  N N   . LYS A 1 89  ? -8.008  -36.709 27.683 1.00 61.89  ? 584  LYS A N   1 
ATOM   490  C CA  . LYS A 1 89  ? -8.107  -36.412 26.252 1.00 60.15  ? 584  LYS A CA  1 
ATOM   491  C C   . LYS A 1 89  ? -6.765  -35.962 25.669 1.00 62.60  ? 584  LYS A C   1 
ATOM   492  O O   . LYS A 1 89  ? -6.687  -35.603 24.491 1.00 61.92  ? 584  LYS A O   1 
ATOM   493  C CB  . LYS A 1 89  ? -9.236  -35.404 25.949 1.00 62.04  ? 584  LYS A CB  1 
ATOM   494  C CG  . LYS A 1 89  ? -10.645 -35.839 26.381 1.00 65.32  ? 584  LYS A CG  1 
ATOM   495  C CD  . LYS A 1 89  ? -10.944 -37.357 26.304 1.00 67.34  ? 584  LYS A CD  1 
ATOM   496  C CE  . LYS A 1 89  ? -12.297 -37.725 26.873 1.00 72.47  ? 584  LYS A CE  1 
ATOM   497  N NZ  . LYS A 1 89  ? -12.412 -37.452 28.329 1.00 74.75  ? 584  LYS A NZ  1 
ATOM   498  N N   . ILE A 1 90  ? -5.707  -36.002 26.502 1.00 57.40  ? 585  ILE A N   1 
ATOM   499  C CA  . ILE A 1 90  ? -4.323  -35.749 26.125 1.00 54.76  ? 585  ILE A CA  1 
ATOM   500  C C   . ILE A 1 90  ? -3.584  -37.112 26.212 1.00 60.27  ? 585  ILE A C   1 
ATOM   501  O O   . ILE A 1 90  ? -3.741  -37.835 27.198 1.00 60.63  ? 585  ILE A O   1 
ATOM   502  C CB  . ILE A 1 90  ? -3.708  -34.637 27.007 1.00 55.99  ? 585  ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 90  ? -4.193  -33.260 26.532 1.00 54.39  ? 585  ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 90  ? -2.182  -34.690 26.977 1.00 56.12  ? 585  ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 90  ? -4.668  -32.441 27.534 1.00 55.41  ? 585  ILE A CD1 1 
ATOM   506  N N   . ILE A 1 91  ? -2.844  -37.480 25.152 1.00 57.08  ? 586  ILE A N   1 
ATOM   507  C CA  . ILE A 1 91  ? -2.065  -38.728 25.066 1.00 57.02  ? 586  ILE A CA  1 
ATOM   508  C C   . ILE A 1 91  ? -1.210  -38.990 26.326 1.00 59.30  ? 586  ILE A C   1 
ATOM   509  O O   . ILE A 1 91  ? -0.561  -38.077 26.848 1.00 57.14  ? 586  ILE A O   1 
ATOM   510  C CB  . ILE A 1 91  ? -1.218  -38.777 23.755 1.00 59.77  ? 586  ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 91  ? -0.705  -40.196 23.457 1.00 62.27  ? 586  ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 91  ? -0.082  -37.734 23.735 1.00 58.33  ? 586  ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 91  ? -0.054  -40.381 22.091 1.00 74.54  ? 586  ILE A CD1 1 
ATOM   514  N N   . ARG A 1 92  ? -1.244  -40.240 26.822 1.00 57.49  ? 587  ARG A N   1 
ATOM   515  C CA  . ARG A 1 92  ? -0.448  -40.660 27.981 1.00 57.18  ? 587  ARG A CA  1 
ATOM   516  C C   . ARG A 1 92  ? 1.020   -40.779 27.589 1.00 57.24  ? 587  ARG A C   1 
ATOM   517  O O   . ARG A 1 92  ? 1.336   -41.372 26.563 1.00 56.10  ? 587  ARG A O   1 
ATOM   518  C CB  . ARG A 1 92  ? -0.923  -42.009 28.564 1.00 59.47  ? 587  ARG A CB  1 
ATOM   519  C CG  . ARG A 1 92  ? -2.340  -42.028 29.089 1.00 73.81  ? 587  ARG A CG  1 
ATOM   520  C CD  . ARG A 1 92  ? -2.494  -41.534 30.522 1.00 85.44  ? 587  ARG A CD  1 
ATOM   521  N NE  . ARG A 1 92  ? -2.627  -40.076 30.656 1.00 76.98  ? 587  ARG A NE  1 
ATOM   522  C CZ  . ARG A 1 92  ? -3.626  -39.350 30.166 1.00 85.19  ? 587  ARG A CZ  1 
ATOM   523  N NH1 . ARG A 1 92  ? -4.581  -39.922 29.445 1.00 88.28  ? 587  ARG A NH1 1 
ATOM   524  N NH2 . ARG A 1 92  ? -3.664  -38.040 30.370 1.00 59.93  ? 587  ARG A NH2 1 
ATOM   525  N N   . LEU A 1 93  ? 1.895   -40.165 28.386 1.00 52.45  ? 588  LEU A N   1 
ATOM   526  C CA  . LEU A 1 93  ? 3.352   -40.208 28.293 1.00 51.46  ? 588  LEU A CA  1 
ATOM   527  C C   . LEU A 1 93  ? 3.728   -40.930 29.570 1.00 58.42  ? 588  LEU A C   1 
ATOM   528  O O   . LEU A 1 93  ? 3.467   -40.440 30.669 1.00 56.36  ? 588  LEU A O   1 
ATOM   529  C CB  . LEU A 1 93  ? 3.978   -38.790 28.227 1.00 49.45  ? 588  LEU A CB  1 
ATOM   530  C CG  . LEU A 1 93  ? 5.511   -38.672 28.242 1.00 52.24  ? 588  LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 93  ? 6.146   -39.329 27.029 1.00 51.58  ? 588  LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 93  ? 5.925   -37.222 28.312 1.00 52.31  ? 588  LEU A CD2 1 
ATOM   533  N N   . TYR A 1 94  ? 4.219   -42.162 29.408 1.00 59.09  ? 589  TYR A N   1 
ATOM   534  C CA  . TYR A 1 94  ? 4.587   -43.054 30.498 1.00 60.13  ? 589  TYR A CA  1 
ATOM   535  C C   . TYR A 1 94  ? 6.011   -42.872 31.000 1.00 65.12  ? 589  TYR A C   1 
ATOM   536  O O   . TYR A 1 94  ? 6.241   -42.900 32.213 1.00 66.17  ? 589  TYR A O   1 
ATOM   537  C CB  . TYR A 1 94  ? 4.332   -44.492 30.083 1.00 61.02  ? 589  TYR A CB  1 
ATOM   538  C CG  . TYR A 1 94  ? 2.862   -44.769 29.902 1.00 62.73  ? 589  TYR A CG  1 
ATOM   539  C CD1 . TYR A 1 94  ? 1.996   -44.778 30.989 1.00 64.69  ? 589  TYR A CD1 1 
ATOM   540  C CD2 . TYR A 1 94  ? 2.338   -45.061 28.646 1.00 63.78  ? 589  TYR A CD2 1 
ATOM   541  C CE1 . TYR A 1 94  ? 0.640   -45.030 30.828 1.00 64.94  ? 589  TYR A CE1 1 
ATOM   542  C CE2 . TYR A 1 94  ? 0.986   -45.351 28.478 1.00 64.84  ? 589  TYR A CE2 1 
ATOM   543  C CZ  . TYR A 1 94  ? 0.137   -45.312 29.570 1.00 71.60  ? 589  TYR A CZ  1 
ATOM   544  O OH  . TYR A 1 94  ? -1.202  -45.569 29.417 1.00 75.04  ? 589  TYR A OH  1 
ATOM   545  N N   . ASP A 1 95  ? 6.964   -42.691 30.081 1.00 60.71  ? 590  ASP A N   1 
ATOM   546  C CA  . ASP A 1 95  ? 8.372   -42.544 30.430 1.00 61.03  ? 590  ASP A CA  1 
ATOM   547  C C   . ASP A 1 95  ? 9.117   -41.932 29.261 1.00 63.76  ? 590  ASP A C   1 
ATOM   548  O O   . ASP A 1 95  ? 8.610   -41.921 28.137 1.00 62.07  ? 590  ASP A O   1 
ATOM   549  C CB  . ASP A 1 95  ? 8.963   -43.942 30.737 1.00 64.99  ? 590  ASP A CB  1 
ATOM   550  C CG  . ASP A 1 95  ? 10.109  -43.988 31.726 1.00 80.76  ? 590  ASP A CG  1 
ATOM   551  O OD1 . ASP A 1 95  ? 10.487  -42.913 32.253 1.00 82.99  ? 590  ASP A OD1 1 
ATOM   552  O OD2 . ASP A 1 95  ? 10.627  -45.105 31.985 1.00 87.09  ? 590  ASP A OD2 1 
ATOM   553  N N   . TYR A 1 96  ? 10.339  -41.455 29.519 1.00 61.45  ? 591  TYR A N   1 
ATOM   554  C CA  . TYR A 1 96  ? 11.232  -40.923 28.495 1.00 60.87  ? 591  TYR A CA  1 
ATOM   555  C C   . TYR A 1 96  ? 12.690  -41.008 28.856 1.00 65.99  ? 591  TYR A C   1 
ATOM   556  O O   . TYR A 1 96  ? 13.026  -40.963 30.036 1.00 66.67  ? 591  TYR A O   1 
ATOM   557  C CB  . TYR A 1 96  ? 10.847  -39.510 28.026 1.00 60.46  ? 591  TYR A CB  1 
ATOM   558  C CG  . TYR A 1 96  ? 10.789  -38.431 29.077 1.00 61.97  ? 591  TYR A CG  1 
ATOM   559  C CD1 . TYR A 1 96  ? 11.946  -37.797 29.517 1.00 64.67  ? 591  TYR A CD1 1 
ATOM   560  C CD2 . TYR A 1 96  ? 9.573   -37.920 29.503 1.00 62.86  ? 591  TYR A CD2 1 
ATOM   561  C CE1 . TYR A 1 96  ? 11.895  -36.734 30.415 1.00 65.48  ? 591  TYR A CE1 1 
ATOM   562  C CE2 . TYR A 1 96  ? 9.507   -36.842 30.381 1.00 64.54  ? 591  TYR A CE2 1 
ATOM   563  C CZ  . TYR A 1 96  ? 10.670  -36.256 30.842 1.00 72.98  ? 591  TYR A CZ  1 
ATOM   564  O OH  . TYR A 1 96  ? 10.586  -35.200 31.719 1.00 74.58  ? 591  TYR A OH  1 
ATOM   565  N N   . GLU A 1 97  ? 13.554  -41.088 27.834 1.00 63.45  ? 592  GLU A N   1 
ATOM   566  C CA  . GLU A 1 97  ? 15.019  -41.098 27.959 1.00 65.33  ? 592  GLU A CA  1 
ATOM   567  C C   . GLU A 1 97  ? 15.585  -40.028 27.025 1.00 69.34  ? 592  GLU A C   1 
ATOM   568  O O   . GLU A 1 97  ? 15.272  -40.029 25.830 1.00 69.50  ? 592  GLU A O   1 
ATOM   569  C CB  . GLU A 1 97  ? 15.558  -42.476 27.597 1.00 68.16  ? 592  GLU A CB  1 
ATOM   570  C CG  . GLU A 1 97  ? 17.064  -42.625 27.645 1.00 76.20  ? 592  GLU A CG  1 
ATOM   571  C CD  . GLU A 1 97  ? 17.437  -44.079 27.484 1.00 91.66  ? 592  GLU A CD  1 
ATOM   572  O OE1 . GLU A 1 97  ? 16.894  -44.907 28.251 1.00 73.82  ? 592  GLU A OE1 1 
ATOM   573  O OE2 . GLU A 1 97  ? 18.201  -44.406 26.548 1.00 93.03  ? 592  GLU A OE2 1 
ATOM   574  N N   . ILE A 1 98  ? 16.353  -39.072 27.572 1.00 65.19  ? 593  ILE A N   1 
ATOM   575  C CA  . ILE A 1 98  ? 16.892  -37.966 26.766 1.00 63.77  ? 593  ILE A CA  1 
ATOM   576  C C   . ILE A 1 98  ? 18.392  -37.881 26.875 1.00 67.50  ? 593  ILE A C   1 
ATOM   577  O O   . ILE A 1 98  ? 18.948  -37.843 27.977 1.00 68.37  ? 593  ILE A O   1 
ATOM   578  C CB  . ILE A 1 98  ? 16.227  -36.587 27.039 1.00 65.72  ? 593  ILE A CB  1 
ATOM   579  C CG1 . ILE A 1 98  ? 14.715  -36.705 27.199 1.00 65.24  ? 593  ILE A CG1 1 
ATOM   580  C CG2 . ILE A 1 98  ? 16.564  -35.592 25.929 1.00 66.77  ? 593  ILE A CG2 1 
ATOM   581  C CD1 . ILE A 1 98  ? 14.024  -35.448 27.582 1.00 76.64  ? 593  ILE A CD1 1 
ATOM   582  N N   . THR A 1 99  ? 19.050  -37.895 25.723 1.00 63.41  ? 594  THR A N   1 
ATOM   583  C CA  . THR A 1 99  ? 20.490  -37.726 25.657 1.00 64.65  ? 594  THR A CA  1 
ATOM   584  C C   . THR A 1 99  ? 20.777  -36.601 24.662 1.00 68.42  ? 594  THR A C   1 
ATOM   585  O O   . THR A 1 99  ? 19.835  -35.944 24.180 1.00 66.39  ? 594  THR A O   1 
ATOM   586  C CB  . THR A 1 99  ? 21.246  -39.034 25.390 1.00 70.54  ? 594  THR A CB  1 
ATOM   587  O OG1 . THR A 1 99  ? 21.046  -39.421 24.037 1.00 75.40  ? 594  THR A OG1 1 
ATOM   588  C CG2 . THR A 1 99  ? 20.887  -40.156 26.370 1.00 65.47  ? 594  THR A CG2 1 
ATOM   589  N N   . ASP A 1 100 ? 22.073  -36.351 24.406 1.00 65.75  ? 595  ASP A N   1 
ATOM   590  C CA  . ASP A 1 100 ? 22.535  -35.335 23.479 1.00 66.63  ? 595  ASP A CA  1 
ATOM   591  C C   . ASP A 1 100 ? 22.395  -35.810 22.017 1.00 73.27  ? 595  ASP A C   1 
ATOM   592  O O   . ASP A 1 100 ? 22.412  -34.992 21.096 1.00 74.64  ? 595  ASP A O   1 
ATOM   593  C CB  . ASP A 1 100 ? 23.975  -34.925 23.839 1.00 70.44  ? 595  ASP A CB  1 
ATOM   594  C CG  . ASP A 1 100 ? 24.085  -34.291 25.215 1.00 79.19  ? 595  ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 100 ? 23.136  -33.613 25.626 1.00 82.15  ? 595  ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 100 ? 25.128  -34.461 25.868 1.00 80.93  ? 595  ASP A OD2 1 
ATOM   597  N N   . GLN A 1 101 ? 22.188  -37.125 21.817 1.00 70.28  ? 596  GLN A N   1 
ATOM   598  C CA  . GLN A 1 101 ? 22.053  -37.749 20.494 1.00 70.26  ? 596  GLN A CA  1 
ATOM   599  C C   . GLN A 1 101 ? 20.607  -38.136 20.139 1.00 71.09  ? 596  GLN A C   1 
ATOM   600  O O   . GLN A 1 101 ? 20.258  -38.114 18.951 1.00 71.90  ? 596  GLN A O   1 
ATOM   601  C CB  . GLN A 1 101 ? 22.988  -38.969 20.344 1.00 73.04  ? 596  GLN A CB  1 
ATOM   602  C CG  . GLN A 1 101 ? 24.381  -38.823 20.988 1.00 91.00  ? 596  GLN A CG  1 
ATOM   603  C CD  . GLN A 1 101 ? 24.405  -39.083 22.492 1.00 108.53 ? 596  GLN A CD  1 
ATOM   604  O OE1 . GLN A 1 101 ? 23.574  -39.840 23.051 1.00 99.60  ? 596  GLN A OE1 1 
ATOM   605  N NE2 . GLN A 1 101 ? 25.369  -38.453 23.181 1.00 94.72  ? 596  GLN A NE2 1 
ATOM   606  N N   . TYR A 1 102 ? 19.769  -38.483 21.147 1.00 63.72  ? 597  TYR A N   1 
ATOM   607  C CA  . TYR A 1 102 ? 18.404  -38.941 20.890 1.00 61.85  ? 597  TYR A CA  1 
ATOM   608  C C   . TYR A 1 102 ? 17.398  -38.697 22.020 1.00 66.34  ? 597  TYR A C   1 
ATOM   609  O O   . TYR A 1 102 ? 17.784  -38.382 23.149 1.00 68.00  ? 597  TYR A O   1 
ATOM   610  C CB  . TYR A 1 102 ? 18.432  -40.454 20.595 1.00 63.33  ? 597  TYR A CB  1 
ATOM   611  C CG  . TYR A 1 102 ? 18.894  -41.289 21.777 1.00 64.80  ? 597  TYR A CG  1 
ATOM   612  C CD1 . TYR A 1 102 ? 18.020  -41.626 22.803 1.00 65.65  ? 597  TYR A CD1 1 
ATOM   613  C CD2 . TYR A 1 102 ? 20.200  -41.762 21.854 1.00 66.90  ? 597  TYR A CD2 1 
ATOM   614  C CE1 . TYR A 1 102 ? 18.445  -42.361 23.903 1.00 66.68  ? 597  TYR A CE1 1 
ATOM   615  C CE2 . TYR A 1 102 ? 20.633  -42.511 22.946 1.00 67.73  ? 597  TYR A CE2 1 
ATOM   616  C CZ  . TYR A 1 102 ? 19.749  -42.809 23.967 1.00 70.80  ? 597  TYR A CZ  1 
ATOM   617  O OH  . TYR A 1 102 ? 20.151  -43.550 25.047 1.00 70.97  ? 597  TYR A OH  1 
ATOM   618  N N   . ILE A 1 103 ? 16.104  -38.935 21.709 1.00 60.70  ? 598  ILE A N   1 
ATOM   619  C CA  . ILE A 1 103 ? 14.952  -38.942 22.610 1.00 58.77  ? 598  ILE A CA  1 
ATOM   620  C C   . ILE A 1 103 ? 14.144  -40.234 22.335 1.00 66.55  ? 598  ILE A C   1 
ATOM   621  O O   . ILE A 1 103 ? 13.972  -40.647 21.180 1.00 66.58  ? 598  ILE A O   1 
ATOM   622  C CB  . ILE A 1 103 ? 14.029  -37.704 22.511 1.00 59.27  ? 598  ILE A CB  1 
ATOM   623  C CG1 . ILE A 1 103 ? 14.823  -36.372 22.494 1.00 59.86  ? 598  ILE A CG1 1 
ATOM   624  C CG2 . ILE A 1 103 ? 12.978  -37.725 23.634 1.00 56.59  ? 598  ILE A CG2 1 
ATOM   625  C CD1 . ILE A 1 103 ? 13.958  -35.062 22.236 1.00 57.98  ? 598  ILE A CD1 1 
ATOM   626  N N   . TYR A 1 104 ? 13.685  -40.880 23.412 1.00 64.32  ? 599  TYR A N   1 
ATOM   627  C CA  . TYR A 1 104 ? 12.813  -42.044 23.386 1.00 64.12  ? 599  TYR A CA  1 
ATOM   628  C C   . TYR A 1 104 ? 11.660  -41.652 24.271 1.00 63.02  ? 599  TYR A C   1 
ATOM   629  O O   . TYR A 1 104 ? 11.880  -41.199 25.387 1.00 62.25  ? 599  TYR A O   1 
ATOM   630  C CB  . TYR A 1 104 ? 13.483  -43.311 23.947 1.00 68.18  ? 599  TYR A CB  1 
ATOM   631  C CG  . TYR A 1 104 ? 14.548  -43.949 23.078 1.00 74.81  ? 599  TYR A CG  1 
ATOM   632  C CD1 . TYR A 1 104 ? 14.550  -43.776 21.698 1.00 77.98  ? 599  TYR A CD1 1 
ATOM   633  C CD2 . TYR A 1 104 ? 15.515  -44.789 23.629 1.00 77.65  ? 599  TYR A CD2 1 
ATOM   634  C CE1 . TYR A 1 104 ? 15.526  -44.370 20.895 1.00 81.23  ? 599  TYR A CE1 1 
ATOM   635  C CE2 . TYR A 1 104 ? 16.488  -45.395 22.834 1.00 80.22  ? 599  TYR A CE2 1 
ATOM   636  C CZ  . TYR A 1 104 ? 16.488  -45.182 21.467 1.00 88.88  ? 599  TYR A CZ  1 
ATOM   637  O OH  . TYR A 1 104 ? 17.426  -45.780 20.666 1.00 96.23  ? 599  TYR A OH  1 
ATOM   638  N N   . MET A 1 105 ? 10.442  -41.771 23.764 1.00 56.63  ? 600  MET A N   1 
ATOM   639  C CA  . MET A 1 105 ? 9.252   -41.444 24.513 1.00 54.59  ? 600  MET A CA  1 
ATOM   640  C C   . MET A 1 105 ? 8.335   -42.643 24.498 1.00 60.55  ? 600  MET A C   1 
ATOM   641  O O   . MET A 1 105 ? 7.949   -43.122 23.422 1.00 60.31  ? 600  MET A O   1 
ATOM   642  C CB  . MET A 1 105 ? 8.557   -40.213 23.919 1.00 55.32  ? 600  MET A CB  1 
ATOM   643  C CG  . MET A 1 105 ? 9.317   -38.926 24.161 1.00 58.22  ? 600  MET A CG  1 
ATOM   644  S SD  . MET A 1 105 ? 8.715   -37.575 23.125 1.00 61.32  ? 600  MET A SD  1 
ATOM   645  C CE  . MET A 1 105 ? 7.308   -36.995 24.138 1.00 56.39  ? 600  MET A CE  1 
ATOM   646  N N   . VAL A 1 106 ? 8.015   -43.151 25.702 1.00 58.31  ? 601  VAL A N   1 
ATOM   647  C CA  . VAL A 1 106 ? 7.099   -44.280 25.897 1.00 58.75  ? 601  VAL A CA  1 
ATOM   648  C C   . VAL A 1 106 ? 5.694   -43.685 26.105 1.00 61.34  ? 601  VAL A C   1 
ATOM   649  O O   . VAL A 1 106 ? 5.425   -42.996 27.087 1.00 60.63  ? 601  VAL A O   1 
ATOM   650  C CB  . VAL A 1 106 ? 7.562   -45.236 27.025 1.00 62.91  ? 601  VAL A CB  1 
ATOM   651  C CG1 . VAL A 1 106 ? 6.604   -46.411 27.179 1.00 63.77  ? 601  VAL A CG1 1 
ATOM   652  C CG2 . VAL A 1 106 ? 8.968   -45.733 26.747 1.00 63.59  ? 601  VAL A CG2 1 
ATOM   653  N N   . MET A 1 107 ? 4.841   -43.891 25.132 1.00 57.80  ? 602  MET A N   1 
ATOM   654  C CA  . MET A 1 107 ? 3.503   -43.329 25.138 1.00 58.18  ? 602  MET A CA  1 
ATOM   655  C C   . MET A 1 107 ? 2.398   -44.383 25.003 1.00 63.06  ? 602  MET A C   1 
ATOM   656  O O   . MET A 1 107 ? 2.684   -45.567 24.828 1.00 63.97  ? 602  MET A O   1 
ATOM   657  C CB  . MET A 1 107 ? 3.397   -42.289 24.002 1.00 59.81  ? 602  MET A CB  1 
ATOM   658  C CG  . MET A 1 107 ? 4.416   -41.173 24.124 1.00 62.91  ? 602  MET A CG  1 
ATOM   659  S SD  . MET A 1 107 ? 4.520   -40.241 22.608 1.00 66.01  ? 602  MET A SD  1 
ATOM   660  C CE  . MET A 1 107 ? 3.420   -38.978 23.011 1.00 61.75  ? 602  MET A CE  1 
ATOM   661  N N   . GLU A 1 108 ? 1.136   -43.956 25.057 1.00 59.73  ? 603  GLU A N   1 
ATOM   662  C CA  . GLU A 1 108 ? 0.074   -44.920 24.835 1.00 61.35  ? 603  GLU A CA  1 
ATOM   663  C C   . GLU A 1 108 ? -0.112  -45.132 23.330 1.00 66.28  ? 603  GLU A C   1 
ATOM   664  O O   . GLU A 1 108 ? 0.175   -44.237 22.513 1.00 61.85  ? 603  GLU A O   1 
ATOM   665  C CB  . GLU A 1 108 ? -1.238  -44.604 25.604 1.00 62.56  ? 603  GLU A CB  1 
ATOM   666  C CG  . GLU A 1 108 ? -2.041  -43.400 25.142 1.00 68.24  ? 603  GLU A CG  1 
ATOM   667  C CD  . GLU A 1 108 ? -3.375  -43.214 25.844 1.00 85.52  ? 603  GLU A CD  1 
ATOM   668  O OE1 . GLU A 1 108 ? -4.125  -44.206 25.989 1.00 89.28  ? 603  GLU A OE1 1 
ATOM   669  O OE2 . GLU A 1 108 ? -3.689  -42.063 26.220 1.00 69.39  ? 603  GLU A OE2 1 
ATOM   670  N N   . CYS A 1 109 ? -0.495  -46.365 22.971 1.00 67.88  ? 604  CYS A N   1 
ATOM   671  C CA  . CYS A 1 109 ? -0.739  -46.692 21.581 1.00 69.16  ? 604  CYS A CA  1 
ATOM   672  C C   . CYS A 1 109 ? -2.212  -46.492 21.200 1.00 71.67  ? 604  CYS A C   1 
ATOM   673  O O   . CYS A 1 109 ? -3.128  -46.999 21.869 1.00 71.46  ? 604  CYS A O   1 
ATOM   674  C CB  . CYS A 1 109 ? -0.247  -48.087 21.232 1.00 72.40  ? 604  CYS A CB  1 
ATOM   675  S SG  . CYS A 1 109 ? -0.012  -48.340 19.457 1.00 77.92  ? 604  CYS A SG  1 
ATOM   676  N N   . GLY A 1 110 ? -2.417  -45.711 20.150 1.00 65.93  ? 605  GLY A N   1 
ATOM   677  C CA  . GLY A 1 110 ? -3.752  -45.469 19.636 1.00 65.51  ? 605  GLY A CA  1 
ATOM   678  C C   . GLY A 1 110 ? -4.112  -46.522 18.617 1.00 68.18  ? 605  GLY A C   1 
ATOM   679  O O   . GLY A 1 110 ? -3.265  -47.333 18.241 1.00 67.77  ? 605  GLY A O   1 
ATOM   680  N N   . ASN A 1 111 ? -5.352  -46.501 18.145 1.00 65.29  ? 606  ASN A N   1 
ATOM   681  C CA  . ASN A 1 111 ? -5.792  -47.422 17.105 1.00 68.09  ? 606  ASN A CA  1 
ATOM   682  C C   . ASN A 1 111 ? -5.401  -46.885 15.710 1.00 74.75  ? 606  ASN A C   1 
ATOM   683  O O   . ASN A 1 111 ? -4.716  -47.566 14.947 1.00 75.67  ? 606  ASN A O   1 
ATOM   684  C CB  . ASN A 1 111 ? -7.289  -47.705 17.228 1.00 66.99  ? 606  ASN A CB  1 
ATOM   685  C CG  . ASN A 1 111 ? -7.632  -48.519 18.443 1.00 98.98  ? 606  ASN A CG  1 
ATOM   686  O OD1 . ASN A 1 111 ? -6.969  -49.513 18.764 1.00 109.74 ? 606  ASN A OD1 1 
ATOM   687  N ND2 . ASN A 1 111 ? -8.681  -48.134 19.140 1.00 87.62  ? 606  ASN A ND2 1 
ATOM   688  N N   . ILE A 1 112 ? -5.789  -45.641 15.415 1.00 71.59  ? 607  ILE A N   1 
ATOM   689  C CA  . ILE A 1 112 ? -5.547  -44.954 14.147 1.00 71.47  ? 607  ILE A CA  1 
ATOM   690  C C   . ILE A 1 112 ? -5.613  -43.441 14.437 1.00 75.70  ? 607  ILE A C   1 
ATOM   691  O O   . ILE A 1 112 ? -6.143  -43.050 15.479 1.00 75.32  ? 607  ILE A O   1 
ATOM   692  C CB  . ILE A 1 112 ? -6.644  -45.437 13.146 1.00 76.09  ? 607  ILE A CB  1 
ATOM   693  C CG1 . ILE A 1 112 ? -6.407  -44.938 11.703 1.00 77.07  ? 607  ILE A CG1 1 
ATOM   694  C CG2 . ILE A 1 112 ? -8.080  -45.193 13.676 1.00 75.61  ? 607  ILE A CG2 1 
ATOM   695  C CD1 . ILE A 1 112 ? -7.308  -45.577 10.619 1.00 82.69  ? 607  ILE A CD1 1 
ATOM   696  N N   . ASP A 1 113 ? -5.070  -42.593 13.554 1.00 72.38  ? 608  ASP A N   1 
ATOM   697  C CA  . ASP A 1 113 ? -5.189  -41.152 13.772 1.00 70.16  ? 608  ASP A CA  1 
ATOM   698  C C   . ASP A 1 113 ? -6.529  -40.768 13.188 1.00 74.24  ? 608  ASP A C   1 
ATOM   699  O O   . ASP A 1 113 ? -7.092  -41.551 12.417 1.00 75.76  ? 608  ASP A O   1 
ATOM   700  C CB  . ASP A 1 113 ? -4.025  -40.350 13.157 1.00 71.48  ? 608  ASP A CB  1 
ATOM   701  C CG  . ASP A 1 113 ? -4.020  -40.337 11.647 1.00 86.52  ? 608  ASP A CG  1 
ATOM   702  O OD1 . ASP A 1 113 ? -4.747  -39.525 11.069 1.00 91.69  ? 608  ASP A OD1 1 
ATOM   703  O OD2 . ASP A 1 113 ? -3.301  -41.156 11.052 1.00 88.73  ? 608  ASP A OD2 1 
ATOM   704  N N   . LEU A 1 114 ? -7.055  -39.592 13.563 1.00 69.62  ? 609  LEU A N   1 
ATOM   705  C CA  . LEU A 1 114 ? -8.368  -39.137 13.104 1.00 69.83  ? 609  LEU A CA  1 
ATOM   706  C C   . LEU A 1 114 ? -8.446  -38.972 11.580 1.00 75.90  ? 609  LEU A C   1 
ATOM   707  O O   . LEU A 1 114 ? -9.460  -39.356 10.989 1.00 77.49  ? 609  LEU A O   1 
ATOM   708  C CB  . LEU A 1 114 ? -8.802  -37.862 13.867 1.00 67.76  ? 609  LEU A CB  1 
ATOM   709  C CG  . LEU A 1 114 ? -10.150 -37.200 13.513 1.00 71.58  ? 609  LEU A CG  1 
ATOM   710  C CD1 . LEU A 1 114 ? -11.337 -38.070 13.933 1.00 72.75  ? 609  LEU A CD1 1 
ATOM   711  C CD2 . LEU A 1 114 ? -10.245 -35.818 14.118 1.00 68.43  ? 609  LEU A CD2 1 
ATOM   712  N N   . ASN A 1 115 ? -7.363  -38.462 10.951 1.00 72.35  ? 610  ASN A N   1 
ATOM   713  C CA  . ASN A 1 115 ? -7.293  -38.230 9.504  1.00 74.69  ? 610  ASN A CA  1 
ATOM   714  C C   . ASN A 1 115 ? -7.459  -39.508 8.695  1.00 82.69  ? 610  ASN A C   1 
ATOM   715  O O   . ASN A 1 115 ? -8.400  -39.584 7.899  1.00 85.51  ? 610  ASN A O   1 
ATOM   716  C CB  . ASN A 1 115 ? -6.012  -37.487 9.106  1.00 73.86  ? 610  ASN A CB  1 
ATOM   717  C CG  . ASN A 1 115 ? -6.055  -36.813 7.762  1.00 99.93  ? 610  ASN A CG  1 
ATOM   718  O OD1 . ASN A 1 115 ? -7.083  -36.771 7.067  1.00 96.68  ? 610  ASN A OD1 1 
ATOM   719  N ND2 . ASN A 1 115 ? -4.942  -36.198 7.404  1.00 96.23  ? 610  ASN A ND2 1 
ATOM   720  N N   . SER A 1 116 ? -6.596  -40.519 8.917  1.00 78.84  ? 611  SER A N   1 
ATOM   721  C CA  . SER A 1 116 ? -6.713  -41.781 8.185  1.00 81.73  ? 611  SER A CA  1 
ATOM   722  C C   . SER A 1 116 ? -8.019  -42.536 8.476  1.00 87.90  ? 611  SER A C   1 
ATOM   723  O O   . SER A 1 116 ? -8.542  -43.191 7.573  1.00 90.10  ? 611  SER A O   1 
ATOM   724  C CB  . SER A 1 116 ? -5.470  -42.653 8.326  1.00 84.83  ? 611  SER A CB  1 
ATOM   725  O OG  . SER A 1 116 ? -4.905  -42.567 9.622  1.00 93.00  ? 611  SER A OG  1 
ATOM   726  N N   . TRP A 1 117 ? -8.592  -42.367 9.689  1.00 83.43  ? 612  TRP A N   1 
ATOM   727  C CA  . TRP A 1 117 ? -9.884  -42.959 10.023 1.00 84.95  ? 612  TRP A CA  1 
ATOM   728  C C   . TRP A 1 117 ? -10.970 -42.315 9.153  1.00 88.32  ? 612  TRP A C   1 
ATOM   729  O O   . TRP A 1 117 ? -11.776 -43.042 8.573  1.00 89.80  ? 612  TRP A O   1 
ATOM   730  C CB  . TRP A 1 117 ? -10.208 -42.827 11.526 1.00 82.47  ? 612  TRP A CB  1 
ATOM   731  C CG  . TRP A 1 117 ? -11.618 -43.226 11.891 1.00 85.27  ? 612  TRP A CG  1 
ATOM   732  C CD1 . TRP A 1 117 ? -12.614 -42.400 12.323 1.00 87.68  ? 612  TRP A CD1 1 
ATOM   733  C CD2 . TRP A 1 117 ? -12.199 -44.534 11.789 1.00 88.02  ? 612  TRP A CD2 1 
ATOM   734  N NE1 . TRP A 1 117 ? -13.769 -43.119 12.539 1.00 89.45  ? 612  TRP A NE1 1 
ATOM   735  C CE2 . TRP A 1 117 ? -13.545 -44.430 12.213 1.00 93.01  ? 612  TRP A CE2 1 
ATOM   736  C CE3 . TRP A 1 117 ? -11.720 -45.786 11.357 1.00 92.10  ? 612  TRP A CE3 1 
ATOM   737  C CZ2 . TRP A 1 117 ? -14.417 -45.531 12.226 1.00 95.54  ? 612  TRP A CZ2 1 
ATOM   738  C CZ3 . TRP A 1 117 ? -12.585 -46.878 11.357 1.00 96.90  ? 612  TRP A CZ3 1 
ATOM   739  C CH2 . TRP A 1 117 ? -13.918 -46.745 11.783 1.00 98.35  ? 612  TRP A CH2 1 
ATOM   740  N N   . LEU A 1 118 ? -10.953 -40.966 9.021  1.00 82.75  ? 613  LEU A N   1 
ATOM   741  C CA  . LEU A 1 118 ? -11.908 -40.215 8.193  1.00 84.00  ? 613  LEU A CA  1 
ATOM   742  C C   . LEU A 1 118 ? -11.730 -40.508 6.696  1.00 91.39  ? 613  LEU A C   1 
ATOM   743  O O   . LEU A 1 118 ? -12.708 -40.785 6.009  1.00 92.31  ? 613  LEU A O   1 
ATOM   744  C CB  . LEU A 1 118 ? -11.841 -38.695 8.465  1.00 82.22  ? 613  LEU A CB  1 
ATOM   745  C CG  . LEU A 1 118 ? -12.331 -38.194 9.852  1.00 84.68  ? 613  LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 118 ? -11.895 -36.747 10.113 1.00 82.02  ? 613  LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 118 ? -13.838 -38.388 10.037 1.00 86.59  ? 613  LEU A CD2 1 
ATOM   748  N N   . LYS A 1 119 ? -10.481 -40.492 6.207  1.00 89.83  ? 614  LYS A N   1 
ATOM   749  C CA  . LYS A 1 119 ? -10.146 -40.781 4.811  1.00 92.58  ? 614  LYS A CA  1 
ATOM   750  C C   . LYS A 1 119 ? -10.669 -42.161 4.377  1.00 100.93 ? 614  LYS A C   1 
ATOM   751  O O   . LYS A 1 119 ? -11.243 -42.265 3.296  1.00 103.66 ? 614  LYS A O   1 
ATOM   752  C CB  . LYS A 1 119 ? -8.633  -40.635 4.566  1.00 93.66  ? 614  LYS A CB  1 
ATOM   753  C CG  . LYS A 1 119 ? -8.145  -39.183 4.599  1.00 96.61  ? 614  LYS A CG  1 
ATOM   754  N N   . LYS A 1 120 ? -10.543 -43.191 5.249  1.00 98.15  ? 615  LYS A N   1 
ATOM   755  C CA  . LYS A 1 120 ? -11.030 -44.557 4.992  1.00 101.26 ? 615  LYS A CA  1 
ATOM   756  C C   . LYS A 1 120 ? -12.567 -44.672 5.066  1.00 109.90 ? 615  LYS A C   1 
ATOM   757  O O   . LYS A 1 120 ? -13.151 -45.475 4.337  1.00 113.58 ? 615  LYS A O   1 
ATOM   758  C CB  . LYS A 1 120 ? -10.368 -45.574 5.939  1.00 102.00 ? 615  LYS A CB  1 
ATOM   759  N N   . LYS A 1 121 ? -13.219 -43.880 5.936  1.00 105.89 ? 616  LYS A N   1 
ATOM   760  C CA  . LYS A 1 121 ? -14.672 -43.916 6.115  1.00 107.33 ? 616  LYS A CA  1 
ATOM   761  C C   . LYS A 1 121 ? -15.429 -43.068 5.083  1.00 114.64 ? 616  LYS A C   1 
ATOM   762  O O   . LYS A 1 121 ? -15.054 -41.927 4.809  1.00 111.77 ? 616  LYS A O   1 
ATOM   763  C CB  . LYS A 1 121 ? -15.049 -43.484 7.546  1.00 106.37 ? 616  LYS A CB  1 
ATOM   764  C CG  . LYS A 1 121 ? -15.329 -44.632 8.508  1.00 108.35 ? 616  LYS A CG  1 
ATOM   765  C CD  . LYS A 1 121 ? -16.421 -44.235 9.506  1.00 113.85 ? 616  LYS A CD  1 
ATOM   766  N N   . LYS A 1 122 ? -16.516 -43.623 4.535  1.00 117.32 ? 617  LYS A N   1 
ATOM   767  C CA  . LYS A 1 122 ? -17.369 -42.906 3.584  1.00 120.12 ? 617  LYS A CA  1 
ATOM   768  C C   . LYS A 1 122 ? -18.258 -41.916 4.372  1.00 124.42 ? 617  LYS A C   1 
ATOM   769  O O   . LYS A 1 122 ? -17.994 -40.704 4.353  1.00 123.08 ? 617  LYS A O   1 
ATOM   770  C CB  . LYS A 1 122 ? -18.208 -43.886 2.737  1.00 127.10 ? 617  LYS A CB  1 
ATOM   771  N N   . SER A 1 123 ? -19.267 -42.448 5.109  1.00 121.20 ? 618  SER A N   1 
ATOM   772  C CA  . SER A 1 123 ? -20.184 -41.669 5.945  1.00 118.95 ? 618  SER A CA  1 
ATOM   773  C C   . SER A 1 123 ? -19.849 -41.868 7.427  1.00 118.52 ? 618  SER A C   1 
ATOM   774  O O   . SER A 1 123 ? -19.578 -43.000 7.852  1.00 119.04 ? 618  SER A O   1 
ATOM   775  C CB  . SER A 1 123 ? -21.631 -42.069 5.673  1.00 125.23 ? 618  SER A CB  1 
ATOM   776  N N   . ILE A 1 124 ? -19.854 -40.757 8.201  1.00 109.97 ? 619  ILE A N   1 
ATOM   777  C CA  . ILE A 1 124 ? -19.575 -40.735 9.648  1.00 106.41 ? 619  ILE A CA  1 
ATOM   778  C C   . ILE A 1 124 ? -20.861 -40.557 10.463 1.00 108.38 ? 619  ILE A C   1 
ATOM   779  O O   . ILE A 1 124 ? -21.654 -39.653 10.185 1.00 109.25 ? 619  ILE A O   1 
ATOM   780  C CB  . ILE A 1 124 ? -18.434 -39.740 10.044 1.00 106.16 ? 619  ILE A CB  1 
ATOM   781  C CG1 . ILE A 1 124 ? -18.344 -39.509 11.581 1.00 103.64 ? 619  ILE A CG1 1 
ATOM   782  C CG2 . ILE A 1 124 ? -18.549 -38.422 9.276  1.00 107.48 ? 619  ILE A CG2 1 
ATOM   783  C CD1 . ILE A 1 124 ? -17.005 -39.050 12.105 1.00 103.31 ? 619  ILE A CD1 1 
ATOM   784  N N   . ASP A 1 125 ? -21.046 -41.431 11.470 1.00 101.81 ? 620  ASP A N   1 
ATOM   785  C CA  . ASP A 1 125 ? -22.196 -41.480 12.376 1.00 100.84 ? 620  ASP A CA  1 
ATOM   786  C C   . ASP A 1 125 ? -22.380 -40.189 13.189 1.00 98.81  ? 620  ASP A C   1 
ATOM   787  O O   . ASP A 1 125 ? -21.410 -39.675 13.747 1.00 95.68  ? 620  ASP A O   1 
ATOM   788  C CB  . ASP A 1 125 ? -22.055 -42.693 13.307 1.00 103.51 ? 620  ASP A CB  1 
ATOM   789  C CG  . ASP A 1 125 ? -23.268 -42.991 14.150 1.00 112.71 ? 620  ASP A CG  1 
ATOM   790  O OD1 . ASP A 1 125 ? -24.286 -43.448 13.584 1.00 116.50 ? 620  ASP A OD1 1 
ATOM   791  O OD2 . ASP A 1 125 ? -23.187 -42.816 15.377 1.00 115.36 ? 620  ASP A OD2 1 
ATOM   792  N N   . PRO A 1 126 ? -23.617 -39.657 13.290 1.00 94.89  ? 621  PRO A N   1 
ATOM   793  C CA  . PRO A 1 126 ? -23.824 -38.410 14.049 1.00 92.43  ? 621  PRO A CA  1 
ATOM   794  C C   . PRO A 1 126 ? -23.493 -38.499 15.539 1.00 93.64  ? 621  PRO A C   1 
ATOM   795  O O   . PRO A 1 126 ? -23.093 -37.495 16.136 1.00 91.04  ? 621  PRO A O   1 
ATOM   796  C CB  . PRO A 1 126 ? -25.305 -38.094 13.809 1.00 96.40  ? 621  PRO A CB  1 
ATOM   797  C CG  . PRO A 1 126 ? -25.655 -38.846 12.563 1.00 103.13 ? 621  PRO A CG  1 
ATOM   798  C CD  . PRO A 1 126 ? -24.881 -40.111 12.679 1.00 99.12  ? 621  PRO A CD  1 
ATOM   799  N N   . TRP A 1 127 ? -23.638 -39.695 16.133 1.00 90.59  ? 622  TRP A N   1 
ATOM   800  C CA  . TRP A 1 127 ? -23.334 -39.895 17.541 1.00 89.68  ? 622  TRP A CA  1 
ATOM   801  C C   . TRP A 1 127 ? -21.825 -39.896 17.753 1.00 90.79  ? 622  TRP A C   1 
ATOM   802  O O   . TRP A 1 127 ? -21.350 -39.225 18.680 1.00 89.75  ? 622  TRP A O   1 
ATOM   803  C CB  . TRP A 1 127 ? -23.973 -41.177 18.071 1.00 91.72  ? 622  TRP A CB  1 
ATOM   804  C CG  . TRP A 1 127 ? -24.079 -41.225 19.565 1.00 93.24  ? 622  TRP A CG  1 
ATOM   805  C CD1 . TRP A 1 127 ? -25.138 -40.816 20.329 1.00 97.77  ? 622  TRP A CD1 1 
ATOM   806  C CD2 . TRP A 1 127 ? -23.102 -41.744 20.474 1.00 92.04  ? 622  TRP A CD2 1 
ATOM   807  N NE1 . TRP A 1 127 ? -24.880 -41.054 21.662 1.00 97.54  ? 622  TRP A NE1 1 
ATOM   808  C CE2 . TRP A 1 127 ? -23.624 -41.600 21.781 1.00 97.29  ? 622  TRP A CE2 1 
ATOM   809  C CE3 . TRP A 1 127 ? -21.843 -42.342 20.311 1.00 92.34  ? 622  TRP A CE3 1 
ATOM   810  C CZ2 . TRP A 1 127 ? -22.917 -42.009 22.919 1.00 96.37  ? 622  TRP A CZ2 1 
ATOM   811  C CZ3 . TRP A 1 127 ? -21.138 -42.736 21.440 1.00 93.78  ? 622  TRP A CZ3 1 
ATOM   812  C CH2 . TRP A 1 127 ? -21.673 -42.569 22.725 1.00 95.33  ? 622  TRP A CH2 1 
ATOM   813  N N   . GLU A 1 128 ? -21.063 -40.602 16.878 1.00 84.92  ? 623  GLU A N   1 
ATOM   814  C CA  . GLU A 1 128 ? -19.614 -40.613 17.001 1.00 81.77  ? 623  GLU A CA  1 
ATOM   815  C C   . GLU A 1 128 ? -19.004 -39.250 16.714 1.00 78.85  ? 623  GLU A C   1 
ATOM   816  O O   . GLU A 1 128 ? -18.025 -38.893 17.362 1.00 76.37  ? 623  GLU A O   1 
ATOM   817  C CB  . GLU A 1 128 ? -18.936 -41.779 16.244 1.00 84.96  ? 623  GLU A CB  1 
ATOM   818  C CG  . GLU A 1 128 ? -18.736 -41.620 14.743 1.00 99.93  ? 623  GLU A CG  1 
ATOM   819  C CD  . GLU A 1 128 ? -17.954 -42.748 14.088 1.00 123.82 ? 623  GLU A CD  1 
ATOM   820  O OE1 . GLU A 1 128 ? -16.724 -42.847 14.325 1.00 113.80 ? 623  GLU A OE1 1 
ATOM   821  O OE2 . GLU A 1 128 ? -18.572 -43.516 13.312 1.00 113.64 ? 623  GLU A OE2 1 
ATOM   822  N N   . ARG A 1 129 ? -19.623 -38.462 15.801 1.00 72.39  ? 624  ARG A N   1 
ATOM   823  C CA  . ARG A 1 129 ? -19.183 -37.107 15.468 1.00 68.82  ? 624  ARG A CA  1 
ATOM   824  C C   . ARG A 1 129 ? -19.397 -36.179 16.664 1.00 71.52  ? 624  ARG A C   1 
ATOM   825  O O   . ARG A 1 129 ? -18.467 -35.456 17.027 1.00 69.40  ? 624  ARG A O   1 
ATOM   826  C CB  . ARG A 1 129 ? -19.903 -36.593 14.225 1.00 67.80  ? 624  ARG A CB  1 
ATOM   827  C CG  . ARG A 1 129 ? -19.617 -35.138 13.889 1.00 69.52  ? 624  ARG A CG  1 
ATOM   828  C CD  . ARG A 1 129 ? -20.364 -34.678 12.659 1.00 77.08  ? 624  ARG A CD  1 
ATOM   829  N NE  . ARG A 1 129 ? -21.762 -35.112 12.669 1.00 82.12  ? 624  ARG A NE  1 
ATOM   830  C CZ  . ARG A 1 129 ? -22.447 -35.450 11.584 1.00 91.70  ? 624  ARG A CZ  1 
ATOM   831  N NH1 . ARG A 1 129 ? -21.881 -35.388 10.385 1.00 75.00  ? 624  ARG A NH1 1 
ATOM   832  N NH2 . ARG A 1 129 ? -23.706 -35.844 11.686 1.00 80.90  ? 624  ARG A NH2 1 
ATOM   833  N N   . LYS A 1 130 ? -20.599 -36.217 17.301 1.00 68.62  ? 625  LYS A N   1 
ATOM   834  C CA  . LYS A 1 130 ? -20.873 -35.420 18.509 1.00 66.80  ? 625  LYS A CA  1 
ATOM   835  C C   . LYS A 1 130 ? -19.848 -35.787 19.601 1.00 69.95  ? 625  LYS A C   1 
ATOM   836  O O   . LYS A 1 130 ? -19.217 -34.891 20.167 1.00 68.05  ? 625  LYS A O   1 
ATOM   837  C CB  . LYS A 1 130 ? -22.289 -35.662 19.020 1.00 69.31  ? 625  LYS A CB  1 
ATOM   838  C CG  . LYS A 1 130 ? -22.969 -34.414 19.513 1.00 63.27  ? 625  LYS A CG  1 
ATOM   839  C CD  . LYS A 1 130 ? -24.419 -34.708 19.929 1.00 70.81  ? 625  LYS A CD  1 
ATOM   840  C CE  . LYS A 1 130 ? -25.484 -33.923 19.192 1.00 72.43  ? 625  LYS A CE  1 
ATOM   841  N NZ  . LYS A 1 130 ? -26.519 -33.385 20.132 1.00 75.87  ? 625  LYS A NZ  1 
ATOM   842  N N   . SER A 1 131 ? -19.628 -37.105 19.823 1.00 66.97  ? 626  SER A N   1 
ATOM   843  C CA  . SER A 1 131 ? -18.687 -37.636 20.800 1.00 66.10  ? 626  SER A CA  1 
ATOM   844  C C   . SER A 1 131 ? -17.269 -37.136 20.569 1.00 69.99  ? 626  SER A C   1 
ATOM   845  O O   . SER A 1 131 ? -16.636 -36.668 21.519 1.00 70.49  ? 626  SER A O   1 
ATOM   846  C CB  . SER A 1 131 ? -18.708 -39.158 20.797 1.00 71.41  ? 626  SER A CB  1 
ATOM   847  O OG  . SER A 1 131 ? -17.817 -39.647 21.785 1.00 80.74  ? 626  SER A OG  1 
ATOM   848  N N   . TYR A 1 132 ? -16.776 -37.216 19.314 1.00 64.61  ? 627  TYR A N   1 
ATOM   849  C CA  . TYR A 1 132 ? -15.434 -36.781 18.933 1.00 61.69  ? 627  TYR A CA  1 
ATOM   850  C C   . TYR A 1 132 ? -15.217 -35.295 19.134 1.00 64.19  ? 627  TYR A C   1 
ATOM   851  O O   . TYR A 1 132 ? -14.135 -34.890 19.575 1.00 62.31  ? 627  TYR A O   1 
ATOM   852  C CB  . TYR A 1 132 ? -15.113 -37.186 17.487 1.00 63.50  ? 627  TYR A CB  1 
ATOM   853  C CG  . TYR A 1 132 ? -14.853 -38.670 17.277 1.00 66.76  ? 627  TYR A CG  1 
ATOM   854  C CD1 . TYR A 1 132 ? -14.491 -39.499 18.345 1.00 67.93  ? 627  TYR A CD1 1 
ATOM   855  C CD2 . TYR A 1 132 ? -14.982 -39.248 16.020 1.00 69.48  ? 627  TYR A CD2 1 
ATOM   856  C CE1 . TYR A 1 132 ? -14.259 -40.860 18.158 1.00 68.54  ? 627  TYR A CE1 1 
ATOM   857  C CE2 . TYR A 1 132 ? -14.741 -40.607 15.819 1.00 72.89  ? 627  TYR A CE2 1 
ATOM   858  C CZ  . TYR A 1 132 ? -14.371 -41.408 16.889 1.00 80.61  ? 627  TYR A CZ  1 
ATOM   859  O OH  . TYR A 1 132 ? -14.165 -42.752 16.684 1.00 84.60  ? 627  TYR A OH  1 
ATOM   860  N N   . TRP A 1 133 ? -16.261 -34.485 18.828 1.00 61.19  ? 628  TRP A N   1 
ATOM   861  C CA  . TRP A 1 133 ? -16.280 -33.032 18.975 1.00 58.95  ? 628  TRP A CA  1 
ATOM   862  C C   . TRP A 1 133 ? -16.031 -32.661 20.425 1.00 60.91  ? 628  TRP A C   1 
ATOM   863  O O   . TRP A 1 133 ? -15.114 -31.880 20.715 1.00 59.59  ? 628  TRP A O   1 
ATOM   864  C CB  . TRP A 1 133 ? -17.617 -32.459 18.487 1.00 58.68  ? 628  TRP A CB  1 
ATOM   865  C CG  . TRP A 1 133 ? -17.683 -30.957 18.517 1.00 58.89  ? 628  TRP A CG  1 
ATOM   866  C CD1 . TRP A 1 133 ? -18.562 -30.187 19.224 1.00 62.12  ? 628  TRP A CD1 1 
ATOM   867  C CD2 . TRP A 1 133 ? -16.794 -30.045 17.854 1.00 57.75  ? 628  TRP A CD2 1 
ATOM   868  N NE1 . TRP A 1 133 ? -18.300 -28.852 19.016 1.00 60.56  ? 628  TRP A NE1 1 
ATOM   869  C CE2 . TRP A 1 133 ? -17.234 -28.733 18.161 1.00 61.12  ? 628  TRP A CE2 1 
ATOM   870  C CE3 . TRP A 1 133 ? -15.692 -30.207 16.986 1.00 58.15  ? 628  TRP A CE3 1 
ATOM   871  C CZ2 . TRP A 1 133 ? -16.603 -27.591 17.648 1.00 59.67  ? 628  TRP A CZ2 1 
ATOM   872  C CZ3 . TRP A 1 133 ? -15.060 -29.073 16.491 1.00 58.99  ? 628  TRP A CZ3 1 
ATOM   873  C CH2 . TRP A 1 133 ? -15.514 -27.785 16.823 1.00 59.64  ? 628  TRP A CH2 1 
ATOM   874  N N   . LYS A 1 134 ? -16.815 -33.273 21.333 1.00 57.30  ? 629  LYS A N   1 
ATOM   875  C CA  . LYS A 1 134 ? -16.732 -33.108 22.782 1.00 56.95  ? 629  LYS A CA  1 
ATOM   876  C C   . LYS A 1 134 ? -15.292 -33.325 23.267 1.00 61.83  ? 629  LYS A C   1 
ATOM   877  O O   . LYS A 1 134 ? -14.791 -32.515 24.043 1.00 62.56  ? 629  LYS A O   1 
ATOM   878  C CB  . LYS A 1 134 ? -17.665 -34.111 23.478 1.00 60.49  ? 629  LYS A CB  1 
ATOM   879  C CG  . LYS A 1 134 ? -19.162 -33.852 23.317 1.00 66.46  ? 629  LYS A CG  1 
ATOM   880  C CD  . LYS A 1 134 ? -19.916 -34.540 24.443 1.00 70.12  ? 629  LYS A CD  1 
ATOM   881  C CE  . LYS A 1 134 ? -21.229 -35.156 24.053 1.00 65.69  ? 629  LYS A CE  1 
ATOM   882  N NZ  . LYS A 1 134 ? -21.674 -36.104 25.107 1.00 72.61  ? 629  LYS A NZ  1 
ATOM   883  N N   . ASN A 1 135 ? -14.629 -34.399 22.779 1.00 57.30  ? 630  ASN A N   1 
ATOM   884  C CA  . ASN A 1 135 ? -13.263 -34.782 23.102 1.00 56.09  ? 630  ASN A CA  1 
ATOM   885  C C   . ASN A 1 135 ? -12.231 -33.747 22.635 1.00 60.57  ? 630  ASN A C   1 
ATOM   886  O O   . ASN A 1 135 ? -11.298 -33.430 23.383 1.00 59.32  ? 630  ASN A O   1 
ATOM   887  C CB  . ASN A 1 135 ? -12.951 -36.156 22.515 1.00 56.07  ? 630  ASN A CB  1 
ATOM   888  C CG  . ASN A 1 135 ? -13.683 -37.328 23.134 1.00 75.34  ? 630  ASN A CG  1 
ATOM   889  O OD1 . ASN A 1 135 ? -13.661 -38.438 22.605 1.00 65.85  ? 630  ASN A OD1 1 
ATOM   890  N ND2 . ASN A 1 135 ? -14.327 -37.133 24.273 1.00 71.22  ? 630  ASN A ND2 1 
ATOM   891  N N   . MET A 1 136 ? -12.397 -33.236 21.397 1.00 57.96  ? 631  MET A N   1 
ATOM   892  C CA  . MET A 1 136 ? -11.544 -32.208 20.795 1.00 56.73  ? 631  MET A CA  1 
ATOM   893  C C   . MET A 1 136 ? -11.639 -30.929 21.632 1.00 60.62  ? 631  MET A C   1 
ATOM   894  O O   . MET A 1 136 ? -10.596 -30.322 21.925 1.00 60.41  ? 631  MET A O   1 
ATOM   895  C CB  . MET A 1 136 ? -11.971 -31.913 19.346 1.00 59.74  ? 631  MET A CB  1 
ATOM   896  C CG  . MET A 1 136 ? -11.710 -33.047 18.407 1.00 64.59  ? 631  MET A CG  1 
ATOM   897  S SD  . MET A 1 136 ? -12.106 -32.680 16.686 1.00 70.46  ? 631  MET A SD  1 
ATOM   898  C CE  . MET A 1 136 ? -13.470 -33.769 16.442 1.00 69.38  ? 631  MET A CE  1 
ATOM   899  N N   . LEU A 1 137 ? -12.883 -30.529 22.035 1.00 55.27  ? 632  LEU A N   1 
ATOM   900  C CA  . LEU A 1 137 ? -13.077 -29.333 22.861 1.00 54.14  ? 632  LEU A CA  1 
ATOM   901  C C   . LEU A 1 137 ? -12.392 -29.497 24.211 1.00 57.40  ? 632  LEU A C   1 
ATOM   902  O O   . LEU A 1 137 ? -11.669 -28.584 24.613 1.00 55.85  ? 632  LEU A O   1 
ATOM   903  C CB  . LEU A 1 137 ? -14.553 -28.972 23.059 1.00 55.18  ? 632  LEU A CB  1 
ATOM   904  C CG  . LEU A 1 137 ? -15.376 -28.692 21.818 1.00 60.14  ? 632  LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 137 ? -16.860 -28.734 22.143 1.00 60.82  ? 632  LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 137 ? -14.942 -27.386 21.122 1.00 62.10  ? 632  LEU A CD2 1 
ATOM   907  N N   . GLU A 1 138 ? -12.570 -30.681 24.878 1.00 54.97  ? 633  GLU A N   1 
ATOM   908  C CA  . GLU A 1 138 ? -11.949 -31.004 26.173 1.00 54.89  ? 633  GLU A CA  1 
ATOM   909  C C   . GLU A 1 138 ? -10.407 -30.871 26.106 1.00 59.15  ? 633  GLU A C   1 
ATOM   910  O O   . GLU A 1 138 ? -9.816  -30.209 26.965 1.00 59.15  ? 633  GLU A O   1 
ATOM   911  C CB  . GLU A 1 138 ? -12.349 -32.404 26.665 1.00 57.02  ? 633  GLU A CB  1 
ATOM   912  C CG  . GLU A 1 138 ? -12.054 -32.619 28.147 1.00 71.67  ? 633  GLU A CG  1 
ATOM   913  C CD  . GLU A 1 138 ? -12.268 -33.992 28.772 1.00 101.01 ? 633  GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 138 ? -13.172 -34.734 28.316 1.00 94.88  ? 633  GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 138 ? -11.548 -34.307 29.751 1.00 94.80  ? 633  GLU A OE2 1 
ATOM   916  N N   . ALA A 1 139 ? -9.776  -31.465 25.071 1.00 54.56  ? 634  ALA A N   1 
ATOM   917  C CA  . ALA A 1 139 ? -8.328  -31.450 24.869 1.00 53.31  ? 634  ALA A CA  1 
ATOM   918  C C   . ALA A 1 139 ? -7.787  -30.027 24.580 1.00 59.31  ? 634  ALA A C   1 
ATOM   919  O O   . ALA A 1 139 ? -6.935  -29.523 25.330 1.00 59.01  ? 634  ALA A O   1 
ATOM   920  C CB  . ALA A 1 139 ? -7.943  -32.431 23.765 1.00 53.41  ? 634  ALA A CB  1 
ATOM   921  N N   . VAL A 1 140 ? -8.323  -29.359 23.543 1.00 57.42  ? 635  VAL A N   1 
ATOM   922  C CA  . VAL A 1 140 ? -7.908  -27.992 23.185 1.00 57.80  ? 635  VAL A CA  1 
ATOM   923  C C   . VAL A 1 140 ? -8.153  -27.024 24.334 1.00 62.23  ? 635  VAL A C   1 
ATOM   924  O O   . VAL A 1 140 ? -7.262  -26.256 24.669 1.00 61.91  ? 635  VAL A O   1 
ATOM   925  C CB  . VAL A 1 140 ? -8.514  -27.524 21.846 1.00 62.74  ? 635  VAL A CB  1 
ATOM   926  C CG1 . VAL A 1 140 ? -8.026  -26.134 21.488 1.00 62.30  ? 635  VAL A CG1 1 
ATOM   927  C CG2 . VAL A 1 140 ? -8.155  -28.512 20.725 1.00 62.95  ? 635  VAL A CG2 1 
ATOM   928  N N   . HIS A 1 141 ? -9.305  -27.128 25.006 1.00 59.89  ? 636  HIS A N   1 
ATOM   929  C CA  . HIS A 1 141 ? -9.573  -26.296 26.173 1.00 61.40  ? 636  HIS A CA  1 
ATOM   930  C C   . HIS A 1 141 ? -8.461  -26.420 27.239 1.00 65.28  ? 636  HIS A C   1 
ATOM   931  O O   . HIS A 1 141 ? -8.079  -25.402 27.804 1.00 66.23  ? 636  HIS A O   1 
ATOM   932  C CB  . HIS A 1 141 ? -10.932 -26.654 26.787 1.00 63.88  ? 636  HIS A CB  1 
ATOM   933  C CG  . HIS A 1 141 ? -11.371 -25.761 27.907 1.00 68.73  ? 636  HIS A CG  1 
ATOM   934  N ND1 . HIS A 1 141 ? -11.999 -26.276 29.033 1.00 71.70  ? 636  HIS A ND1 1 
ATOM   935  C CD2 . HIS A 1 141 ? -11.277 -24.414 28.033 1.00 71.13  ? 636  HIS A CD2 1 
ATOM   936  C CE1 . HIS A 1 141 ? -12.237 -25.233 29.815 1.00 72.47  ? 636  HIS A CE1 1 
ATOM   937  N NE2 . HIS A 1 141 ? -11.825 -24.091 29.252 1.00 72.41  ? 636  HIS A NE2 1 
ATOM   938  N N   . THR A 1 142 ? -7.925  -27.647 27.484 1.00 59.90  ? 637  THR A N   1 
ATOM   939  C CA  . THR A 1 142 ? -6.883  -27.898 28.495 1.00 59.10  ? 637  THR A CA  1 
ATOM   940  C C   . THR A 1 142 ? -5.595  -27.130 28.213 1.00 61.21  ? 637  THR A C   1 
ATOM   941  O O   . THR A 1 142 ? -5.070  -26.450 29.094 1.00 61.46  ? 637  THR A O   1 
ATOM   942  C CB  . THR A 1 142 ? -6.632  -29.393 28.678 1.00 65.00  ? 637  THR A CB  1 
ATOM   943  O OG1 . THR A 1 142 ? -7.885  -30.053 28.833 1.00 64.73  ? 637  THR A OG1 1 
ATOM   944  C CG2 . THR A 1 142 ? -5.760  -29.685 29.890 1.00 67.56  ? 637  THR A CG2 1 
ATOM   945  N N   . ILE A 1 143 ? -5.105  -27.230 26.975 1.00 54.81  ? 638  ILE A N   1 
ATOM   946  C CA  . ILE A 1 143 ? -3.906  -26.547 26.541 1.00 52.10  ? 638  ILE A CA  1 
ATOM   947  C C   . ILE A 1 143 ? -4.128  -25.038 26.710 1.00 55.90  ? 638  ILE A C   1 
ATOM   948  O O   . ILE A 1 143 ? -3.252  -24.360 27.228 1.00 57.09  ? 638  ILE A O   1 
ATOM   949  C CB  . ILE A 1 143 ? -3.424  -27.019 25.115 1.00 53.31  ? 638  ILE A CB  1 
ATOM   950  C CG1 . ILE A 1 143 ? -4.224  -26.398 23.938 1.00 53.06  ? 638  ILE A CG1 1 
ATOM   951  C CG2 . ILE A 1 143 ? -3.322  -28.562 25.014 1.00 50.68  ? 638  ILE A CG2 1 
ATOM   952  C CD1 . ILE A 1 143 ? -3.658  -26.590 22.510 1.00 51.84  ? 638  ILE A CD1 1 
ATOM   953  N N   . HIS A 1 144 ? -5.342  -24.543 26.398 1.00 52.05  ? 639  HIS A N   1 
ATOM   954  C CA  . HIS A 1 144 ? -5.688  -23.121 26.528 1.00 51.86  ? 639  HIS A CA  1 
ATOM   955  C C   . HIS A 1 144 ? -5.613  -22.634 27.975 1.00 56.61  ? 639  HIS A C   1 
ATOM   956  O O   . HIS A 1 144 ? -5.076  -21.551 28.224 1.00 56.50  ? 639  HIS A O   1 
ATOM   957  C CB  . HIS A 1 144 ? -7.035  -22.807 25.883 1.00 51.89  ? 639  HIS A CB  1 
ATOM   958  C CG  . HIS A 1 144 ? -7.047  -22.853 24.381 1.00 54.47  ? 639  HIS A CG  1 
ATOM   959  N ND1 . HIS A 1 144 ? -8.216  -22.635 23.662 1.00 56.41  ? 639  HIS A ND1 1 
ATOM   960  C CD2 . HIS A 1 144 ? -6.043  -23.084 23.505 1.00 55.52  ? 639  HIS A CD2 1 
ATOM   961  C CE1 . HIS A 1 144 ? -7.882  -22.743 22.389 1.00 55.24  ? 639  HIS A CE1 1 
ATOM   962  N NE2 . HIS A 1 144 ? -6.588  -23.011 22.246 1.00 55.33  ? 639  HIS A NE2 1 
ATOM   963  N N   . GLN A 1 145 ? -6.046  -23.473 28.929 1.00 53.52  ? 640  GLN A N   1 
ATOM   964  C CA  . GLN A 1 145 ? -5.980  -23.166 30.361 1.00 55.09  ? 640  GLN A CA  1 
ATOM   965  C C   . GLN A 1 145 ? -4.552  -23.045 30.877 1.00 64.43  ? 640  GLN A C   1 
ATOM   966  O O   . GLN A 1 145 ? -4.356  -22.449 31.934 1.00 67.33  ? 640  GLN A O   1 
ATOM   967  C CB  . GLN A 1 145 ? -6.720  -24.207 31.175 1.00 55.83  ? 640  GLN A CB  1 
ATOM   968  C CG  . GLN A 1 145 ? -8.182  -24.226 30.841 1.00 61.59  ? 640  GLN A CG  1 
ATOM   969  C CD  . GLN A 1 145 ? -8.937  -25.125 31.749 1.00 81.34  ? 640  GLN A CD  1 
ATOM   970  O OE1 . GLN A 1 145 ? -8.657  -26.327 31.848 1.00 79.12  ? 640  GLN A OE1 1 
ATOM   971  N NE2 . GLN A 1 145 ? -9.933  -24.555 32.407 1.00 73.18  ? 640  GLN A NE2 1 
ATOM   972  N N   . HIS A 1 146 ? -3.557  -23.590 30.133 1.00 60.86  ? 641  HIS A N   1 
ATOM   973  C CA  . HIS A 1 146 ? -2.139  -23.549 30.491 1.00 60.67  ? 641  HIS A CA  1 
ATOM   974  C C   . HIS A 1 146 ? -1.314  -22.561 29.661 1.00 63.59  ? 641  HIS A C   1 
ATOM   975  O O   . HIS A 1 146 ? -0.081  -22.536 29.760 1.00 64.27  ? 641  HIS A O   1 
ATOM   976  C CB  . HIS A 1 146 ? -1.565  -24.967 30.511 1.00 61.11  ? 641  HIS A CB  1 
ATOM   977  C CG  . HIS A 1 146 ? -2.120  -25.761 31.654 1.00 66.51  ? 641  HIS A CG  1 
ATOM   978  N ND1 . HIS A 1 146 ? -3.338  -26.437 31.548 1.00 69.11  ? 641  HIS A ND1 1 
ATOM   979  C CD2 . HIS A 1 146 ? -1.664  -25.886 32.924 1.00 70.28  ? 641  HIS A CD2 1 
ATOM   980  C CE1 . HIS A 1 146 ? -3.555  -26.982 32.736 1.00 69.82  ? 641  HIS A CE1 1 
ATOM   981  N NE2 . HIS A 1 146 ? -2.578  -26.673 33.601 1.00 71.04  ? 641  HIS A NE2 1 
ATOM   982  N N   . GLY A 1 147 ? -2.021  -21.707 28.922 1.00 59.17  ? 642  GLY A N   1 
ATOM   983  C CA  . GLY A 1 147 ? -1.452  -20.680 28.061 1.00 59.43  ? 642  GLY A CA  1 
ATOM   984  C C   . GLY A 1 147 ? -1.073  -21.139 26.667 1.00 64.27  ? 642  GLY A C   1 
ATOM   985  O O   . GLY A 1 147 ? -0.515  -20.354 25.896 1.00 64.47  ? 642  GLY A O   1 
ATOM   986  N N   . ILE A 1 148 ? -1.373  -22.401 26.318 1.00 61.52  ? 643  ILE A N   1 
ATOM   987  C CA  . ILE A 1 148 ? -1.037  -22.943 24.991 1.00 61.48  ? 643  ILE A CA  1 
ATOM   988  C C   . ILE A 1 148 ? -2.144  -22.759 23.915 1.00 64.26  ? 643  ILE A C   1 
ATOM   989  O O   . ILE A 1 148 ? -3.270  -23.214 24.096 1.00 63.86  ? 643  ILE A O   1 
ATOM   990  C CB  . ILE A 1 148 ? -0.563  -24.435 25.076 1.00 63.56  ? 643  ILE A CB  1 
ATOM   991  C CG1 . ILE A 1 148 ? 0.506   -24.628 26.146 1.00 64.20  ? 643  ILE A CG1 1 
ATOM   992  C CG2 . ILE A 1 148 ? -0.101  -24.995 23.709 1.00 63.79  ? 643  ILE A CG2 1 
ATOM   993  C CD1 . ILE A 1 148 ? 0.352   -25.873 26.810 1.00 73.28  ? 643  ILE A CD1 1 
ATOM   994  N N   . VAL A 1 149 ? -1.777  -22.137 22.786 1.00 59.26  ? 644  VAL A N   1 
ATOM   995  C CA  . VAL A 1 149 ? -2.562  -22.011 21.563 1.00 58.11  ? 644  VAL A CA  1 
ATOM   996  C C   . VAL A 1 149 ? -1.797  -22.917 20.587 1.00 60.97  ? 644  VAL A C   1 
ATOM   997  O O   . VAL A 1 149 ? -0.610  -22.704 20.335 1.00 60.17  ? 644  VAL A O   1 
ATOM   998  C CB  . VAL A 1 149 ? -2.672  -20.556 21.038 1.00 63.25  ? 644  VAL A CB  1 
ATOM   999  C CG1 . VAL A 1 149 ? -3.163  -20.529 19.591 1.00 63.61  ? 644  VAL A CG1 1 
ATOM   1000 C CG2 . VAL A 1 149 ? -3.589  -19.728 21.924 1.00 63.69  ? 644  VAL A CG2 1 
ATOM   1001 N N   . HIS A 1 150 ? -2.451  -23.962 20.096 1.00 58.19  ? 645  HIS A N   1 
ATOM   1002 C CA  . HIS A 1 150 ? -1.839  -24.920 19.179 1.00 57.09  ? 645  HIS A CA  1 
ATOM   1003 C C   . HIS A 1 150 ? -1.482  -24.263 17.828 1.00 66.06  ? 645  HIS A C   1 
ATOM   1004 O O   . HIS A 1 150 ? -0.348  -24.380 17.384 1.00 66.36  ? 645  HIS A O   1 
ATOM   1005 C CB  . HIS A 1 150 ? -2.770  -26.110 18.973 1.00 55.84  ? 645  HIS A CB  1 
ATOM   1006 C CG  . HIS A 1 150 ? -2.107  -27.222 18.247 1.00 58.60  ? 645  HIS A CG  1 
ATOM   1007 N ND1 . HIS A 1 150 ? -1.639  -27.062 16.949 1.00 60.61  ? 645  HIS A ND1 1 
ATOM   1008 C CD2 . HIS A 1 150 ? -1.834  -28.481 18.667 1.00 59.41  ? 645  HIS A CD2 1 
ATOM   1009 C CE1 . HIS A 1 150 ? -1.071  -28.212 16.642 1.00 60.14  ? 645  HIS A CE1 1 
ATOM   1010 N NE2 . HIS A 1 150 ? -1.182  -29.102 17.642 1.00 59.56  ? 645  HIS A NE2 1 
ATOM   1011 N N   . SER A 1 151 ? -2.449  -23.576 17.191 1.00 67.05  ? 646  SER A N   1 
ATOM   1012 C CA  . SER A 1 151 ? -2.363  -22.858 15.905 1.00 70.44  ? 646  SER A CA  1 
ATOM   1013 C C   . SER A 1 151 ? -2.274  -23.688 14.615 1.00 76.59  ? 646  SER A C   1 
ATOM   1014 O O   . SER A 1 151 ? -2.620  -23.170 13.541 1.00 78.66  ? 646  SER A O   1 
ATOM   1015 C CB  . SER A 1 151 ? -1.333  -21.741 15.937 1.00 77.25  ? 646  SER A CB  1 
ATOM   1016 O OG  . SER A 1 151 ? -0.045  -22.327 15.990 1.00 95.60  ? 646  SER A OG  1 
ATOM   1017 N N   . ASP A 1 152 ? -1.841  -24.966 14.710 1.00 71.08  ? 647  ASP A N   1 
ATOM   1018 C CA  . ASP A 1 152 ? -1.800  -25.841 13.543 1.00 70.73  ? 647  ASP A CA  1 
ATOM   1019 C C   . ASP A 1 152 ? -2.631  -27.111 13.765 1.00 71.71  ? 647  ASP A C   1 
ATOM   1020 O O   . ASP A 1 152 ? -2.124  -28.227 13.622 1.00 72.82  ? 647  ASP A O   1 
ATOM   1021 C CB  . ASP A 1 152 ? -0.360  -26.126 13.089 1.00 73.33  ? 647  ASP A CB  1 
ATOM   1022 C CG  . ASP A 1 152 ? -0.251  -26.900 11.782 1.00 84.65  ? 647  ASP A CG  1 
ATOM   1023 O OD1 . ASP A 1 152 ? -0.835  -26.446 10.765 1.00 86.29  ? 647  ASP A OD1 1 
ATOM   1024 O OD2 . ASP A 1 152 ? 0.384   -27.970 11.785 1.00 90.07  ? 647  ASP A OD2 1 
ATOM   1025 N N   . LEU A 1 153 ? -3.917  -26.941 14.108 1.00 64.39  ? 648  LEU A N   1 
ATOM   1026 C CA  . LEU A 1 153 ? -4.781  -28.086 14.344 1.00 61.75  ? 648  LEU A CA  1 
ATOM   1027 C C   . LEU A 1 153 ? -5.285  -28.670 13.044 1.00 66.76  ? 648  LEU A C   1 
ATOM   1028 O O   . LEU A 1 153 ? -5.702  -27.938 12.150 1.00 67.48  ? 648  LEU A O   1 
ATOM   1029 C CB  . LEU A 1 153 ? -5.943  -27.761 15.282 1.00 60.38  ? 648  LEU A CB  1 
ATOM   1030 C CG  . LEU A 1 153 ? -5.622  -27.583 16.754 1.00 63.05  ? 648  LEU A CG  1 
ATOM   1031 C CD1 . LEU A 1 153 ? -6.820  -26.976 17.488 1.00 63.27  ? 648  LEU A CD1 1 
ATOM   1032 C CD2 . LEU A 1 153 ? -5.195  -28.886 17.404 1.00 62.52  ? 648  LEU A CD2 1 
ATOM   1033 N N   . LYS A 1 154 ? -5.221  -30.003 12.946 1.00 63.35  ? 649  LYS A N   1 
ATOM   1034 C CA  . LYS A 1 154 ? -5.631  -30.819 11.804 1.00 64.25  ? 649  LYS A CA  1 
ATOM   1035 C C   . LYS A 1 154 ? -6.196  -32.128 12.354 1.00 67.94  ? 649  LYS A C   1 
ATOM   1036 O O   . LYS A 1 154 ? -5.800  -32.515 13.459 1.00 67.29  ? 649  LYS A O   1 
ATOM   1037 C CB  . LYS A 1 154 ? -4.388  -31.201 10.970 1.00 66.94  ? 649  LYS A CB  1 
ATOM   1038 C CG  . LYS A 1 154 ? -3.732  -30.094 10.155 1.00 73.57  ? 649  LYS A CG  1 
ATOM   1039 C CD  . LYS A 1 154 ? -2.269  -30.455 9.866  1.00 80.16  ? 649  LYS A CD  1 
ATOM   1040 C CE  . LYS A 1 154 ? -1.398  -30.307 11.093 1.00 83.65  ? 649  LYS A CE  1 
ATOM   1041 N NZ  . LYS A 1 154 ? -0.111  -31.022 10.978 1.00 90.86  ? 649  LYS A NZ  1 
ATOM   1042 N N   . PRO A 1 155 ? -6.984  -32.921 11.584 1.00 64.37  ? 650  PRO A N   1 
ATOM   1043 C CA  . PRO A 1 155 ? -7.388  -34.238 12.094 1.00 63.62  ? 650  PRO A CA  1 
ATOM   1044 C C   . PRO A 1 155 ? -6.182  -35.134 12.431 1.00 66.63  ? 650  PRO A C   1 
ATOM   1045 O O   . PRO A 1 155 ? -6.261  -35.886 13.400 1.00 65.83  ? 650  PRO A O   1 
ATOM   1046 C CB  . PRO A 1 155 ? -8.256  -34.807 10.962 1.00 66.77  ? 650  PRO A CB  1 
ATOM   1047 C CG  . PRO A 1 155 ? -8.709  -33.623 10.198 1.00 71.43  ? 650  PRO A CG  1 
ATOM   1048 C CD  . PRO A 1 155 ? -7.544  -32.692 10.238 1.00 66.69  ? 650  PRO A CD  1 
ATOM   1049 N N   . ALA A 1 156 ? -5.043  -35.000 11.695 1.00 63.66  ? 651  ALA A N   1 
ATOM   1050 C CA  . ALA A 1 156 ? -3.804  -35.782 11.930 1.00 62.87  ? 651  ALA A CA  1 
ATOM   1051 C C   . ALA A 1 156 ? -3.172  -35.600 13.327 1.00 62.16  ? 651  ALA A C   1 
ATOM   1052 O O   . ALA A 1 156 ? -2.353  -36.420 13.717 1.00 61.51  ? 651  ALA A O   1 
ATOM   1053 C CB  . ALA A 1 156 ? -2.776  -35.488 10.851 1.00 64.85  ? 651  ALA A CB  1 
ATOM   1054 N N   . ASN A 1 157 ? -3.601  -34.564 14.082 1.00 56.30  ? 652  ASN A N   1 
ATOM   1055 C CA  . ASN A 1 157 ? -3.171  -34.201 15.439 1.00 53.59  ? 652  ASN A CA  1 
ATOM   1056 C C   . ASN A 1 157 ? -3.928  -34.935 16.532 1.00 56.15  ? 652  ASN A C   1 
ATOM   1057 O O   . ASN A 1 157 ? -3.635  -34.708 17.710 1.00 56.31  ? 652  ASN A O   1 
ATOM   1058 C CB  . ASN A 1 157 ? -3.393  -32.702 15.663 1.00 50.90  ? 652  ASN A CB  1 
ATOM   1059 C CG  . ASN A 1 157 ? -2.356  -31.841 15.023 1.00 75.94  ? 652  ASN A CG  1 
ATOM   1060 O OD1 . ASN A 1 157 ? -2.530  -31.306 13.932 1.00 80.94  ? 652  ASN A OD1 1 
ATOM   1061 N ND2 . ASN A 1 157 ? -1.262  -31.672 15.705 1.00 62.39  ? 652  ASN A ND2 1 
ATOM   1062 N N   . PHE A 1 158 ? -4.956  -35.718 16.165 1.00 51.80  ? 653  PHE A N   1 
ATOM   1063 C CA  . PHE A 1 158 ? -5.832  -36.443 17.088 1.00 51.56  ? 653  PHE A CA  1 
ATOM   1064 C C   . PHE A 1 158 ? -5.734  -37.932 16.870 1.00 62.16  ? 653  PHE A C   1 
ATOM   1065 O O   . PHE A 1 158 ? -5.547  -38.385 15.741 1.00 64.15  ? 653  PHE A O   1 
ATOM   1066 C CB  . PHE A 1 158 ? -7.286  -35.994 16.933 1.00 52.57  ? 653  PHE A CB  1 
ATOM   1067 C CG  . PHE A 1 158 ? -7.523  -34.593 17.418 1.00 51.87  ? 653  PHE A CG  1 
ATOM   1068 C CD1 . PHE A 1 158 ? -7.772  -34.338 18.765 1.00 53.49  ? 653  PHE A CD1 1 
ATOM   1069 C CD2 . PHE A 1 158 ? -7.500  -33.521 16.532 1.00 52.17  ? 653  PHE A CD2 1 
ATOM   1070 C CE1 . PHE A 1 158 ? -7.970  -33.035 19.220 1.00 52.61  ? 653  PHE A CE1 1 
ATOM   1071 C CE2 . PHE A 1 158 ? -7.687  -32.217 16.991 1.00 53.67  ? 653  PHE A CE2 1 
ATOM   1072 C CZ  . PHE A 1 158 ? -7.927  -31.985 18.328 1.00 51.07  ? 653  PHE A CZ  1 
ATOM   1073 N N   . LEU A 1 159 ? -5.926  -38.695 17.941 1.00 61.03  ? 654  LEU A N   1 
ATOM   1074 C CA  . LEU A 1 159 ? -5.766  -40.144 17.941 1.00 62.90  ? 654  LEU A CA  1 
ATOM   1075 C C   . LEU A 1 159 ? -6.995  -40.820 18.456 1.00 66.25  ? 654  LEU A C   1 
ATOM   1076 O O   . LEU A 1 159 ? -7.492  -40.416 19.507 1.00 66.04  ? 654  LEU A O   1 
ATOM   1077 C CB  . LEU A 1 159 ? -4.635  -40.419 18.935 1.00 63.02  ? 654  LEU A CB  1 
ATOM   1078 C CG  . LEU A 1 159 ? -3.874  -41.694 18.843 1.00 69.99  ? 654  LEU A CG  1 
ATOM   1079 C CD1 . LEU A 1 159 ? -3.041  -41.683 17.612 1.00 71.72  ? 654  LEU A CD1 1 
ATOM   1080 C CD2 . LEU A 1 159 ? -2.936  -41.807 20.021 1.00 71.85  ? 654  LEU A CD2 1 
ATOM   1081 N N   . ILE A 1 160 ? -7.453  -41.875 17.783 1.00 62.94  ? 655  ILE A N   1 
ATOM   1082 C CA  . ILE A 1 160 ? -8.598  -42.617 18.289 1.00 64.55  ? 655  ILE A CA  1 
ATOM   1083 C C   . ILE A 1 160 ? -8.082  -43.745 19.160 1.00 72.30  ? 655  ILE A C   1 
ATOM   1084 O O   . ILE A 1 160 ? -7.326  -44.595 18.697 1.00 72.64  ? 655  ILE A O   1 
ATOM   1085 C CB  . ILE A 1 160 ? -9.646  -43.066 17.222 1.00 69.10  ? 655  ILE A CB  1 
ATOM   1086 C CG1 . ILE A 1 160 ? -10.185 -41.850 16.434 1.00 68.69  ? 655  ILE A CG1 1 
ATOM   1087 C CG2 . ILE A 1 160 ? -10.809 -43.809 17.906 1.00 69.54  ? 655  ILE A CG2 1 
ATOM   1088 C CD1 . ILE A 1 160 ? -10.593 -42.106 15.123 1.00 72.61  ? 655  ILE A CD1 1 
ATOM   1089 N N   . VAL A 1 161 ? -8.424  -43.693 20.450 1.00 71.68  ? 656  VAL A N   1 
ATOM   1090 C CA  . VAL A 1 161 ? -8.024  -44.693 21.438 1.00 73.52  ? 656  VAL A CA  1 
ATOM   1091 C C   . VAL A 1 161 ? -9.264  -45.093 22.180 1.00 79.59  ? 656  VAL A C   1 
ATOM   1092 O O   . VAL A 1 161 ? -9.804  -44.289 22.939 1.00 78.99  ? 656  VAL A O   1 
ATOM   1093 C CB  . VAL A 1 161 ? -6.938  -44.227 22.453 1.00 76.22  ? 656  VAL A CB  1 
ATOM   1094 C CG1 . VAL A 1 161 ? -6.339  -45.435 23.171 1.00 78.00  ? 656  VAL A CG1 1 
ATOM   1095 C CG2 . VAL A 1 161 ? -5.843  -43.392 21.793 1.00 73.89  ? 656  VAL A CG2 1 
ATOM   1096 N N   . ASP A 1 162 ? -9.713  -46.328 21.970 1.00 78.94  ? 657  ASP A N   1 
ATOM   1097 C CA  . ASP A 1 162 ? -10.865 -46.915 22.648 1.00 81.05  ? 657  ASP A CA  1 
ATOM   1098 C C   . ASP A 1 162 ? -12.095 -46.010 22.565 1.00 83.17  ? 657  ASP A C   1 
ATOM   1099 O O   . ASP A 1 162 ? -12.656 -45.617 23.597 1.00 82.11  ? 657  ASP A O   1 
ATOM   1100 C CB  . ASP A 1 162 ? -10.498 -47.255 24.112 1.00 83.93  ? 657  ASP A CB  1 
ATOM   1101 C CG  . ASP A 1 162 ? -9.222  -48.071 24.263 1.00 94.90  ? 657  ASP A CG  1 
ATOM   1102 O OD1 . ASP A 1 162 ? -9.181  -49.221 23.740 1.00 97.58  ? 657  ASP A OD1 1 
ATOM   1103 O OD2 . ASP A 1 162 ? -8.271  -47.572 24.924 1.00 93.92  ? 657  ASP A OD2 1 
ATOM   1104 N N   . GLY A 1 163 ? -12.465 -45.658 21.332 1.00 79.20  ? 658  GLY A N   1 
ATOM   1105 C CA  . GLY A 1 163 ? -13.604 -44.788 21.039 1.00 79.04  ? 658  GLY A CA  1 
ATOM   1106 C C   . GLY A 1 163 ? -13.552 -43.459 21.760 1.00 80.82  ? 658  GLY A C   1 
ATOM   1107 O O   . GLY A 1 163 ? -14.557 -42.995 22.296 1.00 81.63  ? 658  GLY A O   1 
ATOM   1108 N N   . MET A 1 164 ? -12.360 -42.868 21.813 1.00 75.06  ? 659  MET A N   1 
ATOM   1109 C CA  . MET A 1 164 ? -12.113 -41.622 22.505 1.00 72.91  ? 659  MET A CA  1 
ATOM   1110 C C   . MET A 1 164 ? -11.009 -40.884 21.769 1.00 72.46  ? 659  MET A C   1 
ATOM   1111 O O   . MET A 1 164 ? -9.964  -41.483 21.521 1.00 73.92  ? 659  MET A O   1 
ATOM   1112 C CB  . MET A 1 164 ? -11.713 -41.957 23.947 1.00 76.28  ? 659  MET A CB  1 
ATOM   1113 C CG  . MET A 1 164 ? -11.395 -40.763 24.788 1.00 80.39  ? 659  MET A CG  1 
ATOM   1114 S SD  . MET A 1 164 ? -11.103 -41.210 26.521 1.00 87.84  ? 659  MET A SD  1 
ATOM   1115 C CE  . MET A 1 164 ? -12.801 -41.546 27.061 1.00 86.88  ? 659  MET A CE  1 
ATOM   1116 N N   . LEU A 1 165 ? -11.230 -39.614 21.386 1.00 64.47  ? 660  LEU A N   1 
ATOM   1117 C CA  . LEU A 1 165 ? -10.182 -38.835 20.706 1.00 61.93  ? 660  LEU A CA  1 
ATOM   1118 C C   . LEU A 1 165 ? -9.134  -38.310 21.684 1.00 66.82  ? 660  LEU A C   1 
ATOM   1119 O O   . LEU A 1 165 ? -9.472  -37.856 22.785 1.00 67.72  ? 660  LEU A O   1 
ATOM   1120 C CB  . LEU A 1 165 ? -10.725 -37.655 19.888 1.00 60.64  ? 660  LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 165 ? -11.112 -37.910 18.456 1.00 65.88  ? 660  LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 165 ? -11.480 -36.634 17.789 1.00 65.12  ? 660  LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 165 ? -9.974  -38.475 17.674 1.00 70.29  ? 660  LEU A CD2 1 
ATOM   1124 N N   . LYS A 1 166 ? -7.864  -38.325 21.266 1.00 62.17  ? 661  LYS A N   1 
ATOM   1125 C CA  . LYS A 1 166 ? -6.786  -37.804 22.102 1.00 59.33  ? 661  LYS A CA  1 
ATOM   1126 C C   . LYS A 1 166 ? -5.866  -36.887 21.323 1.00 58.81  ? 661  LYS A C   1 
ATOM   1127 O O   . LYS A 1 166 ? -5.431  -37.259 20.230 1.00 58.97  ? 661  LYS A O   1 
ATOM   1128 C CB  . LYS A 1 166 ? -6.015  -38.954 22.768 1.00 61.32  ? 661  LYS A CB  1 
ATOM   1129 C CG  . LYS A 1 166 ? -6.562  -39.314 24.139 1.00 60.68  ? 661  LYS A CG  1 
ATOM   1130 C CD  . LYS A 1 166 ? -6.666  -40.808 24.317 1.00 62.85  ? 661  LYS A CD  1 
ATOM   1131 C CE  . LYS A 1 166 ? -7.206  -41.213 25.663 1.00 66.58  ? 661  LYS A CE  1 
ATOM   1132 N NZ  . LYS A 1 166 ? -6.177  -41.100 26.743 1.00 63.38  ? 661  LYS A NZ  1 
ATOM   1133 N N   . LEU A 1 167 ? -5.564  -35.695 21.881 1.00 52.35  ? 662  LEU A N   1 
ATOM   1134 C CA  . LEU A 1 167 ? -4.640  -34.718 21.268 1.00 51.10  ? 662  LEU A CA  1 
ATOM   1135 C C   . LEU A 1 167 ? -3.200  -35.216 21.345 1.00 56.14  ? 662  LEU A C   1 
ATOM   1136 O O   . LEU A 1 167 ? -2.671  -35.427 22.439 1.00 55.66  ? 662  LEU A O   1 
ATOM   1137 C CB  . LEU A 1 167 ? -4.783  -33.304 21.880 1.00 49.99  ? 662  LEU A CB  1 
ATOM   1138 C CG  . LEU A 1 167 ? -3.969  -32.187 21.237 1.00 52.51  ? 662  LEU A CG  1 
ATOM   1139 C CD1 . LEU A 1 167 ? -4.379  -31.948 19.767 1.00 52.41  ? 662  LEU A CD1 1 
ATOM   1140 C CD2 . LEU A 1 167 ? -4.059  -30.939 22.048 1.00 51.94  ? 662  LEU A CD2 1 
ATOM   1141 N N   . ILE A 1 168 ? -2.598  -35.453 20.167 1.00 54.78  ? 663  ILE A N   1 
ATOM   1142 C CA  . ILE A 1 168 ? -1.254  -36.037 19.985 1.00 54.97  ? 663  ILE A CA  1 
ATOM   1143 C C   . ILE A 1 168 ? -0.141  -35.090 20.406 1.00 59.31  ? 663  ILE A C   1 
ATOM   1144 O O   . ILE A 1 168 ? 0.822   -35.553 21.001 1.00 59.21  ? 663  ILE A O   1 
ATOM   1145 C CB  . ILE A 1 168 ? -1.078  -36.641 18.540 1.00 58.29  ? 663  ILE A CB  1 
ATOM   1146 C CG1 . ILE A 1 168 ? -1.906  -37.911 18.391 1.00 61.79  ? 663  ILE A CG1 1 
ATOM   1147 C CG2 . ILE A 1 168 ? 0.335   -36.958 18.188 1.00 57.40  ? 663  ILE A CG2 1 
ATOM   1148 C CD1 . ILE A 1 168 ? -2.023  -38.456 16.905 1.00 83.80  ? 663  ILE A CD1 1 
ATOM   1149 N N   . ASP A 1 169 ? -0.267  -33.779 20.091 1.00 55.89  ? 664  ASP A N   1 
ATOM   1150 C CA  . ASP A 1 169 ? 0.757   -32.774 20.358 1.00 56.02  ? 664  ASP A CA  1 
ATOM   1151 C C   . ASP A 1 169 ? 0.193   -31.353 20.556 1.00 60.59  ? 664  ASP A C   1 
ATOM   1152 O O   . ASP A 1 169 ? -0.996  -31.127 20.348 1.00 61.65  ? 664  ASP A O   1 
ATOM   1153 C CB  . ASP A 1 169 ? 1.766   -32.788 19.229 1.00 59.58  ? 664  ASP A CB  1 
ATOM   1154 C CG  . ASP A 1 169 ? 1.185   -32.203 17.971 1.00 70.23  ? 664  ASP A CG  1 
ATOM   1155 O OD1 . ASP A 1 169 ? 0.481   -32.940 17.251 1.00 69.49  ? 664  ASP A OD1 1 
ATOM   1156 O OD2 . ASP A 1 169 ? 1.375   -30.982 17.745 1.00 78.36  ? 664  ASP A OD2 1 
ATOM   1157 N N   . PHE A 1 170 ? 1.060   -30.396 20.958 1.00 56.06  ? 665  PHE A N   1 
ATOM   1158 C CA  . PHE A 1 170 ? 0.690   -29.030 21.344 1.00 55.38  ? 665  PHE A CA  1 
ATOM   1159 C C   . PHE A 1 170 ? 1.100   -27.922 20.387 1.00 59.05  ? 665  PHE A C   1 
ATOM   1160 O O   . PHE A 1 170 ? 0.773   -26.758 20.637 1.00 58.67  ? 665  PHE A O   1 
ATOM   1161 C CB  . PHE A 1 170 ? 1.205   -28.737 22.769 1.00 57.05  ? 665  PHE A CB  1 
ATOM   1162 C CG  . PHE A 1 170 ? 0.760   -29.679 23.869 1.00 58.81  ? 665  PHE A CG  1 
ATOM   1163 C CD1 . PHE A 1 170 ? -0.254  -30.608 23.655 1.00 62.74  ? 665  PHE A CD1 1 
ATOM   1164 C CD2 . PHE A 1 170 ? 1.296   -29.584 25.138 1.00 62.62  ? 665  PHE A CD2 1 
ATOM   1165 C CE1 . PHE A 1 170 ? -0.655  -31.486 24.666 1.00 64.13  ? 665  PHE A CE1 1 
ATOM   1166 C CE2 . PHE A 1 170 ? 0.856   -30.430 26.166 1.00 66.17  ? 665  PHE A CE2 1 
ATOM   1167 C CZ  . PHE A 1 170 ? -0.110  -31.378 25.923 1.00 64.08  ? 665  PHE A CZ  1 
ATOM   1168 N N   . GLY A 1 171 ? 1.800   -28.281 19.314 1.00 55.99  ? 666  GLY A N   1 
ATOM   1169 C CA  . GLY A 1 171 ? 2.259   -27.326 18.316 1.00 57.92  ? 666  GLY A CA  1 
ATOM   1170 C C   . GLY A 1 171 ? 3.492   -26.525 18.696 1.00 66.48  ? 666  GLY A C   1 
ATOM   1171 O O   . GLY A 1 171 ? 3.901   -25.662 17.923 1.00 70.05  ? 666  GLY A O   1 
ATOM   1172 N N   . ILE A 1 172 ? 4.103   -26.800 19.878 1.00 62.03  ? 667  ILE A N   1 
ATOM   1173 C CA  . ILE A 1 172 ? 5.307   -26.133 20.406 1.00 61.49  ? 667  ILE A CA  1 
ATOM   1174 C C   . ILE A 1 172 ? 6.583   -26.628 19.682 1.00 71.80  ? 667  ILE A C   1 
ATOM   1175 O O   . ILE A 1 172 ? 7.424   -25.794 19.321 1.00 73.11  ? 667  ILE A O   1 
ATOM   1176 C CB  . ILE A 1 172 ? 5.456   -26.298 21.958 1.00 61.19  ? 667  ILE A CB  1 
ATOM   1177 C CG1 . ILE A 1 172 ? 4.199   -25.893 22.734 1.00 58.36  ? 667  ILE A CG1 1 
ATOM   1178 C CG2 . ILE A 1 172 ? 6.724   -25.591 22.489 1.00 61.78  ? 667  ILE A CG2 1 
ATOM   1179 C CD1 . ILE A 1 172 ? 4.173   -26.428 24.177 1.00 55.91  ? 667  ILE A CD1 1 
ATOM   1180 N N   . ALA A 1 173 ? 6.750   -27.977 19.533 1.00 71.17  ? 668  ALA A N   1 
ATOM   1181 C CA  . ALA A 1 173 ? 7.924   -28.594 18.890 1.00 73.63  ? 668  ALA A CA  1 
ATOM   1182 C C   . ALA A 1 173 ? 7.983   -28.316 17.399 1.00 85.47  ? 668  ALA A C   1 
ATOM   1183 O O   . ALA A 1 173 ? 6.960   -28.389 16.711 1.00 85.63  ? 668  ALA A O   1 
ATOM   1184 C CB  . ALA A 1 173 ? 7.952   -30.093 19.139 1.00 73.12  ? 668  ALA A CB  1 
ATOM   1185 N N   . ASN A 1 174 ? 9.197   -27.995 16.912 1.00 88.39  ? 669  ASN A N   1 
ATOM   1186 C CA  . ASN A 1 174 ? 9.528   -27.719 15.503 1.00 91.96  ? 669  ASN A CA  1 
ATOM   1187 C C   . ASN A 1 174 ? 9.069   -28.853 14.551 1.00 100.92 ? 669  ASN A C   1 
ATOM   1188 O O   . ASN A 1 174 ? 9.229   -30.038 14.880 1.00 101.10 ? 669  ASN A O   1 
ATOM   1189 C CB  . ASN A 1 174 ? 11.040  -27.439 15.333 1.00 88.09  ? 669  ASN A CB  1 
ATOM   1190 C CG  . ASN A 1 174 ? 11.460  -26.013 15.611 1.00 101.34 ? 669  ASN A CG  1 
ATOM   1191 O OD1 . ASN A 1 174 ? 10.644  -25.121 15.906 1.00 85.50  ? 669  ASN A OD1 1 
ATOM   1192 N ND2 . ASN A 1 174 ? 12.758  -25.758 15.502 1.00 97.78  ? 669  ASN A ND2 1 
ATOM   1193 N N   . GLN A 1 175 ? 8.485   -28.467 13.384 1.00 99.81  ? 670  GLN A N   1 
ATOM   1194 C CA  . GLN A 1 175 ? 7.940   -29.348 12.341 1.00 135.83 ? 670  GLN A CA  1 
ATOM   1195 C C   . GLN A 1 175 ? 6.735   -30.150 12.855 1.00 152.65 ? 670  GLN A C   1 
ATOM   1196 O O   . GLN A 1 175 ? 5.866   -29.595 13.537 1.00 103.80 ? 670  GLN A O   1 
ATOM   1197 C CB  . GLN A 1 175 ? 9.022   -30.259 11.713 1.00 138.62 ? 670  GLN A CB  1 
ATOM   1198 N N   . GLN A 1 188 ? -0.561  -35.303 7.643  1.00 105.01 ? 683  GLN A N   1 
ATOM   1199 C CA  . GLN A 1 188 ? -0.937  -34.002 7.085  1.00 105.71 ? 683  GLN A CA  1 
ATOM   1200 C C   . GLN A 1 188 ? 0.021   -32.889 7.576  1.00 108.38 ? 683  GLN A C   1 
ATOM   1201 O O   . GLN A 1 188 ? 0.073   -32.603 8.777  1.00 106.26 ? 683  GLN A O   1 
ATOM   1202 C CB  . GLN A 1 188 ? -2.415  -33.673 7.397  1.00 106.39 ? 683  GLN A CB  1 
ATOM   1203 N N   . VAL A 1 189 ? 0.804   -32.296 6.645  1.00 105.27 ? 684  VAL A N   1 
ATOM   1204 C CA  . VAL A 1 189 ? 1.783   -31.234 6.931  1.00 103.60 ? 684  VAL A CA  1 
ATOM   1205 C C   . VAL A 1 189 ? 1.874   -30.247 5.771  1.00 104.87 ? 684  VAL A C   1 
ATOM   1206 O O   . VAL A 1 189 ? 1.994   -30.644 4.604  1.00 105.28 ? 684  VAL A O   1 
ATOM   1207 C CB  . VAL A 1 189 ? 3.179   -31.778 7.343  1.00 107.60 ? 684  VAL A CB  1 
ATOM   1208 N N   . GLY A 1 190 ? 1.809   -28.969 6.125  1.00 98.56  ? 685  GLY A N   1 
ATOM   1209 C CA  . GLY A 1 190 ? 1.813   -27.861 5.182  1.00 99.60  ? 685  GLY A CA  1 
ATOM   1210 C C   . GLY A 1 190 ? 0.413   -27.332 4.923  1.00 100.16 ? 685  GLY A C   1 
ATOM   1211 O O   . GLY A 1 190 ? 0.228   -26.114 4.826  1.00 101.80 ? 685  GLY A O   1 
ATOM   1212 N N   . THR A 1 191 ? -0.589  -28.257 4.845  1.00 91.38  ? 686  THR A N   1 
ATOM   1213 C CA  . THR A 1 191 ? -2.022  -28.026 4.573  1.00 89.18  ? 686  THR A CA  1 
ATOM   1214 C C   . THR A 1 191 ? -2.588  -26.699 5.115  1.00 89.52  ? 686  THR A C   1 
ATOM   1215 O O   . THR A 1 191 ? -2.390  -26.381 6.297  1.00 88.14  ? 686  THR A O   1 
ATOM   1216 C CB  . THR A 1 191 ? -2.857  -29.311 4.844  1.00 83.97  ? 686  THR A CB  1 
ATOM   1217 O OG1 . THR A 1 191 ? -3.964  -29.382 3.946  1.00 82.25  ? 686  THR A OG1 1 
ATOM   1218 C CG2 . THR A 1 191 ? -3.302  -29.467 6.308  1.00 72.82  ? 686  THR A CG2 1 
ATOM   1219 N N   . VAL A 1 192 ? -3.234  -25.907 4.236  1.00 83.57  ? 687  VAL A N   1 
ATOM   1220 C CA  . VAL A 1 192 ? -3.818  -24.616 4.633  1.00 81.20  ? 687  VAL A CA  1 
ATOM   1221 C C   . VAL A 1 192 ? -5.344  -24.660 4.846  1.00 80.99  ? 687  VAL A C   1 
ATOM   1222 O O   . VAL A 1 192 ? -5.949  -23.643 5.188  1.00 78.92  ? 687  VAL A O   1 
ATOM   1223 C CB  . VAL A 1 192 ? -3.368  -23.431 3.741  1.00 87.25  ? 687  VAL A CB  1 
ATOM   1224 C CG1 . VAL A 1 192 ? -1.869  -23.203 3.862  1.00 87.22  ? 687  VAL A CG1 1 
ATOM   1225 C CG2 . VAL A 1 192 ? -3.796  -23.618 2.281  1.00 90.14  ? 687  VAL A CG2 1 
ATOM   1226 N N   . ASN A 1 193 ? -5.947  -25.848 4.656  1.00 76.65  ? 688  ASN A N   1 
ATOM   1227 C CA  . ASN A 1 193 ? -7.390  -26.098 4.750  1.00 75.90  ? 688  ASN A CA  1 
ATOM   1228 C C   . ASN A 1 193 ? -8.030  -25.775 6.110  1.00 76.55  ? 688  ASN A C   1 
ATOM   1229 O O   . ASN A 1 193 ? -9.227  -25.466 6.152  1.00 76.63  ? 688  ASN A O   1 
ATOM   1230 C CB  . ASN A 1 193 ? -7.711  -27.541 4.337  1.00 75.33  ? 688  ASN A CB  1 
ATOM   1231 C CG  . ASN A 1 193 ? -7.440  -27.857 2.883  1.00 93.39  ? 688  ASN A CG  1 
ATOM   1232 O OD1 . ASN A 1 193 ? -8.029  -27.272 1.960  1.00 79.10  ? 688  ASN A OD1 1 
ATOM   1233 N ND2 . ASN A 1 193 ? -6.575  -28.839 2.654  1.00 89.09  ? 688  ASN A ND2 1 
ATOM   1234 N N   . TYR A 1 194 ? -7.235  -25.855 7.205  1.00 69.28  ? 689  TYR A N   1 
ATOM   1235 C CA  . TYR A 1 194 ? -7.671  -25.648 8.590  1.00 66.01  ? 689  TYR A CA  1 
ATOM   1236 C C   . TYR A 1 194 ? -7.087  -24.364 9.187  1.00 70.82  ? 689  TYR A C   1 
ATOM   1237 O O   . TYR A 1 194 ? -7.263  -24.101 10.383 1.00 67.44  ? 689  TYR A O   1 
ATOM   1238 C CB  . TYR A 1 194 ? -7.299  -26.875 9.457  1.00 63.92  ? 689  TYR A CB  1 
ATOM   1239 C CG  . TYR A 1 194 ? -7.746  -28.198 8.872  1.00 65.13  ? 689  TYR A CG  1 
ATOM   1240 C CD1 . TYR A 1 194 ? -6.955  -28.877 7.948  1.00 69.09  ? 689  TYR A CD1 1 
ATOM   1241 C CD2 . TYR A 1 194 ? -8.966  -28.768 9.232  1.00 64.63  ? 689  TYR A CD2 1 
ATOM   1242 C CE1 . TYR A 1 194 ? -7.381  -30.071 7.370  1.00 71.72  ? 689  TYR A CE1 1 
ATOM   1243 C CE2 . TYR A 1 194 ? -9.396  -29.970 8.673  1.00 65.92  ? 689  TYR A CE2 1 
ATOM   1244 C CZ  . TYR A 1 194 ? -8.597  -30.619 7.742  1.00 76.75  ? 689  TYR A CZ  1 
ATOM   1245 O OH  . TYR A 1 194 ? -8.987  -31.812 7.183  1.00 80.31  ? 689  TYR A OH  1 
ATOM   1246 N N   . MET A 1 195 ? -6.430  -23.553 8.336  1.00 71.32  ? 690  MET A N   1 
ATOM   1247 C CA  . MET A 1 195 ? -5.755  -22.306 8.686  1.00 72.81  ? 690  MET A CA  1 
ATOM   1248 C C   . MET A 1 195 ? -6.705  -21.118 8.934  1.00 78.51  ? 690  MET A C   1 
ATOM   1249 O O   . MET A 1 195 ? -7.495  -20.805 8.047  1.00 80.07  ? 690  MET A O   1 
ATOM   1250 C CB  . MET A 1 195 ? -4.726  -21.978 7.596  1.00 78.10  ? 690  MET A CB  1 
ATOM   1251 C CG  . MET A 1 195 ? -3.771  -20.877 7.951  1.00 83.38  ? 690  MET A CG  1 
ATOM   1252 S SD  . MET A 1 195 ? -2.377  -20.813 6.798  1.00 91.05  ? 690  MET A SD  1 
ATOM   1253 C CE  . MET A 1 195 ? -1.350  -22.123 7.450  1.00 85.38  ? 690  MET A CE  1 
ATOM   1254 N N   . PRO A 1 196 ? -6.599  -20.412 10.096 1.00 75.50  ? 691  PRO A N   1 
ATOM   1255 C CA  . PRO A 1 196 ? -7.474  -19.244 10.345 1.00 76.63  ? 691  PRO A CA  1 
ATOM   1256 C C   . PRO A 1 196 ? -7.127  -17.993 9.532  1.00 84.73  ? 691  PRO A C   1 
ATOM   1257 O O   . PRO A 1 196 ? -5.968  -17.850 9.142  1.00 85.83  ? 691  PRO A O   1 
ATOM   1258 C CB  . PRO A 1 196 ? -7.340  -18.993 11.854 1.00 76.39  ? 691  PRO A CB  1 
ATOM   1259 C CG  . PRO A 1 196 ? -6.105  -19.626 12.253 1.00 79.74  ? 691  PRO A CG  1 
ATOM   1260 C CD  . PRO A 1 196 ? -5.710  -20.673 11.247 1.00 75.62  ? 691  PRO A CD  1 
ATOM   1261 N N   . PRO A 1 197 ? -8.088  -17.062 9.279  1.00 83.94  ? 692  PRO A N   1 
ATOM   1262 C CA  . PRO A 1 197 ? -7.756  -15.851 8.499  1.00 88.00  ? 692  PRO A CA  1 
ATOM   1263 C C   . PRO A 1 197 ? -6.650  -14.997 9.119  1.00 94.24  ? 692  PRO A C   1 
ATOM   1264 O O   . PRO A 1 197 ? -5.809  -14.470 8.394  1.00 96.08  ? 692  PRO A O   1 
ATOM   1265 C CB  . PRO A 1 197 ? -9.088  -15.093 8.420  1.00 90.77  ? 692  PRO A CB  1 
ATOM   1266 C CG  . PRO A 1 197 ? -10.129 -16.126 8.692  1.00 92.52  ? 692  PRO A CG  1 
ATOM   1267 C CD  . PRO A 1 197 ? -9.510  -17.058 9.673  1.00 84.76  ? 692  PRO A CD  1 
ATOM   1268 N N   . GLU A 1 198 ? -6.634  -14.906 10.462 1.00 90.04  ? 693  GLU A N   1 
ATOM   1269 C CA  . GLU A 1 198 ? -5.645  -14.172 11.257 1.00 90.57  ? 693  GLU A CA  1 
ATOM   1270 C C   . GLU A 1 198 ? -4.211  -14.730 11.090 1.00 96.71  ? 693  GLU A C   1 
ATOM   1271 O O   . GLU A 1 198 ? -3.243  -13.965 11.161 1.00 98.54  ? 693  GLU A O   1 
ATOM   1272 C CB  . GLU A 1 198 ? -6.067  -14.121 12.741 1.00 89.58  ? 693  GLU A CB  1 
ATOM   1273 C CG  . GLU A 1 198 ? -6.270  -15.482 13.396 1.00 95.61  ? 693  GLU A CG  1 
ATOM   1274 C CD  . GLU A 1 198 ? -7.691  -15.870 13.753 1.00 103.54 ? 693  GLU A CD  1 
ATOM   1275 O OE1 . GLU A 1 198 ? -8.602  -15.705 12.907 1.00 85.13  ? 693  GLU A OE1 1 
ATOM   1276 O OE2 . GLU A 1 198 ? -7.882  -16.372 14.885 1.00 89.75  ? 693  GLU A OE2 1 
ATOM   1277 N N   . ALA A 1 199 ? -4.086  -16.052 10.856 1.00 92.31  ? 694  ALA A N   1 
ATOM   1278 C CA  . ALA A 1 199 ? -2.806  -16.718 10.634 1.00 92.55  ? 694  ALA A CA  1 
ATOM   1279 C C   . ALA A 1 199 ? -2.252  -16.413 9.235  1.00 101.36 ? 694  ALA A C   1 
ATOM   1280 O O   . ALA A 1 199 ? -1.030  -16.336 9.064  1.00 102.95 ? 694  ALA A O   1 
ATOM   1281 C CB  . ALA A 1 199 ? -2.956  -18.216 10.822 1.00 90.68  ? 694  ALA A CB  1 
ATOM   1282 N N   . ILE A 1 200 ? -3.152  -16.239 8.241  1.00 99.37  ? 695  ILE A N   1 
ATOM   1283 C CA  . ILE A 1 200 ? -2.790  -15.923 6.855  1.00 101.90 ? 695  ILE A CA  1 
ATOM   1284 C C   . ILE A 1 200 ? -2.207  -14.505 6.743  1.00 109.43 ? 695  ILE A C   1 
ATOM   1285 O O   . ILE A 1 200 ? -1.137  -14.341 6.149  1.00 111.72 ? 695  ILE A O   1 
ATOM   1286 C CB  . ILE A 1 200 ? -3.950  -16.230 5.854  1.00 105.24 ? 695  ILE A CB  1 
ATOM   1287 C CG1 . ILE A 1 200 ? -4.186  -17.753 5.748  1.00 102.75 ? 695  ILE A CG1 1 
ATOM   1288 C CG2 . ILE A 1 200 ? -3.682  -15.635 4.465  1.00 109.86 ? 695  ILE A CG2 1 
ATOM   1289 C CD1 . ILE A 1 200 ? -5.582  -18.154 5.487  1.00 104.45 ? 695  ILE A CD1 1 
ATOM   1290 N N   . LYS A 1 201 ? -2.886  -13.505 7.349  1.00 106.50 ? 696  LYS A N   1 
ATOM   1291 C CA  . LYS A 1 201 ? -2.501  -12.083 7.346  1.00 109.72 ? 696  LYS A CA  1 
ATOM   1292 C C   . LYS A 1 201 ? -1.050  -11.802 7.864  1.00 115.88 ? 696  LYS A C   1 
ATOM   1293 O O   . LYS A 1 201 ? -0.280  -11.086 7.203  1.00 119.15 ? 696  LYS A O   1 
ATOM   1294 C CB  . LYS A 1 201 ? -3.561  -11.235 8.082  1.00 110.71 ? 696  LYS A CB  1 
ATOM   1295 C CG  . LYS A 1 201 ? -4.931  -11.220 7.401  1.00 108.10 ? 696  LYS A CG  1 
ATOM   1296 N N   . ASP A 1 202 ? -0.677  -12.419 9.009  1.00 109.38 ? 697  ASP A N   1 
ATOM   1297 C CA  . ASP A 1 202 ? 0.641   -12.294 9.644  1.00 135.61 ? 697  ASP A CA  1 
ATOM   1298 C C   . ASP A 1 202 ? 1.758   -12.959 8.805  1.00 146.36 ? 697  ASP A C   1 
ATOM   1299 O O   . ASP A 1 202 ? 1.965   -14.177 8.847  1.00 96.00  ? 697  ASP A O   1 
ATOM   1300 C CB  . ASP A 1 202 ? 0.611   -12.852 11.090 1.00 133.84 ? 697  ASP A CB  1 
ATOM   1301 C CG  . ASP A 1 202 ? -0.515  -12.361 11.998 1.00 141.95 ? 697  ASP A CG  1 
ATOM   1302 O OD1 . ASP A 1 202 ? -1.291  -11.474 11.570 1.00 144.29 ? 697  ASP A OD1 1 
ATOM   1303 O OD2 . ASP A 1 202 ? -0.627  -12.876 13.133 1.00 145.15 ? 697  ASP A OD2 1 
ATOM   1304 N N   . ILE A 1 216 ? -3.078  -14.224 16.640 1.00 87.48  ? 711  ILE A N   1 
ATOM   1305 C CA  . ILE A 1 216 ? -2.987  -15.587 17.196 1.00 84.45  ? 711  ILE A CA  1 
ATOM   1306 C C   . ILE A 1 216 ? -3.329  -15.685 18.700 1.00 82.19  ? 711  ILE A C   1 
ATOM   1307 O O   . ILE A 1 216 ? -2.513  -15.384 19.582 1.00 82.36  ? 711  ILE A O   1 
ATOM   1308 C CB  . ILE A 1 216 ? -1.725  -16.402 16.737 1.00 87.98  ? 711  ILE A CB  1 
ATOM   1309 C CG1 . ILE A 1 216 ? -1.575  -16.432 15.180 1.00 90.72  ? 711  ILE A CG1 1 
ATOM   1310 C CG2 . ILE A 1 216 ? -1.680  -17.826 17.346 1.00 85.83  ? 711  ILE A CG2 1 
ATOM   1311 C CD1 . ILE A 1 216 ? -2.870  -16.853 14.350 1.00 101.48 ? 711  ILE A CD1 1 
ATOM   1312 N N   . SER A 1 217 ? -4.565  -16.115 18.946 1.00 72.81  ? 712  SER A N   1 
ATOM   1313 C CA  . SER A 1 217 ? -5.204  -16.273 20.240 1.00 69.66  ? 712  SER A CA  1 
ATOM   1314 C C   . SER A 1 217 ? -5.962  -17.629 20.232 1.00 67.25  ? 712  SER A C   1 
ATOM   1315 O O   . SER A 1 217 ? -6.041  -18.260 19.168 1.00 65.28  ? 712  SER A O   1 
ATOM   1316 C CB  . SER A 1 217 ? -6.208  -15.136 20.425 1.00 73.98  ? 712  SER A CB  1 
ATOM   1317 O OG  . SER A 1 217 ? -7.286  -15.229 19.503 1.00 78.83  ? 712  SER A OG  1 
ATOM   1318 N N   . PRO A 1 218 ? -6.598  -18.059 21.360 1.00 58.97  ? 713  PRO A N   1 
ATOM   1319 C CA  . PRO A 1 218 ? -7.368  -19.319 21.339 1.00 55.64  ? 713  PRO A CA  1 
ATOM   1320 C C   . PRO A 1 218 ? -8.433  -19.405 20.243 1.00 57.93  ? 713  PRO A C   1 
ATOM   1321 O O   . PRO A 1 218 ? -8.816  -20.510 19.837 1.00 58.43  ? 713  PRO A O   1 
ATOM   1322 C CB  . PRO A 1 218 ? -8.007  -19.345 22.719 1.00 56.84  ? 713  PRO A CB  1 
ATOM   1323 C CG  . PRO A 1 218 ? -7.051  -18.576 23.573 1.00 61.89  ? 713  PRO A CG  1 
ATOM   1324 C CD  . PRO A 1 218 ? -6.624  -17.452 22.706 1.00 59.34  ? 713  PRO A CD  1 
ATOM   1325 N N   . LYS A 1 219 ? -8.883  -18.252 19.730 1.00 52.77  ? 714  LYS A N   1 
ATOM   1326 C CA  . LYS A 1 219 ? -9.881  -18.205 18.665 1.00 52.51  ? 714  LYS A CA  1 
ATOM   1327 C C   . LYS A 1 219 ? -9.369  -18.897 17.383 1.00 57.90  ? 714  LYS A C   1 
ATOM   1328 O O   . LYS A 1 219 ? -10.170 -19.418 16.615 1.00 58.81  ? 714  LYS A O   1 
ATOM   1329 C CB  . LYS A 1 219 ? -10.314 -16.758 18.385 1.00 54.98  ? 714  LYS A CB  1 
ATOM   1330 C CG  . LYS A 1 219 ? -11.012 -16.075 19.548 1.00 55.17  ? 714  LYS A CG  1 
ATOM   1331 C CD  . LYS A 1 219 ? -12.374 -16.702 19.874 1.00 61.38  ? 714  LYS A CD  1 
ATOM   1332 C CE  . LYS A 1 219 ? -13.146 -15.917 20.899 1.00 61.80  ? 714  LYS A CE  1 
ATOM   1333 N NZ  . LYS A 1 219 ? -13.694 -14.655 20.326 1.00 70.46  ? 714  LYS A NZ  1 
ATOM   1334 N N   . SER A 1 220 ? -8.040  -18.909 17.169 1.00 54.10  ? 715  SER A N   1 
ATOM   1335 C CA  . SER A 1 220 ? -7.404  -19.537 16.018 1.00 54.03  ? 715  SER A CA  1 
ATOM   1336 C C   . SER A 1 220 ? -7.680  -21.042 16.048 1.00 57.91  ? 715  SER A C   1 
ATOM   1337 O O   . SER A 1 220 ? -8.088  -21.623 15.027 1.00 60.31  ? 715  SER A O   1 
ATOM   1338 C CB  . SER A 1 220 ? -5.903  -19.268 16.025 1.00 56.81  ? 715  SER A CB  1 
ATOM   1339 O OG  . SER A 1 220 ? -5.616  -17.891 16.206 1.00 63.06  ? 715  SER A OG  1 
ATOM   1340 N N   . ASP A 1 221 ? -7.531  -21.656 17.240 1.00 50.73  ? 716  ASP A N   1 
ATOM   1341 C CA  . ASP A 1 221 ? -7.776  -23.076 17.449 1.00 48.55  ? 716  ASP A CA  1 
ATOM   1342 C C   . ASP A 1 221 ? -9.259  -23.408 17.223 1.00 53.86  ? 716  ASP A C   1 
ATOM   1343 O O   . ASP A 1 221 ? -9.570  -24.513 16.761 1.00 52.07  ? 716  ASP A O   1 
ATOM   1344 C CB  . ASP A 1 221 ? -7.274  -23.501 18.836 1.00 48.84  ? 716  ASP A CB  1 
ATOM   1345 C CG  . ASP A 1 221 ? -5.757  -23.641 18.956 1.00 57.29  ? 716  ASP A CG  1 
ATOM   1346 O OD1 . ASP A 1 221 ? -5.074  -23.692 17.904 1.00 58.75  ? 716  ASP A OD1 1 
ATOM   1347 O OD2 . ASP A 1 221 ? -5.256  -23.741 20.101 1.00 58.69  ? 716  ASP A OD2 1 
ATOM   1348 N N   . VAL A 1 222 ? -10.161 -22.405 17.487 1.00 52.26  ? 717  VAL A N   1 
ATOM   1349 C CA  . VAL A 1 222 ? -11.615 -22.479 17.289 1.00 52.40  ? 717  VAL A CA  1 
ATOM   1350 C C   . VAL A 1 222 ? -11.947 -22.596 15.797 1.00 60.13  ? 717  VAL A C   1 
ATOM   1351 O O   . VAL A 1 222 ? -12.772 -23.449 15.424 1.00 60.39  ? 717  VAL A O   1 
ATOM   1352 C CB  . VAL A 1 222 ? -12.376 -21.328 17.978 1.00 56.50  ? 717  VAL A CB  1 
ATOM   1353 C CG1 . VAL A 1 222 ? -13.846 -21.322 17.583 1.00 57.35  ? 717  VAL A CG1 1 
ATOM   1354 C CG2 . VAL A 1 222 ? -12.235 -21.412 19.496 1.00 55.80  ? 717  VAL A CG2 1 
ATOM   1355 N N   . TRP A 1 223 ? -11.288 -21.766 14.946 1.00 58.15  ? 718  TRP A N   1 
ATOM   1356 C CA  . TRP A 1 223 ? -11.469 -21.805 13.497 1.00 59.87  ? 718  TRP A CA  1 
ATOM   1357 C C   . TRP A 1 223 ? -11.089 -23.203 12.973 1.00 63.94  ? 718  TRP A C   1 
ATOM   1358 O O   . TRP A 1 223 ? -11.836 -23.782 12.168 1.00 63.57  ? 718  TRP A O   1 
ATOM   1359 C CB  . TRP A 1 223 ? -10.593 -20.745 12.799 1.00 60.38  ? 718  TRP A CB  1 
ATOM   1360 C CG  . TRP A 1 223 ? -10.617 -20.849 11.296 1.00 63.45  ? 718  TRP A CG  1 
ATOM   1361 C CD1 . TRP A 1 223 ? -9.928  -21.738 10.519 1.00 66.43  ? 718  TRP A CD1 1 
ATOM   1362 C CD2 . TRP A 1 223 ? -11.452 -20.096 10.401 1.00 65.84  ? 718  TRP A CD2 1 
ATOM   1363 N NE1 . TRP A 1 223 ? -10.271 -21.577 9.195  1.00 68.35  ? 718  TRP A NE1 1 
ATOM   1364 C CE2 . TRP A 1 223 ? -11.194 -20.564 9.093  1.00 71.16  ? 718  TRP A CE2 1 
ATOM   1365 C CE3 . TRP A 1 223 ? -12.409 -19.080 10.580 1.00 68.55  ? 718  TRP A CE3 1 
ATOM   1366 C CZ2 . TRP A 1 223 ? -11.834 -20.027 7.967  1.00 73.22  ? 718  TRP A CZ2 1 
ATOM   1367 C CZ3 . TRP A 1 223 ? -13.042 -18.548 9.465  1.00 72.65  ? 718  TRP A CZ3 1 
ATOM   1368 C CH2 . TRP A 1 223 ? -12.747 -19.014 8.177  1.00 74.77  ? 718  TRP A CH2 1 
ATOM   1369 N N   . SER A 1 224 ? -9.907  -23.724 13.417 1.00 58.95  ? 719  SER A N   1 
ATOM   1370 C CA  . SER A 1 224 ? -9.382  -25.022 12.979 1.00 57.62  ? 719  SER A CA  1 
ATOM   1371 C C   . SER A 1 224 ? -10.255 -26.193 13.393 1.00 59.89  ? 719  SER A C   1 
ATOM   1372 O O   . SER A 1 224 ? -10.535 -27.053 12.562 1.00 60.88  ? 719  SER A O   1 
ATOM   1373 C CB  . SER A 1 224 ? -7.937  -25.200 13.414 1.00 59.68  ? 719  SER A CB  1 
ATOM   1374 O OG  . SER A 1 224 ? -7.168  -24.132 12.890 1.00 67.56  ? 719  SER A OG  1 
ATOM   1375 N N   . LEU A 1 225 ? -10.761 -26.181 14.635 1.00 55.05  ? 720  LEU A N   1 
ATOM   1376 C CA  . LEU A 1 225 ? -11.696 -27.192 15.126 1.00 54.36  ? 720  LEU A CA  1 
ATOM   1377 C C   . LEU A 1 225 ? -13.000 -27.168 14.289 1.00 62.21  ? 720  LEU A C   1 
ATOM   1378 O O   . LEU A 1 225 ? -13.526 -28.222 13.934 1.00 64.23  ? 720  LEU A O   1 
ATOM   1379 C CB  . LEU A 1 225 ? -11.982 -27.000 16.634 1.00 52.65  ? 720  LEU A CB  1 
ATOM   1380 C CG  . LEU A 1 225 ? -10.846 -27.364 17.613 1.00 54.16  ? 720  LEU A CG  1 
ATOM   1381 C CD1 . LEU A 1 225 ? -11.210 -26.990 19.045 1.00 53.18  ? 720  LEU A CD1 1 
ATOM   1382 C CD2 . LEU A 1 225 ? -10.479 -28.848 17.545 1.00 52.58  ? 720  LEU A CD2 1 
ATOM   1383 N N   . GLY A 1 226 ? -13.450 -25.975 13.916 1.00 59.60  ? 721  GLY A N   1 
ATOM   1384 C CA  . GLY A 1 226 ? -14.637 -25.802 13.088 1.00 61.78  ? 721  GLY A CA  1 
ATOM   1385 C C   . GLY A 1 226 ? -14.489 -26.391 11.698 1.00 69.06  ? 721  GLY A C   1 
ATOM   1386 O O   . GLY A 1 226 ? -15.455 -26.925 11.147 1.00 70.22  ? 721  GLY A O   1 
ATOM   1387 N N   . CYS A 1 227 ? -13.269 -26.318 11.131 1.00 66.16  ? 722  CYS A N   1 
ATOM   1388 C CA  . CYS A 1 227 ? -12.926 -26.900 9.835  1.00 67.23  ? 722  CYS A CA  1 
ATOM   1389 C C   . CYS A 1 227 ? -12.967 -28.443 9.942  1.00 68.88  ? 722  CYS A C   1 
ATOM   1390 O O   . CYS A 1 227 ? -13.447 -29.102 9.015  1.00 69.28  ? 722  CYS A O   1 
ATOM   1391 C CB  . CYS A 1 227 ? -11.553 -26.410 9.377  1.00 68.15  ? 722  CYS A CB  1 
ATOM   1392 S SG  . CYS A 1 227 ? -11.537 -24.725 8.710  1.00 74.10  ? 722  CYS A SG  1 
ATOM   1393 N N   . ILE A 1 228 ? -12.455 -29.009 11.077 1.00 62.73  ? 723  ILE A N   1 
ATOM   1394 C CA  . ILE A 1 228 ? -12.441 -30.457 11.352 1.00 61.64  ? 723  ILE A CA  1 
ATOM   1395 C C   . ILE A 1 228 ? -13.892 -30.947 11.484 1.00 68.65  ? 723  ILE A C   1 
ATOM   1396 O O   . ILE A 1 228 ? -14.276 -31.929 10.838 1.00 70.67  ? 723  ILE A O   1 
ATOM   1397 C CB  . ILE A 1 228 ? -11.545 -30.855 12.567 1.00 61.66  ? 723  ILE A CB  1 
ATOM   1398 C CG1 . ILE A 1 228 ? -10.062 -30.534 12.291 1.00 61.35  ? 723  ILE A CG1 1 
ATOM   1399 C CG2 . ILE A 1 228 ? -11.690 -32.342 12.879 1.00 61.61  ? 723  ILE A CG2 1 
ATOM   1400 C CD1 . ILE A 1 228 ? -9.164  -30.238 13.528 1.00 60.26  ? 723  ILE A CD1 1 
ATOM   1401 N N   . LEU A 1 229 ? -14.714 -30.226 12.260 1.00 64.22  ? 724  LEU A N   1 
ATOM   1402 C CA  . LEU A 1 229 ? -16.106 -30.610 12.392 1.00 65.04  ? 724  LEU A CA  1 
ATOM   1403 C C   . LEU A 1 229 ? -16.832 -30.487 11.063 1.00 71.78  ? 724  LEU A C   1 
ATOM   1404 O O   . LEU A 1 229 ? -17.693 -31.313 10.798 1.00 74.36  ? 724  LEU A O   1 
ATOM   1405 C CB  . LEU A 1 229 ? -16.818 -29.807 13.483 1.00 64.18  ? 724  LEU A CB  1 
ATOM   1406 C CG  . LEU A 1 229 ? -18.236 -30.270 13.871 1.00 68.79  ? 724  LEU A CG  1 
ATOM   1407 C CD1 . LEU A 1 229 ? -18.198 -31.548 14.714 1.00 68.09  ? 724  LEU A CD1 1 
ATOM   1408 C CD2 . LEU A 1 229 ? -18.948 -29.199 14.634 1.00 69.24  ? 724  LEU A CD2 1 
ATOM   1409 N N   . TYR A 1 230 ? -16.462 -29.498 10.220 1.00 68.00  ? 725  TYR A N   1 
ATOM   1410 C CA  . TYR A 1 230 ? -17.060 -29.262 8.894  1.00 69.91  ? 725  TYR A CA  1 
ATOM   1411 C C   . TYR A 1 230 ? -16.818 -30.461 7.988  1.00 76.14  ? 725  TYR A C   1 
ATOM   1412 O O   . TYR A 1 230 ? -17.727 -30.862 7.259  1.00 77.76  ? 725  TYR A O   1 
ATOM   1413 C CB  . TYR A 1 230 ? -16.482 -27.982 8.268  1.00 70.80  ? 725  TYR A CB  1 
ATOM   1414 C CG  . TYR A 1 230 ? -17.184 -27.469 7.033  1.00 74.38  ? 725  TYR A CG  1 
ATOM   1415 C CD1 . TYR A 1 230 ? -16.998 -28.079 5.798  1.00 78.07  ? 725  TYR A CD1 1 
ATOM   1416 C CD2 . TYR A 1 230 ? -17.936 -26.301 7.072  1.00 76.29  ? 725  TYR A CD2 1 
ATOM   1417 C CE1 . TYR A 1 230 ? -17.608 -27.587 4.647  1.00 81.78  ? 725  TYR A CE1 1 
ATOM   1418 C CE2 . TYR A 1 230 ? -18.556 -25.798 5.928  1.00 80.08  ? 725  TYR A CE2 1 
ATOM   1419 C CZ  . TYR A 1 230 ? -18.380 -26.440 4.714  1.00 89.95  ? 725  TYR A CZ  1 
ATOM   1420 O OH  . TYR A 1 230 ? -18.972 -25.946 3.577  1.00 96.57  ? 725  TYR A OH  1 
ATOM   1421 N N   . TYR A 1 231 ? -15.598 -31.035 8.056  1.00 72.19  ? 726  TYR A N   1 
ATOM   1422 C CA  . TYR A 1 231 ? -15.171 -32.202 7.296  1.00 73.80  ? 726  TYR A CA  1 
ATOM   1423 C C   . TYR A 1 231 ? -16.013 -33.389 7.723  1.00 77.99  ? 726  TYR A C   1 
ATOM   1424 O O   . TYR A 1 231 ? -16.597 -34.027 6.859  1.00 80.78  ? 726  TYR A O   1 
ATOM   1425 C CB  . TYR A 1 231 ? -13.662 -32.440 7.507  1.00 74.78  ? 726  TYR A CB  1 
ATOM   1426 C CG  . TYR A 1 231 ? -12.989 -33.531 6.692  1.00 79.80  ? 726  TYR A CG  1 
ATOM   1427 C CD1 . TYR A 1 231 ? -13.484 -33.910 5.443  1.00 84.74  ? 726  TYR A CD1 1 
ATOM   1428 C CD2 . TYR A 1 231 ? -11.793 -34.108 7.117  1.00 80.11  ? 726  TYR A CD2 1 
ATOM   1429 C CE1 . TYR A 1 231 ? -12.853 -34.898 4.681  1.00 87.45  ? 726  TYR A CE1 1 
ATOM   1430 C CE2 . TYR A 1 231 ? -11.150 -35.093 6.361  1.00 83.17  ? 726  TYR A CE2 1 
ATOM   1431 C CZ  . TYR A 1 231 ? -11.676 -35.476 5.138  1.00 94.39  ? 726  TYR A CZ  1 
ATOM   1432 O OH  . TYR A 1 231 ? -11.032 -36.443 4.398  1.00 98.07  ? 726  TYR A OH  1 
ATOM   1433 N N   . MET A 1 232 ? -16.184 -33.612 9.045  1.00 72.08  ? 727  MET A N   1 
ATOM   1434 C CA  . MET A 1 232 ? -17.012 -34.706 9.587  1.00 72.15  ? 727  MET A CA  1 
ATOM   1435 C C   . MET A 1 232 ? -18.508 -34.498 9.289  1.00 78.00  ? 727  MET A C   1 
ATOM   1436 O O   . MET A 1 232 ? -19.300 -35.416 9.481  1.00 79.48  ? 727  MET A O   1 
ATOM   1437 C CB  . MET A 1 232 ? -16.818 -34.848 11.110 1.00 72.38  ? 727  MET A CB  1 
ATOM   1438 C CG  . MET A 1 232 ? -15.403 -35.177 11.541 1.00 74.75  ? 727  MET A CG  1 
ATOM   1439 S SD  . MET A 1 232 ? -15.146 -34.896 13.318 1.00 77.05  ? 727  MET A SD  1 
ATOM   1440 C CE  . MET A 1 232 ? -14.866 -36.504 13.816 1.00 74.31  ? 727  MET A CE  1 
ATOM   1441 N N   . THR A 1 233 ? -18.899 -33.289 8.856  1.00 74.48  ? 728  THR A N   1 
ATOM   1442 C CA  . THR A 1 233 ? -20.293 -32.944 8.583  1.00 75.75  ? 728  THR A CA  1 
ATOM   1443 C C   . THR A 1 233 ? -20.616 -32.982 7.090  1.00 82.52  ? 728  THR A C   1 
ATOM   1444 O O   . THR A 1 233 ? -21.594 -33.615 6.697  1.00 84.12  ? 728  THR A O   1 
ATOM   1445 C CB  . THR A 1 233 ? -20.628 -31.587 9.229  1.00 77.96  ? 728  THR A CB  1 
ATOM   1446 O OG1 . THR A 1 233 ? -20.299 -31.647 10.616 1.00 74.27  ? 728  THR A OG1 1 
ATOM   1447 C CG2 . THR A 1 233 ? -22.091 -31.186 9.057  1.00 77.63  ? 728  THR A CG2 1 
ATOM   1448 N N   . TYR A 1 234 ? -19.809 -32.279 6.273  1.00 79.34  ? 729  TYR A N   1 
ATOM   1449 C CA  . TYR A 1 234 ? -20.017 -32.129 4.835  1.00 81.52  ? 729  TYR A CA  1 
ATOM   1450 C C   . TYR A 1 234 ? -19.165 -33.013 3.897  1.00 88.05  ? 729  TYR A C   1 
ATOM   1451 O O   . TYR A 1 234 ? -19.484 -33.110 2.707  1.00 91.35  ? 729  TYR A O   1 
ATOM   1452 C CB  . TYR A 1 234 ? -20.000 -30.639 4.438  1.00 81.64  ? 729  TYR A CB  1 
ATOM   1453 C CG  . TYR A 1 234 ? -21.104 -29.827 5.085  1.00 81.58  ? 729  TYR A CG  1 
ATOM   1454 C CD1 . TYR A 1 234 ? -22.444 -30.136 4.867  1.00 85.82  ? 729  TYR A CD1 1 
ATOM   1455 C CD2 . TYR A 1 234 ? -20.811 -28.723 5.880  1.00 79.57  ? 729  TYR A CD2 1 
ATOM   1456 C CE1 . TYR A 1 234 ? -23.465 -29.388 5.453  1.00 86.60  ? 729  TYR A CE1 1 
ATOM   1457 C CE2 . TYR A 1 234 ? -21.822 -27.970 6.473  1.00 80.13  ? 729  TYR A CE2 1 
ATOM   1458 C CZ  . TYR A 1 234 ? -23.150 -28.306 6.255  1.00 89.71  ? 729  TYR A CZ  1 
ATOM   1459 O OH  . TYR A 1 234 ? -24.159 -27.564 6.817  1.00 91.36  ? 729  TYR A OH  1 
ATOM   1460 N N   . GLY A 1 235 ? -18.135 -33.671 4.439  1.00 82.06  ? 730  GLY A N   1 
ATOM   1461 C CA  . GLY A 1 235 ? -17.272 -34.572 3.681  1.00 82.64  ? 730  GLY A CA  1 
ATOM   1462 C C   . GLY A 1 235 ? -16.068 -33.913 3.050  1.00 86.44  ? 730  GLY A C   1 
ATOM   1463 O O   . GLY A 1 235 ? -15.247 -34.590 2.426  1.00 87.16  ? 730  GLY A O   1 
ATOM   1464 N N   . LYS A 1 236 ? -15.956 -32.590 3.218  1.00 82.67  ? 731  LYS A N   1 
ATOM   1465 C CA  . LYS A 1 236 ? -14.842 -31.765 2.736  1.00 82.45  ? 731  LYS A CA  1 
ATOM   1466 C C   . LYS A 1 236 ? -14.581 -30.604 3.716  1.00 82.31  ? 731  LYS A C   1 
ATOM   1467 O O   . LYS A 1 236 ? -15.427 -30.329 4.562  1.00 79.28  ? 731  LYS A O   1 
ATOM   1468 C CB  . LYS A 1 236 ? -15.106 -31.247 1.292  1.00 88.30  ? 731  LYS A CB  1 
ATOM   1469 C CG  . LYS A 1 236 ? -16.373 -30.390 1.111  1.00 99.58  ? 731  LYS A CG  1 
ATOM   1470 C CD  . LYS A 1 236 ? -16.124 -29.145 0.247  1.00 106.83 ? 731  LYS A CD  1 
ATOM   1471 C CE  . LYS A 1 236 ? -17.383 -28.330 0.059  1.00 110.02 ? 731  LYS A CE  1 
ATOM   1472 N NZ  . LYS A 1 236 ? -17.100 -26.971 -0.466 1.00 116.22 ? 731  LYS A NZ  1 
ATOM   1473 N N   . THR A 1 237 ? -13.425 -29.932 3.609  1.00 79.10  ? 732  THR A N   1 
ATOM   1474 C CA  . THR A 1 237 ? -13.150 -28.745 4.429  1.00 77.39  ? 732  THR A CA  1 
ATOM   1475 C C   . THR A 1 237 ? -13.821 -27.545 3.722  1.00 83.75  ? 732  THR A C   1 
ATOM   1476 O O   . THR A 1 237 ? -14.091 -27.669 2.522  1.00 86.73  ? 732  THR A O   1 
ATOM   1477 C CB  . THR A 1 237 ? -11.651 -28.559 4.684  1.00 84.58  ? 732  THR A CB  1 
ATOM   1478 O OG1 . THR A 1 237 ? -10.951 -28.515 3.444  1.00 89.61  ? 732  THR A OG1 1 
ATOM   1479 C CG2 . THR A 1 237 ? -11.083 -29.630 5.574  1.00 78.31  ? 732  THR A CG2 1 
ATOM   1480 N N   . PRO A 1 238 ? -14.129 -26.401 4.401  1.00 79.27  ? 733  PRO A N   1 
ATOM   1481 C CA  . PRO A 1 238 ? -14.835 -25.293 3.711  1.00 81.36  ? 733  PRO A CA  1 
ATOM   1482 C C   . PRO A 1 238 ? -14.254 -24.769 2.398  1.00 89.75  ? 733  PRO A C   1 
ATOM   1483 O O   . PRO A 1 238 ? -15.024 -24.289 1.566  1.00 92.34  ? 733  PRO A O   1 
ATOM   1484 C CB  . PRO A 1 238 ? -14.876 -24.179 4.757  1.00 81.04  ? 733  PRO A CB  1 
ATOM   1485 C CG  . PRO A 1 238 ? -14.758 -24.853 6.034  1.00 82.76  ? 733  PRO A CG  1 
ATOM   1486 C CD  . PRO A 1 238 ? -13.929 -26.086 5.831  1.00 77.86  ? 733  PRO A CD  1 
ATOM   1487 N N   . PHE A 1 239 ? -12.917 -24.860 2.212  1.00 86.72  ? 734  PHE A N   1 
ATOM   1488 C CA  . PHE A 1 239 ? -12.205 -24.342 1.039  1.00 89.32  ? 734  PHE A CA  1 
ATOM   1489 C C   . PHE A 1 239 ? -11.544 -25.415 0.147  1.00 95.24  ? 734  PHE A C   1 
ATOM   1490 O O   . PHE A 1 239 ? -10.881 -25.068 -0.841 1.00 97.98  ? 734  PHE A O   1 
ATOM   1491 C CB  . PHE A 1 239 ? -11.204 -23.254 1.481  1.00 90.35  ? 734  PHE A CB  1 
ATOM   1492 C CG  . PHE A 1 239 ? -11.877 -22.075 2.153  1.00 91.09  ? 734  PHE A CG  1 
ATOM   1493 C CD1 . PHE A 1 239 ? -12.390 -21.023 1.400  1.00 96.77  ? 734  PHE A CD1 1 
ATOM   1494 C CD2 . PHE A 1 239 ? -12.037 -22.037 3.534  1.00 89.50  ? 734  PHE A CD2 1 
ATOM   1495 C CE1 . PHE A 1 239 ? -13.037 -19.952 2.017  1.00 96.82  ? 734  PHE A CE1 1 
ATOM   1496 C CE2 . PHE A 1 239 ? -12.689 -20.967 4.147  1.00 91.48  ? 734  PHE A CE2 1 
ATOM   1497 C CZ  . PHE A 1 239 ? -13.180 -19.933 3.383  1.00 92.40  ? 734  PHE A CZ  1 
ATOM   1498 N N   . GLN A 1 240 ? -11.786 -26.711 0.461  1.00 89.77  ? 735  GLN A N   1 
ATOM   1499 C CA  . GLN A 1 240 ? -11.262 -27.886 -0.248 1.00 90.71  ? 735  GLN A CA  1 
ATOM   1500 C C   . GLN A 1 240 ? -11.451 -27.849 -1.776 1.00 99.11  ? 735  GLN A C   1 
ATOM   1501 O O   . GLN A 1 240 ? -10.564 -28.316 -2.494 1.00 101.10 ? 735  GLN A O   1 
ATOM   1502 C CB  . GLN A 1 240 ? -11.833 -29.186 0.350  1.00 90.28  ? 735  GLN A CB  1 
ATOM   1503 C CG  . GLN A 1 240 ? -10.959 -30.428 0.130  1.00 100.47 ? 735  GLN A CG  1 
ATOM   1504 C CD  . GLN A 1 240 ? -11.455 -31.620 0.912  1.00 113.63 ? 735  GLN A CD  1 
ATOM   1505 O OE1 . GLN A 1 240 ? -11.546 -31.590 2.140  1.00 112.22 ? 735  GLN A OE1 1 
ATOM   1506 N NE2 . GLN A 1 240 ? -11.763 -32.710 0.227  1.00 98.36  ? 735  GLN A NE2 1 
ATOM   1507 N N   . GLN A 1 241 ? -12.588 -27.287 -2.264 1.00 96.75  ? 736  GLN A N   1 
ATOM   1508 C CA  . GLN A 1 241 ? -12.927 -27.152 -3.691 1.00 100.31 ? 736  GLN A CA  1 
ATOM   1509 C C   . GLN A 1 241 ? -11.816 -26.466 -4.503 1.00 104.70 ? 736  GLN A C   1 
ATOM   1510 O O   . GLN A 1 241 ? -11.593 -26.842 -5.649 1.00 107.38 ? 736  GLN A O   1 
ATOM   1511 C CB  . GLN A 1 241 ? -14.260 -26.388 -3.878 1.00 103.19 ? 736  GLN A CB  1 
ATOM   1512 C CG  . GLN A 1 241 ? -15.505 -27.178 -3.452 1.00 126.16 ? 736  GLN A CG  1 
ATOM   1513 C CD  . GLN A 1 241 ? -16.784 -26.874 -4.224 1.00 151.24 ? 736  GLN A CD  1 
ATOM   1514 O OE1 . GLN A 1 241 ? -16.983 -25.788 -4.793 1.00 149.94 ? 736  GLN A OE1 1 
ATOM   1515 N NE2 . GLN A 1 241 ? -17.706 -27.833 -4.231 1.00 141.96 ? 736  GLN A NE2 1 
ATOM   1516 N N   . ILE A 1 242 ? -11.118 -25.479 -3.900 1.00 99.21  ? 737  ILE A N   1 
ATOM   1517 C CA  . ILE A 1 242 ? -10.039 -24.701 -4.527 1.00 100.89 ? 737  ILE A CA  1 
ATOM   1518 C C   . ILE A 1 242 ? -8.702  -25.458 -4.537 1.00 103.91 ? 737  ILE A C   1 
ATOM   1519 O O   . ILE A 1 242 ? -8.107  -25.662 -3.479 1.00 100.27 ? 737  ILE A O   1 
ATOM   1520 C CB  . ILE A 1 242 ? -9.900  -23.295 -3.877 1.00 102.32 ? 737  ILE A CB  1 
ATOM   1521 C CG1 . ILE A 1 242 ? -11.248 -22.539 -3.854 1.00 102.94 ? 737  ILE A CG1 1 
ATOM   1522 C CG2 . ILE A 1 242 ? -8.820  -22.481 -4.588 1.00 105.64 ? 737  ILE A CG2 1 
ATOM   1523 C CD1 . ILE A 1 242 ? -11.425 -21.578 -2.684 1.00 104.24 ? 737  ILE A CD1 1 
ATOM   1524 N N   . ILE A 1 243 ? -8.221  -25.838 -5.737 1.00 103.45 ? 738  ILE A N   1 
ATOM   1525 C CA  . ILE A 1 243 ? -6.945  -26.543 -5.896 1.00 102.80 ? 738  ILE A CA  1 
ATOM   1526 C C   . ILE A 1 243 ? -5.780  -25.584 -5.625 1.00 105.10 ? 738  ILE A C   1 
ATOM   1527 O O   . ILE A 1 243 ? -5.022  -25.814 -4.680 1.00 101.03 ? 738  ILE A O   1 
ATOM   1528 C CB  . ILE A 1 243 ? -6.843  -27.229 -7.279 1.00 110.27 ? 738  ILE A CB  1 
ATOM   1529 N N   . ASN A 1 244 ? -5.692  -24.479 -6.422 1.00 104.53 ? 739  ASN A N   1 
ATOM   1530 C CA  . ASN A 1 244 ? -4.700  -23.390 -6.372 1.00 104.58 ? 739  ASN A CA  1 
ATOM   1531 C C   . ASN A 1 244 ? -4.535  -22.833 -4.949 1.00 102.74 ? 739  ASN A C   1 
ATOM   1532 O O   . ASN A 1 244 ? -5.460  -22.200 -4.425 1.00 100.37 ? 739  ASN A O   1 
ATOM   1533 C CB  . ASN A 1 244 ? -5.105  -22.273 -7.356 1.00 107.95 ? 739  ASN A CB  1 
ATOM   1534 C CG  . ASN A 1 244 ? -4.113  -21.140 -7.486 1.00 128.95 ? 739  ASN A CG  1 
ATOM   1535 O OD1 . ASN A 1 244 ? -3.834  -20.407 -6.532 1.00 118.79 ? 739  ASN A OD1 1 
ATOM   1536 N ND2 . ASN A 1 244 ? -3.606  -20.931 -8.694 1.00 125.90 ? 739  ASN A ND2 1 
ATOM   1537 N N   . GLN A 1 245 ? -3.348  -23.072 -4.335 1.00 97.12  ? 740  GLN A N   1 
ATOM   1538 C CA  . GLN A 1 245 ? -3.030  -22.655 -2.959 1.00 92.59  ? 740  GLN A CA  1 
ATOM   1539 C C   . GLN A 1 245 ? -3.223  -21.167 -2.697 1.00 95.37  ? 740  GLN A C   1 
ATOM   1540 O O   . GLN A 1 245 ? -3.853  -20.831 -1.691 1.00 92.52  ? 740  GLN A O   1 
ATOM   1541 C CB  . GLN A 1 245 ? -1.642  -23.133 -2.501 1.00 92.73  ? 740  GLN A CB  1 
ATOM   1542 C CG  . GLN A 1 245 ? -1.494  -24.648 -2.332 1.00 107.22 ? 740  GLN A CG  1 
ATOM   1543 C CD  . GLN A 1 245 ? -2.227  -25.202 -1.142 1.00 125.98 ? 740  GLN A CD  1 
ATOM   1544 O OE1 . GLN A 1 245 ? -3.375  -25.647 -1.246 1.00 124.08 ? 740  GLN A OE1 1 
ATOM   1545 N NE2 . GLN A 1 245 ? -1.571  -25.209 0.009  1.00 113.90 ? 740  GLN A NE2 1 
ATOM   1546 N N   . ILE A 1 246 ? -2.735  -20.282 -3.607 1.00 93.68  ? 741  ILE A N   1 
ATOM   1547 C CA  . ILE A 1 246 ? -2.900  -18.827 -3.474 1.00 94.17  ? 741  ILE A CA  1 
ATOM   1548 C C   . ILE A 1 246 ? -4.382  -18.444 -3.532 1.00 98.70  ? 741  ILE A C   1 
ATOM   1549 O O   . ILE A 1 246 ? -4.863  -17.764 -2.622 1.00 95.81  ? 741  ILE A O   1 
ATOM   1550 C CB  . ILE A 1 246 ? -2.020  -18.022 -4.461 1.00 101.74 ? 741  ILE A CB  1 
ATOM   1551 C CG1 . ILE A 1 246 ? -0.539  -18.399 -4.282 1.00 102.68 ? 741  ILE A CG1 1 
ATOM   1552 C CG2 . ILE A 1 246 ? -2.222  -16.508 -4.277 1.00 102.29 ? 741  ILE A CG2 1 
ATOM   1553 C CD1 . ILE A 1 246 ? 0.307   -18.164 -5.475 1.00 114.15 ? 741  ILE A CD1 1 
ATOM   1554 N N   . SER A 1 247 ? -5.115  -18.940 -4.556 1.00 98.70  ? 742  SER A N   1 
ATOM   1555 C CA  . SER A 1 247 ? -6.557  -18.705 -4.716 1.00 99.40  ? 742  SER A CA  1 
ATOM   1556 C C   . SER A 1 247 ? -7.344  -19.202 -3.478 1.00 99.60  ? 742  SER A C   1 
ATOM   1557 O O   . SER A 1 247 ? -8.379  -18.622 -3.146 1.00 99.10  ? 742  SER A O   1 
ATOM   1558 C CB  . SER A 1 247 ? -7.084  -19.366 -5.989 1.00 106.25 ? 742  SER A CB  1 
ATOM   1559 O OG  . SER A 1 247 ? -6.505  -18.839 -7.172 1.00 119.91 ? 742  SER A OG  1 
ATOM   1560 N N   . LYS A 1 248 ? -6.833  -20.246 -2.781 1.00 92.74  ? 743  LYS A N   1 
ATOM   1561 C CA  . LYS A 1 248 ? -7.456  -20.759 -1.561 1.00 87.89  ? 743  LYS A CA  1 
ATOM   1562 C C   . LYS A 1 248 ? -7.246  -19.737 -0.449 1.00 90.16  ? 743  LYS A C   1 
ATOM   1563 O O   . LYS A 1 248 ? -8.224  -19.285 0.128  1.00 87.90  ? 743  LYS A O   1 
ATOM   1564 C CB  . LYS A 1 248 ? -6.903  -22.145 -1.169 1.00 87.11  ? 743  LYS A CB  1 
ATOM   1565 C CG  . LYS A 1 248 ? -7.976  -23.106 -0.635 1.00 89.59  ? 743  LYS A CG  1 
ATOM   1566 C CD  . LYS A 1 248 ? -7.425  -24.273 0.204  1.00 92.51  ? 743  LYS A CD  1 
ATOM   1567 C CE  . LYS A 1 248 ? -6.596  -25.282 -0.570 1.00 97.56  ? 743  LYS A CE  1 
ATOM   1568 N NZ  . LYS A 1 248 ? -7.365  -26.495 -0.949 1.00 98.33  ? 743  LYS A NZ  1 
ATOM   1569 N N   . LEU A 1 249 ? -5.983  -19.310 -0.207 1.00 88.43  ? 744  LEU A N   1 
ATOM   1570 C CA  . LEU A 1 249 ? -5.629  -18.310 0.817  1.00 87.10  ? 744  LEU A CA  1 
ATOM   1571 C C   . LEU A 1 249 ? -6.368  -16.979 0.568  1.00 94.19  ? 744  LEU A C   1 
ATOM   1572 O O   . LEU A 1 249 ? -6.856  -16.351 1.515  1.00 92.26  ? 744  LEU A O   1 
ATOM   1573 C CB  . LEU A 1 249 ? -4.105  -18.088 0.886  1.00 87.52  ? 744  LEU A CB  1 
ATOM   1574 C CG  . LEU A 1 249 ? -3.224  -19.322 1.166  1.00 90.59  ? 744  LEU A CG  1 
ATOM   1575 C CD1 . LEU A 1 249 ? -1.772  -19.031 0.871  1.00 92.99  ? 744  LEU A CD1 1 
ATOM   1576 C CD2 . LEU A 1 249 ? -3.350  -19.810 2.619  1.00 90.08  ? 744  LEU A CD2 1 
ATOM   1577 N N   . HIS A 1 250 ? -6.519  -16.603 -0.711 1.00 94.38  ? 745  HIS A N   1 
ATOM   1578 C CA  . HIS A 1 250 ? -7.237  -15.401 -1.101 1.00 97.52  ? 745  HIS A CA  1 
ATOM   1579 C C   . HIS A 1 250 ? -8.729  -15.482 -0.800 1.00 101.07 ? 745  HIS A C   1 
ATOM   1580 O O   . HIS A 1 250 ? -9.369  -14.437 -0.729 1.00 103.53 ? 745  HIS A O   1 
ATOM   1581 C CB  . HIS A 1 250 ? -6.995  -15.072 -2.579 1.00 103.55 ? 745  HIS A CB  1 
ATOM   1582 C CG  . HIS A 1 250 ? -5.755  -14.268 -2.816 1.00 109.86 ? 745  HIS A CG  1 
ATOM   1583 N ND1 . HIS A 1 250 ? -5.782  -13.111 -3.571 1.00 116.36 ? 745  HIS A ND1 1 
ATOM   1584 C CD2 . HIS A 1 250 ? -4.490  -14.472 -2.375 1.00 110.55 ? 745  HIS A CD2 1 
ATOM   1585 C CE1 . HIS A 1 250 ? -4.537  -12.662 -3.586 1.00 117.38 ? 745  HIS A CE1 1 
ATOM   1586 N NE2 . HIS A 1 250 ? -3.726  -13.446 -2.875 1.00 114.32 ? 745  HIS A NE2 1 
ATOM   1587 N N   . ALA A 1 251 ? -9.281  -16.701 -0.610 1.00 94.35  ? 746  ALA A N   1 
ATOM   1588 C CA  . ALA A 1 251 ? -10.703 -16.917 -0.310 1.00 92.70  ? 746  ALA A CA  1 
ATOM   1589 C C   . ALA A 1 251 ? -10.981 -17.007 1.195  1.00 94.01  ? 746  ALA A C   1 
ATOM   1590 O O   . ALA A 1 251 ? -12.014 -16.520 1.659  1.00 93.74  ? 746  ALA A O   1 
ATOM   1591 C CB  . ALA A 1 251 ? -11.212 -18.163 -1.019 1.00 93.48  ? 746  ALA A CB  1 
ATOM   1592 N N   . ILE A 1 252 ? -10.065 -17.625 1.953  1.00 88.92  ? 747  ILE A N   1 
ATOM   1593 C CA  . ILE A 1 252 ? -10.179 -17.768 3.403  1.00 85.79  ? 747  ILE A CA  1 
ATOM   1594 C C   . ILE A 1 252 ? -10.239 -16.380 4.045  1.00 92.16  ? 747  ILE A C   1 
ATOM   1595 O O   . ILE A 1 252 ? -11.054 -16.163 4.936  1.00 90.44  ? 747  ILE A O   1 
ATOM   1596 C CB  . ILE A 1 252 ? -9.052  -18.669 4.007  1.00 86.16  ? 747  ILE A CB  1 
ATOM   1597 C CG1 . ILE A 1 252 ? -8.996  -20.053 3.325  1.00 86.67  ? 747  ILE A CG1 1 
ATOM   1598 C CG2 . ILE A 1 252 ? -9.231  -18.844 5.514  1.00 83.14  ? 747  ILE A CG2 1 
ATOM   1599 C CD1 . ILE A 1 252 ? -7.601  -20.647 3.209  1.00 96.89  ? 747  ILE A CD1 1 
ATOM   1600 N N   . ILE A 1 253 ? -9.419  -15.436 3.558  1.00 92.80  ? 748  ILE A N   1 
ATOM   1601 C CA  . ILE A 1 253 ? -9.397  -14.074 4.089  1.00 94.12  ? 748  ILE A CA  1 
ATOM   1602 C C   . ILE A 1 253 ? -10.565 -13.198 3.643  1.00 101.72 ? 748  ILE A C   1 
ATOM   1603 O O   . ILE A 1 253 ? -11.128 -12.482 4.470  1.00 101.41 ? 748  ILE A O   1 
ATOM   1604 C CB  . ILE A 1 253 ? -8.016  -13.366 3.994  1.00 98.82  ? 748  ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 253 ? -7.493  -13.289 2.549  1.00 102.70 ? 748  ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 253 ? -7.000  -14.022 4.935  1.00 96.28  ? 748  ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 253 ? -6.719  -12.031 2.237  1.00 113.60 ? 748  ILE A CD1 1 
ATOM   1608 N N   . ASP A 1 254 ? -10.940 -13.269 2.356  1.00 101.76 ? 749  ASP A N   1 
ATOM   1609 C CA  . ASP A 1 254 ? -12.007 -12.454 1.770  1.00 104.87 ? 749  ASP A CA  1 
ATOM   1610 C C   . ASP A 1 254 ? -13.403 -12.659 2.391  1.00 107.63 ? 749  ASP A C   1 
ATOM   1611 O O   . ASP A 1 254 ? -13.950 -13.756 2.286  1.00 105.55 ? 749  ASP A O   1 
ATOM   1612 C CB  . ASP A 1 254 ? -12.031 -12.592 0.239  1.00 110.48 ? 749  ASP A CB  1 
ATOM   1613 C CG  . ASP A 1 254 ? -13.123 -11.790 -0.429 1.00 125.55 ? 749  ASP A CG  1 
ATOM   1614 O OD1 . ASP A 1 254 ? -12.924 -10.572 -0.639 1.00 129.03 ? 749  ASP A OD1 1 
ATOM   1615 O OD2 . ASP A 1 254 ? -14.185 -12.372 -0.722 1.00 132.13 ? 749  ASP A OD2 1 
ATOM   1616 N N   . PRO A 1 255 ? -13.999 -11.588 2.993  1.00 105.64 ? 750  PRO A N   1 
ATOM   1617 C CA  . PRO A 1 255 ? -15.352 -11.711 3.593  1.00 103.57 ? 750  PRO A CA  1 
ATOM   1618 C C   . PRO A 1 255 ? -16.506 -11.824 2.591  1.00 105.86 ? 750  PRO A C   1 
ATOM   1619 O O   . PRO A 1 255 ? -17.577 -12.315 2.946  1.00 102.53 ? 750  PRO A O   1 
ATOM   1620 C CB  . PRO A 1 255 ? -15.483 -10.431 4.420  1.00 106.34 ? 750  PRO A CB  1 
ATOM   1621 C CG  . PRO A 1 255 ? -14.642 -9.434  3.690  1.00 114.72 ? 750  PRO A CG  1 
ATOM   1622 C CD  . PRO A 1 255 ? -13.458 -10.221 3.176  1.00 109.87 ? 750  PRO A CD  1 
ATOM   1623 N N   . ASN A 1 256 ? -16.291 -11.364 1.351  1.00 105.56 ? 751  ASN A N   1 
ATOM   1624 C CA  . ASN A 1 256 ? -17.295 -11.436 0.288  1.00 108.44 ? 751  ASN A CA  1 
ATOM   1625 C C   . ASN A 1 256 ? -17.399 -12.862 -0.269 1.00 110.61 ? 751  ASN A C   1 
ATOM   1626 O O   . ASN A 1 256 ? -18.324 -13.161 -1.035 1.00 111.21 ? 751  ASN A O   1 
ATOM   1627 C CB  . ASN A 1 256 ? -17.001 -10.413 -0.816 1.00 114.15 ? 751  ASN A CB  1 
ATOM   1628 C CG  . ASN A 1 256 ? -16.862 -9.009  -0.290 1.00 133.19 ? 751  ASN A CG  1 
ATOM   1629 O OD1 . ASN A 1 256 ? -17.830 -8.398  0.175  1.00 128.07 ? 751  ASN A OD1 1 
ATOM   1630 N ND2 . ASN A 1 256 ? -15.640 -8.491  -0.300 1.00 123.41 ? 751  ASN A ND2 1 
ATOM   1631 N N   . HIS A 1 257 ? -16.443 -13.741 0.127  1.00 104.82 ? 752  HIS A N   1 
ATOM   1632 C CA  . HIS A 1 257 ? -16.424 -15.149 -0.255 1.00 103.50 ? 752  HIS A CA  1 
ATOM   1633 C C   . HIS A 1 257 ? -17.242 -15.960 0.758  1.00 103.78 ? 752  HIS A C   1 
ATOM   1634 O O   . HIS A 1 257 ? -16.705 -16.451 1.758  1.00 99.65  ? 752  HIS A O   1 
ATOM   1635 C CB  . HIS A 1 257 ? -14.999 -15.700 -0.408 1.00 103.36 ? 752  HIS A CB  1 
ATOM   1636 C CG  . HIS A 1 257 ? -14.986 -16.982 -1.178 1.00 107.07 ? 752  HIS A CG  1 
ATOM   1637 N ND1 . HIS A 1 257 ? -15.309 -18.192 -0.577 1.00 105.61 ? 752  HIS A ND1 1 
ATOM   1638 C CD2 . HIS A 1 257 ? -14.762 -17.193 -2.496 1.00 112.25 ? 752  HIS A CD2 1 
ATOM   1639 C CE1 . HIS A 1 257 ? -15.243 -19.096 -1.539 1.00 106.61 ? 752  HIS A CE1 1 
ATOM   1640 N NE2 . HIS A 1 257 ? -14.918 -18.542 -2.713 1.00 110.96 ? 752  HIS A NE2 1 
ATOM   1641 N N   . GLU A 1 258 ? -18.558 -16.074 0.492  1.00 101.11 ? 753  GLU A N   1 
ATOM   1642 C CA  . GLU A 1 258 ? -19.500 -16.770 1.360  1.00 97.95  ? 753  GLU A CA  1 
ATOM   1643 C C   . GLU A 1 258 ? -19.274 -18.276 1.437  1.00 99.41  ? 753  GLU A C   1 
ATOM   1644 O O   . GLU A 1 258 ? -19.314 -18.962 0.414  1.00 100.27 ? 753  GLU A O   1 
ATOM   1645 C CB  . GLU A 1 258 ? -20.948 -16.427 0.987  1.00 101.40 ? 753  GLU A CB  1 
ATOM   1646 C CG  . GLU A 1 258 ? -21.383 -15.064 1.502  1.00 111.60 ? 753  GLU A CG  1 
ATOM   1647 C CD  . GLU A 1 258 ? -22.829 -14.680 1.249  1.00 134.74 ? 753  GLU A CD  1 
ATOM   1648 O OE1 . GLU A 1 258 ? -23.694 -15.585 1.199  1.00 131.38 ? 753  GLU A OE1 1 
ATOM   1649 O OE2 . GLU A 1 258 ? -23.102 -13.462 1.136  1.00 126.89 ? 753  GLU A OE2 1 
ATOM   1650 N N   . ILE A 1 259 ? -19.013 -18.778 2.661  1.00 92.56  ? 754  ILE A N   1 
ATOM   1651 C CA  . ILE A 1 259 ? -18.830 -20.207 2.940  1.00 90.19  ? 754  ILE A CA  1 
ATOM   1652 C C   . ILE A 1 259 ? -20.231 -20.844 2.910  1.00 95.96  ? 754  ILE A C   1 
ATOM   1653 O O   . ILE A 1 259 ? -21.164 -20.306 3.517  1.00 95.36  ? 754  ILE A O   1 
ATOM   1654 C CB  . ILE A 1 259 ? -18.080 -20.452 4.297  1.00 89.17  ? 754  ILE A CB  1 
ATOM   1655 C CG1 . ILE A 1 259 ? -16.653 -19.855 4.272  1.00 88.56  ? 754  ILE A CG1 1 
ATOM   1656 C CG2 . ILE A 1 259 ? -18.033 -21.951 4.673  1.00 87.97  ? 754  ILE A CG2 1 
ATOM   1657 C CD1 . ILE A 1 259 ? -15.998 -19.638 5.633  1.00 85.95  ? 754  ILE A CD1 1 
ATOM   1658 N N   . GLU A 1 260 ? -20.382 -21.956 2.175  1.00 94.87  ? 755  GLU A N   1 
ATOM   1659 C CA  . GLU A 1 260 ? -21.670 -22.643 2.066  1.00 96.53  ? 755  GLU A CA  1 
ATOM   1660 C C   . GLU A 1 260 ? -21.928 -23.528 3.275  1.00 98.26  ? 755  GLU A C   1 
ATOM   1661 O O   . GLU A 1 260 ? -21.057 -24.299 3.681  1.00 95.68  ? 755  GLU A O   1 
ATOM   1662 C CB  . GLU A 1 260 ? -21.761 -23.478 0.777  1.00 100.76 ? 755  GLU A CB  1 
ATOM   1663 C CG  . GLU A 1 260 ? -21.870 -22.661 -0.495 1.00 116.17 ? 755  GLU A CG  1 
ATOM   1664 C CD  . GLU A 1 260 ? -22.091 -23.492 -1.742 1.00 140.82 ? 755  GLU A CD  1 
ATOM   1665 O OE1 . GLU A 1 260 ? -21.100 -24.041 -2.277 1.00 135.26 ? 755  GLU A OE1 1 
ATOM   1666 O OE2 . GLU A 1 260 ? -23.260 -23.602 -2.178 1.00 136.42 ? 755  GLU A OE2 1 
ATOM   1667 N N   . PHE A 1 261 ? -23.123 -23.413 3.846  1.00 95.19  ? 756  PHE A N   1 
ATOM   1668 C CA  . PHE A 1 261 ? -23.534 -24.242 4.967  1.00 93.31  ? 756  PHE A CA  1 
ATOM   1669 C C   . PHE A 1 261 ? -24.853 -24.915 4.570  1.00 99.45  ? 756  PHE A C   1 
ATOM   1670 O O   . PHE A 1 261 ? -25.934 -24.431 4.944  1.00 99.10  ? 756  PHE A O   1 
ATOM   1671 C CB  . PHE A 1 261 ? -23.670 -23.422 6.254  1.00 93.34  ? 756  PHE A CB  1 
ATOM   1672 C CG  . PHE A 1 261 ? -22.381 -22.872 6.802  1.00 93.08  ? 756  PHE A CG  1 
ATOM   1673 C CD1 . PHE A 1 261 ? -21.615 -23.610 7.698  1.00 93.75  ? 756  PHE A CD1 1 
ATOM   1674 C CD2 . PHE A 1 261 ? -21.961 -21.588 6.475  1.00 96.24  ? 756  PHE A CD2 1 
ATOM   1675 C CE1 . PHE A 1 261 ? -20.441 -23.082 8.243  1.00 92.48  ? 756  PHE A CE1 1 
ATOM   1676 C CE2 . PHE A 1 261 ? -20.781 -21.063 7.017  1.00 97.27  ? 756  PHE A CE2 1 
ATOM   1677 C CZ  . PHE A 1 261 ? -20.033 -21.812 7.901  1.00 92.39  ? 756  PHE A CZ  1 
ATOM   1678 N N   . PRO A 1 262 ? -24.781 -25.999 3.750  1.00 97.53  ? 757  PRO A N   1 
ATOM   1679 C CA  . PRO A 1 262 ? -26.020 -26.663 3.289  1.00 99.88  ? 757  PRO A CA  1 
ATOM   1680 C C   . PRO A 1 262 ? -26.900 -27.196 4.421  1.00 104.00 ? 757  PRO A C   1 
ATOM   1681 O O   . PRO A 1 262 ? -26.370 -27.710 5.411  1.00 102.26 ? 757  PRO A O   1 
ATOM   1682 C CB  . PRO A 1 262 ? -25.508 -27.793 2.384  1.00 102.54 ? 757  PRO A CB  1 
ATOM   1683 C CG  . PRO A 1 262 ? -24.133 -27.399 2.012  1.00 105.88 ? 757  PRO A CG  1 
ATOM   1684 C CD  . PRO A 1 262 ? -23.585 -26.658 3.186  1.00 98.21  ? 757  PRO A CD  1 
ATOM   1685 N N   . ASP A 1 263 ? -28.241 -27.049 4.278  1.00 102.53 ? 758  ASP A N   1 
ATOM   1686 C CA  . ASP A 1 263 ? -29.262 -27.475 5.248  1.00 101.60 ? 758  ASP A CA  1 
ATOM   1687 C C   . ASP A 1 263 ? -29.154 -28.979 5.594  1.00 103.36 ? 758  ASP A C   1 
ATOM   1688 O O   . ASP A 1 263 ? -29.338 -29.843 4.732  1.00 104.90 ? 758  ASP A O   1 
ATOM   1689 C CB  . ASP A 1 263 ? -30.676 -27.069 4.783  1.00 106.44 ? 758  ASP A CB  1 
ATOM   1690 N N   . ILE A 1 264 ? -28.760 -29.263 6.848  1.00 96.03  ? 759  ILE A N   1 
ATOM   1691 C CA  . ILE A 1 264 ? -28.560 -30.606 7.407  1.00 93.91  ? 759  ILE A CA  1 
ATOM   1692 C C   . ILE A 1 264 ? -29.696 -30.878 8.440  1.00 94.89  ? 759  ILE A C   1 
ATOM   1693 O O   . ILE A 1 264 ? -30.308 -29.904 8.896  1.00 93.24  ? 759  ILE A O   1 
ATOM   1694 C CB  . ILE A 1 264 ? -27.121 -30.718 8.019  1.00 93.37  ? 759  ILE A CB  1 
ATOM   1695 N N   . PRO A 1 265 ? -30.023 -32.154 8.809  1.00 90.99  ? 760  PRO A N   1 
ATOM   1696 C CA  . PRO A 1 265 ? -31.110 -32.383 9.789  1.00 91.26  ? 760  PRO A CA  1 
ATOM   1697 C C   . PRO A 1 265 ? -30.769 -31.958 11.216 1.00 91.95  ? 760  PRO A C   1 
ATOM   1698 O O   . PRO A 1 265 ? -31.653 -31.895 12.065 1.00 91.70  ? 760  PRO A O   1 
ATOM   1699 C CB  . PRO A 1 265 ? -31.378 -33.893 9.706  1.00 94.83  ? 760  PRO A CB  1 
ATOM   1700 C CG  . PRO A 1 265 ? -30.522 -34.412 8.601  1.00 99.79  ? 760  PRO A CG  1 
ATOM   1701 C CD  . PRO A 1 265 ? -29.415 -33.433 8.394  1.00 92.91  ? 760  PRO A CD  1 
ATOM   1702 N N   . GLU A 1 266 ? -29.484 -31.681 11.474 1.00 86.30  ? 761  GLU A N   1 
ATOM   1703 C CA  . GLU A 1 266 ? -28.989 -31.239 12.768 1.00 83.63  ? 761  GLU A CA  1 
ATOM   1704 C C   . GLU A 1 266 ? -28.819 -29.726 12.716 1.00 86.02  ? 761  GLU A C   1 
ATOM   1705 O O   . GLU A 1 266 ? -27.807 -29.244 12.214 1.00 82.70  ? 761  GLU A O   1 
ATOM   1706 C CB  . GLU A 1 266 ? -27.677 -31.964 13.127 1.00 82.65  ? 761  GLU A CB  1 
ATOM   1707 C CG  . GLU A 1 266 ? -27.864 -33.428 13.490 1.00 90.17  ? 761  GLU A CG  1 
ATOM   1708 C CD  . GLU A 1 266 ? -26.862 -33.981 14.484 1.00 95.24  ? 761  GLU A CD  1 
ATOM   1709 O OE1 . GLU A 1 266 ? -26.951 -33.644 15.689 1.00 83.87  ? 761  GLU A OE1 1 
ATOM   1710 O OE2 . GLU A 1 266 ? -25.995 -34.772 14.054 1.00 72.32  ? 761  GLU A OE2 1 
ATOM   1711 N N   . LYS A 1 267 ? -29.849 -28.973 13.169 1.00 85.18  ? 762  LYS A N   1 
ATOM   1712 C CA  . LYS A 1 267 ? -29.813 -27.502 13.142 1.00 84.47  ? 762  LYS A CA  1 
ATOM   1713 C C   . LYS A 1 267 ? -28.725 -26.925 14.078 1.00 87.43  ? 762  LYS A C   1 
ATOM   1714 O O   . LYS A 1 267 ? -28.090 -25.927 13.730 1.00 87.00  ? 762  LYS A O   1 
ATOM   1715 C CB  . LYS A 1 267 ? -31.202 -26.895 13.398 1.00 87.47  ? 762  LYS A CB  1 
ATOM   1716 N N   . ASP A 1 268 ? -28.482 -27.591 15.230 1.00 82.71  ? 763  ASP A N   1 
ATOM   1717 C CA  . ASP A 1 268 ? -27.500 -27.203 16.241 1.00 80.51  ? 763  ASP A CA  1 
ATOM   1718 C C   . ASP A 1 268 ? -26.073 -27.307 15.697 1.00 82.59  ? 763  ASP A C   1 
ATOM   1719 O O   . ASP A 1 268 ? -25.241 -26.436 15.969 1.00 80.03  ? 763  ASP A O   1 
ATOM   1720 C CB  . ASP A 1 268 ? -27.640 -28.098 17.485 1.00 82.84  ? 763  ASP A CB  1 
ATOM   1721 C CG  . ASP A 1 268 ? -28.850 -27.840 18.361 1.00 98.32  ? 763  ASP A CG  1 
ATOM   1722 O OD1 . ASP A 1 268 ? -29.536 -26.812 18.144 1.00 100.41 ? 763  ASP A OD1 1 
ATOM   1723 O OD2 . ASP A 1 268 ? -29.097 -28.654 19.284 1.00 106.29 ? 763  ASP A OD2 1 
ATOM   1724 N N   . LEU A 1 269 ? -25.800 -28.398 14.947 1.00 79.40  ? 764  LEU A N   1 
ATOM   1725 C CA  . LEU A 1 269 ? -24.533 -28.720 14.294 1.00 76.88  ? 764  LEU A CA  1 
ATOM   1726 C C   . LEU A 1 269 ? -24.215 -27.651 13.242 1.00 80.46  ? 764  LEU A C   1 
ATOM   1727 O O   . LEU A 1 269 ? -23.057 -27.223 13.145 1.00 79.07  ? 764  LEU A O   1 
ATOM   1728 C CB  . LEU A 1 269 ? -24.620 -30.142 13.685 1.00 77.82  ? 764  LEU A CB  1 
ATOM   1729 C CG  . LEU A 1 269 ? -23.436 -30.753 12.892 1.00 81.97  ? 764  LEU A CG  1 
ATOM   1730 C CD1 . LEU A 1 269 ? -22.082 -30.479 13.530 1.00 79.23  ? 764  LEU A CD1 1 
ATOM   1731 C CD2 . LEU A 1 269 ? -23.606 -32.242 12.759 1.00 85.62  ? 764  LEU A CD2 1 
ATOM   1732 N N   . GLN A 1 270 ? -25.246 -27.181 12.504 1.00 78.27  ? 765  GLN A N   1 
ATOM   1733 C CA  . GLN A 1 270 ? -25.089 -26.125 11.497 1.00 79.04  ? 765  GLN A CA  1 
ATOM   1734 C C   . GLN A 1 270 ? -24.741 -24.807 12.187 1.00 79.93  ? 765  GLN A C   1 
ATOM   1735 O O   . GLN A 1 270 ? -23.900 -24.062 11.682 1.00 78.79  ? 765  GLN A O   1 
ATOM   1736 C CB  . GLN A 1 270 ? -26.353 -25.977 10.619 1.00 83.68  ? 765  GLN A CB  1 
ATOM   1737 C CG  . GLN A 1 270 ? -26.083 -25.309 9.264  1.00 101.76 ? 765  GLN A CG  1 
ATOM   1738 C CD  . GLN A 1 270 ? -27.339 -24.991 8.490  1.00 115.65 ? 765  GLN A CD  1 
ATOM   1739 O OE1 . GLN A 1 270 ? -27.998 -25.881 7.948  1.00 111.31 ? 765  GLN A OE1 1 
ATOM   1740 N NE2 . GLN A 1 270 ? -27.669 -23.704 8.384  1.00 104.91 ? 765  GLN A NE2 1 
ATOM   1741 N N   . ASP A 1 271 ? -25.346 -24.548 13.364 1.00 75.41  ? 766  ASP A N   1 
ATOM   1742 C CA  . ASP A 1 271 ? -25.060 -23.328 14.119 1.00 74.18  ? 766  ASP A CA  1 
ATOM   1743 C C   . ASP A 1 271 ? -23.617 -23.296 14.618 1.00 73.87  ? 766  ASP A C   1 
ATOM   1744 O O   . ASP A 1 271 ? -22.992 -22.250 14.510 1.00 73.55  ? 766  ASP A O   1 
ATOM   1745 C CB  . ASP A 1 271 ? -26.062 -23.097 15.265 1.00 76.69  ? 766  ASP A CB  1 
ATOM   1746 C CG  . ASP A 1 271 ? -25.913 -21.731 15.919 1.00 84.88  ? 766  ASP A CG  1 
ATOM   1747 O OD1 . ASP A 1 271 ? -26.487 -20.742 15.381 1.00 86.35  ? 766  ASP A OD1 1 
ATOM   1748 O OD2 . ASP A 1 271 ? -25.199 -21.641 16.950 1.00 85.55  ? 766  ASP A OD2 1 
ATOM   1749 N N   . VAL A 1 272 ? -23.086 -24.438 15.121 1.00 67.09  ? 767  VAL A N   1 
ATOM   1750 C CA  . VAL A 1 272 ? -21.708 -24.562 15.623 1.00 64.03  ? 767  VAL A CA  1 
ATOM   1751 C C   . VAL A 1 272 ? -20.751 -24.130 14.523 1.00 67.37  ? 767  VAL A C   1 
ATOM   1752 O O   . VAL A 1 272 ? -19.913 -23.258 14.754 1.00 64.95  ? 767  VAL A O   1 
ATOM   1753 C CB  . VAL A 1 272 ? -21.356 -25.996 16.122 1.00 66.03  ? 767  VAL A CB  1 
ATOM   1754 C CG1 . VAL A 1 272 ? -19.872 -26.129 16.401 1.00 63.79  ? 767  VAL A CG1 1 
ATOM   1755 C CG2 . VAL A 1 272 ? -22.145 -26.368 17.357 1.00 66.16  ? 767  VAL A CG2 1 
ATOM   1756 N N   . LEU A 1 273 ? -20.910 -24.730 13.319 1.00 66.37  ? 768  LEU A N   1 
ATOM   1757 C CA  . LEU A 1 273 ? -20.074 -24.476 12.137 1.00 66.63  ? 768  LEU A CA  1 
ATOM   1758 C C   . LEU A 1 273 ? -20.079 -23.005 11.772 1.00 70.71  ? 768  LEU A C   1 
ATOM   1759 O O   . LEU A 1 273 ? -19.008 -22.391 11.712 1.00 69.16  ? 768  LEU A O   1 
ATOM   1760 C CB  . LEU A 1 273 ? -20.466 -25.379 10.939 1.00 68.04  ? 768  LEU A CB  1 
ATOM   1761 C CG  . LEU A 1 273 ? -20.329 -26.896 11.157 1.00 70.98  ? 768  LEU A CG  1 
ATOM   1762 C CD1 . LEU A 1 273 ? -20.893 -27.663 10.004 1.00 72.33  ? 768  LEU A CD1 1 
ATOM   1763 C CD2 . LEU A 1 273 ? -18.882 -27.305 11.424 1.00 70.22  ? 768  LEU A CD2 1 
ATOM   1764 N N   . LYS A 1 274 ? -21.287 -22.421 11.657 1.00 68.92  ? 769  LYS A N   1 
ATOM   1765 C CA  . LYS A 1 274 ? -21.481 -20.998 11.372 1.00 69.94  ? 769  LYS A CA  1 
ATOM   1766 C C   . LYS A 1 274 ? -20.787 -20.113 12.430 1.00 75.77  ? 769  LYS A C   1 
ATOM   1767 O O   . LYS A 1 274 ? -20.203 -19.101 12.055 1.00 76.82  ? 769  LYS A O   1 
ATOM   1768 C CB  . LYS A 1 274 ? -22.980 -20.663 11.195 1.00 72.03  ? 769  LYS A CB  1 
ATOM   1769 C CG  . LYS A 1 274 ? -23.546 -21.094 9.824  1.00 68.91  ? 769  LYS A CG  1 
ATOM   1770 C CD  . LYS A 1 274 ? -25.037 -20.803 9.640  1.00 71.14  ? 769  LYS A CD  1 
ATOM   1771 N N   . CYS A 1 275 ? -20.762 -20.552 13.722 1.00 72.55  ? 770  CYS A N   1 
ATOM   1772 C CA  . CYS A 1 275 ? -20.143 -19.857 14.871 1.00 72.23  ? 770  CYS A CA  1 
ATOM   1773 C C   . CYS A 1 275 ? -18.620 -19.923 14.907 1.00 75.85  ? 770  CYS A C   1 
ATOM   1774 O O   . CYS A 1 275 ? -17.967 -18.966 15.339 1.00 75.37  ? 770  CYS A O   1 
ATOM   1775 C CB  . CYS A 1 275 ? -20.731 -20.360 16.181 1.00 72.00  ? 770  CYS A CB  1 
ATOM   1776 S SG  . CYS A 1 275 ? -22.384 -19.734 16.524 1.00 78.28  ? 770  CYS A SG  1 
ATOM   1777 N N   . CYS A 1 276 ? -18.071 -21.085 14.539 1.00 71.58  ? 771  CYS A N   1 
ATOM   1778 C CA  . CYS A 1 276 ? -16.637 -21.335 14.484 1.00 69.84  ? 771  CYS A CA  1 
ATOM   1779 C C   . CYS A 1 276 ? -16.028 -20.643 13.278 1.00 73.59  ? 771  CYS A C   1 
ATOM   1780 O O   . CYS A 1 276 ? -14.981 -20.013 13.404 1.00 73.05  ? 771  CYS A O   1 
ATOM   1781 C CB  . CYS A 1 276 ? -16.360 -22.834 14.449 1.00 69.22  ? 771  CYS A CB  1 
ATOM   1782 S SG  . CYS A 1 276 ? -16.791 -23.702 15.975 1.00 72.19  ? 771  CYS A SG  1 
ATOM   1783 N N   . LEU A 1 277 ? -16.676 -20.764 12.108 1.00 70.34  ? 772  LEU A N   1 
ATOM   1784 C CA  . LEU A 1 277 ? -16.144 -20.239 10.861 1.00 70.89  ? 772  LEU A CA  1 
ATOM   1785 C C   . LEU A 1 277 ? -16.459 -18.784 10.541 1.00 77.78  ? 772  LEU A C   1 
ATOM   1786 O O   . LEU A 1 277 ? -16.874 -18.474 9.427  1.00 80.78  ? 772  LEU A O   1 
ATOM   1787 C CB  . LEU A 1 277 ? -16.447 -21.206 9.709  1.00 71.34  ? 772  LEU A CB  1 
ATOM   1788 C CG  . LEU A 1 277 ? -15.956 -22.641 9.926  1.00 73.21  ? 772  LEU A CG  1 
ATOM   1789 C CD1 . LEU A 1 277 ? -16.728 -23.591 9.086  1.00 74.07  ? 772  LEU A CD1 1 
ATOM   1790 C CD2 . LEU A 1 277 ? -14.478 -22.775 9.629  1.00 74.36  ? 772  LEU A CD2 1 
ATOM   1791 N N   . LYS A 1 278 ? -16.230 -17.884 11.517 1.00 74.00  ? 773  LYS A N   1 
ATOM   1792 C CA  . LYS A 1 278 ? -16.426 -16.430 11.402 1.00 75.50  ? 773  LYS A CA  1 
ATOM   1793 C C   . LYS A 1 278 ? -15.050 -15.781 11.310 1.00 81.98  ? 773  LYS A C   1 
ATOM   1794 O O   . LYS A 1 278 ? -14.271 -15.877 12.262 1.00 80.68  ? 773  LYS A O   1 
ATOM   1795 C CB  . LYS A 1 278 ? -17.224 -15.884 12.602 1.00 76.20  ? 773  LYS A CB  1 
ATOM   1796 C CG  . LYS A 1 278 ? -18.692 -15.635 12.285 1.00 80.95  ? 773  LYS A CG  1 
ATOM   1797 C CD  . LYS A 1 278 ? -19.549 -15.687 13.530 1.00 87.39  ? 773  LYS A CD  1 
ATOM   1798 N N   . ARG A 1 279 ? -14.733 -15.172 10.139 1.00 82.18  ? 774  ARG A N   1 
ATOM   1799 C CA  . ARG A 1 279 ? -13.450 -14.515 9.792  1.00 83.27  ? 774  ARG A CA  1 
ATOM   1800 C C   . ARG A 1 279 ? -12.846 -13.594 10.866 1.00 86.52  ? 774  ARG A C   1 
ATOM   1801 O O   . ARG A 1 279 ? -11.626 -13.532 10.992 1.00 85.85  ? 774  ARG A O   1 
ATOM   1802 C CB  . ARG A 1 279 ? -13.557 -13.762 8.449  1.00 86.20  ? 774  ARG A CB  1 
ATOM   1803 C CG  . ARG A 1 279 ? -13.139 -14.584 7.240  1.00 92.87  ? 774  ARG A CG  1 
ATOM   1804 C CD  . ARG A 1 279 ? -14.233 -14.668 6.195  1.00 97.00  ? 774  ARG A CD  1 
ATOM   1805 N NE  . ARG A 1 279 ? -13.912 -15.649 5.157  1.00 94.19  ? 774  ARG A NE  1 
ATOM   1806 C CZ  . ARG A 1 279 ? -14.726 -15.981 4.160  1.00 107.79 ? 774  ARG A CZ  1 
ATOM   1807 N NH1 . ARG A 1 279 ? -15.910 -15.391 4.034  1.00 93.73  ? 774  ARG A NH1 1 
ATOM   1808 N NH2 . ARG A 1 279 ? -14.349 -16.879 3.257  1.00 93.34  ? 774  ARG A NH2 1 
ATOM   1809 N N   . ASP A 1 280 ? -13.691 -12.862 11.607 1.00 83.09  ? 775  ASP A N   1 
ATOM   1810 C CA  . ASP A 1 280 ? -13.244 -11.967 12.671 1.00 82.08  ? 775  ASP A CA  1 
ATOM   1811 C C   . ASP A 1 280 ? -13.118 -12.740 13.981 1.00 79.16  ? 775  ASP A C   1 
ATOM   1812 O O   . ASP A 1 280 ? -14.138 -13.162 14.548 1.00 75.93  ? 775  ASP A O   1 
ATOM   1813 C CB  . ASP A 1 280 ? -14.209 -10.779 12.836 1.00 86.69  ? 775  ASP A CB  1 
ATOM   1814 C CG  . ASP A 1 280 ? -13.782 -9.732  13.859 1.00 96.06  ? 775  ASP A CG  1 
ATOM   1815 O OD1 . ASP A 1 280 ? -12.547 -9.633  14.147 1.00 92.32  ? 775  ASP A OD1 1 
ATOM   1816 O OD2 . ASP A 1 280 ? -14.671 -8.970  14.332 1.00 105.59 ? 775  ASP A OD2 1 
ATOM   1817 N N   . PRO A 1 281 ? -11.874 -12.900 14.496 1.00 74.01  ? 776  PRO A N   1 
ATOM   1818 C CA  . PRO A 1 281 ? -11.690 -13.614 15.780 1.00 71.12  ? 776  PRO A CA  1 
ATOM   1819 C C   . PRO A 1 281 ? -12.569 -13.042 16.893 1.00 76.48  ? 776  PRO A C   1 
ATOM   1820 O O   . PRO A 1 281 ? -13.055 -13.802 17.731 1.00 75.60  ? 776  PRO A O   1 
ATOM   1821 C CB  . PRO A 1 281 ? -10.212 -13.407 16.095 1.00 72.28  ? 776  PRO A CB  1 
ATOM   1822 C CG  . PRO A 1 281 ? -9.583  -13.089 14.808 1.00 78.16  ? 776  PRO A CG  1 
ATOM   1823 C CD  . PRO A 1 281 ? -10.587 -12.423 13.951 1.00 76.13  ? 776  PRO A CD  1 
ATOM   1824 N N   . LYS A 1 282 ? -12.802 -11.704 16.862 1.00 74.36  ? 777  LYS A N   1 
ATOM   1825 C CA  . LYS A 1 282 ? -13.627 -10.956 17.804 1.00 74.89  ? 777  LYS A CA  1 
ATOM   1826 C C   . LYS A 1 282 ? -15.087 -11.428 17.786 1.00 77.87  ? 777  LYS A C   1 
ATOM   1827 O O   . LYS A 1 282 ? -15.733 -11.419 18.834 1.00 77.25  ? 777  LYS A O   1 
ATOM   1828 C CB  . LYS A 1 282 ? -13.564 -9.452  17.501 1.00 80.80  ? 777  LYS A CB  1 
ATOM   1829 C CG  . LYS A 1 282 ? -12.201 -8.802  17.728 1.00 98.10  ? 777  LYS A CG  1 
ATOM   1830 C CD  . LYS A 1 282 ? -12.206 -7.321  17.330 1.00 109.00 ? 777  LYS A CD  1 
ATOM   1831 N N   . GLN A 1 283 ? -15.586 -11.856 16.603 1.00 73.87  ? 778  GLN A N   1 
ATOM   1832 C CA  . GLN A 1 283 ? -16.958 -12.326 16.343 1.00 73.07  ? 778  GLN A CA  1 
ATOM   1833 C C   . GLN A 1 283 ? -17.113 -13.862 16.476 1.00 73.28  ? 778  GLN A C   1 
ATOM   1834 O O   . GLN A 1 283 ? -18.226 -14.396 16.379 1.00 72.54  ? 778  GLN A O   1 
ATOM   1835 C CB  . GLN A 1 283 ? -17.375 -11.881 14.930 1.00 76.49  ? 778  GLN A CB  1 
ATOM   1836 C CG  . GLN A 1 283 ? -17.923 -10.459 14.856 1.00 96.10  ? 778  GLN A CG  1 
ATOM   1837 C CD  . GLN A 1 283 ? -19.344 -10.401 15.360 1.00 121.12 ? 778  GLN A CD  1 
ATOM   1838 O OE1 . GLN A 1 283 ? -20.281 -10.997 14.779 1.00 116.00 ? 778  GLN A OE1 1 
ATOM   1839 N NE2 . GLN A 1 283 ? -19.523 -9.712  16.482 1.00 114.69 ? 778  GLN A NE2 1 
ATOM   1840 N N   . ARG A 1 284 ? -15.994 -14.565 16.682 1.00 67.11  ? 779  ARG A N   1 
ATOM   1841 C CA  . ARG A 1 284 ? -15.960 -16.021 16.797 1.00 64.18  ? 779  ARG A CA  1 
ATOM   1842 C C   . ARG A 1 284 ? -16.282 -16.513 18.214 1.00 66.19  ? 779  ARG A C   1 
ATOM   1843 O O   . ARG A 1 284 ? -15.854 -15.913 19.200 1.00 66.62  ? 779  ARG A O   1 
ATOM   1844 C CB  . ARG A 1 284 ? -14.578 -16.518 16.384 1.00 60.98  ? 779  ARG A CB  1 
ATOM   1845 C CG  . ARG A 1 284 ? -14.535 -17.942 15.902 1.00 64.12  ? 779  ARG A CG  1 
ATOM   1846 C CD  . ARG A 1 284 ? -13.149 -18.279 15.392 1.00 72.24  ? 779  ARG A CD  1 
ATOM   1847 N NE  . ARG A 1 284 ? -12.820 -17.563 14.155 1.00 74.20  ? 779  ARG A NE  1 
ATOM   1848 C CZ  . ARG A 1 284 ? -11.583 -17.260 13.783 1.00 83.16  ? 779  ARG A CZ  1 
ATOM   1849 N NH1 . ARG A 1 284 ? -10.551 -17.617 14.535 1.00 60.74  ? 779  ARG A NH1 1 
ATOM   1850 N NH2 . ARG A 1 284 ? -11.368 -16.590 12.661 1.00 77.13  ? 779  ARG A NH2 1 
ATOM   1851 N N   . ILE A 1 285 ? -16.995 -17.642 18.299 1.00 59.94  ? 780  ILE A N   1 
ATOM   1852 C CA  . ILE A 1 285 ? -17.364 -18.309 19.553 1.00 57.89  ? 780  ILE A CA  1 
ATOM   1853 C C   . ILE A 1 285 ? -16.079 -18.820 20.303 1.00 61.25  ? 780  ILE A C   1 
ATOM   1854 O O   . ILE A 1 285 ? -15.089 -19.191 19.663 1.00 60.04  ? 780  ILE A O   1 
ATOM   1855 C CB  . ILE A 1 285 ? -18.410 -19.425 19.238 1.00 59.57  ? 780  ILE A CB  1 
ATOM   1856 C CG1 . ILE A 1 285 ? -19.078 -19.985 20.497 1.00 57.82  ? 780  ILE A CG1 1 
ATOM   1857 C CG2 . ILE A 1 285 ? -17.817 -20.534 18.341 1.00 61.92  ? 780  ILE A CG2 1 
ATOM   1858 C CD1 . ILE A 1 285 ? -20.285 -20.899 20.203 1.00 60.07  ? 780  ILE A CD1 1 
ATOM   1859 N N   . SER A 1 286 ? -16.091 -18.787 21.648 1.00 56.50  ? 781  SER A N   1 
ATOM   1860 C CA  . SER A 1 286 ? -14.975 -19.261 22.457 1.00 53.73  ? 781  SER A CA  1 
ATOM   1861 C C   . SER A 1 286 ? -15.148 -20.756 22.854 1.00 59.20  ? 781  SER A C   1 
ATOM   1862 O O   . SER A 1 286 ? -16.264 -21.286 22.766 1.00 59.98  ? 781  SER A O   1 
ATOM   1863 C CB  . SER A 1 286 ? -14.817 -18.378 23.687 1.00 55.24  ? 781  SER A CB  1 
ATOM   1864 O OG  . SER A 1 286 ? -15.801 -18.606 24.681 1.00 60.86  ? 781  SER A OG  1 
ATOM   1865 N N   . ILE A 1 287 ? -14.042 -21.444 23.269 1.00 54.48  ? 782  ILE A N   1 
ATOM   1866 C CA  . ILE A 1 287 ? -14.152 -22.839 23.715 1.00 52.33  ? 782  ILE A CA  1 
ATOM   1867 C C   . ILE A 1 287 ? -15.095 -22.993 24.921 1.00 56.37  ? 782  ILE A C   1 
ATOM   1868 O O   . ILE A 1 287 ? -15.967 -23.857 24.832 1.00 55.42  ? 782  ILE A O   1 
ATOM   1869 C CB  . ILE A 1 287 ? -12.809 -23.590 23.849 1.00 53.24  ? 782  ILE A CB  1 
ATOM   1870 C CG1 . ILE A 1 287 ? -12.327 -23.992 22.463 1.00 51.85  ? 782  ILE A CG1 1 
ATOM   1871 C CG2 . ILE A 1 287 ? -12.956 -24.837 24.724 1.00 52.91  ? 782  ILE A CG2 1 
ATOM   1872 C CD1 . ILE A 1 287 ? -10.973 -24.132 22.390 1.00 55.06  ? 782  ILE A CD1 1 
ATOM   1873 N N   . PRO A 1 288 ? -15.036 -22.136 25.996 1.00 53.92  ? 783  PRO A N   1 
ATOM   1874 C CA  . PRO A 1 288 ? -16.013 -22.290 27.091 1.00 54.77  ? 783  PRO A CA  1 
ATOM   1875 C C   . PRO A 1 288 ? -17.455 -22.142 26.598 1.00 59.92  ? 783  PRO A C   1 
ATOM   1876 O O   . PRO A 1 288 ? -18.341 -22.827 27.118 1.00 60.31  ? 783  PRO A O   1 
ATOM   1877 C CB  . PRO A 1 288 ? -15.608 -21.200 28.103 1.00 56.96  ? 783  PRO A CB  1 
ATOM   1878 C CG  . PRO A 1 288 ? -14.205 -20.871 27.780 1.00 59.26  ? 783  PRO A CG  1 
ATOM   1879 C CD  . PRO A 1 288 ? -14.087 -21.037 26.295 1.00 54.24  ? 783  PRO A CD  1 
ATOM   1880 N N   . GLU A 1 289 ? -17.673 -21.303 25.550 1.00 56.17  ? 784  GLU A N   1 
ATOM   1881 C CA  . GLU A 1 289 ? -18.996 -21.086 24.942 1.00 56.22  ? 784  GLU A CA  1 
ATOM   1882 C C   . GLU A 1 289 ? -19.420 -22.280 24.125 1.00 60.06  ? 784  GLU A C   1 
ATOM   1883 O O   . GLU A 1 289 ? -20.599 -22.642 24.161 1.00 61.46  ? 784  GLU A O   1 
ATOM   1884 C CB  . GLU A 1 289 ? -19.063 -19.787 24.131 1.00 57.49  ? 784  GLU A CB  1 
ATOM   1885 C CG  . GLU A 1 289 ? -19.196 -18.565 25.025 1.00 67.43  ? 784  GLU A CG  1 
ATOM   1886 C CD  . GLU A 1 289 ? -19.070 -17.184 24.398 1.00 93.09  ? 784  GLU A CD  1 
ATOM   1887 O OE1 . GLU A 1 289 ? -18.863 -17.081 23.165 1.00 76.82  ? 784  GLU A OE1 1 
ATOM   1888 O OE2 . GLU A 1 289 ? -19.147 -16.196 25.164 1.00 93.86  ? 784  GLU A OE2 1 
ATOM   1889 N N   . LEU A 1 290 ? -18.462 -22.934 23.430 1.00 55.46  ? 785  LEU A N   1 
ATOM   1890 C CA  . LEU A 1 290 ? -18.762 -24.143 22.647 1.00 55.03  ? 785  LEU A CA  1 
ATOM   1891 C C   . LEU A 1 290 ? -19.159 -25.315 23.554 1.00 63.39  ? 785  LEU A C   1 
ATOM   1892 O O   . LEU A 1 290 ? -20.037 -26.118 23.192 1.00 66.11  ? 785  LEU A O   1 
ATOM   1893 C CB  . LEU A 1 290 ? -17.617 -24.555 21.713 1.00 52.55  ? 785  LEU A CB  1 
ATOM   1894 C CG  . LEU A 1 290 ? -17.457 -23.750 20.419 1.00 56.64  ? 785  LEU A CG  1 
ATOM   1895 C CD1 . LEU A 1 290 ? -16.049 -23.934 19.838 1.00 56.05  ? 785  LEU A CD1 1 
ATOM   1896 C CD2 . LEU A 1 290 ? -18.513 -24.127 19.373 1.00 55.74  ? 785  LEU A CD2 1 
ATOM   1897 N N   . LEU A 1 291 ? -18.551 -25.381 24.758 1.00 58.72  ? 786  LEU A N   1 
ATOM   1898 C CA  . LEU A 1 291 ? -18.818 -26.451 25.711 1.00 58.34  ? 786  LEU A CA  1 
ATOM   1899 C C   . LEU A 1 291 ? -20.177 -26.331 26.346 1.00 64.36  ? 786  LEU A C   1 
ATOM   1900 O O   . LEU A 1 291 ? -20.630 -27.286 26.967 1.00 66.43  ? 786  LEU A O   1 
ATOM   1901 C CB  . LEU A 1 291 ? -17.708 -26.546 26.765 1.00 57.53  ? 786  LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 291 ? -16.381 -27.152 26.289 1.00 59.54  ? 786  LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 291 ? -15.219 -26.599 27.069 1.00 58.50  ? 786  LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 291 ? -16.402 -28.664 26.383 1.00 61.64  ? 786  LEU A CD2 1 
ATOM   1905 N N   . ALA A 1 292 ? -20.857 -25.187 26.153 1.00 61.09  ? 787  ALA A N   1 
ATOM   1906 C CA  . ALA A 1 292 ? -22.201 -24.939 26.692 1.00 62.43  ? 787  ALA A CA  1 
ATOM   1907 C C   . ALA A 1 292 ? -23.265 -24.866 25.582 1.00 67.77  ? 787  ALA A C   1 
ATOM   1908 O O   . ALA A 1 292 ? -24.449 -24.690 25.894 1.00 69.47  ? 787  ALA A O   1 
ATOM   1909 C CB  . ALA A 1 292 ? -22.210 -23.663 27.522 1.00 63.37  ? 787  ALA A CB  1 
ATOM   1910 N N   . HIS A 1 293 ? -22.842 -24.994 24.295 1.00 62.78  ? 788  HIS A N   1 
ATOM   1911 C CA  . HIS A 1 293 ? -23.728 -24.952 23.128 1.00 63.85  ? 788  HIS A CA  1 
ATOM   1912 C C   . HIS A 1 293 ? -24.704 -26.127 23.146 1.00 67.67  ? 788  HIS A C   1 
ATOM   1913 O O   . HIS A 1 293 ? -24.296 -27.206 23.559 1.00 65.86  ? 788  HIS A O   1 
ATOM   1914 C CB  . HIS A 1 293 ? -22.899 -24.984 21.830 1.00 64.39  ? 788  HIS A CB  1 
ATOM   1915 C CG  . HIS A 1 293 ? -23.693 -24.741 20.583 1.00 70.24  ? 788  HIS A CG  1 
ATOM   1916 N ND1 . HIS A 1 293 ? -24.469 -25.740 20.010 1.00 74.02  ? 788  HIS A ND1 1 
ATOM   1917 C CD2 . HIS A 1 293 ? -23.826 -23.612 19.847 1.00 73.77  ? 788  HIS A CD2 1 
ATOM   1918 C CE1 . HIS A 1 293 ? -25.070 -25.180 18.967 1.00 75.17  ? 788  HIS A CE1 1 
ATOM   1919 N NE2 . HIS A 1 293 ? -24.709 -23.901 18.823 1.00 75.23  ? 788  HIS A NE2 1 
ATOM   1920 N N   . PRO A 1 294 ? -25.980 -25.957 22.688 1.00 67.98  ? 789  PRO A N   1 
ATOM   1921 C CA  . PRO A 1 294 ? -26.928 -27.098 22.654 1.00 69.55  ? 789  PRO A CA  1 
ATOM   1922 C C   . PRO A 1 294 ? -26.441 -28.378 21.942 1.00 73.53  ? 789  PRO A C   1 
ATOM   1923 O O   . PRO A 1 294 ? -26.852 -29.476 22.319 1.00 74.26  ? 789  PRO A O   1 
ATOM   1924 C CB  . PRO A 1 294 ? -28.132 -26.519 21.901 1.00 72.90  ? 789  PRO A CB  1 
ATOM   1925 C CG  . PRO A 1 294 ? -28.091 -25.058 22.195 1.00 77.53  ? 789  PRO A CG  1 
ATOM   1926 C CD  . PRO A 1 294 ? -26.638 -24.714 22.216 1.00 70.93  ? 789  PRO A CD  1 
ATOM   1927 N N   . TYR A 1 295 ? -25.580 -28.242 20.906 1.00 67.92  ? 790  TYR A N   1 
ATOM   1928 C CA  . TYR A 1 295 ? -25.074 -29.386 20.155 1.00 67.08  ? 790  TYR A CA  1 
ATOM   1929 C C   . TYR A 1 295 ? -24.333 -30.393 21.044 1.00 71.34  ? 790  TYR A C   1 
ATOM   1930 O O   . TYR A 1 295 ? -24.485 -31.596 20.869 1.00 71.48  ? 790  TYR A O   1 
ATOM   1931 C CB  . TYR A 1 295 ? -24.193 -28.920 18.982 1.00 66.45  ? 790  TYR A CB  1 
ATOM   1932 C CG  . TYR A 1 295 ? -23.521 -30.044 18.217 1.00 66.69  ? 790  TYR A CG  1 
ATOM   1933 C CD1 . TYR A 1 295 ? -24.253 -30.874 17.371 1.00 70.24  ? 790  TYR A CD1 1 
ATOM   1934 C CD2 . TYR A 1 295 ? -22.149 -30.260 18.315 1.00 64.53  ? 790  TYR A CD2 1 
ATOM   1935 C CE1 . TYR A 1 295 ? -23.643 -31.915 16.671 1.00 70.46  ? 790  TYR A CE1 1 
ATOM   1936 C CE2 . TYR A 1 295 ? -21.530 -31.308 17.629 1.00 64.34  ? 790  TYR A CE2 1 
ATOM   1937 C CZ  . TYR A 1 295 ? -22.281 -32.126 16.801 1.00 71.40  ? 790  TYR A CZ  1 
ATOM   1938 O OH  . TYR A 1 295 ? -21.699 -33.171 16.130 1.00 72.90  ? 790  TYR A OH  1 
ATOM   1939 N N   . VAL A 1 296 ? -23.554 -29.889 21.995 1.00 67.20  ? 791  VAL A N   1 
ATOM   1940 C CA  . VAL A 1 296 ? -22.720 -30.653 22.921 1.00 66.15  ? 791  VAL A CA  1 
ATOM   1941 C C   . VAL A 1 296 ? -23.528 -31.163 24.139 1.00 70.41  ? 791  VAL A C   1 
ATOM   1942 O O   . VAL A 1 296 ? -23.192 -32.211 24.701 1.00 70.05  ? 791  VAL A O   1 
ATOM   1943 C CB  . VAL A 1 296 ? -21.540 -29.715 23.324 1.00 68.77  ? 791  VAL A CB  1 
ATOM   1944 C CG1 . VAL A 1 296 ? -20.879 -30.111 24.636 1.00 68.56  ? 791  VAL A CG1 1 
ATOM   1945 C CG2 . VAL A 1 296 ? -20.513 -29.619 22.207 1.00 67.18  ? 791  VAL A CG2 1 
ATOM   1946 N N   . GLN A 1 297 ? -24.596 -30.420 24.520 1.00 66.84  ? 792  GLN A N   1 
ATOM   1947 C CA  . GLN A 1 297 ? -25.379 -30.615 25.740 1.00 67.49  ? 792  GLN A CA  1 
ATOM   1948 C C   . GLN A 1 297 ? -26.726 -31.301 25.640 1.00 72.29  ? 792  GLN A C   1 
ATOM   1949 O O   . GLN A 1 297 ? -27.091 -32.035 26.559 1.00 74.22  ? 792  GLN A O   1 
ATOM   1950 C CB  . GLN A 1 297 ? -25.536 -29.276 26.486 1.00 68.53  ? 792  GLN A CB  1 
ATOM   1951 C CG  . GLN A 1 297 ? -24.239 -28.650 26.997 1.00 66.47  ? 792  GLN A CG  1 
ATOM   1952 C CD  . GLN A 1 297 ? -23.540 -29.453 28.069 1.00 70.53  ? 792  GLN A CD  1 
ATOM   1953 O OE1 . GLN A 1 297 ? -24.147 -30.214 28.825 1.00 70.74  ? 792  GLN A OE1 1 
ATOM   1954 N NE2 . GLN A 1 297 ? -22.238 -29.284 28.173 1.00 47.36  ? 792  GLN A NE2 1 
ATOM   1955 N N   . ILE A 1 298 ? -27.499 -31.000 24.594 1.00 67.70  ? 793  ILE A N   1 
ATOM   1956 C CA  . ILE A 1 298 ? -28.833 -31.566 24.379 1.00 69.44  ? 793  ILE A CA  1 
ATOM   1957 C C   . ILE A 1 298 ? -28.734 -33.006 23.849 1.00 74.83  ? 793  ILE A C   1 
ATOM   1958 O O   . ILE A 1 298 ? -27.927 -33.282 22.947 1.00 71.34  ? 793  ILE A O   1 
ATOM   1959 C CB  . ILE A 1 298 ? -29.706 -30.666 23.431 1.00 72.21  ? 793  ILE A CB  1 
ATOM   1960 C CG1 . ILE A 1 298 ? -29.709 -29.143 23.803 1.00 70.29  ? 793  ILE A CG1 1 
ATOM   1961 C CG2 . ILE A 1 298 ? -31.122 -31.234 23.203 1.00 75.50  ? 793  ILE A CG2 1 
ATOM   1962 C CD1 . ILE A 1 298 ? -30.363 -28.677 25.111 1.00 68.49  ? 793  ILE A CD1 1 
ATOM   1963 N N   . GLN A 1 299 ? -29.610 -33.901 24.395 1.00 76.47  ? 794  GLN A N   1 
ATOM   1964 C CA  . GLN A 1 299 ? -29.778 -35.317 24.029 1.00 107.03 ? 794  GLN A CA  1 
ATOM   1965 C C   . GLN A 1 299 ? -30.922 -35.504 23.015 1.00 131.97 ? 794  GLN A C   1 
ATOM   1966 O O   . GLN A 1 299 ? -30.729 -35.348 21.806 1.00 94.18  ? 794  GLN A O   1 
ATOM   1967 C CB  . GLN A 1 299 ? -30.049 -36.167 25.280 1.00 110.65 ? 794  GLN A CB  1 
ATOM   1968 C CG  . GLN A 1 299 ? -28.778 -36.531 26.050 1.00 123.86 ? 794  GLN A CG  1 
ATOM   1969 C CD  . GLN A 1 299 ? -28.604 -35.766 27.343 1.00 137.85 ? 794  GLN A CD  1 
ATOM   1970 O OE1 . GLN A 1 299 ? -28.985 -34.594 27.474 1.00 129.11 ? 794  GLN A OE1 1 
ATOM   1971 N NE2 . GLN A 1 299 ? -27.986 -36.412 28.322 1.00 130.34 ? 794  GLN A NE2 1 
HETATM 1972 O O19 . 7PE B 2 .   ? 8.021   -35.190 15.535 1.00 85.03  ? 1795 7PE A O19 1 
HETATM 1973 C C18 . 7PE B 2 .   ? 8.949   -34.126 15.828 1.00 81.93  ? 1795 7PE A C18 1 
HETATM 1974 C C17 . 7PE B 2 .   ? 9.857   -34.503 17.008 1.00 76.46  ? 1795 7PE A C17 1 
HETATM 1975 O O16 . 7PE B 2 .   ? 9.494   -33.720 18.157 1.00 71.49  ? 1795 7PE A O16 1 
HETATM 1976 C C15 . 7PE B 2 .   ? 10.094  -34.281 19.322 1.00 69.57  ? 1795 7PE A C15 1 
HETATM 1977 C C14 . 7PE B 2 .   ? 9.489   -33.637 20.551 1.00 69.97  ? 1795 7PE A C14 1 
HETATM 1978 O O13 . 7PE B 2 .   ? 8.433   -34.467 21.086 1.00 70.90  ? 1795 7PE A O13 1 
HETATM 1979 C C12 . 7PE B 2 .   ? 7.128   -33.866 20.932 1.00 69.80  ? 1795 7PE A C12 1 
HETATM 1980 C C11 . 7PE B 2 .   ? 6.054   -34.622 21.699 1.00 69.39  ? 1795 7PE A C11 1 
HETATM 1981 O O10 . 7PE B 2 .   ? 5.682   -35.855 21.090 1.00 70.23  ? 1795 7PE A O10 1 
HETATM 1982 C C9  . 7PE B 2 .   ? 4.241   -35.894 20.993 1.00 70.37  ? 1795 7PE A C9  1 
HETATM 1983 C C8  . 7PE B 2 .   ? 3.769   -36.896 19.945 1.00 70.36  ? 1795 7PE A C8  1 
HETATM 1984 O O7  . 7PE B 2 .   ? 3.855   -36.386 18.601 1.00 72.72  ? 1795 7PE A O7  1 
HETATM 1985 C C6  . 7PE B 2 .   ? 4.129   -37.503 17.731 1.00 75.52  ? 1795 7PE A C6  1 
HETATM 1986 C C5  . 7PE B 2 .   ? 4.534   -37.090 16.308 1.00 78.69  ? 1795 7PE A C5  1 
HETATM 1987 O O4  . 7PE B 2 .   ? 5.560   -37.964 15.794 1.00 79.65  ? 1795 7PE A O4  1 
HETATM 1988 O O19 . 7PE C 2 .   ? -25.118 -34.802 26.510 1.00 77.74  ? 1796 7PE A O19 1 
HETATM 1989 C C18 . 7PE C 2 .   ? -24.885 -34.817 25.082 1.00 80.95  ? 1796 7PE A C18 1 
HETATM 1990 C C17 . 7PE C 2 .   ? -25.439 -36.027 24.314 1.00 83.73  ? 1796 7PE A C17 1 
HETATM 1991 O O16 . 7PE C 2 .   ? -24.935 -36.087 22.940 1.00 84.65  ? 1796 7PE A O16 1 
HETATM 1992 C C15 . 7PE C 2 .   ? -24.604 -37.477 22.509 1.00 84.20  ? 1796 7PE A C15 1 
HETATM 1993 C C14 . 7PE C 2 .   ? -23.130 -37.834 22.099 1.00 81.90  ? 1796 7PE A C14 1 
HETATM 1994 O O13 . 7PE C 2 .   ? -22.430 -38.158 23.318 1.00 81.83  ? 1796 7PE A O13 1 
HETATM 1995 C C12 . 7PE C 2 .   ? -21.169 -38.803 23.130 1.00 82.07  ? 1796 7PE A C12 1 
HETATM 1996 C C11 . 7PE C 2 .   ? -20.589 -39.457 24.405 1.00 80.83  ? 1796 7PE A C11 1 
HETATM 1997 O O10 . 7PE C 2 .   ? -20.635 -38.563 25.533 1.00 79.64  ? 1796 7PE A O10 1 
HETATM 1998 C CAO . Z0B D 3 .   ? 0.894   -42.218 17.337 1.00 63.00  ? 1797 Z0B A CAO 1 
HETATM 1999 C CAN . Z0B D 3 .   ? 1.066   -42.560 18.716 1.00 62.49  ? 1797 Z0B A CAN 1 
HETATM 2000 C CAH . Z0B D 3 .   ? 1.966   -41.803 19.497 1.00 62.58  ? 1797 Z0B A CAH 1 
HETATM 2001 C CAD . Z0B D 3 .   ? 2.648   -40.778 18.915 1.00 61.95  ? 1797 Z0B A CAD 1 
HETATM 2002 C CAL . Z0B D 3 .   ? 1.673   -41.128 16.882 1.00 60.05  ? 1797 Z0B A CAL 1 
HETATM 2003 C CAC . Z0B D 3 .   ? -1.418  -43.790 14.851 1.00 72.17  ? 1797 Z0B A CAC 1 
HETATM 2004 C CAG . Z0B D 3 .   ? -0.484  -42.862 15.149 1.00 69.79  ? 1797 Z0B A CAG 1 
HETATM 2005 C CAM . Z0B D 3 .   ? -0.034  -42.979 16.539 1.00 67.87  ? 1797 Z0B A CAM 1 
HETATM 2006 C CAJ . Z0B D 3 .   ? -0.693  -44.046 17.256 1.00 70.74  ? 1797 Z0B A CAJ 1 
HETATM 2007 N NAC . Z0B D 3 .   ? -0.535  -44.372 18.546 1.00 69.54  ? 1797 Z0B A NAC 1 
HETATM 2008 S SAK . Z0B D 3 .   ? -1.805  -44.829 16.171 1.00 73.18  ? 1797 Z0B A SAK 1 
HETATM 2009 C CAK . Z0B D 3 .   ? 0.316   -43.645 19.239 1.00 65.33  ? 1797 Z0B A CAK 1 
HETATM 2010 N N   . Z0B D 3 .   ? 2.526   -40.430 17.628 1.00 60.99  ? 1797 Z0B A N   1 
HETATM 2011 C C1  . EDO E 4 .   ? -1.523  -48.274 14.872 1.00 77.78  ? 1798 EDO A C1  1 
HETATM 2012 O O1  . EDO E 4 .   ? -1.306  -48.484 13.486 1.00 76.45  ? 1798 EDO A O1  1 
HETATM 2013 C C2  . EDO E 4 .   ? -1.717  -49.600 15.663 1.00 79.81  ? 1798 EDO A C2  1 
HETATM 2014 O O2  . EDO E 4 .   ? -2.814  -50.378 15.184 1.00 80.74  ? 1798 EDO A O2  1 
HETATM 2015 O O   . HOH F 5 .   ? 9.244   -33.223 31.562 1.00 59.63  ? 2001 HOH A O   1 
HETATM 2016 O O   . HOH F 5 .   ? -6.464  -28.086 33.580 1.00 65.85  ? 2002 HOH A O   1 
HETATM 2017 O O   . HOH F 5 .   ? 12.614  -34.644 32.894 1.00 43.80  ? 2003 HOH A O   1 
HETATM 2018 O O   . HOH F 5 .   ? -23.287 -35.175 14.860 1.00 70.23  ? 2004 HOH A O   1 
HETATM 2019 O O   . HOH F 5 .   ? 1.565   -24.176 20.355 1.00 56.84  ? 2005 HOH A O   1 
HETATM 2020 O O   . HOH F 5 .   ? -16.898 -13.437 8.936  1.00 66.95  ? 2006 HOH A O   1 
HETATM 2021 O O   . HOH F 5 .   ? 5.910   -32.874 16.495 1.00 63.46  ? 2007 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLN A 21  ? 1.1431 1.0659 1.9527 0.2037  -0.2002 -0.4497 516 GLN A N   
2    C CA  . GLN A 21  ? 1.1019 1.0651 1.8568 0.1957  -0.1739 -0.4277 516 GLN A CA  
3    C C   . GLN A 21  ? 1.1374 1.0730 1.8732 0.1723  -0.1669 -0.3736 516 GLN A C   
4    O O   . GLN A 21  ? 1.1545 1.0589 1.8924 0.1548  -0.1699 -0.3528 516 GLN A O   
5    C CB  . GLN A 21  ? 1.1007 1.1046 1.8160 0.1935  -0.1583 -0.4455 516 GLN A CB  
6    N N   . SER A 22  ? 1.0470 0.9966 1.7664 0.1732  -0.1582 -0.3524 517 SER A N   
7    C CA  . SER A 22  ? 1.0177 0.9455 1.7172 0.1560  -0.1537 -0.3053 517 SER A CA  
8    C C   . SER A 22  ? 1.0237 0.9886 1.6799 0.1493  -0.1337 -0.2894 517 SER A C   
9    O O   . SER A 22  ? 1.0239 1.0320 1.6700 0.1579  -0.1222 -0.3117 517 SER A O   
10   C CB  . SER A 22  ? 1.0660 0.9586 1.8004 0.1644  -0.1724 -0.2899 517 SER A CB  
11   O OG  . SER A 22  ? 1.1371 1.0088 1.8501 0.1501  -0.1696 -0.2443 517 SER A OG  
12   N N   . MET A 23  ? 0.9300 0.8788 1.5622 0.1342  -0.1295 -0.2504 518 MET A N   
13   C CA  . MET A 23  ? 0.8777 0.8529 1.4744 0.1264  -0.1151 -0.2326 518 MET A CA  
14   C C   . MET A 23  ? 0.8915 0.8419 1.4712 0.1168  -0.1188 -0.1939 518 MET A C   
15   O O   . MET A 23  ? 0.8974 0.8148 1.4780 0.1085  -0.1237 -0.1734 518 MET A O   
16   C CB  . MET A 23  ? 0.8782 0.8857 1.4426 0.1167  -0.0955 -0.2397 518 MET A CB  
17   C CG  . MET A 23  ? 0.9210 0.9109 1.4686 0.1020  -0.0915 -0.2299 518 MET A CG  
18   S SD  . MET A 23  ? 0.9481 0.9727 1.4511 0.0894  -0.0695 -0.2227 518 MET A SD  
19   C CE  . MET A 23  ? 0.9091 0.9539 1.4120 0.0949  -0.0652 -0.2544 518 MET A CE  
20   N N   . SER A 24  ? 0.8136 0.7828 1.3805 0.1190  -0.1169 -0.1847 519 SER A N   
21   C CA  . SER A 24  ? 0.8104 0.7637 1.3577 0.1146  -0.1222 -0.1528 519 SER A CA  
22   C C   . SER A 24  ? 0.8246 0.7964 1.3324 0.1013  -0.1088 -0.1398 519 SER A C   
23   O O   . SER A 24  ? 0.8117 0.8144 1.3161 0.1019  -0.1028 -0.1502 519 SER A O   
24   C CB  . SER A 24  ? 0.8653 0.8188 1.4338 0.1306  -0.1380 -0.1522 519 SER A CB  
25   O OG  . SER A 24  ? 1.0120 0.9632 1.5557 0.1290  -0.1428 -0.1271 519 SER A OG  
26   N N   . VAL A 25  ? 0.7576 0.7103 1.2399 0.0899  -0.1050 -0.1164 520 VAL A N   
27   C CA  . VAL A 25  ? 0.7420 0.7076 1.1882 0.0796  -0.0953 -0.1041 520 VAL A CA  
28   C C   . VAL A 25  ? 0.8157 0.7656 1.2450 0.0837  -0.1056 -0.0774 520 VAL A C   
29   O O   . VAL A 25  ? 0.8471 0.7708 1.2778 0.0837  -0.1097 -0.0575 520 VAL A O   
30   C CB  . VAL A 25  ? 0.7746 0.7399 1.2010 0.0650  -0.0806 -0.1019 520 VAL A CB  
31   C CG1 . VAL A 25  ? 0.7439 0.7259 1.1386 0.0569  -0.0718 -0.0952 520 VAL A CG1 
32   C CG2 . VAL A 25  ? 0.7670 0.7456 1.2101 0.0648  -0.0737 -0.1277 520 VAL A CG2 
33   N N   . LYS A 26  ? 0.7454 0.7128 1.1612 0.0882  -0.1106 -0.0771 521 LYS A N   
34   C CA  . LYS A 26  ? 0.7502 0.7110 1.1444 0.0959  -0.1224 -0.0563 521 LYS A CA  
35   C C   . LYS A 26  ? 0.8604 0.7945 1.2672 0.1070  -0.1356 -0.0372 521 LYS A C   
36   O O   . LYS A 26  ? 0.8915 0.8079 1.2781 0.1056  -0.1347 -0.0096 521 LYS A O   
37   C CB  . LYS A 26  ? 0.7501 0.7124 1.1033 0.0872  -0.1135 -0.0412 521 LYS A CB  
38   C CG  . LYS A 26  ? 0.7537 0.7408 1.0964 0.0800  -0.1069 -0.0579 521 LYS A CG  
39   C CD  . LYS A 26  ? 0.6910 0.6903 1.0153 0.0884  -0.1198 -0.0569 521 LYS A CD  
40   C CE  . LYS A 26  ? 0.9462 0.9538 1.2404 0.0811  -0.1128 -0.0568 521 LYS A CE  
41   N NZ  . LYS A 26  ? 1.0400 1.0343 1.3029 0.0782  -0.1035 -0.0358 521 LYS A NZ  
42   N N   . GLY A 27  ? 0.8151 0.7473 1.2585 0.1178  -0.1464 -0.0513 522 GLY A N   
43   C CA  . GLY A 27  ? 0.8511 0.7561 1.3147 0.1297  -0.1614 -0.0352 522 GLY A CA  
44   C C   . GLY A 27  ? 0.9376 0.8116 1.4188 0.1230  -0.1574 -0.0232 522 GLY A C   
45   O O   . GLY A 27  ? 0.9802 0.8285 1.4871 0.1324  -0.1708 -0.0104 522 GLY A O   
46   N N   . ARG A 28  ? 0.8577 0.7330 1.3300 0.1068  -0.1408 -0.0271 523 ARG A N   
47   C CA  . ARG A 28  ? 0.8557 0.7037 1.3508 0.0988  -0.1382 -0.0184 523 ARG A CA  
48   C C   . ARG A 28  ? 0.8904 0.7417 1.4208 0.0985  -0.1376 -0.0546 523 ARG A C   
49   O O   . ARG A 28  ? 0.8461 0.7255 1.3660 0.0955  -0.1278 -0.0795 523 ARG A O   
50   C CB  . ARG A 28  ? 0.8349 0.6813 1.3006 0.0830  -0.1227 0.0040  523 ARG A CB  
51   C CG  . ARG A 28  ? 0.9229 0.7643 1.3560 0.0861  -0.1234 0.0429  523 ARG A CG  
52   N N   . ILE A 29  ? 0.9030 0.7265 1.4763 0.1036  -0.1494 -0.0577 524 ILE A N   
53   C CA  . ILE A 29  ? 0.8927 0.7174 1.5029 0.1077  -0.1530 -0.0950 524 ILE A CA  
54   C C   . ILE A 29  ? 0.9304 0.7490 1.5446 0.0924  -0.1437 -0.1007 524 ILE A C   
55   O O   . ILE A 29  ? 0.9350 0.7292 1.5537 0.0810  -0.1425 -0.0725 524 ILE A O   
56   C CB  . ILE A 29  ? 0.9564 0.7548 1.6160 0.1237  -0.1739 -0.1020 524 ILE A CB  
57   N N   . TYR A 30  ? 0.8528 0.6979 1.4645 0.0926  -0.1364 -0.1362 525 TYR A N   
58   C CA  . TYR A 30  ? 0.8260 0.6737 1.4391 0.0813  -0.1291 -0.1496 525 TYR A CA  
59   C C   . TYR A 30  ? 0.8871 0.7419 1.5325 0.0932  -0.1379 -0.1930 525 TYR A C   
60   O O   . TYR A 30  ? 0.8725 0.7567 1.5127 0.1063  -0.1358 -0.2187 525 TYR A O   
61   C CB  . TYR A 30  ? 0.7892 0.6690 1.3553 0.0713  -0.1101 -0.1487 525 TYR A CB  
62   C CG  . TYR A 30  ? 0.7802 0.6558 1.3129 0.0601  -0.1013 -0.1114 525 TYR A CG  
63   C CD1 . TYR A 30  ? 0.7833 0.6458 1.3112 0.0456  -0.0949 -0.0908 525 TYR A CD1 
64   C CD2 . TYR A 30  ? 0.7940 0.6822 1.3007 0.0651  -0.0996 -0.0990 525 TYR A CD2 
65   C CE1 . TYR A 30  ? 0.7897 0.6532 1.2847 0.0380  -0.0858 -0.0587 525 TYR A CE1 
66   C CE2 . TYR A 30  ? 0.8019 0.6893 1.2755 0.0578  -0.0930 -0.0691 525 TYR A CE2 
67   C CZ  . TYR A 30  ? 0.8933 0.7692 1.3593 0.0450  -0.0853 -0.0491 525 TYR A CZ  
68   O OH  . TYR A 30  ? 0.9205 0.7998 1.3524 0.0406  -0.0780 -0.0216 525 TYR A OH  
69   N N   . SER A 31  ? 0.8658 0.6968 1.5463 0.0891  -0.1476 -0.2020 526 SER A N   
70   C CA  . SER A 31  ? 0.8789 0.7145 1.5927 0.1019  -0.1593 -0.2472 526 SER A CA  
71   C C   . SER A 31  ? 0.9216 0.7861 1.6101 0.0956  -0.1481 -0.2679 526 SER A C   
72   O O   . SER A 31  ? 0.9161 0.7717 1.5960 0.0784  -0.1421 -0.2486 526 SER A O   
73   C CB  . SER A 31  ? 0.9469 0.7377 1.7199 0.1011  -0.1799 -0.2471 526 SER A CB  
74   O OG  . SER A 31  ? 1.0610 0.8197 1.8507 0.1009  -0.1873 -0.2110 526 SER A OG  
75   N N   . ILE A 32  ? 0.8667 0.7685 1.5425 0.1104  -0.1446 -0.3052 527 ILE A N   
76   C CA  . ILE A 32  ? 0.8529 0.7856 1.5016 0.1080  -0.1349 -0.3250 527 ILE A CA  
77   C C   . ILE A 32  ? 0.9251 0.8403 1.6120 0.1092  -0.1524 -0.3528 527 ILE A C   
78   O O   . ILE A 32  ? 0.9599 0.8571 1.6917 0.1224  -0.1714 -0.3773 527 ILE A O   
79   C CB  . ILE A 32  ? 0.8828 0.8657 1.5027 0.1242  -0.1231 -0.3509 527 ILE A CB  
80   C CG1 . ILE A 32  ? 0.8667 0.8672 1.4553 0.1198  -0.1065 -0.3227 527 ILE A CG1 
81   C CG2 . ILE A 32  ? 0.8923 0.9073 1.4827 0.1241  -0.1145 -0.3696 527 ILE A CG2 
82   C CD1 . ILE A 32  ? 0.9874 1.0326 1.5669 0.1369  -0.0972 -0.3441 527 ILE A CD1 
83   N N   . LEU A 33  ? 0.8636 0.7831 1.5374 0.0959  -0.1481 -0.3499 528 LEU A N   
84   C CA  . LEU A 33  ? 0.8808 0.7885 1.5922 0.0966  -0.1660 -0.3793 528 LEU A CA  
85   C C   . LEU A 33  ? 0.9574 0.9097 1.6384 0.1102  -0.1631 -0.4178 528 LEU A C   
86   O O   . LEU A 33  ? 1.0012 0.9599 1.7084 0.1274  -0.1806 -0.4624 528 LEU A O   
87   C CB  . LEU A 33  ? 0.8705 0.7521 1.5988 0.0729  -0.1663 -0.3507 528 LEU A CB  
88   C CG  . LEU A 33  ? 0.9256 0.7673 1.6784 0.0575  -0.1657 -0.3054 528 LEU A CG  
89   C CD1 . LEU A 33  ? 0.9165 0.7501 1.6692 0.0347  -0.1572 -0.2747 528 LEU A CD1 
90   C CD2 . LEU A 33  ? 0.9571 0.7605 1.7755 0.0636  -0.1887 -0.3159 528 LEU A CD2 
91   N N   . LYS A 34  ? 0.8743 0.8576 1.5006 0.1037  -0.1421 -0.4005 529 LYS A N   
92   C CA  . LYS A 34  ? 0.8657 0.8943 1.4544 0.1158  -0.1357 -0.4271 529 LYS A CA  
93   C C   . LYS A 34  ? 0.8945 0.9526 1.4269 0.1098  -0.1100 -0.3983 529 LYS A C   
94   O O   . LYS A 34  ? 0.8825 0.9232 1.4056 0.0935  -0.0994 -0.3597 529 LYS A O   
95   C CB  . LYS A 34  ? 0.8988 0.9258 1.5000 0.1116  -0.1489 -0.4465 529 LYS A CB  
96   C CG  . LYS A 34  ? 0.8650 0.8751 1.4611 0.0868  -0.1417 -0.4104 529 LYS A CG  
97   C CD  . LYS A 34  ? 0.8738 0.8830 1.4947 0.0842  -0.1586 -0.4347 529 LYS A CD  
98   C CE  . LYS A 34  ? 0.8062 0.8212 1.4045 0.0665  -0.1475 -0.4079 529 LYS A CE  
99   N N   . GLN A 35  ? 0.8457 0.9487 1.3423 0.1241  -0.1007 -0.4169 530 GLN A N   
100  C CA  . GLN A 35  ? 0.8293 0.9601 1.2784 0.1183  -0.0775 -0.3899 530 GLN A CA  
101  C C   . GLN A 35  ? 0.9164 1.0519 1.3420 0.1082  -0.0753 -0.3814 530 GLN A C   
102  O O   . GLN A 35  ? 0.9455 1.0930 1.3740 0.1179  -0.0877 -0.4111 530 GLN A O   
103  C CB  . GLN A 35  ? 0.8564 1.0362 1.2811 0.1391  -0.0663 -0.4093 530 GLN A CB  
104  C CG  . GLN A 35  ? 1.1860 1.3903 1.5740 0.1314  -0.0418 -0.3762 530 GLN A CG  
105  C CD  . GLN A 35  ? 1.5205 1.7795 1.8759 0.1488  -0.0284 -0.3899 530 GLN A CD  
106  O OE1 . GLN A 35  ? 1.4839 1.7725 1.8408 0.1618  -0.0186 -0.3975 530 GLN A OE1 
107  N NE2 . GLN A 35  ? 1.4481 1.7243 1.7737 0.1501  -0.0270 -0.3919 530 GLN A NE2 
108  N N   . ILE A 36  ? 0.8517 0.9788 1.2561 0.0902  -0.0618 -0.3438 531 ILE A N   
109  C CA  . ILE A 36  ? 0.8457 0.9788 1.2284 0.0816  -0.0593 -0.3344 531 ILE A CA  
110  C C   . ILE A 36  ? 0.9506 1.1257 1.2864 0.0898  -0.0427 -0.3290 531 ILE A C   
111  O O   . ILE A 36  ? 0.9679 1.1712 1.2865 0.1032  -0.0466 -0.3509 531 ILE A O   
112  C CB  . ILE A 36  ? 0.8469 0.9476 1.2368 0.0594  -0.0561 -0.3003 531 ILE A CB  
113  C CG1 . ILE A 36  ? 0.8442 0.9069 1.2824 0.0518  -0.0714 -0.3026 531 ILE A CG1 
114  C CG2 . ILE A 36  ? 0.8308 0.9423 1.1976 0.0527  -0.0524 -0.2916 531 ILE A CG2 
115  C CD1 . ILE A 36  ? 0.8260 0.8594 1.2702 0.0331  -0.0644 -0.2636 531 ILE A CD1 
116  N N   . GLY A 37  ? 0.9091 1.0889 1.2277 0.0828  -0.0256 -0.3004 532 GLY A N   
117  C CA  . GLY A 37  ? 1.1994 1.4151 1.4816 0.0874  -0.0083 -0.2879 532 GLY A CA  
118  C C   . GLY A 37  ? 1.3312 1.5746 1.6130 0.0991  0.0026  -0.2927 532 GLY A C   
119  O O   . GLY A 37  ? 0.8940 1.1668 1.1529 0.1004  0.0196  -0.2761 532 GLY A O   
120  N N   . SER A 41  ? 1.0124 1.4347 1.3120 0.0803  0.1226  -0.1586 536 SER A N   
121  C CA  . SER A 41  ? 0.9852 1.3722 1.3141 0.0636  0.1134  -0.1475 536 SER A CA  
122  C C   . SER A 41  ? 1.0040 1.3422 1.3347 0.0619  0.0903  -0.1645 536 SER A C   
123  O O   . SER A 41  ? 0.9925 1.3153 1.3493 0.0609  0.0808  -0.1713 536 SER A O   
124  C CB  . SER A 41  ? 1.0192 1.3939 1.3470 0.0448  0.1195  -0.1142 536 SER A CB  
125  O OG  . SER A 41  ? 1.1536 1.4978 1.4533 0.0401  0.1104  -0.1101 536 SER A OG  
126  N N   . SER A 42  ? 0.9321 1.2476 1.2369 0.0615  0.0815  -0.1689 537 SER A N   
127  C CA  . SER A 42  ? 0.9009 1.1723 1.2092 0.0581  0.0622  -0.1796 537 SER A CA  
128  C C   . SER A 42  ? 0.9218 1.1892 1.2224 0.0707  0.0513  -0.2068 537 SER A C   
129  O O   . SER A 42  ? 0.9378 1.2230 1.2148 0.0773  0.0547  -0.2124 537 SER A O   
130  C CB  . SER A 42  ? 0.9200 1.1597 1.2170 0.0419  0.0582  -0.1584 537 SER A CB  
131  O OG  . SER A 42  ? 1.0708 1.3261 1.3438 0.0402  0.0679  -0.1457 537 SER A OG  
132  N N   . LYS A 43  ? 0.8235 1.0658 1.1465 0.0741  0.0364  -0.2229 538 LYS A N   
133  C CA  . LYS A 43  ? 0.8087 1.0376 1.1383 0.0839  0.0215  -0.2496 538 LYS A CA  
134  C C   . LYS A 43  ? 0.8149 0.9958 1.1549 0.0709  0.0076  -0.2400 538 LYS A C   
135  O O   . LYS A 43  ? 0.8077 0.9687 1.1586 0.0623  0.0060  -0.2232 538 LYS A O   
136  C CB  . LYS A 43  ? 0.8408 1.0834 1.1957 0.1010  0.0165  -0.2759 538 LYS A CB  
137  N N   . VAL A 44  ? 0.7416 0.9075 1.0787 0.0696  -0.0020 -0.2495 539 VAL A N   
138  C CA  . VAL A 44  ? 0.7175 0.8430 1.0680 0.0575  -0.0130 -0.2391 539 VAL A CA  
139  C C   . VAL A 44  ? 0.7708 0.8808 1.1524 0.0663  -0.0298 -0.2652 539 VAL A C   
140  O O   . VAL A 44  ? 0.7771 0.9062 1.1593 0.0789  -0.0348 -0.2931 539 VAL A O   
141  C CB  . VAL A 44  ? 0.7463 0.8652 1.0767 0.0457  -0.0102 -0.2244 539 VAL A CB  
142  C CG1 . VAL A 44  ? 0.7332 0.8161 1.0795 0.0334  -0.0183 -0.2107 539 VAL A CG1 
143  C CG2 . VAL A 44  ? 0.7281 0.8619 1.0320 0.0392  0.0044  -0.2018 539 VAL A CG2 
144  N N   . PHE A 45  ? 0.7223 0.7986 1.1305 0.0608  -0.0395 -0.2564 540 PHE A N   
145  C CA  . PHE A 45  ? 0.7412 0.7967 1.1873 0.0676  -0.0570 -0.2777 540 PHE A CA  
146  C C   . PHE A 45  ? 0.7739 0.7915 1.2413 0.0533  -0.0654 -0.2597 540 PHE A C   
147  O O   . PHE A 45  ? 0.7652 0.7704 1.2194 0.0407  -0.0578 -0.2287 540 PHE A O   
148  C CB  . PHE A 45  ? 0.7738 0.8251 1.2429 0.0791  -0.0625 -0.2852 540 PHE A CB  
149  C CG  . PHE A 45  ? 0.7982 0.8893 1.2535 0.0933  -0.0524 -0.2998 540 PHE A CG  
150  C CD1 . PHE A 45  ? 0.8584 0.9753 1.3210 0.1121  -0.0566 -0.3363 540 PHE A CD1 
151  C CD2 . PHE A 45  ? 0.8109 0.9160 1.2502 0.0889  -0.0391 -0.2783 540 PHE A CD2 
152  C CE1 . PHE A 45  ? 0.8663 1.0257 1.3174 0.1261  -0.0444 -0.3477 540 PHE A CE1 
153  C CE2 . PHE A 45  ? 0.8448 0.9897 1.2785 0.1007  -0.0282 -0.2892 540 PHE A CE2 
154  C CZ  . PHE A 45  ? 0.8354 1.0085 1.2744 0.1193  -0.0295 -0.3224 540 PHE A CZ  
155  N N   . GLN A 46  ? 0.7203 0.7206 1.2243 0.0562  -0.0815 -0.2797 541 GLN A N   
156  C CA  . GLN A 46  ? 0.7201 0.6846 1.2566 0.0429  -0.0901 -0.2625 541 GLN A CA  
157  C C   . GLN A 46  ? 0.8089 0.7464 1.3801 0.0487  -0.1012 -0.2593 541 GLN A C   
158  O O   . GLN A 46  ? 0.8223 0.7620 1.4171 0.0643  -0.1132 -0.2902 541 GLN A O   
159  C CB  . GLN A 46  ? 0.7446 0.7061 1.3088 0.0418  -0.1032 -0.2869 541 GLN A CB  
160  C CG  . GLN A 46  ? 0.8480 0.7796 1.4442 0.0237  -0.1070 -0.2627 541 GLN A CG  
161  C CD  . GLN A 46  ? 0.9890 0.9125 1.6305 0.0239  -0.1256 -0.2917 541 GLN A CD  
162  O OE1 . GLN A 46  ? 0.9557 0.8779 1.6234 0.0386  -0.1421 -0.3275 541 GLN A OE1 
163  N NE2 . GLN A 46  ? 0.8279 0.7468 1.4833 0.0084  -0.1246 -0.2787 541 GLN A NE2 
164  N N   . VAL A 47  ? 0.7548 0.6697 1.3261 0.0385  -0.0970 -0.2222 542 VAL A N   
165  C CA  . VAL A 47  ? 0.7518 0.6415 1.3504 0.0447  -0.1069 -0.2123 542 VAL A CA  
166  C C   . VAL A 47  ? 0.8011 0.6529 1.4319 0.0324  -0.1129 -0.1803 542 VAL A C   
167  O O   . VAL A 47  ? 0.7928 0.6417 1.4188 0.0172  -0.1052 -0.1602 542 VAL A O   
168  C CB  . VAL A 47  ? 0.7671 0.6721 1.3325 0.0509  -0.0975 -0.1987 542 VAL A CB  
169  C CG1 . VAL A 47  ? 0.7425 0.6859 1.2860 0.0629  -0.0907 -0.2275 542 VAL A CG1 
170  C CG2 . VAL A 47  ? 0.7461 0.6523 1.2759 0.0375  -0.0837 -0.1625 542 VAL A CG2 
171  N N   . LEU A 48  ? 0.7557 0.5804 1.4200 0.0396  -0.1259 -0.1737 543 LEU A N   
172  C CA  . LEU A 48  ? 0.7676 0.5565 1.4624 0.0300  -0.1310 -0.1371 543 LEU A CA  
173  C C   . LEU A 48  ? 0.8094 0.5915 1.4861 0.0377  -0.1302 -0.1102 543 LEU A C   
174  O O   . LEU A 48  ? 0.8075 0.5946 1.4880 0.0540  -0.1387 -0.1308 543 LEU A O   
175  C CB  . LEU A 48  ? 0.8044 0.5611 1.5668 0.0336  -0.1526 -0.1545 543 LEU A CB  
176  C CG  . LEU A 48  ? 0.8582 0.6060 1.6609 0.0222  -0.1596 -0.1695 543 LEU A CG  
177  C CD1 . LEU A 48  ? 0.8674 0.5804 1.7394 0.0282  -0.1835 -0.1862 543 LEU A CD1 
178  C CD2 . LEU A 48  ? 0.9088 0.6503 1.7103 0.0002  -0.1462 -0.1270 543 LEU A CD2 
179  N N   . ASN A 49  ? 0.7664 0.5388 1.4257 0.0281  -0.1214 -0.0654 544 ASN A N   
180  C CA  . ASN A 49  ? 0.7863 0.5521 1.4281 0.0373  -0.1236 -0.0387 544 ASN A CA  
181  C C   . ASN A 49  ? 0.9137 0.6393 1.6061 0.0422  -0.1407 -0.0197 544 ASN A C   
182  O O   . ASN A 49  ? 0.9231 0.6253 1.6688 0.0383  -0.1519 -0.0318 544 ASN A O   
183  C CB  . ASN A 49  ? 0.7831 0.5637 1.3744 0.0297  -0.1070 -0.0032 544 ASN A CB  
184  C CG  . ASN A 49  ? 0.9982 0.7632 1.5986 0.0158  -0.0993 0.0377  544 ASN A CG  
185  O OD1 . ASN A 49  ? 0.9830 0.7241 1.6324 0.0076  -0.1051 0.0437  544 ASN A OD1 
186  N ND2 . ASN A 49  ? 0.8865 0.6670 1.4419 0.0133  -0.0857 0.0668  544 ASN A ND2 
187  N N   . GLU A 50  ? 0.9031 0.6208 1.5804 0.0517  -0.1447 0.0092  545 GLU A N   
188  C CA  . GLU A 50  ? 0.9379 0.6179 1.6568 0.0584  -0.1609 0.0342  545 GLU A CA  
189  C C   . GLU A 50  ? 1.0255 0.6788 1.7756 0.0411  -0.1566 0.0736  545 GLU A C   
190  O O   . GLU A 50  ? 1.0651 0.6821 1.8754 0.0409  -0.1718 0.0800  545 GLU A O   
191  C CB  . GLU A 50  ? 0.9628 0.6469 1.6487 0.0730  -0.1647 0.0585  545 GLU A CB  
192  N N   . LYS A 51  ? 0.9546 0.6273 1.6690 0.0265  -0.1360 0.0977  546 LYS A N   
193  C CA  . LYS A 51  ? 0.9658 0.6243 1.7063 0.0082  -0.1265 0.1355  546 LYS A CA  
194  C C   . LYS A 51  ? 0.9918 0.6477 1.7771 -0.0065 -0.1274 0.1052  546 LYS A C   
195  O O   . LYS A 51  ? 0.9950 0.6483 1.8010 -0.0240 -0.1169 0.1305  546 LYS A O   
196  C CB  . LYS A 51  ? 0.9847 0.6711 1.6656 0.0024  -0.1037 0.1718  546 LYS A CB  
197  N N   . LYS A 52  ? 0.9240 0.5836 1.7248 0.0018  -0.1405 0.0509  547 LYS A N   
198  C CA  . LYS A 52  ? 0.9092 0.5691 1.7493 -0.0062 -0.1467 0.0123  547 LYS A CA  
199  C C   . LYS A 52  ? 0.9631 0.6537 1.7737 -0.0208 -0.1282 0.0098  547 LYS A C   
200  O O   . LYS A 52  ? 0.9599 0.6472 1.8106 -0.0327 -0.1316 -0.0041 547 LYS A O   
201  C CB  . LYS A 52  ? 0.9707 0.5885 1.8950 -0.0127 -0.1652 0.0171  547 LYS A CB  
202  N N   . GLN A 53  ? 0.9256 0.6468 1.6682 -0.0185 -0.1107 0.0201  548 GLN A N   
203  C CA  . GLN A 53  ? 0.9011 0.6534 1.6084 -0.0289 -0.0931 0.0176  548 GLN A CA  
204  C C   . GLN A 53  ? 0.9014 0.6800 1.5807 -0.0203 -0.0945 -0.0298 548 GLN A C   
205  O O   . GLN A 53  ? 0.8799 0.6655 1.5366 -0.0056 -0.0992 -0.0475 548 GLN A O   
206  C CB  . GLN A 53  ? 0.9167 0.6868 1.5684 -0.0302 -0.0742 0.0558  548 GLN A CB  
207  C CG  . GLN A 53  ? 1.1702 0.9241 1.8395 -0.0386 -0.0673 0.1081  548 GLN A CG  
208  C CD  . GLN A 53  ? 1.3823 1.1611 1.9893 -0.0357 -0.0493 0.1376  548 GLN A CD  
209  O OE1 . GLN A 53  ? 1.3161 1.0995 1.8832 -0.0213 -0.0520 0.1421  548 GLN A OE1 
210  N NE2 . GLN A 53  ? 1.1727 0.9707 1.7716 -0.0481 -0.0318 0.1543  548 GLN A NE2 
211  N N   . ILE A 54  ? 0.8322 0.6277 1.5129 -0.0293 -0.0896 -0.0476 549 ILE A N   
212  C CA  . ILE A 54  ? 0.7994 0.6217 1.4549 -0.0221 -0.0900 -0.0885 549 ILE A CA  
213  C C   . ILE A 54  ? 0.8165 0.6688 1.4071 -0.0209 -0.0724 -0.0812 549 ILE A C   
214  O O   . ILE A 54  ? 0.8153 0.6747 1.3860 -0.0306 -0.0588 -0.0533 549 ILE A O   
215  C CB  . ILE A 54  ? 0.8403 0.6640 1.5343 -0.0298 -0.0980 -0.1134 549 ILE A CB  
216  C CG1 . ILE A 54  ? 0.8345 0.6765 1.5216 -0.0159 -0.1082 -0.1631 549 ILE A CG1 
217  C CG2 . ILE A 54  ? 0.8426 0.6821 1.5250 -0.0452 -0.0832 -0.0939 549 ILE A CG2 
218  C CD1 . ILE A 54  ? 0.9063 0.7393 1.6482 -0.0169 -0.1269 -0.1953 549 ILE A CD1 
219  N N   . TYR A 55  ? 0.7415 0.6119 1.3029 -0.0084 -0.0729 -0.1057 550 TYR A N   
220  C CA  . TYR A 55  ? 0.7050 0.6015 1.2131 -0.0068 -0.0591 -0.1017 550 TYR A CA  
221  C C   . TYR A 55  ? 0.7329 0.6542 1.2258 0.0017  -0.0594 -0.1364 550 TYR A C   
222  O O   . TYR A 55  ? 0.7290 0.6495 1.2484 0.0089  -0.0706 -0.1651 550 TYR A O   
223  C CB  . TYR A 55  ? 0.7257 0.6191 1.2117 0.0005  -0.0575 -0.0833 550 TYR A CB  
224  C CG  . TYR A 55  ? 0.7742 0.6505 1.2605 -0.0051 -0.0544 -0.0445 550 TYR A CG  
225  C CD1 . TYR A 55  ? 0.7951 0.6832 1.2496 -0.0124 -0.0407 -0.0218 550 TYR A CD1 
226  C CD2 . TYR A 55  ? 0.8091 0.6590 1.3264 -0.0014 -0.0651 -0.0298 550 TYR A CD2 
227  C CE1 . TYR A 55  ? 0.8382 0.7165 1.2889 -0.0153 -0.0360 0.0148  550 TYR A CE1 
228  C CE2 . TYR A 55  ? 0.8435 0.6806 1.3581 -0.0053 -0.0610 0.0103  550 TYR A CE2 
229  C CZ  . TYR A 55  ? 0.9558 0.8093 1.4352 -0.0120 -0.0456 0.0327  550 TYR A CZ  
230  O OH  . TYR A 55  ? 1.0046 0.8511 1.4774 -0.0138 -0.0396 0.0731  550 TYR A OH  
231  N N   . ALA A 56  ? 0.6776 0.6218 1.1284 0.0019  -0.0474 -0.1333 551 ALA A N   
232  C CA  . ALA A 56  ? 0.6604 0.6316 1.0912 0.0098  -0.0440 -0.1575 551 ALA A CA  
233  C C   . ALA A 56  ? 0.6952 0.6765 1.1060 0.0162  -0.0392 -0.1519 551 ALA A C   
234  O O   . ALA A 56  ? 0.7047 0.6813 1.0979 0.0114  -0.0342 -0.1289 551 ALA A O   
235  C CB  . ALA A 56  ? 0.6573 0.6457 1.0629 0.0030  -0.0346 -0.1555 551 ALA A CB  
236  N N   . ILE A 57  ? 0.6429 0.6395 1.0592 0.0279  -0.0416 -0.1734 552 ILE A N   
237  C CA  . ILE A 57  ? 0.6305 0.6407 1.0340 0.0329  -0.0368 -0.1684 552 ILE A CA  
238  C C   . ILE A 57  ? 0.6640 0.7071 1.0473 0.0356  -0.0258 -0.1794 552 ILE A C   
239  O O   . ILE A 57  ? 0.6722 0.7339 1.0617 0.0450  -0.0260 -0.2026 552 ILE A O   
240  C CB  . ILE A 57  ? 0.6808 0.6832 1.1092 0.0440  -0.0468 -0.1745 552 ILE A CB  
241  C CG1 . ILE A 57  ? 0.7023 0.6727 1.1421 0.0405  -0.0555 -0.1512 552 ILE A CG1 
242  C CG2 . ILE A 57  ? 0.6690 0.6962 1.0877 0.0493  -0.0406 -0.1755 552 ILE A CG2 
243  C CD1 . ILE A 57  ? 0.7211 0.6789 1.1900 0.0532  -0.0688 -0.1559 552 ILE A CD1 
244  N N   . LYS A 58  ? 0.5941 0.6459 0.9546 0.0285  -0.0166 -0.1628 553 LYS A N   
245  C CA  . LYS A 58  ? 0.5766 0.6589 0.9224 0.0302  -0.0054 -0.1677 553 LYS A CA  
246  C C   . LYS A 58  ? 0.6497 0.7481 1.0078 0.0364  -0.0035 -0.1697 553 LYS A C   
247  O O   . LYS A 58  ? 0.6353 0.7232 0.9966 0.0332  -0.0072 -0.1568 553 LYS A O   
248  C CB  . LYS A 58  ? 0.5561 0.6391 0.8779 0.0194  0.0025  -0.1502 553 LYS A CB  
249  C CG  . LYS A 58  ? 0.4861 0.5978 0.7940 0.0204  0.0139  -0.1520 553 LYS A CG  
250  C CD  . LYS A 58  ? 0.6302 0.7385 0.9223 0.0104  0.0193  -0.1329 553 LYS A CD  
251  C CE  . LYS A 58  ? 0.7026 0.8363 0.9832 0.0105  0.0305  -0.1291 553 LYS A CE  
252  N NZ  . LYS A 58  ? 0.8363 0.9612 1.1038 0.0016  0.0329  -0.1127 553 LYS A NZ  
253  N N   . TYR A 59  ? 0.6207 0.7469 0.9869 0.0469  0.0013  -0.1875 554 TYR A N   
254  C CA  . TYR A 59  ? 0.6254 0.7747 1.0071 0.0529  0.0057  -0.1902 554 TYR A CA  
255  C C   . TYR A 59  ? 0.6997 0.8813 1.0681 0.0485  0.0224  -0.1814 554 TYR A C   
256  O O   . TYR A 59  ? 0.7131 0.9120 1.0647 0.0513  0.0304  -0.1866 554 TYR A O   
257  C CB  . TYR A 59  ? 0.6516 0.8141 1.0560 0.0696  0.0009  -0.2155 554 TYR A CB  
258  C CG  . TYR A 59  ? 0.6893 0.8912 1.1074 0.0773  0.0114  -0.2210 554 TYR A CG  
259  C CD1 . TYR A 59  ? 0.7057 0.9083 1.1435 0.0752  0.0087  -0.2116 554 TYR A CD1 
260  C CD2 . TYR A 59  ? 0.7103 0.9528 1.1219 0.0870  0.0248  -0.2345 554 TYR A CD2 
261  C CE1 . TYR A 59  ? 0.6972 0.9392 1.1544 0.0810  0.0190  -0.2160 554 TYR A CE1 
262  C CE2 . TYR A 59  ? 0.7198 1.0038 1.1466 0.0936  0.0377  -0.2365 554 TYR A CE2 
263  C CZ  . TYR A 59  ? 0.7917 1.0750 1.2443 0.0896  0.0350  -0.2270 554 TYR A CZ  
264  O OH  . TYR A 59  ? 0.8359 1.1627 1.3100 0.0950  0.0480  -0.2286 554 TYR A OH  
265  N N   . VAL A 60  ? 0.6486 0.8381 1.0264 0.0419  0.0266  -0.1673 555 VAL A N   
266  C CA  . VAL A 60  ? 0.6332 0.8507 1.0081 0.0354  0.0420  -0.1541 555 VAL A CA  
267  C C   . VAL A 60  ? 0.7020 0.9479 1.1081 0.0392  0.0469  -0.1561 555 VAL A C   
268  O O   . VAL A 60  ? 0.6984 0.9315 1.1244 0.0389  0.0355  -0.1570 555 VAL A O   
269  C CB  . VAL A 60  ? 0.6601 0.8566 1.0228 0.0206  0.0406  -0.1338 555 VAL A CB  
270  C CG1 . VAL A 60  ? 0.6474 0.8687 1.0136 0.0130  0.0552  -0.1176 555 VAL A CG1 
271  C CG2 . VAL A 60  ? 0.6567 0.8282 0.9928 0.0181  0.0357  -0.1329 555 VAL A CG2 
272  N N   . ASN A 61  ? 0.6752 0.9623 1.0858 0.0438  0.0639  -0.1565 556 ASN A N   
273  C CA  . ASN A 61  ? 0.6813 1.0029 1.1255 0.0469  0.0720  -0.1570 556 ASN A CA  
274  C C   . ASN A 61  ? 0.7323 1.0638 1.1904 0.0306  0.0814  -0.1320 556 ASN A C   
275  O O   . ASN A 61  ? 0.7258 1.0702 1.1683 0.0245  0.0954  -0.1158 556 ASN A O   
276  C CB  . ASN A 61  ? 0.7247 1.0912 1.1687 0.0628  0.0868  -0.1716 556 ASN A CB  
277  C CG  . ASN A 61  ? 1.0241 1.4323 1.5059 0.0677  0.0972  -0.1733 556 ASN A CG  
278  O OD1 . ASN A 61  ? 0.9741 1.4182 1.4664 0.0614  0.1164  -0.1554 556 ASN A OD1 
279  N ND2 . ASN A 61  ? 0.9520 1.3561 1.4581 0.0786  0.0846  -0.1930 556 ASN A ND2 
280  N N   . LEU A 62  ? 0.6791 1.0030 1.1686 0.0241  0.0714  -0.1290 557 LEU A N   
281  C CA  . LEU A 62  ? 0.6628 0.9913 1.1760 0.0082  0.0749  -0.1092 557 LEU A CA  
282  C C   . LEU A 62  ? 0.7610 1.1383 1.3148 0.0070  0.0918  -0.1026 557 LEU A C   
283  O O   . LEU A 62  ? 0.7772 1.1616 1.3586 -0.0075 0.0964  -0.0844 557 LEU A O   
284  C CB  . LEU A 62  ? 0.6416 0.9369 1.1680 0.0025  0.0522  -0.1120 557 LEU A CB  
285  C CG  . LEU A 62  ? 0.6741 0.9239 1.1638 0.0033  0.0360  -0.1153 557 LEU A CG  
286  C CD1 . LEU A 62  ? 0.6718 0.8997 1.1740 -0.0006 0.0163  -0.1163 557 LEU A CD1 
287  C CD2 . LEU A 62  ? 0.6446 0.8811 1.1023 -0.0040 0.0438  -0.1031 557 LEU A CD2 
288  N N   . GLU A 63  ? 0.7384 1.1502 1.3001 0.0225  0.1009  -0.1177 558 GLU A N   
289  C CA  . GLU A 63  ? 0.7472 1.2135 1.3501 0.0249  0.1189  -0.1144 558 GLU A CA  
290  C C   . GLU A 63  ? 0.8151 1.3139 1.4325 0.0113  0.1426  -0.0847 558 GLU A C   
291  O O   . GLU A 63  ? 0.8048 1.3265 1.4722 0.0010  0.1477  -0.0732 558 GLU A O   
292  C CB  . GLU A 63  ? 0.7750 1.2739 1.3738 0.0473  0.1262  -0.1380 558 GLU A CB  
293  C CG  . GLU A 63  ? 0.9217 1.3928 1.5251 0.0602  0.1023  -0.1647 558 GLU A CG  
294  C CD  . GLU A 63  ? 1.2402 1.7351 1.8950 0.0659  0.0968  -0.1752 558 GLU A CD  
295  O OE1 . GLU A 63  ? 1.2524 1.7511 1.9422 0.0518  0.0940  -0.1615 558 GLU A OE1 
296  O OE2 . GLU A 63  ? 1.1157 1.6241 1.7784 0.0855  0.0931  -0.1991 558 GLU A OE2 
297  N N   . GLU A 64  ? 0.7955 1.2952 1.3730 0.0108  0.1556  -0.0708 559 GLU A N   
298  C CA  . GLU A 64  ? 0.8085 1.3363 1.3967 -0.0014 0.1783  -0.0374 559 GLU A CA  
299  C C   . GLU A 64  ? 0.8496 1.3333 1.4233 -0.0182 0.1692  -0.0171 559 GLU A C   
300  O O   . GLU A 64  ? 0.8491 1.3440 1.4070 -0.0230 0.1850  0.0082  559 GLU A O   
301  C CB  . GLU A 64  ? 0.8494 1.4254 1.4066 0.0140  0.2035  -0.0337 559 GLU A CB  
302  N N   . ALA A 65  ? 0.7984 1.2342 1.3784 -0.0256 0.1437  -0.0279 560 ALA A N   
303  C CA  . ALA A 65  ? 0.7896 1.1819 1.3568 -0.0386 0.1319  -0.0151 560 ALA A CA  
304  C C   . ALA A 65  ? 0.8090 1.1898 1.4283 -0.0562 0.1224  -0.0038 560 ALA A C   
305  O O   . ALA A 65  ? 0.7756 1.1571 1.4297 -0.0568 0.1093  -0.0185 560 ALA A O   
306  C CB  . ALA A 65  ? 0.7870 1.1346 1.3135 -0.0313 0.1106  -0.0365 560 ALA A CB  
307  N N   . ASP A 66  ? 0.7785 1.1472 1.4038 -0.0696 0.1268  0.0211  561 ASP A N   
308  C CA  . ASP A 66  ? 0.7847 1.1384 1.4615 -0.0874 0.1171  0.0336  561 ASP A CA  
309  C C   . ASP A 66  ? 0.8145 1.1175 1.4807 -0.0886 0.0874  0.0144  561 ASP A C   
310  O O   . ASP A 66  ? 0.8022 1.0820 1.4188 -0.0771 0.0778  -0.0028 561 ASP A O   
311  C CB  . ASP A 66  ? 0.8395 1.2005 1.5275 -0.0995 0.1346  0.0703  561 ASP A CB  
312  C CG  . ASP A 66  ? 1.0921 1.4278 1.7214 -0.0936 0.1350  0.0768  561 ASP A CG  
313  O OD1 . ASP A 66  ? 1.1149 1.4723 1.6991 -0.0803 0.1498  0.0769  561 ASP A OD1 
314  O OD2 . ASP A 66  ? 1.1981 1.4932 1.8269 -0.1005 0.1186  0.0783  561 ASP A OD2 
315  N N   . ASN A 67  ? 0.7738 1.0616 1.4889 -0.1021 0.0730  0.0173  562 ASN A N   
316  C CA  . ASN A 67  ? 0.7710 1.0160 1.4803 -0.1018 0.0442  -0.0024 562 ASN A CA  
317  C C   . ASN A 67  ? 0.8436 1.0546 1.5077 -0.1000 0.0409  0.0024  562 ASN A C   
318  O O   . ASN A 67  ? 0.8497 1.0342 1.4759 -0.0903 0.0248  -0.0178 562 ASN A O   
319  C CB  . ASN A 67  ? 0.7687 1.0101 1.5460 -0.1150 0.0283  -0.0042 562 ASN A CB  
320  C CG  . ASN A 67  ? 1.2035 1.4805 2.0288 -0.1161 0.0297  -0.0113 562 ASN A CG  
321  O OD1 . ASN A 67  ? 1.1556 1.4699 2.0218 -0.1251 0.0512  0.0098  562 ASN A OD1 
322  N ND2 . ASN A 67  ? 1.1179 1.3876 1.9369 -0.1053 0.0081  -0.0400 562 ASN A ND2 
323  N N   . GLN A 68  ? 0.7980 1.0123 1.4646 -0.1078 0.0570  0.0305  563 GLN A N   
324  C CA  . GLN A 68  ? 0.7980 0.9832 1.4232 -0.1048 0.0545  0.0362  563 GLN A CA  
325  C C   . GLN A 68  ? 0.8295 1.0161 1.3898 -0.0892 0.0596  0.0236  563 GLN A C   
326  O O   . GLN A 68  ? 0.8337 0.9919 1.3585 -0.0828 0.0473  0.0108  563 GLN A O   
327  C CB  . GLN A 68  ? 0.8336 1.0254 1.4754 -0.1147 0.0710  0.0720  563 GLN A CB  
328  N N   . THR A 69  ? 0.7554 0.9762 1.3054 -0.0827 0.0764  0.0244  564 THR A N   
329  C CA  . THR A 69  ? 0.7269 0.9514 1.2259 -0.0681 0.0797  0.0093  564 THR A CA  
330  C C   . THR A 69  ? 0.6983 0.9006 1.1865 -0.0611 0.0595  -0.0184 564 THR A C   
331  O O   . THR A 69  ? 0.6944 0.8756 1.1434 -0.0539 0.0526  -0.0285 564 THR A O   
332  C CB  . THR A 69  ? 0.8426 1.1117 1.3404 -0.0618 0.1015  0.0155  564 THR A CB  
333  O OG1 . THR A 69  ? 0.8839 1.1717 1.3824 -0.0666 0.1199  0.0448  564 THR A OG1 
334  C CG2 . THR A 69  ? 0.8069 1.0798 1.2601 -0.0460 0.1022  -0.0038 564 THR A CG2 
335  N N   . LEU A 70  ? 0.5958 0.8041 1.1204 -0.0632 0.0499  -0.0286 565 LEU A N   
336  C CA  . LEU A 70  ? 0.5679 0.7576 1.0837 -0.0555 0.0300  -0.0514 565 LEU A CA  
337  C C   . LEU A 70  ? 0.6194 0.7735 1.1168 -0.0561 0.0129  -0.0572 565 LEU A C   
338  O O   . LEU A 70  ? 0.6010 0.7378 1.0649 -0.0470 0.0035  -0.0696 565 LEU A O   
339  C CB  . LEU A 70  ? 0.5613 0.7663 1.1243 -0.0575 0.0208  -0.0599 565 LEU A CB  
340  C CG  . LEU A 70  ? 0.6057 0.8465 1.1859 -0.0518 0.0331  -0.0627 565 LEU A CG  
341  C CD1 . LEU A 70  ? 0.5976 0.8569 1.2346 -0.0565 0.0247  -0.0679 565 LEU A CD1 
342  C CD2 . LEU A 70  ? 0.6213 0.8553 1.1654 -0.0367 0.0288  -0.0787 565 LEU A CD2 
343  N N   . ASP A 71  ? 0.6107 0.7548 1.1326 -0.0662 0.0089  -0.0480 566 ASP A N   
344  C CA  . ASP A 71  ? 0.6167 0.7295 1.1242 -0.0649 -0.0077 -0.0562 566 ASP A CA  
345  C C   . ASP A 71  ? 0.6239 0.7235 1.0832 -0.0592 -0.0009 -0.0525 566 ASP A C   
346  O O   . ASP A 71  ? 0.6156 0.6973 1.0454 -0.0512 -0.0119 -0.0656 566 ASP A O   
347  C CB  . ASP A 71  ? 0.6581 0.7613 1.2099 -0.0762 -0.0159 -0.0498 566 ASP A CB  
348  C CG  . ASP A 71  ? 0.9416 1.0454 1.5357 -0.0779 -0.0360 -0.0666 566 ASP A CG  
349  O OD1 . ASP A 71  ? 0.9482 1.0477 1.5216 -0.0667 -0.0504 -0.0870 566 ASP A OD1 
350  O OD2 . ASP A 71  ? 1.1392 1.2480 1.7888 -0.0903 -0.0384 -0.0586 566 ASP A OD2 
351  N N   . SER A 72  ? 0.5413 0.6539 0.9913 -0.0620 0.0177  -0.0347 567 SER A N   
352  C CA  . SER A 72  ? 0.5289 0.6328 0.9363 -0.0562 0.0233  -0.0321 567 SER A CA  
353  C C   . SER A 72  ? 0.6050 0.7067 0.9793 -0.0459 0.0207  -0.0480 567 SER A C   
354  O O   . SER A 72  ? 0.6188 0.7034 0.9654 -0.0412 0.0152  -0.0538 567 SER A O   
355  C CB  . SER A 72  ? 0.5525 0.6751 0.9557 -0.0588 0.0419  -0.0113 567 SER A CB  
356  O OG  . SER A 72  ? 0.6839 0.8339 1.0759 -0.0532 0.0552  -0.0123 567 SER A OG  
357  N N   . TYR A 73  ? 0.5483 0.6671 0.9318 -0.0426 0.0234  -0.0546 568 TYR A N   
358  C CA  . TYR A 73  ? 0.5431 0.6603 0.9066 -0.0333 0.0202  -0.0677 568 TYR A CA  
359  C C   . TYR A 73  ? 0.6251 0.7218 0.9812 -0.0290 0.0033  -0.0786 568 TYR A C   
360  O O   . TYR A 73  ? 0.6387 0.7240 0.9688 -0.0230 0.0007  -0.0830 568 TYR A O   
361  C CB  . TYR A 73  ? 0.5549 0.6975 0.9377 -0.0300 0.0271  -0.0716 568 TYR A CB  
362  C CG  . TYR A 73  ? 0.5860 0.7546 0.9653 -0.0290 0.0452  -0.0639 568 TYR A CG  
363  C CD1 . TYR A 73  ? 0.6295 0.7962 0.9859 -0.0303 0.0529  -0.0539 568 TYR A CD1 
364  C CD2 . TYR A 73  ? 0.5890 0.7869 0.9857 -0.0242 0.0541  -0.0679 568 TYR A CD2 
365  C CE1 . TYR A 73  ? 0.6631 0.8570 1.0106 -0.0264 0.0685  -0.0472 568 TYR A CE1 
366  C CE2 . TYR A 73  ? 0.6079 0.8350 0.9966 -0.0201 0.0714  -0.0624 568 TYR A CE2 
367  C CZ  . TYR A 73  ? 0.7570 0.9821 1.1191 -0.0209 0.0783  -0.0516 568 TYR A CZ  
368  O OH  . TYR A 73  ? 0.8296 1.0857 1.1779 -0.0143 0.0941  -0.0461 568 TYR A OH  
369  N N   . ARG A 74  ? 0.5810 0.6752 0.9614 -0.0314 -0.0085 -0.0827 569 ARG A N   
370  C CA  . ARG A 74  ? 0.5827 0.6620 0.9532 -0.0246 -0.0260 -0.0939 569 ARG A CA  
371  C C   . ARG A 74  ? 0.6370 0.6982 0.9837 -0.0235 -0.0301 -0.0942 569 ARG A C   
372  O O   . ARG A 74  ? 0.6458 0.6970 0.9680 -0.0151 -0.0387 -0.1006 569 ARG A O   
373  C CB  . ARG A 74  ? 0.5770 0.6621 0.9837 -0.0265 -0.0399 -0.1017 569 ARG A CB  
374  C CG  . ARG A 74  ? 0.5985 0.7038 1.0334 -0.0258 -0.0388 -0.1040 569 ARG A CG  
375  C CD  . ARG A 74  ? 0.5607 0.6713 1.0358 -0.0291 -0.0543 -0.1124 569 ARG A CD  
376  N NE  . ARG A 74  ? 0.6574 0.7935 1.1734 -0.0321 -0.0504 -0.1122 569 ARG A NE  
377  C CZ  . ARG A 74  ? 0.7831 0.9348 1.3478 -0.0436 -0.0475 -0.1071 569 ARG A CZ  
378  N NH1 . ARG A 74  ? 0.7668 0.9070 1.3460 -0.0536 -0.0491 -0.1012 569 ARG A NH1 
379  N NH2 . ARG A 74  ? 0.3763 0.5557 0.9798 -0.0453 -0.0428 -0.1073 569 ARG A NH2 
380  N N   . ASN A 75  ? 0.5728 0.6317 0.9285 -0.0309 -0.0242 -0.0865 570 ASN A N   
381  C CA  . ASN A 75  ? 0.5750 0.6180 0.9125 -0.0286 -0.0285 -0.0883 570 ASN A CA  
382  C C   . ASN A 75  ? 0.6423 0.6826 0.9442 -0.0242 -0.0192 -0.0847 570 ASN A C   
383  O O   . ASN A 75  ? 0.6618 0.6934 0.9416 -0.0174 -0.0245 -0.0904 570 ASN A O   
384  C CB  . ASN A 75  ? 0.5396 0.5785 0.9002 -0.0369 -0.0264 -0.0796 570 ASN A CB  
385  C CG  . ASN A 75  ? 0.6899 0.7111 1.0434 -0.0324 -0.0378 -0.0881 570 ASN A CG  
386  O OD1 . ASN A 75  ? 0.6868 0.7019 1.0228 -0.0310 -0.0319 -0.0825 570 ASN A OD1 
387  N ND2 . ASN A 75  ? 0.4704 0.4852 0.8360 -0.0276 -0.0558 -0.1047 570 ASN A ND2 
388  N N   . GLU A 76  ? 0.5712 0.6220 0.8693 -0.0271 -0.0057 -0.0763 571 GLU A N   
389  C CA  . GLU A 76  ? 0.5585 0.6078 0.8305 -0.0238 0.0012  -0.0748 571 GLU A CA  
390  C C   . GLU A 76  ? 0.6002 0.6449 0.8580 -0.0175 -0.0033 -0.0805 571 GLU A C   
391  O O   . GLU A 76  ? 0.6041 0.6421 0.8429 -0.0143 -0.0031 -0.0801 571 GLU A O   
392  C CB  . GLU A 76  ? 0.5699 0.6333 0.8424 -0.0263 0.0136  -0.0683 571 GLU A CB  
393  C CG  . GLU A 76  ? 0.6627 0.7255 0.9145 -0.0227 0.0176  -0.0707 571 GLU A CG  
394  C CD  . GLU A 76  ? 0.8457 0.9127 1.0859 -0.0229 0.0235  -0.0660 571 GLU A CD  
395  O OE1 . GLU A 76  ? 0.7644 0.8432 1.0088 -0.0245 0.0298  -0.0582 571 GLU A OE1 
396  O OE2 . GLU A 76  ? 0.8235 0.8853 1.0511 -0.0207 0.0223  -0.0695 571 GLU A OE2 
397  N N   . ILE A 77  ? 0.5207 0.5700 0.7903 -0.0153 -0.0074 -0.0839 572 ILE A N   
398  C CA  . ILE A 77  ? 0.5074 0.5512 0.7669 -0.0087 -0.0130 -0.0857 572 ILE A CA  
399  C C   . ILE A 77  ? 0.6295 0.6649 0.8710 -0.0028 -0.0217 -0.0869 572 ILE A C   
400  O O   . ILE A 77  ? 0.6459 0.6765 0.8682 0.0011  -0.0196 -0.0817 572 ILE A O   
401  C CB  . ILE A 77  ? 0.5285 0.5796 0.8077 -0.0059 -0.0180 -0.0898 572 ILE A CB  
402  C CG1 . ILE A 77  ? 0.5140 0.5772 0.8065 -0.0080 -0.0079 -0.0907 572 ILE A CG1 
403  C CG2 . ILE A 77  ? 0.5303 0.5732 0.7991 0.0026  -0.0272 -0.0889 572 ILE A CG2 
404  C CD1 . ILE A 77  ? 0.4782 0.5563 0.7982 -0.0059 -0.0104 -0.0962 572 ILE A CD1 
405  N N   . ALA A 78  ? 0.6275 0.6629 0.8770 -0.0016 -0.0315 -0.0940 573 ALA A N   
406  C CA  . ALA A 78  ? 0.6528 0.6841 0.8841 0.0072  -0.0418 -0.1001 573 ALA A CA  
407  C C   . ALA A 78  ? 0.7156 0.7438 0.9261 0.0083  -0.0343 -0.0971 573 ALA A C   
408  O O   . ALA A 78  ? 0.7430 0.7727 0.9293 0.0171  -0.0353 -0.0960 573 ALA A O   
409  C CB  . ALA A 78  ? 0.6692 0.7006 0.9205 0.0077  -0.0556 -0.1126 573 ALA A CB  
410  N N   . TYR A 79  ? 0.6309 0.6575 0.8505 0.0005  -0.0262 -0.0943 574 TYR A N   
411  C CA  . TYR A 79  ? 0.6147 0.6402 0.8191 0.0019  -0.0197 -0.0921 574 TYR A CA  
412  C C   . TYR A 79  ? 0.6747 0.7035 0.8648 0.0018  -0.0096 -0.0829 574 TYR A C   
413  O O   . TYR A 79  ? 0.6798 0.7118 0.8526 0.0077  -0.0071 -0.0811 574 TYR A O   
414  C CB  . TYR A 79  ? 0.6185 0.6412 0.8366 -0.0045 -0.0165 -0.0906 574 TYR A CB  
415  C CG  . TYR A 79  ? 0.6744 0.6900 0.9016 -0.0006 -0.0279 -0.1007 574 TYR A CG  
416  C CD1 . TYR A 79  ? 0.7166 0.7313 0.9278 0.0089  -0.0314 -0.1089 574 TYR A CD1 
417  C CD2 . TYR A 79  ? 0.6808 0.6920 0.9361 -0.0057 -0.0362 -0.1037 574 TYR A CD2 
418  C CE1 . TYR A 79  ? 0.7489 0.7564 0.9705 0.0148  -0.0446 -0.1229 574 TYR A CE1 
419  C CE2 . TYR A 79  ? 0.7076 0.7097 0.9779 -0.0021 -0.0499 -0.1155 574 TYR A CE2 
420  C CZ  . TYR A 79  ? 0.8644 0.8637 1.1170 0.0090  -0.0551 -0.1268 574 TYR A CZ  
421  O OH  . TYR A 79  ? 0.8987 0.8882 1.1681 0.0146  -0.0708 -0.1427 574 TYR A OH  
422  N N   . LEU A 80  ? 0.6206 0.6502 0.8208 -0.0038 -0.0045 -0.0778 575 LEU A N   
423  C CA  . LEU A 80  ? 0.6015 0.6314 0.7980 -0.0051 0.0023  -0.0706 575 LEU A CA  
424  C C   . LEU A 80  ? 0.6663 0.6945 0.8505 0.0015  -0.0004 -0.0639 575 LEU A C   
425  O O   . LEU A 80  ? 0.6482 0.6779 0.8248 0.0019  0.0060  -0.0549 575 LEU A O   
426  C CB  . LEU A 80  ? 0.5788 0.6098 0.7915 -0.0096 0.0046  -0.0718 575 LEU A CB  
427  C CG  . LEU A 80  ? 0.6233 0.6517 0.8411 -0.0112 0.0083  -0.0681 575 LEU A CG  
428  C CD1 . LEU A 80  ? 0.6085 0.6388 0.8217 -0.0139 0.0143  -0.0646 575 LEU A CD1 
429  C CD2 . LEU A 80  ? 0.6376 0.6699 0.8710 -0.0127 0.0089  -0.0754 575 LEU A CD2 
430  N N   . ASN A 81  ? 0.6454 0.6724 0.8292 0.0069  -0.0099 -0.0669 576 ASN A N   
431  C CA  . ASN A 81  ? 0.6707 0.6977 0.8391 0.0156  -0.0142 -0.0592 576 ASN A CA  
432  C C   . ASN A 81  ? 0.7427 0.7777 0.8859 0.0236  -0.0122 -0.0574 576 ASN A C   
433  O O   . ASN A 81  ? 0.7510 0.7899 0.8807 0.0272  -0.0057 -0.0429 576 ASN A O   
434  C CB  . ASN A 81  ? 0.6762 0.7029 0.8506 0.0213  -0.0275 -0.0658 576 ASN A CB  
435  C CG  . ASN A 81  ? 1.0587 1.0860 1.2161 0.0324  -0.0342 -0.0566 576 ASN A CG  
436  O OD1 . ASN A 81  ? 1.0422 1.0677 1.1890 0.0337  -0.0268 -0.0399 576 ASN A OD1 
437  N ND2 . ASN A 81  ? 1.0137 1.0447 1.1702 0.0408  -0.0488 -0.0660 576 ASN A ND2 
438  N N   . LYS A 82  ? 0.6927 0.7310 0.8325 0.0265  -0.0169 -0.0715 577 LYS A N   
439  C CA  . LYS A 82  ? 0.7107 0.7591 0.8282 0.0368  -0.0162 -0.0756 577 LYS A CA  
440  C C   . LYS A 82  ? 0.7738 0.8285 0.8885 0.0329  -0.0014 -0.0673 577 LYS A C   
441  O O   . LYS A 82  ? 0.7872 0.8547 0.8832 0.0403  0.0060  -0.0582 577 LYS A O   
442  C CB  . LYS A 82  ? 0.7442 0.7912 0.8663 0.0416  -0.0287 -0.0962 577 LYS A CB  
443  N N   . LEU A 83  ? 0.7128 0.7616 0.8468 0.0221  0.0032  -0.0691 578 LEU A N   
444  C CA  . LEU A 83  ? 0.6983 0.7541 0.8348 0.0185  0.0145  -0.0645 578 LEU A CA  
445  C C   . LEU A 83  ? 0.7814 0.8415 0.9224 0.0130  0.0255  -0.0475 578 LEU A C   
446  O O   . LEU A 83  ? 0.7944 0.8646 0.9398 0.0108  0.0349  -0.0428 578 LEU A O   
447  C CB  . LEU A 83  ? 0.6703 0.7202 0.8232 0.0114  0.0136  -0.0720 578 LEU A CB  
448  C CG  . LEU A 83  ? 0.7116 0.7551 0.8679 0.0151  0.0033  -0.0852 578 LEU A CG  
449  C CD1 . LEU A 83  ? 0.7054 0.7462 0.8739 0.0104  0.0050  -0.0866 578 LEU A CD1 
450  C CD2 . LEU A 83  ? 0.7200 0.7697 0.8609 0.0282  -0.0024 -0.0953 578 LEU A CD2 
451  N N   . GLN A 84  ? 0.7462 0.7991 0.8900 0.0112  0.0234  -0.0384 579 GLN A N   
452  C CA  . GLN A 84  ? 0.7549 0.8071 0.9092 0.0058  0.0311  -0.0206 579 GLN A CA  
453  C C   . GLN A 84  ? 0.8682 0.9368 1.0061 0.0125  0.0411  -0.0056 579 GLN A C   
454  O O   . GLN A 84  ? 0.8714 0.9470 1.0238 0.0058  0.0521  0.0072  579 GLN A O   
455  C CB  . GLN A 84  ? 0.7705 0.8103 0.9286 0.0067  0.0235  -0.0151 579 GLN A CB  
456  C CG  . GLN A 84  ? 0.6564 0.6838 0.8404 -0.0020 0.0198  -0.0217 579 GLN A CG  
457  C CD  . GLN A 84  ? 0.9593 0.9765 1.1500 0.0001  0.0149  -0.0109 579 GLN A CD  
458  O OE1 . GLN A 84  ? 0.9553 0.9661 1.1630 -0.0047 0.0187  0.0023  579 GLN A OE1 
459  N NE2 . GLN A 84  ? 0.9406 0.9564 1.1196 0.0084  0.0055  -0.0145 579 GLN A NE2 
460  N N   . GLN A 85  ? 0.8585 0.9362 0.9676 0.0264  0.0369  -0.0082 580 GLN A N   
461  C CA  . GLN A 85  ? 0.8795 0.9791 0.9647 0.0374  0.0466  0.0046  580 GLN A CA  
462  C C   . GLN A 85  ? 0.9276 1.0455 1.0138 0.0386  0.0569  -0.0019 580 GLN A C   
463  O O   . GLN A 85  ? 0.9541 1.0943 1.0316 0.0434  0.0710  0.0135  580 GLN A O   
464  C CB  . GLN A 85  ? 0.9173 1.0236 0.9698 0.0550  0.0355  -0.0038 580 GLN A CB  
465  N N   . HIS A 86  ? 0.8429 0.9533 0.9413 0.0348  0.0508  -0.0224 581 HIS A N   
466  C CA  . HIS A 86  ? 0.8271 0.9532 0.9288 0.0376  0.0578  -0.0307 581 HIS A CA  
467  C C   . HIS A 86  ? 0.8193 0.9494 0.9500 0.0244  0.0682  -0.0218 581 HIS A C   
468  O O   . HIS A 86  ? 0.8230 0.9733 0.9570 0.0282  0.0771  -0.0233 581 HIS A O   
469  C CB  . HIS A 86  ? 0.8349 0.9527 0.9341 0.0437  0.0447  -0.0559 581 HIS A CB  
470  C CG  . HIS A 86  ? 0.9088 1.0272 0.9840 0.0584  0.0331  -0.0684 581 HIS A CG  
471  N ND1 . HIS A 86  ? 0.9594 1.0977 1.0139 0.0760  0.0332  -0.0805 581 HIS A ND1 
472  C CD2 . HIS A 86  ? 0.9409 1.0454 1.0113 0.0592  0.0206  -0.0718 581 HIS A CD2 
473  C CE1 . HIS A 86  ? 0.9735 1.1081 1.0108 0.0870  0.0190  -0.0924 581 HIS A CE1 
474  N NE2 . HIS A 86  ? 0.9641 1.0786 1.0116 0.0767  0.0110  -0.0869 581 HIS A NE2 
475  N N   . SER A 87  ? 0.7122 0.8253 0.8660 0.0105  0.0659  -0.0156 582 SER A N   
476  C CA  . SER A 87  ? 0.6795 0.7965 0.8641 -0.0014 0.0720  -0.0114 582 SER A CA  
477  C C   . SER A 87  ? 0.7317 0.8331 0.9409 -0.0138 0.0699  -0.0021 582 SER A C   
478  O O   . SER A 87  ? 0.7210 0.8037 0.9278 -0.0150 0.0600  -0.0078 582 SER A O   
479  C CB  . SER A 87  ? 0.6761 0.7913 0.8684 -0.0020 0.0655  -0.0301 582 SER A CB  
480  O OG  . SER A 87  ? 0.7519 0.8759 0.9728 -0.0108 0.0701  -0.0279 582 SER A OG  
481  N N   . ASP A 88  ? 0.6867 0.7970 0.9249 -0.0230 0.0785  0.0103  583 ASP A N   
482  C CA  . ASP A 88  ? 0.6842 0.7787 0.9539 -0.0347 0.0744  0.0159  583 ASP A CA  
483  C C   . ASP A 88  ? 0.7225 0.8093 1.0099 -0.0398 0.0636  -0.0059 583 ASP A C   
484  O O   . ASP A 88  ? 0.7249 0.7980 1.0359 -0.0466 0.0565  -0.0091 583 ASP A O   
485  C CB  . ASP A 88  ? 0.7255 0.8308 1.0258 -0.0436 0.0864  0.0392  583 ASP A CB  
486  C CG  . ASP A 88  ? 0.9075 1.0370 1.2305 -0.0479 0.0951  0.0381  583 ASP A CG  
487  O OD1 . ASP A 88  ? 0.9236 1.0686 1.2251 -0.0387 0.0971  0.0259  583 ASP A OD1 
488  O OD2 . ASP A 88  ? 0.9806 1.1143 1.3462 -0.0599 0.0998  0.0502  583 ASP A OD2 
489  N N   . LYS A 89  ? 0.6602 0.7562 0.9353 -0.0347 0.0614  -0.0211 584 LYS A N   
490  C CA  . LYS A 89  ? 0.6360 0.7291 0.9202 -0.0364 0.0515  -0.0397 584 LYS A CA  
491  C C   . LYS A 89  ? 0.6789 0.7573 0.9423 -0.0319 0.0427  -0.0502 584 LYS A C   
492  O O   . LYS A 89  ? 0.6703 0.7488 0.9338 -0.0309 0.0358  -0.0632 584 LYS A O   
493  C CB  . LYS A 89  ? 0.6538 0.7646 0.9389 -0.0328 0.0531  -0.0471 584 LYS A CB  
494  C CG  . LYS A 89  ? 0.6792 0.8105 0.9922 -0.0377 0.0625  -0.0384 584 LYS A CG  
495  C CD  . LYS A 89  ? 0.6928 0.8211 1.0445 -0.0502 0.0636  -0.0292 584 LYS A CD  
496  C CE  . LYS A 89  ? 0.7397 0.8912 1.1227 -0.0563 0.0757  -0.0156 584 LYS A CE  
497  N NZ  . LYS A 89  ? 0.7708 0.9364 1.1330 -0.0505 0.0920  0.0039  584 LYS A NZ  
498  N N   . ILE A 90  ? 0.6219 0.6906 0.8685 -0.0285 0.0431  -0.0433 585 ILE A N   
499  C CA  . ILE A 90  ? 0.5966 0.6535 0.8305 -0.0254 0.0359  -0.0505 585 ILE A CA  
500  C C   . ILE A 90  ? 0.6657 0.7107 0.9137 -0.0288 0.0332  -0.0456 585 ILE A C   
501  O O   . ILE A 90  ? 0.6695 0.7123 0.9221 -0.0300 0.0374  -0.0307 585 ILE A O   
502  C CB  . ILE A 90  ? 0.6207 0.6773 0.8296 -0.0176 0.0354  -0.0499 585 ILE A CB  
503  C CG1 . ILE A 90  ? 0.6009 0.6632 0.8026 -0.0141 0.0340  -0.0588 585 ILE A CG1 
504  C CG2 . ILE A 90  ? 0.6279 0.6734 0.8310 -0.0157 0.0288  -0.0528 585 ILE A CG2 
505  C CD1 . ILE A 90  ? 0.6157 0.6852 0.8043 -0.0068 0.0365  -0.0582 585 ILE A CD1 
506  N N   . ILE A 91  ? 0.6245 0.6635 0.8807 -0.0293 0.0264  -0.0575 586 ILE A N   
507  C CA  . ILE A 91  ? 0.6222 0.6493 0.8949 -0.0304 0.0214  -0.0578 586 ILE A CA  
508  C C   . ILE A 91  ? 0.6573 0.6758 0.9201 -0.0268 0.0215  -0.0440 586 ILE A C   
509  O O   . ILE A 91  ? 0.6364 0.6576 0.8770 -0.0214 0.0212  -0.0436 586 ILE A O   
510  C CB  . ILE A 91  ? 0.6556 0.6842 0.9313 -0.0273 0.0152  -0.0757 586 ILE A CB  
511  C CG1 . ILE A 91  ? 0.6826 0.7006 0.9828 -0.0270 0.0083  -0.0818 586 ILE A CG1 
512  C CG2 . ILE A 91  ? 0.6431 0.6754 0.8980 -0.0224 0.0156  -0.0776 586 ILE A CG2 
513  C CD1 . ILE A 91  ? 0.8340 0.8594 1.1387 -0.0216 0.0030  -0.1031 586 ILE A CD1 
514  N N   . ARG A 92  ? 0.6317 0.6394 0.9133 -0.0292 0.0203  -0.0326 587 ARG A N   
515  C CA  . ARG A 92  ? 0.6335 0.6329 0.9061 -0.0242 0.0188  -0.0173 587 ARG A CA  
516  C C   . ARG A 92  ? 0.6366 0.6292 0.9091 -0.0183 0.0095  -0.0293 587 ARG A C   
517  O O   . ARG A 92  ? 0.6168 0.6049 0.9098 -0.0193 0.0043  -0.0433 587 ARG A O   
518  C CB  . ARG A 92  ? 0.6581 0.6464 0.9551 -0.0287 0.0202  0.0027  587 ARG A CB  
519  C CG  . ARG A 92  ? 0.8341 0.8328 1.1377 -0.0353 0.0316  0.0192  587 ARG A CG  
520  C CD  . ARG A 92  ? 0.9874 0.9984 1.2605 -0.0290 0.0409  0.0400  587 ARG A CD  
521  N NE  . ARG A 92  ? 0.8854 0.9129 1.1267 -0.0226 0.0438  0.0275  587 ARG A NE  
522  C CZ  . ARG A 92  ? 0.9842 1.0250 1.2277 -0.0259 0.0496  0.0186  587 ARG A CZ  
523  N NH1 . ARG A 92  ? 1.0121 1.0542 1.2878 -0.0361 0.0525  0.0187  587 ARG A NH1 
524  N NH2 . ARG A 92  ? 0.6693 0.7216 0.8863 -0.0186 0.0503  0.0079  587 ARG A NH2 
525  N N   . LEU A 93  ? 0.5824 0.5776 0.8329 -0.0112 0.0070  -0.0263 588 LEU A N   
526  C CA  . LEU A 93  ? 0.5705 0.5628 0.8221 -0.0050 -0.0018 -0.0348 588 LEU A CA  
527  C C   . LEU A 93  ? 0.6631 0.6468 0.9097 0.0013  -0.0062 -0.0166 588 LEU A C   
528  O O   . LEU A 93  ? 0.6431 0.6329 0.8655 0.0058  -0.0041 -0.0049 588 LEU A O   
529  C CB  . LEU A 93  ? 0.5469 0.5506 0.7814 -0.0022 -0.0029 -0.0457 588 LEU A CB  
530  C CG  . LEU A 93  ? 0.5799 0.5853 0.8196 0.0036  -0.0116 -0.0540 588 LEU A CG  
531  C CD1 . LEU A 93  ? 0.5633 0.5695 0.8269 0.0029  -0.0128 -0.0659 588 LEU A CD1 
532  C CD2 . LEU A 93  ? 0.5808 0.5963 0.8105 0.0039  -0.0127 -0.0621 588 LEU A CD2 
533  N N   . TYR A 94  ? 0.6683 0.6383 0.9385 0.0025  -0.0125 -0.0138 589 TYR A N   
534  C CA  . TYR A 94  ? 0.6851 0.6436 0.9560 0.0089  -0.0182 0.0066  589 TYR A CA  
535  C C   . TYR A 94  ? 0.7507 0.7112 1.0122 0.0203  -0.0296 0.0018  589 TYR A C   
536  O O   . TYR A 94  ? 0.7705 0.7317 1.0120 0.0287  -0.0335 0.0183  589 TYR A O   
537  C CB  . TYR A 94  ? 0.6904 0.6302 0.9980 0.0049  -0.0214 0.0122  589 TYR A CB  
538  C CG  . TYR A 94  ? 0.7081 0.6463 1.0291 -0.0064 -0.0116 0.0222  589 TYR A CG  
539  C CD1 . TYR A 94  ? 0.7359 0.6780 1.0439 -0.0085 -0.0022 0.0502  589 TYR A CD1 
540  C CD2 . TYR A 94  ? 0.7130 0.6491 1.0611 -0.0139 -0.0120 0.0033  589 TYR A CD2 
541  C CE1 . TYR A 94  ? 0.7322 0.6766 1.0585 -0.0197 0.0077  0.0601  589 TYR A CE1 
542  C CE2 . TYR A 94  ? 0.7203 0.6563 1.0871 -0.0246 -0.0052 0.0110  589 TYR A CE2 
543  C CZ  . TYR A 94  ? 0.8075 0.7479 1.1653 -0.0284 0.0053  0.0398  589 TYR A CZ  
544  O OH  . TYR A 94  ? 0.8420 0.7862 1.2230 -0.0396 0.0132  0.0481  589 TYR A OH  
545  N N   . ASP A 95  ? 0.6886 0.6531 0.9651 0.0215  -0.0349 -0.0203 590 ASP A N   
546  C CA  . ASP A 95  ? 0.6909 0.6602 0.9677 0.0314  -0.0462 -0.0274 590 ASP A CA  
547  C C   . ASP A 95  ? 0.7161 0.6990 1.0073 0.0293  -0.0454 -0.0514 590 ASP A C   
548  O O   . ASP A 95  ? 0.6903 0.6761 0.9918 0.0225  -0.0376 -0.0617 590 ASP A O   
549  C CB  . ASP A 95  ? 0.7396 0.6925 1.0371 0.0392  -0.0566 -0.0180 590 ASP A CB  
550  C CG  . ASP A 95  ? 0.9412 0.8965 1.2307 0.0523  -0.0703 -0.0132 590 ASP A CG  
551  O OD1 . ASP A 95  ? 0.9718 0.9423 1.2392 0.0556  -0.0728 -0.0184 590 ASP A OD1 
552  O OD2 . ASP A 95  ? 1.0201 0.9615 1.3275 0.0602  -0.0803 -0.0051 590 ASP A OD2 
553  N N   . TYR A 96  ? 0.6825 0.6761 0.9762 0.0357  -0.0536 -0.0597 591 TYR A N   
554  C CA  . TYR A 96  ? 0.6633 0.6738 0.9757 0.0341  -0.0517 -0.0786 591 TYR A CA  
555  C C   . TYR A 96  ? 0.7195 0.7390 1.0489 0.0432  -0.0636 -0.0856 591 TYR A C   
556  O O   . TYR A 96  ? 0.7330 0.7491 1.0511 0.0504  -0.0750 -0.0780 591 TYR A O   
557  C CB  . TYR A 96  ? 0.6575 0.6809 0.9587 0.0253  -0.0425 -0.0838 591 TYR A CB  
558  C CG  . TYR A 96  ? 0.6825 0.7079 0.9641 0.0261  -0.0478 -0.0797 591 TYR A CG  
559  C CD1 . TYR A 96  ? 0.7097 0.7457 1.0017 0.0304  -0.0583 -0.0876 591 TYR A CD1 
560  C CD2 . TYR A 96  ? 0.7039 0.7239 0.9605 0.0228  -0.0424 -0.0717 591 TYR A CD2 
561  C CE1 . TYR A 96  ? 0.7241 0.7625 1.0012 0.0322  -0.0658 -0.0892 591 TYR A CE1 
562  C CE2 . TYR A 96  ? 0.7296 0.7536 0.9690 0.0256  -0.0480 -0.0731 591 TYR A CE2 
563  C CZ  . TYR A 96  ? 0.8305 0.8626 1.0799 0.0306  -0.0607 -0.0829 591 TYR A CZ  
564  O OH  . TYR A 96  ? 0.8544 0.8900 1.0892 0.0348  -0.0691 -0.0885 591 TYR A OH  
565  N N   . GLU A 97  ? 0.6733 0.7081 1.0294 0.0439  -0.0608 -0.1007 592 GLU A N   
566  C CA  . GLU A 97  ? 0.6837 0.7339 1.0646 0.0517  -0.0702 -0.1104 592 GLU A CA  
567  C C   . GLU A 97  ? 0.7204 0.7974 1.1167 0.0443  -0.0601 -0.1212 592 GLU A C   
568  O O   . GLU A 97  ? 0.7179 0.8049 1.1180 0.0397  -0.0464 -0.1266 592 GLU A O   
569  C CB  . GLU A 97  ? 0.7128 0.7588 1.1181 0.0618  -0.0753 -0.1171 592 GLU A CB  
570  C CG  . GLU A 97  ? 0.7983 0.8628 1.2340 0.0716  -0.0846 -0.1287 592 GLU A CG  
571  C CD  . GLU A 97  ? 0.9913 1.0436 1.4477 0.0845  -0.0941 -0.1327 592 GLU A CD  
572  O OE1 . GLU A 97  ? 0.7785 0.8033 1.2229 0.0888  -0.1038 -0.1174 592 GLU A OE1 
573  O OE2 . GLU A 97  ? 0.9931 1.0634 1.4783 0.0906  -0.0911 -0.1503 592 GLU A OE2 
574  N N   . ILE A 98  ? 0.6608 0.7499 1.0662 0.0433  -0.0673 -0.1232 593 ILE A N   
575  C CA  . ILE A 98  ? 0.6278 0.7414 1.0539 0.0341  -0.0576 -0.1287 593 ILE A CA  
576  C C   . ILE A 98  ? 0.6547 0.7910 1.1191 0.0386  -0.0656 -0.1378 593 ILE A C   
577  O O   . ILE A 98  ? 0.6654 0.7981 1.1343 0.0447  -0.0836 -0.1398 593 ILE A O   
578  C CB  . ILE A 98  ? 0.6597 0.7680 1.0695 0.0235  -0.0552 -0.1227 593 ILE A CB  
579  C CG1 . ILE A 98  ? 0.6737 0.7597 1.0456 0.0214  -0.0504 -0.1138 593 ILE A CG1 
580  C CG2 . ILE A 98  ? 0.6587 0.7885 1.0899 0.0125  -0.0407 -0.1226 593 ILE A CG2 
581  C CD1 . ILE A 98  ? 0.8255 0.9053 1.1811 0.0142  -0.0498 -0.1099 593 ILE A CD1 
582  N N   . THR A 99  ? 0.5847 0.7478 1.0769 0.0369  -0.0524 -0.1438 594 THR A N   
583  C CA  . THR A 99  ? 0.5760 0.7682 1.1122 0.0394  -0.0561 -0.1521 594 THR A CA  
584  C C   . THR A 99  ? 0.6072 0.8271 1.1653 0.0262  -0.0377 -0.1477 594 THR A C   
585  O O   . THR A 99  ? 0.5918 0.8037 1.1271 0.0166  -0.0259 -0.1382 594 THR A O   
586  C CB  . THR A 99  ? 0.6403 0.8434 1.1965 0.0543  -0.0592 -0.1632 594 THR A CB  
587  O OG1 . THR A 99  ? 0.6959 0.9158 1.2530 0.0550  -0.0396 -0.1675 594 THR A OG1 
588  C CG2 . THR A 99  ? 0.5934 0.7649 1.1294 0.0668  -0.0772 -0.1623 594 THR A CG2 
589  N N   . ASP A 100 ? 0.5468 0.8001 1.1515 0.0257  -0.0357 -0.1528 595 ASP A N   
590  C CA  . ASP A 100 ? 0.5374 0.8221 1.1720 0.0131  -0.0171 -0.1447 595 ASP A CA  
591  C C   . ASP A 100 ? 0.6153 0.9255 1.2433 0.0168  0.0076  -0.1432 595 ASP A C   
592  O O   . ASP A 100 ? 0.6212 0.9553 1.2596 0.0069  0.0274  -0.1308 595 ASP A O   
593  C CB  . ASP A 100 ? 0.5570 0.8699 1.2495 0.0107  -0.0252 -0.1499 595 ASP A CB  
594  C CG  . ASP A 100 ? 0.6731 0.9639 1.3717 0.0077  -0.0513 -0.1541 595 ASP A CG  
595  O OD1 . ASP A 100 ? 0.7304 0.9927 1.3981 0.0012  -0.0558 -0.1481 595 ASP A OD1 
596  O OD2 . ASP A 100 ? 0.6783 0.9829 1.4136 0.0132  -0.0678 -0.1651 595 ASP A OD2 
597  N N   . GLN A 101 ? 0.5855 0.8896 1.1951 0.0319  0.0056  -0.1555 596 GLN A N   
598  C CA  . GLN A 101 ? 0.5799 0.9084 1.1813 0.0402  0.0246  -0.1613 596 GLN A CA  
599  C C   . GLN A 101 ? 0.6159 0.9165 1.1689 0.0417  0.0270  -0.1607 596 GLN A C   
600  O O   . GLN A 101 ? 0.6235 0.9452 1.1631 0.0440  0.0447  -0.1609 596 GLN A O   
601  C CB  . GLN A 101 ? 0.6000 0.9483 1.2270 0.0583  0.0202  -0.1810 596 GLN A CB  
602  C CG  . GLN A 101 ? 0.8033 1.1739 1.4805 0.0596  0.0110  -0.1850 596 GLN A CG  
603  C CD  . GLN A 101 ? 1.0376 1.3722 1.7138 0.0620  -0.0176 -0.1872 596 GLN A CD  
604  O OE1 . GLN A 101 ? 0.9488 1.2443 1.5913 0.0684  -0.0310 -0.1886 596 GLN A OE1 
605  N NE2 . GLN A 101 ? 0.8451 1.1942 1.5597 0.0572  -0.0278 -0.1866 596 GLN A NE2 
606  N N   . TYR A 102 ? 0.5454 0.8025 1.0733 0.0412  0.0097  -0.1596 597 TYR A N   
607  C CA  . TYR A 102 ? 0.5431 0.7743 1.0328 0.0422  0.0104  -0.1597 597 TYR A CA  
608  C C   . TYR A 102 ? 0.6223 0.8129 1.0853 0.0350  -0.0024 -0.1491 597 TYR A C   
609  O O   . TYR A 102 ? 0.6448 0.8238 1.1150 0.0329  -0.0155 -0.1448 597 TYR A O   
610  C CB  . TYR A 102 ? 0.5620 0.7892 1.0550 0.0583  0.0044  -0.1779 597 TYR A CB  
611  C CG  . TYR A 102 ? 0.5838 0.7877 1.0906 0.0662  -0.0164 -0.1815 597 TYR A CG  
612  C CD1 . TYR A 102 ? 0.6154 0.7789 1.1002 0.0638  -0.0300 -0.1722 597 TYR A CD1 
613  C CD2 . TYR A 102 ? 0.5915 0.8163 1.1339 0.0771  -0.0219 -0.1926 597 TYR A CD2 
614  C CE1 . TYR A 102 ? 0.6318 0.7755 1.1261 0.0720  -0.0486 -0.1710 597 TYR A CE1 
615  C CE2 . TYR A 102 ? 0.6053 0.8088 1.1594 0.0858  -0.0426 -0.1940 597 TYR A CE2 
616  C CZ  . TYR A 102 ? 0.6665 0.8289 1.1947 0.0834  -0.0559 -0.1819 597 TYR A CZ  
617  O OH  . TYR A 102 ? 0.6728 0.8150 1.2087 0.0932  -0.0758 -0.1791 597 TYR A OH  
618  N N   . ILE A 103 ? 0.5672 0.7391 1.0001 0.0333  0.0008  -0.1471 598 ILE A N   
619  C CA  . ILE A 103 ? 0.5631 0.7003 0.9696 0.0287  -0.0081 -0.1382 598 ILE A CA  
620  C C   . ILE A 103 ? 0.6704 0.7903 1.0677 0.0355  -0.0114 -0.1455 598 ILE A C   
621  O O   . ILE A 103 ? 0.6658 0.7999 1.0642 0.0399  -0.0034 -0.1568 598 ILE A O   
622  C CB  . ILE A 103 ? 0.5781 0.7105 0.9632 0.0167  -0.0008 -0.1260 598 ILE A CB  
623  C CG1 . ILE A 103 ? 0.5737 0.7243 0.9763 0.0088  0.0035  -0.1195 598 ILE A CG1 
624  C CG2 . ILE A 103 ? 0.5624 0.6638 0.9239 0.0143  -0.0105 -0.1179 598 ILE A CG2 
625  C CD1 . ILE A 103 ? 0.5565 0.7030 0.9434 -0.0024 0.0112  -0.1072 598 ILE A CD1 
626  N N   . TYR A 104 ? 0.6542 0.7450 1.0445 0.0370  -0.0238 -0.1389 599 TYR A N   
627  C CA  . TYR A 104 ? 0.6600 0.7286 1.0476 0.0403  -0.0287 -0.1409 599 TYR A CA  
628  C C   . TYR A 104 ? 0.6614 0.7084 1.0245 0.0317  -0.0296 -0.1237 599 TYR A C   
629  O O   . TYR A 104 ? 0.6569 0.6972 1.0111 0.0310  -0.0355 -0.1123 599 TYR A O   
630  C CB  . TYR A 104 ? 0.7087 0.7635 1.1182 0.0515  -0.0425 -0.1445 599 TYR A CB  
631  C CG  . TYR A 104 ? 0.7765 0.8518 1.2141 0.0633  -0.0431 -0.1652 599 TYR A CG  
632  C CD1 . TYR A 104 ? 0.8073 0.9090 1.2465 0.0651  -0.0308 -0.1812 599 TYR A CD1 
633  C CD2 . TYR A 104 ? 0.8062 0.8762 1.2681 0.0750  -0.0562 -0.1692 599 TYR A CD2 
634  C CE1 . TYR A 104 ? 0.8322 0.9582 1.2958 0.0784  -0.0299 -0.2019 599 TYR A CE1 
635  C CE2 . TYR A 104 ? 0.8222 0.9136 1.3123 0.0878  -0.0566 -0.1906 599 TYR A CE2 
636  C CZ  . TYR A 104 ? 0.9219 1.0426 1.4125 0.0897  -0.0427 -0.2076 599 TYR A CZ  
637  O OH  . TYR A 104 ? 0.9975 1.1446 1.5142 0.1046  -0.0416 -0.2303 599 TYR A OH  
638  N N   . MET A 105 ? 0.5863 0.6263 0.9391 0.0264  -0.0241 -0.1235 600 MET A N   
639  C CA  . MET A 105 ? 0.5725 0.5966 0.9052 0.0188  -0.0229 -0.1081 600 MET A CA  
640  C C   . MET A 105 ? 0.6510 0.6559 0.9937 0.0183  -0.0265 -0.1064 600 MET A C   
641  O O   . MET A 105 ? 0.6429 0.6518 0.9969 0.0189  -0.0251 -0.1209 600 MET A O   
642  C CB  . MET A 105 ? 0.5835 0.6201 0.8982 0.0111  -0.0124 -0.1077 600 MET A CB  
643  C CG  . MET A 105 ? 0.6177 0.6674 0.9271 0.0091  -0.0103 -0.1049 600 MET A CG  
644  S SD  . MET A 105 ? 0.6557 0.7211 0.9530 0.0017  0.0018  -0.1046 600 MET A SD  
645  C CE  . MET A 105 ? 0.6068 0.6544 0.8811 -0.0036 0.0005  -0.0924 600 MET A CE  
646  N N   . VAL A 106 ? 0.6298 0.6153 0.9705 0.0181  -0.0320 -0.0885 601 VAL A N   
647  C CA  . VAL A 106 ? 0.6370 0.6020 0.9930 0.0154  -0.0351 -0.0798 601 VAL A CA  
648  C C   . VAL A 106 ? 0.6754 0.6413 1.0141 0.0053  -0.0258 -0.0683 601 VAL A C   
649  O O   . VAL A 106 ? 0.6735 0.6413 0.9889 0.0038  -0.0219 -0.0523 601 VAL A O   
650  C CB  . VAL A 106 ? 0.6929 0.6386 1.0588 0.0214  -0.0448 -0.0623 601 VAL A CB  
651  C CG1 . VAL A 106 ? 0.7037 0.6268 1.0926 0.0166  -0.0472 -0.0494 601 VAL A CG1 
652  C CG2 . VAL A 106 ? 0.6944 0.6422 1.0796 0.0328  -0.0548 -0.0767 601 VAL A CG2 
653  N N   . MET A 107 ? 0.6259 0.5940 0.9760 0.0002  -0.0231 -0.0796 602 MET A N   
654  C CA  . MET A 107 ? 0.6329 0.6055 0.9721 -0.0085 -0.0150 -0.0727 602 MET A CA  
655  C C   . MET A 107 ? 0.6895 0.6491 1.0575 -0.0151 -0.0173 -0.0693 602 MET A C   
656  O O   . MET A 107 ? 0.6959 0.6405 1.0943 -0.0127 -0.0264 -0.0742 602 MET A O   
657  C CB  . MET A 107 ? 0.6516 0.6443 0.9768 -0.0088 -0.0099 -0.0899 602 MET A CB  
658  C CG  . MET A 107 ? 0.6936 0.6988 0.9980 -0.0051 -0.0069 -0.0906 602 MET A CG  
659  S SD  . MET A 107 ? 0.7281 0.7562 1.0238 -0.0042 -0.0010 -0.1072 602 MET A SD  
660  C CE  . MET A 107 ? 0.6805 0.7110 0.9545 -0.0109 0.0055  -0.0954 602 MET A CE  
661  N N   . GLU A 108 ? 0.6467 0.6123 1.0103 -0.0231 -0.0100 -0.0620 603 GLU A N   
662  C CA  . GLU A 108 ? 0.6588 0.6150 1.0574 -0.0308 -0.0128 -0.0605 603 GLU A CA  
663  C C   . GLU A 108 ? 0.7133 0.6767 1.1282 -0.0289 -0.0204 -0.0913 603 GLU A C   
664  O O   . GLU A 108 ? 0.6594 0.6406 1.0501 -0.0238 -0.0181 -0.1072 603 GLU A O   
665  C CB  . GLU A 108 ? 0.6729 0.6347 1.0692 -0.0401 -0.0022 -0.0389 603 GLU A CB  
666  C CG  . GLU A 108 ? 0.7444 0.7268 1.1215 -0.0422 0.0045  -0.0482 603 GLU A CG  
667  C CD  . GLU A 108 ? 0.9591 0.9500 1.3404 -0.0500 0.0149  -0.0291 603 GLU A CD  
668  O OE1 . GLU A 108 ? 0.9964 0.9806 1.4153 -0.0585 0.0145  -0.0192 603 GLU A OE1 
669  O OE2 . GLU A 108 ? 0.7601 0.7657 1.1108 -0.0474 0.0232  -0.0247 603 GLU A OE2 
670  N N   . CYS A 109 ? 0.7242 0.6734 1.1817 -0.0316 -0.0307 -0.0998 604 CYS A N   
671  C CA  . CYS A 109 ? 0.7318 0.6888 1.2071 -0.0276 -0.0409 -0.1326 604 CYS A CA  
672  C C   . CYS A 109 ? 0.7561 0.7229 1.2441 -0.0363 -0.0403 -0.1360 604 CYS A C   
673  O O   . CYS A 109 ? 0.7470 0.7036 1.2644 -0.0478 -0.0388 -0.1180 604 CYS A O   
674  C CB  . CYS A 109 ? 0.7653 0.7032 1.2823 -0.0225 -0.0564 -0.1490 604 CYS A CB  
675  S SG  . CYS A 109 ? 0.8272 0.7825 1.3507 -0.0086 -0.0698 -0.1973 604 CYS A SG  
676  N N   . GLY A 110 ? 0.6835 0.6726 1.1490 -0.0305 -0.0407 -0.1567 605 GLY A N   
677  C CA  . GLY A 110 ? 0.6703 0.6723 1.1463 -0.0358 -0.0429 -0.1646 605 GLY A CA  
678  C C   . GLY A 110 ? 0.6915 0.6914 1.2077 -0.0325 -0.0612 -0.1956 605 GLY A C   
679  O O   . GLY A 110 ? 0.6848 0.6750 1.2151 -0.0242 -0.0713 -0.2132 605 GLY A O   
680  N N   . ASN A 111 ? 0.6447 0.6551 1.1809 -0.0376 -0.0671 -0.2053 606 ASN A N   
681  C CA  . ASN A 111 ? 0.6666 0.6784 1.2421 -0.0334 -0.0877 -0.2399 606 ASN A CA  
682  C C   . ASN A 111 ? 0.7544 0.7930 1.2928 -0.0152 -0.0944 -0.2719 606 ASN A C   
683  O O   . ASN A 111 ? 0.7635 0.8030 1.3086 -0.0022 -0.1069 -0.3008 606 ASN A O   
684  C CB  . ASN A 111 ? 0.6374 0.6504 1.2576 -0.0471 -0.0928 -0.2367 606 ASN A CB  
685  C CG  . ASN A 111 ? 1.0355 1.0239 1.7016 -0.0639 -0.0875 -0.2066 606 ASN A CG  
686  O OD1 . ASN A 111 ? 1.1714 1.1348 1.8633 -0.0643 -0.0932 -0.2036 606 ASN A OD1 
687  N ND2 . ASN A 111 ? 0.8847 0.8809 1.5635 -0.0773 -0.0763 -0.1824 606 ASN A ND2 
688  N N   . ILE A 112 ? 0.7205 0.7817 1.2179 -0.0128 -0.0851 -0.2648 607 ILE A N   
689  C CA  . ILE A 112 ? 0.7228 0.8127 1.1801 0.0039  -0.0884 -0.2865 607 ILE A CA  
690  C C   . ILE A 112 ? 0.7879 0.8902 1.1983 0.0022  -0.0709 -0.2599 607 ILE A C   
691  O O   . ILE A 112 ? 0.7846 0.8762 1.2008 -0.0108 -0.0607 -0.2337 607 ILE A O   
692  C CB  . ILE A 112 ? 0.7674 0.8714 1.2524 0.0087  -0.1093 -0.3187 607 ILE A CB  
693  C CG1 . ILE A 112 ? 0.7821 0.9187 1.2277 0.0303  -0.1171 -0.3467 607 ILE A CG1 
694  C CG2 . ILE A 112 ? 0.7527 0.8566 1.2635 -0.0062 -0.1089 -0.3040 607 ILE A CG2 
695  C CD1 . ILE A 112 ? 0.8387 0.9911 1.3122 0.0396  -0.1429 -0.3867 607 ILE A CD1 
696  N N   . ASP A 113 ? 0.7529 0.8781 1.1192 0.0158  -0.0669 -0.2655 608 ASP A N   
697  C CA  . ASP A 113 ? 0.7341 0.8681 1.0635 0.0139  -0.0530 -0.2409 608 ASP A CA  
698  C C   . ASP A 113 ? 0.7795 0.9284 1.1130 0.0151  -0.0620 -0.2484 608 ASP A C   
699  O O   . ASP A 113 ? 0.7881 0.9450 1.1457 0.0201  -0.0790 -0.2757 608 ASP A O   
700  C CB  . ASP A 113 ? 0.7596 0.9107 1.0454 0.0255  -0.0431 -0.2362 608 ASP A CB  
701  C CG  . ASP A 113 ? 0.9473 1.1285 1.2115 0.0439  -0.0510 -0.2600 608 ASP A CG  
702  O OD1 . ASP A 113 ? 1.0076 1.2021 1.2740 0.0491  -0.0632 -0.2744 608 ASP A OD1 
703  O OD2 . ASP A 113 ? 0.9779 1.1733 1.2201 0.0539  -0.0439 -0.2620 608 ASP A OD2 
704  N N   . LEU A 114 ? 0.7263 0.8788 1.0401 0.0114  -0.0529 -0.2269 609 LEU A N   
705  C CA  . LEU A 114 ? 0.7224 0.8899 1.0411 0.0132  -0.0613 -0.2322 609 LEU A CA  
706  C C   . LEU A 114 ? 0.7985 0.9931 1.0923 0.0314  -0.0735 -0.2537 609 LEU A C   
707  O O   . LEU A 114 ? 0.8079 1.0160 1.1204 0.0357  -0.0899 -0.2742 609 LEU A O   
708  C CB  . LEU A 114 ? 0.7024 0.8667 1.0054 0.0074  -0.0488 -0.2048 609 LEU A CB  
709  C CG  . LEU A 114 ? 0.7445 0.9245 1.0507 0.0105  -0.0558 -0.2064 609 LEU A CG  
710  C CD1 . LEU A 114 ? 0.7425 0.9226 1.0992 0.0005  -0.0641 -0.2164 609 LEU A CD1 
711  C CD2 . LEU A 114 ? 0.7134 0.8896 0.9970 0.0093  -0.0436 -0.1814 609 LEU A CD2 
712  N N   . ASN A 115 ? 0.7633 0.9684 1.0174 0.0425  -0.0658 -0.2494 610 ASN A N   
713  C CA  . ASN A 115 ? 0.7935 1.0291 1.0152 0.0622  -0.0736 -0.2647 610 ASN A CA  
714  C C   . ASN A 115 ? 0.8842 1.1334 1.1242 0.0735  -0.0934 -0.3045 610 ASN A C   
715  O O   . ASN A 115 ? 0.9132 1.1817 1.1541 0.0833  -0.1102 -0.3235 610 ASN A O   
716  C CB  . ASN A 115 ? 0.7932 1.0392 0.9740 0.0699  -0.0576 -0.2474 610 ASN A CB  
717  C CG  . ASN A 115 ? 1.1257 1.4056 1.2654 0.0895  -0.0604 -0.2494 610 ASN A CG  
718  O OD1 . ASN A 115 ? 1.0811 1.3758 1.2163 0.0978  -0.0744 -0.2594 610 ASN A OD1 
719  N ND2 . ASN A 115 ? 1.0840 1.3791 1.1932 0.0974  -0.0465 -0.2371 610 ASN A ND2 
720  N N   . SER A 116 ? 0.8330 1.0719 1.0907 0.0731  -0.0938 -0.3190 611 SER A N   
721  C CA  . SER A 116 ? 0.8588 1.1069 1.1399 0.0845  -0.1145 -0.3604 611 SER A CA  
722  C C   . SER A 116 ? 0.9229 1.1587 1.2581 0.0743  -0.1337 -0.3778 611 SER A C   
723  O O   . SER A 116 ? 0.9404 1.1929 1.2901 0.0869  -0.1562 -0.4143 611 SER A O   
724  C CB  . SER A 116 ? 0.8981 1.1370 1.1881 0.0877  -0.1107 -0.3713 611 SER A CB  
725  O OG  . SER A 116 ? 1.0056 1.2119 1.3162 0.0688  -0.0969 -0.3448 611 SER A OG  
726  N N   . TRP A 117 ? 0.8649 1.0760 1.2290 0.0527  -0.1251 -0.3516 612 TRP A N   
727  C CA  . TRP A 117 ? 0.8686 1.0721 1.2871 0.0408  -0.1393 -0.3614 612 TRP A CA  
728  C C   . TRP A 117 ? 0.9062 1.1381 1.3115 0.0511  -0.1520 -0.3728 612 TRP A C   
729  O O   . TRP A 117 ? 0.9098 1.1523 1.3500 0.0555  -0.1753 -0.4047 612 TRP A O   
730  C CB  . TRP A 117 ? 0.8367 1.0143 1.2823 0.0177  -0.1231 -0.3268 612 TRP A CB  
731  C CG  . TRP A 117 ? 0.8542 1.0307 1.3550 0.0045  -0.1329 -0.3299 612 TRP A CG  
732  C CD1 . TRP A 117 ? 0.8810 1.0663 1.3842 -0.0028 -0.1260 -0.3112 612 TRP A CD1 
733  C CD2 . TRP A 117 ? 0.8699 1.0384 1.4361 -0.0023 -0.1522 -0.3542 612 TRP A CD2 
734  N NE1 . TRP A 117 ? 0.8822 1.0682 1.4484 -0.0147 -0.1375 -0.3204 612 TRP A NE1 
735  C CE2 . TRP A 117 ? 0.9173 1.0920 1.5249 -0.0156 -0.1541 -0.3461 612 TRP A CE2 
736  C CE3 . TRP A 117 ? 0.9148 1.0719 1.5128 0.0020  -0.1691 -0.3836 612 TRP A CE3 
737  C CZ2 . TRP A 117 ? 0.9259 1.0956 1.6086 -0.0268 -0.1715 -0.3635 612 TRP A CZ2 
738  C CZ3 . TRP A 117 ? 0.9536 1.1025 1.6256 -0.0081 -0.1886 -0.4032 612 TRP A CZ3 
739  C CH2 . TRP A 117 ? 0.9554 1.1108 1.6705 -0.0233 -0.1895 -0.3922 612 TRP A CH2 
740  N N   . LEU A 118 ? 0.8476 1.0917 1.2047 0.0562  -0.1388 -0.3481 613 LEU A N   
741  C CA  . LEU A 118 ? 0.8608 1.1316 1.1993 0.0681  -0.1501 -0.3539 613 LEU A CA  
742  C C   . LEU A 118 ? 0.9533 1.2546 1.2646 0.0932  -0.1689 -0.3878 613 LEU A C   
743  O O   . LEU A 118 ? 0.9530 1.2736 1.2809 0.1021  -0.1917 -0.4144 613 LEU A O   
744  C CB  . LEU A 118 ? 0.8521 1.1243 1.1476 0.0682  -0.1316 -0.3171 613 LEU A CB  
745  C CG  . LEU A 118 ? 0.8825 1.1333 1.2016 0.0483  -0.1167 -0.2879 613 LEU A CG  
746  C CD1 . LEU A 118 ? 0.8647 1.1115 1.1403 0.0500  -0.0986 -0.2549 613 LEU A CD1 
747  C CD2 . LEU A 118 ? 0.8894 1.1490 1.2517 0.0426  -0.1298 -0.2975 613 LEU A CD2 
748  N N   . LYS A 119 ? 0.9443 1.2525 1.2163 0.1054  -0.1599 -0.3889 614 LYS A N   
749  C CA  . LYS A 119 ? 0.9787 1.3208 1.2182 0.1322  -0.1743 -0.4205 614 LYS A CA  
750  C C   . LYS A 119 ? 1.0675 1.4132 1.3543 0.1379  -0.2034 -0.4701 614 LYS A C   
751  O O   . LYS A 119 ? 1.0957 1.4722 1.3706 0.1583  -0.2257 -0.5010 614 LYS A O   
752  C CB  . LYS A 119 ? 1.0040 1.3533 1.2012 0.1417  -0.1553 -0.4102 614 LYS A CB  
753  C CG  . LYS A 119 ? 1.0559 1.4123 1.2025 0.1423  -0.1317 -0.3665 614 LYS A CG  
754  N N   . LYS A 120 ? 1.0240 1.3376 1.3676 0.1199  -0.2048 -0.4768 615 LYS A N   
755  C CA  . LYS A 120 ? 1.0454 1.3541 1.4478 0.1211  -0.2328 -0.5212 615 LYS A CA  
756  C C   . LYS A 120 ? 1.1378 1.4490 1.5890 0.1119  -0.2529 -0.5325 615 LYS A C   
757  O O   . LYS A 120 ? 1.1686 1.4922 1.6546 0.1219  -0.2827 -0.5768 615 LYS A O   
758  C CB  . LYS A 120 ? 1.0517 1.3224 1.5014 0.1039  -0.2265 -0.5177 615 LYS A CB  
759  N N   . LYS A 121 ? 1.0880 1.3896 1.5455 0.0938  -0.2377 -0.4952 616 LYS A N   
760  C CA  . LYS A 121 ? 1.0880 1.3949 1.5952 0.0837  -0.2530 -0.5015 616 LYS A CA  
761  C C   . LYS A 121 ? 1.1812 1.5253 1.6493 0.1038  -0.2663 -0.5109 616 LYS A C   
762  O O   . LYS A 121 ? 1.1623 1.5172 1.5673 0.1133  -0.2498 -0.4840 616 LYS A O   
763  C CB  . LYS A 121 ? 1.0745 1.3568 1.6102 0.0562  -0.2297 -0.4585 616 LYS A CB  
764  C CG  . LYS A 121 ? 1.0852 1.3373 1.6945 0.0332  -0.2297 -0.4574 616 LYS A CG  
765  C CD  . LYS A 121 ? 1.1410 1.3889 1.7960 0.0111  -0.2200 -0.4308 616 LYS A CD  
766  N N   . LYS A 122 ? 1.1951 1.5581 1.7043 0.1102  -0.2972 -0.5480 617 LYS A N   
767  C CA  . LYS A 122 ? 1.2290 1.6285 1.7065 0.1304  -0.3139 -0.5587 617 LYS A CA  
768  C C   . LYS A 122 ? 1.2801 1.6767 1.7705 0.1148  -0.3005 -0.5225 617 LYS A C   
769  O O   . LYS A 122 ? 1.2799 1.6842 1.7124 0.1231  -0.2848 -0.4922 617 LYS A O   
770  C CB  . LYS A 122 ? 1.2955 1.7185 1.8152 0.1442  -0.3549 -0.6152 617 LYS A CB  
771  N N   . SER A 123 ? 1.2167 1.6019 1.7864 0.0920  -0.3055 -0.5244 618 SER A N   
772  C CA  . SER A 123 ? 1.1801 1.5656 1.7739 0.0767  -0.2928 -0.4943 618 SER A CA  
773  C C   . SER A 123 ? 1.1744 1.5268 1.8019 0.0481  -0.2638 -0.4596 618 SER A C   
774  O O   . SER A 123 ? 1.1705 1.5033 1.8491 0.0335  -0.2662 -0.4695 618 SER A O   
775  C CB  . SER A 123 ? 1.2299 1.6392 1.8892 0.0757  -0.3216 -0.5237 618 SER A CB  
776  N N   . ILE A 124 ? 1.0778 1.4245 1.6761 0.0419  -0.2377 -0.4194 619 ILE A N   
777  C CA  . ILE A 124 ? 1.0349 1.3558 1.6523 0.0189  -0.2085 -0.3835 619 ILE A CA  
778  C C   . ILE A 124 ? 1.0371 1.3691 1.7117 0.0035  -0.2038 -0.3712 619 ILE A C   
779  O O   . ILE A 124 ? 1.0424 1.3983 1.7104 0.0132  -0.2109 -0.3725 619 ILE A O   
780  C CB  . ILE A 124 ? 1.0606 1.3659 1.6071 0.0232  -0.1822 -0.3501 619 ILE A CB  
781  C CG1 . ILE A 124 ? 1.0308 1.3140 1.5931 0.0025  -0.1538 -0.3146 619 ILE A CG1 
782  C CG2 . ILE A 124 ? 1.0885 1.4131 1.5820 0.0419  -0.1843 -0.3426 619 ILE A CG2 
783  C CD1 . ILE A 124 ? 1.0521 1.3139 1.5594 0.0036  -0.1319 -0.2892 619 ILE A CD1 
784  N N   . ASP A 125 ? 0.9403 1.2564 1.6715 -0.0196 -0.1912 -0.3575 620 ASP A N   
785  C CA  . ASP A 125 ? 0.9033 1.2315 1.6965 -0.0371 -0.1819 -0.3422 620 ASP A CA  
786  C C   . ASP A 125 ? 0.8876 1.2221 1.6446 -0.0357 -0.1567 -0.3092 620 ASP A C   
787  O O   . ASP A 125 ? 0.8719 1.1861 1.5773 -0.0346 -0.1361 -0.2856 620 ASP A O   
788  C CB  . ASP A 125 ? 0.9238 1.2311 1.7778 -0.0610 -0.1716 -0.3298 620 ASP A CB  
789  C CG  . ASP A 125 ? 1.0100 1.3336 1.9388 -0.0807 -0.1618 -0.3137 620 ASP A CG  
790  O OD1 . ASP A 125 ? 1.0299 1.3753 2.0214 -0.0838 -0.1837 -0.3382 620 ASP A OD1 
791  O OD2 . ASP A 125 ? 1.0463 1.3632 1.9738 -0.0929 -0.1327 -0.2773 620 ASP A OD2 
792  N N   . PRO A 126 ? 0.8182 1.1812 1.6059 -0.0352 -0.1590 -0.3089 621 PRO A N   
793  C CA  . PRO A 126 ? 0.7951 1.1650 1.5518 -0.0314 -0.1369 -0.2817 621 PRO A CA  
794  C C   . PRO A 126 ? 0.8133 1.1691 1.5756 -0.0476 -0.1050 -0.2481 621 PRO A C   
795  O O   . PRO A 126 ? 0.7980 1.1482 1.5129 -0.0410 -0.0869 -0.2277 621 PRO A O   
796  C CB  . PRO A 126 ? 0.8170 1.2236 1.6223 -0.0287 -0.1490 -0.2937 621 PRO A CB  
797  C CG  . PRO A 126 ? 0.8894 1.3072 1.7220 -0.0224 -0.1831 -0.3311 621 PRO A CG  
798  C CD  . PRO A 126 ? 0.8404 1.2325 1.6932 -0.0360 -0.1838 -0.3363 621 PRO A CD  
799  N N   . TRP A 127 ? 0.7572 1.1073 1.5775 -0.0677 -0.0993 -0.2422 622 TRP A N   
800  C CA  . TRP A 127 ? 0.7476 1.0870 1.5727 -0.0819 -0.0696 -0.2083 622 TRP A CA  
801  C C   . TRP A 127 ? 0.7934 1.0978 1.5584 -0.0785 -0.0609 -0.1974 622 TRP A C   
802  O O   . TRP A 127 ? 0.7956 1.0933 1.5210 -0.0767 -0.0389 -0.1731 622 TRP A O   
803  C CB  . TRP A 127 ? 0.7435 1.0886 1.6529 -0.1046 -0.0659 -0.2006 622 TRP A CB  
804  C CG  . TRP A 127 ? 0.7580 1.1067 1.6780 -0.1173 -0.0332 -0.1618 622 TRP A CG  
805  C CD1 . TRP A 127 ? 0.7943 1.1768 1.7438 -0.1215 -0.0145 -0.1445 622 TRP A CD1 
806  C CD2 . TRP A 127 ? 0.7584 1.0793 1.6595 -0.1256 -0.0155 -0.1358 622 TRP A CD2 
807  N NE1 . TRP A 127 ? 0.7933 1.1727 1.7403 -0.1314 0.0147  -0.1085 622 TRP A NE1 
808  C CE2 . TRP A 127 ? 0.8135 1.1540 1.7292 -0.1338 0.0139  -0.1020 622 TRP A CE2 
809  C CE3 . TRP A 127 ? 0.7835 1.0671 1.6580 -0.1258 -0.0220 -0.1380 622 TRP A CE3 
810  C CZ2 . TRP A 127 ? 0.8127 1.1363 1.7128 -0.1413 0.0359  -0.0695 622 TRP A CZ2 
811  C CZ3 . TRP A 127 ? 0.8121 1.0769 1.6744 -0.1338 -0.0010 -0.1065 622 TRP A CZ3 
812  C CH2 . TRP A 127 ? 0.8215 1.1059 1.6948 -0.1412 0.0270  -0.0722 622 TRP A CH2 
813  N N   . GLU A 128 ? 0.7282 1.0126 1.4859 -0.0758 -0.0791 -0.2177 623 GLU A N   
814  C CA  . GLU A 128 ? 0.7160 0.9706 1.4202 -0.0717 -0.0716 -0.2091 623 GLU A CA  
815  C C   . GLU A 128 ? 0.7042 0.9577 1.3341 -0.0540 -0.0677 -0.2062 623 GLU A C   
816  O O   . GLU A 128 ? 0.6926 0.9275 1.2817 -0.0533 -0.0521 -0.1877 623 GLU A O   
817  C CB  . GLU A 128 ? 0.7575 0.9929 1.4777 -0.0729 -0.0900 -0.2313 623 GLU A CB  
818  C CG  . GLU A 128 ? 0.9527 1.1962 1.6479 -0.0550 -0.1156 -0.2664 623 GLU A CG  
819  C CD  . GLU A 128 ? 1.2569 1.4830 1.9647 -0.0533 -0.1324 -0.2904 623 GLU A CD  
820  O OE1 . GLU A 128 ? 1.1493 1.3532 1.8213 -0.0511 -0.1228 -0.2811 623 GLU A OE1 
821  O OE2 . GLU A 128 ? 1.1088 1.3448 1.8643 -0.0530 -0.1568 -0.3211 623 GLU A OE2 
822  N N   . ARG A 129 ? 0.6202 0.8939 1.2363 -0.0401 -0.0821 -0.2226 624 ARG A N   
823  C CA  . ARG A 129 ? 0.5962 0.8695 1.1491 -0.0235 -0.0797 -0.2172 624 ARG A CA  
824  C C   . ARG A 129 ? 0.6339 0.9085 1.1749 -0.0253 -0.0579 -0.1918 624 ARG A C   
825  O O   . ARG A 129 ? 0.6284 0.8862 1.1222 -0.0201 -0.0469 -0.1779 624 ARG A O   
826  C CB  . ARG A 129 ? 0.5780 0.8735 1.1247 -0.0077 -0.1019 -0.2388 624 ARG A CB  
827  C CG  . ARG A 129 ? 0.6187 0.9146 1.1081 0.0091  -0.1000 -0.2287 624 ARG A CG  
828  C CD  . ARG A 129 ? 0.7082 1.0278 1.1927 0.0259  -0.1227 -0.2468 624 ARG A CD  
829  N NE  . ARG A 129 ? 0.7434 1.0879 1.2891 0.0208  -0.1343 -0.2621 624 ARG A NE  
830  C CZ  . ARG A 129 ? 0.8512 1.2181 1.4149 0.0307  -0.1602 -0.2885 624 ARG A CZ  
831  N NH1 . ARG A 129 ? 0.6536 1.0231 1.1728 0.0482  -0.1767 -0.3018 624 ARG A NH1 
832  N NH2 . ARG A 129 ? 0.6856 1.0757 1.3125 0.0239  -0.1701 -0.3017 624 ARG A NH2 
833  N N   . LYS A 130 ? 0.5746 0.8710 1.1615 -0.0325 -0.0515 -0.1870 625 LYS A N   
834  C CA  . LYS A 130 ? 0.5520 0.8551 1.1311 -0.0325 -0.0300 -0.1657 625 LYS A CA  
835  C C   . LYS A 130 ? 0.6062 0.8864 1.1653 -0.0411 -0.0106 -0.1449 625 LYS A C   
836  O O   . LYS A 130 ? 0.6008 0.8696 1.1152 -0.0334 -0.0004 -0.1339 625 LYS A O   
837  C CB  . LYS A 130 ? 0.5533 0.8882 1.1919 -0.0401 -0.0243 -0.1639 625 LYS A CB  
838  C CG  . LYS A 130 ? 0.4738 0.8289 1.1014 -0.0282 -0.0158 -0.1586 625 LYS A CG  
839  C CD  . LYS A 130 ? 0.5352 0.9281 1.2272 -0.0352 -0.0100 -0.1583 625 LYS A CD  
840  C CE  . LYS A 130 ? 0.5413 0.9613 1.2493 -0.0216 -0.0255 -0.1754 625 LYS A CE  
841  N NZ  . LYS A 130 ? 0.5648 1.0181 1.2999 -0.0191 -0.0075 -0.1660 625 LYS A NZ  
842  N N   . SER A 131 ? 0.5602 0.8315 1.1531 -0.0560 -0.0088 -0.1414 626 SER A N   
843  C CA  . SER A 131 ? 0.5606 0.8106 1.1402 -0.0640 0.0066  -0.1214 626 SER A CA  
844  C C   . SER A 131 ? 0.6383 0.8623 1.1586 -0.0546 0.0044  -0.1225 626 SER A C   
845  O O   . SER A 131 ? 0.6582 0.8733 1.1468 -0.0522 0.0189  -0.1060 626 SER A O   
846  C CB  . SER A 131 ? 0.6140 0.8553 1.2441 -0.0798 0.0025  -0.1209 626 SER A CB  
847  O OG  . SER A 131 ? 0.7434 0.9644 1.3600 -0.0861 0.0172  -0.0987 626 SER A OG  
848  N N   . TYR A 132 ? 0.5776 0.7933 1.0839 -0.0481 -0.0136 -0.1424 627 TYR A N   
849  C CA  . TYR A 132 ? 0.5642 0.7600 1.0197 -0.0394 -0.0155 -0.1436 627 TYR A CA  
850  C C   . TYR A 132 ? 0.6098 0.8063 1.0228 -0.0283 -0.0092 -0.1352 627 TYR A C   
851  O O   . TYR A 132 ? 0.6028 0.7823 0.9824 -0.0262 -0.0015 -0.1250 627 TYR A O   
852  C CB  . TYR A 132 ? 0.5886 0.7841 1.0399 -0.0327 -0.0349 -0.1671 627 TYR A CB  
853  C CG  . TYR A 132 ? 0.6214 0.8071 1.1080 -0.0414 -0.0430 -0.1784 627 TYR A CG  
854  C CD1 . TYR A 132 ? 0.6345 0.8040 1.1424 -0.0542 -0.0313 -0.1618 627 TYR A CD1 
855  C CD2 . TYR A 132 ? 0.6491 0.8419 1.1489 -0.0355 -0.0638 -0.2062 627 TYR A CD2 
856  C CE1 . TYR A 132 ? 0.6338 0.7908 1.1795 -0.0619 -0.0403 -0.1713 627 TYR A CE1 
857  C CE2 . TYR A 132 ? 0.6836 0.8655 1.2205 -0.0421 -0.0738 -0.2203 627 TYR A CE2 
858  C CZ  . TYR A 132 ? 0.7797 0.9417 1.3414 -0.0559 -0.0621 -0.2021 627 TYR A CZ  
859  O OH  . TYR A 132 ? 0.8208 0.9690 1.4247 -0.0623 -0.0737 -0.2154 627 TYR A OH  
860  N N   . TRP A 133 ? 0.5636 0.7792 0.9823 -0.0210 -0.0141 -0.1403 628 TRP A N   
861  C CA  . TRP A 133 ? 0.5452 0.7615 0.9330 -0.0095 -0.0110 -0.1340 628 TRP A CA  
862  C C   . TRP A 133 ? 0.5748 0.7853 0.9540 -0.0120 0.0068  -0.1180 628 TRP A C   
863  O O   . TRP A 133 ? 0.5750 0.7692 0.9200 -0.0065 0.0103  -0.1114 628 TRP A O   
864  C CB  . TRP A 133 ? 0.5274 0.7677 0.9346 -0.0016 -0.0202 -0.1430 628 TRP A CB  
865  C CG  . TRP A 133 ? 0.5395 0.7783 0.9198 0.0118  -0.0202 -0.1378 628 TRP A CG  
866  C CD1 . TRP A 133 ? 0.5715 0.8244 0.9642 0.0175  -0.0145 -0.1353 628 TRP A CD1 
867  C CD2 . TRP A 133 ? 0.5442 0.7656 0.8843 0.0215  -0.0260 -0.1336 628 TRP A CD2 
868  N NE1 . TRP A 133 ? 0.5648 0.8071 0.9293 0.0306  -0.0189 -0.1320 628 TRP A NE1 
869  C CE2 . TRP A 133 ? 0.5888 0.8114 0.9221 0.0323  -0.0259 -0.1290 628 TRP A CE2 
870  C CE3 . TRP A 133 ? 0.5633 0.7708 0.8754 0.0226  -0.0312 -0.1329 628 TRP A CE3 
871  C CZ2 . TRP A 133 ? 0.5859 0.7921 0.8891 0.0423  -0.0314 -0.1214 628 TRP A CZ2 
872  C CZ3 . TRP A 133 ? 0.5885 0.7842 0.8687 0.0322  -0.0340 -0.1235 628 TRP A CZ3 
873  C CH2 . TRP A 133 ? 0.5984 0.7916 0.8760 0.0411  -0.0346 -0.1168 628 TRP A CH2 
874  N N   . LYS A 134 ? 0.5131 0.7387 0.9253 -0.0203 0.0176  -0.1115 629 LYS A N   
875  C CA  . LYS A 134 ? 0.5100 0.7381 0.9156 -0.0213 0.0357  -0.0962 629 LYS A CA  
876  C C   . LYS A 134 ? 0.5910 0.7932 0.9652 -0.0234 0.0402  -0.0874 629 LYS A C   
877  O O   . LYS A 134 ? 0.6120 0.8079 0.9570 -0.0158 0.0462  -0.0824 629 LYS A O   
878  C CB  . LYS A 134 ? 0.5329 0.7821 0.9832 -0.0328 0.0473  -0.0868 629 LYS A CB  
879  C CG  . LYS A 134 ? 0.5852 0.8668 1.0730 -0.0310 0.0469  -0.0932 629 LYS A CG  
880  C CD  . LYS A 134 ? 0.6113 0.9167 1.1362 -0.0412 0.0662  -0.0760 629 LYS A CD  
881  C CE  . LYS A 134 ? 0.5252 0.8599 1.1107 -0.0492 0.0638  -0.0808 629 LYS A CE  
882  N NZ  . LYS A 134 ? 0.5940 0.9465 1.2182 -0.0632 0.0841  -0.0578 629 LYS A NZ  
883  N N   . ASN A 135 ? 0.5357 0.7234 0.9182 -0.0323 0.0350  -0.0883 630 ASN A N   
884  C CA  . ASN A 135 ? 0.5356 0.7004 0.8952 -0.0344 0.0372  -0.0817 630 ASN A CA  
885  C C   . ASN A 135 ? 0.6104 0.7603 0.9306 -0.0251 0.0311  -0.0868 630 ASN A C   
886  O O   . ASN A 135 ? 0.6065 0.7441 0.9034 -0.0228 0.0364  -0.0792 630 ASN A O   
887  C CB  . ASN A 135 ? 0.5304 0.6854 0.9146 -0.0439 0.0302  -0.0859 630 ASN A CB  
888  C CG  . ASN A 135 ? 0.7573 0.9199 1.1852 -0.0561 0.0371  -0.0752 630 ASN A CG  
889  O OD1 . ASN A 135 ? 0.6289 0.7846 1.0885 -0.0641 0.0286  -0.0815 630 ASN A OD1 
890  N ND2 . ASN A 135 ? 0.6982 0.8762 1.1316 -0.0573 0.0525  -0.0585 630 ASN A ND2 
891  N N   . MET A 136 ? 0.5782 0.7307 0.8932 -0.0194 0.0196  -0.0984 631 MET A N   
892  C CA  . MET A 136 ? 0.5768 0.7183 0.8605 -0.0113 0.0145  -0.0996 631 MET A CA  
893  C C   . MET A 136 ? 0.6314 0.7711 0.9006 -0.0042 0.0194  -0.0936 631 MET A C   
894  O O   . MET A 136 ? 0.6409 0.7654 0.8892 -0.0017 0.0202  -0.0893 631 MET A O   
895  C CB  . MET A 136 ? 0.6121 0.7629 0.8946 -0.0050 0.0022  -0.1098 631 MET A CB  
896  C CG  . MET A 136 ? 0.6703 0.8229 0.9608 -0.0080 -0.0054 -0.1207 631 MET A CG  
897  S SD  . MET A 136 ? 0.7432 0.9111 1.0226 0.0037  -0.0208 -0.1334 631 MET A SD  
898  C CE  . MET A 136 ? 0.7091 0.8956 1.0315 -0.0004 -0.0307 -0.1501 631 MET A CE  
899  N N   . LEU A 137 ? 0.5531 0.7098 0.8373 -0.0003 0.0217  -0.0953 632 LEU A N   
900  C CA  . LEU A 137 ? 0.5421 0.6993 0.8156 0.0091  0.0251  -0.0941 632 LEU A CA  
901  C C   . LEU A 137 ? 0.5895 0.7406 0.8507 0.0080  0.0351  -0.0878 632 LEU A C   
902  O O   . LEU A 137 ? 0.5804 0.7185 0.8229 0.0146  0.0327  -0.0889 632 LEU A O   
903  C CB  . LEU A 137 ? 0.5404 0.7214 0.8347 0.0151  0.0265  -0.0989 632 LEU A CB  
904  C CG  . LEU A 137 ? 0.5959 0.7864 0.9028 0.0195  0.0143  -0.1064 632 LEU A CG  
905  C CD1 . LEU A 137 ? 0.5850 0.8041 0.9219 0.0227  0.0175  -0.1113 632 LEU A CD1 
906  C CD2 . LEU A 137 ? 0.6330 0.8076 0.9189 0.0300  0.0035  -0.1063 632 LEU A CD2 
907  N N   . GLU A 138 ? 0.5518 0.7115 0.8253 -0.0003 0.0449  -0.0805 633 GLU A N   
908  C CA  . GLU A 138 ? 0.5563 0.7132 0.8162 -0.0004 0.0545  -0.0714 633 GLU A CA  
909  C C   . GLU A 138 ? 0.6261 0.7583 0.8632 -0.0007 0.0482  -0.0714 633 GLU A C   
910  O O   . GLU A 138 ? 0.6343 0.7613 0.8519 0.0067  0.0486  -0.0723 633 GLU A O   
911  C CB  . GLU A 138 ? 0.5726 0.7401 0.8538 -0.0108 0.0647  -0.0589 633 GLU A CB  
912  C CG  . GLU A 138 ? 0.7614 0.9345 1.0272 -0.0076 0.0767  -0.0459 633 GLU A CG  
913  C CD  . GLU A 138 ? 1.1237 1.3050 1.4093 -0.0176 0.0883  -0.0266 633 GLU A CD  
914  O OE1 . GLU A 138 ? 1.0300 1.2228 1.3522 -0.0273 0.0911  -0.0231 633 GLU A OE1 
915  O OE2 . GLU A 138 ? 1.0529 1.2298 1.3194 -0.0153 0.0939  -0.0142 633 GLU A OE2 
916  N N   . ALA A 139 ? 0.5707 0.6904 0.8121 -0.0079 0.0417  -0.0726 634 ALA A N   
917  C CA  . ALA A 139 ? 0.5661 0.6671 0.7923 -0.0090 0.0369  -0.0724 634 ALA A CA  
918  C C   . ALA A 139 ? 0.6500 0.7417 0.8619 -0.0020 0.0301  -0.0772 634 ALA A C   
919  O O   . ALA A 139 ? 0.6533 0.7356 0.8530 0.0015  0.0288  -0.0772 634 ALA A O   
920  C CB  . ALA A 139 ? 0.5654 0.6617 0.8023 -0.0161 0.0325  -0.0750 634 ALA A CB  
921  N N   . VAL A 140 ? 0.6238 0.7183 0.8395 0.0006  0.0247  -0.0808 635 VAL A N   
922  C CA  . VAL A 140 ? 0.6347 0.7188 0.8427 0.0065  0.0181  -0.0813 635 VAL A CA  
923  C C   . VAL A 140 ? 0.6924 0.7745 0.8974 0.0148  0.0174  -0.0857 635 VAL A C   
924  O O   . VAL A 140 ? 0.6947 0.7627 0.8948 0.0170  0.0126  -0.0868 635 VAL A O   
925  C CB  . VAL A 140 ? 0.6945 0.7835 0.9059 0.0094  0.0121  -0.0809 635 VAL A CB  
926  C CG1 . VAL A 140 ? 0.6949 0.7704 0.9019 0.0143  0.0058  -0.0759 635 VAL A CG1 
927  C CG2 . VAL A 140 ? 0.6957 0.7897 0.9064 0.0040  0.0116  -0.0805 635 VAL A CG2 
928  N N   . HIS A 141 ? 0.6557 0.7541 0.8659 0.0198  0.0224  -0.0896 636 HIS A N   
929  C CA  . HIS A 141 ? 0.6754 0.7772 0.8804 0.0308  0.0225  -0.0972 636 HIS A CA  
930  C C   . HIS A 141 ? 0.7321 0.8256 0.9225 0.0318  0.0228  -0.0982 636 HIS A C   
931  O O   . HIS A 141 ? 0.7485 0.8336 0.9342 0.0407  0.0152  -0.1078 636 HIS A O   
932  C CB  . HIS A 141 ? 0.6955 0.8237 0.9082 0.0355  0.0321  -0.0990 636 HIS A CB  
933  C CG  . HIS A 141 ? 0.7556 0.8937 0.9623 0.0506  0.0326  -0.1100 636 HIS A CG  
934  N ND1 . HIS A 141 ? 0.7859 0.9497 0.9885 0.0559  0.0454  -0.1090 636 HIS A ND1 
935  C CD2 . HIS A 141 ? 0.7897 0.9168 0.9959 0.0623  0.0216  -0.1224 636 HIS A CD2 
936  C CE1 . HIS A 141 ? 0.7960 0.9659 0.9916 0.0723  0.0418  -0.1237 636 HIS A CE1 
937  N NE2 . HIS A 141 ? 0.8017 0.9481 1.0015 0.0766  0.0263  -0.1335 636 HIS A NE2 
938  N N   . THR A 142 ? 0.6650 0.7601 0.8506 0.0236  0.0293  -0.0896 637 THR A N   
939  C CA  . THR A 142 ? 0.6617 0.7513 0.8327 0.0256  0.0286  -0.0892 637 THR A CA  
940  C C   . THR A 142 ? 0.6954 0.7644 0.8658 0.0250  0.0168  -0.0947 637 THR A C   
941  O O   . THR A 142 ? 0.7024 0.7675 0.8654 0.0335  0.0098  -0.1043 637 THR A O   
942  C CB  . THR A 142 ? 0.7351 0.8286 0.9060 0.0170  0.0368  -0.0765 637 THR A CB  
943  O OG1 . THR A 142 ? 0.7221 0.8350 0.9022 0.0156  0.0478  -0.0697 637 THR A OG1 
944  C CG2 . THR A 142 ? 0.7738 0.8656 0.9274 0.0219  0.0361  -0.0742 637 THR A CG2 
945  N N   . ILE A 143 ? 0.6145 0.6732 0.7947 0.0158  0.0145  -0.0892 638 ILE A N   
946  C CA  . ILE A 143 ? 0.5836 0.6264 0.7696 0.0129  0.0062  -0.0900 638 ILE A CA  
947  C C   . ILE A 143 ? 0.6322 0.6664 0.8255 0.0207  -0.0032 -0.0984 638 ILE A C   
948  O O   . ILE A 143 ? 0.6491 0.6722 0.8479 0.0228  -0.0123 -0.1051 638 ILE A O   
949  C CB  . ILE A 143 ? 0.5973 0.6379 0.7903 0.0032  0.0088  -0.0806 638 ILE A CB  
950  C CG1 . ILE A 143 ? 0.5917 0.6346 0.7899 0.0036  0.0083  -0.0767 638 ILE A CG1 
951  C CG2 . ILE A 143 ? 0.5626 0.6103 0.7526 -0.0024 0.0156  -0.0767 638 ILE A CG2 
952  C CD1 . ILE A 143 ? 0.5752 0.6187 0.7759 -0.0021 0.0097  -0.0678 638 ILE A CD1 
953  N N   . HIS A 144 ? 0.5803 0.6202 0.7769 0.0262  -0.0025 -0.1002 639 HIS A N   
954  C CA  . HIS A 144 ? 0.5777 0.6080 0.7847 0.0353  -0.0126 -0.1091 639 HIS A CA  
955  C C   . HIS A 144 ? 0.6391 0.6711 0.8406 0.0474  -0.0188 -0.1267 639 HIS A C   
956  O O   . HIS A 144 ? 0.6390 0.6549 0.8530 0.0519  -0.0319 -0.1366 639 HIS A O   
957  C CB  . HIS A 144 ? 0.5736 0.6121 0.7858 0.0402  -0.0111 -0.1076 639 HIS A CB  
958  C CG  . HIS A 144 ? 0.6056 0.6407 0.8232 0.0327  -0.0106 -0.0931 639 HIS A CG  
959  N ND1 . HIS A 144 ? 0.6258 0.6699 0.8477 0.0374  -0.0112 -0.0911 639 HIS A ND1 
960  C CD2 . HIS A 144 ? 0.6212 0.6488 0.8394 0.0229  -0.0097 -0.0808 639 HIS A CD2 
961  C CE1 . HIS A 144 ? 0.6121 0.6535 0.8333 0.0313  -0.0114 -0.0778 639 HIS A CE1 
962  N NE2 . HIS A 144 ? 0.6170 0.6497 0.8355 0.0226  -0.0094 -0.0709 639 HIS A NE2 
963  N N   . GLN A 145 ? 0.5993 0.6512 0.7829 0.0526  -0.0097 -0.1299 640 GLN A N   
964  C CA  . GLN A 145 ? 0.6207 0.6817 0.7908 0.0669  -0.0137 -0.1461 640 GLN A CA  
965  C C   . GLN A 145 ? 0.7440 0.7918 0.9121 0.0660  -0.0246 -0.1522 640 GLN A C   
966  O O   . GLN A 145 ? 0.7822 0.8331 0.9432 0.0799  -0.0344 -0.1709 640 GLN A O   
967  C CB  . GLN A 145 ? 0.6275 0.7158 0.7779 0.0711  0.0015  -0.1406 640 GLN A CB  
968  C CG  . GLN A 145 ? 0.6921 0.7981 0.8498 0.0740  0.0112  -0.1383 640 GLN A CG  
969  C CD  . GLN A 145 ? 0.9368 1.0729 1.0809 0.0782  0.0274  -0.1314 640 GLN A CD  
970  O OE1 . GLN A 145 ? 0.9091 1.0492 1.0479 0.0680  0.0368  -0.1148 640 GLN A OE1 
971  N NE2 . GLN A 145 ? 0.8269 0.9856 0.9682 0.0937  0.0314  -0.1429 640 GLN A NE2 
972  N N   . HIS A 146 ? 0.7002 0.7361 0.8760 0.0512  -0.0239 -0.1389 641 HIS A N   
973  C CA  . HIS A 146 ? 0.6998 0.7252 0.8802 0.0485  -0.0342 -0.1433 641 HIS A CA  
974  C C   . HIS A 146 ? 0.7337 0.7378 0.9446 0.0403  -0.0451 -0.1429 641 HIS A C   
975  O O   . HIS A 146 ? 0.7408 0.7371 0.9640 0.0348  -0.0527 -0.1441 641 HIS A O   
976  C CB  . HIS A 146 ? 0.7071 0.7395 0.8751 0.0407  -0.0251 -0.1297 641 HIS A CB  
977  C CG  . HIS A 146 ? 0.7780 0.8296 0.9194 0.0505  -0.0177 -0.1295 641 HIS A CG  
978  N ND1 . HIS A 146 ? 0.8086 0.8749 0.9422 0.0494  -0.0025 -0.1184 641 HIS A ND1 
979  C CD2 . HIS A 146 ? 0.8292 0.8897 0.9516 0.0626  -0.0237 -0.1383 641 HIS A CD2 
980  C CE1 . HIS A 146 ? 0.8193 0.9029 0.9307 0.0594  0.0026  -0.1171 641 HIS A CE1 
981  N NE2 . HIS A 146 ? 0.8391 0.9205 0.9395 0.0688  -0.0099 -0.1289 641 HIS A NE2 
982  N N   . GLY A 147 ? 0.6757 0.6717 0.9008 0.0403  -0.0462 -0.1405 642 GLY A N   
983  C CA  . GLY A 147 ? 0.6755 0.6513 0.9314 0.0328  -0.0547 -0.1344 642 GLY A CA  
984  C C   . GLY A 147 ? 0.7348 0.7101 0.9971 0.0180  -0.0442 -0.1105 642 GLY A C   
985  O O   . GLY A 147 ? 0.7332 0.6952 1.0211 0.0105  -0.0486 -0.1002 642 GLY A O   
986  N N   . ILE A 148 ? 0.7018 0.6926 0.9430 0.0142  -0.0305 -0.1013 643 ILE A N   
987  C CA  . ILE A 148 ? 0.6993 0.6939 0.9426 0.0033  -0.0210 -0.0829 643 ILE A CA  
988  C C   . ILE A 148 ? 0.7346 0.7333 0.9736 0.0045  -0.0160 -0.0728 643 ILE A C   
989  O O   . ILE A 148 ? 0.7306 0.7396 0.9561 0.0101  -0.0123 -0.0778 643 ILE A O   
990  C CB  . ILE A 148 ? 0.7264 0.7336 0.9551 -0.0013 -0.0121 -0.0809 643 ILE A CB  
991  C CG1 . ILE A 148 ? 0.7345 0.7390 0.9659 -0.0004 -0.0188 -0.0903 643 ILE A CG1 
992  C CG2 . ILE A 148 ? 0.7261 0.7405 0.9570 -0.0098 -0.0033 -0.0666 643 ILE A CG2 
993  C CD1 . ILE A 148 ? 0.8525 0.8672 1.0645 0.0022  -0.0134 -0.0926 643 ILE A CD1 
994  N N   . VAL A 149 ? 0.6689 0.6622 0.9207 -0.0007 -0.0157 -0.0570 644 VAL A N   
995  C CA  . VAL A 149 ? 0.6543 0.6540 0.8998 0.0008  -0.0116 -0.0439 644 VAL A CA  
996  C C   . VAL A 149 ? 0.6885 0.7024 0.9258 -0.0065 -0.0013 -0.0326 644 VAL A C   
997  O O   . VAL A 149 ? 0.6747 0.6866 0.9250 -0.0134 0.0009  -0.0234 644 VAL A O   
998  C CB  . VAL A 149 ? 0.7181 0.7022 0.9830 0.0028  -0.0193 -0.0316 644 VAL A CB  
999  C CG1 . VAL A 149 ? 0.7226 0.7168 0.9774 0.0040  -0.0142 -0.0124 644 VAL A CG1 
1000 C CG2 . VAL A 149 ? 0.7250 0.6975 0.9975 0.0134  -0.0304 -0.0469 644 VAL A CG2 
1001 N N   . HIS A 150 ? 0.6541 0.6840 0.8731 -0.0045 0.0044  -0.0358 645 HIS A N   
1002 C CA  . HIS A 150 ? 0.6379 0.6835 0.8479 -0.0081 0.0126  -0.0309 645 HIS A CA  
1003 C C   . HIS A 150 ? 0.7491 0.8017 0.9590 -0.0081 0.0163  -0.0112 645 HIS A C   
1004 O O   . HIS A 150 ? 0.7488 0.8089 0.9636 -0.0130 0.0231  -0.0025 645 HIS A O   
1005 C CB  . HIS A 150 ? 0.6220 0.6814 0.8181 -0.0049 0.0144  -0.0417 645 HIS A CB  
1006 C CG  . HIS A 150 ? 0.6544 0.7281 0.8441 -0.0068 0.0203  -0.0436 645 HIS A CG  
1007 N ND1 . HIS A 150 ? 0.6775 0.7650 0.8603 -0.0049 0.0247  -0.0330 645 HIS A ND1 
1008 C CD2 . HIS A 150 ? 0.6635 0.7403 0.8536 -0.0091 0.0220  -0.0549 645 HIS A CD2 
1009 C CE1 . HIS A 150 ? 0.6687 0.7683 0.8480 -0.0051 0.0287  -0.0418 645 HIS A CE1 
1010 N NE2 . HIS A 150 ? 0.6620 0.7534 0.8474 -0.0080 0.0262  -0.0551 645 HIS A NE2 
1011 N N   . SER A 151 ? 0.7634 0.8160 0.9682 -0.0017 0.0124  -0.0027 646 SER A N   
1012 C CA  . SER A 151 ? 0.8052 0.8650 1.0061 0.0010  0.0151  0.0203  646 SER A CA  
1013 C C   . SER A 151 ? 0.8817 0.9696 1.0588 0.0060  0.0224  0.0237  646 SER A C   
1014 O O   . SER A 151 ? 0.9085 1.0068 1.0736 0.0130  0.0226  0.0405  646 SER A O   
1015 C CB  . SER A 151 ? 0.8876 0.9354 1.1120 -0.0067 0.0176  0.0396  646 SER A CB  
1016 O OG  . SER A 151 ? 1.1149 1.1758 1.3419 -0.0135 0.0275  0.0401  646 SER A OG  
1017 N N   . ASP A 152 ? 0.8099 0.9106 0.9801 0.0042  0.0271  0.0078  647 ASP A N   
1018 C CA  . ASP A 152 ? 0.8034 0.9315 0.9523 0.0113  0.0316  0.0043  647 ASP A CA  
1019 C C   . ASP A 152 ? 0.8159 0.9496 0.9592 0.0146  0.0255  -0.0219 647 ASP A C   
1020 O O   . ASP A 152 ? 0.8270 0.9715 0.9683 0.0145  0.0285  -0.0354 647 ASP A O   
1021 C CB  . ASP A 152 ? 0.8307 0.9748 0.9806 0.0084  0.0437  0.0126  647 ASP A CB  
1022 C CG  . ASP A 152 ? 0.9713 1.1486 1.0963 0.0195  0.0489  0.0098  647 ASP A CG  
1023 O OD1 . ASP A 152 ? 0.9938 1.1850 1.0998 0.0289  0.0480  0.0231  647 ASP A OD1 
1024 O OD2 . ASP A 152 ? 1.0360 1.2262 1.1601 0.0206  0.0526  -0.0065 647 ASP A OD2 
1025 N N   . LEU A 153 ? 0.7250 0.8516 0.8700 0.0176  0.0165  -0.0290 648 LEU A N   
1026 C CA  . LEU A 153 ? 0.6888 0.8208 0.8365 0.0188  0.0106  -0.0512 648 LEU A CA  
1027 C C   . LEU A 153 ? 0.7492 0.9059 0.8814 0.0292  0.0054  -0.0602 648 LEU A C   
1028 O O   . LEU A 153 ? 0.7597 0.9271 0.8771 0.0383  0.0020  -0.0496 648 LEU A O   
1029 C CB  . LEU A 153 ? 0.6713 0.7910 0.8321 0.0174  0.0047  -0.0562 648 LEU A CB  
1030 C CG  . LEU A 153 ? 0.7069 0.8073 0.8815 0.0095  0.0080  -0.0569 648 LEU A CG  
1031 C CD1 . LEU A 153 ? 0.7086 0.8032 0.8923 0.0123  0.0032  -0.0601 648 LEU A CD1 
1032 C CD2 . LEU A 153 ? 0.6981 0.7981 0.8791 0.0033  0.0115  -0.0684 648 LEU A CD2 
1033 N N   . LYS A 154 ? 0.7018 0.8670 0.8383 0.0290  0.0034  -0.0807 649 LYS A N   
1034 C CA  . LYS A 154 ? 0.7086 0.8978 0.8350 0.0397  -0.0045 -0.0982 649 LYS A CA  
1035 C C   . LYS A 154 ? 0.7488 0.9330 0.8995 0.0344  -0.0117 -0.1219 649 LYS A C   
1036 O O   . LYS A 154 ? 0.7410 0.9068 0.9089 0.0236  -0.0064 -0.1208 649 LYS A O   
1037 C CB  . LYS A 154 ? 0.7423 0.9490 0.8521 0.0457  0.0030  -0.0986 649 LYS A CB  
1038 C CG  . LYS A 154 ? 0.8296 1.0494 0.9163 0.0518  0.0123  -0.0730 649 LYS A CG  
1039 C CD  . LYS A 154 ? 0.9103 1.1429 0.9926 0.0519  0.0249  -0.0701 649 LYS A CD  
1040 C CE  . LYS A 154 ? 0.9547 1.1627 1.0608 0.0369  0.0324  -0.0629 649 LYS A CE  
1041 N NZ  . LYS A 154 ? 1.0407 1.2609 1.1505 0.0373  0.0411  -0.0695 649 LYS A NZ  
1042 N N   . PRO A 155 ? 0.6968 0.8977 0.8513 0.0422  -0.0243 -0.1437 650 PRO A N   
1043 C CA  . PRO A 155 ? 0.6791 0.8731 0.8651 0.0352  -0.0311 -0.1646 650 PRO A CA  
1044 C C   . PRO A 155 ? 0.7180 0.9029 0.9109 0.0309  -0.0250 -0.1699 650 PRO A C   
1045 O O   . PRO A 155 ? 0.7045 0.8721 0.9245 0.0204  -0.0248 -0.1731 650 PRO A O   
1046 C CB  . PRO A 155 ? 0.7107 0.9277 0.8985 0.0470  -0.0480 -0.1892 650 PRO A CB  
1047 C CG  . PRO A 155 ? 0.7740 1.0067 0.9334 0.0583  -0.0504 -0.1772 650 PRO A CG  
1048 C CD  . PRO A 155 ? 0.7245 0.9516 0.8578 0.0580  -0.0346 -0.1510 650 PRO A CD  
1049 N N   . ALA A 156 ? 0.6841 0.8815 0.8533 0.0392  -0.0187 -0.1678 651 ALA A N   
1050 C CA  . ALA A 156 ? 0.6734 0.8660 0.8494 0.0375  -0.0130 -0.1737 651 ALA A CA  
1051 C C   . ALA A 156 ? 0.6685 0.8353 0.8579 0.0238  -0.0033 -0.1566 651 ALA A C   
1052 O O   . ALA A 156 ? 0.6584 0.8174 0.8612 0.0215  -0.0021 -0.1634 651 ALA A O   
1053 C CB  . ALA A 156 ? 0.6993 0.9170 0.8477 0.0500  -0.0059 -0.1723 651 ALA A CB  
1054 N N   . ASN A 157 ? 0.5994 0.7538 0.7861 0.0165  0.0014  -0.1368 652 ASN A N   
1055 C CA  . ASN A 157 ? 0.5693 0.7021 0.7645 0.0060  0.0085  -0.1218 652 ASN A CA  
1056 C C   . ASN A 157 ? 0.5993 0.7168 0.8173 -0.0021 0.0051  -0.1253 652 ASN A C   
1057 O O   . ASN A 157 ? 0.6051 0.7076 0.8269 -0.0085 0.0103  -0.1140 652 ASN A O   
1058 C CB  . ASN A 157 ? 0.5407 0.6695 0.7237 0.0049  0.0127  -0.1030 652 ASN A CB  
1059 C CG  . ASN A 157 ? 0.8600 0.9980 1.0274 0.0086  0.0195  -0.0901 652 ASN A CG  
1060 O OD1 . ASN A 157 ? 0.9231 1.0776 1.0745 0.0166  0.0190  -0.0859 652 ASN A OD1 
1061 N ND2 . ASN A 157 ? 0.6895 0.8183 0.8625 0.0031  0.0258  -0.0818 652 ASN A ND2 
1062 N N   . PHE A 158 ? 0.5370 0.6604 0.7707 -0.0013 -0.0035 -0.1395 653 PHE A N   
1063 C CA  . PHE A 158 ? 0.5281 0.6414 0.7895 -0.0100 -0.0056 -0.1400 653 PHE A CA  
1064 C C   . PHE A 158 ? 0.6549 0.7644 0.9426 -0.0114 -0.0133 -0.1562 653 PHE A C   
1065 O O   . PHE A 158 ? 0.6768 0.7979 0.9626 -0.0030 -0.0215 -0.1751 653 PHE A O   
1066 C CB  . PHE A 158 ? 0.5350 0.6587 0.8037 -0.0099 -0.0098 -0.1414 653 PHE A CB  
1067 C CG  . PHE A 158 ? 0.5324 0.6550 0.7834 -0.0090 -0.0030 -0.1253 653 PHE A CG  
1068 C CD1 . PHE A 158 ? 0.5539 0.6668 0.8115 -0.0152 0.0048  -0.1130 653 PHE A CD1 
1069 C CD2 . PHE A 158 ? 0.5407 0.6725 0.7688 -0.0004 -0.0049 -0.1224 653 PHE A CD2 
1070 C CE1 . PHE A 158 ? 0.5479 0.6596 0.7913 -0.0121 0.0089  -0.1028 653 PHE A CE1 
1071 C CE2 . PHE A 158 ? 0.5650 0.6919 0.7822 0.0008  -0.0007 -0.1085 653 PHE A CE2 
1072 C CZ  . PHE A 158 ? 0.5326 0.6492 0.7586 -0.0047 0.0053  -0.1013 653 PHE A CZ  
1073 N N   . LEU A 159 ? 0.6371 0.7314 0.9504 -0.0209 -0.0114 -0.1489 654 LEU A N   
1074 C CA  . LEU A 159 ? 0.6535 0.7375 0.9989 -0.0239 -0.0191 -0.1601 654 LEU A CA  
1075 C C   . LEU A 159 ? 0.6844 0.7645 1.0683 -0.0341 -0.0219 -0.1569 654 LEU A C   
1076 O O   . LEU A 159 ? 0.6824 0.7600 1.0671 -0.0412 -0.0116 -0.1362 654 LEU A O   
1077 C CB  . LEU A 159 ? 0.6621 0.7287 1.0034 -0.0265 -0.0120 -0.1458 654 LEU A CB  
1078 C CG  . LEU A 159 ? 0.7470 0.8012 1.1110 -0.0249 -0.0195 -0.1567 654 LEU A CG  
1079 C CD1 . LEU A 159 ? 0.7690 0.8369 1.1190 -0.0125 -0.0253 -0.1793 654 LEU A CD1 
1080 C CD2 . LEU A 159 ? 0.7778 0.8159 1.1363 -0.0272 -0.0126 -0.1380 654 LEU A CD2 
1081 N N   . ILE A 160 ? 0.6305 0.7112 1.0496 -0.0346 -0.0357 -0.1774 655 ILE A N   
1082 C CA  . ILE A 160 ? 0.6363 0.7133 1.1030 -0.0467 -0.0387 -0.1730 655 ILE A CA  
1083 C C   . ILE A 160 ? 0.7325 0.7856 1.2290 -0.0548 -0.0371 -0.1605 655 ILE A C   
1084 O O   . ILE A 160 ? 0.7364 0.7778 1.2459 -0.0502 -0.0478 -0.1768 655 ILE A O   
1085 C CB  . ILE A 160 ? 0.6785 0.7698 1.1771 -0.0450 -0.0561 -0.2003 655 ILE A CB  
1086 C CG1 . ILE A 160 ? 0.6768 0.7926 1.1406 -0.0349 -0.0576 -0.2083 655 ILE A CG1 
1087 C CG2 . ILE A 160 ? 0.6660 0.7545 1.2216 -0.0606 -0.0566 -0.1906 655 ILE A CG2 
1088 C CD1 . ILE A 160 ? 0.7180 0.8503 1.1905 -0.0254 -0.0764 -0.2394 655 ILE A CD1 
1089 N N   . VAL A 161 ? 0.7244 0.7716 1.2277 -0.0649 -0.0233 -0.1306 656 VAL A N   
1090 C CA  . VAL A 161 ? 0.7463 0.7718 1.2752 -0.0726 -0.0198 -0.1105 656 VAL A CA  
1091 C C   . VAL A 161 ? 0.8081 0.8379 1.3779 -0.0865 -0.0127 -0.0900 656 VAL A C   
1092 O O   . VAL A 161 ? 0.8022 0.8465 1.3527 -0.0886 0.0026  -0.0700 656 VAL A O   
1093 C CB  . VAL A 161 ? 0.7970 0.8137 1.2852 -0.0682 -0.0076 -0.0885 656 VAL A CB  
1094 C CG1 . VAL A 161 ? 0.8189 0.8112 1.3336 -0.0720 -0.0101 -0.0740 656 VAL A CG1 
1095 C CG2 . VAL A 161 ? 0.7810 0.8027 1.2239 -0.0555 -0.0096 -0.1044 656 VAL A CG2 
1096 N N   . ASP A 162 ? 0.7838 0.8022 1.4131 -0.0957 -0.0236 -0.0952 657 ASP A N   
1097 C CA  . ASP A 162 ? 0.7918 0.8137 1.4741 -0.1116 -0.0170 -0.0731 657 ASP A CA  
1098 C C   . ASP A 162 ? 0.8089 0.8617 1.4894 -0.1142 -0.0093 -0.0734 657 ASP A C   
1099 O O   . ASP A 162 ? 0.7921 0.8585 1.4691 -0.1200 0.0098  -0.0441 657 ASP A O   
1100 C CB  . ASP A 162 ? 0.8333 0.8431 1.5126 -0.1175 0.0001  -0.0311 657 ASP A CB  
1101 C CG  . ASP A 162 ? 0.9834 0.9630 1.6595 -0.1125 -0.0078 -0.0289 657 ASP A CG  
1102 O OD1 . ASP A 162 ? 1.0068 0.9660 1.7347 -0.1168 -0.0244 -0.0421 657 ASP A OD1 
1103 O OD2 . ASP A 162 ? 0.9887 0.9654 1.6143 -0.1036 0.0012  -0.0153 657 ASP A OD2 
1104 N N   . GLY A 163 ? 0.7546 0.8204 1.4343 -0.1076 -0.0245 -0.1071 658 GLY A N   
1105 C CA  . GLY A 163 ? 0.7430 0.8381 1.4221 -0.1072 -0.0220 -0.1131 658 GLY A CA  
1106 C C   . GLY A 163 ? 0.7792 0.8885 1.4032 -0.1004 -0.0030 -0.0945 658 GLY A C   
1107 O O   . GLY A 163 ? 0.7786 0.9094 1.4136 -0.1048 0.0088  -0.0809 658 GLY A O   
1108 N N   . MET A 164 ? 0.7284 0.8263 1.2970 -0.0894 -0.0003 -0.0945 659 MET A N   
1109 C CA  . MET A 164 ? 0.7156 0.8217 1.2330 -0.0819 0.0145  -0.0801 659 MET A CA  
1110 C C   . MET A 164 ? 0.7284 0.8271 1.1975 -0.0690 0.0076  -0.0960 659 MET A C   
1111 O O   . MET A 164 ? 0.7542 0.8353 1.2191 -0.0670 0.0013  -0.1019 659 MET A O   
1112 C CB  . MET A 164 ? 0.7629 0.8599 1.2756 -0.0868 0.0305  -0.0489 659 MET A CB  
1113 C CG  . MET A 164 ? 0.8288 0.9341 1.2916 -0.0779 0.0439  -0.0363 659 MET A CG  
1114 S SD  . MET A 164 ? 0.9267 1.0282 1.3827 -0.0808 0.0615  -0.0001 659 MET A SD  
1115 C CE  . MET A 164 ? 0.8894 1.0186 1.3930 -0.0922 0.0758  0.0188  659 MET A CE  
1116 N N   . LEU A 165 ? 0.6335 0.7460 1.0699 -0.0601 0.0086  -0.1021 660 LEU A N   
1117 C CA  . LEU A 165 ? 0.6175 0.7248 1.0107 -0.0491 0.0043  -0.1119 660 LEU A CA  
1118 C C   . LEU A 165 ? 0.6943 0.7899 1.0548 -0.0466 0.0151  -0.0953 660 LEU A C   
1119 O O   . LEU A 165 ? 0.7066 0.8063 1.0602 -0.0478 0.0262  -0.0793 660 LEU A O   
1120 C CB  . LEU A 165 ? 0.6024 0.7261 0.9754 -0.0403 0.0000  -0.1217 660 LEU A CB  
1121 C CG  . LEU A 165 ? 0.6618 0.7967 1.0445 -0.0349 -0.0159 -0.1450 660 LEU A CG  
1122 C CD1 . LEU A 165 ? 0.6566 0.8056 1.0123 -0.0246 -0.0187 -0.1478 660 LEU A CD1 
1123 C CD2 . LEU A 165 ? 0.7243 0.8509 1.0954 -0.0296 -0.0234 -0.1584 660 LEU A CD2 
1124 N N   . LYS A 166 ? 0.6457 0.7301 0.9863 -0.0417 0.0113  -0.1010 661 LYS A N   
1125 C CA  . LYS A 166 ? 0.6223 0.6966 0.9352 -0.0388 0.0184  -0.0887 661 LYS A CA  
1126 C C   . LYS A 166 ? 0.6248 0.7004 0.9094 -0.0311 0.0157  -0.0964 661 LYS A C   
1127 O O   . LYS A 166 ? 0.6255 0.7038 0.9113 -0.0276 0.0089  -0.1101 661 LYS A O   
1128 C CB  . LYS A 166 ? 0.6485 0.7069 0.9744 -0.0426 0.0185  -0.0812 661 LYS A CB  
1129 C CG  . LYS A 166 ? 0.6377 0.6944 0.9733 -0.0481 0.0279  -0.0598 661 LYS A CG  
1130 C CD  . LYS A 166 ? 0.6554 0.7019 1.0305 -0.0563 0.0250  -0.0542 661 LYS A CD  
1131 C CE  . LYS A 166 ? 0.6990 0.7467 1.0842 -0.0618 0.0367  -0.0271 661 LYS A CE  
1132 N NZ  . LYS A 166 ? 0.6711 0.7098 1.0271 -0.0558 0.0410  -0.0117 661 LYS A NZ  
1133 N N   . LEU A 167 ? 0.5510 0.6260 0.8121 -0.0277 0.0209  -0.0877 662 LEU A N   
1134 C CA  . LEU A 167 ? 0.5423 0.6173 0.7819 -0.0223 0.0197  -0.0899 662 LEU A CA  
1135 C C   . LEU A 167 ? 0.6098 0.6764 0.8469 -0.0220 0.0194  -0.0902 662 LEU A C   
1136 O O   . LEU A 167 ? 0.6072 0.6644 0.8432 -0.0234 0.0215  -0.0825 662 LEU A O   
1137 C CB  . LEU A 167 ? 0.5336 0.6078 0.7578 -0.0192 0.0227  -0.0823 662 LEU A CB  
1138 C CG  . LEU A 167 ? 0.5707 0.6437 0.7809 -0.0155 0.0213  -0.0809 662 LEU A CG  
1139 C CD1 . LEU A 167 ? 0.5666 0.6511 0.7735 -0.0120 0.0181  -0.0851 662 LEU A CD1 
1140 C CD2 . LEU A 167 ? 0.5678 0.6350 0.7709 -0.0129 0.0216  -0.0758 662 LEU A CD2 
1141 N N   . ILE A 168 ? 0.5905 0.6638 0.8270 -0.0187 0.0163  -0.1001 663 ILE A N   
1142 C CA  . ILE A 168 ? 0.5930 0.6640 0.8316 -0.0167 0.0158  -0.1042 663 ILE A CA  
1143 C C   . ILE A 168 ? 0.6525 0.7213 0.8797 -0.0162 0.0197  -0.0952 663 ILE A C   
1144 O O   . ILE A 168 ? 0.6517 0.7136 0.8845 -0.0164 0.0191  -0.0940 663 ILE A O   
1145 C CB  . ILE A 168 ? 0.6295 0.7147 0.8705 -0.0105 0.0119  -0.1205 663 ILE A CB  
1146 C CG1 . ILE A 168 ? 0.6674 0.7497 0.9307 -0.0117 0.0041  -0.1333 663 ILE A CG1 
1147 C CG2 . ILE A 168 ? 0.6166 0.7062 0.8582 -0.0061 0.0133  -0.1255 663 ILE A CG2 
1148 C CD1 . ILE A 168 ? 0.9398 1.0392 1.2051 -0.0028 -0.0035 -0.1557 663 ILE A CD1 
1149 N N   . ASP A 169 ? 0.6114 0.6853 0.8267 -0.0155 0.0222  -0.0889 664 ASP A N   
1150 C CA  . ASP A 169 ? 0.6149 0.6868 0.8270 -0.0162 0.0245  -0.0809 664 ASP A CA  
1151 C C   . ASP A 169 ? 0.6761 0.7441 0.8820 -0.0167 0.0242  -0.0727 664 ASP A C   
1152 O O   . ASP A 169 ? 0.6905 0.7603 0.8917 -0.0151 0.0231  -0.0732 664 ASP A O   
1153 C CB  . ASP A 169 ? 0.6547 0.7416 0.8676 -0.0137 0.0284  -0.0821 664 ASP A CB  
1154 C CG  . ASP A 169 ? 0.7886 0.8895 0.9902 -0.0101 0.0310  -0.0790 664 ASP A CG  
1155 O OD1 . ASP A 169 ? 0.7778 0.8875 0.9749 -0.0057 0.0283  -0.0891 664 ASP A OD1 
1156 O OD2 . ASP A 169 ? 0.8922 0.9940 1.0911 -0.0115 0.0339  -0.0661 664 ASP A OD2 
1157 N N   . PHE A 170 ? 0.6191 0.6816 0.8293 -0.0184 0.0237  -0.0666 665 PHE A N   
1158 C CA  . PHE A 170 ? 0.6131 0.6671 0.8239 -0.0183 0.0205  -0.0613 665 PHE A CA  
1159 C C   . PHE A 170 ? 0.6566 0.7138 0.8730 -0.0197 0.0225  -0.0499 665 PHE A C   
1160 O O   . PHE A 170 ? 0.6535 0.7007 0.8751 -0.0193 0.0181  -0.0453 665 PHE A O   
1161 C CB  . PHE A 170 ? 0.6365 0.6788 0.8522 -0.0182 0.0147  -0.0652 665 PHE A CB  
1162 C CG  . PHE A 170 ? 0.6625 0.7024 0.8697 -0.0155 0.0136  -0.0710 665 PHE A CG  
1163 C CD1 . PHE A 170 ? 0.7123 0.7573 0.9143 -0.0153 0.0176  -0.0717 665 PHE A CD1 
1164 C CD2 . PHE A 170 ? 0.7131 0.7469 0.9190 -0.0125 0.0079  -0.0747 665 PHE A CD2 
1165 C CE1 . PHE A 170 ? 0.7315 0.7752 0.9299 -0.0141 0.0185  -0.0717 665 PHE A CE1 
1166 C CE2 . PHE A 170 ? 0.7617 0.7960 0.9567 -0.0088 0.0085  -0.0754 665 PHE A CE2 
1167 C CZ  . PHE A 170 ? 0.7344 0.7733 0.9270 -0.0104 0.0149  -0.0717 665 PHE A CZ  
1168 N N   . GLY A 171 ? 0.6127 0.6849 0.8295 -0.0203 0.0291  -0.0448 666 GLY A N   
1169 C CA  . GLY A 171 ? 0.6328 0.7131 0.8547 -0.0217 0.0342  -0.0287 666 GLY A CA  
1170 C C   . GLY A 171 ? 0.7350 0.8098 0.9812 -0.0285 0.0343  -0.0200 666 GLY A C   
1171 O O   . GLY A 171 ? 0.7749 0.8554 1.0313 -0.0314 0.0394  -0.0024 666 GLY A O   
1172 N N   . ILE A 172 ? 0.6780 0.7430 0.9357 -0.0309 0.0281  -0.0310 667 ILE A N   
1173 C CA  . ILE A 172 ? 0.6634 0.7236 0.9494 -0.0371 0.0245  -0.0280 667 ILE A CA  
1174 C C   . ILE A 172 ? 0.7821 0.8641 1.0820 -0.0404 0.0343  -0.0220 667 ILE A C   
1175 O O   . ILE A 172 ? 0.7880 0.8756 1.1144 -0.0472 0.0379  -0.0084 667 ILE A O   
1176 C CB  . ILE A 172 ? 0.6634 0.7088 0.9525 -0.0352 0.0120  -0.0446 667 ILE A CB  
1177 C CG1 . ILE A 172 ? 0.6377 0.6678 0.9117 -0.0296 0.0042  -0.0522 667 ILE A CG1 
1178 C CG2 . ILE A 172 ? 0.6611 0.7031 0.9833 -0.0408 0.0046  -0.0454 667 ILE A CG2 
1179 C CD1 . ILE A 172 ? 0.6119 0.6360 0.8764 -0.0241 -0.0042 -0.0674 667 ILE A CD1 
1180 N N   . ALA A 173 ? 0.7743 0.8686 1.0612 -0.0356 0.0382  -0.0327 668 ALA A N   
1181 C CA  . ALA A 173 ? 0.7934 0.9114 1.0927 -0.0355 0.0472  -0.0318 668 ALA A CA  
1182 C C   . ALA A 173 ? 0.9369 1.0797 1.2310 -0.0342 0.0617  -0.0165 668 ALA A C   
1183 O O   . ALA A 173 ? 0.9464 1.0920 1.2151 -0.0287 0.0640  -0.0148 668 ALA A O   
1184 C CB  . ALA A 173 ? 0.7898 0.9107 1.0777 -0.0286 0.0449  -0.0490 668 ALA A CB  
1185 N N   . ASN A 174 ? 0.9586 1.1225 1.2775 -0.0385 0.0715  -0.0047 669 ASN A N   
1186 C CA  . ASN A 174 ? 0.9941 1.1896 1.3102 -0.0366 0.0887  0.0139  669 ASN A CA  
1187 C C   . ASN A 174 ? 1.1114 1.3291 1.3941 -0.0230 0.0948  0.0013  669 ASN A C   
1188 O O   . ASN A 174 ? 1.1147 1.3324 1.3942 -0.0171 0.0897  -0.0211 669 ASN A O   
1189 C CB  . ASN A 174 ? 0.9246 1.1437 1.2786 -0.0434 0.0992  0.0254  669 ASN A CB  
1190 C CG  . ASN A 174 ? 1.0838 1.2917 1.4751 -0.0572 0.0983  0.0475  669 ASN A CG  
1191 O OD1 . ASN A 174 ? 0.8929 1.0743 1.2815 -0.0610 0.0898  0.0555  669 ASN A OD1 
1192 N ND2 . ASN A 174 ? 1.0181 1.2469 1.4502 -0.0648 0.1064  0.0571  669 ASN A ND2 
1193 N N   . GLN A 175 ? 1.0991 1.3349 1.3584 -0.0170 0.1039  0.0153  670 GLN A N   
1194 C CA  . GLN A 175 ? 1.5583 1.8182 1.7844 -0.0020 0.1077  0.0027  670 GLN A CA  
1195 C C   . GLN A 175 ? 1.7855 2.0210 1.9935 0.0026  0.0917  -0.0215 670 GLN A C   
1196 O O   . GLN A 175 ? 1.1767 1.3852 1.3820 -0.0027 0.0823  -0.0175 670 GLN A O   
1197 C CB  . GLN A 175 ? 1.5799 1.8763 1.8108 0.0066  0.1189  -0.0082 670 GLN A CB  
1198 N N   . GLN A 188 ? 1.2010 1.5111 1.2778 0.0920  0.0140  -0.1782 683 GLN A N   
1199 C CA  . GLN A 188 ? 1.2144 1.5401 1.2619 0.0969  0.0199  -0.1518 683 GLN A CA  
1200 C C   . GLN A 188 ? 1.2507 1.5660 1.3012 0.0841  0.0381  -0.1141 683 GLN A C   
1201 O O   . GLN A 188 ? 1.2272 1.5088 1.3016 0.0673  0.0382  -0.1041 683 GLN A O   
1202 C CB  . GLN A 188 ? 1.2271 1.5382 1.2770 0.0946  0.0047  -0.1538 683 GLN A CB  
1203 N N   . VAL A 189 ? 1.2083 1.5548 1.2367 0.0926  0.0534  -0.0941 684 VAL A N   
1204 C CA  . VAL A 189 ? 1.1860 1.5275 1.2229 0.0808  0.0708  -0.0575 684 VAL A CA  
1205 C C   . VAL A 189 ? 1.2017 1.5741 1.2088 0.0912  0.0820  -0.0273 684 VAL A C   
1206 O O   . VAL A 189 ? 1.2033 1.6165 1.1801 0.1105  0.0851  -0.0355 684 VAL A O   
1207 C CB  . VAL A 189 ? 1.2279 1.5735 1.2869 0.0748  0.0826  -0.0610 684 VAL A CB  
1208 N N   . GLY A 190 ? 1.1251 1.4778 1.1419 0.0793  0.0871  0.0073  685 GLY A N   
1209 C CA  . GLY A 190 ? 1.1386 1.5124 1.1335 0.0862  0.0971  0.0441  685 GLY A CA  
1210 C C   . GLY A 190 ? 1.1552 1.5195 1.1308 0.0940  0.0815  0.0476  685 GLY A C   
1211 O O   . GLY A 190 ? 1.1790 1.5357 1.1533 0.0914  0.0848  0.0829  685 GLY A O   
1212 N N   . THR A 191 ? 1.0475 1.4109 1.0137 0.1030  0.0630  0.0108  686 THR A N   
1213 C CA  . THR A 191 ? 1.0260 1.3853 0.9772 0.1124  0.0449  0.0049  686 THR A CA  
1214 C C   . THR A 191 ? 1.0361 1.3637 1.0015 0.1024  0.0418  0.0347  686 THR A C   
1215 O O   . THR A 191 ? 1.0192 1.3119 1.0177 0.0844  0.0436  0.0391  686 THR A O   
1216 C CB  . THR A 191 ? 0.9588 1.3140 0.9176 0.1162  0.0259  -0.0411 686 THR A CB  
1217 O OG1 . THR A 191 ? 0.9386 1.3146 0.8718 0.1344  0.0099  -0.0523 686 THR A OG1 
1218 C CG2 . THR A 191 ? 0.8189 1.1309 0.8169 0.0968  0.0187  -0.0518 686 THR A CG2 
1219 N N   . VAL A 192 ? 0.9647 1.3057 0.9047 0.1159  0.0367  0.0551  687 VAL A N   
1220 C CA  . VAL A 192 ? 0.9398 1.2511 0.8942 0.1095  0.0317  0.0829  687 VAL A CA  
1221 C C   . VAL A 192 ? 0.9406 1.2396 0.8972 0.1159  0.0094  0.0628  687 VAL A C   
1222 O O   . VAL A 192 ? 0.9178 1.1929 0.8878 0.1131  0.0030  0.0810  687 VAL A O   
1223 C CB  . VAL A 192 ? 1.0176 1.3419 0.9557 0.1152  0.0438  0.1317  687 VAL A CB  
1224 C CG1 . VAL A 192 ? 1.0104 1.3394 0.9641 0.1026  0.0666  0.1540  687 VAL A CG1 
1225 C CG2 . VAL A 192 ? 1.0559 1.4245 0.9446 0.1408  0.0403  0.1368  687 VAL A CG2 
1226 N N   . ASN A 193 ? 0.8827 1.1984 0.8314 0.1242  -0.0028 0.0240  688 ASN A N   
1227 C CA  . ASN A 193 ? 0.8722 1.1848 0.8269 0.1307  -0.0241 0.0003  688 ASN A CA  
1228 C C   . ASN A 193 ? 0.8800 1.1544 0.8742 0.1148  -0.0293 -0.0045 688 ASN A C   
1229 O O   . ASN A 193 ? 0.8798 1.1509 0.8810 0.1206  -0.0443 -0.0108 688 ASN A O   
1230 C CB  . ASN A 193 ? 0.8589 1.1959 0.8075 0.1396  -0.0353 -0.0419 688 ASN A CB  
1231 C CG  . ASN A 193 ? 1.0873 1.4686 0.9924 0.1622  -0.0361 -0.0453 688 ASN A CG  
1232 O OD1 . ASN A 193 ? 0.9090 1.3119 0.7844 0.1804  -0.0450 -0.0330 688 ASN A OD1 
1233 N ND2 . ASN A 193 ? 1.0291 1.4272 0.9288 0.1636  -0.0282 -0.0643 688 ASN A ND2 
1234 N N   . TYR A 194 ? 0.7881 1.0372 0.8070 0.0965  -0.0172 -0.0025 689 TYR A N   
1235 C CA  . TYR A 194 ? 0.7462 0.9631 0.7989 0.0826  -0.0197 -0.0089 689 TYR A CA  
1236 C C   . TYR A 194 ? 0.8115 1.0019 0.8775 0.0738  -0.0115 0.0205  689 TYR A C   
1237 O O   . TYR A 194 ? 0.7687 0.9334 0.8604 0.0636  -0.0123 0.0153  689 TYR A O   
1238 C CB  . TYR A 194 ? 0.7156 0.9258 0.7871 0.0706  -0.0157 -0.0347 689 TYR A CB  
1239 C CG  . TYR A 194 ? 0.7252 0.9586 0.7911 0.0780  -0.0247 -0.0647 689 TYR A CG  
1240 C CD1 . TYR A 194 ? 0.7743 1.0318 0.8188 0.0861  -0.0205 -0.0713 689 TYR A CD1 
1241 C CD2 . TYR A 194 ? 0.7123 0.9455 0.7979 0.0777  -0.0379 -0.0876 689 TYR A CD2 
1242 C CE1 . TYR A 194 ? 0.8016 1.0800 0.8434 0.0952  -0.0320 -0.1029 689 TYR A CE1 
1243 C CE2 . TYR A 194 ? 0.7213 0.9744 0.8091 0.0840  -0.0490 -0.1166 689 TYR A CE2 
1244 C CZ  . TYR A 194 ? 0.8588 1.1330 0.9245 0.0933  -0.0473 -0.1258 689 TYR A CZ  
1245 O OH  . TYR A 194 ? 0.8960 1.1889 0.9667 0.1011  -0.0608 -0.1587 689 TYR A OH  
1246 N N   . MET A 195 ? 0.8206 1.0189 0.8704 0.0788  -0.0041 0.0514  690 MET A N   
1247 C CA  . MET A 195 ? 0.8416 1.0164 0.9087 0.0703  0.0031  0.0825  690 MET A CA  
1248 C C   . MET A 195 ? 0.9166 1.0689 0.9976 0.0746  -0.0092 0.0954  690 MET A C   
1249 O O   . MET A 195 ? 0.9381 1.1041 1.0001 0.0893  -0.0178 0.1052  690 MET A O   
1250 C CB  . MET A 195 ? 0.9077 1.1040 0.9559 0.0737  0.0172  0.1135  690 MET A CB  
1251 C CG  . MET A 195 ? 0.9730 1.1474 1.0478 0.0608  0.0272  0.1451  690 MET A CG  
1252 S SD  . MET A 195 ? 1.0643 1.2725 1.1225 0.0618  0.0493  0.1789  690 MET A SD  
1253 C CE  . MET A 195 ? 0.9863 1.2037 1.0540 0.0511  0.0594  0.1478  690 MET A CE  
1254 N N   . PRO A 196 ? 0.8787 0.9976 0.9923 0.0640  -0.0111 0.0952  691 PRO A N   
1255 C CA  . PRO A 196 ? 0.8948 0.9916 1.0252 0.0700  -0.0239 0.1051  691 PRO A CA  
1256 C C   . PRO A 196 ? 0.9997 1.0885 1.1314 0.0741  -0.0231 0.1466  691 PRO A C   
1257 O O   . PRO A 196 ? 1.0122 1.1065 1.1424 0.0667  -0.0095 0.1696  691 PRO A O   
1258 C CB  . PRO A 196 ? 0.8905 0.9581 1.0538 0.0590  -0.0257 0.0882  691 PRO A CB  
1259 C CG  . PRO A 196 ? 0.9315 1.0007 1.0977 0.0457  -0.0130 0.0834  691 PRO A CG  
1260 C CD  . PRO A 196 ? 0.8783 0.9801 1.0148 0.0484  -0.0039 0.0830  691 PRO A CD  
1261 N N   . PRO A 197 ? 0.9916 1.0681 1.1295 0.0856  -0.0370 0.1589  692 PRO A N   
1262 C CA  . PRO A 197 ? 1.0450 1.1114 1.1872 0.0893  -0.0365 0.2035  692 PRO A CA  
1263 C C   . PRO A 197 ? 1.1212 1.1569 1.3024 0.0729  -0.0296 0.2229  692 PRO A C   
1264 O O   . PRO A 197 ? 1.1430 1.1816 1.3262 0.0688  -0.0192 0.2613  692 PRO A O   
1265 C CB  . PRO A 197 ? 1.0821 1.1361 1.2307 0.1049  -0.0561 0.2046  692 PRO A CB  
1266 C CG  . PRO A 197 ? 1.1022 1.1759 1.2373 0.1121  -0.0641 0.1634  692 PRO A CG  
1267 C CD  . PRO A 197 ? 1.0012 1.0737 1.1455 0.0962  -0.0534 0.1350  692 PRO A CD  
1268 N N   . GLU A 198 ? 1.0663 1.0759 1.2791 0.0639  -0.0353 0.1955  693 GLU A N   
1269 C CA  . GLU A 198 ? 1.0689 1.0485 1.3237 0.0488  -0.0334 0.2022  693 GLU A CA  
1270 C C   . GLU A 198 ? 1.1419 1.1377 1.3949 0.0340  -0.0144 0.2124  693 GLU A C   
1271 O O   . GLU A 198 ? 1.1593 1.1387 1.4460 0.0221  -0.0100 0.2358  693 GLU A O   
1272 C CB  . GLU A 198 ? 1.0559 1.0131 1.3346 0.0471  -0.0448 0.1631  693 GLU A CB  
1273 C CG  . GLU A 198 ? 1.1329 1.1116 1.3883 0.0460  -0.0396 0.1261  693 GLU A CG  
1274 C CD  . GLU A 198 ? 1.2344 1.2204 1.4792 0.0587  -0.0497 0.0988  693 GLU A CD  
1275 O OE1 . GLU A 198 ? 1.0025 0.9997 1.2324 0.0715  -0.0563 0.1083  693 GLU A OE1 
1276 O OE2 . GLU A 198 ? 1.0582 1.0418 1.3100 0.0562  -0.0507 0.0685  693 GLU A OE2 
1277 N N   . ALA A 199 ? 1.0869 1.1151 1.3053 0.0352  -0.0043 0.1942  694 ALA A N   
1278 C CA  . ALA A 199 ? 1.0846 1.1337 1.2980 0.0247  0.0133  0.1996  694 ALA A CA  
1279 C C   . ALA A 199 ? 1.1934 1.2673 1.3904 0.0281  0.0270  0.2417  694 ALA A C   
1280 O O   . ALA A 199 ? 1.2056 1.2889 1.4173 0.0169  0.0421  0.2608  694 ALA A O   
1281 C CB  . ALA A 199 ? 1.0625 1.1358 1.2471 0.0273  0.0169  0.1647  694 ALA A CB  
1282 N N   . ILE A 200 ? 1.1737 1.2614 1.3404 0.0445  0.0218  0.2566  695 ILE A N   
1283 C CA  . ILE A 200 ? 1.2045 1.3200 1.3473 0.0522  0.0339  0.2989  695 ILE A CA  
1284 C C   . ILE A 200 ? 1.2948 1.3852 1.4777 0.0428  0.0371  0.3456  695 ILE A C   
1285 O O   . ILE A 200 ? 1.3157 1.4245 1.5046 0.0351  0.0560  0.3785  695 ILE A O   
1286 C CB  . ILE A 200 ? 1.2543 1.3948 1.3494 0.0750  0.0246  0.2969  695 ILE A CB  
1287 C CG1 . ILE A 200 ? 1.2236 1.3972 1.2833 0.0821  0.0259  0.2557  695 ILE A CG1 
1288 C CG2 . ILE A 200 ? 1.3129 1.4777 1.3837 0.0860  0.0342  0.3473  695 ILE A CG2 
1289 C CD1 . ILE A 200 ? 1.2504 1.4320 1.2861 0.0986  0.0076  0.2296  695 ILE A CD1 
1290 N N   . LYS A 201 ? 1.2608 1.3098 1.4760 0.0429  0.0187  0.3469  696 LYS A N   
1291 C CA  . LYS A 201 ? 1.2967 1.3126 1.5596 0.0345  0.0158  0.3874  696 LYS A CA  
1292 C C   . LYS A 201 ? 1.3619 1.3672 1.6739 0.0114  0.0283  0.3991  696 LYS A C   
1293 O O   . LYS A 201 ? 1.3948 1.4025 1.7297 0.0035  0.0404  0.4473  696 LYS A O   
1294 C CB  . LYS A 201 ? 1.3144 1.2871 1.6051 0.0408  -0.0095 0.3722  696 LYS A CB  
1295 C CG  . LYS A 201 ? 1.2905 1.2732 1.5437 0.0635  -0.0224 0.3731  696 LYS A CG  
1296 N N   . ASP A 202 ? 1.2771 1.2744 1.6046 0.0011  0.0258  0.3564  697 ASP A N   
1297 C CA  . ASP A 202 ? 1.5965 1.5858 1.9702 -0.0193 0.0339  0.3580  697 ASP A CA  
1298 C C   . ASP A 202 ? 1.7234 1.7579 2.0799 -0.0250 0.0606  0.3801  697 ASP A C   
1299 O O   . ASP A 202 ? 1.0871 1.1514 1.4091 -0.0216 0.0691  0.3522  697 ASP A O   
1300 C CB  . ASP A 202 ? 1.5756 1.5472 1.9625 -0.0243 0.0218  0.3047  697 ASP A CB  
1301 C CG  . ASP A 202 ? 1.6864 1.6219 2.0851 -0.0160 -0.0024 0.2760  697 ASP A CG  
1302 O OD1 . ASP A 202 ? 1.7188 1.6329 2.1307 -0.0088 -0.0133 0.2975  697 ASP A OD1 
1303 O OD2 . ASP A 202 ? 1.7299 1.6600 2.1252 -0.0157 -0.0100 0.2330  697 ASP A OD2 
1304 N N   . ILE A 216 ? 1.0165 0.9244 1.3829 0.0083  -0.0460 0.0992  711 ILE A N   
1305 C CA  . ILE A 216 ? 0.9801 0.9108 1.3178 0.0066  -0.0373 0.0732  711 ILE A CA  
1306 C C   . ILE A 216 ? 0.9527 0.8730 1.2970 0.0110  -0.0475 0.0362  711 ILE A C   
1307 O O   . ILE A 216 ? 0.9513 0.8580 1.3199 0.0050  -0.0531 0.0245  711 ILE A O   
1308 C CB  . ILE A 216 ? 1.0206 0.9712 1.3511 -0.0059 -0.0212 0.0852  711 ILE A CB  
1309 C CG1 . ILE A 216 ? 1.0540 1.0239 1.3689 -0.0059 -0.0089 0.1208  711 ILE A CG1 
1310 C CG2 . ILE A 216 ? 0.9958 0.9663 1.2992 -0.0062 -0.0145 0.0585  711 ILE A CG2 
1311 C CD1 . ILE A 216 ? 1.1970 1.1846 1.4740 0.0086  -0.0095 0.1229  711 ILE A CD1 
1312 N N   . SER A 217 ? 0.8378 0.7684 1.1603 0.0226  -0.0498 0.0185  712 SER A N   
1313 C CA  . SER A 217 ? 0.7987 0.7282 1.1198 0.0308  -0.0565 -0.0137 712 SER A CA  
1314 C C   . SER A 217 ? 0.7698 0.7279 1.0575 0.0334  -0.0459 -0.0252 712 SER A C   
1315 O O   . SER A 217 ? 0.7454 0.7198 1.0151 0.0306  -0.0376 -0.0106 712 SER A O   
1316 C CB  . SER A 217 ? 0.8529 0.7663 1.1919 0.0445  -0.0710 -0.0198 712 SER A CB  
1317 O OG  . SER A 217 ? 0.9152 0.8408 1.2393 0.0523  -0.0698 -0.0079 712 SER A OG  
1318 N N   . PRO A 218 ? 0.6645 0.6308 0.9452 0.0401  -0.0466 -0.0506 713 PRO A N   
1319 C CA  . PRO A 218 ? 0.6214 0.6139 0.8789 0.0409  -0.0366 -0.0580 713 PRO A CA  
1320 C C   . PRO A 218 ? 0.6483 0.6540 0.8987 0.0464  -0.0368 -0.0490 713 PRO A C   
1321 O O   . PRO A 218 ? 0.6527 0.6792 0.8881 0.0436  -0.0294 -0.0502 713 PRO A O   
1322 C CB  . PRO A 218 ? 0.6345 0.6324 0.8927 0.0500  -0.0385 -0.0817 713 PRO A CB  
1323 C CG  . PRO A 218 ? 0.7004 0.6781 0.9729 0.0501  -0.0470 -0.0901 713 PRO A CG  
1324 C CD  . PRO A 218 ? 0.6684 0.6234 0.9628 0.0476  -0.0560 -0.0733 713 PRO A CD  
1325 N N   . LYS A 219 ? 0.5828 0.5759 0.8464 0.0546  -0.0471 -0.0402 714 LYS A N   
1326 C CA  . LYS A 219 ? 0.5775 0.5826 0.8350 0.0624  -0.0506 -0.0309 714 LYS A CA  
1327 C C   . LYS A 219 ? 0.6481 0.6661 0.8857 0.0557  -0.0435 -0.0122 714 LYS A C   
1328 O O   . LYS A 219 ? 0.6571 0.6953 0.8820 0.0611  -0.0444 -0.0123 714 LYS A O   
1329 C CB  . LYS A 219 ? 0.6090 0.5936 0.8865 0.0732  -0.0644 -0.0216 714 LYS A CB  
1330 C CG  . LYS A 219 ? 0.6075 0.5843 0.9043 0.0847  -0.0732 -0.0447 714 LYS A CG  
1331 C CD  . LYS A 219 ? 0.6788 0.6840 0.9693 0.0937  -0.0705 -0.0634 714 LYS A CD  
1332 C CE  . LYS A 219 ? 0.6785 0.6813 0.9882 0.1085  -0.0785 -0.0855 714 LYS A CE  
1333 N NZ  . LYS A 219 ? 0.7871 0.7731 1.1169 0.1219  -0.0945 -0.0780 714 LYS A NZ  
1334 N N   . SER A 220 ? 0.6032 0.6127 0.8398 0.0452  -0.0372 0.0018  715 SER A N   
1335 C CA  . SER A 220 ? 0.6034 0.6285 0.8210 0.0404  -0.0288 0.0183  715 SER A CA  
1336 C C   . SER A 220 ? 0.6506 0.6993 0.8506 0.0382  -0.0222 0.0005  715 SER A C   
1337 O O   . SER A 220 ? 0.6799 0.7491 0.8624 0.0427  -0.0218 0.0030  715 SER A O   
1338 C CB  . SER A 220 ? 0.6391 0.6530 0.8662 0.0291  -0.0219 0.0334  715 SER A CB  
1339 O OG  . SER A 220 ? 0.7182 0.7062 0.9718 0.0288  -0.0295 0.0475  715 SER A OG  
1340 N N   . ASP A 221 ? 0.5585 0.6046 0.7646 0.0326  -0.0187 -0.0182 716 ASP A N   
1341 C CA  . ASP A 221 ? 0.5280 0.5916 0.7249 0.0291  -0.0130 -0.0334 716 ASP A CA  
1342 C C   . ASP A 221 ? 0.5896 0.6698 0.7871 0.0368  -0.0183 -0.0440 716 ASP A C   
1343 O O   . ASP A 221 ? 0.5631 0.6610 0.7544 0.0354  -0.0167 -0.0519 716 ASP A O   
1344 C CB  . ASP A 221 ? 0.5321 0.5879 0.7357 0.0224  -0.0083 -0.0453 716 ASP A CB  
1345 C CG  . ASP A 221 ? 0.6419 0.6891 0.8456 0.0137  -0.0031 -0.0387 716 ASP A CG  
1346 O OD1 . ASP A 221 ? 0.6606 0.7137 0.8578 0.0113  0.0004  -0.0259 716 ASP A OD1 
1347 O OD2 . ASP A 221 ? 0.6608 0.6989 0.8704 0.0104  -0.0025 -0.0468 716 ASP A OD2 
1348 N N   . VAL A 222 ? 0.5675 0.6420 0.7760 0.0459  -0.0261 -0.0451 717 VAL A N   
1349 C CA  . VAL A 222 ? 0.5616 0.6528 0.7765 0.0549  -0.0326 -0.0544 717 VAL A CA  
1350 C C   . VAL A 222 ? 0.6590 0.7646 0.8610 0.0611  -0.0392 -0.0461 717 VAL A C   
1351 O O   . VAL A 222 ? 0.6547 0.7819 0.8580 0.0632  -0.0423 -0.0582 717 VAL A O   
1352 C CB  . VAL A 222 ? 0.6110 0.6932 0.8425 0.0650  -0.0397 -0.0588 717 VAL A CB  
1353 C CG1 . VAL A 222 ? 0.6119 0.7146 0.8527 0.0755  -0.0472 -0.0669 717 VAL A CG1 
1354 C CG2 . VAL A 222 ? 0.6010 0.6779 0.8412 0.0622  -0.0333 -0.0722 717 VAL A CG2 
1355 N N   . TRP A 223 ? 0.6411 0.7364 0.8319 0.0643  -0.0417 -0.0250 718 TRP A N   
1356 C CA  . TRP A 223 ? 0.6638 0.7755 0.8354 0.0727  -0.0471 -0.0137 718 TRP A CA  
1357 C C   . TRP A 223 ? 0.7133 0.8464 0.8696 0.0681  -0.0419 -0.0250 718 TRP A C   
1358 O O   . TRP A 223 ? 0.7035 0.8591 0.8527 0.0760  -0.0500 -0.0354 718 TRP A O   
1359 C CB  . TRP A 223 ? 0.6778 0.7759 0.8403 0.0746  -0.0459 0.0162  718 TRP A CB  
1360 C CG  . TRP A 223 ? 0.7185 0.8382 0.8542 0.0847  -0.0489 0.0310  718 TRP A CG  
1361 C CD1 . TRP A 223 ? 0.7569 0.8979 0.8691 0.0835  -0.0415 0.0312  718 TRP A CD1 
1362 C CD2 . TRP A 223 ? 0.7494 0.8754 0.8770 0.1004  -0.0614 0.0450  718 TRP A CD2 
1363 N NE1 . TRP A 223 ? 0.7827 0.9449 0.8696 0.0982  -0.0481 0.0440  718 TRP A NE1 
1364 C CE2 . TRP A 223 ? 0.8187 0.9714 0.9138 0.1085  -0.0605 0.0545  718 TRP A CE2 
1365 C CE3 . TRP A 223 ? 0.7823 0.8954 0.9268 0.1103  -0.0743 0.0491  718 TRP A CE3 
1366 C CZ2 . TRP A 223 ? 0.8463 1.0134 0.9224 0.1261  -0.0720 0.0707  718 TRP A CZ2 
1367 C CZ3 . TRP A 223 ? 0.8355 0.9600 0.9649 0.1269  -0.0863 0.0656  718 TRP A CZ3 
1368 C CH2 . TRP A 223 ? 0.8652 1.0164 0.9593 0.1346  -0.0851 0.0775  718 TRP A CH2 
1369 N N   . SER A 224 ? 0.6533 0.7792 0.8074 0.0566  -0.0303 -0.0247 719 SER A N   
1370 C CA  . SER A 224 ? 0.6346 0.7771 0.7776 0.0527  -0.0254 -0.0359 719 SER A CA  
1371 C C   . SER A 224 ? 0.6551 0.8085 0.8122 0.0501  -0.0292 -0.0610 719 SER A C   
1372 O O   . SER A 224 ? 0.6631 0.8363 0.8137 0.0545  -0.0346 -0.0735 719 SER A O   
1373 C CB  . SER A 224 ? 0.6647 0.7961 0.8068 0.0422  -0.0133 -0.0290 719 SER A CB  
1374 O OG  . SER A 224 ? 0.7691 0.8935 0.9043 0.0435  -0.0095 -0.0037 719 SER A OG  
1375 N N   . LEU A 225 ? 0.5901 0.7330 0.7684 0.0442  -0.0272 -0.0682 720 LEU A N   
1376 C CA  . LEU A 225 ? 0.5709 0.7253 0.7693 0.0404  -0.0290 -0.0868 720 LEU A CA  
1377 C C   . LEU A 225 ? 0.6615 0.8364 0.8659 0.0508  -0.0422 -0.0954 720 LEU A C   
1378 O O   . LEU A 225 ? 0.6776 0.8691 0.8937 0.0497  -0.0479 -0.1116 720 LEU A O   
1379 C CB  . LEU A 225 ? 0.5468 0.6906 0.7630 0.0344  -0.0218 -0.0883 720 LEU A CB  
1380 C CG  . LEU A 225 ? 0.5722 0.7001 0.7855 0.0245  -0.0110 -0.0849 720 LEU A CG  
1381 C CD1 . LEU A 225 ? 0.5583 0.6798 0.7824 0.0236  -0.0056 -0.0862 720 LEU A CD1 
1382 C CD2 . LEU A 225 ? 0.5488 0.6822 0.7670 0.0163  -0.0076 -0.0933 720 LEU A CD2 
1383 N N   . GLY A 226 ? 0.6310 0.8042 0.8292 0.0614  -0.0489 -0.0848 721 GLY A N   
1384 C CA  . GLY A 226 ? 0.6507 0.8437 0.8529 0.0738  -0.0635 -0.0913 721 GLY A CA  
1385 C C   . GLY A 226 ? 0.7434 0.9557 0.9249 0.0814  -0.0724 -0.0964 721 GLY A C   
1386 O O   . GLY A 226 ? 0.7473 0.9816 0.9392 0.0880  -0.0855 -0.1132 721 GLY A O   
1387 N N   . CYS A 227 ? 0.7175 0.9247 0.8714 0.0814  -0.0656 -0.0835 722 CYS A N   
1388 C CA  . CYS A 227 ? 0.7325 0.9612 0.8608 0.0905  -0.0712 -0.0886 722 CYS A CA  
1389 C C   . CYS A 227 ? 0.7445 0.9839 0.8888 0.0837  -0.0733 -0.1167 722 CYS A C   
1390 O O   . CYS A 227 ? 0.7432 1.0060 0.8833 0.0936  -0.0870 -0.1353 722 CYS A O   
1391 C CB  . CYS A 227 ? 0.7557 0.9782 0.8554 0.0909  -0.0593 -0.0655 722 CYS A CB  
1392 S SG  . CYS A 227 ? 0.8396 1.0580 0.9179 0.1035  -0.0614 -0.0302 722 CYS A SG  
1393 N N   . ILE A 228 ? 0.6661 0.8877 0.8299 0.0677  -0.0614 -0.1197 723 ILE A N   
1394 C CA  . ILE A 228 ? 0.6437 0.8689 0.8294 0.0591  -0.0625 -0.1421 723 ILE A CA  
1395 C C   . ILE A 228 ? 0.7167 0.9550 0.9366 0.0585  -0.0750 -0.1605 723 ILE A C   
1396 O O   . ILE A 228 ? 0.7326 0.9867 0.9659 0.0612  -0.0874 -0.1834 723 ILE A O   
1397 C CB  . ILE A 228 ? 0.6478 0.8504 0.8446 0.0437  -0.0471 -0.1359 723 ILE A CB  
1398 C CG1 . ILE A 228 ? 0.6558 0.8507 0.8246 0.0445  -0.0367 -0.1216 723 ILE A CG1 
1399 C CG2 . ILE A 228 ? 0.6373 0.8411 0.8626 0.0350  -0.0498 -0.1559 723 ILE A CG2 
1400 C CD1 . ILE A 228 ? 0.6485 0.8190 0.8223 0.0325  -0.0225 -0.1073 723 ILE A CD1 
1401 N N   . LEU A 229 ? 0.6565 0.8906 0.8931 0.0564  -0.0730 -0.1522 724 LEU A N   
1402 C CA  . LEU A 229 ? 0.6490 0.8999 0.9224 0.0558  -0.0832 -0.1677 724 LEU A CA  
1403 C C   . LEU A 229 ? 0.7289 1.0040 0.9943 0.0721  -0.1037 -0.1804 724 LEU A C   
1404 O O   . LEU A 229 ? 0.7452 1.0383 1.0420 0.0715  -0.1167 -0.2023 724 LEU A O   
1405 C CB  . LEU A 229 ? 0.6335 0.8796 0.9256 0.0526  -0.0752 -0.1569 724 LEU A CB  
1406 C CG  . LEU A 229 ? 0.6696 0.9359 1.0083 0.0488  -0.0804 -0.1704 724 LEU A CG  
1407 C CD1 . LEU A 229 ? 0.6502 0.9144 1.0226 0.0314  -0.0711 -0.1762 724 LEU A CD1 
1408 C CD2 . LEU A 229 ? 0.6719 0.9393 1.0197 0.0528  -0.0743 -0.1606 724 LEU A CD2 
1409 N N   . TYR A 230 ? 0.6939 0.9704 0.9193 0.0867  -0.1072 -0.1663 725 TYR A N   
1410 C CA  . TYR A 230 ? 0.7157 1.0170 0.9235 0.1059  -0.1270 -0.1742 725 TYR A CA  
1411 C C   . TYR A 230 ? 0.7904 1.1101 0.9926 0.1107  -0.1384 -0.1995 725 TYR A C   
1412 O O   . TYR A 230 ? 0.7989 1.1433 1.0124 0.1214  -0.1592 -0.2219 725 TYR A O   
1413 C CB  . TYR A 230 ? 0.7435 1.0392 0.9075 0.1190  -0.1242 -0.1463 725 TYR A CB  
1414 C CG  . TYR A 230 ? 0.7878 1.1077 0.9306 0.1410  -0.1439 -0.1466 725 TYR A CG  
1415 C CD1 . TYR A 230 ? 0.8354 1.1810 0.9500 0.1551  -0.1557 -0.1603 725 TYR A CD1 
1416 C CD2 . TYR A 230 ? 0.8115 1.1290 0.9581 0.1504  -0.1508 -0.1318 725 TYR A CD2 
1417 C CE1 . TYR A 230 ? 0.8824 1.2530 0.9718 0.1780  -0.1747 -0.1594 725 TYR A CE1 
1418 C CE2 . TYR A 230 ? 0.8593 1.1990 0.9842 0.1724  -0.1701 -0.1294 725 TYR A CE2 
1419 C CZ  . TYR A 230 ? 0.9855 1.3523 1.0797 0.1863  -0.1818 -0.1421 725 TYR A CZ  
1420 O OH  . TYR A 230 ? 1.0700 1.4614 1.1377 0.2104  -0.2017 -0.1390 725 TYR A OH  
1421 N N   . TYR A 231 ? 0.7488 1.0574 0.9367 0.1037  -0.1261 -0.1985 726 TYR A N   
1422 C CA  . TYR A 231 ? 0.7660 1.0888 0.9493 0.1085  -0.1348 -0.2240 726 TYR A CA  
1423 C C   . TYR A 231 ? 0.8001 1.1257 1.0376 0.0978  -0.1462 -0.2526 726 TYR A C   
1424 O O   . TYR A 231 ? 0.8247 1.1730 1.0717 0.1084  -0.1675 -0.2811 726 TYR A O   
1425 C CB  . TYR A 231 ? 0.7904 1.0976 0.9531 0.1017  -0.1162 -0.2132 726 TYR A CB  
1426 C CG  . TYR A 231 ? 0.8528 1.1751 1.0040 0.1100  -0.1227 -0.2379 726 TYR A CG  
1427 C CD1 . TYR A 231 ? 0.9096 1.2632 1.0470 0.1298  -0.1439 -0.2635 726 TYR A CD1 
1428 C CD2 . TYR A 231 ? 0.8619 1.1696 1.0124 0.1011  -0.1084 -0.2363 726 TYR A CD2 
1429 C CE1 . TYR A 231 ? 0.9423 1.3123 1.0681 0.1405  -0.1509 -0.2902 726 TYR A CE1 
1430 C CE2 . TYR A 231 ? 0.8987 1.2215 1.0399 0.1110  -0.1145 -0.2611 726 TYR A CE2 
1431 C CZ  . TYR A 231 ? 1.0347 1.3890 1.1627 0.1312  -0.1355 -0.2888 726 TYR A CZ  
1432 O OH  . TYR A 231 ? 1.0788 1.4501 1.1972 0.1436  -0.1425 -0.3172 726 TYR A OH  
1433 N N   . MET A 232 ? 0.7193 1.0245 0.9947 0.0779  -0.1334 -0.2443 727 MET A N   
1434 C CA  . MET A 232 ? 0.6999 1.0070 1.0344 0.0646  -0.1407 -0.2641 727 MET A CA  
1435 C C   . MET A 232 ? 0.7561 1.0867 1.1207 0.0703  -0.1582 -0.2766 727 MET A C   
1436 O O   . MET A 232 ? 0.7541 1.0930 1.1726 0.0611  -0.1683 -0.2959 727 MET A O   
1437 C CB  . MET A 232 ? 0.7021 0.9852 1.0627 0.0437  -0.1192 -0.2451 727 MET A CB  
1438 C CG  . MET A 232 ? 0.7470 1.0071 1.0860 0.0370  -0.1035 -0.2339 727 MET A CG  
1439 S SD  . MET A 232 ? 0.7799 1.0154 1.1323 0.0189  -0.0786 -0.2061 727 MET A SD  
1440 C CE  . MET A 232 ? 0.7352 0.9596 1.1288 0.0043  -0.0785 -0.2172 727 MET A CE  
1441 N N   . THR A 233 ? 0.7180 1.0589 1.0531 0.0849  -0.1621 -0.2643 728 THR A N   
1442 C CA  . THR A 233 ? 0.7173 1.0813 1.0796 0.0924  -0.1789 -0.2745 728 THR A CA  
1443 C C   . THR A 233 ? 0.8010 1.1926 1.1417 0.1148  -0.2058 -0.2963 728 THR A C   
1444 O O   . THR A 233 ? 0.8007 1.2141 1.1813 0.1170  -0.2272 -0.3245 728 THR A O   
1445 C CB  . THR A 233 ? 0.7507 1.1072 1.1041 0.0941  -0.1669 -0.2476 728 THR A CB  
1446 O OG1 . THR A 233 ? 0.7048 1.0398 1.0772 0.0752  -0.1434 -0.2321 728 THR A OG1 
1447 C CG2 . THR A 233 ? 0.7275 1.1088 1.1134 0.1023  -0.1831 -0.2574 728 THR A CG2 
1448 N N   . TYR A 234 ? 0.7811 1.1737 1.0599 0.1317  -0.2047 -0.2825 729 TYR A N   
1449 C CA  . TYR A 234 ? 0.8104 1.2321 1.0548 0.1571  -0.2280 -0.2970 729 TYR A CA  
1450 C C   . TYR A 234 ? 0.8982 1.3322 1.1149 0.1672  -0.2357 -0.3195 729 TYR A C   
1451 O O   . TYR A 234 ? 0.9368 1.4013 1.1327 0.1895  -0.2593 -0.3410 729 TYR A O   
1452 C CB  . TYR A 234 ? 0.8274 1.2498 1.0247 0.1732  -0.2247 -0.2649 729 TYR A CB  
1453 C CG  . TYR A 234 ? 0.8173 1.2368 1.0456 0.1708  -0.2266 -0.2535 729 TYR A CG  
1454 C CD1 . TYR A 234 ? 0.8495 1.2944 1.1170 0.1773  -0.2501 -0.2780 729 TYR A CD1 
1455 C CD2 . TYR A 234 ? 0.8033 1.1965 1.0235 0.1639  -0.2066 -0.2204 729 TYR A CD2 
1456 C CE1 . TYR A 234 ? 0.8487 1.2948 1.1468 0.1769  -0.2514 -0.2689 729 TYR A CE1 
1457 C CE2 . TYR A 234 ? 0.8010 1.1935 1.0499 0.1646  -0.2090 -0.2131 729 TYR A CE2 
1458 C CZ  . TYR A 234 ? 0.9005 1.3204 1.1878 0.1714  -0.2305 -0.2369 729 TYR A CZ  
1459 O OH  . TYR A 234 ? 0.9102 1.3335 1.2276 0.1741  -0.2330 -0.2312 729 TYR A OH  
1460 N N   . GLY A 235 ? 0.8291 1.2419 1.0470 0.1529  -0.2177 -0.3169 730 GLY A N   
1461 C CA  . GLY A 235 ? 0.8401 1.2629 1.0370 0.1618  -0.2228 -0.3399 730 GLY A CA  
1462 C C   . GLY A 235 ? 0.9089 1.3360 1.0393 0.1753  -0.2077 -0.3168 730 GLY A C   
1463 O O   . GLY A 235 ? 0.9213 1.3603 1.0301 0.1847  -0.2088 -0.3342 730 GLY A O   
1464 N N   . LYS A 236 ? 0.8737 1.2922 0.9752 0.1765  -0.1935 -0.2776 731 LYS A N   
1465 C CA  . LYS A 236 ? 0.8890 1.3095 0.9343 0.1859  -0.1759 -0.2461 731 LYS A CA  
1466 C C   . LYS A 236 ? 0.8968 1.2861 0.9447 0.1710  -0.1548 -0.2045 731 LYS A C   
1467 O O   . LYS A 236 ? 0.8515 1.2254 0.9353 0.1601  -0.1573 -0.2021 731 LYS A O   
1468 C CB  . LYS A 236 ? 0.9675 1.4257 0.9620 0.2161  -0.1913 -0.2452 731 LYS A CB  
1469 C CG  . LYS A 236 ? 1.1059 1.5721 1.1056 0.2261  -0.2091 -0.2382 731 LYS A CG  
1470 C CD  . LYS A 236 ? 1.2119 1.6913 1.1560 0.2459  -0.2055 -0.2005 731 LYS A CD  
1471 C CE  . LYS A 236 ? 1.2477 1.7315 1.2009 0.2560  -0.2239 -0.1928 731 LYS A CE  
1472 N NZ  . LYS A 236 ? 1.3408 1.8276 1.2475 0.2715  -0.2179 -0.1481 731 LYS A NZ  
1473 N N   . THR A 237 ? 0.8700 1.2521 0.8834 0.1712  -0.1347 -0.1733 732 THR A N   
1474 C CA  . THR A 237 ? 0.8570 1.2100 0.8736 0.1594  -0.1181 -0.1354 732 THR A CA  
1475 C C   . THR A 237 ? 0.9418 1.3056 0.9348 0.1769  -0.1283 -0.1130 732 THR A C   
1476 O O   . THR A 237 ? 0.9789 1.3753 0.9410 0.1984  -0.1427 -0.1215 732 THR A O   
1477 C CB  . THR A 237 ? 0.9579 1.2978 0.9581 0.1503  -0.0941 -0.1123 732 THR A CB  
1478 O OG1 . THR A 237 ? 1.0269 1.3963 0.9815 0.1683  -0.0913 -0.1032 732 THR A OG1 
1479 C CG2 . THR A 237 ? 0.8744 1.1991 0.9021 0.1331  -0.0855 -0.1318 732 THR A CG2 
1480 N N   . PRO A 238 ? 0.8888 1.2276 0.8953 0.1706  -0.1235 -0.0861 733 PRO A N   
1481 C CA  . PRO A 238 ? 0.9185 1.2660 0.9067 0.1887  -0.1360 -0.0653 733 PRO A CA  
1482 C C   . PRO A 238 ? 1.0348 1.4050 0.9702 0.2083  -0.1345 -0.0390 733 PRO A C   
1483 O O   . PRO A 238 ? 1.0677 1.4574 0.9832 0.2289  -0.1517 -0.0330 733 PRO A O   
1484 C CB  . PRO A 238 ? 0.9181 1.2293 0.9316 0.1766  -0.1270 -0.0402 733 PRO A CB  
1485 C CG  . PRO A 238 ? 0.9340 1.2258 0.9847 0.1553  -0.1174 -0.0594 733 PRO A CG  
1486 C CD  . PRO A 238 ? 0.8716 1.1745 0.9121 0.1492  -0.1094 -0.0768 733 PRO A CD  
1487 N N   . PHE A 239 ? 1.0036 1.3741 0.9172 0.2029  -0.1139 -0.0220 734 PHE A N   
1488 C CA  . PHE A 239 ? 1.0448 1.4397 0.9094 0.2197  -0.1063 0.0090  734 PHE A CA  
1489 C C   . PHE A 239 ? 1.1180 1.5517 0.9490 0.2315  -0.1033 -0.0129 734 PHE A C   
1490 O O   . PHE A 239 ? 1.1582 1.6191 0.9454 0.2466  -0.0939 0.0123  734 PHE A O   
1491 C CB  . PHE A 239 ? 1.0654 1.4322 0.9351 0.2059  -0.0838 0.0553  734 PHE A CB  
1492 C CG  . PHE A 239 ? 1.0768 1.4081 0.9760 0.1999  -0.0899 0.0761  734 PHE A CG  
1493 C CD1 . PHE A 239 ? 1.1535 1.4889 1.0344 0.2170  -0.0998 0.1074  734 PHE A CD1 
1494 C CD2 . PHE A 239 ? 1.0534 1.3491 0.9982 0.1794  -0.0872 0.0628  734 PHE A CD2 
1495 C CE1 . PHE A 239 ? 1.1550 1.4570 1.0668 0.2135  -0.1077 0.1230  734 PHE A CE1 
1496 C CE2 . PHE A 239 ? 1.0792 1.3454 1.0514 0.1770  -0.0942 0.0768  734 PHE A CE2 
1497 C CZ  . PHE A 239 ? 1.0950 1.3634 1.0524 0.1939  -0.1048 0.1058  734 PHE A CZ  
1498 N N   . GLN A 240 ? 1.0399 1.4782 0.8926 0.2264  -0.1126 -0.0599 735 GLN A N   
1499 C CA  . GLN A 240 ? 1.0479 1.5192 0.8794 0.2375  -0.1141 -0.0914 735 GLN A CA  
1500 C C   . GLN A 240 ? 1.1562 1.6770 0.9324 0.2702  -0.1263 -0.0933 735 GLN A C   
1501 O O   . GLN A 240 ? 1.1824 1.7336 0.9254 0.2821  -0.1166 -0.0987 735 GLN A O   
1502 C CB  . GLN A 240 ? 1.0309 1.4942 0.9050 0.2275  -0.1290 -0.1416 735 GLN A CB  
1503 C CG  . GLN A 240 ? 1.1561 1.6342 1.0272 0.2286  -0.1241 -0.1719 735 GLN A CG  
1504 C CD  . GLN A 240 ? 1.3112 1.7719 1.2342 0.2141  -0.1368 -0.2135 735 GLN A CD  
1505 O OE1 . GLN A 240 ? 1.2916 1.7162 1.2558 0.1902  -0.1286 -0.2066 735 GLN A OE1 
1506 N NE2 . GLN A 240 ? 1.1089 1.5959 1.0325 0.2289  -0.1571 -0.2571 735 GLN A NE2 
1507 N N   . GLN A 241 ? 1.1265 1.6579 0.8917 0.2864  -0.1475 -0.0893 736 GLN A N   
1508 C CA  . GLN A 241 ? 1.1740 1.7533 0.8841 0.3203  -0.1628 -0.0894 736 GLN A CA  
1509 C C   . GLN A 241 ? 1.2399 1.8422 0.8960 0.3326  -0.1390 -0.0433 736 GLN A C   
1510 O O   . GLN A 241 ? 1.2744 1.9251 0.8804 0.3594  -0.1429 -0.0528 736 GLN A O   
1511 C CB  . GLN A 241 ? 1.2097 1.7881 0.9229 0.3323  -0.1871 -0.0820 736 GLN A CB  
1512 C CG  . GLN A 241 ? 1.4864 2.0605 1.2468 0.3282  -0.2150 -0.1324 736 GLN A CG  
1513 C CD  . GLN A 241 ? 1.7994 2.3984 1.5486 0.3529  -0.2467 -0.1420 736 GLN A CD  
1514 O OE1 . GLN A 241 ? 1.7916 2.3959 1.5096 0.3682  -0.2486 -0.1030 736 GLN A OE1 
1515 N NE2 . GLN A 241 ? 1.6667 2.2802 1.4471 0.3565  -0.2738 -0.1941 736 GLN A NE2 
1516 N N   . ILE A 242 ? 1.1768 1.7467 0.8459 0.3133  -0.1145 0.0057  737 ILE A N   
1517 C CA  . ILE A 242 ? 1.2052 1.7919 0.8364 0.3191  -0.0886 0.0576  737 ILE A CA  
1518 C C   . ILE A 242 ? 1.2398 1.8432 0.8651 0.3126  -0.0650 0.0475  737 ILE A C   
1519 O O   . ILE A 242 ? 1.1909 1.7597 0.8593 0.2857  -0.0516 0.0423  737 ILE A O   
1520 C CB  . ILE A 242 ? 1.2291 1.7719 0.8866 0.3003  -0.0753 0.1120  737 ILE A CB  
1521 C CG1 . ILE A 242 ? 1.2397 1.7666 0.9050 0.3094  -0.1000 0.1203  737 ILE A CG1 
1522 C CG2 . ILE A 242 ? 1.2757 1.8369 0.9010 0.3047  -0.0481 0.1688  737 ILE A CG2 
1523 C CD1 . ILE A 242 ? 1.2577 1.7285 0.9745 0.2854  -0.0963 0.1438  737 ILE A CD1 
1524 N N   . ILE A 243 ? 1.2337 1.8924 0.8046 0.3391  -0.0600 0.0451  738 ILE A N   
1525 C CA  . ILE A 243 ? 1.2205 1.9035 0.7822 0.3379  -0.0374 0.0348  738 ILE A CA  
1526 C C   . ILE A 243 ? 1.2509 1.9221 0.8205 0.3200  -0.0026 0.0935  738 ILE A C   
1527 O O   . ILE A 243 ? 1.1948 1.8385 0.8054 0.2950  0.0127  0.0889  738 ILE A O   
1528 C CB  . ILE A 243 ? 1.3128 2.0637 0.8131 0.3753  -0.0441 0.0099  738 ILE A CB  
1529 N N   . ASN A 244 ? 1.2489 1.9394 0.7833 0.3326  0.0081  0.1497  739 ASN A N   
1530 C CA  . ASN A 244 ? 1.2493 1.9330 0.7913 0.3183  0.0395  0.2144  739 ASN A CA  
1531 C C   . ASN A 244 ? 1.2255 1.8422 0.8359 0.2812  0.0445  0.2274  739 ASN A C   
1532 O O   . ASN A 244 ? 1.2010 1.7770 0.8355 0.2736  0.0266  0.2326  739 ASN A O   
1533 C CB  . ASN A 244 ? 1.2989 2.0038 0.7988 0.3385  0.0399  0.2697  739 ASN A CB  
1534 C CG  . ASN A 244 ? 1.5628 2.2656 1.0711 0.3257  0.0719  0.3411  739 ASN A CG  
1535 O OD1 . ASN A 244 ? 1.4335 2.0833 0.9968 0.2966  0.0786  0.3671  739 ASN A OD1 
1536 N ND2 . ASN A 244 ? 1.5222 2.2845 0.9771 0.3485  0.0914  0.3752  739 ASN A ND2 
1537 N N   . GLN A 245 ? 1.1469 1.7552 0.7880 0.2600  0.0683  0.2317  740 GLN A N   
1538 C CA  . GLN A 245 ? 1.0879 1.6375 0.7926 0.2263  0.0731  0.2390  740 GLN A CA  
1539 C C   . GLN A 245 ? 1.1274 1.6411 0.8550 0.2149  0.0749  0.2928  740 GLN A C   
1540 O O   . GLN A 245 ? 1.0948 1.5582 0.8624 0.1991  0.0599  0.2827  740 GLN A O   
1541 C CB  . GLN A 245 ? 1.0796 1.6332 0.8106 0.2090  0.0970  0.2346  740 GLN A CB  
1542 C CG  . GLN A 245 ? 1.2586 1.8313 0.9842 0.2151  0.0914  0.1750  740 GLN A CG  
1543 C CD  . GLN A 245 ? 1.4992 2.0277 1.2596 0.2021  0.0682  0.1293  740 GLN A CD  
1544 O OE1 . GLN A 245 ? 1.4793 2.0097 1.2254 0.2153  0.0442  0.0981  740 GLN A OE1 
1545 N NE2 . GLN A 245 ? 1.3428 1.8344 1.1506 0.1765  0.0751  0.1241  740 GLN A NE2 
1546 N N   . ILE A 246 ? 1.1053 1.6457 0.8085 0.2242  0.0923  0.3496  741 ILE A N   
1547 C CA  . ILE A 246 ? 1.1148 1.6210 0.8421 0.2149  0.0932  0.4052  741 ILE A CA  
1548 C C   . ILE A 246 ? 1.1828 1.6669 0.9006 0.2283  0.0624  0.3959  741 ILE A C   
1549 O O   . ILE A 246 ? 1.1487 1.5797 0.9120 0.2123  0.0501  0.3980  741 ILE A O   
1550 C CB  . ILE A 246 ? 1.2061 1.7484 0.9111 0.2221  0.1197  0.4719  741 ILE A CB  
1551 C CG1 . ILE A 246 ? 1.2042 1.7730 0.9241 0.2087  0.1509  0.4773  741 ILE A CG1 
1552 C CG2 . ILE A 246 ? 1.2153 1.7136 0.9576 0.2092  0.1188  0.5295  741 ILE A CG2 
1553 C CD1 . ILE A 246 ? 1.3427 1.9717 1.0229 0.2244  0.1785  0.5256  741 ILE A CD1 
1554 N N   . SER A 247 ? 1.1875 1.7145 0.8482 0.2588  0.0485  0.3799  742 SER A N   
1555 C CA  . SER A 247 ? 1.2041 1.7203 0.8522 0.2755  0.0174  0.3663  742 SER A CA  
1556 C C   . SER A 247 ? 1.2060 1.6790 0.8996 0.2596  -0.0035 0.3129  742 SER A C   
1557 O O   . SER A 247 ? 1.2033 1.6473 0.9146 0.2616  -0.0247 0.3123  742 SER A O   
1558 C CB  . SER A 247 ? 1.2935 1.8697 0.8738 0.3110  0.0056  0.3478  742 SER A CB  
1559 O OG  . SER A 247 ? 1.4681 2.0874 1.0003 0.3298  0.0235  0.4017  742 SER A OG  
1560 N N   . LYS A 248 ? 1.1132 1.5829 0.8277 0.2442  0.0034  0.2709  743 LYS A N   
1561 C CA  . LYS A 248 ? 1.0499 1.4812 0.8083 0.2275  -0.0118 0.2255  743 LYS A CA  
1562 C C   . LYS A 248 ? 1.0793 1.4562 0.8902 0.2030  -0.0064 0.2513  743 LYS A C   
1563 O O   . LYS A 248 ? 1.0529 1.3991 0.8878 0.2014  -0.0246 0.2440  743 LYS A O   
1564 C CB  . LYS A 248 ? 1.0338 1.4769 0.7990 0.2190  -0.0054 0.1791  743 LYS A CB  
1565 C CG  . LYS A 248 ? 1.0626 1.4976 0.8437 0.2198  -0.0294 0.1231  743 LYS A CG  
1566 C CD  . LYS A 248 ? 1.0936 1.5221 0.8992 0.2044  -0.0234 0.0827  743 LYS A CD  
1567 C CE  . LYS A 248 ? 1.1537 1.6269 0.9263 0.2177  -0.0142 0.0651  743 LYS A CE  
1568 N NZ  . LYS A 248 ? 1.1588 1.6505 0.9267 0.2298  -0.0354 0.0100  743 LYS A NZ  
1569 N N   . LEU A 249 ? 1.0541 1.4218 0.8839 0.1859  0.0177  0.2820  744 LEU A N   
1570 C CA  . LEU A 249 ? 1.0363 1.3539 0.9191 0.1627  0.0224  0.3057  744 LEU A CA  
1571 C C   . LEU A 249 ? 1.1315 1.4259 1.0215 0.1703  0.0101  0.3442  744 LEU A C   
1572 O O   . LEU A 249 ? 1.1080 1.3576 1.0398 0.1596  -0.0019 0.3393  744 LEU A O   
1573 C CB  . LEU A 249 ? 1.0345 1.3559 0.9349 0.1459  0.0496  0.3341  744 LEU A CB  
1574 C CG  . LEU A 249 ? 1.0669 1.4096 0.9653 0.1386  0.0621  0.2985  744 LEU A CG  
1575 C CD1 . LEU A 249 ? 1.0885 1.4551 0.9895 0.1313  0.0900  0.3330  744 LEU A CD1 
1576 C CD2 . LEU A 249 ? 1.0594 1.3617 1.0017 0.1184  0.0543  0.2602  744 LEU A CD2 
1577 N N   . HIS A 250 ? 1.1373 1.4643 0.9843 0.1917  0.0112  0.3792  745 HIS A N   
1578 C CA  . HIS A 250 ? 1.1825 1.4916 1.0311 0.2029  -0.0019 0.4184  745 HIS A CA  
1579 C C   . HIS A 250 ? 1.2314 1.5258 1.0830 0.2149  -0.0319 0.3834  745 HIS A C   
1580 O O   . HIS A 250 ? 1.2657 1.5301 1.1378 0.2189  -0.0456 0.4068  745 HIS A O   
1581 C CB  . HIS A 250 ? 1.2616 1.6154 1.0574 0.2250  0.0077  0.4657  745 HIS A CB  
1582 C CG  . HIS A 250 ? 1.3366 1.6893 1.1485 0.2116  0.0350  0.5247  745 HIS A CG  
1583 N ND1 . HIS A 250 ? 1.4215 1.7706 1.2291 0.2201  0.0375  0.5886  745 HIS A ND1 
1584 C CD2 . HIS A 250 ? 1.3361 1.6906 1.1737 0.1900  0.0597  0.5288  745 HIS A CD2 
1585 C CE1 . HIS A 250 ? 1.4258 1.7763 1.2578 0.2024  0.0649  0.6305  745 HIS A CE1 
1586 N NE2 . HIS A 250 ? 1.3793 1.7338 1.2305 0.1840  0.0787  0.5953  745 HIS A NE2 
1587 N N   . ALA A 251 ? 1.1445 1.4596 0.9809 0.2206  -0.0425 0.3281  746 ALA A N   
1588 C CA  . ALA A 251 ? 1.1234 1.4310 0.9676 0.2309  -0.0698 0.2913  746 ALA A CA  
1589 C C   . ALA A 251 ? 1.1359 1.4015 1.0347 0.2095  -0.0743 0.2584  746 ALA A C   
1590 O O   . ALA A 251 ? 1.1316 1.3756 1.0544 0.2137  -0.0928 0.2487  746 ALA A O   
1591 C CB  . ALA A 251 ? 1.1312 1.4857 0.9350 0.2491  -0.0806 0.2508  746 ALA A CB  
1592 N N   . ILE A 252 ? 1.0680 1.3250 0.9856 0.1885  -0.0575 0.2413  747 ILE A N   
1593 C CA  . ILE A 252 ? 1.0247 1.2462 0.9887 0.1691  -0.0592 0.2119  747 ILE A CA  
1594 C C   . ILE A 252 ? 1.1071 1.2842 1.1103 0.1618  -0.0630 0.2388  747 ILE A C   
1595 O O   . ILE A 252 ? 1.0832 1.2368 1.1164 0.1599  -0.0761 0.2161  747 ILE A O   
1596 C CB  . ILE A 252 ? 1.0261 1.2491 0.9986 0.1501  -0.0407 0.1927  747 ILE A CB  
1597 C CG1 . ILE A 252 ? 1.0301 1.2960 0.9669 0.1594  -0.0391 0.1644  747 ILE A CG1 
1598 C CG2 . ILE A 252 ? 0.9846 1.1752 0.9992 0.1330  -0.0437 0.1623  747 ILE A CG2 
1599 C CD1 . ILE A 252 ? 1.1575 1.4381 1.0859 0.1496  -0.0171 0.1684  747 ILE A CD1 
1600 N N   . ILE A 253 ? 1.1178 1.2853 1.1227 0.1592  -0.0522 0.2870  748 ILE A N   
1601 C CA  . ILE A 253 ? 1.1352 1.2582 1.1829 0.1525  -0.0575 0.3142  748 ILE A CA  
1602 C C   . ILE A 253 ? 1.2348 1.3489 1.2811 0.1724  -0.0787 0.3302  748 ILE A C   
1603 O O   . ILE A 253 ? 1.2297 1.3082 1.3152 0.1709  -0.0925 0.3213  748 ILE A O   
1604 C CB  . ILE A 253 ? 1.1928 1.3014 1.2604 0.1369  -0.0384 0.3581  748 ILE A CB  
1605 C CG1 . ILE A 253 ? 1.2434 1.3897 1.2689 0.1477  -0.0244 0.4025  748 ILE A CG1 
1606 C CG2 . ILE A 253 ? 1.1553 1.2564 1.2464 0.1145  -0.0240 0.3337  748 ILE A CG2 
1607 C CD1 . ILE A 253 ? 1.3797 1.5054 1.4313 0.1407  -0.0150 0.4630  748 ILE A CD1 
1608 N N   . ASP A 254 ? 1.2391 1.3874 1.2401 0.1930  -0.0824 0.3517  749 ASP A N   
1609 C CA  . ASP A 254 ? 1.2820 1.4270 1.2758 0.2151  -0.1033 0.3716  749 ASP A CA  
1610 C C   . ASP A 254 ? 1.3133 1.4522 1.3240 0.2245  -0.1269 0.3270  749 ASP A C   
1611 O O   . ASP A 254 ? 1.2835 1.4545 1.2723 0.2307  -0.1322 0.2876  749 ASP A O   
1612 C CB  . ASP A 254 ? 1.3576 1.5482 1.2919 0.2371  -0.1018 0.4010  749 ASP A CB  
1613 C CG  . ASP A 254 ? 1.5524 1.7430 1.4749 0.2624  -0.1250 0.4232  749 ASP A CG  
1614 O OD1 . ASP A 254 ? 1.5993 1.7578 1.5455 0.2628  -0.1271 0.4697  749 ASP A OD1 
1615 O OD2 . ASP A 254 ? 1.6350 1.8561 1.5294 0.2819  -0.1428 0.3933  749 ASP A OD2 
1616 N N   . PRO A 255 ? 1.2871 1.3864 1.3403 0.2265  -0.1418 0.3330  750 PRO A N   
1617 C CA  . PRO A 255 ? 1.2549 1.3521 1.3283 0.2367  -0.1628 0.2917  750 PRO A CA  
1618 C C   . PRO A 255 ? 1.2834 1.4125 1.3263 0.2641  -0.1838 0.2908  750 PRO A C   
1619 O O   . PRO A 255 ? 1.2332 1.3762 1.2864 0.2718  -0.1984 0.2505  750 PRO A O   
1620 C CB  . PRO A 255 ? 1.2890 1.3358 1.4157 0.2330  -0.1714 0.3025  750 PRO A CB  
1621 C CG  . PRO A 255 ? 1.4019 1.4292 1.5278 0.2321  -0.1651 0.3621  750 PRO A CG  
1622 C CD  . PRO A 255 ? 1.3432 1.3986 1.4330 0.2198  -0.1404 0.3761  750 PRO A CD  
1623 N N   . ASN A 256 ? 1.2870 1.4302 1.2937 0.2794  -0.1851 0.3362  751 ASN A N   
1624 C CA  . ASN A 256 ? 1.3241 1.5010 1.2951 0.3083  -0.2061 0.3396  751 ASN A CA  
1625 C C   . ASN A 256 ? 1.3485 1.5778 1.2763 0.3139  -0.2049 0.3038  751 ASN A C   
1626 O O   . ASN A 256 ? 1.3535 1.6158 1.2561 0.3373  -0.2256 0.2905  751 ASN A O   
1627 C CB  . ASN A 256 ? 1.4058 1.5802 1.3510 0.3241  -0.2075 0.4042  751 ASN A CB  
1628 C CG  . ASN A 256 ? 1.6488 1.7681 1.6438 0.3188  -0.2117 0.4393  751 ASN A CG  
1629 O OD1 . ASN A 256 ? 1.5801 1.6773 1.6089 0.3296  -0.2338 0.4267  751 ASN A OD1 
1630 N ND2 . ASN A 256 ? 1.5290 1.6251 1.5349 0.3018  -0.1910 0.4814  751 ASN A ND2 
1631 N N   . HIS A 257 ? 1.2744 1.5106 1.1975 0.2932  -0.1824 0.2862  752 HIS A N   
1632 C CA  . HIS A 257 ? 1.2538 1.5336 1.1450 0.2956  -0.1808 0.2478  752 HIS A CA  
1633 C C   . HIS A 257 ? 1.2457 1.5223 1.1752 0.2855  -0.1897 0.1915  752 HIS A C   
1634 O O   . HIS A 257 ? 1.1905 1.4489 1.1467 0.2622  -0.1742 0.1718  752 HIS A O   
1635 C CB  . HIS A 257 ? 1.2560 1.5472 1.1240 0.2811  -0.1533 0.2579  752 HIS A CB  
1636 C CG  . HIS A 257 ? 1.3003 1.6410 1.1269 0.2920  -0.1554 0.2257  752 HIS A CG  
1637 N ND1 . HIS A 257 ? 1.2729 1.6213 1.1184 0.2818  -0.1590 0.1711  752 HIS A ND1 
1638 C CD2 . HIS A 257 ? 1.3702 1.7549 1.1400 0.3140  -0.1564 0.2401  752 HIS A CD2 
1639 C CE1 . HIS A 257 ? 1.2846 1.6778 1.0884 0.2970  -0.1635 0.1519  752 HIS A CE1 
1640 N NE2 . HIS A 257 ? 1.3476 1.7660 1.1024 0.3178  -0.1622 0.1903  752 HIS A NE2 
1641 N N   . GLU A 258 ? 1.2042 1.5000 1.1377 0.3038  -0.2151 0.1677  753 GLU A N   
1642 C CA  . GLU A 258 ? 1.1499 1.4483 1.1236 0.2966  -0.2249 0.1183  753 GLU A CA  
1643 C C   . GLU A 258 ? 1.1615 1.4864 1.1291 0.2857  -0.2183 0.0775  753 GLU A C   
1644 O O   . GLU A 258 ? 1.1724 1.5348 1.1028 0.3000  -0.2267 0.0671  753 GLU A O   
1645 C CB  . GLU A 258 ? 1.1846 1.4989 1.1694 0.3197  -0.2543 0.1070  753 GLU A CB  
1646 C CG  . GLU A 258 ? 1.3143 1.5922 1.3337 0.3238  -0.2612 0.1295  753 GLU A CG  
1647 C CD  . GLU A 258 ? 1.5970 1.8896 1.6331 0.3474  -0.2905 0.1181  753 GLU A CD  
1648 O OE1 . GLU A 258 ? 1.5398 1.8667 1.5853 0.3526  -0.3043 0.0777  753 GLU A OE1 
1649 O OE2 . GLU A 258 ? 1.5022 1.7711 1.5478 0.3604  -0.3006 0.1492  753 GLU A OE2 
1650 N N   . ILE A 259 ? 1.0691 1.3742 1.0737 0.2615  -0.2041 0.0546  754 ILE A N   
1651 C CA  . ILE A 259 ? 1.0312 1.3540 1.0415 0.2484  -0.1979 0.0162  754 ILE A CA  
1652 C C   . ILE A 259 ? 1.0870 1.4358 1.1233 0.2572  -0.2207 -0.0224 754 ILE A C   
1653 O O   . ILE A 259 ? 1.0705 1.4094 1.1434 0.2586  -0.2294 -0.0273 754 ILE A O   
1654 C CB  . ILE A 259 ? 1.0185 1.3103 1.0591 0.2207  -0.1751 0.0105  754 ILE A CB  
1655 C CG1 . ILE A 259 ? 1.0252 1.2948 1.0447 0.2117  -0.1542 0.0468  754 ILE A CG1 
1656 C CG2 . ILE A 259 ? 0.9937 1.3012 1.0476 0.2074  -0.1709 -0.0286 754 ILE A CG2 
1657 C CD1 . ILE A 259 ? 0.9936 1.2269 1.0451 0.1890  -0.1367 0.0486  754 ILE A CD1 
1658 N N   . GLU A 260 ? 1.0669 1.4507 1.0871 0.2644  -0.2315 -0.0504 755 GLU A N   
1659 C CA  . GLU A 260 ? 1.0687 1.4804 1.1186 0.2719  -0.2550 -0.0890 755 GLU A CA  
1660 C C   . GLU A 260 ? 1.0756 1.4792 1.1786 0.2477  -0.2459 -0.1197 755 GLU A C   
1661 O O   . GLU A 260 ? 1.0463 1.4410 1.1482 0.2305  -0.2290 -0.1271 755 GLU A O   
1662 C CB  . GLU A 260 ? 1.1200 1.5731 1.1353 0.2909  -0.2738 -0.1105 755 GLU A CB  
1663 C CG  . GLU A 260 ? 1.3260 1.7984 1.2895 0.3206  -0.2887 -0.0839 755 GLU A CG  
1664 C CD  . GLU A 260 ? 1.6345 2.1529 1.5633 0.3426  -0.3101 -0.1112 755 GLU A CD  
1665 O OE1 . GLU A 260 ? 1.5742 2.1046 1.4603 0.3456  -0.2988 -0.1078 755 GLU A OE1 
1666 O OE2 . GLU A 260 ? 1.5639 2.1085 1.5110 0.3575  -0.3390 -0.1390 755 GLU A OE2 
1667 N N   . PHE A 261 ? 1.0193 1.4282 1.1694 0.2472  -0.2569 -0.1360 756 PHE A N   
1668 C CA  . PHE A 261 ? 0.9781 1.3857 1.1818 0.2258  -0.2484 -0.1623 756 PHE A CA  
1669 C C   . PHE A 261 ? 1.0312 1.4755 1.2721 0.2339  -0.2737 -0.1970 756 PHE A C   
1670 O O   . PHE A 261 ? 1.0111 1.4636 1.2906 0.2381  -0.2822 -0.2021 756 PHE A O   
1671 C CB  . PHE A 261 ? 0.9777 1.3577 1.2109 0.2144  -0.2318 -0.1477 756 PHE A CB  
1672 C CG  . PHE A 261 ? 0.9951 1.3387 1.2030 0.2032  -0.2082 -0.1196 756 PHE A CG  
1673 C CD1 . PHE A 261 ? 1.0056 1.3348 1.2218 0.1811  -0.1873 -0.1253 756 PHE A CD1 
1674 C CD2 . PHE A 261 ? 1.0506 1.3734 1.2326 0.2145  -0.2079 -0.0870 756 PHE A CD2 
1675 C CE1 . PHE A 261 ? 1.0064 1.3035 1.2038 0.1711  -0.1675 -0.1016 756 PHE A CE1 
1676 C CE2 . PHE A 261 ? 1.0796 1.3689 1.2473 0.2027  -0.1875 -0.0626 756 PHE A CE2 
1677 C CZ  . PHE A 261 ? 1.0190 1.2969 1.1944 0.1814  -0.1679 -0.0715 756 PHE A CZ  
1678 N N   . PRO A 262 ? 1.0019 1.4706 1.2333 0.2379  -0.2876 -0.2228 757 PRO A N   
1679 C CA  . PRO A 262 ? 1.0062 1.5113 1.2773 0.2460  -0.3155 -0.2591 757 PRO A CA  
1680 C C   . PRO A 262 ? 1.0321 1.5406 1.3787 0.2257  -0.3101 -0.2776 757 PRO A C   
1681 O O   . PRO A 262 ? 1.0109 1.4977 1.3769 0.2021  -0.2854 -0.2729 757 PRO A O   
1682 C CB  . PRO A 262 ? 1.0413 1.5639 1.2909 0.2495  -0.3264 -0.2847 757 PRO A CB  
1683 C CG  . PRO A 262 ? 1.1117 1.6167 1.2946 0.2544  -0.3096 -0.2563 757 PRO A CG  
1684 C CD  . PRO A 262 ? 1.0261 1.4926 1.2130 0.2370  -0.2802 -0.2226 757 PRO A CD  
1685 N N   . ASP A 263 ? 0.9893 1.5275 1.3787 0.2358  -0.3329 -0.2967 758 ASP A N   
1686 C CA  . ASP A 263 ? 0.9474 1.4988 1.4142 0.2194  -0.3295 -0.3136 758 ASP A CA  
1687 C C   . ASP A 263 ? 0.9547 1.5092 1.4633 0.1954  -0.3235 -0.3374 758 ASP A C   
1688 O O   . ASP A 263 ? 0.9656 1.5395 1.4806 0.2001  -0.3458 -0.3659 758 ASP A O   
1689 C CB  . ASP A 263 ? 0.9843 1.5724 1.4875 0.2380  -0.3590 -0.3314 758 ASP A CB  
1690 N N   . ILE A 264 ? 0.8608 1.3940 1.3939 0.1712  -0.2935 -0.3244 759 ILE A N   
1691 C CA  . ILE A 264 ? 0.8215 1.3506 1.3959 0.1460  -0.2824 -0.3379 759 ILE A CA  
1692 C C   . ILE A 264 ? 0.8009 1.3495 1.4549 0.1302  -0.2742 -0.3430 759 ILE A C   
1693 O O   . ILE A 264 ? 0.7750 1.3310 1.4367 0.1378  -0.2684 -0.3305 759 ILE A O   
1694 C CB  . ILE A 264 ? 0.8416 1.3317 1.3742 0.1323  -0.2531 -0.3142 759 ILE A CB  
1695 N N   . PRO A 265 ? 0.7272 1.2859 1.4439 0.1092  -0.2734 -0.3604 760 PRO A N   
1696 C CA  . PRO A 265 ? 0.6969 1.2787 1.4918 0.0936  -0.2623 -0.3606 760 PRO A CA  
1697 C C   . PRO A 265 ? 0.7134 1.2773 1.5030 0.0803  -0.2245 -0.3298 760 PRO A C   
1698 O O   . PRO A 265 ? 0.6852 1.2716 1.5275 0.0723  -0.2111 -0.3250 760 PRO A O   
1699 C CB  . PRO A 265 ? 0.7170 1.3089 1.5771 0.0738  -0.2718 -0.3836 760 PRO A CB  
1700 C CG  . PRO A 265 ? 0.7998 1.3769 1.6151 0.0834  -0.2928 -0.4021 760 PRO A CG  
1701 C CD  . PRO A 265 ? 0.7526 1.3020 1.4757 0.0985  -0.2814 -0.3790 760 PRO A CD  
1702 N N   . GLU A 266 ? 0.6753 1.2019 1.4017 0.0791  -0.2076 -0.3103 761 GLU A N   
1703 C CA  . GLU A 266 ? 0.6538 1.1601 1.3637 0.0696  -0.1748 -0.2834 761 GLU A CA  
1704 C C   . GLU A 266 ? 0.7045 1.2000 1.3636 0.0902  -0.1738 -0.2691 761 GLU A C   
1705 O O   . GLU A 266 ? 0.6919 1.1602 1.2900 0.0992  -0.1763 -0.2596 761 GLU A O   
1706 C CB  . GLU A 266 ? 0.6626 1.1350 1.3425 0.0547  -0.1596 -0.2731 761 GLU A CB  
1707 C CG  . GLU A 266 ? 0.7370 1.2149 1.4743 0.0322  -0.1567 -0.2822 761 GLU A CG  
1708 C CD  . GLU A 266 ? 0.8143 1.2642 1.5402 0.0144  -0.1304 -0.2621 761 GLU A CD  
1709 O OE1 . GLU A 266 ? 0.6688 1.1190 1.3987 0.0080  -0.1049 -0.2411 761 GLU A OE1 
1710 O OE2 . GLU A 266 ? 0.5348 0.9645 1.2487 0.0083  -0.1362 -0.2689 761 GLU A OE2 
1711 N N   . LYS A 267 ? 0.6763 1.1950 1.3652 0.0988  -0.1717 -0.2684 762 LYS A N   
1712 C CA  . LYS A 267 ? 0.6835 1.1916 1.3343 0.1198  -0.1736 -0.2567 762 LYS A CA  
1713 C C   . LYS A 267 ? 0.7467 1.2199 1.3555 0.1155  -0.1482 -0.2344 762 LYS A C   
1714 O O   . LYS A 267 ? 0.7653 1.2135 1.3267 0.1295  -0.1525 -0.2225 762 LYS A O   
1715 C CB  . LYS A 267 ? 0.6936 1.2375 1.3922 0.1319  -0.1801 -0.2656 762 LYS A CB  
1716 N N   . ASP A 268 ? 0.6810 1.1528 1.3088 0.0962  -0.1231 -0.2281 763 ASP A N   
1717 C CA  . ASP A 268 ? 0.6739 1.1175 1.2675 0.0912  -0.0996 -0.2103 763 ASP A CA  
1718 C C   . ASP A 268 ? 0.7311 1.1369 1.2701 0.0881  -0.1018 -0.2012 763 ASP A C   
1719 O O   . ASP A 268 ? 0.7215 1.0996 1.2195 0.0945  -0.0955 -0.1880 763 ASP A O   
1720 C CB  . ASP A 268 ? 0.6871 1.1444 1.3160 0.0718  -0.0745 -0.2054 763 ASP A CB  
1721 C CG  . ASP A 268 ? 0.8544 1.3501 1.5313 0.0748  -0.0625 -0.2082 763 ASP A CG  
1722 O OD1 . ASP A 268 ? 0.8749 1.3838 1.5562 0.0938  -0.0730 -0.2152 763 ASP A OD1 
1723 O OD2 . ASP A 268 ? 0.9381 1.4517 1.6486 0.0589  -0.0417 -0.2016 763 ASP A OD2 
1724 N N   . LEU A 269 ? 0.6891 1.0955 1.2322 0.0786  -0.1112 -0.2101 764 LEU A N   
1725 C CA  . LEU A 269 ? 0.6812 1.0605 1.1796 0.0761  -0.1145 -0.2059 764 LEU A CA  
1726 C C   . LEU A 269 ? 0.7450 1.1140 1.1980 0.0962  -0.1305 -0.2006 764 LEU A C   
1727 O O   . LEU A 269 ? 0.7516 1.0930 1.1598 0.0974  -0.1239 -0.1856 764 LEU A O   
1728 C CB  . LEU A 269 ? 0.6802 1.0713 1.2053 0.0656  -0.1258 -0.2238 764 LEU A CB  
1729 C CG  . LEU A 269 ? 0.7517 1.1227 1.2399 0.0635  -0.1311 -0.2267 764 LEU A CG  
1730 C CD1 . LEU A 269 ? 0.7418 1.0802 1.1884 0.0577  -0.1108 -0.2061 764 LEU A CD1 
1731 C CD2 . LEU A 269 ? 0.7810 1.1606 1.3117 0.0489  -0.1364 -0.2445 764 LEU A CD2 
1732 N N   . GLN A 270 ? 0.7048 1.0969 1.1722 0.1120  -0.1507 -0.2103 765 GLN A N   
1733 C CA  . GLN A 270 ? 0.7302 1.1153 1.1575 0.1330  -0.1670 -0.2016 765 GLN A CA  
1734 C C   . GLN A 270 ? 0.7561 1.1166 1.1644 0.1392  -0.1553 -0.1810 765 GLN A C   
1735 O O   . GLN A 270 ? 0.7638 1.1006 1.1292 0.1467  -0.1568 -0.1634 765 GLN A O   
1736 C CB  . GLN A 270 ? 0.7703 1.1880 1.2210 0.1498  -0.1932 -0.2175 765 GLN A CB  
1737 C CG  . GLN A 270 ? 1.0160 1.4314 1.4190 0.1710  -0.2139 -0.2102 765 GLN A CG  
1738 C CD  . GLN A 270 ? 1.1749 1.6216 1.5976 0.1907  -0.2412 -0.2240 765 GLN A CD  
1739 O OE1 . GLN A 270 ? 1.1019 1.5775 1.5500 0.1912  -0.2585 -0.2488 765 GLN A OE1 
1740 N NE2 . GLN A 270 ? 1.0440 1.4849 1.4571 0.2084  -0.2479 -0.2089 765 GLN A NE2 
1741 N N   . ASP A 271 ? 0.6853 1.0525 1.1274 0.1358  -0.1428 -0.1834 766 ASP A N   
1742 C CA  . ASP A 271 ? 0.6815 1.0263 1.1108 0.1431  -0.1336 -0.1698 766 ASP A CA  
1743 C C   . ASP A 271 ? 0.7007 1.0108 1.0951 0.1318  -0.1171 -0.1547 766 ASP A C   
1744 O O   . ASP A 271 ? 0.7141 0.9978 1.0827 0.1402  -0.1190 -0.1399 766 ASP A O   
1745 C CB  . ASP A 271 ? 0.6922 1.0578 1.1638 0.1449  -0.1237 -0.1794 766 ASP A CB  
1746 C CG  . ASP A 271 ? 0.8063 1.1511 1.2675 0.1581  -0.1204 -0.1714 766 ASP A CG  
1747 O OD1 . ASP A 271 ? 0.8243 1.1686 1.2879 0.1774  -0.1378 -0.1704 766 ASP A OD1 
1748 O OD2 . ASP A 271 ? 0.8240 1.1516 1.2749 0.1503  -0.1023 -0.1668 766 ASP A OD2 
1749 N N   . VAL A 272 ? 0.6140 0.9239 1.0111 0.1131  -0.1026 -0.1578 767 VAL A N   
1750 C CA  . VAL A 272 ? 0.5949 0.8754 0.9625 0.1018  -0.0877 -0.1456 767 VAL A CA  
1751 C C   . VAL A 272 ? 0.6574 0.9178 0.9846 0.1077  -0.0970 -0.1325 767 VAL A C   
1752 O O   . VAL A 272 ? 0.6430 0.8767 0.9481 0.1098  -0.0922 -0.1173 767 VAL A O   
1753 C CB  . VAL A 272 ? 0.6147 0.9002 0.9939 0.0825  -0.0746 -0.1510 767 VAL A CB  
1754 C CG1 . VAL A 272 ? 0.6070 0.8631 0.9536 0.0734  -0.0630 -0.1390 767 VAL A CG1 
1755 C CG2 . VAL A 272 ? 0.5971 0.9025 1.0142 0.0755  -0.0607 -0.1569 767 VAL A CG2 
1756 N N   . LEU A 273 ? 0.6420 0.9180 0.9618 0.1113  -0.1106 -0.1388 768 LEU A N   
1757 C CA  . LEU A 273 ? 0.6619 0.9286 0.9411 0.1187  -0.1185 -0.1265 768 LEU A CA  
1758 C C   . LEU A 273 ? 0.7243 0.9762 0.9863 0.1340  -0.1257 -0.1068 768 LEU A C   
1759 O O   . LEU A 273 ? 0.7212 0.9484 0.9580 0.1323  -0.1184 -0.0866 768 LEU A O   
1760 C CB  . LEU A 273 ? 0.6719 0.9653 0.9482 0.1244  -0.1348 -0.1424 768 LEU A CB  
1761 C CG  . LEU A 273 ? 0.6992 1.0025 0.9954 0.1089  -0.1301 -0.1620 768 LEU A CG  
1762 C CD1 . LEU A 273 ? 0.7060 1.0364 1.0059 0.1173  -0.1506 -0.1828 768 LEU A CD1 
1763 C CD2 . LEU A 273 ? 0.7050 0.9858 0.9773 0.0966  -0.1136 -0.1526 768 LEU A CD2 
1764 N N   . LYS A 274 ? 0.6899 0.9558 0.9729 0.1479  -0.1394 -0.1123 769 LYS A N   
1765 C CA  . LYS A 274 ? 0.7101 0.9613 0.9861 0.1643  -0.1492 -0.0949 769 LYS A CA  
1766 C C   . LYS A 274 ? 0.7941 1.0120 1.0729 0.1588  -0.1358 -0.0827 769 LYS A C   
1767 O O   . LYS A 274 ? 0.8212 1.0148 1.0828 0.1653  -0.1392 -0.0603 769 LYS A O   
1768 C CB  . LYS A 274 ? 0.7185 0.9941 1.0243 0.1801  -0.1664 -0.1082 769 LYS A CB  
1769 C CG  . LYS A 274 ? 0.6733 0.9772 0.9678 0.1925  -0.1871 -0.1145 769 LYS A CG  
1770 C CD  . LYS A 274 ? 0.6814 1.0123 1.0093 0.2085  -0.2062 -0.1294 769 LYS A CD  
1771 N N   . CYS A 275 ? 0.7465 0.9640 1.0463 0.1464  -0.1207 -0.0966 770 CYS A N   
1772 C CA  . CYS A 275 ? 0.7499 0.9408 1.0537 0.1421  -0.1092 -0.0923 770 CYS A CA  
1773 C C   . CYS A 275 ? 0.8130 0.9779 1.0909 0.1294  -0.0984 -0.0773 770 CYS A C   
1774 O O   . CYS A 275 ? 0.8168 0.9537 1.0933 0.1302  -0.0968 -0.0668 770 CYS A O   
1775 C CB  . CYS A 275 ? 0.7325 0.9398 1.0634 0.1365  -0.0971 -0.1120 770 CYS A CB  
1776 S SG  . CYS A 275 ? 0.7909 1.0237 1.1597 0.1545  -0.1068 -0.1279 770 CYS A SG  
1777 N N   . CYS A 276 ? 0.7607 0.9355 1.0234 0.1175  -0.0915 -0.0790 771 CYS A N   
1778 C CA  . CYS A 276 ? 0.7524 0.9088 0.9925 0.1057  -0.0809 -0.0667 771 CYS A CA  
1779 C C   . CYS A 276 ? 0.8113 0.9577 1.0270 0.1127  -0.0877 -0.0431 771 CYS A C   
1780 O O   . CYS A 276 ? 0.8151 0.9379 1.0226 0.1077  -0.0816 -0.0259 771 CYS A O   
1781 C CB  . CYS A 276 ? 0.7407 0.9128 0.9766 0.0932  -0.0728 -0.0786 771 CYS A CB  
1782 S SG  . CYS A 276 ? 0.7662 0.9470 1.0298 0.0816  -0.0601 -0.0971 771 CYS A SG  
1783 N N   . LEU A 277 ? 0.7669 0.9338 0.9719 0.1246  -0.1004 -0.0415 772 LEU A N   
1784 C CA  . LEU A 277 ? 0.7841 0.9492 0.9602 0.1332  -0.1056 -0.0168 772 LEU A CA  
1785 C C   . LEU A 277 ? 0.8758 1.0242 1.0552 0.1470  -0.1166 0.0058  772 LEU A C   
1786 O O   . LEU A 277 ? 0.9151 1.0766 1.0776 0.1619  -0.1289 0.0184  772 LEU A O   
1787 C CB  . LEU A 277 ? 0.7861 0.9836 0.9408 0.1396  -0.1128 -0.0263 772 LEU A CB  
1788 C CG  . LEU A 277 ? 0.8062 1.0152 0.9600 0.1258  -0.1029 -0.0468 772 LEU A CG  
1789 C CD1 . LEU A 277 ? 0.8078 1.0492 0.9575 0.1339  -0.1160 -0.0679 772 LEU A CD1 
1790 C CD2 . LEU A 277 ? 0.8323 1.0312 0.9618 0.1176  -0.0887 -0.0308 772 LEU A CD2 
1791 N N   . LYS A 278 ? 0.8304 0.9492 1.0322 0.1432  -0.1134 0.0106  773 LYS A N   
1792 C CA  . LYS A 278 ? 0.8533 0.9479 1.0675 0.1548  -0.1243 0.0313  773 LYS A CA  
1793 C C   . LYS A 278 ? 0.9464 1.0128 1.1555 0.1452  -0.1155 0.0599  773 LYS A C   
1794 O O   . LYS A 278 ? 0.9314 0.9816 1.1523 0.1312  -0.1047 0.0521  773 LYS A O   
1795 C CB  . LYS A 278 ? 0.8540 0.9376 1.1037 0.1598  -0.1299 0.0106  773 LYS A CB  
1796 C CG  . LYS A 278 ? 0.9035 1.0065 1.1658 0.1784  -0.1466 0.0002  773 LYS A CG  
1797 C CD  . LYS A 278 ? 0.9718 1.0824 1.2662 0.1808  -0.1457 -0.0300 773 LYS A CD  
1798 N N   . ARG A 279 ? 0.9557 1.0194 1.1473 0.1528  -0.1198 0.0940  774 ARG A N   
1799 C CA  . ARG A 279 ? 0.9776 1.0198 1.1665 0.1442  -0.1108 0.1293  774 ARG A CA  
1800 C C   . ARG A 279 ? 1.0193 1.0219 1.2463 0.1342  -0.1098 0.1310  774 ARG A C   
1801 O O   . ARG A 279 ? 1.0134 1.0043 1.2443 0.1193  -0.0975 0.1435  774 ARG A O   
1802 C CB  . ARG A 279 ? 1.0197 1.0649 1.1907 0.1586  -0.1187 0.1688  774 ARG A CB  
1803 C CG  . ARG A 279 ? 1.1074 1.1885 1.2329 0.1615  -0.1100 0.1819  774 ARG A CG  
1804 C CD  . ARG A 279 ? 1.1586 1.2685 1.2583 0.1837  -0.1261 0.1812  774 ARG A CD  
1805 N NE  . ARG A 279 ? 1.1248 1.2744 1.1797 0.1885  -0.1195 0.1812  774 ARG A NE  
1806 C CZ  . ARG A 279 ? 1.2959 1.4783 1.3213 0.2083  -0.1334 0.1761  774 ARG A CZ  
1807 N NH1 . ARG A 279 ? 1.1147 1.2952 1.1515 0.2247  -0.1543 0.1737  774 ARG A NH1 
1808 N NH2 . ARG A 279 ? 1.1141 1.3331 1.0992 0.2136  -0.1280 0.1721  774 ARG A NH2 
1809 N N   . ASP A 280 ? 0.9720 0.9560 1.2291 0.1437  -0.1238 0.1167  775 ASP A N   
1810 C CA  . ASP A 280 ? 0.9587 0.9062 1.2539 0.1378  -0.1269 0.1110  775 ASP A CA  
1811 C C   . ASP A 280 ? 0.9177 0.8723 1.2176 0.1285  -0.1183 0.0727  775 ASP A C   
1812 O O   . ASP A 280 ? 0.8705 0.8429 1.1718 0.1366  -0.1216 0.0437  775 ASP A O   
1813 C CB  . ASP A 280 ? 1.0142 0.9396 1.3402 0.1554  -0.1472 0.1103  775 ASP A CB  
1814 C CG  . ASP A 280 ? 1.1315 1.0172 1.5009 0.1528  -0.1548 0.1020  775 ASP A CG  
1815 O OD1 . ASP A 280 ? 1.0868 0.9550 1.4661 0.1362  -0.1463 0.1115  775 ASP A OD1 
1816 O OD2 . ASP A 280 ? 1.2476 1.1202 1.6440 0.1685  -0.1709 0.0855  775 ASP A OD2 
1817 N N   . PRO A 281 ? 0.8549 0.7974 1.1596 0.1119  -0.1073 0.0734  776 PRO A N   
1818 C CA  . PRO A 281 ? 0.8155 0.7643 1.1223 0.1044  -0.0998 0.0396  776 PRO A CA  
1819 C C   . PRO A 281 ? 0.8781 0.8177 1.2100 0.1166  -0.1110 0.0110  776 PRO A C   
1820 O O   . PRO A 281 ? 0.8624 0.8220 1.1879 0.1175  -0.1052 -0.0169 776 PRO A O   
1821 C CB  . PRO A 281 ? 0.8331 0.7626 1.1505 0.0883  -0.0926 0.0498  776 PRO A CB  
1822 C CG  . PRO A 281 ? 0.9108 0.8378 1.2211 0.0839  -0.0888 0.0892  776 PRO A CG  
1823 C CD  . PRO A 281 ? 0.8857 0.8100 1.1968 0.0998  -0.1013 0.1062  776 PRO A CD  
1824 N N   . LYS A 282 ? 0.8510 0.7619 1.2124 0.1271  -0.1270 0.0192  777 LYS A N   
1825 C CA  . LYS A 282 ? 0.8520 0.7524 1.2410 0.1426  -0.1404 -0.0080 777 LYS A CA  
1826 C C   . LYS A 282 ? 0.8822 0.8148 1.2618 0.1572  -0.1417 -0.0263 777 LYS A C   
1827 O O   . LYS A 282 ? 0.8671 0.8103 1.2576 0.1663  -0.1426 -0.0577 777 LYS A O   
1828 C CB  . LYS A 282 ? 0.9280 0.7893 1.3529 0.1514  -0.1591 0.0092  777 LYS A CB  
1829 C CG  . LYS A 282 ? 1.1503 0.9769 1.6002 0.1375  -0.1611 0.0224  777 LYS A CG  
1830 C CD  . LYS A 282 ? 1.2877 1.0736 1.7802 0.1457  -0.1810 0.0423  777 LYS A CD  
1831 N N   . GLN A 283 ? 0.8318 0.7833 1.1918 0.1599  -0.1417 -0.0073 778 GLN A N   
1832 C CA  . GLN A 283 ? 0.8123 0.7968 1.1671 0.1726  -0.1451 -0.0209 778 GLN A CA  
1833 C C   . GLN A 283 ? 0.8105 0.8320 1.1418 0.1617  -0.1291 -0.0356 778 GLN A C   
1834 O O   . GLN A 283 ? 0.7905 0.8425 1.1231 0.1693  -0.1305 -0.0499 778 GLN A O   
1835 C CB  . GLN A 283 ? 0.8583 0.8425 1.2054 0.1830  -0.1573 0.0076  778 GLN A CB  
1836 C CG  . GLN A 283 ? 1.1057 1.0620 1.4835 0.2008  -0.1773 0.0159  778 GLN A CG  
1837 C CD  . GLN A 283 ? 1.4093 1.3857 1.8071 0.2192  -0.1867 -0.0141 778 GLN A CD  
1838 O OE1 . GLN A 283 ? 1.3366 1.3460 1.7248 0.2274  -0.1898 -0.0186 778 GLN A OE1 
1839 N NE2 . GLN A 283 ? 1.3231 1.2839 1.7507 0.2266  -0.1913 -0.0382 778 GLN A NE2 
1840 N N   . ARG A 284 ? 0.7390 0.7573 1.0534 0.1439  -0.1149 -0.0315 779 ARG A N   
1841 C CA  . ARG A 284 ? 0.6987 0.7458 0.9941 0.1323  -0.1006 -0.0427 779 ARG A CA  
1842 C C   . ARG A 284 ? 0.7165 0.7762 1.0223 0.1304  -0.0914 -0.0705 779 ARG A C   
1843 O O   . ARG A 284 ? 0.7244 0.7658 1.0412 0.1316  -0.0915 -0.0795 779 ARG A O   
1844 C CB  . ARG A 284 ? 0.6680 0.7064 0.9424 0.1162  -0.0902 -0.0255 779 ARG A CB  
1845 C CG  . ARG A 284 ? 0.7058 0.7721 0.9584 0.1077  -0.0809 -0.0291 779 ARG A CG  
1846 C CD  . ARG A 284 ? 0.8176 0.8761 1.0511 0.0950  -0.0716 -0.0117 779 ARG A CD  
1847 N NE  . ARG A 284 ? 0.8485 0.8988 1.0719 0.1001  -0.0773 0.0173  779 ARG A NE  
1848 C CZ  . ARG A 284 ? 0.9685 1.0050 1.1861 0.0914  -0.0704 0.0394  779 ARG A CZ  
1849 N NH1 . ARG A 284 ? 0.6859 0.7145 0.9073 0.0776  -0.0596 0.0329  779 ARG A NH1 
1850 N NH2 . ARG A 284 ? 0.8963 0.9287 1.1057 0.0968  -0.0739 0.0697  779 ARG A NH2 
1851 N N   . ILE A 285 ? 0.6275 0.7196 0.9302 0.1273  -0.0837 -0.0832 780 ILE A N   
1852 C CA  . ILE A 285 ? 0.5925 0.7037 0.9032 0.1243  -0.0715 -0.1040 780 ILE A CA  
1853 C C   . ILE A 285 ? 0.6446 0.7424 0.9404 0.1099  -0.0592 -0.1031 780 ILE A C   
1854 O O   . ILE A 285 ? 0.6385 0.7244 0.9182 0.0986  -0.0568 -0.0885 780 ILE A O   
1855 C CB  . ILE A 285 ? 0.5993 0.7475 0.9165 0.1220  -0.0671 -0.1120 780 ILE A CB  
1856 C CG1 . ILE A 285 ? 0.5636 0.7371 0.8962 0.1217  -0.0540 -0.1295 780 ILE A CG1 
1857 C CG2 . ILE A 285 ? 0.6339 0.7864 0.9325 0.1077  -0.0631 -0.1022 780 ILE A CG2 
1858 C CD1 . ILE A 285 ? 0.5731 0.7841 0.9253 0.1198  -0.0511 -0.1369 780 ILE A CD1 
1859 N N   . SER A 286 ? 0.5812 0.6833 0.8821 0.1125  -0.0521 -0.1189 781 SER A N   
1860 C CA  . SER A 286 ? 0.5538 0.6467 0.8409 0.1018  -0.0425 -0.1199 781 SER A CA  
1861 C C   . SER A 286 ? 0.6168 0.7361 0.8966 0.0908  -0.0267 -0.1219 781 SER A C   
1862 O O   . SER A 286 ? 0.6135 0.7601 0.9052 0.0931  -0.0227 -0.1267 781 SER A O   
1863 C CB  . SER A 286 ? 0.5741 0.6571 0.8676 0.1129  -0.0458 -0.1361 781 SER A CB  
1864 O OG  . SER A 286 ? 0.6336 0.7462 0.9325 0.1230  -0.0378 -0.1534 781 SER A OG  
1865 N N   . ILE A 287 ? 0.5649 0.6757 0.8294 0.0788  -0.0187 -0.1173 782 ILE A N   
1866 C CA  . ILE A 287 ? 0.5322 0.6632 0.7929 0.0686  -0.0048 -0.1168 782 ILE A CA  
1867 C C   . ILE A 287 ? 0.5718 0.7293 0.8406 0.0765  0.0052  -0.1277 782 ILE A C   
1868 O O   . ILE A 287 ? 0.5471 0.7298 0.8289 0.0719  0.0133  -0.1261 782 ILE A O   
1869 C CB  . ILE A 287 ? 0.5538 0.6706 0.7984 0.0556  0.0003  -0.1089 782 ILE A CB  
1870 C CG1 . ILE A 287 ? 0.5403 0.6489 0.7807 0.0469  -0.0040 -0.0981 782 ILE A CG1 
1871 C CG2 . ILE A 287 ? 0.5441 0.6790 0.7871 0.0488  0.0142  -0.1088 782 ILE A CG2 
1872 C CD1 . ILE A 287 ? 0.5908 0.6819 0.8192 0.0390  -0.0030 -0.0913 782 ILE A CD1 
1873 N N   . PRO A 288 ? 0.5426 0.6985 0.8075 0.0895  0.0042  -0.1397 783 PRO A N   
1874 C CA  . PRO A 288 ? 0.5406 0.7295 0.8111 0.0996  0.0159  -0.1496 783 PRO A CA  
1875 C C   . PRO A 288 ? 0.5891 0.8029 0.8848 0.1062  0.0155  -0.1537 783 PRO A C   
1876 O O   . PRO A 288 ? 0.5785 0.8267 0.8863 0.1058  0.0297  -0.1535 783 PRO A O   
1877 C CB  . PRO A 288 ? 0.5746 0.7542 0.8353 0.1159  0.0096  -0.1662 783 PRO A CB  
1878 C CG  . PRO A 288 ? 0.6199 0.7621 0.8696 0.1084  -0.0016 -0.1616 783 PRO A CG  
1879 C CD  . PRO A 288 ? 0.5588 0.6858 0.8165 0.0963  -0.0076 -0.1462 783 PRO A CD  
1880 N N   . GLU A 289 ? 0.5436 0.7411 0.8494 0.1115  -0.0005 -0.1547 784 GLU A N   
1881 C CA  . GLU A 289 ? 0.5287 0.7478 0.8594 0.1193  -0.0052 -0.1589 784 GLU A CA  
1882 C C   . GLU A 289 ? 0.5684 0.8040 0.9097 0.1047  -0.0009 -0.1491 784 GLU A C   
1883 O O   . GLU A 289 ? 0.5666 0.8355 0.9330 0.1069  0.0044  -0.1538 784 GLU A O   
1884 C CB  . GLU A 289 ? 0.5507 0.7461 0.8874 0.1314  -0.0252 -0.1609 784 GLU A CB  
1885 C CG  . GLU A 289 ? 0.6767 0.8662 1.0193 0.1510  -0.0313 -0.1779 784 GLU A CG  
1886 C CD  . GLU A 289 ? 1.0093 1.1666 1.3611 0.1626  -0.0524 -0.1782 784 GLU A CD  
1887 O OE1 . GLU A 289 ? 0.8095 0.9494 1.1599 0.1563  -0.0621 -0.1612 784 GLU A OE1 
1888 O OE2 . GLU A 289 ? 1.0187 1.1683 1.3793 0.1792  -0.0596 -0.1952 784 GLU A OE2 
1889 N N   . LEU A 290 ? 0.5221 0.7372 0.8479 0.0901  -0.0032 -0.1373 785 LEU A N   
1890 C CA  . LEU A 290 ? 0.5084 0.7372 0.8451 0.0769  -0.0017 -0.1320 785 LEU A CA  
1891 C C   . LEU A 290 ? 0.6006 0.8553 0.9526 0.0668  0.0160  -0.1306 785 LEU A C   
1892 O O   . LEU A 290 ? 0.6179 0.8961 0.9976 0.0601  0.0174  -0.1314 785 LEU A O   
1893 C CB  . LEU A 290 ? 0.4925 0.6960 0.8083 0.0664  -0.0076 -0.1224 785 LEU A CB  
1894 C CG  . LEU A 290 ? 0.5525 0.7407 0.8589 0.0735  -0.0241 -0.1182 785 LEU A CG  
1895 C CD1 . LEU A 290 ? 0.5615 0.7252 0.8428 0.0650  -0.0250 -0.1071 785 LEU A CD1 
1896 C CD2 . LEU A 290 ? 0.5281 0.7386 0.8513 0.0763  -0.0340 -0.1228 785 LEU A CD2 
1897 N N   . LEU A 291 ? 0.5477 0.7993 0.8840 0.0664  0.0286  -0.1279 786 LEU A N   
1898 C CA  . LEU A 291 ? 0.5319 0.8065 0.8781 0.0579  0.0471  -0.1209 786 LEU A CA  
1899 C C   . LEU A 291 ? 0.5858 0.9005 0.9590 0.0659  0.0577  -0.1256 786 LEU A C   
1900 O O   . LEU A 291 ? 0.5973 0.9373 0.9895 0.0567  0.0736  -0.1161 786 LEU A O   
1901 C CB  . LEU A 291 ? 0.5364 0.7967 0.8528 0.0573  0.0555  -0.1154 786 LEU A CB  
1902 C CG  . LEU A 291 ? 0.5782 0.8076 0.8766 0.0446  0.0504  -0.1070 786 LEU A CG  
1903 C CD1 . LEU A 291 ? 0.5818 0.7911 0.8499 0.0503  0.0497  -0.1082 786 LEU A CD1 
1904 C CD2 . LEU A 291 ? 0.5970 0.8350 0.9100 0.0287  0.0605  -0.0947 786 LEU A CD2 
1905 N N   . ALA A 292 ? 0.5399 0.8618 0.9195 0.0829  0.0490  -0.1391 787 ALA A N   
1906 C CA  . ALA A 292 ? 0.5333 0.8970 0.9416 0.0939  0.0580  -0.1468 787 ALA A CA  
1907 C C   . ALA A 292 ? 0.5845 0.9626 1.0277 0.0946  0.0455  -0.1528 787 ALA A C   
1908 O O   . ALA A 292 ? 0.5831 0.9990 1.0573 0.1031  0.0517  -0.1598 787 ALA A O   
1909 C CB  . ALA A 292 ? 0.5500 0.9149 0.9427 0.1164  0.0568  -0.1615 787 ALA A CB  
1910 N N   . HIS A 293 ? 0.5319 0.8836 0.9698 0.0874  0.0278  -0.1508 788 HIS A N   
1911 C CA  . HIS A 293 ? 0.5325 0.8960 0.9974 0.0896  0.0119  -0.1573 788 HIS A CA  
1912 C C   . HIS A 293 ? 0.5538 0.9542 1.0632 0.0768  0.0206  -0.1563 788 HIS A C   
1913 O O   . HIS A 293 ? 0.5300 0.9301 1.0422 0.0602  0.0333  -0.1458 788 HIS A O   
1914 C CB  . HIS A 293 ? 0.5583 0.8883 1.0000 0.0852  -0.0064 -0.1536 788 HIS A CB  
1915 C CG  . HIS A 293 ? 0.6233 0.9632 1.0823 0.0928  -0.0263 -0.1608 788 HIS A CG  
1916 N ND1 . HIS A 293 ? 0.6514 1.0170 1.1439 0.0840  -0.0306 -0.1661 788 HIS A ND1 
1917 C CD2 . HIS A 293 ? 0.6756 1.0033 1.1241 0.1091  -0.0439 -0.1630 788 HIS A CD2 
1918 C CE1 . HIS A 293 ? 0.6622 1.0333 1.1607 0.0966  -0.0511 -0.1735 788 HIS A CE1 
1919 N NE2 . HIS A 293 ? 0.6795 1.0280 1.1508 0.1121  -0.0592 -0.1699 788 HIS A NE2 
1920 N N   . PRO A 294 ? 0.5341 0.9659 1.0830 0.0839  0.0126  -0.1666 789 PRO A N   
1921 C CA  . PRO A 294 ? 0.5245 0.9926 1.1254 0.0698  0.0191  -0.1661 789 PRO A CA  
1922 C C   . PRO A 294 ? 0.5777 1.0308 1.1855 0.0496  0.0128  -0.1616 789 PRO A C   
1923 O O   . PRO A 294 ? 0.5672 1.0408 1.2136 0.0333  0.0247  -0.1552 789 PRO A O   
1924 C CB  . PRO A 294 ? 0.5472 1.0410 1.1816 0.0833  0.0019  -0.1813 789 PRO A CB  
1925 C CG  . PRO A 294 ? 0.6176 1.1022 1.2261 0.1062  -0.0017 -0.1872 789 PRO A CG  
1926 C CD  . PRO A 294 ? 0.5684 1.0049 1.1215 0.1052  -0.0036 -0.1789 789 PRO A CD  
1927 N N   . TYR A 295 ? 0.5295 0.9483 1.1027 0.0513  -0.0059 -0.1646 790 TYR A N   
1928 C CA  . TYR A 295 ? 0.5224 0.9273 1.0991 0.0361  -0.0143 -0.1650 790 TYR A CA  
1929 C C   . TYR A 295 ? 0.5810 0.9743 1.1551 0.0187  0.0050  -0.1506 790 TYR A C   
1930 O O   . TYR A 295 ? 0.5699 0.9687 1.1774 0.0030  0.0048  -0.1503 790 TYR A O   
1931 C CB  . TYR A 295 ? 0.5392 0.9136 1.0719 0.0446  -0.0342 -0.1691 790 TYR A CB  
1932 C CG  . TYR A 295 ? 0.5481 0.9083 1.0775 0.0325  -0.0425 -0.1725 790 TYR A CG  
1933 C CD1 . TYR A 295 ? 0.5738 0.9535 1.1415 0.0281  -0.0583 -0.1877 790 TYR A CD1 
1934 C CD2 . TYR A 295 ? 0.5443 0.8728 1.0346 0.0269  -0.0364 -0.1632 790 TYR A CD2 
1935 C CE1 . TYR A 295 ? 0.5810 0.9483 1.1478 0.0191  -0.0678 -0.1952 790 TYR A CE1 
1936 C CE2 . TYR A 295 ? 0.5460 0.8634 1.0352 0.0177  -0.0441 -0.1687 790 TYR A CE2 
1937 C CZ  . TYR A 295 ? 0.6165 0.9529 1.1433 0.0145  -0.0600 -0.1856 790 TYR A CZ  
1938 O OH  . TYR A 295 ? 0.6384 0.9646 1.1668 0.0077  -0.0696 -0.1955 790 TYR A OH  
1939 N N   . VAL A 296 ? 0.5462 0.9235 1.0835 0.0225  0.0198  -0.1394 791 VAL A N   
1940 C CA  . VAL A 296 ? 0.5413 0.9056 1.0664 0.0102  0.0372  -0.1240 791 VAL A CA  
1941 C C   . VAL A 296 ? 0.5720 0.9707 1.1324 0.0035  0.0603  -0.1120 791 VAL A C   
1942 O O   . VAL A 296 ? 0.5646 0.9607 1.1361 -0.0113 0.0728  -0.0969 791 VAL A O   
1943 C CB  . VAL A 296 ? 0.6030 0.9376 1.0723 0.0205  0.0390  -0.1204 791 VAL A CB  
1944 C CG1 . VAL A 296 ? 0.6071 0.9375 1.0602 0.0150  0.0588  -0.1055 791 VAL A CG1 
1945 C CG2 . VAL A 296 ? 0.6040 0.9054 1.0431 0.0207  0.0218  -0.1245 791 VAL A CG2 
1946 N N   . GLN A 297 ? 0.5091 0.9415 1.0890 0.0153  0.0660  -0.1175 792 GLN A N   
1947 C CA  . GLN A 297 ? 0.4951 0.9673 1.1020 0.0144  0.0909  -0.1060 792 GLN A CA  
1948 C C   . GLN A 297 ? 0.5188 1.0334 1.1947 0.0043  0.0961  -0.1049 792 GLN A C   
1949 O O   . GLN A 297 ? 0.5251 1.0656 1.2295 -0.0068 0.1190  -0.0860 792 GLN A O   
1950 C CB  . GLN A 297 ? 0.5133 0.9982 1.0922 0.0372  0.0978  -0.1134 792 GLN A CB  
1951 C CG  . GLN A 297 ? 0.5190 0.9693 1.0371 0.0465  0.0977  -0.1125 792 GLN A CG  
1952 C CD  . GLN A 297 ? 0.5774 1.0248 1.0775 0.0369  0.1171  -0.0927 792 GLN A CD  
1953 O OE1 . GLN A 297 ? 0.5602 1.0407 1.0870 0.0294  0.1381  -0.0769 792 GLN A OE1 
1954 N NE2 . GLN A 297 ? 0.3117 0.7207 0.7672 0.0376  0.1107  -0.0913 792 GLN A NE2 
1955 N N   . ILE A 298 ? 0.4478 0.9731 1.1515 0.0097  0.0761  -0.1236 793 ILE A N   
1956 C CA  . ILE A 298 ? 0.4316 0.9994 1.2073 0.0013  0.0765  -0.1271 793 ILE A CA  
1957 C C   . ILE A 298 ? 0.4899 1.0476 1.3056 -0.0226 0.0695  -0.1223 793 ILE A C   
1958 O O   . ILE A 298 ? 0.4664 0.9866 1.2574 -0.0255 0.0494  -0.1311 793 ILE A O   
1959 C CB  . ILE A 298 ? 0.4564 1.0398 1.2477 0.0181  0.0537  -0.1510 793 ILE A CB  
1960 C CG1 . ILE A 298 ? 0.4450 1.0294 1.1964 0.0441  0.0551  -0.1587 793 ILE A CG1 
1961 C CG2 . ILE A 298 ? 0.4553 1.0863 1.3272 0.0099  0.0522  -0.1571 793 ILE A CG2 
1962 C CD1 . ILE A 298 ? 0.4044 1.0300 1.1680 0.0539  0.0820  -0.1528 793 ILE A CD1 
1963 N N   . GLN A 299 ? 0.4765 1.0704 1.3584 -0.0390 0.0862  -0.1088 794 GLN A N   
1964 C CA  . GLN A 299 ? 0.8447 1.4364 1.7856 -0.0634 0.0811  -0.1033 794 GLN A CA  
1965 C C   . GLN A 299 ? 1.1303 1.7473 2.1367 -0.0661 0.0576  -0.1268 794 GLN A C   
1966 O O   . GLN A 299 ? 0.6636 1.2587 1.6562 -0.0601 0.0273  -0.1510 794 GLN A O   
1967 C CB  . GLN A 299 ? 0.8688 1.4862 1.8492 -0.0804 0.1139  -0.0706 794 GLN A CB  
1968 C CG  . GLN A 299 ? 1.0648 1.6483 1.9931 -0.0848 0.1296  -0.0467 794 GLN A CG  
1969 C CD  . GLN A 299 ? 1.2536 1.8534 2.1308 -0.0690 0.1562  -0.0311 794 GLN A CD  
1970 O OE1 . GLN A 299 ? 1.1461 1.7629 1.9968 -0.0481 0.1556  -0.0464 794 GLN A OE1 
1971 N NE2 . GLN A 299 ? 1.1661 1.7595 2.0267 -0.0770 0.1782  -0.0015 794 GLN A NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   496 ?   ?   ?   A . n 
A 1 2   HIS 2   497 ?   ?   ?   A . n 
A 1 3   HIS 3   498 ?   ?   ?   A . n 
A 1 4   HIS 4   499 ?   ?   ?   A . n 
A 1 5   HIS 5   500 ?   ?   ?   A . n 
A 1 6   HIS 6   501 ?   ?   ?   A . n 
A 1 7   HIS 7   502 ?   ?   ?   A . n 
A 1 8   SER 8   503 ?   ?   ?   A . n 
A 1 9   SER 9   504 ?   ?   ?   A . n 
A 1 10  GLY 10  505 ?   ?   ?   A . n 
A 1 11  VAL 11  506 ?   ?   ?   A . n 
A 1 12  ASP 12  507 ?   ?   ?   A . n 
A 1 13  LEU 13  508 ?   ?   ?   A . n 
A 1 14  GLY 14  509 ?   ?   ?   A . n 
A 1 15  THR 15  510 ?   ?   ?   A . n 
A 1 16  GLU 16  511 ?   ?   ?   A . n 
A 1 17  ASN 17  512 ?   ?   ?   A . n 
A 1 18  LEU 18  513 ?   ?   ?   A . n 
A 1 19  TYR 19  514 ?   ?   ?   A . n 
A 1 20  PHE 20  515 ?   ?   ?   A . n 
A 1 21  GLN 21  516 516 GLN GLN A . n 
A 1 22  SER 22  517 517 SER SER A . n 
A 1 23  MET 23  518 518 MET MET A . n 
A 1 24  SER 24  519 519 SER SER A . n 
A 1 25  VAL 25  520 520 VAL VAL A . n 
A 1 26  LYS 26  521 521 LYS LYS A . n 
A 1 27  GLY 27  522 522 GLY GLY A . n 
A 1 28  ARG 28  523 523 ARG ARG A . n 
A 1 29  ILE 29  524 524 ILE ILE A . n 
A 1 30  TYR 30  525 525 TYR TYR A . n 
A 1 31  SER 31  526 526 SER SER A . n 
A 1 32  ILE 32  527 527 ILE ILE A . n 
A 1 33  LEU 33  528 528 LEU LEU A . n 
A 1 34  LYS 34  529 529 LYS LYS A . n 
A 1 35  GLN 35  530 530 GLN GLN A . n 
A 1 36  ILE 36  531 531 ILE ILE A . n 
A 1 37  GLY 37  532 532 GLY GLY A . n 
A 1 38  SER 38  533 ?   ?   ?   A . n 
A 1 39  GLY 39  534 ?   ?   ?   A . n 
A 1 40  GLY 40  535 ?   ?   ?   A . n 
A 1 41  SER 41  536 536 SER SER A . n 
A 1 42  SER 42  537 537 SER SER A . n 
A 1 43  LYS 43  538 538 LYS LYS A . n 
A 1 44  VAL 44  539 539 VAL VAL A . n 
A 1 45  PHE 45  540 540 PHE PHE A . n 
A 1 46  GLN 46  541 541 GLN GLN A . n 
A 1 47  VAL 47  542 542 VAL VAL A . n 
A 1 48  LEU 48  543 543 LEU LEU A . n 
A 1 49  ASN 49  544 544 ASN ASN A . n 
A 1 50  GLU 50  545 545 GLU GLU A . n 
A 1 51  LYS 51  546 546 LYS LYS A . n 
A 1 52  LYS 52  547 547 LYS LYS A . n 
A 1 53  GLN 53  548 548 GLN GLN A . n 
A 1 54  ILE 54  549 549 ILE ILE A . n 
A 1 55  TYR 55  550 550 TYR TYR A . n 
A 1 56  ALA 56  551 551 ALA ALA A . n 
A 1 57  ILE 57  552 552 ILE ILE A . n 
A 1 58  LYS 58  553 553 LYS LYS A . n 
A 1 59  TYR 59  554 554 TYR TYR A . n 
A 1 60  VAL 60  555 555 VAL VAL A . n 
A 1 61  ASN 61  556 556 ASN ASN A . n 
A 1 62  LEU 62  557 557 LEU LEU A . n 
A 1 63  GLU 63  558 558 GLU GLU A . n 
A 1 64  GLU 64  559 559 GLU GLU A . n 
A 1 65  ALA 65  560 560 ALA ALA A . n 
A 1 66  ASP 66  561 561 ASP ASP A . n 
A 1 67  ASN 67  562 562 ASN ASN A . n 
A 1 68  GLN 68  563 563 GLN GLN A . n 
A 1 69  THR 69  564 564 THR THR A . n 
A 1 70  LEU 70  565 565 LEU LEU A . n 
A 1 71  ASP 71  566 566 ASP ASP A . n 
A 1 72  SER 72  567 567 SER SER A . n 
A 1 73  TYR 73  568 568 TYR TYR A . n 
A 1 74  ARG 74  569 569 ARG ARG A . n 
A 1 75  ASN 75  570 570 ASN ASN A . n 
A 1 76  GLU 76  571 571 GLU GLU A . n 
A 1 77  ILE 77  572 572 ILE ILE A . n 
A 1 78  ALA 78  573 573 ALA ALA A . n 
A 1 79  TYR 79  574 574 TYR TYR A . n 
A 1 80  LEU 80  575 575 LEU LEU A . n 
A 1 81  ASN 81  576 576 ASN ASN A . n 
A 1 82  LYS 82  577 577 LYS LYS A . n 
A 1 83  LEU 83  578 578 LEU LEU A . n 
A 1 84  GLN 84  579 579 GLN GLN A . n 
A 1 85  GLN 85  580 580 GLN GLN A . n 
A 1 86  HIS 86  581 581 HIS HIS A . n 
A 1 87  SER 87  582 582 SER SER A . n 
A 1 88  ASP 88  583 583 ASP ASP A . n 
A 1 89  LYS 89  584 584 LYS LYS A . n 
A 1 90  ILE 90  585 585 ILE ILE A . n 
A 1 91  ILE 91  586 586 ILE ILE A . n 
A 1 92  ARG 92  587 587 ARG ARG A . n 
A 1 93  LEU 93  588 588 LEU LEU A . n 
A 1 94  TYR 94  589 589 TYR TYR A . n 
A 1 95  ASP 95  590 590 ASP ASP A . n 
A 1 96  TYR 96  591 591 TYR TYR A . n 
A 1 97  GLU 97  592 592 GLU GLU A . n 
A 1 98  ILE 98  593 593 ILE ILE A . n 
A 1 99  THR 99  594 594 THR THR A . n 
A 1 100 ASP 100 595 595 ASP ASP A . n 
A 1 101 GLN 101 596 596 GLN GLN A . n 
A 1 102 TYR 102 597 597 TYR TYR A . n 
A 1 103 ILE 103 598 598 ILE ILE A . n 
A 1 104 TYR 104 599 599 TYR TYR A . n 
A 1 105 MET 105 600 600 MET MET A . n 
A 1 106 VAL 106 601 601 VAL VAL A . n 
A 1 107 MET 107 602 602 MET MET A . n 
A 1 108 GLU 108 603 603 GLU GLU A . n 
A 1 109 CYS 109 604 604 CYS CYS A . n 
A 1 110 GLY 110 605 605 GLY GLY A . n 
A 1 111 ASN 111 606 606 ASN ASN A . n 
A 1 112 ILE 112 607 607 ILE ILE A . n 
A 1 113 ASP 113 608 608 ASP ASP A . n 
A 1 114 LEU 114 609 609 LEU LEU A . n 
A 1 115 ASN 115 610 610 ASN ASN A . n 
A 1 116 SER 116 611 611 SER SER A . n 
A 1 117 TRP 117 612 612 TRP TRP A . n 
A 1 118 LEU 118 613 613 LEU LEU A . n 
A 1 119 LYS 119 614 614 LYS LYS A . n 
A 1 120 LYS 120 615 615 LYS LYS A . n 
A 1 121 LYS 121 616 616 LYS LYS A . n 
A 1 122 LYS 122 617 617 LYS LYS A . n 
A 1 123 SER 123 618 618 SER SER A . n 
A 1 124 ILE 124 619 619 ILE ILE A . n 
A 1 125 ASP 125 620 620 ASP ASP A . n 
A 1 126 PRO 126 621 621 PRO PRO A . n 
A 1 127 TRP 127 622 622 TRP TRP A . n 
A 1 128 GLU 128 623 623 GLU GLU A . n 
A 1 129 ARG 129 624 624 ARG ARG A . n 
A 1 130 LYS 130 625 625 LYS LYS A . n 
A 1 131 SER 131 626 626 SER SER A . n 
A 1 132 TYR 132 627 627 TYR TYR A . n 
A 1 133 TRP 133 628 628 TRP TRP A . n 
A 1 134 LYS 134 629 629 LYS LYS A . n 
A 1 135 ASN 135 630 630 ASN ASN A . n 
A 1 136 MET 136 631 631 MET MET A . n 
A 1 137 LEU 137 632 632 LEU LEU A . n 
A 1 138 GLU 138 633 633 GLU GLU A . n 
A 1 139 ALA 139 634 634 ALA ALA A . n 
A 1 140 VAL 140 635 635 VAL VAL A . n 
A 1 141 HIS 141 636 636 HIS HIS A . n 
A 1 142 THR 142 637 637 THR THR A . n 
A 1 143 ILE 143 638 638 ILE ILE A . n 
A 1 144 HIS 144 639 639 HIS HIS A . n 
A 1 145 GLN 145 640 640 GLN GLN A . n 
A 1 146 HIS 146 641 641 HIS HIS A . n 
A 1 147 GLY 147 642 642 GLY GLY A . n 
A 1 148 ILE 148 643 643 ILE ILE A . n 
A 1 149 VAL 149 644 644 VAL VAL A . n 
A 1 150 HIS 150 645 645 HIS HIS A . n 
A 1 151 SER 151 646 646 SER SER A . n 
A 1 152 ASP 152 647 647 ASP ASP A . n 
A 1 153 LEU 153 648 648 LEU LEU A . n 
A 1 154 LYS 154 649 649 LYS LYS A . n 
A 1 155 PRO 155 650 650 PRO PRO A . n 
A 1 156 ALA 156 651 651 ALA ALA A . n 
A 1 157 ASN 157 652 652 ASN ASN A . n 
A 1 158 PHE 158 653 653 PHE PHE A . n 
A 1 159 LEU 159 654 654 LEU LEU A . n 
A 1 160 ILE 160 655 655 ILE ILE A . n 
A 1 161 VAL 161 656 656 VAL VAL A . n 
A 1 162 ASP 162 657 657 ASP ASP A . n 
A 1 163 GLY 163 658 658 GLY GLY A . n 
A 1 164 MET 164 659 659 MET MET A . n 
A 1 165 LEU 165 660 660 LEU LEU A . n 
A 1 166 LYS 166 661 661 LYS LYS A . n 
A 1 167 LEU 167 662 662 LEU LEU A . n 
A 1 168 ILE 168 663 663 ILE ILE A . n 
A 1 169 ASP 169 664 664 ASP ASP A . n 
A 1 170 PHE 170 665 665 PHE PHE A . n 
A 1 171 GLY 171 666 666 GLY GLY A . n 
A 1 172 ILE 172 667 667 ILE ILE A . n 
A 1 173 ALA 173 668 668 ALA ALA A . n 
A 1 174 ASN 174 669 669 ASN ASN A . n 
A 1 175 GLN 175 670 670 GLN GLN A . n 
A 1 176 MET 176 671 ?   ?   ?   A . n 
A 1 177 GLN 177 672 ?   ?   ?   A . n 
A 1 178 PRO 178 673 ?   ?   ?   A . n 
A 1 179 ASP 179 674 ?   ?   ?   A . n 
A 1 180 THR 180 675 ?   ?   ?   A . n 
A 1 181 THR 181 676 ?   ?   ?   A . n 
A 1 182 SER 182 677 ?   ?   ?   A . n 
A 1 183 VAL 183 678 ?   ?   ?   A . n 
A 1 184 VAL 184 679 ?   ?   ?   A . n 
A 1 185 LYS 185 680 ?   ?   ?   A . n 
A 1 186 ASP 186 681 ?   ?   ?   A . n 
A 1 187 SER 187 682 ?   ?   ?   A . n 
A 1 188 GLN 188 683 683 GLN GLN A . n 
A 1 189 VAL 189 684 684 VAL VAL A . n 
A 1 190 GLY 190 685 685 GLY GLY A . n 
A 1 191 THR 191 686 686 THR THR A . n 
A 1 192 VAL 192 687 687 VAL VAL A . n 
A 1 193 ASN 193 688 688 ASN ASN A . n 
A 1 194 TYR 194 689 689 TYR TYR A . n 
A 1 195 MET 195 690 690 MET MET A . n 
A 1 196 PRO 196 691 691 PRO PRO A . n 
A 1 197 PRO 197 692 692 PRO PRO A . n 
A 1 198 GLU 198 693 693 GLU GLU A . n 
A 1 199 ALA 199 694 694 ALA ALA A . n 
A 1 200 ILE 200 695 695 ILE ILE A . n 
A 1 201 LYS 201 696 696 LYS LYS A . n 
A 1 202 ASP 202 697 697 ASP ASP A . n 
A 1 203 MET 203 698 ?   ?   ?   A . n 
A 1 204 SER 204 699 ?   ?   ?   A . n 
A 1 205 SER 205 700 ?   ?   ?   A . n 
A 1 206 SER 206 701 ?   ?   ?   A . n 
A 1 207 ARG 207 702 ?   ?   ?   A . n 
A 1 208 GLU 208 703 ?   ?   ?   A . n 
A 1 209 ASN 209 704 ?   ?   ?   A . n 
A 1 210 GLY 210 705 ?   ?   ?   A . n 
A 1 211 LYS 211 706 ?   ?   ?   A . n 
A 1 212 SER 212 707 ?   ?   ?   A . n 
A 1 213 LYS 213 708 ?   ?   ?   A . n 
A 1 214 SER 214 709 ?   ?   ?   A . n 
A 1 215 LYS 215 710 ?   ?   ?   A . n 
A 1 216 ILE 216 711 711 ILE ILE A . n 
A 1 217 SER 217 712 712 SER SER A . n 
A 1 218 PRO 218 713 713 PRO PRO A . n 
A 1 219 LYS 219 714 714 LYS LYS A . n 
A 1 220 SER 220 715 715 SER SER A . n 
A 1 221 ASP 221 716 716 ASP ASP A . n 
A 1 222 VAL 222 717 717 VAL VAL A . n 
A 1 223 TRP 223 718 718 TRP TRP A . n 
A 1 224 SER 224 719 719 SER SER A . n 
A 1 225 LEU 225 720 720 LEU LEU A . n 
A 1 226 GLY 226 721 721 GLY GLY A . n 
A 1 227 CYS 227 722 722 CYS CYS A . n 
A 1 228 ILE 228 723 723 ILE ILE A . n 
A 1 229 LEU 229 724 724 LEU LEU A . n 
A 1 230 TYR 230 725 725 TYR TYR A . n 
A 1 231 TYR 231 726 726 TYR TYR A . n 
A 1 232 MET 232 727 727 MET MET A . n 
A 1 233 THR 233 728 728 THR THR A . n 
A 1 234 TYR 234 729 729 TYR TYR A . n 
A 1 235 GLY 235 730 730 GLY GLY A . n 
A 1 236 LYS 236 731 731 LYS LYS A . n 
A 1 237 THR 237 732 732 THR THR A . n 
A 1 238 PRO 238 733 733 PRO PRO A . n 
A 1 239 PHE 239 734 734 PHE PHE A . n 
A 1 240 GLN 240 735 735 GLN GLN A . n 
A 1 241 GLN 241 736 736 GLN GLN A . n 
A 1 242 ILE 242 737 737 ILE ILE A . n 
A 1 243 ILE 243 738 738 ILE ILE A . n 
A 1 244 ASN 244 739 739 ASN ASN A . n 
A 1 245 GLN 245 740 740 GLN GLN A . n 
A 1 246 ILE 246 741 741 ILE ILE A . n 
A 1 247 SER 247 742 742 SER SER A . n 
A 1 248 LYS 248 743 743 LYS LYS A . n 
A 1 249 LEU 249 744 744 LEU LEU A . n 
A 1 250 HIS 250 745 745 HIS HIS A . n 
A 1 251 ALA 251 746 746 ALA ALA A . n 
A 1 252 ILE 252 747 747 ILE ILE A . n 
A 1 253 ILE 253 748 748 ILE ILE A . n 
A 1 254 ASP 254 749 749 ASP ASP A . n 
A 1 255 PRO 255 750 750 PRO PRO A . n 
A 1 256 ASN 256 751 751 ASN ASN A . n 
A 1 257 HIS 257 752 752 HIS HIS A . n 
A 1 258 GLU 258 753 753 GLU GLU A . n 
A 1 259 ILE 259 754 754 ILE ILE A . n 
A 1 260 GLU 260 755 755 GLU GLU A . n 
A 1 261 PHE 261 756 756 PHE PHE A . n 
A 1 262 PRO 262 757 757 PRO PRO A . n 
A 1 263 ASP 263 758 758 ASP ASP A . n 
A 1 264 ILE 264 759 759 ILE ILE A . n 
A 1 265 PRO 265 760 760 PRO PRO A . n 
A 1 266 GLU 266 761 761 GLU GLU A . n 
A 1 267 LYS 267 762 762 LYS LYS A . n 
A 1 268 ASP 268 763 763 ASP ASP A . n 
A 1 269 LEU 269 764 764 LEU LEU A . n 
A 1 270 GLN 270 765 765 GLN GLN A . n 
A 1 271 ASP 271 766 766 ASP ASP A . n 
A 1 272 VAL 272 767 767 VAL VAL A . n 
A 1 273 LEU 273 768 768 LEU LEU A . n 
A 1 274 LYS 274 769 769 LYS LYS A . n 
A 1 275 CYS 275 770 770 CYS CYS A . n 
A 1 276 CYS 276 771 771 CYS CYS A . n 
A 1 277 LEU 277 772 772 LEU LEU A . n 
A 1 278 LYS 278 773 773 LYS LYS A . n 
A 1 279 ARG 279 774 774 ARG ARG A . n 
A 1 280 ASP 280 775 775 ASP ASP A . n 
A 1 281 PRO 281 776 776 PRO PRO A . n 
A 1 282 LYS 282 777 777 LYS LYS A . n 
A 1 283 GLN 283 778 778 GLN GLN A . n 
A 1 284 ARG 284 779 779 ARG ARG A . n 
A 1 285 ILE 285 780 780 ILE ILE A . n 
A 1 286 SER 286 781 781 SER SER A . n 
A 1 287 ILE 287 782 782 ILE ILE A . n 
A 1 288 PRO 288 783 783 PRO PRO A . n 
A 1 289 GLU 289 784 784 GLU GLU A . n 
A 1 290 LEU 290 785 785 LEU LEU A . n 
A 1 291 LEU 291 786 786 LEU LEU A . n 
A 1 292 ALA 292 787 787 ALA ALA A . n 
A 1 293 HIS 293 788 788 HIS HIS A . n 
A 1 294 PRO 294 789 789 PRO PRO A . n 
A 1 295 TYR 295 790 790 TYR TYR A . n 
A 1 296 VAL 296 791 791 VAL VAL A . n 
A 1 297 GLN 297 792 792 GLN GLN A . n 
A 1 298 ILE 298 793 793 ILE ILE A . n 
A 1 299 GLN 299 794 794 GLN GLN A . n 
A 1 300 THR 300 795 ?   ?   ?   A . n 
A 1 301 HIS 301 796 ?   ?   ?   A . n 
A 1 302 PRO 302 797 ?   ?   ?   A . n 
A 1 303 VAL 303 798 ?   ?   ?   A . n 
A 1 304 ASN 304 799 ?   ?   ?   A . n 
A 1 305 GLN 305 800 ?   ?   ?   A . n 
A 1 306 MET 306 801 ?   ?   ?   A . n 
A 1 307 ALA 307 802 ?   ?   ?   A . n 
A 1 308 LYS 308 803 ?   ?   ?   A . n 
A 1 309 GLY 309 804 ?   ?   ?   A . n 
A 1 310 THR 310 805 ?   ?   ?   A . n 
A 1 311 THR 311 806 ?   ?   ?   A . n 
A 1 312 GLU 312 807 ?   ?   ?   A . n 
A 1 313 GLU 313 808 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 7PE 1 1795 1795 7PE 7PE A . 
C 2 7PE 1 1796 1796 7PE 7PE A . 
D 3 Z0B 1 1797 1797 Z0B Z0B A . 
E 4 EDO 1 1798 1798 EDO EDO A . 
F 5 HOH 1 2001 2001 HOH HOH A . 
F 5 HOH 2 2002 2002 HOH HOH A . 
F 5 HOH 3 2003 2003 HOH HOH A . 
F 5 HOH 4 2004 2004 HOH HOH A . 
F 5 HOH 5 2005 2005 HOH HOH A . 
F 5 HOH 6 2006 2006 HOH HOH A . 
F 5 HOH 7 2007 2007 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-05-22 
2 'Structure model' 1 1 2013-06-05 
3 'Structure model' 1 2 2019-05-08 
4 'Structure model' 1 3 2019-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Data collection'          
3 3 'Structure model' 'Experimental preparation' 
4 3 'Structure model' Other                      
5 4 'Structure model' 'Data collection'          
6 4 'Structure model' 'Experimental preparation' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow   
2 3 'Structure model' pdbx_database_proc   
3 3 'Structure model' pdbx_database_status 
4 4 'Structure model' exptl_crystal_grow   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'                  
2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3 4 'Structure model' '_exptl_crystal_grow.temp'                    
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -4.8915 
_pdbx_refine_tls.origin_y         -32.3800 
_pdbx_refine_tls.origin_z         16.8329 
_pdbx_refine_tls.T[1][1]          -0.3519 
_pdbx_refine_tls.T[2][2]          -0.2357 
_pdbx_refine_tls.T[3][3]          -0.1552 
_pdbx_refine_tls.T[1][2]          -0.0006 
_pdbx_refine_tls.T[1][3]          0.0092 
_pdbx_refine_tls.T[2][3]          -0.1005 
_pdbx_refine_tls.L[1][1]          4.9943 
_pdbx_refine_tls.L[2][2]          2.6505 
_pdbx_refine_tls.L[3][3]          1.8098 
_pdbx_refine_tls.L[1][2]          -1.4974 
_pdbx_refine_tls.L[1][3]          1.0033 
_pdbx_refine_tls.L[2][3]          0.2639 
_pdbx_refine_tls.S[1][1]          0.1394 
_pdbx_refine_tls.S[1][2]          0.5643 
_pdbx_refine_tls.S[1][3]          -0.2271 
_pdbx_refine_tls.S[2][1]          -0.2269 
_pdbx_refine_tls.S[2][2]          -0.1711 
_pdbx_refine_tls.S[2][3]          0.1515 
_pdbx_refine_tls.S[3][1]          -0.0402 
_pdbx_refine_tls.S[3][2]          -0.0882 
_pdbx_refine_tls.S[3][3]          0.0317 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   'CHAIN A' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER refinement       2.11.2 ? 1 
MOSFLM 'data reduction' .      ? 2 
SCALA  'data scaling'   .      ? 3 
PHASER phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             4BHZ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE SEQUENCE INCLUDING HEXAHISTIDINE TAG IS AS DESCRIBED
IN NAT. CHEM. BIOL. 2010, 6, 259-368.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 531 ? ? -97.56 -68.73 
2 1 LYS A 617 ? ? -77.21 -72.44 
3 1 SER A 646 ? ? 72.15  -21.43 
4 1 THR A 686 ? ? -33.12 126.88 
5 1 LEU A 772 ? ? -86.56 49.22  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 516  ? CG  ? A GLN 21  CG  
2   1 Y 1 A GLN 516  ? CD  ? A GLN 21  CD  
3   1 Y 1 A GLN 516  ? OE1 ? A GLN 21  OE1 
4   1 Y 1 A GLN 516  ? NE2 ? A GLN 21  NE2 
5   1 Y 1 A ARG 523  ? CD  ? A ARG 28  CD  
6   1 Y 1 A ARG 523  ? NE  ? A ARG 28  NE  
7   1 Y 1 A ARG 523  ? CZ  ? A ARG 28  CZ  
8   1 Y 1 A ARG 523  ? NH1 ? A ARG 28  NH1 
9   1 Y 1 A ARG 523  ? NH2 ? A ARG 28  NH2 
10  1 Y 1 A ILE 524  ? CG1 ? A ILE 29  CG1 
11  1 Y 1 A ILE 524  ? CG2 ? A ILE 29  CG2 
12  1 Y 1 A ILE 524  ? CD1 ? A ILE 29  CD1 
13  1 Y 1 A LYS 529  ? NZ  ? A LYS 34  NZ  
14  1 Y 1 A LYS 538  ? CG  ? A LYS 43  CG  
15  1 Y 1 A LYS 538  ? CD  ? A LYS 43  CD  
16  1 Y 1 A LYS 538  ? CE  ? A LYS 43  CE  
17  1 Y 1 A LYS 538  ? NZ  ? A LYS 43  NZ  
18  1 Y 1 A GLU 545  ? CG  ? A GLU 50  CG  
19  1 Y 1 A GLU 545  ? CD  ? A GLU 50  CD  
20  1 Y 1 A GLU 545  ? OE1 ? A GLU 50  OE1 
21  1 Y 1 A GLU 545  ? OE2 ? A GLU 50  OE2 
22  1 Y 1 A LYS 546  ? CG  ? A LYS 51  CG  
23  1 Y 1 A LYS 546  ? CD  ? A LYS 51  CD  
24  1 Y 1 A LYS 546  ? CE  ? A LYS 51  CE  
25  1 Y 1 A LYS 546  ? NZ  ? A LYS 51  NZ  
26  1 Y 1 A LYS 547  ? CG  ? A LYS 52  CG  
27  1 Y 1 A LYS 547  ? CD  ? A LYS 52  CD  
28  1 Y 1 A LYS 547  ? CE  ? A LYS 52  CE  
29  1 Y 1 A LYS 547  ? NZ  ? A LYS 52  NZ  
30  1 Y 1 A GLU 559  ? CG  ? A GLU 64  CG  
31  1 Y 1 A GLU 559  ? CD  ? A GLU 64  CD  
32  1 Y 1 A GLU 559  ? OE1 ? A GLU 64  OE1 
33  1 Y 1 A GLU 559  ? OE2 ? A GLU 64  OE2 
34  1 Y 1 A GLN 563  ? CG  ? A GLN 68  CG  
35  1 Y 1 A GLN 563  ? CD  ? A GLN 68  CD  
36  1 Y 1 A GLN 563  ? OE1 ? A GLN 68  OE1 
37  1 Y 1 A GLN 563  ? NE2 ? A GLN 68  NE2 
38  1 Y 1 A LYS 577  ? CG  ? A LYS 82  CG  
39  1 Y 1 A LYS 577  ? CD  ? A LYS 82  CD  
40  1 Y 1 A LYS 577  ? CE  ? A LYS 82  CE  
41  1 Y 1 A LYS 577  ? NZ  ? A LYS 82  NZ  
42  1 Y 1 A GLN 580  ? CG  ? A GLN 85  CG  
43  1 Y 1 A GLN 580  ? CD  ? A GLN 85  CD  
44  1 Y 1 A GLN 580  ? OE1 ? A GLN 85  OE1 
45  1 Y 1 A GLN 580  ? NE2 ? A GLN 85  NE2 
46  1 Y 1 A LYS 614  ? CD  ? A LYS 119 CD  
47  1 Y 1 A LYS 614  ? CE  ? A LYS 119 CE  
48  1 Y 1 A LYS 614  ? NZ  ? A LYS 119 NZ  
49  1 Y 1 A LYS 615  ? CG  ? A LYS 120 CG  
50  1 Y 1 A LYS 615  ? CD  ? A LYS 120 CD  
51  1 Y 1 A LYS 615  ? CE  ? A LYS 120 CE  
52  1 Y 1 A LYS 615  ? NZ  ? A LYS 120 NZ  
53  1 Y 1 A LYS 616  ? CE  ? A LYS 121 CE  
54  1 Y 1 A LYS 616  ? NZ  ? A LYS 121 NZ  
55  1 Y 1 A LYS 617  ? CG  ? A LYS 122 CG  
56  1 Y 1 A LYS 617  ? CD  ? A LYS 122 CD  
57  1 Y 1 A LYS 617  ? CE  ? A LYS 122 CE  
58  1 Y 1 A LYS 617  ? NZ  ? A LYS 122 NZ  
59  1 Y 1 A SER 618  ? OG  ? A SER 123 OG  
60  1 Y 1 A GLN 670  ? CG  ? A GLN 175 CG  
61  1 Y 1 A GLN 670  ? CD  ? A GLN 175 CD  
62  1 Y 1 A GLN 670  ? OE1 ? A GLN 175 OE1 
63  1 Y 1 A GLN 670  ? NE2 ? A GLN 175 NE2 
64  1 Y 1 A GLN 683  ? CG  ? A GLN 188 CG  
65  1 Y 1 A GLN 683  ? CD  ? A GLN 188 CD  
66  1 Y 1 A GLN 683  ? OE1 ? A GLN 188 OE1 
67  1 Y 1 A GLN 683  ? NE2 ? A GLN 188 NE2 
68  1 Y 1 A VAL 684  ? CG1 ? A VAL 189 CG1 
69  1 Y 1 A VAL 684  ? CG2 ? A VAL 189 CG2 
70  1 Y 1 A LYS 696  ? CD  ? A LYS 201 CD  
71  1 Y 1 A LYS 696  ? CE  ? A LYS 201 CE  
72  1 Y 1 A LYS 696  ? NZ  ? A LYS 201 NZ  
73  1 Y 1 A ILE 738  ? CG1 ? A ILE 243 CG1 
74  1 Y 1 A ILE 738  ? CG2 ? A ILE 243 CG2 
75  1 Y 1 A ILE 738  ? CD1 ? A ILE 243 CD1 
76  1 Y 1 A ASP 758  ? CG  ? A ASP 263 CG  
77  1 Y 1 A ASP 758  ? OD1 ? A ASP 263 OD1 
78  1 Y 1 A ASP 758  ? OD2 ? A ASP 263 OD2 
79  1 Y 1 A ILE 759  ? CG1 ? A ILE 264 CG1 
80  1 Y 1 A ILE 759  ? CG2 ? A ILE 264 CG2 
81  1 Y 1 A ILE 759  ? CD1 ? A ILE 264 CD1 
82  1 Y 1 A LYS 762  ? CG  ? A LYS 267 CG  
83  1 Y 1 A LYS 762  ? CD  ? A LYS 267 CD  
84  1 Y 1 A LYS 762  ? CE  ? A LYS 267 CE  
85  1 Y 1 A LYS 762  ? NZ  ? A LYS 267 NZ  
86  1 Y 1 A LYS 769  ? CE  ? A LYS 274 CE  
87  1 Y 1 A LYS 769  ? NZ  ? A LYS 274 NZ  
88  1 Y 1 A LYS 773  ? CE  ? A LYS 278 CE  
89  1 Y 1 A LYS 773  ? NZ  ? A LYS 278 NZ  
90  1 Y 1 A LYS 777  ? CE  ? A LYS 282 CE  
91  1 Y 1 A LYS 777  ? NZ  ? A LYS 282 NZ  
92  1 N 1 A 7PE 1795 ? C21 ? B 7PE 1   C21 
93  1 N 1 A 7PE 1795 ? C20 ? B 7PE 1   C20 
94  1 N 1 A 7PE 1795 ? C3  ? B 7PE 1   C3  
95  1 N 1 A 7PE 1795 ? C2  ? B 7PE 1   C2  
96  1 N 1 A 7PE 1795 ? O1  ? B 7PE 1   O1  
97  1 N 1 A 7PE 1796 ? C21 ? C 7PE 1   C21 
98  1 N 1 A 7PE 1796 ? C20 ? C 7PE 1   C20 
99  1 N 1 A 7PE 1796 ? C9  ? C 7PE 1   C9  
100 1 N 1 A 7PE 1796 ? C8  ? C 7PE 1   C8  
101 1 N 1 A 7PE 1796 ? O7  ? C 7PE 1   O7  
102 1 N 1 A 7PE 1796 ? C6  ? C 7PE 1   C6  
103 1 N 1 A 7PE 1796 ? C5  ? C 7PE 1   C5  
104 1 N 1 A 7PE 1796 ? O4  ? C 7PE 1   O4  
105 1 N 1 A 7PE 1796 ? C3  ? C 7PE 1   C3  
106 1 N 1 A 7PE 1796 ? C2  ? C 7PE 1   C2  
107 1 N 1 A 7PE 1796 ? O1  ? C 7PE 1   O1  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 496 ? A MET 1   
2  1 Y 1 A HIS 497 ? A HIS 2   
3  1 Y 1 A HIS 498 ? A HIS 3   
4  1 Y 1 A HIS 499 ? A HIS 4   
5  1 Y 1 A HIS 500 ? A HIS 5   
6  1 Y 1 A HIS 501 ? A HIS 6   
7  1 Y 1 A HIS 502 ? A HIS 7   
8  1 Y 1 A SER 503 ? A SER 8   
9  1 Y 1 A SER 504 ? A SER 9   
10 1 Y 1 A GLY 505 ? A GLY 10  
11 1 Y 1 A VAL 506 ? A VAL 11  
12 1 Y 1 A ASP 507 ? A ASP 12  
13 1 Y 1 A LEU 508 ? A LEU 13  
14 1 Y 1 A GLY 509 ? A GLY 14  
15 1 Y 1 A THR 510 ? A THR 15  
16 1 Y 1 A GLU 511 ? A GLU 16  
17 1 Y 1 A ASN 512 ? A ASN 17  
18 1 Y 1 A LEU 513 ? A LEU 18  
19 1 Y 1 A TYR 514 ? A TYR 19  
20 1 Y 1 A PHE 515 ? A PHE 20  
21 1 Y 1 A SER 533 ? A SER 38  
22 1 Y 1 A GLY 534 ? A GLY 39  
23 1 Y 1 A GLY 535 ? A GLY 40  
24 1 Y 1 A MET 671 ? A MET 176 
25 1 Y 1 A GLN 672 ? A GLN 177 
26 1 Y 1 A PRO 673 ? A PRO 178 
27 1 Y 1 A ASP 674 ? A ASP 179 
28 1 Y 1 A THR 675 ? A THR 180 
29 1 Y 1 A THR 676 ? A THR 181 
30 1 Y 1 A SER 677 ? A SER 182 
31 1 Y 1 A VAL 678 ? A VAL 183 
32 1 Y 1 A VAL 679 ? A VAL 184 
33 1 Y 1 A LYS 680 ? A LYS 185 
34 1 Y 1 A ASP 681 ? A ASP 186 
35 1 Y 1 A SER 682 ? A SER 187 
36 1 Y 1 A MET 698 ? A MET 203 
37 1 Y 1 A SER 699 ? A SER 204 
38 1 Y 1 A SER 700 ? A SER 205 
39 1 Y 1 A SER 701 ? A SER 206 
40 1 Y 1 A ARG 702 ? A ARG 207 
41 1 Y 1 A GLU 703 ? A GLU 208 
42 1 Y 1 A ASN 704 ? A ASN 209 
43 1 Y 1 A GLY 705 ? A GLY 210 
44 1 Y 1 A LYS 706 ? A LYS 211 
45 1 Y 1 A SER 707 ? A SER 212 
46 1 Y 1 A LYS 708 ? A LYS 213 
47 1 Y 1 A SER 709 ? A SER 214 
48 1 Y 1 A LYS 710 ? A LYS 215 
49 1 Y 1 A THR 795 ? A THR 300 
50 1 Y 1 A HIS 796 ? A HIS 301 
51 1 Y 1 A PRO 797 ? A PRO 302 
52 1 Y 1 A VAL 798 ? A VAL 303 
53 1 Y 1 A ASN 799 ? A ASN 304 
54 1 Y 1 A GLN 800 ? A GLN 305 
55 1 Y 1 A MET 801 ? A MET 306 
56 1 Y 1 A ALA 802 ? A ALA 307 
57 1 Y 1 A LYS 803 ? A LYS 308 
58 1 Y 1 A GLY 804 ? A GLY 309 
59 1 Y 1 A THR 805 ? A THR 310 
60 1 Y 1 A THR 806 ? A THR 311 
61 1 Y 1 A GLU 807 ? A GLU 312 
62 1 Y 1 A GLU 808 ? A GLU 313 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 7PE 
3 'thieno[2,3-c][2,6]naphthyridine'                                   Z0B 
4 1,2-ETHANEDIOL                                                      EDO 
5 water                                                               HOH 
#