data_4BI2
# 
_entry.id   4BI2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BI2         
PDBE  EBI-56434    
WWPDB D_1290056434 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4BHZ unspecified 'SCAFFOLD FOCUSED VIRTUAL SCREENING: PROSPECTIVE APPLICATION TO THE DISCOVERY OF TTK INHIBITOR' 
PDB 4BI0 unspecified 'SCAFFOLD FOCUSED VIRTUAL SCREENING: PROSPECTIVE APPLICATION TO THE DISCOVERY OF TTK INHIBITOR' 
PDB 4BI1 unspecified 'SCAFFOLD FOCUSED VIRTUAL SCREENING: PROSPECTIVE APPLICATION TO THE DISCOVERY OF TTK INHIBITOR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BI2 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Langdon, S.R.'        1 
'Westwood, I.M.'       2 
'van Montfort, R.L.M.' 3 
'Brown, N.'            4 
'Blagg, J.'            5 
# 
_citation.id                        primary 
_citation.title                     
'Scaffold-Focused Virtual Screening: Prospective Application to the Discovery of Ttk Inhibitors.' 
_citation.journal_abbrev            J.Chem.Inf.Model 
_citation.journal_volume            53 
_citation.page_first                1100 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1549-9596 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23672464 
_citation.pdbx_database_id_DOI      10.1021/CI400100C 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Langdon, S.R.'        1 ? 
primary 'Westwood, I.M.'       2 ? 
primary 'Van Montfort, R.L.M.' 3 ? 
primary 'Brown, N.'            4 ? 
primary 'Blagg, J.'            5 ? 
# 
_cell.entry_id           4BI2 
_cell.length_a           70.690 
_cell.length_b           111.600 
_cell.length_c           112.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BI2 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DUAL SPECIFICITY PROTEIN KINASE TTK'                               36115.258 1 2.7.12.1 ? 
'KINASE DOMAIN, RESIDUES 519-808' ? 
2 non-polymer syn 1,2-ETHANEDIOL                                                      62.068    2 ?        ? ? ? 
3 non-polymer syn '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 310.384   1 ?        ? ? ? 
4 non-polymer syn 'thieno[2,3-c][2,7]naphthyridine'                                   186.233   1 ?        ? ? ? 
5 water       nat water                                                               18.015    3 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PHOSPHOTYROSINE PICKED THREONINE-PROTEIN KINASE, PYT, MONOPOLAR SPINDLE KINASE 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYL
NKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLI
VDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQ
QIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYL
NKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLI
VDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQ
QIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  SER n 
1 25  VAL n 
1 26  LYS n 
1 27  GLY n 
1 28  ARG n 
1 29  ILE n 
1 30  TYR n 
1 31  SER n 
1 32  ILE n 
1 33  LEU n 
1 34  LYS n 
1 35  GLN n 
1 36  ILE n 
1 37  GLY n 
1 38  SER n 
1 39  GLY n 
1 40  GLY n 
1 41  SER n 
1 42  SER n 
1 43  LYS n 
1 44  VAL n 
1 45  PHE n 
1 46  GLN n 
1 47  VAL n 
1 48  LEU n 
1 49  ASN n 
1 50  GLU n 
1 51  LYS n 
1 52  LYS n 
1 53  GLN n 
1 54  ILE n 
1 55  TYR n 
1 56  ALA n 
1 57  ILE n 
1 58  LYS n 
1 59  TYR n 
1 60  VAL n 
1 61  ASN n 
1 62  LEU n 
1 63  GLU n 
1 64  GLU n 
1 65  ALA n 
1 66  ASP n 
1 67  ASN n 
1 68  GLN n 
1 69  THR n 
1 70  LEU n 
1 71  ASP n 
1 72  SER n 
1 73  TYR n 
1 74  ARG n 
1 75  ASN n 
1 76  GLU n 
1 77  ILE n 
1 78  ALA n 
1 79  TYR n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  LEU n 
1 84  GLN n 
1 85  GLN n 
1 86  HIS n 
1 87  SER n 
1 88  ASP n 
1 89  LYS n 
1 90  ILE n 
1 91  ILE n 
1 92  ARG n 
1 93  LEU n 
1 94  TYR n 
1 95  ASP n 
1 96  TYR n 
1 97  GLU n 
1 98  ILE n 
1 99  THR n 
1 100 ASP n 
1 101 GLN n 
1 102 TYR n 
1 103 ILE n 
1 104 TYR n 
1 105 MET n 
1 106 VAL n 
1 107 MET n 
1 108 GLU n 
1 109 CYS n 
1 110 GLY n 
1 111 ASN n 
1 112 ILE n 
1 113 ASP n 
1 114 LEU n 
1 115 ASN n 
1 116 SER n 
1 117 TRP n 
1 118 LEU n 
1 119 LYS n 
1 120 LYS n 
1 121 LYS n 
1 122 LYS n 
1 123 SER n 
1 124 ILE n 
1 125 ASP n 
1 126 PRO n 
1 127 TRP n 
1 128 GLU n 
1 129 ARG n 
1 130 LYS n 
1 131 SER n 
1 132 TYR n 
1 133 TRP n 
1 134 LYS n 
1 135 ASN n 
1 136 MET n 
1 137 LEU n 
1 138 GLU n 
1 139 ALA n 
1 140 VAL n 
1 141 HIS n 
1 142 THR n 
1 143 ILE n 
1 144 HIS n 
1 145 GLN n 
1 146 HIS n 
1 147 GLY n 
1 148 ILE n 
1 149 VAL n 
1 150 HIS n 
1 151 SER n 
1 152 ASP n 
1 153 LEU n 
1 154 LYS n 
1 155 PRO n 
1 156 ALA n 
1 157 ASN n 
1 158 PHE n 
1 159 LEU n 
1 160 ILE n 
1 161 VAL n 
1 162 ASP n 
1 163 GLY n 
1 164 MET n 
1 165 LEU n 
1 166 LYS n 
1 167 LEU n 
1 168 ILE n 
1 169 ASP n 
1 170 PHE n 
1 171 GLY n 
1 172 ILE n 
1 173 ALA n 
1 174 ASN n 
1 175 GLN n 
1 176 MET n 
1 177 GLN n 
1 178 PRO n 
1 179 ASP n 
1 180 THR n 
1 181 THR n 
1 182 SER n 
1 183 VAL n 
1 184 VAL n 
1 185 LYS n 
1 186 ASP n 
1 187 SER n 
1 188 GLN n 
1 189 VAL n 
1 190 GLY n 
1 191 THR n 
1 192 VAL n 
1 193 ASN n 
1 194 TYR n 
1 195 MET n 
1 196 PRO n 
1 197 PRO n 
1 198 GLU n 
1 199 ALA n 
1 200 ILE n 
1 201 LYS n 
1 202 ASP n 
1 203 MET n 
1 204 SER n 
1 205 SER n 
1 206 SER n 
1 207 ARG n 
1 208 GLU n 
1 209 ASN n 
1 210 GLY n 
1 211 LYS n 
1 212 SER n 
1 213 LYS n 
1 214 SER n 
1 215 LYS n 
1 216 ILE n 
1 217 SER n 
1 218 PRO n 
1 219 LYS n 
1 220 SER n 
1 221 ASP n 
1 222 VAL n 
1 223 TRP n 
1 224 SER n 
1 225 LEU n 
1 226 GLY n 
1 227 CYS n 
1 228 ILE n 
1 229 LEU n 
1 230 TYR n 
1 231 TYR n 
1 232 MET n 
1 233 THR n 
1 234 TYR n 
1 235 GLY n 
1 236 LYS n 
1 237 THR n 
1 238 PRO n 
1 239 PHE n 
1 240 GLN n 
1 241 GLN n 
1 242 ILE n 
1 243 ILE n 
1 244 ASN n 
1 245 GLN n 
1 246 ILE n 
1 247 SER n 
1 248 LYS n 
1 249 LEU n 
1 250 HIS n 
1 251 ALA n 
1 252 ILE n 
1 253 ILE n 
1 254 ASP n 
1 255 PRO n 
1 256 ASN n 
1 257 HIS n 
1 258 GLU n 
1 259 ILE n 
1 260 GLU n 
1 261 PHE n 
1 262 PRO n 
1 263 ASP n 
1 264 ILE n 
1 265 PRO n 
1 266 GLU n 
1 267 LYS n 
1 268 ASP n 
1 269 LEU n 
1 270 GLN n 
1 271 ASP n 
1 272 VAL n 
1 273 LEU n 
1 274 LYS n 
1 275 CYS n 
1 276 CYS n 
1 277 LEU n 
1 278 LYS n 
1 279 ARG n 
1 280 ASP n 
1 281 PRO n 
1 282 LYS n 
1 283 GLN n 
1 284 ARG n 
1 285 ILE n 
1 286 SER n 
1 287 ILE n 
1 288 PRO n 
1 289 GLU n 
1 290 LEU n 
1 291 LEU n 
1 292 ALA n 
1 293 HIS n 
1 294 PRO n 
1 295 TYR n 
1 296 VAL n 
1 297 GLN n 
1 298 ILE n 
1 299 GLN n 
1 300 THR n 
1 301 HIS n 
1 302 PRO n 
1 303 VAL n 
1 304 ASN n 
1 305 GLN n 
1 306 MET n 
1 307 ALA n 
1 308 LYS n 
1 309 GLY n 
1 310 THR n 
1 311 THR n 
1 312 GLU n 
1 313 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              AI 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TTK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P33981 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4BI2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 313 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P33981 
_struct_ref_seq.db_align_beg                  519 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  808 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       519 
_struct_ref_seq.pdbx_auth_seq_align_end       808 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4BI2 MET A 1  ? UNP P33981 ? ? 'expression tag' 496 1  
1 4BI2 HIS A 2  ? UNP P33981 ? ? 'expression tag' 497 2  
1 4BI2 HIS A 3  ? UNP P33981 ? ? 'expression tag' 498 3  
1 4BI2 HIS A 4  ? UNP P33981 ? ? 'expression tag' 499 4  
1 4BI2 HIS A 5  ? UNP P33981 ? ? 'expression tag' 500 5  
1 4BI2 HIS A 6  ? UNP P33981 ? ? 'expression tag' 501 6  
1 4BI2 HIS A 7  ? UNP P33981 ? ? 'expression tag' 502 7  
1 4BI2 SER A 8  ? UNP P33981 ? ? 'expression tag' 503 8  
1 4BI2 SER A 9  ? UNP P33981 ? ? 'expression tag' 504 9  
1 4BI2 GLY A 10 ? UNP P33981 ? ? 'expression tag' 505 10 
1 4BI2 VAL A 11 ? UNP P33981 ? ? 'expression tag' 506 11 
1 4BI2 ASP A 12 ? UNP P33981 ? ? 'expression tag' 507 12 
1 4BI2 LEU A 13 ? UNP P33981 ? ? 'expression tag' 508 13 
1 4BI2 GLY A 14 ? UNP P33981 ? ? 'expression tag' 509 14 
1 4BI2 THR A 15 ? UNP P33981 ? ? 'expression tag' 510 15 
1 4BI2 GLU A 16 ? UNP P33981 ? ? 'expression tag' 511 16 
1 4BI2 ASN A 17 ? UNP P33981 ? ? 'expression tag' 512 17 
1 4BI2 LEU A 18 ? UNP P33981 ? ? 'expression tag' 513 18 
1 4BI2 TYR A 19 ? UNP P33981 ? ? 'expression tag' 514 19 
1 4BI2 PHE A 20 ? UNP P33981 ? ? 'expression tag' 515 20 
1 4BI2 GLN A 21 ? UNP P33981 ? ? 'expression tag' 516 21 
1 4BI2 SER A 22 ? UNP P33981 ? ? 'expression tag' 517 22 
1 4BI2 MET A 23 ? UNP P33981 ? ? 'expression tag' 518 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
7PE non-polymer         . '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 'POLYETHYLENE GLYCOL FRAGMENT' 
'C14 H30 O7'     310.384 
ALA 'L-peptide linking' y ALANINE                                                             ?                              
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                            ?                              
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                          ?                              
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                     ?                              
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                            ?                              
'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                      'ETHYLENE GLYCOL'              
'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                           ?                              
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                     ?                              
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                             ?                              
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                           ?                              
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                               ?                              
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                          ?                              
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                             ?                              
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                              ?                              
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                          ?                              
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                       ?                              
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                             ?                              
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                              ?                              
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                           ?                              
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                          ?                              
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                            ?                              
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                              ?                              
'C5 H11 N O2'    117.146 
ZO8 non-polymer         . 'thieno[2,3-c][2,7]naphthyridine'                                   ?                              
'C10 H6 N2 S'    186.233 
# 
_exptl.entry_id          4BI2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.13 
_exptl_crystal.density_percent_sol   59.97 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30-45% (V/V) PEG300, SITTING DROP VAPOUR DIFFUSION, 291K, pH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2011-04-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87260 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             0.87260 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BI2 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             56.08 
_reflns.d_resolution_high            3.11 
_reflns.number_obs                   8291 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.50 
_reflns.B_iso_Wilson_estimate        108.28 
_reflns.pdbx_redundancy              4.3 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.11 
_reflns_shell.d_res_low              3.28 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.52 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.70 
_reflns_shell.pdbx_redundancy        4.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BI2 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     8291 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             56.08 
_refine.ls_d_res_high                            3.11 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.1951 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1937 
_refine.ls_R_factor_R_free                       0.2260 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.63 
_refine.ls_number_reflns_R_free                  384 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9033 
_refine.correlation_coeff_Fo_to_Fc_free          0.8652 
_refine.B_iso_mean                               86.28 
_refine.aniso_B[1][1]                            26.1559 
_refine.aniso_B[2][2]                            6.1735 
_refine.aniso_B[3][3]                            -32.3294 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'IDEAL-DIST CONTACT TERM CONTACT SETUP. ALL ATOMS HAVE CCP4 ATOM TYPE FROM LIBRARY' 
_refine.pdbx_starting_model                      'PDB ENTRY 2ZMC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             1.575 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.344 
_refine.pdbx_overall_SU_R_Blow_DPI               1.717 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.339 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1960 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               2000 
_refine_hist.d_res_high                       3.11 
_refine_hist.d_res_low                        56.08 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  2041 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.20  ? 2.00  2771 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  677  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  51   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  308  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 2041 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           2.51  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           21.00 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  276  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  2375 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   5 
_refine_ls_shell.d_res_high                       3.11 
_refine_ls_shell.d_res_low                        3.48 
_refine_ls_shell.number_reflns_R_work             2221 
_refine_ls_shell.R_factor_R_work                  0.2096 
_refine_ls_shell.percent_reflns_obs               99.98 
_refine_ls_shell.R_factor_R_free                  0.2244 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.56 
_refine_ls_shell.number_reflns_R_free             106 
_refine_ls_shell.number_reflns_all                2327 
_refine_ls_shell.R_factor_all                     0.2103 
# 
_struct.entry_id                  4BI2 
_struct.title                     'Scaffold Focused Virtual Screening: Prospective Application to the Discovery of TTK Inhibitor' 
_struct.pdbx_descriptor           'DUAL SPECIFICITY PROTEIN KINASE TTK (E.C.2.7.12.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BI2 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, MITOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 2 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 66  ? LEU A 83  ? ASP A 561 LEU A 578 1 ? 18 
HELX_P HELX_P2  2  LEU A 114 ? LYS A 121 ? LEU A 609 LYS A 616 1 ? 8  
HELX_P HELX_P3  3  ASP A 125 ? HIS A 146 ? ASP A 620 HIS A 641 1 ? 22 
HELX_P HELX_P4  4  LYS A 154 ? ALA A 156 ? LYS A 649 ALA A 651 5 ? 3  
HELX_P HELX_P5  5  PRO A 196 ? LYS A 201 ? PRO A 691 LYS A 696 1 ? 6  
HELX_P HELX_P6  6  PRO A 218 ? GLY A 235 ? PRO A 713 GLY A 730 1 ? 18 
HELX_P HELX_P7  7  ASN A 244 ? ILE A 253 ? ASN A 739 ILE A 748 1 ? 10 
HELX_P HELX_P8  8  GLU A 266 ? LEU A 277 ? GLU A 761 LEU A 772 1 ? 12 
HELX_P HELX_P9  9  ASP A 280 ? ARG A 284 ? ASP A 775 ARG A 779 5 ? 5  
HELX_P HELX_P10 10 SER A 286 ? LEU A 291 ? SER A 781 LEU A 786 1 ? 6  
HELX_P HELX_P11 11 HIS A 293 ? ILE A 298 ? HIS A 788 ILE A 793 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 SER A 22  ? SER A 24  ? SER A 517 SER A 519 
AA 2 ILE A 29  ? SER A 38  ? ILE A 524 SER A 533 
AA 3 SER A 42  ? LEU A 48  ? SER A 537 LEU A 543 
AA 4 ILE A 54  ? ASN A 61  ? ILE A 549 ASN A 556 
AA 5 TYR A 102 ? MET A 107 ? TYR A 597 MET A 602 
AA 6 LEU A 93  ? ILE A 98  ? LEU A 588 ILE A 593 
AB 1 ILE A 112 ? ASP A 113 ? ILE A 607 ASP A 608 
AB 2 PHE A 158 ? VAL A 161 ? PHE A 653 VAL A 656 
AB 3 MET A 164 ? LEU A 167 ? MET A 659 LEU A 662 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 23  ? N MET A 518 O TYR A 30  ? O TYR A 525 
AA 2 3 N ILE A 36  ? N ILE A 531 O VAL A 44  ? O VAL A 539 
AA 3 4 N VAL A 47  ? N VAL A 542 O TYR A 55  ? O TYR A 550 
AA 4 5 N VAL A 60  ? N VAL A 555 O ILE A 103 ? O ILE A 598 
AA 5 6 O VAL A 106 ? O VAL A 601 N TYR A 94  ? N TYR A 589 
AB 1 2 O ILE A 112 ? O ILE A 607 N ILE A 160 ? N ILE A 655 
AB 2 3 N VAL A 161 ? N VAL A 656 O MET A 164 ? O MET A 659 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 1795' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE 7PE A 1796' 
AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE ZO8 A 1797' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 1798' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 LYS A 34  ? LYS A 529  . ? 1_555 ? 
2  AC1 4 GLN A 46  ? GLN A 541  . ? 1_555 ? 
3  AC1 4 ASN A 111 ? ASN A 606  . ? 1_555 ? 
4  AC1 4 ZO8 D .   ? ZO8 A 1797 . ? 1_555 ? 
5  AC2 6 SER A 42  ? SER A 537  . ? 1_555 ? 
6  AC2 6 LYS A 58  ? LYS A 553  . ? 1_555 ? 
7  AC2 6 TYR A 73  ? TYR A 568  . ? 1_555 ? 
8  AC2 6 GLU A 76  ? GLU A 571  . ? 1_555 ? 
9  AC2 6 MET A 105 ? MET A 600  . ? 1_555 ? 
10 AC2 6 ILE A 168 ? ILE A 663  . ? 1_555 ? 
11 AC3 8 ILE A 36  ? ILE A 531  . ? 1_555 ? 
12 AC3 8 ALA A 56  ? ALA A 551  . ? 1_555 ? 
13 AC3 8 ILE A 91  ? ILE A 586  . ? 1_555 ? 
14 AC3 8 MET A 107 ? MET A 602  . ? 1_555 ? 
15 AC3 8 GLU A 108 ? GLU A 603  . ? 1_555 ? 
16 AC3 8 GLY A 110 ? GLY A 605  . ? 1_555 ? 
17 AC3 8 LEU A 159 ? LEU A 654  . ? 1_555 ? 
18 AC3 8 EDO B .   ? EDO A 1795 . ? 1_555 ? 
19 AC4 2 TRP A 127 ? TRP A 622  . ? 1_555 ? 
20 AC4 2 SER A 131 ? SER A 626  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BI2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BI2 
_atom_sites.fract_transf_matrix[1][1]   0.014146 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008961 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008916 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 21  ? -13.070 56.860 15.727 1.00 121.59 ? 516  GLN A N   1 
ATOM   2    C CA  . GLN A 1 21  ? -14.044 55.937 16.321 1.00 119.22 ? 516  GLN A CA  1 
ATOM   3    C C   . GLN A 1 21  ? -13.642 55.502 17.740 1.00 120.71 ? 516  GLN A C   1 
ATOM   4    O O   . GLN A 1 21  ? -12.519 55.782 18.175 1.00 121.57 ? 516  GLN A O   1 
ATOM   5    C CB  . GLN A 1 21  ? -14.293 54.720 15.409 1.00 118.70 ? 516  GLN A CB  1 
ATOM   6    N N   . SER A 1 22  ? -14.565 54.840 18.460 1.00 113.42 ? 517  SER A N   1 
ATOM   7    C CA  . SER A 1 22  ? -14.333 54.412 19.831 1.00 111.01 ? 517  SER A CA  1 
ATOM   8    C C   . SER A 1 22  ? -14.987 53.065 20.141 1.00 111.72 ? 517  SER A C   1 
ATOM   9    O O   . SER A 1 22  ? -15.702 52.509 19.298 1.00 111.41 ? 517  SER A O   1 
ATOM   10   C CB  . SER A 1 22  ? -14.812 55.491 20.803 1.00 115.67 ? 517  SER A CB  1 
ATOM   11   O OG  . SER A 1 22  ? -14.445 55.160 22.131 1.00 122.17 ? 517  SER A OG  1 
ATOM   12   N N   . MET A 1 23  ? -14.680 52.514 21.336 1.00 105.18 ? 518  MET A N   1 
ATOM   13   C CA  . MET A 1 23  ? -15.200 51.258 21.873 1.00 102.13 ? 518  MET A CA  1 
ATOM   14   C C   . MET A 1 23  ? -14.969 51.146 23.380 1.00 103.03 ? 518  MET A C   1 
ATOM   15   O O   . MET A 1 23  ? -14.051 51.771 23.923 1.00 103.58 ? 518  MET A O   1 
ATOM   16   C CB  . MET A 1 23  ? -14.638 50.036 21.121 1.00 102.33 ? 518  MET A CB  1 
ATOM   17   C CG  . MET A 1 23  ? -13.115 50.019 21.006 1.00 105.62 ? 518  MET A CG  1 
ATOM   18   S SD  . MET A 1 23  ? -12.526 48.432 20.356 1.00 107.89 ? 518  MET A SD  1 
ATOM   19   C CE  . MET A 1 23  ? -12.845 48.614 18.637 1.00 105.80 ? 518  MET A CE  1 
ATOM   20   N N   . SER A 1 24  ? -15.839 50.382 24.052 1.00 96.22  ? 519  SER A N   1 
ATOM   21   C CA  . SER A 1 24  ? -15.747 50.140 25.475 1.00 95.17  ? 519  SER A CA  1 
ATOM   22   C C   . SER A 1 24  ? -15.547 48.653 25.774 1.00 95.48  ? 519  SER A C   1 
ATOM   23   O O   . SER A 1 24  ? -16.359 47.805 25.390 1.00 95.05  ? 519  SER A O   1 
ATOM   24   C CB  . SER A 1 24  ? -16.975 50.679 26.202 1.00 100.11 ? 519  SER A CB  1 
ATOM   25   O OG  . SER A 1 24  ? -16.985 50.295 27.572 1.00 109.39 ? 519  SER A OG  1 
ATOM   26   N N   . VAL A 1 25  ? -14.408 48.344 26.399 1.00 88.99  ? 520  VAL A N   1 
ATOM   27   C CA  . VAL A 1 25  ? -14.065 47.007 26.855 1.00 86.05  ? 520  VAL A CA  1 
ATOM   28   C C   . VAL A 1 25  ? -14.158 47.122 28.362 1.00 91.72  ? 520  VAL A C   1 
ATOM   29   O O   . VAL A 1 25  ? -13.331 47.788 29.002 1.00 92.91  ? 520  VAL A O   1 
ATOM   30   C CB  . VAL A 1 25  ? -12.680 46.512 26.392 1.00 87.44  ? 520  VAL A CB  1 
ATOM   31   C CG1 . VAL A 1 25  ? -12.373 45.164 27.005 1.00 85.23  ? 520  VAL A CG1 1 
ATOM   32   C CG2 . VAL A 1 25  ? -12.602 46.414 24.883 1.00 86.51  ? 520  VAL A CG2 1 
ATOM   33   N N   . LYS A 1 26  ? -15.187 46.469 28.928 1.00 87.59  ? 521  LYS A N   1 
ATOM   34   C CA  . LYS A 1 26  ? -15.556 46.520 30.338 1.00 87.86  ? 521  LYS A CA  1 
ATOM   35   C C   . LYS A 1 26  ? -15.896 47.977 30.682 1.00 94.42  ? 521  LYS A C   1 
ATOM   36   O O   . LYS A 1 26  ? -16.628 48.614 29.893 1.00 95.36  ? 521  LYS A O   1 
ATOM   37   C CB  . LYS A 1 26  ? -14.482 45.914 31.249 1.00 87.76  ? 521  LYS A CB  1 
ATOM   38   C CG  . LYS A 1 26  ? -14.473 44.411 31.192 1.00 89.21  ? 521  LYS A CG  1 
ATOM   39   C CD  . LYS A 1 26  ? -14.042 43.819 32.531 1.00 95.17  ? 521  LYS A CD  1 
ATOM   40   C CE  . LYS A 1 26  ? -14.030 42.320 32.526 1.00 95.96  ? 521  LYS A CE  1 
ATOM   41   N NZ  . LYS A 1 26  ? -15.301 41.757 31.970 1.00 94.52  ? 521  LYS A NZ  1 
ATOM   42   N N   . GLY A 1 27  ? -15.346 48.488 31.791 1.00 91.00  ? 522  GLY A N   1 
ATOM   43   C CA  . GLY A 1 27  ? -15.542 49.876 32.217 1.00 92.81  ? 522  GLY A CA  1 
ATOM   44   C C   . GLY A 1 27  ? -14.855 50.862 31.285 1.00 95.25  ? 522  GLY A C   1 
ATOM   45   O O   . GLY A 1 27  ? -15.506 51.786 30.786 1.00 95.98  ? 522  GLY A O   1 
ATOM   46   N N   . ARG A 1 28  ? -13.547 50.633 31.005 1.00 88.95  ? 523  ARG A N   1 
ATOM   47   C CA  . ARG A 1 28  ? -12.673 51.452 30.175 1.00 88.72  ? 523  ARG A CA  1 
ATOM   48   C C   . ARG A 1 28  ? -13.141 51.673 28.717 1.00 90.71  ? 523  ARG A C   1 
ATOM   49   O O   . ARG A 1 28  ? -13.843 50.844 28.145 1.00 87.44  ? 523  ARG A O   1 
ATOM   50   C CB  . ARG A 1 28  ? -11.216 50.975 30.293 1.00 86.81  ? 523  ARG A CB  1 
ATOM   51   N N   . ILE A 1 29  ? -12.785 52.857 28.173 1.00 90.03  ? 524  ILE A N   1 
ATOM   52   C CA  . ILE A 1 29  ? -13.061 53.359 26.824 1.00 89.92  ? 524  ILE A CA  1 
ATOM   53   C C   . ILE A 1 29  ? -11.753 53.492 26.019 1.00 92.85  ? 524  ILE A C   1 
ATOM   54   O O   . ILE A 1 29  ? -10.748 54.048 26.491 1.00 92.96  ? 524  ILE A O   1 
ATOM   55   C CB  . ILE A 1 29  ? -13.872 54.687 26.805 1.00 95.98  ? 524  ILE A CB  1 
ATOM   56   C CG1 . ILE A 1 29  ? -14.932 54.793 27.934 1.00 97.63  ? 524  ILE A CG1 1 
ATOM   57   C CG2 . ILE A 1 29  ? -14.437 55.002 25.417 1.00 96.44  ? 524  ILE A CG2 1 
ATOM   58   C CD1 . ILE A 1 29  ? -16.170 53.776 27.976 1.00 105.67 ? 524  ILE A CD1 1 
ATOM   59   N N   . TYR A 1 30  ? -11.772 52.902 24.817 1.00 87.14  ? 525  TYR A N   1 
ATOM   60   C CA  . TYR A 1 30  ? -10.635 52.825 23.929 1.00 85.46  ? 525  TYR A CA  1 
ATOM   61   C C   . TYR A 1 30  ? -10.931 53.453 22.597 1.00 89.09  ? 525  TYR A C   1 
ATOM   62   O O   . TYR A 1 30  ? -11.866 53.050 21.903 1.00 87.74  ? 525  TYR A O   1 
ATOM   63   C CB  . TYR A 1 30  ? -10.184 51.371 23.779 1.00 83.42  ? 525  TYR A CB  1 
ATOM   64   C CG  . TYR A 1 30  ? -9.726  50.752 25.081 1.00 83.50  ? 525  TYR A CG  1 
ATOM   65   C CD1 . TYR A 1 30  ? -10.638 50.165 25.956 1.00 84.59  ? 525  TYR A CD1 1 
ATOM   66   C CD2 . TYR A 1 30  ? -8.382  50.744 25.437 1.00 83.80  ? 525  TYR A CD2 1 
ATOM   67   C CE1 . TYR A 1 30  ? -10.224 49.609 27.163 1.00 85.14  ? 525  TYR A CE1 1 
ATOM   68   C CE2 . TYR A 1 30  ? -7.957  50.188 26.639 1.00 84.06  ? 525  TYR A CE2 1 
ATOM   69   C CZ  . TYR A 1 30  ? -8.882  49.624 27.501 1.00 92.52  ? 525  TYR A CZ  1 
ATOM   70   O OH  . TYR A 1 30  ? -8.461  49.066 28.684 1.00 96.56  ? 525  TYR A OH  1 
ATOM   71   N N   . SER A 1 31  ? -10.147 54.481 22.269 1.00 87.22  ? 526  SER A N   1 
ATOM   72   C CA  . SER A 1 31  ? -10.238 55.253 21.035 1.00 88.40  ? 526  SER A CA  1 
ATOM   73   C C   . SER A 1 31  ? -9.470  54.509 19.948 1.00 89.03  ? 526  SER A C   1 
ATOM   74   O O   . SER A 1 31  ? -8.301  54.190 20.163 1.00 86.92  ? 526  SER A O   1 
ATOM   75   C CB  . SER A 1 31  ? -9.624  56.639 21.243 1.00 96.02  ? 526  SER A CB  1 
ATOM   76   O OG  . SER A 1 31  ? -10.124 57.284 22.404 1.00 107.46 ? 526  SER A OG  1 
ATOM   77   N N   . ILE A 1 32  ? -10.103 54.233 18.790 1.00 85.69  ? 527  ILE A N   1 
ATOM   78   C CA  . ILE A 1 32  ? -9.415  53.515 17.704 1.00 85.37  ? 527  ILE A CA  1 
ATOM   79   C C   . ILE A 1 32  ? -8.490  54.449 16.928 1.00 93.47  ? 527  ILE A C   1 
ATOM   80   O O   . ILE A 1 32  ? -8.947  55.486 16.449 1.00 97.57  ? 527  ILE A O   1 
ATOM   81   C CB  . ILE A 1 32  ? -10.371 52.707 16.781 1.00 87.64  ? 527  ILE A CB  1 
ATOM   82   C CG1 . ILE A 1 32  ? -11.271 51.753 17.594 1.00 85.84  ? 527  ILE A CG1 1 
ATOM   83   C CG2 . ILE A 1 32  ? -9.585  51.928 15.703 1.00 87.67  ? 527  ILE A CG2 1 
ATOM   84   C CD1 . ILE A 1 32  ? -12.677 51.975 17.357 1.00 94.94  ? 527  ILE A CD1 1 
ATOM   85   N N   . LEU A 1 33  ? -7.194  54.085 16.812 1.00 88.67  ? 528  LEU A N   1 
ATOM   86   C CA  . LEU A 1 33  ? -6.166  54.868 16.109 1.00 90.10  ? 528  LEU A CA  1 
ATOM   87   C C   . LEU A 1 33  ? -6.002  54.394 14.666 1.00 95.83  ? 528  LEU A C   1 
ATOM   88   O O   . LEU A 1 33  ? -5.964  55.218 13.748 1.00 98.50  ? 528  LEU A O   1 
ATOM   89   C CB  . LEU A 1 33  ? -4.824  54.764 16.850 1.00 89.00  ? 528  LEU A CB  1 
ATOM   90   C CG  . LEU A 1 33  ? -4.466  55.868 17.830 1.00 94.74  ? 528  LEU A CG  1 
ATOM   91   C CD1 . LEU A 1 33  ? -5.599  56.161 18.795 1.00 94.48  ? 528  LEU A CD1 1 
ATOM   92   C CD2 . LEU A 1 33  ? -3.218  55.506 18.599 1.00 95.78  ? 528  LEU A CD2 1 
ATOM   93   N N   . LYS A 1 34  ? -5.898  53.064 14.483 1.00 90.27  ? 529  LYS A N   1 
ATOM   94   C CA  . LYS A 1 34  ? -5.743  52.377 13.202 1.00 89.89  ? 529  LYS A CA  1 
ATOM   95   C C   . LYS A 1 34  ? -6.082  50.891 13.373 1.00 94.25  ? 529  LYS A C   1 
ATOM   96   O O   . LYS A 1 34  ? -6.211  50.423 14.506 1.00 92.35  ? 529  LYS A O   1 
ATOM   97   C CB  . LYS A 1 34  ? -4.320  52.548 12.634 1.00 91.96  ? 529  LYS A CB  1 
ATOM   98   C CG  . LYS A 1 34  ? -3.180  52.304 13.621 1.00 91.26  ? 529  LYS A CG  1 
ATOM   99   C CD  . LYS A 1 34  ? -1.944  51.860 12.876 1.00 94.02  ? 529  LYS A CD  1 
ATOM   100  C CE  . LYS A 1 34  ? -0.703  51.887 13.722 1.00 101.43 ? 529  LYS A CE  1 
ATOM   101  N NZ  . LYS A 1 34  ? 0.509   51.563 12.926 1.00 111.77 ? 529  LYS A NZ  1 
ATOM   102  N N   . GLN A 1 35  ? -6.257  50.174 12.249 1.00 92.72  ? 530  GLN A N   1 
ATOM   103  C CA  . GLN A 1 35  ? -6.563  48.753 12.221 1.00 91.50  ? 530  GLN A CA  1 
ATOM   104  C C   . GLN A 1 35  ? -5.261  48.030 11.931 1.00 98.15  ? 530  GLN A C   1 
ATOM   105  O O   . GLN A 1 35  ? -4.731  48.179 10.828 1.00 99.51  ? 530  GLN A O   1 
ATOM   106  C CB  . GLN A 1 35  ? -7.588  48.442 11.115 1.00 93.54  ? 530  GLN A CB  1 
ATOM   107  C CG  . GLN A 1 35  ? -8.184  47.021 11.183 1.00 109.15 ? 530  GLN A CG  1 
ATOM   108  C CD  . GLN A 1 35  ? -9.551  46.901 10.542 1.00 142.08 ? 530  GLN A CD  1 
ATOM   109  O OE1 . GLN A 1 35  ? -10.227 47.892 10.218 1.00 142.90 ? 530  GLN A OE1 1 
ATOM   110  N NE2 . GLN A 1 35  ? -10.021 45.674 10.435 1.00 137.76 ? 530  GLN A NE2 1 
ATOM   111  N N   . ILE A 1 36  ? -4.755  47.241 12.899 1.00 94.72  ? 531  ILE A N   1 
ATOM   112  C CA  . ILE A 1 36  ? -3.515  46.478 12.756 1.00 94.38  ? 531  ILE A CA  1 
ATOM   113  C C   . ILE A 1 36  ? -3.697  45.343 11.722 1.00 103.35 ? 531  ILE A C   1 
ATOM   114  O O   . ILE A 1 36  ? -3.093  45.387 10.659 1.00 104.91 ? 531  ILE A O   1 
ATOM   115  C CB  . ILE A 1 36  ? -2.929  46.017 14.128 1.00 94.62  ? 531  ILE A CB  1 
ATOM   116  C CG1 . ILE A 1 36  ? -2.429  47.226 14.956 1.00 95.71  ? 531  ILE A CG1 1 
ATOM   117  C CG2 . ILE A 1 36  ? -1.814  45.014 13.932 1.00 93.24  ? 531  ILE A CG2 1 
ATOM   118  C CD1 . ILE A 1 36  ? -2.019  46.919 16.387 1.00 98.02  ? 531  ILE A CD1 1 
ATOM   119  N N   . GLY A 1 37  ? -4.558  44.388 12.018 1.00 101.90 ? 532  GLY A N   1 
ATOM   120  C CA  . GLY A 1 37  ? -4.797  43.269 11.127 1.00 103.29 ? 532  GLY A CA  1 
ATOM   121  C C   . GLY A 1 37  ? -6.203  42.757 11.210 1.00 111.24 ? 532  GLY A C   1 
ATOM   122  O O   . GLY A 1 37  ? -6.961  43.134 12.107 1.00 110.03 ? 532  GLY A O   1 
ATOM   123  N N   . SER A 1 38  ? -6.550  41.898 10.257 1.00 112.46 ? 533  SER A N   1 
ATOM   124  C CA  . SER A 1 38  ? -7.843  41.240 10.162 1.00 113.43 ? 533  SER A CA  1 
ATOM   125  C C   . SER A 1 38  ? -7.600  39.774 9.787  1.00 120.38 ? 533  SER A C   1 
ATOM   126  O O   . SER A 1 38  ? -6.958  39.482 8.767  1.00 121.57 ? 533  SER A O   1 
ATOM   127  C CB  . SER A 1 38  ? -8.743  41.938 9.152  1.00 118.57 ? 533  SER A CB  1 
ATOM   128  N N   . GLY A 1 39  ? -7.980  38.891 10.703 1.00 117.11 ? 534  GLY A N   1 
ATOM   129  C CA  . GLY A 1 39  ? -7.879  37.439 10.548 1.00 116.96 ? 534  GLY A CA  1 
ATOM   130  C C   . GLY A 1 39  ? -8.896  36.947 9.525  1.00 122.01 ? 534  GLY A C   1 
ATOM   131  O O   . GLY A 1 39  ? -8.575  36.109 8.658  1.00 123.07 ? 534  GLY A O   1 
ATOM   132  N N   . GLY A 1 40  ? -10.102 37.512 9.623  1.00 117.66 ? 535  GLY A N   1 
ATOM   133  C CA  . GLY A 1 40  ? -11.255 37.226 8.767  1.00 118.80 ? 535  GLY A CA  1 
ATOM   134  C C   . GLY A 1 40  ? -12.558 37.645 9.420  1.00 120.58 ? 535  GLY A C   1 
ATOM   135  O O   . GLY A 1 40  ? -13.265 38.525 8.909  1.00 121.37 ? 535  GLY A O   1 
ATOM   136  N N   . SER A 1 41  ? -12.902 36.956 10.529 1.00 113.12 ? 536  SER A N   1 
ATOM   137  C CA  . SER A 1 41  ? -14.053 37.210 11.413 1.00 110.58 ? 536  SER A CA  1 
ATOM   138  C C   . SER A 1 41  ? -13.544 38.064 12.597 1.00 108.02 ? 536  SER A C   1 
ATOM   139  O O   . SER A 1 41  ? -14.333 38.593 13.387 1.00 106.77 ? 536  SER A O   1 
ATOM   140  C CB  . SER A 1 41  ? -14.579 35.895 11.971 1.00 112.91 ? 536  SER A CB  1 
ATOM   141  O OG  . SER A 1 41  ? -13.661 35.317 12.892 1.00 118.00 ? 536  SER A OG  1 
ATOM   142  N N   . SER A 1 42  ? -12.188 38.194 12.682 1.00 100.07 ? 537  SER A N   1 
ATOM   143  C CA  . SER A 1 42  ? -11.425 38.955 13.650 1.00 96.23  ? 537  SER A CA  1 
ATOM   144  C C   . SER A 1 42  ? -10.802 40.218 13.077 1.00 94.16  ? 537  SER A C   1 
ATOM   145  O O   . SER A 1 42  ? -10.340 40.232 11.941 1.00 94.97  ? 537  SER A O   1 
ATOM   146  C CB  . SER A 1 42  ? -10.329 38.079 14.238 1.00 98.84  ? 537  SER A CB  1 
ATOM   147  O OG  . SER A 1 42  ? -10.921 36.932 14.822 1.00 112.71 ? 537  SER A OG  1 
ATOM   148  N N   . LYS A 1 43  ? -10.802 41.287 13.875 1.00 85.04  ? 538  LYS A N   1 
ATOM   149  C CA  . LYS A 1 43  ? -10.218 42.564 13.512 1.00 83.34  ? 538  LYS A CA  1 
ATOM   150  C C   . LYS A 1 43  ? -9.369  43.052 14.688 1.00 83.64  ? 538  LYS A C   1 
ATOM   151  O O   . LYS A 1 43  ? -9.868  43.133 15.808 1.00 84.04  ? 538  LYS A O   1 
ATOM   152  C CB  . LYS A 1 43  ? -11.298 43.586 13.108 1.00 85.72  ? 538  LYS A CB  1 
ATOM   153  N N   . VAL A 1 44  ? -8.074  43.290 14.455 1.00 76.06  ? 539  VAL A N   1 
ATOM   154  C CA  . VAL A 1 44  ? -7.150  43.784 15.468 1.00 73.46  ? 539  VAL A CA  1 
ATOM   155  C C   . VAL A 1 44  ? -6.907  45.274 15.216 1.00 79.41  ? 539  VAL A C   1 
ATOM   156  O O   . VAL A 1 44  ? -6.590  45.664 14.093 1.00 80.21  ? 539  VAL A O   1 
ATOM   157  C CB  . VAL A 1 44  ? -5.830  42.989 15.531 1.00 74.42  ? 539  VAL A CB  1 
ATOM   158  C CG1 . VAL A 1 44  ? -5.102  43.269 16.832 1.00 73.49  ? 539  VAL A CG1 1 
ATOM   159  C CG2 . VAL A 1 44  ? -6.072  41.497 15.385 1.00 72.69  ? 539  VAL A CG2 1 
ATOM   160  N N   . PHE A 1 45  ? -7.093  46.100 16.251 1.00 76.96  ? 540  PHE A N   1 
ATOM   161  C CA  . PHE A 1 45  ? -6.935  47.556 16.172 1.00 79.28  ? 540  PHE A CA  1 
ATOM   162  C C   . PHE A 1 45  ? -5.914  48.060 17.148 1.00 83.80  ? 540  PHE A C   1 
ATOM   163  O O   . PHE A 1 45  ? -5.696  47.437 18.184 1.00 83.16  ? 540  PHE A O   1 
ATOM   164  C CB  . PHE A 1 45  ? -8.258  48.271 16.495 1.00 82.21  ? 540  PHE A CB  1 
ATOM   165  C CG  . PHE A 1 45  ? -9.417  47.803 15.667 1.00 84.13  ? 540  PHE A CG  1 
ATOM   166  C CD1 . PHE A 1 45  ? -9.660  48.349 14.415 1.00 89.29  ? 540  PHE A CD1 1 
ATOM   167  C CD2 . PHE A 1 45  ? -10.255 46.797 16.124 1.00 84.63  ? 540  PHE A CD2 1 
ATOM   168  C CE1 . PHE A 1 45  ? -10.728 47.900 13.642 1.00 90.33  ? 540  PHE A CE1 1 
ATOM   169  C CE2 . PHE A 1 45  ? -11.319 46.349 15.347 1.00 87.74  ? 540  PHE A CE2 1 
ATOM   170  C CZ  . PHE A 1 45  ? -11.545 46.901 14.110 1.00 87.59  ? 540  PHE A CZ  1 
ATOM   171  N N   . GLN A 1 46  ? -5.323  49.212 16.844 1.00 81.17  ? 541  GLN A N   1 
ATOM   172  C CA  . GLN A 1 46  ? -4.424  49.872 17.760 1.00 81.64  ? 541  GLN A CA  1 
ATOM   173  C C   . GLN A 1 46  ? -5.265  50.944 18.430 1.00 87.45  ? 541  GLN A C   1 
ATOM   174  O O   . GLN A 1 46  ? -5.908  51.753 17.746 1.00 89.27  ? 541  GLN A O   1 
ATOM   175  C CB  . GLN A 1 46  ? -3.244  50.489 17.037 1.00 84.50  ? 541  GLN A CB  1 
ATOM   176  C CG  . GLN A 1 46  ? -2.240  51.017 18.031 1.00 95.60  ? 541  GLN A CG  1 
ATOM   177  C CD  . GLN A 1 46  ? -1.123  51.697 17.333 1.00 117.92 ? 541  GLN A CD  1 
ATOM   178  O OE1 . GLN A 1 46  ? -0.006  51.183 17.280 1.00 115.69 ? 541  GLN A OE1 1 
ATOM   179  N NE2 . GLN A 1 46  ? -1.404  52.870 16.786 1.00 113.11 ? 541  GLN A NE2 1 
ATOM   180  N N   . VAL A 1 47  ? -5.289  50.929 19.770 1.00 82.00  ? 542  VAL A N   1 
ATOM   181  C CA  . VAL A 1 47  ? -6.133  51.836 20.548 1.00 82.02  ? 542  VAL A CA  1 
ATOM   182  C C   . VAL A 1 47  ? -5.424  52.713 21.619 1.00 87.20  ? 542  VAL A C   1 
ATOM   183  O O   . VAL A 1 47  ? -4.228  52.563 21.871 1.00 86.97  ? 542  VAL A O   1 
ATOM   184  C CB  . VAL A 1 47  ? -7.342  51.057 21.121 1.00 82.81  ? 542  VAL A CB  1 
ATOM   185  C CG1 . VAL A 1 47  ? -8.168  50.422 20.003 1.00 81.31  ? 542  VAL A CG1 1 
ATOM   186  C CG2 . VAL A 1 47  ? -6.887  50.008 22.123 1.00 80.37  ? 542  VAL A CG2 1 
ATOM   187  N N   . LEU A 1 48  ? -6.192  53.625 22.239 1.00 84.66  ? 543  LEU A N   1 
ATOM   188  C CA  . LEU A 1 48  ? -5.766  54.514 23.316 1.00 86.33  ? 543  LEU A CA  1 
ATOM   189  C C   . LEU A 1 48  ? -6.834  54.512 24.399 1.00 89.30  ? 543  LEU A C   1 
ATOM   190  O O   . LEU A 1 48  ? -8.020  54.628 24.081 1.00 88.72  ? 543  LEU A O   1 
ATOM   191  C CB  . LEU A 1 48  ? -5.600  55.959 22.802 1.00 89.98  ? 543  LEU A CB  1 
ATOM   192  C CG  . LEU A 1 48  ? -4.260  56.386 22.199 1.00 95.80  ? 543  LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 48  ? -4.340  57.787 21.710 1.00 98.48  ? 543  LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 48  ? -3.135  56.302 23.202 1.00 99.50  ? 543  LEU A CD2 1 
ATOM   195  N N   . ASN A 1 49  ? -6.435  54.418 25.671 1.00 86.13  ? 544  ASN A N   1 
ATOM   196  C CA  . ASN A 1 49  ? -7.414  54.465 26.758 1.00 86.90  ? 544  ASN A CA  1 
ATOM   197  C C   . ASN A 1 49  ? -7.607  55.906 27.272 1.00 96.31  ? 544  ASN A C   1 
ATOM   198  O O   . ASN A 1 49  ? -7.206  56.869 26.593 1.00 97.76  ? 544  ASN A O   1 
ATOM   199  C CB  . ASN A 1 49  ? -7.056  53.495 27.886 1.00 86.88  ? 544  ASN A CB  1 
ATOM   200  C CG  . ASN A 1 49  ? -5.725  53.768 28.520 1.00 113.35 ? 544  ASN A CG  1 
ATOM   201  O OD1 . ASN A 1 49  ? -4.738  53.984 27.839 1.00 110.03 ? 544  ASN A OD1 1 
ATOM   202  N ND2 . ASN A 1 49  ? -5.660  53.743 29.836 1.00 107.60 ? 544  ASN A ND2 1 
ATOM   203  N N   . GLU A 1 50  ? -8.262  56.054 28.453 1.00 94.51  ? 545  GLU A N   1 
ATOM   204  C CA  . GLU A 1 50  ? -8.522  57.363 29.070 1.00 97.28  ? 545  GLU A CA  1 
ATOM   205  C C   . GLU A 1 50  ? -7.239  57.966 29.644 1.00 100.41 ? 545  GLU A C   1 
ATOM   206  O O   . GLU A 1 50  ? -7.121  59.185 29.706 1.00 102.49 ? 545  GLU A O   1 
ATOM   207  C CB  . GLU A 1 50  ? -9.648  57.298 30.120 1.00 99.19  ? 545  GLU A CB  1 
ATOM   208  C CG  . GLU A 1 50  ? -11.026 57.019 29.538 1.00 106.83 ? 545  GLU A CG  1 
ATOM   209  C CD  . GLU A 1 50  ? -11.530 55.611 29.791 1.00 127.92 ? 545  GLU A CD  1 
ATOM   210  O OE1 . GLU A 1 50  ? -10.745 54.651 29.602 1.00 120.03 ? 545  GLU A OE1 1 
ATOM   211  O OE2 . GLU A 1 50  ? -12.707 55.470 30.200 1.00 121.06 ? 545  GLU A OE2 1 
ATOM   212  N N   . LYS A 1 51  ? -6.268  57.109 30.017 1.00 94.39  ? 546  LYS A N   1 
ATOM   213  C CA  . LYS A 1 51  ? -4.947  57.501 30.507 1.00 95.67  ? 546  LYS A CA  1 
ATOM   214  C C   . LYS A 1 51  ? -3.974  57.736 29.316 1.00 99.32  ? 546  LYS A C   1 
ATOM   215  O O   . LYS A 1 51  ? -2.775  57.945 29.530 1.00 100.55 ? 546  LYS A O   1 
ATOM   216  C CB  . LYS A 1 51  ? -4.400  56.436 31.479 1.00 96.41  ? 546  LYS A CB  1 
ATOM   217  N N   . LYS A 1 52  ? -4.509  57.730 28.066 1.00 94.34  ? 547  LYS A N   1 
ATOM   218  C CA  . LYS A 1 52  ? -3.792  57.947 26.804 1.00 94.36  ? 547  LYS A CA  1 
ATOM   219  C C   . LYS A 1 52  ? -2.600  56.997 26.556 1.00 99.58  ? 547  LYS A C   1 
ATOM   220  O O   . LYS A 1 52  ? -1.570  57.417 26.026 1.00 101.30 ? 547  LYS A O   1 
ATOM   221  C CB  . LYS A 1 52  ? -3.436  59.429 26.609 1.00 99.99  ? 547  LYS A CB  1 
ATOM   222  N N   . GLN A 1 53  ? -2.766  55.699 26.912 1.00 94.24  ? 548  GLN A N   1 
ATOM   223  C CA  . GLN A 1 53  ? -1.780  54.631 26.691 1.00 92.11  ? 548  GLN A CA  1 
ATOM   224  C C   . GLN A 1 53  ? -2.229  53.776 25.493 1.00 93.03  ? 548  GLN A C   1 
ATOM   225  O O   . GLN A 1 53  ? -3.422  53.512 25.303 1.00 90.40  ? 548  GLN A O   1 
ATOM   226  C CB  . GLN A 1 53  ? -1.601  53.723 27.922 1.00 92.46  ? 548  GLN A CB  1 
ATOM   227  C CG  . GLN A 1 53  ? -1.335  54.432 29.241 1.00 114.73 ? 548  GLN A CG  1 
ATOM   228  C CD  . GLN A 1 53  ? -1.499  53.480 30.401 1.00 132.59 ? 548  GLN A CD  1 
ATOM   229  O OE1 . GLN A 1 53  ? -2.613  53.248 30.901 1.00 124.17 ? 548  GLN A OE1 1 
ATOM   230  N NE2 . GLN A 1 53  ? -0.388  52.893 30.835 1.00 125.09 ? 548  GLN A NE2 1 
ATOM   231  N N   . ILE A 1 54  ? -1.250  53.346 24.696 1.00 89.04  ? 549  ILE A N   1 
ATOM   232  C CA  . ILE A 1 54  ? -1.439  52.588 23.475 1.00 86.14  ? 549  ILE A CA  1 
ATOM   233  C C   . ILE A 1 54  ? -1.573  51.085 23.739 1.00 88.14  ? 549  ILE A C   1 
ATOM   234  O O   . ILE A 1 54  ? -0.779  50.514 24.495 1.00 88.45  ? 549  ILE A O   1 
ATOM   235  C CB  . ILE A 1 54  ? -0.338  53.006 22.470 1.00 89.89  ? 549  ILE A CB  1 
ATOM   236  C CG1 . ILE A 1 54  ? -0.786  52.872 21.026 1.00 89.55  ? 549  ILE A CG1 1 
ATOM   237  C CG2 . ILE A 1 54  ? 1.013   52.366 22.748 1.00 89.67  ? 549  ILE A CG2 1 
ATOM   238  C CD1 . ILE A 1 54  ? -0.170  53.889 20.120 1.00 95.31  ? 549  ILE A CD1 1 
ATOM   239  N N   . TYR A 1 55  ? -2.627  50.467 23.173 1.00 82.38  ? 550  TYR A N   1 
ATOM   240  C CA  . TYR A 1 55  ? -2.951  49.040 23.330 1.00 78.79  ? 550  TYR A CA  1 
ATOM   241  C C   . TYR A 1 55  ? -3.391  48.438 21.997 1.00 82.42  ? 550  TYR A C   1 
ATOM   242  O O   . TYR A 1 55  ? -3.566  49.168 21.017 1.00 84.93  ? 550  TYR A O   1 
ATOM   243  C CB  . TYR A 1 55  ? -4.079  48.845 24.366 1.00 78.68  ? 550  TYR A CB  1 
ATOM   244  C CG  . TYR A 1 55  ? -3.701  49.176 25.790 1.00 81.44  ? 550  TYR A CG  1 
ATOM   245  C CD1 . TYR A 1 55  ? -2.925  48.305 26.545 1.00 82.78  ? 550  TYR A CD1 1 
ATOM   246  C CD2 . TYR A 1 55  ? -4.170  50.330 26.406 1.00 84.80  ? 550  TYR A CD2 1 
ATOM   247  C CE1 . TYR A 1 55  ? -2.579  48.600 27.863 1.00 85.95  ? 550  TYR A CE1 1 
ATOM   248  C CE2 . TYR A 1 55  ? -3.837  50.634 27.725 1.00 87.44  ? 550  TYR A CE2 1 
ATOM   249  C CZ  . TYR A 1 55  ? -3.046  49.760 28.455 1.00 95.13  ? 550  TYR A CZ  1 
ATOM   250  O OH  . TYR A 1 55  ? -2.714  50.043 29.761 1.00 98.86  ? 550  TYR A OH  1 
ATOM   251  N N   . ALA A 1 56  ? -3.581  47.110 21.960 1.00 75.48  ? 551  ALA A N   1 
ATOM   252  C CA  . ALA A 1 56  ? -4.050  46.405 20.771 1.00 73.87  ? 551  ALA A CA  1 
ATOM   253  C C   . ALA A 1 56  ? -5.339  45.680 21.114 1.00 75.98  ? 551  ALA A C   1 
ATOM   254  O O   . ALA A 1 56  ? -5.328  44.819 21.986 1.00 74.85  ? 551  ALA A O   1 
ATOM   255  C CB  . ALA A 1 56  ? -2.993  45.426 20.277 1.00 73.34  ? 551  ALA A CB  1 
ATOM   256  N N   . ILE A 1 57  ? -6.462  46.077 20.517 1.00 73.20  ? 552  ILE A N   1 
ATOM   257  C CA  . ILE A 1 57  ? -7.718  45.400 20.835 1.00 72.67  ? 552  ILE A CA  1 
ATOM   258  C C   . ILE A 1 57  ? -8.104  44.455 19.747 1.00 76.39  ? 552  ILE A C   1 
ATOM   259  O O   . ILE A 1 57  ? -8.067  44.802 18.569 1.00 78.51  ? 552  ILE A O   1 
ATOM   260  C CB  . ILE A 1 57  ? -8.898  46.280 21.335 1.00 76.84  ? 552  ILE A CB  1 
ATOM   261  C CG1 . ILE A 1 57  ? -8.571  46.888 22.699 1.00 78.26  ? 552  ILE A CG1 1 
ATOM   262  C CG2 . ILE A 1 57  ? -10.198 45.455 21.446 1.00 76.19  ? 552  ILE A CG2 1 
ATOM   263  C CD1 . ILE A 1 57  ? -9.569  47.885 23.176 1.00 87.79  ? 552  ILE A CD1 1 
ATOM   264  N N   . LYS A 1 58  ? -8.481  43.258 20.148 1.00 69.42  ? 553  LYS A N   1 
ATOM   265  C CA  . LYS A 1 58  ? -8.898  42.249 19.222 1.00 67.72  ? 553  LYS A CA  1 
ATOM   266  C C   . LYS A 1 58  ? -10.410 42.079 19.275 1.00 72.73  ? 553  LYS A C   1 
ATOM   267  O O   . LYS A 1 58  ? -10.984 41.769 20.324 1.00 71.59  ? 553  LYS A O   1 
ATOM   268  C CB  . LYS A 1 58  ? -8.194  40.943 19.558 1.00 67.30  ? 553  LYS A CB  1 
ATOM   269  C CG  . LYS A 1 58  ? -8.285  39.925 18.463 1.00 66.64  ? 553  LYS A CG  1 
ATOM   270  C CD  . LYS A 1 58  ? -7.540  38.713 18.868 1.00 67.75  ? 553  LYS A CD  1 
ATOM   271  C CE  . LYS A 1 58  ? -7.643  37.704 17.788 1.00 70.62  ? 553  LYS A CE  1 
ATOM   272  N NZ  . LYS A 1 58  ? -7.285  36.381 18.306 1.00 71.89  ? 553  LYS A NZ  1 
ATOM   273  N N   . TYR A 1 59  ? -11.055 42.283 18.140 1.00 70.80  ? 554  TYR A N   1 
ATOM   274  C CA  . TYR A 1 59  ? -12.477 42.031 18.040 1.00 71.27  ? 554  TYR A CA  1 
ATOM   275  C C   . TYR A 1 59  ? -12.635 40.650 17.400 1.00 74.17  ? 554  TYR A C   1 
ATOM   276  O O   . TYR A 1 59  ? -11.865 40.288 16.516 1.00 72.87  ? 554  TYR A O   1 
ATOM   277  C CB  . TYR A 1 59  ? -13.194 43.116 17.230 1.00 74.15  ? 554  TYR A CB  1 
ATOM   278  C CG  . TYR A 1 59  ? -14.622 42.751 16.879 1.00 76.70  ? 554  TYR A CG  1 
ATOM   279  C CD1 . TYR A 1 59  ? -15.606 42.680 17.859 1.00 78.07  ? 554  TYR A CD1 1 
ATOM   280  C CD2 . TYR A 1 59  ? -14.977 42.417 15.573 1.00 78.58  ? 554  TYR A CD2 1 
ATOM   281  C CE1 . TYR A 1 59  ? -16.921 42.359 17.541 1.00 79.58  ? 554  TYR A CE1 1 
ATOM   282  C CE2 . TYR A 1 59  ? -16.285 42.069 15.246 1.00 80.33  ? 554  TYR A CE2 1 
ATOM   283  C CZ  . TYR A 1 59  ? -17.255 42.043 16.234 1.00 88.37  ? 554  TYR A CZ  1 
ATOM   284  O OH  . TYR A 1 59  ? -18.550 41.718 15.916 1.00 92.63  ? 554  TYR A OH  1 
ATOM   285  N N   . VAL A 1 60  ? -13.586 39.865 17.900 1.00 71.15  ? 555  VAL A N   1 
ATOM   286  C CA  . VAL A 1 60  ? -13.887 38.528 17.396 1.00 70.96  ? 555  VAL A CA  1 
ATOM   287  C C   . VAL A 1 60  ? -15.413 38.489 17.241 1.00 79.95  ? 555  VAL A C   1 
ATOM   288  O O   . VAL A 1 60  ? -16.147 38.918 18.139 1.00 80.29  ? 555  VAL A O   1 
ATOM   289  C CB  . VAL A 1 60  ? -13.321 37.389 18.305 1.00 71.88  ? 555  VAL A CB  1 
ATOM   290  C CG1 . VAL A 1 60  ? -13.676 35.999 17.781 1.00 71.32  ? 555  VAL A CG1 1 
ATOM   291  C CG2 . VAL A 1 60  ? -11.813 37.516 18.485 1.00 70.55  ? 555  VAL A CG2 1 
ATOM   292  N N   . ASN A 1 61  ? -15.884 38.028 16.086 1.00 79.18  ? 556  ASN A N   1 
ATOM   293  C CA  . ASN A 1 61  ? -17.312 37.930 15.852 1.00 81.09  ? 556  ASN A CA  1 
ATOM   294  C C   . ASN A 1 61  ? -17.767 36.481 16.075 1.00 86.86  ? 556  ASN A C   1 
ATOM   295  O O   . ASN A 1 61  ? -17.333 35.575 15.355 1.00 87.48  ? 556  ASN A O   1 
ATOM   296  C CB  . ASN A 1 61  ? -17.672 38.463 14.469 1.00 83.83  ? 556  ASN A CB  1 
ATOM   297  C CG  . ASN A 1 61  ? -19.104 38.240 14.055 1.00 109.90 ? 556  ASN A CG  1 
ATOM   298  O OD1 . ASN A 1 61  ? -19.520 37.109 13.806 1.00 106.74 ? 556  ASN A OD1 1 
ATOM   299  N ND2 . ASN A 1 61  ? -19.855 39.319 13.879 1.00 102.19 ? 556  ASN A ND2 1 
ATOM   300  N N   . LEU A 1 62  ? -18.631 36.272 17.107 1.00 83.28  ? 557  LEU A N   1 
ATOM   301  C CA  . LEU A 1 62  ? -19.163 34.954 17.483 1.00 82.77  ? 557  LEU A CA  1 
ATOM   302  C C   . LEU A 1 62  ? -20.473 34.614 16.763 1.00 92.39  ? 557  LEU A C   1 
ATOM   303  O O   . LEU A 1 62  ? -20.996 33.522 16.991 1.00 93.46  ? 557  LEU A O   1 
ATOM   304  C CB  . LEU A 1 62  ? -19.336 34.830 19.015 1.00 80.96  ? 557  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 62  ? -18.137 35.124 19.873 1.00 81.59  ? 557  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 62  ? -18.493 34.957 21.312 1.00 80.51  ? 557  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 62  ? -16.950 34.250 19.473 1.00 79.70  ? 557  LEU A CD2 1 
ATOM   308  N N   . GLU A 1 63  ? -20.983 35.517 15.878 1.00 91.50  ? 558  GLU A N   1 
ATOM   309  C CA  . GLU A 1 63  ? -22.249 35.372 15.146 1.00 93.26  ? 558  GLU A CA  1 
ATOM   310  C C   . GLU A 1 63  ? -22.425 34.061 14.424 1.00 96.06  ? 558  GLU A C   1 
ATOM   311  O O   . GLU A 1 63  ? -23.483 33.467 14.537 1.00 96.48  ? 558  GLU A O   1 
ATOM   312  C CB  . GLU A 1 63  ? -22.524 36.560 14.202 1.00 96.23  ? 558  GLU A CB  1 
ATOM   313  C CG  . GLU A 1 63  ? -22.731 37.899 14.905 1.00 110.02 ? 558  GLU A CG  1 
ATOM   314  C CD  . GLU A 1 63  ? -23.864 38.042 15.907 1.00 137.27 ? 558  GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 63  ? -24.295 37.041 16.526 1.00 142.39 ? 558  GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 63  ? -24.286 39.198 16.117 1.00 130.71 ? 558  GLU A OE2 1 
ATOM   317  N N   . GLU A 1 64  ? -21.391 33.596 13.724 1.00 92.74  ? 559  GLU A N   1 
ATOM   318  C CA  . GLU A 1 64  ? -21.417 32.321 13.021 1.00 94.91  ? 559  GLU A CA  1 
ATOM   319  C C   . GLU A 1 64  ? -20.273 31.449 13.588 1.00 99.44  ? 559  GLU A C   1 
ATOM   320  O O   . GLU A 1 64  ? -19.265 31.180 12.923 1.00 98.55  ? 559  GLU A O   1 
ATOM   321  C CB  . GLU A 1 64  ? -21.328 32.522 11.495 1.00 97.94  ? 559  GLU A CB  1 
ATOM   322  N N   . ALA A 1 65  ? -20.411 31.077 14.872 1.00 96.83  ? 560  ALA A N   1 
ATOM   323  C CA  . ALA A 1 65  ? -19.413 30.273 15.567 1.00 95.95  ? 560  ALA A CA  1 
ATOM   324  C C   . ALA A 1 65  ? -19.997 28.978 16.139 1.00 100.82 ? 560  ALA A C   1 
ATOM   325  O O   . ALA A 1 65  ? -20.928 29.034 16.939 1.00 99.95  ? 560  ALA A O   1 
ATOM   326  C CB  . ALA A 1 65  ? -18.753 31.089 16.669 1.00 94.76  ? 560  ALA A CB  1 
ATOM   327  N N   . ASP A 1 66  ? -19.439 27.803 15.738 1.00 99.20  ? 561  ASP A N   1 
ATOM   328  C CA  . ASP A 1 66  ? -19.853 26.493 16.247 1.00 100.95 ? 561  ASP A CA  1 
ATOM   329  C C   . ASP A 1 66  ? -19.481 26.453 17.764 1.00 100.59 ? 561  ASP A C   1 
ATOM   330  O O   . ASP A 1 66  ? -18.825 27.363 18.280 1.00 97.46  ? 561  ASP A O   1 
ATOM   331  C CB  . ASP A 1 66  ? -19.167 25.347 15.436 1.00 105.37 ? 561  ASP A CB  1 
ATOM   332  C CG  . ASP A 1 66  ? -17.685 25.230 15.693 1.00 132.06 ? 561  ASP A CG  1 
ATOM   333  O OD1 . ASP A 1 66  ? -17.195 25.923 16.565 1.00 134.11 ? 561  ASP A OD1 1 
ATOM   334  O OD2 . ASP A 1 66  ? -16.986 24.549 14.918 1.00 143.69 ? 561  ASP A OD2 1 
ATOM   335  N N   . ASN A 1 67  ? -19.939 25.433 18.476 1.00 97.46  ? 562  ASN A N   1 
ATOM   336  C CA  . ASN A 1 67  ? -19.656 25.299 19.896 1.00 95.73  ? 562  ASN A CA  1 
ATOM   337  C C   . ASN A 1 67  ? -18.275 24.689 20.111 1.00 98.09  ? 562  ASN A C   1 
ATOM   338  O O   . ASN A 1 67  ? -17.704 24.835 21.193 1.00 97.66  ? 562  ASN A O   1 
ATOM   339  C CB  . ASN A 1 67  ? -20.792 24.582 20.613 1.00 97.53  ? 562  ASN A CB  1 
ATOM   340  C CG  . ASN A 1 67  ? -22.136 25.221 20.297 1.00 125.93 ? 562  ASN A CG  1 
ATOM   341  O OD1 . ASN A 1 67  ? -22.530 26.232 20.901 1.00 121.11 ? 562  ASN A OD1 1 
ATOM   342  N ND2 . ASN A 1 67  ? -22.832 24.700 19.279 1.00 117.86 ? 562  ASN A ND2 1 
ATOM   343  N N   . GLN A 1 68  ? -17.694 24.111 19.028 1.00 93.67  ? 563  GLN A N   1 
ATOM   344  C CA  . GLN A 1 68  ? -16.326 23.576 18.992 1.00 91.84  ? 563  GLN A CA  1 
ATOM   345  C C   . GLN A 1 68  ? -15.310 24.739 18.881 1.00 91.26  ? 563  GLN A C   1 
ATOM   346  O O   . GLN A 1 68  ? -14.370 24.786 19.684 1.00 89.87  ? 563  GLN A O   1 
ATOM   347  C CB  . GLN A 1 68  ? -16.152 22.532 17.873 1.00 94.84  ? 563  GLN A CB  1 
ATOM   348  N N   . THR A 1 69  ? -15.525 25.682 17.882 1.00 84.81  ? 564  THR A N   1 
ATOM   349  C CA  . THR A 1 69  ? -14.802 26.953 17.603 1.00 81.23  ? 564  THR A CA  1 
ATOM   350  C C   . THR A 1 69  ? -14.902 27.771 18.897 1.00 80.86  ? 564  THR A C   1 
ATOM   351  O O   . THR A 1 69  ? -13.879 28.273 19.369 1.00 80.10  ? 564  THR A O   1 
ATOM   352  C CB  . THR A 1 69  ? -15.384 27.791 16.371 1.00 86.43  ? 564  THR A CB  1 
ATOM   353  O OG1 . THR A 1 69  ? -15.334 27.031 15.159 1.00 87.79  ? 564  THR A OG1 1 
ATOM   354  C CG2 . THR A 1 69  ? -14.668 29.092 16.177 1.00 83.88  ? 564  THR A CG2 1 
ATOM   355  N N   . LEU A 1 70  ? -16.118 27.862 19.506 1.00 74.52  ? 565  LEU A N   1 
ATOM   356  C CA  . LEU A 1 70  ? -16.268 28.598 20.770 1.00 72.57  ? 565  LEU A CA  1 
ATOM   357  C C   . LEU A 1 70  ? -15.356 28.052 21.817 1.00 74.40  ? 565  LEU A C   1 
ATOM   358  O O   . LEU A 1 70  ? -14.666 28.811 22.489 1.00 70.61  ? 565  LEU A O   1 
ATOM   359  C CB  . LEU A 1 70  ? -17.698 28.626 21.324 1.00 73.92  ? 565  LEU A CB  1 
ATOM   360  C CG  . LEU A 1 70  ? -18.694 29.527 20.615 1.00 79.69  ? 565  LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 70  ? -20.017 29.565 21.350 1.00 80.87  ? 565  LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 70  ? -18.155 30.917 20.445 1.00 81.80  ? 565  LEU A CD2 1 
ATOM   363  N N   . ASP A 1 71  ? -15.320 26.726 21.931 1.00 74.18  ? 566  ASP A N   1 
ATOM   364  C CA  . ASP A 1 71  ? -14.458 26.098 22.908 1.00 74.21  ? 566  ASP A CA  1 
ATOM   365  C C   . ASP A 1 71  ? -12.966 26.328 22.637 1.00 73.08  ? 566  ASP A C   1 
ATOM   366  O O   . ASP A 1 71  ? -12.245 26.656 23.576 1.00 71.80  ? 566  ASP A O   1 
ATOM   367  C CB  . ASP A 1 71  ? -14.825 24.636 23.165 1.00 78.92  ? 566  ASP A CB  1 
ATOM   368  C CG  . ASP A 1 71  ? -14.066 24.084 24.350 1.00 102.29 ? 566  ASP A CG  1 
ATOM   369  O OD1 . ASP A 1 71  ? -14.364 24.509 25.496 1.00 102.91 ? 566  ASP A OD1 1 
ATOM   370  O OD2 . ASP A 1 71  ? -13.110 23.289 24.129 1.00 115.72 ? 566  ASP A OD2 1 
ATOM   371  N N   . SER A 1 72  ? -12.529 26.261 21.369 1.00 67.25  ? 567  SER A N   1 
ATOM   372  C CA  . SER A 1 72  ? -11.134 26.523 21.018 1.00 65.69  ? 567  SER A CA  1 
ATOM   373  C C   . SER A 1 72  ? -10.732 27.958 21.423 1.00 68.53  ? 567  SER A C   1 
ATOM   374  O O   . SER A 1 72  ? -9.662  28.153 22.008 1.00 68.12  ? 567  SER A O   1 
ATOM   375  C CB  . SER A 1 72  ? -10.894 26.280 19.535 1.00 70.11  ? 567  SER A CB  1 
ATOM   376  O OG  . SER A 1 72  ? -11.451 27.315 18.744 1.00 82.43  ? 567  SER A OG  1 
ATOM   377  N N   . TYR A 1 73  ? -11.637 28.936 21.183 1.00 63.41  ? 568  TYR A N   1 
ATOM   378  C CA  . TYR A 1 73  ? -11.462 30.340 21.544 1.00 60.96  ? 568  TYR A CA  1 
ATOM   379  C C   . TYR A 1 73  ? -11.279 30.495 23.042 1.00 63.04  ? 568  TYR A C   1 
ATOM   380  O O   . TYR A 1 73  ? -10.275 31.064 23.452 1.00 62.58  ? 568  TYR A O   1 
ATOM   381  C CB  . TYR A 1 73  ? -12.646 31.181 21.056 1.00 62.11  ? 568  TYR A CB  1 
ATOM   382  C CG  . TYR A 1 73  ? -12.726 31.319 19.553 1.00 65.11  ? 568  TYR A CG  1 
ATOM   383  C CD1 . TYR A 1 73  ? -11.673 30.903 18.736 1.00 67.50  ? 568  TYR A CD1 1 
ATOM   384  C CD2 . TYR A 1 73  ? -13.820 31.926 18.946 1.00 66.68  ? 568  TYR A CD2 1 
ATOM   385  C CE1 . TYR A 1 73  ? -11.731 31.046 17.351 1.00 70.18  ? 568  TYR A CE1 1 
ATOM   386  C CE2 . TYR A 1 73  ? -13.875 32.104 17.564 1.00 68.51  ? 568  TYR A CE2 1 
ATOM   387  C CZ  . TYR A 1 73  ? -12.820 31.673 16.771 1.00 78.43  ? 568  TYR A CZ  1 
ATOM   388  O OH  . TYR A 1 73  ? -12.863 31.805 15.405 1.00 82.99  ? 568  TYR A OH  1 
ATOM   389  N N   . ARG A 1 74  ? -12.202 29.928 23.853 1.00 58.66  ? 569  ARG A N   1 
ATOM   390  C CA  . ARG A 1 74  ? -12.175 29.994 25.319 1.00 58.11  ? 569  ARG A CA  1 
ATOM   391  C C   . ARG A 1 74  ? -10.928 29.316 25.870 1.00 64.09  ? 569  ARG A C   1 
ATOM   392  O O   . ARG A 1 74  ? -10.333 29.802 26.843 1.00 64.35  ? 569  ARG A O   1 
ATOM   393  C CB  . ARG A 1 74  ? -13.421 29.344 25.949 1.00 55.28  ? 569  ARG A CB  1 
ATOM   394  C CG  . ARG A 1 74  ? -14.739 29.728 25.339 1.00 50.90  ? 569  ARG A CG  1 
ATOM   395  C CD  . ARG A 1 74  ? -15.803 29.721 26.392 1.00 56.77  ? 569  ARG A CD  1 
ATOM   396  N NE  . ARG A 1 74  ? -17.140 29.779 25.817 1.00 64.87  ? 569  ARG A NE  1 
ATOM   397  C CZ  . ARG A 1 74  ? -17.833 28.708 25.465 1.00 80.32  ? 569  ARG A CZ  1 
ATOM   398  N NH1 . ARG A 1 74  ? -17.330 27.494 25.650 1.00 80.49  ? 569  ARG A NH1 1 
ATOM   399  N NH2 . ARG A 1 74  ? -19.027 28.840 24.911 1.00 61.95  ? 569  ARG A NH2 1 
ATOM   400  N N   . ASN A 1 75  ? -10.533 28.188 25.249 1.00 61.19  ? 570  ASN A N   1 
ATOM   401  C CA  . ASN A 1 75  ? -9.343  27.450 25.669 1.00 61.24  ? 570  ASN A CA  1 
ATOM   402  C C   . ASN A 1 75  ? -8.089  28.299 25.440 1.00 64.92  ? 570  ASN A C   1 
ATOM   403  O O   . ASN A 1 75  ? -7.376  28.585 26.415 1.00 65.28  ? 570  ASN A O   1 
ATOM   404  C CB  . ASN A 1 75  ? -9.228  26.097 24.951 1.00 61.87  ? 570  ASN A CB  1 
ATOM   405  C CG  . ASN A 1 75  ? -8.350  25.131 25.696 1.00 81.39  ? 570  ASN A CG  1 
ATOM   406  O OD1 . ASN A 1 75  ? -7.196  24.893 25.324 1.00 69.89  ? 570  ASN A OD1 1 
ATOM   407  N ND2 . ASN A 1 75  ? -8.851  24.621 26.824 1.00 76.53  ? 570  ASN A ND2 1 
ATOM   408  N N   . GLU A 1 76  ? -7.875  28.767 24.165 1.00 58.32  ? 571  GLU A N   1 
ATOM   409  C CA  . GLU A 1 76  ? -6.758  29.604 23.740 1.00 55.79  ? 571  GLU A CA  1 
ATOM   410  C C   . GLU A 1 76  ? -6.592  30.825 24.658 1.00 58.21  ? 571  GLU A C   1 
ATOM   411  O O   . GLU A 1 76  ? -5.462  31.104 25.073 1.00 58.46  ? 571  GLU A O   1 
ATOM   412  C CB  . GLU A 1 76  ? -6.942  30.008 22.274 1.00 56.98  ? 571  GLU A CB  1 
ATOM   413  C CG  . GLU A 1 76  ? -5.900  30.976 21.741 1.00 65.96  ? 571  GLU A CG  1 
ATOM   414  C CD  . GLU A 1 76  ? -4.691  30.375 21.061 1.00 74.36  ? 571  GLU A CD  1 
ATOM   415  O OE1 . GLU A 1 76  ? -4.828  29.908 19.907 1.00 80.95  ? 571  GLU A OE1 1 
ATOM   416  O OE2 . GLU A 1 76  ? -3.586  30.474 21.637 1.00 57.31  ? 571  GLU A OE2 1 
ATOM   417  N N   . ILE A 1 77  ? -7.721  31.502 25.021 1.00 53.03  ? 572  ILE A N   1 
ATOM   418  C CA  . ILE A 1 77  ? -7.776  32.670 25.923 1.00 52.18  ? 572  ILE A CA  1 
ATOM   419  C C   . ILE A 1 77  ? -7.266  32.355 27.325 1.00 58.67  ? 572  ILE A C   1 
ATOM   420  O O   . ILE A 1 77  ? -6.329  33.010 27.797 1.00 57.66  ? 572  ILE A O   1 
ATOM   421  C CB  . ILE A 1 77  ? -9.179  33.340 25.947 1.00 54.55  ? 572  ILE A CB  1 
ATOM   422  C CG1 . ILE A 1 77  ? -9.466  33.989 24.573 1.00 54.76  ? 572  ILE A CG1 1 
ATOM   423  C CG2 . ILE A 1 77  ? -9.271  34.382 27.082 1.00 52.88  ? 572  ILE A CG2 1 
ATOM   424  C CD1 . ILE A 1 77  ? -10.896 34.236 24.214 1.00 57.19  ? 572  ILE A CD1 1 
ATOM   425  N N   . ALA A 1 78  ? -7.892  31.364 27.993 1.00 58.68  ? 573  ALA A N   1 
ATOM   426  C CA  . ALA A 1 78  ? -7.534  30.960 29.355 1.00 60.14  ? 573  ALA A CA  1 
ATOM   427  C C   . ALA A 1 78  ? -6.037  30.634 29.440 1.00 66.30  ? 573  ALA A C   1 
ATOM   428  O O   . ALA A 1 78  ? -5.369  31.104 30.372 1.00 66.80  ? 573  ALA A O   1 
ATOM   429  C CB  . ALA A 1 78  ? -8.376  29.769 29.797 1.00 61.60  ? 573  ALA A CB  1 
ATOM   430  N N   . TYR A 1 79  ? -5.504  29.888 28.429 1.00 62.50  ? 574  TYR A N   1 
ATOM   431  C CA  . TYR A 1 79  ? -4.092  29.534 28.350 1.00 62.30  ? 574  TYR A CA  1 
ATOM   432  C C   . TYR A 1 79  ? -3.221  30.770 28.244 1.00 65.16  ? 574  TYR A C   1 
ATOM   433  O O   . TYR A 1 79  ? -2.252  30.877 28.994 1.00 66.20  ? 574  TYR A O   1 
ATOM   434  C CB  . TYR A 1 79  ? -3.808  28.518 27.224 1.00 64.33  ? 574  TYR A CB  1 
ATOM   435  C CG  . TYR A 1 79  ? -3.799  27.083 27.727 1.00 68.72  ? 574  TYR A CG  1 
ATOM   436  C CD1 . TYR A 1 79  ? -2.826  26.643 28.616 1.00 71.30  ? 574  TYR A CD1 1 
ATOM   437  C CD2 . TYR A 1 79  ? -4.813  26.192 27.377 1.00 70.49  ? 574  TYR A CD2 1 
ATOM   438  C CE1 . TYR A 1 79  ? -2.836  25.346 29.118 1.00 73.96  ? 574  TYR A CE1 1 
ATOM   439  C CE2 . TYR A 1 79  ? -4.846  24.896 27.893 1.00 72.93  ? 574  TYR A CE2 1 
ATOM   440  C CZ  . TYR A 1 79  ? -3.847  24.474 28.758 1.00 82.85  ? 574  TYR A CZ  1 
ATOM   441  O OH  . TYR A 1 79  ? -3.825  23.191 29.261 1.00 85.51  ? 574  TYR A OH  1 
ATOM   442  N N   . LEU A 1 80  ? -3.609  31.745 27.376 1.00 59.04  ? 575  LEU A N   1 
ATOM   443  C CA  . LEU A 1 80  ? -2.877  33.003 27.173 1.00 57.12  ? 575  LEU A CA  1 
ATOM   444  C C   . LEU A 1 80  ? -2.896  33.820 28.442 1.00 64.78  ? 575  LEU A C   1 
ATOM   445  O O   . LEU A 1 80  ? -1.912  34.485 28.758 1.00 65.31  ? 575  LEU A O   1 
ATOM   446  C CB  . LEU A 1 80  ? -3.421  33.786 25.957 1.00 55.43  ? 575  LEU A CB  1 
ATOM   447  C CG  . LEU A 1 80  ? -3.037  35.263 25.827 1.00 57.83  ? 575  LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 80  ? -1.574  35.435 25.432 1.00 56.80  ? 575  LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 80  ? -3.961  35.972 24.880 1.00 57.61  ? 575  LEU A CD2 1 
ATOM   450  N N   . ASN A 1 81  ? -4.009  33.737 29.181 1.00 63.60  ? 576  ASN A N   1 
ATOM   451  C CA  . ASN A 1 81  ? -4.195  34.386 30.469 1.00 64.85  ? 576  ASN A CA  1 
ATOM   452  C C   . ASN A 1 81  ? -3.315  33.679 31.533 1.00 69.57  ? 576  ASN A C   1 
ATOM   453  O O   . ASN A 1 81  ? -2.626  34.369 32.278 1.00 69.03  ? 576  ASN A O   1 
ATOM   454  C CB  . ASN A 1 81  ? -5.684  34.375 30.827 1.00 65.30  ? 576  ASN A CB  1 
ATOM   455  C CG  . ASN A 1 81  ? -6.055  34.774 32.230 1.00 96.73  ? 576  ASN A CG  1 
ATOM   456  O OD1 . ASN A 1 81  ? -5.329  35.489 32.932 1.00 92.18  ? 576  ASN A OD1 1 
ATOM   457  N ND2 . ASN A 1 81  ? -7.246  34.360 32.642 1.00 94.47  ? 576  ASN A ND2 1 
ATOM   458  N N   . LYS A 1 82  ? -3.321  32.315 31.579 1.00 66.89  ? 577  LYS A N   1 
ATOM   459  C CA  . LYS A 1 82  ? -2.543  31.493 32.529 1.00 67.94  ? 577  LYS A CA  1 
ATOM   460  C C   . LYS A 1 82  ? -1.036  31.671 32.385 1.00 73.57  ? 577  LYS A C   1 
ATOM   461  O O   . LYS A 1 82  ? -0.317  31.730 33.386 1.00 74.59  ? 577  LYS A O   1 
ATOM   462  C CB  . LYS A 1 82  ? -2.879  30.002 32.355 1.00 69.81  ? 577  LYS A CB  1 
ATOM   463  C CG  . LYS A 1 82  ? -2.160  29.053 33.330 1.00 83.85  ? 577  LYS A CG  1 
ATOM   464  N N   . LEU A 1 83  ? -0.564  31.708 31.131 1.00 69.23  ? 578  LEU A N   1 
ATOM   465  C CA  . LEU A 1 83  ? 0.847   31.787 30.782 1.00 68.39  ? 578  LEU A CA  1 
ATOM   466  C C   . LEU A 1 83  ? 1.453   33.185 30.868 1.00 74.97  ? 578  LEU A C   1 
ATOM   467  O O   . LEU A 1 83  ? 2.661   33.317 30.694 1.00 75.06  ? 578  LEU A O   1 
ATOM   468  C CB  . LEU A 1 83  ? 1.078   31.112 29.424 1.00 66.34  ? 578  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 83  ? 1.406   29.616 29.456 1.00 70.04  ? 578  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 83  ? 0.346   28.798 30.116 1.00 70.09  ? 578  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 83  ? 1.533   29.091 28.092 1.00 73.43  ? 578  LEU A CD2 1 
ATOM   472  N N   . GLN A 1 84  ? 0.631   34.212 31.185 1.00 73.75  ? 579  GLN A N   1 
ATOM   473  C CA  . GLN A 1 84  ? 1.061   35.604 31.366 1.00 75.35  ? 579  GLN A CA  1 
ATOM   474  C C   . GLN A 1 84  ? 2.116   35.621 32.445 1.00 82.98  ? 579  GLN A C   1 
ATOM   475  O O   . GLN A 1 84  ? 3.194   36.175 32.222 1.00 83.54  ? 579  GLN A O   1 
ATOM   476  C CB  . GLN A 1 84  ? -0.094  36.497 31.884 1.00 77.62  ? 579  GLN A CB  1 
ATOM   477  C CG  . GLN A 1 84  ? -1.212  36.817 30.916 1.00 83.65  ? 579  GLN A CG  1 
ATOM   478  C CD  . GLN A 1 84  ? -0.796  37.871 29.955 1.00 95.69  ? 579  GLN A CD  1 
ATOM   479  O OE1 . GLN A 1 84  ? -0.816  39.069 30.262 1.00 89.26  ? 579  GLN A OE1 1 
ATOM   480  N NE2 . GLN A 1 84  ? -0.382  37.431 28.780 1.00 87.08  ? 579  GLN A NE2 1 
ATOM   481  N N   . GLN A 1 85  ? 1.797   35.007 33.621 1.00 81.22  ? 580  GLN A N   1 
ATOM   482  C CA  . GLN A 1 85  ? 2.687   34.971 34.785 1.00 83.32  ? 580  GLN A CA  1 
ATOM   483  C C   . GLN A 1 85  ? 4.027   34.261 34.583 1.00 87.25  ? 580  GLN A C   1 
ATOM   484  O O   . GLN A 1 85  ? 5.012   34.647 35.209 1.00 89.64  ? 580  GLN A O   1 
ATOM   485  C CB  . GLN A 1 85  ? 1.972   34.543 36.085 1.00 86.30  ? 580  GLN A CB  1 
ATOM   486  C CG  . GLN A 1 85  ? 1.109   33.297 35.981 1.00 103.49 ? 580  GLN A CG  1 
ATOM   487  N N   . HIS A 1 86  ? 4.088   33.281 33.676 1.00 80.42  ? 581  HIS A N   1 
ATOM   488  C CA  . HIS A 1 86  ? 5.318   32.528 33.439 1.00 78.95  ? 581  HIS A CA  1 
ATOM   489  C C   . HIS A 1 86  ? 6.352   33.206 32.563 1.00 80.10  ? 581  HIS A C   1 
ATOM   490  O O   . HIS A 1 86  ? 7.512   33.263 32.953 1.00 81.42  ? 581  HIS A O   1 
ATOM   491  C CB  . HIS A 1 86  ? 5.017   31.100 32.972 1.00 78.41  ? 581  HIS A CB  1 
ATOM   492  C CG  . HIS A 1 86  ? 4.247   30.317 33.980 1.00 82.44  ? 581  HIS A CG  1 
ATOM   493  N ND1 . HIS A 1 86  ? 3.042   30.776 34.482 1.00 84.50  ? 581  HIS A ND1 1 
ATOM   494  C CD2 . HIS A 1 86  ? 4.553   29.147 34.578 1.00 85.08  ? 581  HIS A CD2 1 
ATOM   495  C CE1 . HIS A 1 86  ? 2.653   29.874 35.363 1.00 85.10  ? 581  HIS A CE1 1 
ATOM   496  N NE2 . HIS A 1 86  ? 3.528   28.874 35.453 1.00 85.93  ? 581  HIS A NE2 1 
ATOM   497  N N   . SER A 1 87  ? 5.977   33.687 31.383 1.00 72.97  ? 582  SER A N   1 
ATOM   498  C CA  . SER A 1 87  ? 6.998   34.298 30.554 1.00 71.60  ? 582  SER A CA  1 
ATOM   499  C C   . SER A 1 87  ? 6.648   35.677 30.074 1.00 75.39  ? 582  SER A C   1 
ATOM   500  O O   . SER A 1 87  ? 5.482   35.965 29.806 1.00 74.25  ? 582  SER A O   1 
ATOM   501  C CB  . SER A 1 87  ? 7.372   33.396 29.388 1.00 72.05  ? 582  SER A CB  1 
ATOM   502  O OG  . SER A 1 87  ? 8.468   33.964 28.693 1.00 78.51  ? 582  SER A OG  1 
ATOM   503  N N   . ASP A 1 88  ? 7.681   36.528 29.961 1.00 72.57  ? 583  ASP A N   1 
ATOM   504  C CA  . ASP A 1 88  ? 7.594   37.892 29.464 1.00 72.78  ? 583  ASP A CA  1 
ATOM   505  C C   . ASP A 1 88  ? 7.609   37.863 27.936 1.00 74.88  ? 583  ASP A C   1 
ATOM   506  O O   . ASP A 1 88  ? 7.260   38.864 27.309 1.00 74.66  ? 583  ASP A O   1 
ATOM   507  C CB  . ASP A 1 88  ? 8.742   38.755 30.022 1.00 77.35  ? 583  ASP A CB  1 
ATOM   508  C CG  . ASP A 1 88  ? 10.157  38.293 29.705 1.00 94.82  ? 583  ASP A CG  1 
ATOM   509  O OD1 . ASP A 1 88  ? 10.463  37.094 29.931 1.00 95.99  ? 583  ASP A OD1 1 
ATOM   510  O OD2 . ASP A 1 88  ? 10.985  39.145 29.314 1.00 102.99 ? 583  ASP A OD2 1 
ATOM   511  N N   . LYS A 1 89  ? 7.974   36.685 27.342 1.00 69.22  ? 584  LYS A N   1 
ATOM   512  C CA  . LYS A 1 89  ? 8.017   36.429 25.894 1.00 66.79  ? 584  LYS A CA  1 
ATOM   513  C C   . LYS A 1 89  ? 6.669   35.952 25.352 1.00 68.08  ? 584  LYS A C   1 
ATOM   514  O O   . LYS A 1 89  ? 6.589   35.482 24.223 1.00 68.53  ? 584  LYS A O   1 
ATOM   515  C CB  . LYS A 1 89  ? 9.153   35.452 25.528 1.00 68.19  ? 584  LYS A CB  1 
ATOM   516  C CG  . LYS A 1 89  ? 10.522  35.829 26.100 1.00 74.45  ? 584  LYS A CG  1 
ATOM   517  C CD  . LYS A 1 89  ? 11.050  37.209 25.669 1.00 74.18  ? 584  LYS A CD  1 
ATOM   518  C CE  . LYS A 1 89  ? 12.450  37.467 26.151 1.00 74.91  ? 584  LYS A CE  1 
ATOM   519  N NZ  . LYS A 1 89  ? 12.513  37.632 27.617 1.00 91.01  ? 584  LYS A NZ  1 
ATOM   520  N N   . ILE A 1 90  ? 5.612   36.097 26.154 1.00 62.50  ? 585  ILE A N   1 
ATOM   521  C CA  . ILE A 1 90  ? 4.231   35.774 25.810 1.00 60.48  ? 585  ILE A CA  1 
ATOM   522  C C   . ILE A 1 90  ? 3.416   37.091 25.885 1.00 65.54  ? 585  ILE A C   1 
ATOM   523  O O   . ILE A 1 90  ? 3.481   37.775 26.903 1.00 66.24  ? 585  ILE A O   1 
ATOM   524  C CB  . ILE A 1 90  ? 3.752   34.592 26.700 1.00 62.18  ? 585  ILE A CB  1 
ATOM   525  C CG1 . ILE A 1 90  ? 4.217   33.273 26.045 1.00 61.18  ? 585  ILE A CG1 1 
ATOM   526  C CG2 . ILE A 1 90  ? 2.240   34.603 26.932 1.00 62.69  ? 585  ILE A CG2 1 
ATOM   527  C CD1 . ILE A 1 90  ? 4.186   32.074 26.829 1.00 65.47  ? 585  ILE A CD1 1 
ATOM   528  N N   . ILE A 1 91  ? 2.770   37.501 24.772 1.00 62.04  ? 586  ILE A N   1 
ATOM   529  C CA  . ILE A 1 91  ? 2.020   38.767 24.664 1.00 63.16  ? 586  ILE A CA  1 
ATOM   530  C C   . ILE A 1 91  ? 1.151   39.071 25.896 1.00 67.23  ? 586  ILE A C   1 
ATOM   531  O O   . ILE A 1 91  ? 0.366   38.215 26.291 1.00 66.97  ? 586  ILE A O   1 
ATOM   532  C CB  . ILE A 1 91  ? 1.237   38.909 23.306 1.00 66.47  ? 586  ILE A CB  1 
ATOM   533  C CG1 . ILE A 1 91  ? 0.487   40.262 23.220 1.00 68.81  ? 586  ILE A CG1 1 
ATOM   534  C CG2 . ILE A 1 91  ? 0.274   37.732 23.056 1.00 65.76  ? 586  ILE A CG2 1 
ATOM   535  C CD1 . ILE A 1 91  ? -0.050  40.642 21.883 1.00 80.08  ? 586  ILE A CD1 1 
ATOM   536  N N   . ARG A 1 92  ? 1.322   40.271 26.510 1.00 63.98  ? 587  ARG A N   1 
ATOM   537  C CA  . ARG A 1 92  ? 0.542   40.722 27.676 1.00 63.77  ? 587  ARG A CA  1 
ATOM   538  C C   . ARG A 1 92  ? -0.901  40.861 27.260 1.00 65.08  ? 587  ARG A C   1 
ATOM   539  O O   . ARG A 1 92  ? -1.192  41.451 26.217 1.00 63.06  ? 587  ARG A O   1 
ATOM   540  C CB  . ARG A 1 92  ? 1.008   42.098 28.239 1.00 65.14  ? 587  ARG A CB  1 
ATOM   541  C CG  . ARG A 1 92  ? 2.472   42.250 28.648 1.00 76.08  ? 587  ARG A CG  1 
ATOM   542  C CD  . ARG A 1 92  ? 2.913   41.326 29.766 1.00 87.30  ? 587  ARG A CD  1 
ATOM   543  N NE  . ARG A 1 92  ? 3.478   40.080 29.250 1.00 88.94  ? 587  ARG A NE  1 
ATOM   544  C CZ  . ARG A 1 92  ? 3.506   38.935 29.926 1.00 99.63  ? 587  ARG A CZ  1 
ATOM   545  N NH1 . ARG A 1 92  ? 2.996   38.869 31.151 1.00 92.57  ? 587  ARG A NH1 1 
ATOM   546  N NH2 . ARG A 1 92  ? 4.037   37.852 29.385 1.00 76.25  ? 587  ARG A NH2 1 
ATOM   547  N N   . LEU A 1 93  ? -1.787  40.259 28.053 1.00 61.52  ? 588  LEU A N   1 
ATOM   548  C CA  . LEU A 1 93  ? -3.232  40.299 27.898 1.00 60.34  ? 588  LEU A CA  1 
ATOM   549  C C   . LEU A 1 93  ? -3.704  40.997 29.165 1.00 69.22  ? 588  LEU A C   1 
ATOM   550  O O   . LEU A 1 93  ? -3.660  40.401 30.248 1.00 69.40  ? 588  LEU A O   1 
ATOM   551  C CB  . LEU A 1 93  ? -3.817  38.893 27.749 1.00 58.06  ? 588  LEU A CB  1 
ATOM   552  C CG  . LEU A 1 93  ? -5.328  38.745 27.852 1.00 62.99  ? 588  LEU A CG  1 
ATOM   553  C CD1 . LEU A 1 93  ? -6.040  39.387 26.683 1.00 63.38  ? 588  LEU A CD1 1 
ATOM   554  C CD2 . LEU A 1 93  ? -5.726  37.280 27.982 1.00 65.24  ? 588  LEU A CD2 1 
ATOM   555  N N   . TYR A 1 94  ? -4.052  42.307 29.031 1.00 67.54  ? 589  TYR A N   1 
ATOM   556  C CA  . TYR A 1 94  ? -4.489  43.178 30.119 1.00 68.73  ? 589  TYR A CA  1 
ATOM   557  C C   . TYR A 1 94  ? -5.912  42.968 30.584 1.00 75.53  ? 589  TYR A C   1 
ATOM   558  O O   . TYR A 1 94  ? -6.144  43.037 31.796 1.00 78.39  ? 589  TYR A O   1 
ATOM   559  C CB  . TYR A 1 94  ? -4.250  44.653 29.785 1.00 70.20  ? 589  TYR A CB  1 
ATOM   560  C CG  . TYR A 1 94  ? -2.793  44.937 29.534 1.00 70.94  ? 589  TYR A CG  1 
ATOM   561  C CD1 . TYR A 1 94  ? -1.884  44.989 30.586 1.00 73.20  ? 589  TYR A CD1 1 
ATOM   562  C CD2 . TYR A 1 94  ? -2.304  45.072 28.241 1.00 71.19  ? 589  TYR A CD2 1 
ATOM   563  C CE1 . TYR A 1 94  ? -0.524  45.173 30.358 1.00 72.94  ? 589  TYR A CE1 1 
ATOM   564  C CE2 . TYR A 1 94  ? -0.950  45.282 28.001 1.00 72.78  ? 589  TYR A CE2 1 
ATOM   565  C CZ  . TYR A 1 94  ? -0.061  45.320 29.063 1.00 80.53  ? 589  TYR A CZ  1 
ATOM   566  O OH  . TYR A 1 94  ? 1.281   45.476 28.828 1.00 84.05  ? 589  TYR A OH  1 
ATOM   567  N N   . ASP A 1 95  ? -6.875  42.762 29.651 1.00 70.02  ? 590  ASP A N   1 
ATOM   568  C CA  . ASP A 1 95  ? -8.294  42.611 30.006 1.00 69.72  ? 590  ASP A CA  1 
ATOM   569  C C   . ASP A 1 95  ? -9.084  42.071 28.829 1.00 70.98  ? 590  ASP A C   1 
ATOM   570  O O   . ASP A 1 95  ? -8.611  42.128 27.697 1.00 70.43  ? 590  ASP A O   1 
ATOM   571  C CB  . ASP A 1 95  ? -8.875  43.982 30.434 1.00 73.69  ? 590  ASP A CB  1 
ATOM   572  C CG  . ASP A 1 95  ? -10.142 43.981 31.278 1.00 87.19  ? 590  ASP A CG  1 
ATOM   573  O OD1 . ASP A 1 95  ? -10.616 42.873 31.656 1.00 88.37  ? 590  ASP A OD1 1 
ATOM   574  O OD2 . ASP A 1 95  ? -10.656 45.086 31.570 1.00 92.73  ? 590  ASP A OD2 1 
ATOM   575  N N   . TYR A 1 96  ? -10.292 41.554 29.093 1.00 66.62  ? 591  TYR A N   1 
ATOM   576  C CA  . TYR A 1 96  ? -11.182 41.036 28.066 1.00 65.74  ? 591  TYR A CA  1 
ATOM   577  C C   . TYR A 1 96  ? -12.666 41.109 28.405 1.00 71.71  ? 591  TYR A C   1 
ATOM   578  O O   . TYR A 1 96  ? -13.048 40.996 29.568 1.00 72.60  ? 591  TYR A O   1 
ATOM   579  C CB  . TYR A 1 96  ? -10.770 39.629 27.585 1.00 65.74  ? 591  TYR A CB  1 
ATOM   580  C CG  . TYR A 1 96  ? -10.782 38.524 28.618 1.00 67.72  ? 591  TYR A CG  1 
ATOM   581  C CD1 . TYR A 1 96  ? -11.974 37.922 29.011 1.00 69.93  ? 591  TYR A CD1 1 
ATOM   582  C CD2 . TYR A 1 96  ? -9.594  37.970 29.083 1.00 68.54  ? 591  TYR A CD2 1 
ATOM   583  C CE1 . TYR A 1 96  ? -11.989 36.866 29.920 1.00 71.95  ? 591  TYR A CE1 1 
ATOM   584  C CE2 . TYR A 1 96  ? -9.594  36.900 29.979 1.00 70.15  ? 591  TYR A CE2 1 
ATOM   585  C CZ  . TYR A 1 96  ? -10.795 36.353 30.402 1.00 81.13  ? 591  TYR A CZ  1 
ATOM   586  O OH  . TYR A 1 96  ? -10.796 35.293 31.288 1.00 85.72  ? 591  TYR A OH  1 
ATOM   587  N N   . GLU A 1 97  ? -13.498 41.298 27.379 1.00 69.57  ? 592  GLU A N   1 
ATOM   588  C CA  . GLU A 1 97  ? -14.964 41.314 27.490 1.00 70.73  ? 592  GLU A CA  1 
ATOM   589  C C   . GLU A 1 97  ? -15.468 40.191 26.595 1.00 74.57  ? 592  GLU A C   1 
ATOM   590  O O   . GLU A 1 97  ? -15.114 40.115 25.411 1.00 74.68  ? 592  GLU A O   1 
ATOM   591  C CB  . GLU A 1 97  ? -15.553 42.674 27.063 1.00 72.95  ? 592  GLU A CB  1 
ATOM   592  C CG  . GLU A 1 97  ? -17.026 42.894 27.367 1.00 76.13  ? 592  GLU A CG  1 
ATOM   593  C CD  . GLU A 1 97  ? -17.486 44.286 26.972 1.00 106.19 ? 592  GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 97  ? -17.168 45.258 27.693 1.00 110.70 ? 592  GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 97  ? -18.129 44.413 25.908 1.00 107.73 ? 592  GLU A OE2 1 
ATOM   596  N N   . ILE A 1 98  ? -16.218 39.277 27.177 1.00 70.44  ? 593  ILE A N   1 
ATOM   597  C CA  . ILE A 1 98  ? -16.733 38.154 26.418 1.00 70.11  ? 593  ILE A CA  1 
ATOM   598  C C   . ILE A 1 98  ? -18.226 37.970 26.634 1.00 76.04  ? 593  ILE A C   1 
ATOM   599  O O   . ILE A 1 98  ? -18.705 37.879 27.773 1.00 77.12  ? 593  ILE A O   1 
ATOM   600  C CB  . ILE A 1 98  ? -15.870 36.859 26.495 1.00 72.11  ? 593  ILE A CB  1 
ATOM   601  C CG1 . ILE A 1 98  ? -16.493 35.722 25.676 1.00 73.10  ? 593  ILE A CG1 1 
ATOM   602  C CG2 . ILE A 1 98  ? -15.591 36.425 27.925 1.00 72.41  ? 593  ILE A CG2 1 
ATOM   603  C CD1 . ILE A 1 98  ? -15.577 34.572 25.440 1.00 83.80  ? 593  ILE A CD1 1 
ATOM   604  N N   . THR A 1 99  ? -18.958 38.034 25.522 1.00 72.07  ? 594  THR A N   1 
ATOM   605  C CA  . THR A 1 99  ? -20.399 37.863 25.471 1.00 72.64  ? 594  THR A CA  1 
ATOM   606  C C   . THR A 1 99  ? -20.661 36.731 24.480 1.00 77.67  ? 594  THR A C   1 
ATOM   607  O O   . THR A 1 99  ? -19.704 36.194 23.898 1.00 76.59  ? 594  THR A O   1 
ATOM   608  C CB  . THR A 1 99  ? -21.098 39.161 25.036 1.00 73.62  ? 594  THR A CB  1 
ATOM   609  O OG1 . THR A 1 99  ? -20.671 39.471 23.727 1.00 74.25  ? 594  THR A OG1 1 
ATOM   610  C CG2 . THR A 1 99  ? -20.836 40.332 25.964 1.00 68.17  ? 594  THR A CG2 1 
ATOM   611  N N   . ASP A 1 100 ? -21.954 36.368 24.303 1.00 75.35  ? 595  ASP A N   1 
ATOM   612  C CA  . ASP A 1 100 ? -22.428 35.346 23.377 1.00 75.92  ? 595  ASP A CA  1 
ATOM   613  C C   . ASP A 1 100 ? -22.228 35.819 21.922 1.00 79.50  ? 595  ASP A C   1 
ATOM   614  O O   . ASP A 1 100 ? -22.119 34.992 21.012 1.00 80.76  ? 595  ASP A O   1 
ATOM   615  C CB  . ASP A 1 100 ? -23.921 35.102 23.618 1.00 79.98  ? 595  ASP A CB  1 
ATOM   616  C CG  . ASP A 1 100 ? -24.247 34.392 24.915 1.00 96.97  ? 595  ASP A CG  1 
ATOM   617  O OD1 . ASP A 1 100 ? -24.308 33.155 24.907 1.00 99.23  ? 595  ASP A OD1 1 
ATOM   618  O OD2 . ASP A 1 100 ? -24.513 35.082 25.923 1.00 106.01 ? 595  ASP A OD2 1 
ATOM   619  N N   . GLN A 1 101 ? -22.147 37.147 21.723 1.00 73.65  ? 596  GLN A N   1 
ATOM   620  C CA  . GLN A 1 101 ? -22.055 37.821 20.427 1.00 73.21  ? 596  GLN A CA  1 
ATOM   621  C C   . GLN A 1 101 ? -20.630 38.216 19.962 1.00 76.04  ? 596  GLN A C   1 
ATOM   622  O O   . GLN A 1 101 ? -20.405 38.355 18.748 1.00 76.59  ? 596  GLN A O   1 
ATOM   623  C CB  . GLN A 1 101 ? -22.991 39.052 20.396 1.00 75.34  ? 596  GLN A CB  1 
ATOM   624  C CG  . GLN A 1 101 ? -24.290 38.951 21.237 1.00 95.80  ? 596  GLN A CG  1 
ATOM   625  C CD  . GLN A 1 101 ? -24.164 39.456 22.676 1.00 120.31 ? 596  GLN A CD  1 
ATOM   626  O OE1 . GLN A 1 101 ? -23.495 40.466 22.976 1.00 114.37 ? 596  GLN A OE1 1 
ATOM   627  N NE2 . GLN A 1 101 ? -24.836 38.774 23.603 1.00 113.78 ? 596  GLN A NE2 1 
ATOM   628  N N   . TYR A 1 102 ? -19.677 38.415 20.909 1.00 70.00  ? 597  TYR A N   1 
ATOM   629  C CA  . TYR A 1 102 ? -18.311 38.858 20.582 1.00 67.83  ? 597  TYR A CA  1 
ATOM   630  C C   . TYR A 1 102 ? -17.252 38.620 21.679 1.00 71.14  ? 597  TYR A C   1 
ATOM   631  O O   . TYR A 1 102 ? -17.586 38.291 22.822 1.00 72.02  ? 597  TYR A O   1 
ATOM   632  C CB  . TYR A 1 102 ? -18.334 40.357 20.254 1.00 68.79  ? 597  TYR A CB  1 
ATOM   633  C CG  . TYR A 1 102 ? -18.812 41.218 21.405 1.00 70.18  ? 597  TYR A CG  1 
ATOM   634  C CD1 . TYR A 1 102 ? -17.936 41.632 22.404 1.00 71.24  ? 597  TYR A CD1 1 
ATOM   635  C CD2 . TYR A 1 102 ? -20.136 41.645 21.478 1.00 72.04  ? 597  TYR A CD2 1 
ATOM   636  C CE1 . TYR A 1 102 ? -18.375 42.409 23.472 1.00 71.84  ? 597  TYR A CE1 1 
ATOM   637  C CE2 . TYR A 1 102 ? -20.585 42.426 22.542 1.00 73.21  ? 597  TYR A CE2 1 
ATOM   638  C CZ  . TYR A 1 102 ? -19.697 42.812 23.531 1.00 78.37  ? 597  TYR A CZ  1 
ATOM   639  O OH  . TYR A 1 102 ? -20.131 43.590 24.572 1.00 82.42  ? 597  TYR A OH  1 
ATOM   640  N N   . ILE A 1 103 ? -15.974 38.857 21.325 1.00 65.44  ? 598  ILE A N   1 
ATOM   641  C CA  . ILE A 1 103 ? -14.822 38.808 22.219 1.00 63.82  ? 598  ILE A CA  1 
ATOM   642  C C   . ILE A 1 103 ? -14.058 40.095 21.976 1.00 73.26  ? 598  ILE A C   1 
ATOM   643  O O   . ILE A 1 103 ? -13.862 40.487 20.820 1.00 74.35  ? 598  ILE A O   1 
ATOM   644  C CB  . ILE A 1 103 ? -13.895 37.581 21.973 1.00 64.48  ? 598  ILE A CB  1 
ATOM   645  C CG1 . ILE A 1 103 ? -14.614 36.235 22.238 1.00 63.93  ? 598  ILE A CG1 1 
ATOM   646  C CG2 . ILE A 1 103 ? -12.581 37.686 22.773 1.00 63.30  ? 598  ILE A CG2 1 
ATOM   647  C CD1 . ILE A 1 103 ? -13.863 34.933 21.782 1.00 56.21  ? 598  ILE A CD1 1 
ATOM   648  N N   . TYR A 1 104 ? -13.639 40.759 23.064 1.00 71.91  ? 599  TYR A N   1 
ATOM   649  C CA  . TYR A 1 104 ? -12.756 41.923 23.042 1.00 71.99  ? 599  TYR A CA  1 
ATOM   650  C C   . TYR A 1 104 ? -11.583 41.552 23.919 1.00 72.22  ? 599  TYR A C   1 
ATOM   651  O O   . TYR A 1 104 ? -11.795 41.031 25.009 1.00 71.82  ? 599  TYR A O   1 
ATOM   652  C CB  . TYR A 1 104 ? -13.428 43.180 23.589 1.00 75.77  ? 599  TYR A CB  1 
ATOM   653  C CG  . TYR A 1 104 ? -14.413 43.850 22.653 1.00 81.19  ? 599  TYR A CG  1 
ATOM   654  C CD1 . TYR A 1 104 ? -14.246 43.790 21.270 1.00 83.37  ? 599  TYR A CD1 1 
ATOM   655  C CD2 . TYR A 1 104 ? -15.482 44.593 23.149 1.00 83.76  ? 599  TYR A CD2 1 
ATOM   656  C CE1 . TYR A 1 104 ? -15.149 44.409 20.408 1.00 85.53  ? 599  TYR A CE1 1 
ATOM   657  C CE2 . TYR A 1 104 ? -16.395 45.209 22.296 1.00 85.91  ? 599  TYR A CE2 1 
ATOM   658  C CZ  . TYR A 1 104 ? -16.227 45.113 20.925 1.00 94.23  ? 599  TYR A CZ  1 
ATOM   659  O OH  . TYR A 1 104 ? -17.123 45.736 20.088 1.00 98.39  ? 599  TYR A OH  1 
ATOM   660  N N   . MET A 1 105 ? -10.360 41.747 23.427 1.00 66.24  ? 600  MET A N   1 
ATOM   661  C CA  . MET A 1 105 ? -9.135  41.450 24.162 1.00 64.83  ? 600  MET A CA  1 
ATOM   662  C C   . MET A 1 105 ? -8.260  42.671 24.131 1.00 68.99  ? 600  MET A C   1 
ATOM   663  O O   . MET A 1 105 ? -8.010  43.220 23.056 1.00 69.27  ? 600  MET A O   1 
ATOM   664  C CB  . MET A 1 105 ? -8.400  40.249 23.551 1.00 66.30  ? 600  MET A CB  1 
ATOM   665  C CG  . MET A 1 105 ? -9.128  38.940 23.773 1.00 70.21  ? 600  MET A CG  1 
ATOM   666  S SD  . MET A 1 105 ? -8.625  37.606 22.669 1.00 74.25  ? 600  MET A SD  1 
ATOM   667  C CE  . MET A 1 105 ? -7.420  36.778 23.708 1.00 70.50  ? 600  MET A CE  1 
ATOM   668  N N   . VAL A 1 106 ? -7.844  43.135 25.315 1.00 65.26  ? 601  VAL A N   1 
ATOM   669  C CA  . VAL A 1 106 ? -6.968  44.296 25.489 1.00 65.11  ? 601  VAL A CA  1 
ATOM   670  C C   . VAL A 1 106 ? -5.566  43.753 25.721 1.00 68.20  ? 601  VAL A C   1 
ATOM   671  O O   . VAL A 1 106 ? -5.241  43.291 26.814 1.00 67.88  ? 601  VAL A O   1 
ATOM   672  C CB  . VAL A 1 106 ? -7.450  45.214 26.632 1.00 69.24  ? 601  VAL A CB  1 
ATOM   673  C CG1 . VAL A 1 106 ? -6.526  46.413 26.798 1.00 70.58  ? 601  VAL A CG1 1 
ATOM   674  C CG2 . VAL A 1 106 ? -8.873  45.670 26.383 1.00 69.32  ? 601  VAL A CG2 1 
ATOM   675  N N   . MET A 1 107 ? -4.765  43.748 24.674 1.00 64.88  ? 602  MET A N   1 
ATOM   676  C CA  . MET A 1 107 ? -3.404  43.223 24.746 1.00 64.90  ? 602  MET A CA  1 
ATOM   677  C C   . MET A 1 107 ? -2.366  44.317 24.554 1.00 68.29  ? 602  MET A C   1 
ATOM   678  O O   . MET A 1 107 ? -2.710  45.449 24.230 1.00 68.78  ? 602  MET A O   1 
ATOM   679  C CB  . MET A 1 107 ? -3.186  42.109 23.701 1.00 66.17  ? 602  MET A CB  1 
ATOM   680  C CG  . MET A 1 107 ? -4.145  40.963 23.830 1.00 69.37  ? 602  MET A CG  1 
ATOM   681  S SD  . MET A 1 107 ? -4.139  39.928 22.357 1.00 73.42  ? 602  MET A SD  1 
ATOM   682  C CE  . MET A 1 107 ? -4.785  41.074 21.152 1.00 70.93  ? 602  MET A CE  1 
ATOM   683  N N   . GLU A 1 108 ? -1.094  43.971 24.731 1.00 63.77  ? 603  GLU A N   1 
ATOM   684  C CA  . GLU A 1 108 ? -0.031  44.916 24.504 1.00 64.68  ? 603  GLU A CA  1 
ATOM   685  C C   . GLU A 1 108 ? 0.165   45.094 23.006 1.00 70.78  ? 603  GLU A C   1 
ATOM   686  O O   . GLU A 1 108 ? -0.059  44.165 22.210 1.00 67.46  ? 603  GLU A O   1 
ATOM   687  C CB  . GLU A 1 108 ? 1.260   44.507 25.231 1.00 66.02  ? 603  GLU A CB  1 
ATOM   688  C CG  . GLU A 1 108 ? 2.047   43.349 24.638 1.00 71.49  ? 603  GLU A CG  1 
ATOM   689  C CD  . GLU A 1 108 ? 3.336   43.033 25.369 1.00 90.73  ? 603  GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 108 ? 4.108   43.973 25.668 1.00 89.45  ? 603  GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 108 ? 3.555   41.841 25.678 1.00 93.34  ? 603  GLU A OE2 1 
ATOM   692  N N   . CYS A 1 109 ? 0.527   46.321 22.620 1.00 72.77  ? 604  CYS A N   1 
ATOM   693  C CA  . CYS A 1 109 ? 0.755   46.631 21.225 1.00 73.65  ? 604  CYS A CA  1 
ATOM   694  C C   . CYS A 1 109 ? 2.231   46.504 20.879 1.00 77.37  ? 604  CYS A C   1 
ATOM   695  O O   . CYS A 1 109 ? 3.101   47.059 21.557 1.00 77.51  ? 604  CYS A O   1 
ATOM   696  C CB  . CYS A 1 109 ? 0.195   47.998 20.857 1.00 76.37  ? 604  CYS A CB  1 
ATOM   697  S SG  . CYS A 1 109 ? -0.015  48.224 19.079 1.00 81.27  ? 604  CYS A SG  1 
ATOM   698  N N   . GLY A 1 110 ? 2.498   45.689 19.879 1.00 73.13  ? 605  GLY A N   1 
ATOM   699  C CA  . GLY A 1 110 ? 3.853   45.480 19.408 1.00 73.47  ? 605  GLY A CA  1 
ATOM   700  C C   . GLY A 1 110 ? 4.107   46.399 18.242 1.00 80.27  ? 605  GLY A C   1 
ATOM   701  O O   . GLY A 1 110 ? 3.174   47.031 17.732 1.00 81.63  ? 605  GLY A O   1 
ATOM   702  N N   . ASN A 1 111 ? 5.370   46.489 17.825 1.00 77.26  ? 606  ASN A N   1 
ATOM   703  C CA  . ASN A 1 111 ? 5.774   47.316 16.696 1.00 78.60  ? 606  ASN A CA  1 
ATOM   704  C C   . ASN A 1 111 ? 5.355   46.642 15.384 1.00 83.71  ? 606  ASN A C   1 
ATOM   705  O O   . ASN A 1 111 ? 4.615   47.235 14.599 1.00 84.88  ? 606  ASN A O   1 
ATOM   706  C CB  . ASN A 1 111 ? 7.278   47.566 16.722 1.00 76.11  ? 606  ASN A CB  1 
ATOM   707  C CG  . ASN A 1 111 ? 7.783   48.040 18.054 1.00 106.37 ? 606  ASN A CG  1 
ATOM   708  O OD1 . ASN A 1 111 ? 8.150   47.247 18.925 1.00 98.45  ? 606  ASN A OD1 1 
ATOM   709  N ND2 . ASN A 1 111 ? 7.790   49.347 18.249 1.00 109.08 ? 606  ASN A ND2 1 
ATOM   710  N N   . ILE A 1 112 ? 5.777   45.384 15.173 1.00 79.45  ? 607  ILE A N   1 
ATOM   711  C CA  . ILE A 1 112 ? 5.519   44.642 13.941 1.00 79.00  ? 607  ILE A CA  1 
ATOM   712  C C   . ILE A 1 112 ? 5.663   43.133 14.176 1.00 81.53  ? 607  ILE A C   1 
ATOM   713  O O   . ILE A 1 112 ? 6.387   42.721 15.093 1.00 80.86  ? 607  ILE A O   1 
ATOM   714  C CB  . ILE A 1 112 ? 6.543   45.165 12.878 1.00 83.95  ? 607  ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 112 ? 6.304   44.582 11.469 1.00 84.89  ? 607  ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 112 ? 8.009   45.041 13.362 1.00 84.12  ? 607  ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 112 ? 7.160   45.182 10.366 1.00 95.86  ? 607  ILE A CD1 1 
ATOM   718  N N   . ASP A 1 113 ? 5.007   42.309 13.328 1.00 77.04  ? 608  ASP A N   1 
ATOM   719  C CA  . ASP A 1 113 ? 5.165   40.855 13.393 1.00 75.14  ? 608  ASP A CA  1 
ATOM   720  C C   . ASP A 1 113 ? 6.516   40.526 12.787 1.00 78.44  ? 608  ASP A C   1 
ATOM   721  O O   . ASP A 1 113 ? 7.026   41.303 11.978 1.00 78.41  ? 608  ASP A O   1 
ATOM   722  C CB  . ASP A 1 113 ? 4.051   40.114 12.644 1.00 76.81  ? 608  ASP A CB  1 
ATOM   723  C CG  . ASP A 1 113 ? 3.977   40.473 11.182 1.00 95.00  ? 608  ASP A CG  1 
ATOM   724  O OD1 . ASP A 1 113 ? 3.567   41.609 10.872 1.00 100.81 ? 608  ASP A OD1 1 
ATOM   725  O OD2 . ASP A 1 113 ? 4.348   39.632 10.348 1.00 99.25  ? 608  ASP A OD2 1 
ATOM   726  N N   . LEU A 1 114 ? 7.107   39.396 13.195 1.00 74.83  ? 609  LEU A N   1 
ATOM   727  C CA  . LEU A 1 114 ? 8.420   38.959 12.710 1.00 75.57  ? 609  LEU A CA  1 
ATOM   728  C C   . LEU A 1 114 ? 8.435   38.791 11.189 1.00 80.76  ? 609  LEU A C   1 
ATOM   729  O O   . LEU A 1 114 ? 9.385   39.246 10.554 1.00 81.27  ? 609  LEU A O   1 
ATOM   730  C CB  . LEU A 1 114 ? 8.862   37.671 13.436 1.00 74.05  ? 609  LEU A CB  1 
ATOM   731  C CG  . LEU A 1 114 ? 10.264  37.108 13.166 1.00 78.53  ? 609  LEU A CG  1 
ATOM   732  C CD1 . LEU A 1 114 ? 11.329  37.965 13.802 1.00 79.52  ? 609  LEU A CD1 1 
ATOM   733  C CD2 . LEU A 1 114 ? 10.388  35.696 13.719 1.00 79.62  ? 609  LEU A CD2 1 
ATOM   734  N N   . ASN A 1 115 ? 7.344   38.219 10.617 1.00 77.75  ? 610  ASN A N   1 
ATOM   735  C CA  . ASN A 1 115 ? 7.168   37.975 9.181  1.00 79.38  ? 610  ASN A CA  1 
ATOM   736  C C   . ASN A 1 115 ? 7.327   39.216 8.330  1.00 87.66  ? 610  ASN A C   1 
ATOM   737  O O   . ASN A 1 115 ? 8.153   39.201 7.423  1.00 89.96  ? 610  ASN A O   1 
ATOM   738  C CB  . ASN A 1 115 ? 5.843   37.280 8.874  1.00 77.31  ? 610  ASN A CB  1 
ATOM   739  C CG  . ASN A 1 115 ? 5.947   36.272 7.765  1.00 94.59  ? 610  ASN A CG  1 
ATOM   740  O OD1 . ASN A 1 115 ? 6.709   36.445 6.802  1.00 79.01  ? 610  ASN A OD1 1 
ATOM   741  N ND2 . ASN A 1 115 ? 5.209   35.165 7.904  1.00 91.19  ? 610  ASN A ND2 1 
ATOM   742  N N   . SER A 1 116 ? 6.575   40.295 8.635  1.00 84.73  ? 611  SER A N   1 
ATOM   743  C CA  . SER A 1 116 ? 6.650   41.562 7.906  1.00 86.78  ? 611  SER A CA  1 
ATOM   744  C C   . SER A 1 116 ? 8.004   42.228 8.087  1.00 94.81  ? 611  SER A C   1 
ATOM   745  O O   . SER A 1 116 ? 8.521   42.800 7.130  1.00 97.45  ? 611  SER A O   1 
ATOM   746  C CB  . SER A 1 116 ? 5.534   42.500 8.337  1.00 88.81  ? 611  SER A CB  1 
ATOM   747  O OG  . SER A 1 116 ? 4.274   41.886 8.130  1.00 95.63  ? 611  SER A OG  1 
ATOM   748  N N   . TRP A 1 117 ? 8.594   42.123 9.293  1.00 91.80  ? 612  TRP A N   1 
ATOM   749  C CA  . TRP A 1 117 ? 9.909   42.671 9.615  1.00 93.46  ? 612  TRP A CA  1 
ATOM   750  C C   . TRP A 1 117 ? 11.000  41.939 8.834  1.00 97.48  ? 612  TRP A C   1 
ATOM   751  O O   . TRP A 1 117 ? 11.902  42.592 8.309  1.00 99.02  ? 612  TRP A O   1 
ATOM   752  C CB  . TRP A 1 117 ? 10.154  42.605 11.128 1.00 91.67  ? 612  TRP A CB  1 
ATOM   753  C CG  . TRP A 1 117 ? 11.557  42.910 11.565 1.00 94.39  ? 612  TRP A CG  1 
ATOM   754  C CD1 . TRP A 1 117 ? 12.451  42.038 12.113 1.00 96.65  ? 612  TRP A CD1 1 
ATOM   755  C CD2 . TRP A 1 117 ? 12.222  44.180 11.502 1.00 97.08  ? 612  TRP A CD2 1 
ATOM   756  N NE1 . TRP A 1 117 ? 13.631  42.689 12.409 1.00 97.89  ? 612  TRP A NE1 1 
ATOM   757  C CE2 . TRP A 1 117 ? 13.515  44.005 12.047 1.00 101.35 ? 612  TRP A CE2 1 
ATOM   758  C CE3 . TRP A 1 117 ? 11.855  45.453 11.028 1.00 101.05 ? 612  TRP A CE3 1 
ATOM   759  C CZ2 . TRP A 1 117 ? 14.436  45.055 12.142 1.00 103.32 ? 612  TRP A CZ2 1 
ATOM   760  C CZ3 . TRP A 1 117 ? 12.776  46.490 11.100 1.00 105.19 ? 612  TRP A CZ3 1 
ATOM   761  C CH2 . TRP A 1 117 ? 14.048  46.289 11.653 1.00 106.05 ? 612  TRP A CH2 1 
ATOM   762  N N   . LEU A 1 118 ? 10.914  40.594 8.741  1.00 92.52  ? 613  LEU A N   1 
ATOM   763  C CA  . LEU A 1 118 ? 11.885  39.785 7.997  1.00 92.85  ? 613  LEU A CA  1 
ATOM   764  C C   . LEU A 1 118 ? 11.706  40.010 6.490  1.00 99.30  ? 613  LEU A C   1 
ATOM   765  O O   . LEU A 1 118 ? 12.697  40.203 5.787  1.00 100.63 ? 613  LEU A O   1 
ATOM   766  C CB  . LEU A 1 118 ? 11.797  38.291 8.363  1.00 90.73  ? 613  LEU A CB  1 
ATOM   767  N N   . LYS A 1 119 ? 10.442  40.059 6.013  1.00 96.44  ? 614  LYS A N   1 
ATOM   768  C CA  . LYS A 1 119 ? 10.089  40.307 4.609  1.00 98.62  ? 614  LYS A CA  1 
ATOM   769  C C   . LYS A 1 119 ? 10.634  41.659 4.105  1.00 106.46 ? 614  LYS A C   1 
ATOM   770  O O   . LYS A 1 119 ? 11.031  41.742 2.944  1.00 108.60 ? 614  LYS A O   1 
ATOM   771  C CB  . LYS A 1 119 ? 8.567   40.205 4.383  1.00 100.11 ? 614  LYS A CB  1 
ATOM   772  N N   . LYS A 1 120 ? 10.684  42.700 4.974  1.00 103.47 ? 615  LYS A N   1 
ATOM   773  C CA  . LYS A 1 120 ? 11.217  44.012 4.590  1.00 106.02 ? 615  LYS A CA  1 
ATOM   774  C C   . LYS A 1 120 ? 12.758  44.103 4.590  1.00 113.85 ? 615  LYS A C   1 
ATOM   775  O O   . LYS A 1 120 ? 13.338  44.321 3.523  1.00 116.59 ? 615  LYS A O   1 
ATOM   776  C CB  . LYS A 1 120 ? 10.502  45.204 5.280  1.00 107.49 ? 615  LYS A CB  1 
ATOM   777  C CG  . LYS A 1 120 ? 10.738  45.389 6.778  1.00 111.20 ? 615  LYS A CG  1 
ATOM   778  N N   . LYS A 1 121 ? 13.423  43.871 5.744  1.00 110.16 ? 616  LYS A N   1 
ATOM   779  C CA  . LYS A 1 121 ? 14.883  43.970 5.831  1.00 111.63 ? 616  LYS A CA  1 
ATOM   780  C C   . LYS A 1 121 ? 15.711  42.909 5.059  1.00 118.89 ? 616  LYS A C   1 
ATOM   781  O O   . LYS A 1 121 ? 15.509  41.702 5.218  1.00 115.75 ? 616  LYS A O   1 
ATOM   782  C CB  . LYS A 1 121 ? 15.387  44.263 7.268  1.00 111.96 ? 616  LYS A CB  1 
ATOM   783  C CG  . LYS A 1 121 ? 15.381  43.093 8.242  1.00 109.26 ? 616  LYS A CG  1 
ATOM   784  N N   . LYS A 1 122 ? 16.635  43.394 4.205  1.00 121.48 ? 617  LYS A N   1 
ATOM   785  C CA  . LYS A 1 122 ? 17.548  42.580 3.388  1.00 123.48 ? 617  LYS A CA  1 
ATOM   786  C C   . LYS A 1 122 ? 18.673  41.942 4.223  1.00 127.76 ? 617  LYS A C   1 
ATOM   787  O O   . LYS A 1 122 ? 19.042  40.789 3.967  1.00 127.07 ? 617  LYS A O   1 
ATOM   788  C CB  . LYS A 1 122 ? 18.150  43.420 2.246  1.00 129.99 ? 617  LYS A CB  1 
ATOM   789  N N   . SER A 1 123 ? 19.226  42.700 5.201  1.00 124.65 ? 618  SER A N   1 
ATOM   790  C CA  . SER A 1 123 ? 20.299  42.234 6.086  1.00 123.43 ? 618  SER A CA  1 
ATOM   791  C C   . SER A 1 123 ? 19.837  42.131 7.534  1.00 123.28 ? 618  SER A C   1 
ATOM   792  O O   . SER A 1 123 ? 19.314  43.102 8.090  1.00 123.27 ? 618  SER A O   1 
ATOM   793  C CB  . SER A 1 123 ? 21.533  43.133 5.978  1.00 130.21 ? 618  SER A CB  1 
ATOM   794  O OG  . SER A 1 123 ? 22.590  42.703 6.824  1.00 136.51 ? 618  SER A OG  1 
ATOM   795  N N   . ILE A 1 124 ? 20.049  40.947 8.139  1.00 116.35 ? 619  ILE A N   1 
ATOM   796  C CA  . ILE A 1 124 ? 19.716  40.648 9.537  1.00 113.29 ? 619  ILE A CA  1 
ATOM   797  C C   . ILE A 1 124 ? 20.990  40.447 10.371 1.00 116.03 ? 619  ILE A C   1 
ATOM   798  O O   . ILE A 1 124 ? 21.813  39.580 10.063 1.00 115.60 ? 619  ILE A O   1 
ATOM   799  C CB  . ILE A 1 124 ? 18.657  39.513 9.685  1.00 113.60 ? 619  ILE A CB  1 
ATOM   800  C CG1 . ILE A 1 124 ? 18.498  39.018 11.147 1.00 111.36 ? 619  ILE A CG1 1 
ATOM   801  C CG2 . ILE A 1 124 ? 18.926  38.358 8.719  1.00 114.92 ? 619  ILE A CG2 1 
ATOM   802  C CD1 . ILE A 1 124 ? 17.566  39.814 12.021 1.00 114.08 ? 619  ILE A CD1 1 
ATOM   803  N N   . ASP A 1 125 ? 21.149  41.291 11.403 1.00 112.15 ? 620  ASP A N   1 
ATOM   804  C CA  . ASP A 1 125 ? 22.290  41.327 12.317 1.00 112.49 ? 620  ASP A CA  1 
ATOM   805  C C   . ASP A 1 125 ? 22.452  40.017 13.107 1.00 113.49 ? 620  ASP A C   1 
ATOM   806  O O   . ASP A 1 125 ? 21.541  39.630 13.837 1.00 111.53 ? 620  ASP A O   1 
ATOM   807  C CB  . ASP A 1 125 ? 22.164  42.561 13.249 1.00 115.78 ? 620  ASP A CB  1 
ATOM   808  C CG  . ASP A 1 125 ? 23.159  42.725 14.397 1.00 126.88 ? 620  ASP A CG  1 
ATOM   809  O OD1 . ASP A 1 125 ? 24.238  42.091 14.351 1.00 127.90 ? 620  ASP A OD1 1 
ATOM   810  O OD2 . ASP A 1 125 ? 22.879  43.537 15.313 1.00 132.28 ? 620  ASP A OD2 1 
ATOM   811  N N   . PRO A 1 126 ? 23.621  39.341 13.002 1.00 109.88 ? 621  PRO A N   1 
ATOM   812  C CA  . PRO A 1 126 ? 23.834  38.088 13.762 1.00 107.60 ? 621  PRO A CA  1 
ATOM   813  C C   . PRO A 1 126 ? 23.419  38.113 15.235 1.00 108.57 ? 621  PRO A C   1 
ATOM   814  O O   . PRO A 1 126 ? 22.920  37.099 15.731 1.00 105.44 ? 621  PRO A O   1 
ATOM   815  C CB  . PRO A 1 126 ? 25.331  37.837 13.607 1.00 111.00 ? 621  PRO A CB  1 
ATOM   816  C CG  . PRO A 1 126 ? 25.668  38.450 12.303 1.00 117.63 ? 621  PRO A CG  1 
ATOM   817  C CD  . PRO A 1 126 ? 24.793  39.664 12.163 1.00 113.79 ? 621  PRO A CD  1 
ATOM   818  N N   . TRP A 1 127 ? 23.610  39.273 15.915 1.00 106.14 ? 622  TRP A N   1 
ATOM   819  C CA  . TRP A 1 127 ? 23.219  39.500 17.307 1.00 105.43 ? 622  TRP A CA  1 
ATOM   820  C C   . TRP A 1 127 ? 21.698  39.559 17.401 1.00 104.26 ? 622  TRP A C   1 
ATOM   821  O O   . TRP A 1 127 ? 21.127  38.886 18.257 1.00 103.73 ? 622  TRP A O   1 
ATOM   822  C CB  . TRP A 1 127 ? 23.838  40.801 17.863 1.00 107.73 ? 622  TRP A CB  1 
ATOM   823  C CG  . TRP A 1 127 ? 23.187  41.325 19.123 1.00 109.69 ? 622  TRP A CG  1 
ATOM   824  C CD1 . TRP A 1 127 ? 22.012  42.020 19.215 1.00 112.51 ? 622  TRP A CD1 1 
ATOM   825  C CD2 . TRP A 1 127 ? 23.705  41.239 20.460 1.00 110.88 ? 622  TRP A CD2 1 
ATOM   826  N NE1 . TRP A 1 127 ? 21.739  42.323 20.530 1.00 112.61 ? 622  TRP A NE1 1 
ATOM   827  C CE2 . TRP A 1 127 ? 22.774  41.879 21.314 1.00 115.14 ? 622  TRP A CE2 1 
ATOM   828  C CE3 . TRP A 1 127 ? 24.870  40.683 21.024 1.00 113.31 ? 622  TRP A CE3 1 
ATOM   829  C CZ2 . TRP A 1 127 ? 22.976  41.986 22.699 1.00 115.72 ? 622  TRP A CZ2 1 
ATOM   830  C CZ3 . TRP A 1 127 ? 25.066  40.786 22.394 1.00 116.04 ? 622  TRP A CZ3 1 
ATOM   831  C CH2 . TRP A 1 127 ? 24.127  41.428 23.217 1.00 116.90 ? 622  TRP A CH2 1 
ATOM   832  N N   . GLU A 1 128 ? 21.055  40.401 16.560 1.00 96.65  ? 623  GLU A N   1 
ATOM   833  C CA  . GLU A 1 128 ? 19.609  40.598 16.505 1.00 93.28  ? 623  GLU A CA  1 
ATOM   834  C C   . GLU A 1 128 ? 18.943  39.241 16.357 1.00 90.61  ? 623  GLU A C   1 
ATOM   835  O O   . GLU A 1 128 ? 18.015  38.947 17.097 1.00 89.54  ? 623  GLU A O   1 
ATOM   836  C CB  . GLU A 1 128 ? 19.257  41.504 15.315 1.00 96.14  ? 623  GLU A CB  1 
ATOM   837  C CG  . GLU A 1 128 ? 17.872  42.132 15.341 1.00 107.09 ? 623  GLU A CG  1 
ATOM   838  C CD  . GLU A 1 128 ? 17.425  42.800 14.050 1.00 125.78 ? 623  GLU A CD  1 
ATOM   839  O OE1 . GLU A 1 128 ? 18.294  43.213 13.244 1.00 117.72 ? 623  GLU A OE1 1 
ATOM   840  O OE2 . GLU A 1 128 ? 16.192  42.917 13.850 1.00 111.55 ? 623  GLU A OE2 1 
ATOM   841  N N   . ARG A 1 129 ? 19.481  38.392 15.465 1.00 83.20  ? 624  ARG A N   1 
ATOM   842  C CA  . ARG A 1 129 ? 19.031  37.030 15.199 1.00 79.91  ? 624  ARG A CA  1 
ATOM   843  C C   . ARG A 1 129 ? 19.237  36.105 16.413 1.00 80.88  ? 624  ARG A C   1 
ATOM   844  O O   . ARG A 1 129 ? 18.280  35.469 16.834 1.00 78.85  ? 624  ARG A O   1 
ATOM   845  C CB  . ARG A 1 129 ? 19.731  36.495 13.944 1.00 78.81  ? 624  ARG A CB  1 
ATOM   846  C CG  . ARG A 1 129 ? 19.434  35.045 13.593 1.00 79.02  ? 624  ARG A CG  1 
ATOM   847  C CD  . ARG A 1 129 ? 20.198  34.618 12.359 1.00 82.37  ? 624  ARG A CD  1 
ATOM   848  N NE  . ARG A 1 129 ? 21.619  34.963 12.423 1.00 88.80  ? 624  ARG A NE  1 
ATOM   849  C CZ  . ARG A 1 129 ? 22.367  35.250 11.361 1.00 102.44 ? 624  ARG A CZ  1 
ATOM   850  N NH1 . ARG A 1 129 ? 21.834  35.220 10.147 1.00 88.44  ? 624  ARG A NH1 1 
ATOM   851  N NH2 . ARG A 1 129 ? 23.642  35.561 11.505 1.00 92.25  ? 624  ARG A NH2 1 
ATOM   852  N N   . LYS A 1 130 ? 20.473  36.031 16.971 1.00 78.15  ? 625  LYS A N   1 
ATOM   853  C CA  . LYS A 1 130 ? 20.823  35.220 18.162 1.00 76.22  ? 625  LYS A CA  1 
ATOM   854  C C   . LYS A 1 130 ? 19.896  35.572 19.329 1.00 81.15  ? 625  LYS A C   1 
ATOM   855  O O   . LYS A 1 130 ? 19.410  34.674 20.024 1.00 80.30  ? 625  LYS A O   1 
ATOM   856  C CB  . LYS A 1 130 ? 22.279  35.454 18.569 1.00 77.00  ? 625  LYS A CB  1 
ATOM   857  C CG  . LYS A 1 130 ? 22.896  34.274 19.268 1.00 68.61  ? 625  LYS A CG  1 
ATOM   858  C CD  . LYS A 1 130 ? 24.250  34.637 19.886 1.00 78.45  ? 625  LYS A CD  1 
ATOM   859  C CE  . LYS A 1 130 ? 25.437  34.165 19.073 1.00 81.34  ? 625  LYS A CE  1 
ATOM   860  N NZ  . LYS A 1 130 ? 26.420  33.419 19.913 1.00 86.97  ? 625  LYS A NZ  1 
ATOM   861  N N   . SER A 1 131 ? 19.606  36.884 19.486 1.00 78.31  ? 626  SER A N   1 
ATOM   862  C CA  . SER A 1 131 ? 18.717  37.436 20.490 1.00 77.10  ? 626  SER A CA  1 
ATOM   863  C C   . SER A 1 131 ? 17.302  36.941 20.254 1.00 80.35  ? 626  SER A C   1 
ATOM   864  O O   . SER A 1 131 ? 16.727  36.341 21.157 1.00 79.39  ? 626  SER A O   1 
ATOM   865  C CB  . SER A 1 131 ? 18.754  38.952 20.450 1.00 80.04  ? 626  SER A CB  1 
ATOM   866  O OG  . SER A 1 131 ? 18.177  39.424 21.650 1.00 89.29  ? 626  SER A OG  1 
ATOM   867  N N   . TYR A 1 132 ? 16.765  37.146 19.024 1.00 77.22  ? 627  TYR A N   1 
ATOM   868  C CA  . TYR A 1 132 ? 15.414  36.736 18.594 1.00 75.43  ? 627  TYR A CA  1 
ATOM   869  C C   . TYR A 1 132 ? 15.175  35.259 18.795 1.00 74.97  ? 627  TYR A C   1 
ATOM   870  O O   . TYR A 1 132 ? 14.097  34.879 19.251 1.00 73.44  ? 627  TYR A O   1 
ATOM   871  C CB  . TYR A 1 132 ? 15.122  37.151 17.125 1.00 77.93  ? 627  TYR A CB  1 
ATOM   872  C CG  . TYR A 1 132 ? 14.843  38.631 16.938 1.00 82.65  ? 627  TYR A CG  1 
ATOM   873  C CD1 . TYR A 1 132 ? 14.596  39.460 18.035 1.00 85.42  ? 627  TYR A CD1 1 
ATOM   874  C CD2 . TYR A 1 132 ? 14.820  39.203 15.671 1.00 84.98  ? 627  TYR A CD2 1 
ATOM   875  C CE1 . TYR A 1 132 ? 14.355  40.822 17.873 1.00 88.31  ? 627  TYR A CE1 1 
ATOM   876  C CE2 . TYR A 1 132 ? 14.554  40.563 15.494 1.00 87.71  ? 627  TYR A CE2 1 
ATOM   877  C CZ  . TYR A 1 132 ? 14.331  41.370 16.601 1.00 98.13  ? 627  TYR A CZ  1 
ATOM   878  O OH  . TYR A 1 132 ? 14.084  42.715 16.453 1.00 104.59 ? 627  TYR A OH  1 
ATOM   879  N N   . TRP A 1 133 ? 16.199  34.437 18.490 1.00 70.38  ? 628  TRP A N   1 
ATOM   880  C CA  . TRP A 1 133 ? 16.202  32.989 18.646 1.00 68.27  ? 628  TRP A CA  1 
ATOM   881  C C   . TRP A 1 133 ? 15.998  32.635 20.101 1.00 69.22  ? 628  TRP A C   1 
ATOM   882  O O   . TRP A 1 133 ? 15.110  31.854 20.415 1.00 67.10  ? 628  TRP A O   1 
ATOM   883  C CB  . TRP A 1 133 ? 17.526  32.395 18.146 1.00 67.89  ? 628  TRP A CB  1 
ATOM   884  C CG  . TRP A 1 133 ? 17.595  30.899 18.267 1.00 68.48  ? 628  TRP A CG  1 
ATOM   885  C CD1 . TRP A 1 133 ? 18.454  30.175 19.042 1.00 71.71  ? 628  TRP A CD1 1 
ATOM   886  C CD2 . TRP A 1 133 ? 16.737  29.947 17.620 1.00 67.71  ? 628  TRP A CD2 1 
ATOM   887  N NE1 . TRP A 1 133 ? 18.213  28.829 18.886 1.00 70.44  ? 628  TRP A NE1 1 
ATOM   888  C CE2 . TRP A 1 133 ? 17.154  28.659 18.032 1.00 71.13  ? 628  TRP A CE2 1 
ATOM   889  C CE3 . TRP A 1 133 ? 15.688  30.056 16.685 1.00 68.48  ? 628  TRP A CE3 1 
ATOM   890  C CZ2 . TRP A 1 133 ? 16.560  27.487 17.543 1.00 69.97  ? 628  TRP A CZ2 1 
ATOM   891  C CZ3 . TRP A 1 133 ? 15.087  28.896 16.223 1.00 69.62  ? 628  TRP A CZ3 1 
ATOM   892  C CH2 . TRP A 1 133 ? 15.532  27.629 16.635 1.00 70.22  ? 628  TRP A CH2 1 
ATOM   893  N N   . LYS A 1 134 ? 16.801  33.236 20.991 1.00 65.98  ? 629  LYS A N   1 
ATOM   894  C CA  . LYS A 1 134 ? 16.715  33.014 22.431 1.00 65.54  ? 629  LYS A CA  1 
ATOM   895  C C   . LYS A 1 134 ? 15.289  33.299 22.948 1.00 67.77  ? 629  LYS A C   1 
ATOM   896  O O   . LYS A 1 134 ? 14.742  32.511 23.711 1.00 67.80  ? 629  LYS A O   1 
ATOM   897  C CB  . LYS A 1 134 ? 17.787  33.846 23.166 1.00 69.62  ? 629  LYS A CB  1 
ATOM   898  N N   . ASN A 1 135 ? 14.674  34.377 22.462 1.00 63.85  ? 630  ASN A N   1 
ATOM   899  C CA  . ASN A 1 135 ? 13.315  34.781 22.796 1.00 63.19  ? 630  ASN A CA  1 
ATOM   900  C C   . ASN A 1 135 ? 12.274  33.774 22.277 1.00 66.45  ? 630  ASN A C   1 
ATOM   901  O O   . ASN A 1 135 ? 11.249  33.578 22.928 1.00 66.12  ? 630  ASN A O   1 
ATOM   902  C CB  . ASN A 1 135 ? 13.041  36.181 22.242 1.00 63.66  ? 630  ASN A CB  1 
ATOM   903  C CG  . ASN A 1 135 ? 13.845  37.288 22.888 1.00 88.11  ? 630  ASN A CG  1 
ATOM   904  O OD1 . ASN A 1 135 ? 14.649  37.083 23.802 1.00 87.74  ? 630  ASN A OD1 1 
ATOM   905  N ND2 . ASN A 1 135 ? 13.625  38.503 22.443 1.00 80.34  ? 630  ASN A ND2 1 
ATOM   906  N N   . MET A 1 136 ? 12.551  33.140 21.122 1.00 62.14  ? 631  MET A N   1 
ATOM   907  C CA  . MET A 1 136 ? 11.706  32.144 20.474 1.00 61.14  ? 631  MET A CA  1 
ATOM   908  C C   . MET A 1 136 ? 11.740  30.814 21.191 1.00 65.73  ? 631  MET A C   1 
ATOM   909  O O   . MET A 1 136 ? 10.775  30.058 21.103 1.00 66.69  ? 631  MET A O   1 
ATOM   910  C CB  . MET A 1 136 ? 12.189  31.909 19.060 1.00 63.97  ? 631  MET A CB  1 
ATOM   911  C CG  . MET A 1 136 ? 11.567  32.803 18.089 1.00 68.79  ? 631  MET A CG  1 
ATOM   912  S SD  . MET A 1 136 ? 12.074  32.318 16.447 1.00 74.33  ? 631  MET A SD  1 
ATOM   913  C CE  . MET A 1 136 ? 13.293  33.545 16.152 1.00 72.36  ? 631  MET A CE  1 
ATOM   914  N N   . LEU A 1 137 ? 12.864  30.487 21.839 1.00 60.88  ? 632  LEU A N   1 
ATOM   915  C CA  . LEU A 1 137 ? 12.988  29.233 22.560 1.00 59.81  ? 632  LEU A CA  1 
ATOM   916  C C   . LEU A 1 137 ? 12.260  29.375 23.872 1.00 66.58  ? 632  LEU A C   1 
ATOM   917  O O   . LEU A 1 137 ? 11.494  28.479 24.219 1.00 66.71  ? 632  LEU A O   1 
ATOM   918  C CB  . LEU A 1 137 ? 14.447  28.841 22.801 1.00 59.78  ? 632  LEU A CB  1 
ATOM   919  C CG  . LEU A 1 137 ? 15.330  28.631 21.584 1.00 63.43  ? 632  LEU A CG  1 
ATOM   920  C CD1 . LEU A 1 137 ? 16.783  28.640 21.987 1.00 63.98  ? 632  LEU A CD1 1 
ATOM   921  C CD2 . LEU A 1 137 ? 14.959  27.358 20.833 1.00 64.23  ? 632  LEU A CD2 1 
ATOM   922  N N   . GLU A 1 138 ? 12.453  30.520 24.577 1.00 65.23  ? 633  GLU A N   1 
ATOM   923  C CA  . GLU A 1 138 ? 11.814  30.812 25.865 1.00 66.80  ? 633  GLU A CA  1 
ATOM   924  C C   . GLU A 1 138 ? 10.278  30.757 25.765 1.00 72.30  ? 633  GLU A C   1 
ATOM   925  O O   . GLU A 1 138 ? 9.611   30.218 26.662 1.00 72.28  ? 633  GLU A O   1 
ATOM   926  C CB  . GLU A 1 138 ? 12.265  32.180 26.420 1.00 69.65  ? 633  GLU A CB  1 
ATOM   927  C CG  . GLU A 1 138 ? 12.089  32.298 27.936 1.00 87.18  ? 633  GLU A CG  1 
ATOM   928  C CD  . GLU A 1 138 ? 11.917  33.670 28.577 1.00 112.19 ? 633  GLU A CD  1 
ATOM   929  O OE1 . GLU A 1 138 ? 12.596  34.636 28.151 1.00 95.11  ? 633  GLU A OE1 1 
ATOM   930  O OE2 . GLU A 1 138 ? 11.156  33.751 29.571 1.00 110.65 ? 633  GLU A OE2 1 
ATOM   931  N N   . ALA A 1 139 ? 9.726   31.323 24.672 1.00 68.54  ? 634  ALA A N   1 
ATOM   932  C CA  . ALA A 1 139 ? 8.294   31.361 24.430 1.00 67.11  ? 634  ALA A CA  1 
ATOM   933  C C   . ALA A 1 139 ? 7.791   29.931 24.234 1.00 70.98  ? 634  ALA A C   1 
ATOM   934  O O   . ALA A 1 139 ? 7.020   29.460 25.069 1.00 72.97  ? 634  ALA A O   1 
ATOM   935  C CB  . ALA A 1 139 ? 7.985   32.227 23.216 1.00 67.38  ? 634  ALA A CB  1 
ATOM   936  N N   . VAL A 1 140 ? 8.295   29.208 23.211 1.00 64.28  ? 635  VAL A N   1 
ATOM   937  C CA  . VAL A 1 140 ? 7.878   27.831 22.933 1.00 62.37  ? 635  VAL A CA  1 
ATOM   938  C C   . VAL A 1 140 ? 8.107   26.907 24.136 1.00 66.37  ? 635  VAL A C   1 
ATOM   939  O O   . VAL A 1 140 ? 7.226   26.129 24.482 1.00 65.61  ? 635  VAL A O   1 
ATOM   940  C CB  . VAL A 1 140 ? 8.466   27.294 21.614 1.00 65.08  ? 635  VAL A CB  1 
ATOM   941  C CG1 . VAL A 1 140 ? 7.909   25.917 21.291 1.00 64.77  ? 635  VAL A CG1 1 
ATOM   942  C CG2 . VAL A 1 140 ? 8.175   28.256 20.461 1.00 64.50  ? 635  VAL A CG2 1 
ATOM   943  N N   . HIS A 1 141 ? 9.236   27.058 24.826 1.00 63.90  ? 636  HIS A N   1 
ATOM   944  C CA  . HIS A 1 141 ? 9.513   26.276 26.028 1.00 64.65  ? 636  HIS A CA  1 
ATOM   945  C C   . HIS A 1 141 ? 8.425   26.428 27.113 1.00 69.88  ? 636  HIS A C   1 
ATOM   946  O O   . HIS A 1 141 ? 8.087   25.438 27.768 1.00 71.43  ? 636  HIS A O   1 
ATOM   947  C CB  . HIS A 1 141 ? 10.870  26.652 26.613 1.00 65.91  ? 636  HIS A CB  1 
ATOM   948  C CG  . HIS A 1 141 ? 11.332  25.738 27.696 1.00 70.67  ? 636  HIS A CG  1 
ATOM   949  N ND1 . HIS A 1 141 ? 11.971  26.226 28.823 1.00 73.73  ? 636  HIS A ND1 1 
ATOM   950  C CD2 . HIS A 1 141 ? 11.263  24.387 27.778 1.00 73.28  ? 636  HIS A CD2 1 
ATOM   951  C CE1 . HIS A 1 141 ? 12.272  25.164 29.551 1.00 74.38  ? 636  HIS A CE1 1 
ATOM   952  N NE2 . HIS A 1 141 ? 11.860  24.034 28.965 1.00 74.53  ? 636  HIS A NE2 1 
ATOM   953  N N   . THR A 1 142 ? 7.881   27.648 27.306 1.00 64.88  ? 637  THR A N   1 
ATOM   954  C CA  . THR A 1 142 ? 6.869   27.858 28.344 1.00 64.70  ? 637  THR A CA  1 
ATOM   955  C C   . THR A 1 142 ? 5.533   27.201 28.008 1.00 67.07  ? 637  THR A C   1 
ATOM   956  O O   . THR A 1 142 ? 4.951   26.544 28.879 1.00 68.53  ? 637  THR A O   1 
ATOM   957  C CB  . THR A 1 142 ? 6.876   29.284 28.927 1.00 75.45  ? 637  THR A CB  1 
ATOM   958  O OG1 . THR A 1 142 ? 6.786   30.232 27.874 1.00 77.92  ? 637  THR A OG1 1 
ATOM   959  C CG2 . THR A 1 142 ? 8.153   29.580 29.701 1.00 78.75  ? 637  THR A CG2 1 
ATOM   960  N N   . ILE A 1 143 ? 5.102   27.267 26.732 1.00 59.93  ? 638  ILE A N   1 
ATOM   961  C CA  . ILE A 1 143 ? 3.862   26.607 26.323 1.00 58.98  ? 638  ILE A CA  1 
ATOM   962  C C   . ILE A 1 143 ? 4.021   25.079 26.472 1.00 60.95  ? 638  ILE A C   1 
ATOM   963  O O   . ILE A 1 143 ? 3.102   24.407 26.942 1.00 60.31  ? 638  ILE A O   1 
ATOM   964  C CB  . ILE A 1 143 ? 3.305   27.081 24.931 1.00 61.97  ? 638  ILE A CB  1 
ATOM   965  C CG1 . ILE A 1 143 ? 4.174   26.623 23.728 1.00 62.18  ? 638  ILE A CG1 1 
ATOM   966  C CG2 . ILE A 1 143 ? 3.098   28.594 24.903 1.00 62.51  ? 638  ILE A CG2 1 
ATOM   967  C CD1 . ILE A 1 143 ? 3.497   26.587 22.356 1.00 64.00  ? 638  ILE A CD1 1 
ATOM   968  N N   . HIS A 1 144 ? 5.231   24.561 26.145 1.00 56.80  ? 639  HIS A N   1 
ATOM   969  C CA  . HIS A 1 144 ? 5.596   23.148 26.241 1.00 56.74  ? 639  HIS A CA  1 
ATOM   970  C C   . HIS A 1 144 ? 5.481   22.668 27.661 1.00 60.83  ? 639  HIS A C   1 
ATOM   971  O O   . HIS A 1 144 ? 4.915   21.595 27.891 1.00 61.75  ? 639  HIS A O   1 
ATOM   972  C CB  . HIS A 1 144 ? 7.006   22.890 25.691 1.00 57.29  ? 639  HIS A CB  1 
ATOM   973  C CG  . HIS A 1 144 ? 7.066   22.777 24.202 1.00 60.45  ? 639  HIS A CG  1 
ATOM   974  N ND1 . HIS A 1 144 ? 8.238   22.426 23.556 1.00 62.82  ? 639  HIS A ND1 1 
ATOM   975  C CD2 . HIS A 1 144 ? 6.100   22.979 23.274 1.00 61.69  ? 639  HIS A CD2 1 
ATOM   976  C CE1 . HIS A 1 144 ? 7.955   22.461 22.262 1.00 61.86  ? 639  HIS A CE1 1 
ATOM   977  N NE2 . HIS A 1 144 ? 6.677   22.775 22.048 1.00 61.66  ? 639  HIS A NE2 1 
ATOM   978  N N   . GLN A 1 145 ? 5.950   23.482 28.620 1.00 56.50  ? 640  GLN A N   1 
ATOM   979  C CA  . GLN A 1 145 ? 5.875   23.147 30.033 1.00 58.20  ? 640  GLN A CA  1 
ATOM   980  C C   . GLN A 1 145 ? 4.446   22.968 30.534 1.00 66.76  ? 640  GLN A C   1 
ATOM   981  O O   . GLN A 1 145 ? 4.246   22.255 31.509 1.00 69.25  ? 640  GLN A O   1 
ATOM   982  C CB  . GLN A 1 145 ? 6.557   24.218 30.856 1.00 59.39  ? 640  GLN A CB  1 
ATOM   983  C CG  . GLN A 1 145 ? 8.058   24.123 30.842 1.00 63.99  ? 640  GLN A CG  1 
ATOM   984  C CD  . GLN A 1 145 ? 8.658   25.322 31.500 1.00 88.87  ? 640  GLN A CD  1 
ATOM   985  O OE1 . GLN A 1 145 ? 7.979   26.316 31.801 1.00 88.39  ? 640  GLN A OE1 1 
ATOM   986  N NE2 . GLN A 1 145 ? 9.944   25.244 31.766 1.00 85.82  ? 640  GLN A NE2 1 
ATOM   987  N N   . HIS A 1 146 ? 3.460   23.624 29.892 1.00 63.74  ? 641  HIS A N   1 
ATOM   988  C CA  . HIS A 1 146 ? 2.047   23.547 30.267 1.00 64.34  ? 641  HIS A CA  1 
ATOM   989  C C   . HIS A 1 146 ? 1.280   22.543 29.441 1.00 67.86  ? 641  HIS A C   1 
ATOM   990  O O   . HIS A 1 146 ? 0.054   22.452 29.556 1.00 68.74  ? 641  HIS A O   1 
ATOM   991  C CB  . HIS A 1 146 ? 1.410   24.945 30.230 1.00 65.04  ? 641  HIS A CB  1 
ATOM   992  C CG  . HIS A 1 146 ? 1.931   25.797 31.337 1.00 69.92  ? 641  HIS A CG  1 
ATOM   993  N ND1 . HIS A 1 146 ? 3.227   26.288 31.316 1.00 72.14  ? 641  HIS A ND1 1 
ATOM   994  C CD2 . HIS A 1 146 ? 1.370   26.103 32.527 1.00 72.98  ? 641  HIS A CD2 1 
ATOM   995  C CE1 . HIS A 1 146 ? 3.394   26.913 32.470 1.00 72.46  ? 641  HIS A CE1 1 
ATOM   996  N NE2 . HIS A 1 146 ? 2.299   26.842 33.224 1.00 73.40  ? 641  HIS A NE2 1 
ATOM   997  N N   . GLY A 1 147 ? 2.014   21.785 28.633 1.00 63.74  ? 642  GLY A N   1 
ATOM   998  C CA  . GLY A 1 147 ? 1.468   20.747 27.772 1.00 64.06  ? 642  GLY A CA  1 
ATOM   999  C C   . GLY A 1 147 ? 1.152   21.159 26.349 1.00 67.10  ? 642  GLY A C   1 
ATOM   1000 O O   . GLY A 1 147 ? 0.784   20.306 25.539 1.00 68.18  ? 642  GLY A O   1 
ATOM   1001 N N   . ILE A 1 148 ? 1.271   22.446 26.014 1.00 61.26  ? 643  ILE A N   1 
ATOM   1002 C CA  . ILE A 1 148 ? 0.941   22.872 24.646 1.00 59.73  ? 643  ILE A CA  1 
ATOM   1003 C C   . ILE A 1 148 ? 2.070   22.640 23.623 1.00 62.32  ? 643  ILE A C   1 
ATOM   1004 O O   . ILE A 1 148 ? 3.225   22.942 23.898 1.00 62.19  ? 643  ILE A O   1 
ATOM   1005 C CB  . ILE A 1 148 ? 0.390   24.327 24.572 1.00 60.88  ? 643  ILE A CB  1 
ATOM   1006 C CG1 . ILE A 1 148 ? -0.615  24.609 25.698 1.00 61.15  ? 643  ILE A CG1 1 
ATOM   1007 C CG2 . ILE A 1 148 ? -0.208  24.651 23.192 1.00 59.68  ? 643  ILE A CG2 1 
ATOM   1008 C CD1 . ILE A 1 148 ? -0.196  25.728 26.511 1.00 68.71  ? 643  ILE A CD1 1 
ATOM   1009 N N   . VAL A 1 149 ? 1.710   22.102 22.456 1.00 57.45  ? 644  VAL A N   1 
ATOM   1010 C CA  . VAL A 1 149 ? 2.537   21.971 21.261 1.00 56.39  ? 644  VAL A CA  1 
ATOM   1011 C C   . VAL A 1 149 ? 1.873   22.944 20.241 1.00 61.63  ? 644  VAL A C   1 
ATOM   1012 O O   . VAL A 1 149 ? 0.728   22.758 19.837 1.00 61.17  ? 644  VAL A O   1 
ATOM   1013 C CB  . VAL A 1 149 ? 2.670   20.517 20.728 1.00 60.21  ? 644  VAL A CB  1 
ATOM   1014 C CG1 . VAL A 1 149 ? 3.583   20.470 19.516 1.00 60.12  ? 644  VAL A CG1 1 
ATOM   1015 C CG2 . VAL A 1 149 ? 3.201   19.588 21.803 1.00 60.49  ? 644  VAL A CG2 1 
ATOM   1016 N N   . HIS A 1 150 ? 2.542   24.050 19.924 1.00 60.56  ? 645  HIS A N   1 
ATOM   1017 C CA  . HIS A 1 150 ? 1.952   25.002 18.986 1.00 61.56  ? 645  HIS A CA  1 
ATOM   1018 C C   . HIS A 1 150 ? 1.568   24.306 17.664 1.00 71.83  ? 645  HIS A C   1 
ATOM   1019 O O   . HIS A 1 150 ? 0.524   24.620 17.101 1.00 72.21  ? 645  HIS A O   1 
ATOM   1020 C CB  . HIS A 1 150 ? 2.855   26.219 18.707 1.00 61.18  ? 645  HIS A CB  1 
ATOM   1021 C CG  . HIS A 1 150 ? 2.180   27.240 17.832 1.00 63.70  ? 645  HIS A CG  1 
ATOM   1022 N ND1 . HIS A 1 150 ? 1.717   26.914 16.565 1.00 65.59  ? 645  HIS A ND1 1 
ATOM   1023 C CD2 . HIS A 1 150 ? 1.879   28.532 18.103 1.00 64.78  ? 645  HIS A CD2 1 
ATOM   1024 C CE1 . HIS A 1 150 ? 1.134   27.991 16.131 1.00 65.41  ? 645  HIS A CE1 1 
ATOM   1025 N NE2 . HIS A 1 150 ? 1.219   29.002 16.992 1.00 65.13  ? 645  HIS A NE2 1 
ATOM   1026 N N   . SER A 1 151 ? 2.403   23.376 17.148 1.00 73.32  ? 646  SER A N   1 
ATOM   1027 C CA  . SER A 1 151 ? 2.147   22.582 15.917 1.00 76.83  ? 646  SER A CA  1 
ATOM   1028 C C   . SER A 1 151 ? 2.181   23.334 14.578 1.00 83.27  ? 646  SER A C   1 
ATOM   1029 O O   . SER A 1 151 ? 2.274   22.706 13.509 1.00 84.55  ? 646  SER A O   1 
ATOM   1030 C CB  . SER A 1 151 ? 0.846   21.774 16.007 1.00 83.20  ? 646  SER A CB  1 
ATOM   1031 O OG  . SER A 1 151 ? -0.262  22.655 15.830 1.00 94.85  ? 646  SER A OG  1 
ATOM   1032 N N   . ASP A 1 152 ? 2.057   24.664 14.616 1.00 79.52  ? 647  ASP A N   1 
ATOM   1033 C CA  . ASP A 1 152 ? 2.061   25.451 13.392 1.00 80.18  ? 647  ASP A CA  1 
ATOM   1034 C C   . ASP A 1 152 ? 2.792   26.780 13.608 1.00 80.78  ? 647  ASP A C   1 
ATOM   1035 O O   . ASP A 1 152 ? 2.181   27.852 13.669 1.00 79.50  ? 647  ASP A O   1 
ATOM   1036 C CB  . ASP A 1 152 ? 0.626   25.608 12.862 1.00 83.73  ? 647  ASP A CB  1 
ATOM   1037 C CG  . ASP A 1 152 ? 0.487   26.465 11.618 1.00 100.56 ? 647  ASP A CG  1 
ATOM   1038 O OD1 . ASP A 1 152 ? 0.953   26.029 10.545 1.00 104.64 ? 647  ASP A OD1 1 
ATOM   1039 O OD2 . ASP A 1 152 ? -0.019  27.600 11.737 1.00 103.15 ? 647  ASP A OD2 1 
ATOM   1040 N N   . LEU A 1 153 ? 4.112   26.697 13.804 1.00 74.67  ? 648  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 153 ? 4.865   27.914 14.006 1.00 72.46  ? 648  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 153 ? 5.269   28.487 12.652 1.00 77.03  ? 648  LEU A C   1 
ATOM   1043 O O   . LEU A 1 153 ? 5.417   27.746 11.671 1.00 78.42  ? 648  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 153 ? 6.055   27.680 14.922 1.00 71.59  ? 648  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 153 ? 5.733   27.431 16.381 1.00 74.24  ? 648  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 153 ? 6.825   26.602 17.016 1.00 74.96  ? 648  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 153 ? 5.580   28.739 17.139 1.00 73.98  ? 648  LEU A CD2 1 
ATOM   1048 N N   . LYS A 1 154 ? 5.315   29.820 12.586 1.00 72.22  ? 649  LYS A N   1 
ATOM   1049 C CA  . LYS A 1 154 ? 5.613   30.656 11.424 1.00 72.45  ? 649  LYS A CA  1 
ATOM   1050 C C   . LYS A 1 154 ? 6.141   31.991 12.003 1.00 74.75  ? 649  LYS A C   1 
ATOM   1051 O O   . LYS A 1 154 ? 5.812   32.315 13.154 1.00 72.10  ? 649  LYS A O   1 
ATOM   1052 C CB  . LYS A 1 154 ? 4.311   30.964 10.624 1.00 75.28  ? 649  LYS A CB  1 
ATOM   1053 C CG  . LYS A 1 154 ? 3.534   29.759 10.079 1.00 82.49  ? 649  LYS A CG  1 
ATOM   1054 C CD  . LYS A 1 154 ? 2.106   30.071 9.540  1.00 92.31  ? 649  LYS A CD  1 
ATOM   1055 C CE  . LYS A 1 154 ? 1.152   30.816 10.463 1.00 96.74  ? 649  LYS A CE  1 
ATOM   1056 N NZ  . LYS A 1 154 ? 0.917   30.134 11.758 1.00 104.89 ? 649  LYS A NZ  1 
ATOM   1057 N N   . PRO A 1 155 ? 6.894   32.830 11.251 1.00 72.95  ? 650  PRO A N   1 
ATOM   1058 C CA  . PRO A 1 155 ? 7.346   34.107 11.834 1.00 73.03  ? 650  PRO A CA  1 
ATOM   1059 C C   . PRO A 1 155 ? 6.169   35.002 12.214 1.00 77.74  ? 650  PRO A C   1 
ATOM   1060 O O   . PRO A 1 155 ? 6.276   35.729 13.203 1.00 77.60  ? 650  PRO A O   1 
ATOM   1061 C CB  . PRO A 1 155 ? 8.234   34.719 10.740 1.00 76.03  ? 650  PRO A CB  1 
ATOM   1062 C CG  . PRO A 1 155 ? 8.583   33.581 9.846  1.00 80.90  ? 650  PRO A CG  1 
ATOM   1063 C CD  . PRO A 1 155 ? 7.395   32.676 9.873  1.00 75.90  ? 650  PRO A CD  1 
ATOM   1064 N N   . ALA A 1 156 ? 5.022   34.877 11.475 1.00 73.69  ? 651  ALA A N   1 
ATOM   1065 C CA  . ALA A 1 156 ? 3.755   35.600 11.684 1.00 72.35  ? 651  ALA A CA  1 
ATOM   1066 C C   . ALA A 1 156 ? 3.262   35.552 13.141 1.00 73.60  ? 651  ALA A C   1 
ATOM   1067 O O   . ALA A 1 156 ? 2.753   36.561 13.629 1.00 74.07  ? 651  ALA A O   1 
ATOM   1068 C CB  . ALA A 1 156 ? 2.694   35.037 10.768 1.00 73.68  ? 651  ALA A CB  1 
ATOM   1069 N N   . ASN A 1 157 ? 3.459   34.388 13.831 1.00 66.82  ? 652  ASN A N   1 
ATOM   1070 C CA  . ASN A 1 157 ? 3.147   34.080 15.235 1.00 63.83  ? 652  ASN A CA  1 
ATOM   1071 C C   . ASN A 1 157 ? 3.978   34.864 16.251 1.00 65.72  ? 652  ASN A C   1 
ATOM   1072 O O   . ASN A 1 157 ? 3.683   34.797 17.438 1.00 66.15  ? 652  ASN A O   1 
ATOM   1073 C CB  . ASN A 1 157 ? 3.402   32.598 15.491 1.00 61.27  ? 652  ASN A CB  1 
ATOM   1074 C CG  . ASN A 1 157 ? 2.454   31.708 14.762 1.00 83.66  ? 652  ASN A CG  1 
ATOM   1075 O OD1 . ASN A 1 157 ? 2.687   31.300 13.624 1.00 75.95  ? 652  ASN A OD1 1 
ATOM   1076 N ND2 . ASN A 1 157 ? 1.334   31.429 15.385 1.00 79.61  ? 652  ASN A ND2 1 
ATOM   1077 N N   . PHE A 1 158 ? 5.061   35.511 15.822 1.00 60.61  ? 653  PHE A N   1 
ATOM   1078 C CA  . PHE A 1 158 ? 5.941   36.264 16.710 1.00 59.95  ? 653  PHE A CA  1 
ATOM   1079 C C   . PHE A 1 158 ? 5.815   37.734 16.475 1.00 69.39  ? 653  PHE A C   1 
ATOM   1080 O O   . PHE A 1 158 ? 5.608   38.164 15.343 1.00 72.34  ? 653  PHE A O   1 
ATOM   1081 C CB  . PHE A 1 158 ? 7.390   35.815 16.550 1.00 60.88  ? 653  PHE A CB  1 
ATOM   1082 C CG  . PHE A 1 158 ? 7.635   34.431 17.104 1.00 60.10  ? 653  PHE A CG  1 
ATOM   1083 C CD1 . PHE A 1 158 ? 7.914   34.244 18.455 1.00 61.47  ? 653  PHE A CD1 1 
ATOM   1084 C CD2 . PHE A 1 158 ? 7.551   33.314 16.284 1.00 59.89  ? 653  PHE A CD2 1 
ATOM   1085 C CE1 . PHE A 1 158 ? 8.119   32.972 18.968 1.00 60.63  ? 653  PHE A CE1 1 
ATOM   1086 C CE2 . PHE A 1 158 ? 7.738   32.042 16.801 1.00 61.12  ? 653  PHE A CE2 1 
ATOM   1087 C CZ  . PHE A 1 158 ? 8.026   31.880 18.136 1.00 58.99  ? 653  PHE A CZ  1 
ATOM   1088 N N   . LEU A 1 159 ? 5.947   38.516 17.531 1.00 67.00  ? 654  LEU A N   1 
ATOM   1089 C CA  . LEU A 1 159 ? 5.763   39.951 17.451 1.00 68.66  ? 654  LEU A CA  1 
ATOM   1090 C C   . LEU A 1 159 ? 6.885   40.687 18.139 1.00 72.59  ? 654  LEU A C   1 
ATOM   1091 O O   . LEU A 1 159 ? 7.155   40.419 19.311 1.00 72.22  ? 654  LEU A O   1 
ATOM   1092 C CB  . LEU A 1 159 ? 4.419   40.255 18.129 1.00 69.15  ? 654  LEU A CB  1 
ATOM   1093 C CG  . LEU A 1 159 ? 4.106   41.687 18.474 1.00 76.79  ? 654  LEU A CG  1 
ATOM   1094 C CD1 . LEU A 1 159 ? 3.689   42.436 17.243 1.00 79.24  ? 654  LEU A CD1 1 
ATOM   1095 C CD2 . LEU A 1 159 ? 3.045   41.759 19.552 1.00 78.68  ? 654  LEU A CD2 1 
ATOM   1096 N N   . ILE A 1 160 ? 7.527   41.624 17.432 1.00 70.30  ? 655  ILE A N   1 
ATOM   1097 C CA  . ILE A 1 160 ? 8.614   42.410 18.023 1.00 71.31  ? 655  ILE A CA  1 
ATOM   1098 C C   . ILE A 1 160 ? 7.995   43.520 18.853 1.00 78.30  ? 655  ILE A C   1 
ATOM   1099 O O   . ILE A 1 160 ? 7.072   44.180 18.391 1.00 78.03  ? 655  ILE A O   1 
ATOM   1100 C CB  . ILE A 1 160 ? 9.659   42.927 16.989 1.00 75.21  ? 655  ILE A CB  1 
ATOM   1101 C CG1 . ILE A 1 160 ? 10.417  41.757 16.315 1.00 73.90  ? 655  ILE A CG1 1 
ATOM   1102 C CG2 . ILE A 1 160 ? 10.664  43.865 17.658 1.00 77.57  ? 655  ILE A CG2 1 
ATOM   1103 C CD1 . ILE A 1 160 ? 10.256  41.633 14.849 1.00 75.24  ? 655  ILE A CD1 1 
ATOM   1104 N N   . VAL A 1 161 ? 8.428   43.636 20.114 1.00 78.12  ? 656  VAL A N   1 
ATOM   1105 C CA  . VAL A 1 161 ? 7.981   44.644 21.079 1.00 80.91  ? 656  VAL A CA  1 
ATOM   1106 C C   . VAL A 1 161 ? 9.229   45.030 21.832 1.00 90.65  ? 656  VAL A C   1 
ATOM   1107 O O   . VAL A 1 161 ? 9.707   44.241 22.655 1.00 90.18  ? 656  VAL A O   1 
ATOM   1108 C CB  . VAL A 1 161 ? 6.898   44.177 22.098 1.00 84.00  ? 656  VAL A CB  1 
ATOM   1109 C CG1 . VAL A 1 161 ? 6.138   45.371 22.670 1.00 85.48  ? 656  VAL A CG1 1 
ATOM   1110 C CG2 . VAL A 1 161 ? 5.937   43.145 21.514 1.00 81.90  ? 656  VAL A CG2 1 
ATOM   1111 N N   . ASP A 1 162 ? 9.768   46.235 21.554 1.00 91.63  ? 657  ASP A N   1 
ATOM   1112 C CA  . ASP A 1 162 ? 10.973  46.766 22.209 1.00 93.91  ? 657  ASP A CA  1 
ATOM   1113 C C   . ASP A 1 162 ? 12.147  45.771 22.059 1.00 95.91  ? 657  ASP A C   1 
ATOM   1114 O O   . ASP A 1 162 ? 12.663  45.234 23.051 1.00 94.45  ? 657  ASP A O   1 
ATOM   1115 C CB  . ASP A 1 162 ? 10.681  47.153 23.686 1.00 97.15  ? 657  ASP A CB  1 
ATOM   1116 C CG  . ASP A 1 162 ? 9.266   47.683 23.929 1.00 108.41 ? 657  ASP A CG  1 
ATOM   1117 O OD1 . ASP A 1 162 ? 8.914   48.742 23.342 1.00 109.58 ? 657  ASP A OD1 1 
ATOM   1118 O OD2 . ASP A 1 162 ? 8.497   47.015 24.669 1.00 111.99 ? 657  ASP A OD2 1 
ATOM   1119 N N   . GLY A 1 163 ? 12.471  45.482 20.791 1.00 92.07  ? 658  GLY A N   1 
ATOM   1120 C CA  . GLY A 1 163 ? 13.527  44.565 20.355 1.00 91.32  ? 658  GLY A CA  1 
ATOM   1121 C C   . GLY A 1 163 ? 13.447  43.158 20.922 1.00 92.56  ? 658  GLY A C   1 
ATOM   1122 O O   . GLY A 1 163 ? 14.418  42.396 20.862 1.00 92.99  ? 658  GLY A O   1 
ATOM   1123 N N   . MET A 1 164 ? 12.282  42.810 21.460 1.00 85.58  ? 659  MET A N   1 
ATOM   1124 C CA  . MET A 1 164 ? 12.019  41.556 22.119 1.00 82.59  ? 659  MET A CA  1 
ATOM   1125 C C   . MET A 1 164 ? 10.871  40.846 21.415 1.00 83.20  ? 659  MET A C   1 
ATOM   1126 O O   . MET A 1 164 ? 9.812   41.447 21.226 1.00 83.15  ? 659  MET A O   1 
ATOM   1127 C CB  . MET A 1 164 ? 11.688  41.888 23.568 1.00 85.60  ? 659  MET A CB  1 
ATOM   1128 C CG  . MET A 1 164 ? 11.121  40.765 24.347 1.00 88.41  ? 659  MET A CG  1 
ATOM   1129 S SD  . MET A 1 164 ? 10.965  41.265 26.067 1.00 94.80  ? 659  MET A SD  1 
ATOM   1130 C CE  . MET A 1 164 ? 12.721  41.499 26.496 1.00 93.57  ? 659  MET A CE  1 
ATOM   1131 N N   . LEU A 1 165 ? 11.094  39.584 20.994 1.00 76.76  ? 660  LEU A N   1 
ATOM   1132 C CA  . LEU A 1 165 ? 10.090  38.761 20.309 1.00 74.48  ? 660  LEU A CA  1 
ATOM   1133 C C   . LEU A 1 165 ? 9.102   38.162 21.292 1.00 78.13  ? 660  LEU A C   1 
ATOM   1134 O O   . LEU A 1 165 ? 9.498   37.705 22.375 1.00 79.21  ? 660  LEU A O   1 
ATOM   1135 C CB  . LEU A 1 165 ? 10.739  37.615 19.519 1.00 73.60  ? 660  LEU A CB  1 
ATOM   1136 C CG  . LEU A 1 165 ? 11.069  37.852 18.062 1.00 78.98  ? 660  LEU A CG  1 
ATOM   1137 C CD1 . LEU A 1 165 ? 11.365  36.548 17.384 1.00 77.91  ? 660  LEU A CD1 1 
ATOM   1138 C CD2 . LEU A 1 165 ? 9.917   38.494 17.334 1.00 83.57  ? 660  LEU A CD2 1 
ATOM   1139 N N   . LYS A 1 166 ? 7.815   38.145 20.919 1.00 72.18  ? 661  LYS A N   1 
ATOM   1140 C CA  . LYS A 1 166 ? 6.770   37.580 21.769 1.00 70.10  ? 661  LYS A CA  1 
ATOM   1141 C C   . LYS A 1 166 ? 5.816   36.712 20.974 1.00 73.08  ? 661  LYS A C   1 
ATOM   1142 O O   . LYS A 1 166 ? 5.402   37.076 19.871 1.00 72.84  ? 661  LYS A O   1 
ATOM   1143 C CB  . LYS A 1 166 ? 6.000   38.662 22.542 1.00 71.81  ? 661  LYS A CB  1 
ATOM   1144 C CG  . LYS A 1 166 ? 6.864   39.672 23.283 1.00 68.77  ? 661  LYS A CG  1 
ATOM   1145 C CD  . LYS A 1 166 ? 6.175   40.131 24.500 1.00 67.50  ? 661  LYS A CD  1 
ATOM   1146 C CE  . LYS A 1 166 ? 6.985   41.145 25.233 1.00 73.09  ? 661  LYS A CE  1 
ATOM   1147 N NZ  . LYS A 1 166 ? 6.398   41.364 26.582 1.00 87.40  ? 661  LYS A NZ  1 
ATOM   1148 N N   . LEU A 1 167 ? 5.458   35.569 21.545 1.00 69.12  ? 662  LEU A N   1 
ATOM   1149 C CA  . LEU A 1 167 ? 4.536   34.616 20.932 1.00 68.38  ? 662  LEU A CA  1 
ATOM   1150 C C   . LEU A 1 167 ? 3.083   35.151 21.030 1.00 71.68  ? 662  LEU A C   1 
ATOM   1151 O O   . LEU A 1 167 ? 2.619   35.477 22.124 1.00 72.24  ? 662  LEU A O   1 
ATOM   1152 C CB  . LEU A 1 167 ? 4.718   33.248 21.631 1.00 67.75  ? 662  LEU A CB  1 
ATOM   1153 C CG  . LEU A 1 167 ? 3.900   32.059 21.160 1.00 70.64  ? 662  LEU A CG  1 
ATOM   1154 C CD1 . LEU A 1 167 ? 4.292   31.634 19.746 1.00 69.69  ? 662  LEU A CD1 1 
ATOM   1155 C CD2 . LEU A 1 167 ? 4.030   30.926 22.154 1.00 71.99  ? 662  LEU A CD2 1 
ATOM   1156 N N   . ILE A 1 168 ? 2.409   35.276 19.877 1.00 66.53  ? 663  ILE A N   1 
ATOM   1157 C CA  . ILE A 1 168 ? 1.050   35.806 19.717 1.00 65.85  ? 663  ILE A CA  1 
ATOM   1158 C C   . ILE A 1 168 ? 0.002   34.792 20.143 1.00 71.15  ? 663  ILE A C   1 
ATOM   1159 O O   . ILE A 1 168 ? -0.906  35.148 20.883 1.00 70.96  ? 663  ILE A O   1 
ATOM   1160 C CB  . ILE A 1 168 ? 0.827   36.304 18.239 1.00 68.85  ? 663  ILE A CB  1 
ATOM   1161 C CG1 . ILE A 1 168 ? 1.677   37.517 17.897 1.00 70.54  ? 663  ILE A CG1 1 
ATOM   1162 C CG2 . ILE A 1 168 ? -0.611  36.567 17.887 1.00 68.51  ? 663  ILE A CG2 1 
ATOM   1163 C CD1 . ILE A 1 168 ? 1.361   38.729 18.722 1.00 88.54  ? 663  ILE A CD1 1 
ATOM   1164 N N   . ASP A 1 169 ? 0.095   33.549 19.653 1.00 69.34  ? 664  ASP A N   1 
ATOM   1165 C CA  . ASP A 1 169 ? -0.901  32.505 19.924 1.00 69.80  ? 664  ASP A CA  1 
ATOM   1166 C C   . ASP A 1 169 ? -0.270  31.141 20.122 1.00 73.17  ? 664  ASP A C   1 
ATOM   1167 O O   . ASP A 1 169 ? 0.913   30.969 19.838 1.00 72.51  ? 664  ASP A O   1 
ATOM   1168 C CB  . ASP A 1 169 ? -1.870  32.435 18.749 1.00 72.88  ? 664  ASP A CB  1 
ATOM   1169 C CG  . ASP A 1 169 ? -1.115  32.181 17.474 1.00 88.39  ? 664  ASP A CG  1 
ATOM   1170 O OD1 . ASP A 1 169 ? -0.534  33.147 16.931 1.00 88.40  ? 664  ASP A OD1 1 
ATOM   1171 O OD2 . ASP A 1 169 ? -0.973  30.999 17.101 1.00 99.69  ? 664  ASP A OD2 1 
ATOM   1172 N N   . PHE A 1 170 ? -1.075  30.157 20.563 1.00 70.27  ? 665  PHE A N   1 
ATOM   1173 C CA  . PHE A 1 170 ? -0.608  28.793 20.836 1.00 70.20  ? 665  PHE A CA  1 
ATOM   1174 C C   . PHE A 1 170 ? -1.147  27.764 19.857 1.00 74.90  ? 665  PHE A C   1 
ATOM   1175 O O   . PHE A 1 170 ? -1.039  26.554 20.107 1.00 75.56  ? 665  PHE A O   1 
ATOM   1176 C CB  . PHE A 1 170 ? -0.928  28.392 22.282 1.00 72.01  ? 665  PHE A CB  1 
ATOM   1177 C CG  . PHE A 1 170 ? -0.701  29.462 23.322 1.00 74.24  ? 665  PHE A CG  1 
ATOM   1178 C CD1 . PHE A 1 170 ? 0.413   30.292 23.265 1.00 78.47  ? 665  PHE A CD1 1 
ATOM   1179 C CD2 . PHE A 1 170 ? -1.570  29.605 24.389 1.00 77.75  ? 665  PHE A CD2 1 
ATOM   1180 C CE1 . PHE A 1 170 ? 0.623   31.284 24.226 1.00 79.96  ? 665  PHE A CE1 1 
ATOM   1181 C CE2 . PHE A 1 170 ? -1.328  30.559 25.375 1.00 81.49  ? 665  PHE A CE2 1 
ATOM   1182 C CZ  . PHE A 1 170 ? -0.238  31.400 25.284 1.00 79.45  ? 665  PHE A CZ  1 
ATOM   1183 N N   . GLY A 1 171 ? -1.715  28.254 18.751 1.00 71.08  ? 666  GLY A N   1 
ATOM   1184 C CA  . GLY A 1 171 ? -2.323  27.433 17.712 1.00 71.78  ? 666  GLY A CA  1 
ATOM   1185 C C   . GLY A 1 171 ? -3.433  26.513 18.194 1.00 75.71  ? 666  GLY A C   1 
ATOM   1186 O O   . GLY A 1 171 ? -3.580  25.427 17.637 1.00 76.81  ? 666  GLY A O   1 
ATOM   1187 N N   . ILE A 1 172 ? -4.194  26.930 19.262 1.00 70.85  ? 667  ILE A N   1 
ATOM   1188 C CA  . ILE A 1 172 ? -5.345  26.231 19.874 1.00 70.28  ? 667  ILE A CA  1 
ATOM   1189 C C   . ILE A 1 172 ? -6.631  26.709 19.183 1.00 80.95  ? 667  ILE A C   1 
ATOM   1190 O O   . ILE A 1 172 ? -7.433  25.864 18.778 1.00 83.93  ? 667  ILE A O   1 
ATOM   1191 C CB  . ILE A 1 172 ? -5.476  26.374 21.432 1.00 70.33  ? 667  ILE A CB  1 
ATOM   1192 C CG1 . ILE A 1 172 ? -4.252  25.843 22.204 1.00 67.75  ? 667  ILE A CG1 1 
ATOM   1193 C CG2 . ILE A 1 172 ? -6.786  25.725 21.945 1.00 71.36  ? 667  ILE A CG2 1 
ATOM   1194 C CD1 . ILE A 1 172 ? -4.268  26.149 23.741 1.00 57.10  ? 667  ILE A CD1 1 
ATOM   1195 N N   . ALA A 1 173 ? -6.857  28.053 19.105 1.00 78.51  ? 668  ALA A N   1 
ATOM   1196 C CA  . ALA A 1 173 ? -8.036  28.641 18.456 1.00 79.60  ? 668  ALA A CA  1 
ATOM   1197 C C   . ALA A 1 173 ? -7.995  28.313 16.942 1.00 87.73  ? 668  ALA A C   1 
ATOM   1198 O O   . ALA A 1 173 ? -6.914  28.329 16.328 1.00 88.00  ? 668  ALA A O   1 
ATOM   1199 C CB  . ALA A 1 173 ? -8.066  30.148 18.680 1.00 79.39  ? 668  ALA A CB  1 
ATOM   1200 N N   . ASN A 1 174 ? -9.173  27.972 16.368 1.00 86.35  ? 669  ASN A N   1 
ATOM   1201 C CA  . ASN A 1 174 ? -9.389  27.571 14.964 1.00 123.27 ? 669  ASN A CA  1 
ATOM   1202 C C   . ASN A 1 174 ? -8.877  28.547 13.892 1.00 149.07 ? 669  ASN A C   1 
ATOM   1203 O O   . ASN A 1 174 ? -8.526  29.687 14.190 1.00 106.58 ? 669  ASN A O   1 
ATOM   1204 C CB  . ASN A 1 174 ? -10.874 27.204 14.714 1.00 123.74 ? 669  ASN A CB  1 
ATOM   1205 C CG  . ASN A 1 174 ? -11.332 25.891 15.323 1.00 138.82 ? 669  ASN A CG  1 
ATOM   1206 O OD1 . ASN A 1 174 ? -10.738 25.347 16.260 1.00 130.00 ? 669  ASN A OD1 1 
ATOM   1207 N ND2 . ASN A 1 174 ? -12.421 25.350 14.808 1.00 132.32 ? 669  ASN A ND2 1 
ATOM   1208 N N   . GLN A 1 188 ? 0.101   35.611 7.443  1.00 120.31 ? 683  GLN A N   1 
ATOM   1209 C CA  . GLN A 1 188 ? 0.529   34.381 6.774  1.00 120.64 ? 683  GLN A CA  1 
ATOM   1210 C C   . GLN A 1 188 ? -0.076  33.135 7.436  1.00 123.44 ? 683  GLN A C   1 
ATOM   1211 O O   . GLN A 1 188 ? 0.049   32.960 8.650  1.00 121.19 ? 683  GLN A O   1 
ATOM   1212 C CB  . GLN A 1 188 ? 2.065   34.285 6.728  1.00 121.65 ? 683  GLN A CB  1 
ATOM   1213 N N   . VAL A 1 189 ? -0.755  32.288 6.629  1.00 120.88 ? 684  VAL A N   1 
ATOM   1214 C CA  . VAL A 1 189 ? -1.411  31.040 7.053  1.00 119.56 ? 684  VAL A CA  1 
ATOM   1215 C C   . VAL A 1 189 ? -1.534  30.056 5.884  1.00 122.63 ? 684  VAL A C   1 
ATOM   1216 O O   . VAL A 1 189 ? -1.667  30.465 4.723  1.00 123.08 ? 684  VAL A O   1 
ATOM   1217 C CB  . VAL A 1 189 ? -2.781  31.278 7.742  1.00 122.87 ? 684  VAL A CB  1 
ATOM   1218 N N   . GLY A 1 190 ? -1.488  28.768 6.219  1.00 117.69 ? 685  GLY A N   1 
ATOM   1219 C CA  . GLY A 1 190 ? -1.550  27.673 5.257  1.00 118.90 ? 685  GLY A CA  1 
ATOM   1220 C C   . GLY A 1 190 ? -0.179  27.128 4.889  1.00 121.14 ? 685  GLY A C   1 
ATOM   1221 O O   . GLY A 1 190 ? -0.036  25.921 4.663  1.00 122.37 ? 685  GLY A O   1 
ATOM   1222 N N   . THR A 1 191 ? 0.851   28.022 4.862  1.00 113.60 ? 686  THR A N   1 
ATOM   1223 C CA  . THR A 1 191 ? 2.248   27.745 4.503  1.00 111.56 ? 686  THR A CA  1 
ATOM   1224 C C   . THR A 1 191 ? 2.831   26.420 5.058  1.00 111.89 ? 686  THR A C   1 
ATOM   1225 O O   . THR A 1 191 ? 2.874   26.196 6.274  1.00 110.18 ? 686  THR A O   1 
ATOM   1226 C CB  . THR A 1 191 ? 3.118   29.021 4.620  1.00 110.08 ? 686  THR A CB  1 
ATOM   1227 O OG1 . THR A 1 191 ? 4.230   28.946 3.723  1.00 107.91 ? 686  THR A OG1 1 
ATOM   1228 C CG2 . THR A 1 191 ? 3.560   29.332 6.050  1.00 102.33 ? 686  THR A CG2 1 
ATOM   1229 N N   . VAL A 1 192 ? 3.230   25.529 4.139  1.00 106.57 ? 687  VAL A N   1 
ATOM   1230 C CA  . VAL A 1 192 ? 3.796   24.223 4.485  1.00 104.16 ? 687  VAL A CA  1 
ATOM   1231 C C   . VAL A 1 192 ? 5.329   24.252 4.656  1.00 103.47 ? 687  VAL A C   1 
ATOM   1232 O O   . VAL A 1 192 ? 5.918   23.234 5.021  1.00 103.18 ? 687  VAL A O   1 
ATOM   1233 C CB  . VAL A 1 192 ? 3.316   23.105 3.529  1.00 109.85 ? 687  VAL A CB  1 
ATOM   1234 C CG1 . VAL A 1 192 ? 1.817   22.884 3.669  1.00 109.80 ? 687  VAL A CG1 1 
ATOM   1235 C CG2 . VAL A 1 192 ? 3.691   23.407 2.080  1.00 112.03 ? 687  VAL A CG2 1 
ATOM   1236 N N   . ASN A 1 193 ? 5.960   25.424 4.424  1.00 96.36  ? 688  ASN A N   1 
ATOM   1237 C CA  . ASN A 1 193 ? 7.413   25.650 4.497  1.00 94.41  ? 688  ASN A CA  1 
ATOM   1238 C C   . ASN A 1 193 ? 8.039   25.417 5.869  1.00 93.47  ? 688  ASN A C   1 
ATOM   1239 O O   . ASN A 1 193 ? 9.256   25.201 5.950  1.00 92.84  ? 688  ASN A O   1 
ATOM   1240 C CB  . ASN A 1 193 ? 7.763   27.051 3.997  1.00 94.10  ? 688  ASN A CB  1 
ATOM   1241 C CG  . ASN A 1 193 ? 7.500   27.259 2.531  1.00 113.07 ? 688  ASN A CG  1 
ATOM   1242 O OD1 . ASN A 1 193 ? 8.254   26.796 1.671  1.00 105.97 ? 688  ASN A OD1 1 
ATOM   1243 N ND2 . ASN A 1 193 ? 6.426   27.970 2.217  1.00 105.76 ? 688  ASN A ND2 1 
ATOM   1244 N N   . TYR A 1 194 ? 7.209   25.476 6.940  1.00 86.30  ? 689  TYR A N   1 
ATOM   1245 C CA  . TYR A 1 194 ? 7.609   25.321 8.344  1.00 82.96  ? 689  TYR A CA  1 
ATOM   1246 C C   . TYR A 1 194 ? 7.049   24.035 8.983  1.00 86.51  ? 689  TYR A C   1 
ATOM   1247 O O   . TYR A 1 194 ? 7.258   23.793 10.174 1.00 84.04  ? 689  TYR A O   1 
ATOM   1248 C CB  . TYR A 1 194 ? 7.161   26.553 9.151  1.00 81.29  ? 689  TYR A CB  1 
ATOM   1249 C CG  . TYR A 1 194 ? 7.702   27.866 8.631  1.00 81.74  ? 689  TYR A CG  1 
ATOM   1250 C CD1 . TYR A 1 194 ? 7.040   28.566 7.628  1.00 84.80  ? 689  TYR A CD1 1 
ATOM   1251 C CD2 . TYR A 1 194 ? 8.850   28.432 9.170  1.00 81.46  ? 689  TYR A CD2 1 
ATOM   1252 C CE1 . TYR A 1 194 ? 7.534   29.770 7.140  1.00 85.82  ? 689  TYR A CE1 1 
ATOM   1253 C CE2 . TYR A 1 194 ? 9.348   29.644 8.699  1.00 82.74  ? 689  TYR A CE2 1 
ATOM   1254 C CZ  . TYR A 1 194 ? 8.681   30.312 7.688  1.00 92.05  ? 689  TYR A CZ  1 
ATOM   1255 O OH  . TYR A 1 194 ? 9.158   31.506 7.209  1.00 96.92  ? 689  TYR A OH  1 
ATOM   1256 N N   . MET A 1 195 ? 6.361   23.210 8.183  1.00 85.43  ? 690  MET A N   1 
ATOM   1257 C CA  . MET A 1 195 ? 5.708   21.982 8.607  1.00 86.12  ? 690  MET A CA  1 
ATOM   1258 C C   . MET A 1 195 ? 6.681   20.837 8.905  1.00 90.39  ? 690  MET A C   1 
ATOM   1259 O O   . MET A 1 195 ? 7.484   20.511 8.032  1.00 90.75  ? 690  MET A O   1 
ATOM   1260 C CB  . MET A 1 195 ? 4.709   21.558 7.532  1.00 91.05  ? 690  MET A CB  1 
ATOM   1261 C CG  . MET A 1 195 ? 3.546   20.779 8.062  1.00 95.89  ? 690  MET A CG  1 
ATOM   1262 S SD  . MET A 1 195 ? 2.266   20.608 6.803  1.00 103.17 ? 690  MET A SD  1 
ATOM   1263 C CE  . MET A 1 195 ? 1.259   22.044 7.181  1.00 98.16  ? 690  MET A CE  1 
ATOM   1264 N N   . PRO A 1 196 ? 6.597   20.191 10.105 1.00 87.18  ? 691  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 196 ? 7.481   19.043 10.400 1.00 87.88  ? 691  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 196 ? 7.096   17.777 9.631  1.00 94.35  ? 691  PRO A C   1 
ATOM   1267 O O   . PRO A 1 196 ? 5.910   17.611 9.350  1.00 95.46  ? 691  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 196 ? 7.331   18.845 11.911 1.00 88.33  ? 691  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 196 ? 6.027   19.406 12.244 1.00 92.41  ? 691  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 196 ? 5.689   20.473 11.237 1.00 87.86  ? 691  PRO A CD  1 
ATOM   1271 N N   . PRO A 1 197 ? 8.049   16.868 9.294  1.00 91.89  ? 692  PRO A N   1 
ATOM   1272 C CA  . PRO A 1 197 ? 7.683   15.667 8.516  1.00 94.83  ? 692  PRO A CA  1 
ATOM   1273 C C   . PRO A 1 197 ? 6.561   14.818 9.108  1.00 101.25 ? 692  PRO A C   1 
ATOM   1274 O O   . PRO A 1 197 ? 5.720   14.336 8.352  1.00 102.97 ? 692  PRO A O   1 
ATOM   1275 C CB  . PRO A 1 197 ? 8.996   14.894 8.411  1.00 97.55  ? 692  PRO A CB  1 
ATOM   1276 C CG  . PRO A 1 197 ? 10.052  15.927 8.577  1.00 99.90  ? 692  PRO A CG  1 
ATOM   1277 C CD  . PRO A 1 197 ? 9.503   16.919 9.543  1.00 92.60  ? 692  PRO A CD  1 
ATOM   1278 N N   . GLU A 1 198 ? 6.522   14.677 10.451 1.00 97.89  ? 693  GLU A N   1 
ATOM   1279 C CA  . GLU A 1 198 ? 5.498   13.908 11.180 1.00 99.01  ? 693  GLU A CA  1 
ATOM   1280 C C   . GLU A 1 198 ? 4.060   14.437 10.996 1.00 104.42 ? 693  GLU A C   1 
ATOM   1281 O O   . GLU A 1 198 ? 3.111   13.640 10.943 1.00 106.59 ? 693  GLU A O   1 
ATOM   1282 C CB  . GLU A 1 198 ? 5.861   13.736 12.670 1.00 98.74  ? 693  GLU A CB  1 
ATOM   1283 C CG  . GLU A 1 198 ? 6.030   15.024 13.462 1.00 101.25 ? 693  GLU A CG  1 
ATOM   1284 C CD  . GLU A 1 198 ? 7.454   15.512 13.623 1.00 101.50 ? 693  GLU A CD  1 
ATOM   1285 O OE1 . GLU A 1 198 ? 8.280   15.299 12.705 1.00 75.43  ? 693  GLU A OE1 1 
ATOM   1286 O OE2 . GLU A 1 198 ? 7.743   16.114 14.679 1.00 93.64  ? 693  GLU A OE2 1 
ATOM   1287 N N   . ALA A 1 199 ? 3.915   15.775 10.878 1.00 99.09  ? 694  ALA A N   1 
ATOM   1288 C CA  . ALA A 1 199 ? 2.643   16.447 10.630 1.00 99.23  ? 694  ALA A CA  1 
ATOM   1289 C C   . ALA A 1 199 ? 2.170   16.113 9.204  1.00 107.73 ? 694  ALA A C   1 
ATOM   1290 O O   . ALA A 1 199 ? 0.970   15.926 8.975  1.00 108.79 ? 694  ALA A O   1 
ATOM   1291 C CB  . ALA A 1 199 ? 2.811   17.949 10.788 1.00 97.42  ? 694  ALA A CB  1 
ATOM   1292 N N   . ILE A 1 200 ? 3.128   15.993 8.262  1.00 106.36 ? 695  ILE A N   1 
ATOM   1293 C CA  . ILE A 1 200 ? 2.873   15.658 6.863  1.00 109.48 ? 695  ILE A CA  1 
ATOM   1294 C C   . ILE A 1 200 ? 2.516   14.177 6.683  1.00 118.61 ? 695  ILE A C   1 
ATOM   1295 O O   . ILE A 1 200 ? 1.594   13.871 5.921  1.00 120.74 ? 695  ILE A O   1 
ATOM   1296 C CB  . ILE A 1 200 ? 4.035   16.140 5.951  1.00 112.49 ? 695  ILE A CB  1 
ATOM   1297 C CG1 . ILE A 1 200 ? 4.208   17.666 6.081  1.00 109.84 ? 695  ILE A CG1 1 
ATOM   1298 C CG2 . ILE A 1 200 ? 3.813   15.737 4.480  1.00 116.52 ? 695  ILE A CG2 1 
ATOM   1299 C CD1 . ILE A 1 200 ? 5.536   18.177 5.810  1.00 112.60 ? 695  ILE A CD1 1 
ATOM   1300 N N   . LYS A 1 201 ? 3.206   13.271 7.415  1.00 117.10 ? 696  LYS A N   1 
ATOM   1301 C CA  . LYS A 1 201 ? 3.008   11.812 7.359  1.00 120.83 ? 696  LYS A CA  1 
ATOM   1302 C C   . LYS A 1 201 ? 1.571   11.311 7.696  1.00 128.17 ? 696  LYS A C   1 
ATOM   1303 O O   . LYS A 1 201 ? 1.330   10.099 7.678  1.00 131.53 ? 696  LYS A O   1 
ATOM   1304 C CB  . LYS A 1 201 ? 4.094   11.079 8.172  1.00 122.88 ? 696  LYS A CB  1 
ATOM   1305 N N   . ASP A 1 202 ? 0.616   12.245 7.938  1.00 122.95 ? 697  ASP A N   1 
ATOM   1306 C CA  . ASP A 1 202 ? -0.790  11.959 8.245  1.00 140.00 ? 697  ASP A CA  1 
ATOM   1307 C C   . ASP A 1 202 ? -1.734  12.559 7.189  1.00 143.45 ? 697  ASP A C   1 
ATOM   1308 O O   . ASP A 1 202 ? -1.759  12.110 6.041  1.00 99.08  ? 697  ASP A O   1 
ATOM   1309 C CB  . ASP A 1 202 ? -1.147  12.471 9.657  1.00 138.74 ? 697  ASP A CB  1 
ATOM   1310 C CG  . ASP A 1 202 ? -0.346  11.838 10.791 1.00 146.57 ? 697  ASP A CG  1 
ATOM   1311 O OD1 . ASP A 1 202 ? 0.131   10.693 10.620 1.00 149.77 ? 697  ASP A OD1 1 
ATOM   1312 O OD2 . ASP A 1 202 ? -0.226  12.475 11.862 1.00 148.10 ? 697  ASP A OD2 1 
ATOM   1313 N N   . ILE A 1 216 ? 2.955   13.996 16.591 1.00 91.17  ? 711  ILE A N   1 
ATOM   1314 C CA  . ILE A 1 216 ? 3.076   15.404 17.020 1.00 88.80  ? 711  ILE A CA  1 
ATOM   1315 C C   . ILE A 1 216 ? 3.373   15.593 18.543 1.00 89.49  ? 711  ILE A C   1 
ATOM   1316 O O   . ILE A 1 216 ? 2.488   15.474 19.403 1.00 90.42  ? 711  ILE A O   1 
ATOM   1317 C CB  . ILE A 1 216 ? 2.004   16.375 16.411 1.00 91.49  ? 711  ILE A CB  1 
ATOM   1318 C CG1 . ILE A 1 216 ? 2.033   16.336 14.854 1.00 94.03  ? 711  ILE A CG1 1 
ATOM   1319 C CG2 . ILE A 1 216 ? 2.174   17.820 16.918 1.00 88.42  ? 711  ILE A CG2 1 
ATOM   1320 C CD1 . ILE A 1 216 ? 0.959   15.380 14.173 1.00 109.07 ? 711  ILE A CD1 1 
ATOM   1321 N N   . SER A 1 217 ? 4.650   15.882 18.827 1.00 80.59  ? 712  SER A N   1 
ATOM   1322 C CA  . SER A 1 217 ? 5.276   16.047 20.130 1.00 77.47  ? 712  SER A CA  1 
ATOM   1323 C C   . SER A 1 217 ? 5.996   17.393 20.125 1.00 76.42  ? 712  SER A C   1 
ATOM   1324 O O   . SER A 1 217 ? 6.188   17.933 19.033 1.00 77.10  ? 712  SER A O   1 
ATOM   1325 C CB  . SER A 1 217 ? 6.331   14.953 20.299 1.00 81.40  ? 712  SER A CB  1 
ATOM   1326 O OG  . SER A 1 217 ? 7.377   15.066 19.343 1.00 85.30  ? 712  SER A OG  1 
ATOM   1327 N N   . PRO A 1 218 ? 6.526   17.901 21.268 1.00 67.21  ? 713  PRO A N   1 
ATOM   1328 C CA  . PRO A 1 218 ? 7.296   19.152 21.232 1.00 64.12  ? 713  PRO A CA  1 
ATOM   1329 C C   . PRO A 1 218 ? 8.389   19.216 20.157 1.00 68.20  ? 713  PRO A C   1 
ATOM   1330 O O   . PRO A 1 218 ? 8.738   20.313 19.708 1.00 67.77  ? 713  PRO A O   1 
ATOM   1331 C CB  . PRO A 1 218 ? 7.892   19.208 22.621 1.00 65.70  ? 713  PRO A CB  1 
ATOM   1332 C CG  . PRO A 1 218 ? 6.883   18.552 23.460 1.00 71.70  ? 713  PRO A CG  1 
ATOM   1333 C CD  . PRO A 1 218 ? 6.421   17.399 22.651 1.00 68.79  ? 713  PRO A CD  1 
ATOM   1334 N N   . LYS A 1 219 ? 8.897   18.046 19.711 1.00 65.09  ? 714  LYS A N   1 
ATOM   1335 C CA  . LYS A 1 219 ? 9.893   17.946 18.647 1.00 64.84  ? 714  LYS A CA  1 
ATOM   1336 C C   . LYS A 1 219 ? 9.369   18.586 17.356 1.00 71.68  ? 714  LYS A C   1 
ATOM   1337 O O   . LYS A 1 219 ? 10.172  19.104 16.590 1.00 73.31  ? 714  LYS A O   1 
ATOM   1338 C CB  . LYS A 1 219 ? 10.327  16.487 18.404 1.00 67.64  ? 714  LYS A CB  1 
ATOM   1339 C CG  . LYS A 1 219 ? 11.087  15.826 19.558 1.00 76.08  ? 714  LYS A CG  1 
ATOM   1340 C CD  . LYS A 1 219 ? 12.528  16.322 19.712 1.00 83.90  ? 714  LYS A CD  1 
ATOM   1341 C CE  . LYS A 1 219 ? 13.206  15.718 20.914 1.00 97.00  ? 714  LYS A CE  1 
ATOM   1342 N NZ  . LYS A 1 219 ? 13.921  14.451 20.582 1.00 107.79 ? 714  LYS A NZ  1 
ATOM   1343 N N   . SER A 1 220 ? 8.029   18.601 17.136 1.00 68.23  ? 715  SER A N   1 
ATOM   1344 C CA  . SER A 1 220 ? 7.390   19.228 15.970 1.00 67.90  ? 715  SER A CA  1 
ATOM   1345 C C   . SER A 1 220 ? 7.672   20.743 15.963 1.00 71.20  ? 715  SER A C   1 
ATOM   1346 O O   . SER A 1 220 ? 8.007   21.302 14.913 1.00 72.32  ? 715  SER A O   1 
ATOM   1347 C CB  . SER A 1 220 ? 5.885   18.979 15.979 1.00 71.03  ? 715  SER A CB  1 
ATOM   1348 O OG  . SER A 1 220 ? 5.571   17.634 16.300 1.00 80.73  ? 715  SER A OG  1 
ATOM   1349 N N   . ASP A 1 221 ? 7.595   21.388 17.148 1.00 65.14  ? 716  ASP A N   1 
ATOM   1350 C CA  . ASP A 1 221 ? 7.862   22.816 17.305 1.00 62.57  ? 716  ASP A CA  1 
ATOM   1351 C C   . ASP A 1 221 ? 9.315   23.114 17.111 1.00 67.56  ? 716  ASP A C   1 
ATOM   1352 O O   . ASP A 1 221 ? 9.627   24.217 16.670 1.00 68.03  ? 716  ASP A O   1 
ATOM   1353 C CB  . ASP A 1 221 ? 7.334   23.355 18.641 1.00 62.37  ? 716  ASP A CB  1 
ATOM   1354 C CG  . ASP A 1 221 ? 5.814   23.454 18.692 1.00 63.38  ? 716  ASP A CG  1 
ATOM   1355 O OD1 . ASP A 1 221 ? 5.185   23.660 17.608 1.00 64.34  ? 716  ASP A OD1 1 
ATOM   1356 O OD2 . ASP A 1 221 ? 5.251   23.335 19.805 1.00 59.15  ? 716  ASP A OD2 1 
ATOM   1357 N N   . VAL A 1 222 ? 10.205  22.127 17.379 1.00 64.39  ? 717  VAL A N   1 
ATOM   1358 C CA  . VAL A 1 222 ? 11.648  22.274 17.152 1.00 64.19  ? 717  VAL A CA  1 
ATOM   1359 C C   . VAL A 1 222 ? 11.903  22.329 15.643 1.00 68.99  ? 717  VAL A C   1 
ATOM   1360 O O   . VAL A 1 222 ? 12.696  23.160 15.209 1.00 68.86  ? 717  VAL A O   1 
ATOM   1361 C CB  . VAL A 1 222 ? 12.519  21.200 17.852 1.00 68.29  ? 717  VAL A CB  1 
ATOM   1362 C CG1 . VAL A 1 222 ? 14.001  21.381 17.519 1.00 68.44  ? 717  VAL A CG1 1 
ATOM   1363 C CG2 . VAL A 1 222 ? 12.308  21.218 19.357 1.00 67.47  ? 717  VAL A CG2 1 
ATOM   1364 N N   . TRP A 1 223 ? 11.207  21.496 14.843 1.00 66.58  ? 718  TRP A N   1 
ATOM   1365 C CA  . TRP A 1 223 ? 11.377  21.521 13.387 1.00 68.27  ? 718  TRP A CA  1 
ATOM   1366 C C   . TRP A 1 223 ? 11.079  22.914 12.802 1.00 71.62  ? 718  TRP A C   1 
ATOM   1367 O O   . TRP A 1 223 ? 11.878  23.452 12.020 1.00 69.85  ? 718  TRP A O   1 
ATOM   1368 C CB  . TRP A 1 223 ? 10.490  20.475 12.694 1.00 68.94  ? 718  TRP A CB  1 
ATOM   1369 C CG  . TRP A 1 223 ? 10.584  20.561 11.200 1.00 71.63  ? 718  TRP A CG  1 
ATOM   1370 C CD1 . TRP A 1 223 ? 9.952   21.460 10.392 1.00 74.96  ? 718  TRP A CD1 1 
ATOM   1371 C CD2 . TRP A 1 223 ? 11.468  19.811 10.353 1.00 73.89  ? 718  TRP A CD2 1 
ATOM   1372 N NE1 . TRP A 1 223 ? 10.365  21.301 9.089  1.00 76.32  ? 718  TRP A NE1 1 
ATOM   1373 C CE2 . TRP A 1 223 ? 11.291  20.289 9.033  1.00 78.82  ? 718  TRP A CE2 1 
ATOM   1374 C CE3 . TRP A 1 223 ? 12.386  18.767 10.577 1.00 76.05  ? 718  TRP A CE3 1 
ATOM   1375 C CZ2 . TRP A 1 223 ? 11.973  19.737 7.937  1.00 79.81  ? 718  TRP A CZ2 1 
ATOM   1376 C CZ3 . TRP A 1 223 ? 13.053  18.219 9.488  1.00 79.35  ? 718  TRP A CZ3 1 
ATOM   1377 C CH2 . TRP A 1 223 ? 12.853  18.709 8.191  1.00 80.88  ? 718  TRP A CH2 1 
ATOM   1378 N N   . SER A 1 224 ? 9.894   23.456 13.164 1.00 68.70  ? 719  SER A N   1 
ATOM   1379 C CA  . SER A 1 224 ? 9.373   24.748 12.722 1.00 68.45  ? 719  SER A CA  1 
ATOM   1380 C C   . SER A 1 224 ? 10.296  25.922 13.088 1.00 71.72  ? 719  SER A C   1 
ATOM   1381 O O   . SER A 1 224 ? 10.639  26.722 12.201 1.00 71.59  ? 719  SER A O   1 
ATOM   1382 C CB  . SER A 1 224 ? 7.965   24.959 13.263 1.00 71.82  ? 719  SER A CB  1 
ATOM   1383 O OG  . SER A 1 224 ? 7.102   23.911 12.845 1.00 85.43  ? 719  SER A OG  1 
ATOM   1384 N N   . LEU A 1 225 ? 10.740  25.980 14.378 1.00 66.25  ? 720  LEU A N   1 
ATOM   1385 C CA  . LEU A 1 225 ? 11.646  26.997 14.915 1.00 64.80  ? 720  LEU A CA  1 
ATOM   1386 C C   . LEU A 1 225 ? 12.962  27.027 14.164 1.00 71.08  ? 720  LEU A C   1 
ATOM   1387 O O   . LEU A 1 225 ? 13.489  28.106 13.907 1.00 72.21  ? 720  LEU A O   1 
ATOM   1388 C CB  . LEU A 1 225 ? 11.902  26.792 16.406 1.00 63.58  ? 720  LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 225 ? 10.870  27.352 17.351 1.00 66.94  ? 720  LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 225 ? 11.031  26.745 18.692 1.00 66.53  ? 720  LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 225 ? 11.029  28.834 17.500 1.00 70.27  ? 720  LEU A CD2 1 
ATOM   1392 N N   . GLY A 1 226 ? 13.453  25.857 13.786 1.00 68.65  ? 721  GLY A N   1 
ATOM   1393 C CA  . GLY A 1 226 ? 14.667  25.727 12.999 1.00 70.36  ? 721  GLY A CA  1 
ATOM   1394 C C   . GLY A 1 226 ? 14.491  26.341 11.620 1.00 77.85  ? 721  GLY A C   1 
ATOM   1395 O O   . GLY A 1 226 ? 15.363  27.096 11.179 1.00 79.25  ? 721  GLY A O   1 
ATOM   1396 N N   . CYS A 1 227 ? 13.333  26.071 10.948 1.00 74.70  ? 722  CYS A N   1 
ATOM   1397 C CA  . CYS A 1 227 ? 12.999  26.662 9.641  1.00 75.36  ? 722  CYS A CA  1 
ATOM   1398 C C   . CYS A 1 227 ? 13.046  28.193 9.750  1.00 78.65  ? 722  CYS A C   1 
ATOM   1399 O O   . CYS A 1 227 ? 13.586  28.841 8.850  1.00 79.51  ? 722  CYS A O   1 
ATOM   1400 C CB  . CYS A 1 227 ? 11.631  26.194 9.152  1.00 75.83  ? 722  CYS A CB  1 
ATOM   1401 S SG  . CYS A 1 227 ? 11.561  24.460 8.645  1.00 80.91  ? 722  CYS A SG  1 
ATOM   1402 N N   . ILE A 1 228 ? 12.479  28.762 10.858 1.00 72.90  ? 723  ILE A N   1 
ATOM   1403 C CA  . ILE A 1 228 ? 12.459  30.203 11.133 1.00 71.87  ? 723  ILE A CA  1 
ATOM   1404 C C   . ILE A 1 228 ? 13.892  30.715 11.175 1.00 77.75  ? 723  ILE A C   1 
ATOM   1405 O O   . ILE A 1 228 ? 14.215  31.679 10.475 1.00 79.59  ? 723  ILE A O   1 
ATOM   1406 C CB  . ILE A 1 228 ? 11.643  30.588 12.405 1.00 72.76  ? 723  ILE A CB  1 
ATOM   1407 C CG1 . ILE A 1 228 ? 10.160  30.219 12.231 1.00 72.55  ? 723  ILE A CG1 1 
ATOM   1408 C CG2 . ILE A 1 228 ? 11.775  32.091 12.718 1.00 73.05  ? 723  ILE A CG2 1 
ATOM   1409 C CD1 . ILE A 1 228 ? 9.321   30.083 13.526 1.00 77.30  ? 723  ILE A CD1 1 
ATOM   1410 N N   . LEU A 1 229 ? 14.759  30.040 11.943 1.00 73.08  ? 724  LEU A N   1 
ATOM   1411 C CA  . LEU A 1 229 ? 16.170  30.411 12.052 1.00 73.42  ? 724  LEU A CA  1 
ATOM   1412 C C   . LEU A 1 229 ? 16.864  30.328 10.691 1.00 78.75  ? 724  LEU A C   1 
ATOM   1413 O O   . LEU A 1 229 ? 17.534  31.285 10.309 1.00 79.04  ? 724  LEU A O   1 
ATOM   1414 C CB  . LEU A 1 229 ? 16.880  29.561 13.120 1.00 72.78  ? 724  LEU A CB  1 
ATOM   1415 C CG  . LEU A 1 229 ? 18.249  30.016 13.624 1.00 77.84  ? 724  LEU A CG  1 
ATOM   1416 C CD1 . LEU A 1 229 ? 18.214  31.407 14.238 1.00 77.67  ? 724  LEU A CD1 1 
ATOM   1417 C CD2 . LEU A 1 229 ? 18.766  29.051 14.643 1.00 80.22  ? 724  LEU A CD2 1 
ATOM   1418 N N   . TYR A 1 230 ? 16.615  29.235 9.930  1.00 75.94  ? 725  TYR A N   1 
ATOM   1419 C CA  . TYR A 1 230 ? 17.119  28.983 8.574  1.00 77.64  ? 725  TYR A CA  1 
ATOM   1420 C C   . TYR A 1 230 ? 16.760  30.159 7.628  1.00 82.82  ? 725  TYR A C   1 
ATOM   1421 O O   . TYR A 1 230 ? 17.574  30.559 6.791  1.00 83.64  ? 725  TYR A O   1 
ATOM   1422 C CB  . TYR A 1 230 ? 16.520  27.669 8.052  1.00 79.71  ? 725  TYR A CB  1 
ATOM   1423 C CG  . TYR A 1 230 ? 17.226  27.112 6.843  1.00 85.22  ? 725  TYR A CG  1 
ATOM   1424 C CD1 . TYR A 1 230 ? 16.954  27.595 5.569  1.00 89.34  ? 725  TYR A CD1 1 
ATOM   1425 C CD2 . TYR A 1 230 ? 18.153  26.087 6.968  1.00 87.41  ? 725  TYR A CD2 1 
ATOM   1426 C CE1 . TYR A 1 230 ? 17.629  27.112 4.453  1.00 93.28  ? 725  TYR A CE1 1 
ATOM   1427 C CE2 . TYR A 1 230 ? 18.805  25.561 5.852  1.00 91.05  ? 725  TYR A CE2 1 
ATOM   1428 C CZ  . TYR A 1 230 ? 18.541  26.081 4.596  1.00 103.36 ? 725  TYR A CZ  1 
ATOM   1429 O OH  . TYR A 1 230 ? 19.200  25.599 3.492  1.00 111.42 ? 725  TYR A OH  1 
ATOM   1430 N N   . TYR A 1 231 ? 15.549  30.718 7.783  1.00 78.78  ? 726  TYR A N   1 
ATOM   1431 C CA  . TYR A 1 231 ? 15.110  31.862 7.002  1.00 79.68  ? 726  TYR A CA  1 
ATOM   1432 C C   . TYR A 1 231 ? 15.901  33.095 7.417  1.00 81.86  ? 726  TYR A C   1 
ATOM   1433 O O   . TYR A 1 231 ? 16.277  33.863 6.544  1.00 84.35  ? 726  TYR A O   1 
ATOM   1434 C CB  . TYR A 1 231 ? 13.592  32.060 7.143  1.00 81.51  ? 726  TYR A CB  1 
ATOM   1435 C CG  . TYR A 1 231 ? 12.974  33.184 6.330  1.00 86.97  ? 726  TYR A CG  1 
ATOM   1436 C CD1 . TYR A 1 231 ? 13.339  33.399 5.002  1.00 91.60  ? 726  TYR A CD1 1 
ATOM   1437 C CD2 . TYR A 1 231 ? 11.938  33.959 6.852  1.00 87.61  ? 726  TYR A CD2 1 
ATOM   1438 C CE1 . TYR A 1 231 ? 12.762  34.424 4.247  1.00 94.24  ? 726  TYR A CE1 1 
ATOM   1439 C CE2 . TYR A 1 231 ? 11.347  34.980 6.105  1.00 90.32  ? 726  TYR A CE2 1 
ATOM   1440 C CZ  . TYR A 1 231 ? 11.764  35.209 4.803  1.00 100.37 ? 726  TYR A CZ  1 
ATOM   1441 O OH  . TYR A 1 231 ? 11.174  36.208 4.069  1.00 103.48 ? 726  TYR A OH  1 
ATOM   1442 N N   . MET A 1 232 ? 16.233  33.249 8.721  1.00 74.46  ? 727  MET A N   1 
ATOM   1443 C CA  . MET A 1 232 ? 17.011  34.403 9.204  1.00 73.37  ? 727  MET A CA  1 
ATOM   1444 C C   . MET A 1 232 ? 18.511  34.200 8.974  1.00 78.48  ? 727  MET A C   1 
ATOM   1445 O O   . MET A 1 232 ? 19.287  35.130 9.169  1.00 79.13  ? 727  MET A O   1 
ATOM   1446 C CB  . MET A 1 232 ? 16.743  34.704 10.692 1.00 73.67  ? 727  MET A CB  1 
ATOM   1447 C CG  . MET A 1 232 ? 15.267  34.761 11.072 1.00 75.59  ? 727  MET A CG  1 
ATOM   1448 S SD  . MET A 1 232 ? 14.888  35.126 12.816 1.00 77.64  ? 727  MET A SD  1 
ATOM   1449 C CE  . MET A 1 232 ? 15.588  33.768 13.594 1.00 73.42  ? 727  MET A CE  1 
ATOM   1450 N N   . THR A 1 233 ? 18.920  32.988 8.574  1.00 75.43  ? 728  THR A N   1 
ATOM   1451 C CA  . THR A 1 233 ? 20.327  32.626 8.343  1.00 76.32  ? 728  THR A CA  1 
ATOM   1452 C C   . THR A 1 233 ? 20.640  32.630 6.852  1.00 82.06  ? 728  THR A C   1 
ATOM   1453 O O   . THR A 1 233 ? 21.591  33.288 6.437  1.00 82.26  ? 728  THR A O   1 
ATOM   1454 C CB  . THR A 1 233 ? 20.647  31.266 9.034  1.00 82.01  ? 728  THR A CB  1 
ATOM   1455 O OG1 . THR A 1 233 ? 20.577  31.417 10.454 1.00 81.30  ? 728  THR A OG1 1 
ATOM   1456 C CG2 . THR A 1 233 ? 22.000  30.699 8.652  1.00 80.23  ? 728  THR A CG2 1 
ATOM   1457 N N   . TYR A 1 234 ? 19.832  31.899 6.057  1.00 80.45  ? 729  TYR A N   1 
ATOM   1458 C CA  . TYR A 1 234 ? 20.008  31.720 4.615  1.00 83.10  ? 729  TYR A CA  1 
ATOM   1459 C C   . TYR A 1 234 ? 19.119  32.566 3.684  1.00 89.01  ? 729  TYR A C   1 
ATOM   1460 O O   . TYR A 1 234 ? 19.348  32.557 2.472  1.00 90.97  ? 729  TYR A O   1 
ATOM   1461 C CB  . TYR A 1 234 ? 19.975  30.226 4.250  1.00 84.54  ? 729  TYR A CB  1 
ATOM   1462 C CG  . TYR A 1 234 ? 21.073  29.426 4.919  1.00 86.68  ? 729  TYR A CG  1 
ATOM   1463 C CD1 . TYR A 1 234 ? 22.415  29.738 4.715  1.00 90.42  ? 729  TYR A CD1 1 
ATOM   1464 C CD2 . TYR A 1 234 ? 20.774  28.351 5.749  1.00 85.99  ? 729  TYR A CD2 1 
ATOM   1465 C CE1 . TYR A 1 234 ? 23.431  29.019 5.344  1.00 91.13  ? 729  TYR A CE1 1 
ATOM   1466 C CE2 . TYR A 1 234 ? 21.783  27.595 6.347  1.00 86.86  ? 729  TYR A CE2 1 
ATOM   1467 C CZ  . TYR A 1 234 ? 23.112  27.935 6.146  1.00 96.74  ? 729  TYR A CZ  1 
ATOM   1468 O OH  . TYR A 1 234 ? 24.121  27.206 6.737  1.00 99.26  ? 729  TYR A OH  1 
ATOM   1469 N N   . GLY A 1 235 ? 18.149  33.294 4.254  1.00 84.13  ? 730  GLY A N   1 
ATOM   1470 C CA  . GLY A 1 235 ? 17.243  34.178 3.517  1.00 84.57  ? 730  GLY A CA  1 
ATOM   1471 C C   . GLY A 1 235 ? 16.047  33.523 2.850  1.00 88.07  ? 730  GLY A C   1 
ATOM   1472 O O   . GLY A 1 235 ? 15.272  34.199 2.170  1.00 88.99  ? 730  GLY A O   1 
ATOM   1473 N N   . LYS A 1 236 ? 15.881  32.208 3.045  1.00 83.65  ? 731  LYS A N   1 
ATOM   1474 C CA  . LYS A 1 236 ? 14.796  31.398 2.491  1.00 83.56  ? 731  LYS A CA  1 
ATOM   1475 C C   . LYS A 1 236 ? 14.479  30.251 3.464  1.00 85.16  ? 731  LYS A C   1 
ATOM   1476 O O   . LYS A 1 236 ? 15.312  29.925 4.308  1.00 83.45  ? 731  LYS A O   1 
ATOM   1477 C CB  . LYS A 1 236 ? 15.227  30.832 1.120  1.00 88.56  ? 731  LYS A CB  1 
ATOM   1478 N N   . THR A 1 237 ? 13.305  29.614 3.341  1.00 81.83  ? 732  THR A N   1 
ATOM   1479 C CA  . THR A 1 237 ? 13.027  28.444 4.179  1.00 80.59  ? 732  THR A CA  1 
ATOM   1480 C C   . THR A 1 237 ? 13.783  27.252 3.545  1.00 86.66  ? 732  THR A C   1 
ATOM   1481 O O   . THR A 1 237 ? 14.156  27.355 2.373  1.00 88.13  ? 732  THR A O   1 
ATOM   1482 C CB  . THR A 1 237 ? 11.517  28.193 4.400  1.00 90.98  ? 732  THR A CB  1 
ATOM   1483 O OG1 . THR A 1 237 ? 10.884  27.777 3.194  1.00 94.96  ? 732  THR A OG1 1 
ATOM   1484 C CG2 . THR A 1 237 ? 10.802  29.374 5.038  1.00 88.42  ? 732  THR A CG2 1 
ATOM   1485 N N   . PRO A 1 238 ? 14.060  26.134 4.264  1.00 83.31  ? 733  PRO A N   1 
ATOM   1486 C CA  . PRO A 1 238 ? 14.798  25.025 3.631  1.00 84.46  ? 733  PRO A CA  1 
ATOM   1487 C C   . PRO A 1 238 ? 14.219  24.533 2.300  1.00 91.01  ? 733  PRO A C   1 
ATOM   1488 O O   . PRO A 1 238 ? 14.989  24.182 1.406  1.00 92.84  ? 733  PRO A O   1 
ATOM   1489 C CB  . PRO A 1 238 ? 14.754  23.926 4.693  1.00 84.64  ? 733  PRO A CB  1 
ATOM   1490 C CG  . PRO A 1 238 ? 14.589  24.635 5.957  1.00 86.79  ? 733  PRO A CG  1 
ATOM   1491 C CD  . PRO A 1 238 ? 13.726  25.809 5.668  1.00 82.58  ? 733  PRO A CD  1 
ATOM   1492 N N   . PHE A 1 239 ? 12.876  24.543 2.157  1.00 87.30  ? 734  PHE A N   1 
ATOM   1493 C CA  . PHE A 1 239 ? 12.192  24.046 0.960  1.00 89.37  ? 734  PHE A CA  1 
ATOM   1494 C C   . PHE A 1 239 ? 11.527  25.121 0.106  1.00 94.02  ? 734  PHE A C   1 
ATOM   1495 O O   . PHE A 1 239 ? 10.849  24.783 -0.869 1.00 95.79  ? 734  PHE A O   1 
ATOM   1496 C CB  . PHE A 1 239 ? 11.237  22.880 1.313  1.00 91.07  ? 734  PHE A CB  1 
ATOM   1497 C CG  . PHE A 1 239 ? 11.934  21.758 2.050  1.00 92.11  ? 734  PHE A CG  1 
ATOM   1498 C CD1 . PHE A 1 239 ? 12.602  20.757 1.354  1.00 98.04  ? 734  PHE A CD1 1 
ATOM   1499 C CD2 . PHE A 1 239 ? 11.989  21.745 3.440  1.00 91.21  ? 734  PHE A CD2 1 
ATOM   1500 C CE1 . PHE A 1 239 ? 13.287  19.744 2.035  1.00 98.35  ? 734  PHE A CE1 1 
ATOM   1501 C CE2 . PHE A 1 239 ? 12.671  20.735 4.119  1.00 93.54  ? 734  PHE A CE2 1 
ATOM   1502 C CZ  . PHE A 1 239 ? 13.317  19.743 3.413  1.00 94.18  ? 734  PHE A CZ  1 
ATOM   1503 N N   . GLN A 1 240 ? 11.785  26.415 0.421  1.00 89.49  ? 735  GLN A N   1 
ATOM   1504 C CA  . GLN A 1 240 ? 11.265  27.588 -0.308 1.00 90.63  ? 735  GLN A CA  1 
ATOM   1505 C C   . GLN A 1 240 ? 11.568  27.503 -1.809 1.00 99.97  ? 735  GLN A C   1 
ATOM   1506 O O   . GLN A 1 240 ? 10.743  27.919 -2.625 1.00 102.13 ? 735  GLN A O   1 
ATOM   1507 C CB  . GLN A 1 240 ? 11.836  28.896 0.274  1.00 90.11  ? 735  GLN A CB  1 
ATOM   1508 C CG  . GLN A 1 240 ? 10.995  30.135 -0.023 1.00 99.85  ? 735  GLN A CG  1 
ATOM   1509 C CD  . GLN A 1 240 ? 11.555  31.376 0.624  1.00 118.24 ? 735  GLN A CD  1 
ATOM   1510 O OE1 . GLN A 1 240 ? 11.488  31.547 1.845  1.00 115.69 ? 735  GLN A OE1 1 
ATOM   1511 N NE2 . GLN A 1 240 ? 12.092  32.287 -0.181 1.00 107.16 ? 735  GLN A NE2 1 
ATOM   1512 N N   . GLN A 1 241 ? 12.735  26.917 -2.156 1.00 98.33  ? 736  GLN A N   1 
ATOM   1513 C CA  . GLN A 1 241 ? 13.242  26.704 -3.518 1.00 101.52 ? 736  GLN A CA  1 
ATOM   1514 C C   . GLN A 1 241 ? 12.282  25.941 -4.461 1.00 107.02 ? 736  GLN A C   1 
ATOM   1515 O O   . GLN A 1 241 ? 12.426  26.078 -5.675 1.00 109.90 ? 736  GLN A O   1 
ATOM   1516 C CB  . GLN A 1 241 ? 14.623  26.009 -3.472 1.00 103.03 ? 736  GLN A CB  1 
ATOM   1517 N N   . ILE A 1 242 ? 11.323  25.142 -3.918 1.00 101.51 ? 737  ILE A N   1 
ATOM   1518 C CA  . ILE A 1 242 ? 10.393  24.343 -4.736 1.00 103.44 ? 737  ILE A CA  1 
ATOM   1519 C C   . ILE A 1 242 ? 8.927   24.770 -4.725 1.00 105.88 ? 737  ILE A C   1 
ATOM   1520 O O   . ILE A 1 242 ? 8.198   24.491 -3.776 1.00 102.83 ? 737  ILE A O   1 
ATOM   1521 C CB  . ILE A 1 242 ? 10.615  22.809 -4.654 1.00 107.26 ? 737  ILE A CB  1 
ATOM   1522 C CG1 . ILE A 1 242 ? 10.545  22.276 -3.213 1.00 103.53 ? 737  ILE A CG1 1 
ATOM   1523 C CG2 . ILE A 1 242 ? 11.942  22.423 -5.345 1.00 110.97 ? 737  ILE A CG2 1 
ATOM   1524 C CD1 . ILE A 1 242 ? 10.600  20.800 -3.121 1.00 106.50 ? 737  ILE A CD1 1 
ATOM   1525 N N   . ILE A 1 243 ? 8.510   25.444 -5.816 1.00 104.87 ? 738  ILE A N   1 
ATOM   1526 C CA  . ILE A 1 243 ? 7.171   26.001 -6.040 1.00 104.98 ? 738  ILE A CA  1 
ATOM   1527 C C   . ILE A 1 243 ? 6.017   25.041 -5.731 1.00 108.83 ? 738  ILE A C   1 
ATOM   1528 O O   . ILE A 1 243 ? 5.316   25.255 -4.739 1.00 105.45 ? 738  ILE A O   1 
ATOM   1529 C CB  . ILE A 1 243 ? 7.056   26.640 -7.444 1.00 111.63 ? 738  ILE A CB  1 
ATOM   1530 N N   . ASN A 1 244 ? 5.860   23.966 -6.552 1.00 108.64 ? 739  ASN A N   1 
ATOM   1531 C CA  . ASN A 1 244 ? 4.822   22.925 -6.455 1.00 109.20 ? 739  ASN A CA  1 
ATOM   1532 C C   . ASN A 1 244 ? 4.647   22.389 -5.029 1.00 109.74 ? 739  ASN A C   1 
ATOM   1533 O O   . ASN A 1 244 ? 5.538   21.716 -4.513 1.00 108.26 ? 739  ASN A O   1 
ATOM   1534 C CB  . ASN A 1 244 ? 5.115   21.796 -7.457 1.00 112.46 ? 739  ASN A CB  1 
ATOM   1535 C CG  . ASN A 1 244 ? 4.117   20.656 -7.512 1.00 138.61 ? 739  ASN A CG  1 
ATOM   1536 O OD1 . ASN A 1 244 ? 4.420   19.589 -8.057 1.00 138.55 ? 739  ASN A OD1 1 
ATOM   1537 N ND2 . ASN A 1 244 ? 2.900   20.847 -6.997 1.00 127.16 ? 739  ASN A ND2 1 
ATOM   1538 N N   . GLN A 1 245 ? 3.498   22.712 -4.397 1.00 105.12 ? 740  GLN A N   1 
ATOM   1539 C CA  . GLN A 1 245 ? 3.174   22.330 -3.008 1.00 101.76 ? 740  GLN A CA  1 
ATOM   1540 C C   . GLN A 1 245 ? 3.204   20.822 -2.743 1.00 105.19 ? 740  GLN A C   1 
ATOM   1541 O O   . GLN A 1 245 ? 3.665   20.410 -1.672 1.00 102.30 ? 740  GLN A O   1 
ATOM   1542 C CB  . GLN A 1 245 ? 1.873   22.982 -2.506 1.00 101.86 ? 740  GLN A CB  1 
ATOM   1543 C CG  . GLN A 1 245 ? 1.893   24.511 -2.546 1.00 117.40 ? 740  GLN A CG  1 
ATOM   1544 C CD  . GLN A 1 245 ? 2.428   25.158 -1.297 1.00 137.01 ? 740  GLN A CD  1 
ATOM   1545 O OE1 . GLN A 1 245 ? 3.595   25.005 -0.927 1.00 131.73 ? 740  GLN A OE1 1 
ATOM   1546 N NE2 . GLN A 1 245 ? 1.596   25.962 -0.657 1.00 129.54 ? 740  GLN A NE2 1 
ATOM   1547 N N   . ILE A 1 246 ? 2.768   20.004 -3.724 1.00 103.66 ? 741  ILE A N   1 
ATOM   1548 C CA  . ILE A 1 246 ? 2.847   18.551 -3.592 1.00 104.33 ? 741  ILE A CA  1 
ATOM   1549 C C   . ILE A 1 246 ? 4.323   18.118 -3.653 1.00 108.98 ? 741  ILE A C   1 
ATOM   1550 O O   . ILE A 1 246 ? 4.772   17.388 -2.770 1.00 107.75 ? 741  ILE A O   1 
ATOM   1551 C CB  . ILE A 1 246 ? 1.904   17.809 -4.565 1.00 111.08 ? 741  ILE A CB  1 
ATOM   1552 C CG1 . ILE A 1 246 ? 0.458   17.969 -4.075 1.00 110.71 ? 741  ILE A CG1 1 
ATOM   1553 C CG2 . ILE A 1 246 ? 2.266   16.319 -4.680 1.00 113.48 ? 741  ILE A CG2 1 
ATOM   1554 C CD1 . ILE A 1 246 ? -0.579  17.886 -5.117 1.00 121.33 ? 741  ILE A CD1 1 
ATOM   1555 N N   . SER A 1 247 ? 5.093   18.649 -4.628 1.00 106.59 ? 742  SER A N   1 
ATOM   1556 C CA  . SER A 1 247 ? 6.528   18.373 -4.753 1.00 106.16 ? 742  SER A CA  1 
ATOM   1557 C C   . SER A 1 247 ? 7.277   18.895 -3.524 1.00 104.30 ? 742  SER A C   1 
ATOM   1558 O O   . SER A 1 247 ? 8.212   18.244 -3.069 1.00 103.20 ? 742  SER A O   1 
ATOM   1559 C CB  . SER A 1 247 ? 7.102   18.977 -6.035 1.00 112.68 ? 742  SER A CB  1 
ATOM   1560 O OG  . SER A 1 247 ? 6.832   18.185 -7.181 1.00 124.67 ? 742  SER A OG  1 
ATOM   1561 N N   . LYS A 1 248 ? 6.829   20.033 -2.956 1.00 97.61  ? 743  LYS A N   1 
ATOM   1562 C CA  . LYS A 1 248 ? 7.413   20.603 -1.740 1.00 93.41  ? 743  LYS A CA  1 
ATOM   1563 C C   . LYS A 1 248 ? 7.182   19.662 -0.557 1.00 95.39  ? 743  LYS A C   1 
ATOM   1564 O O   . LYS A 1 248 ? 8.078   19.511 0.270  1.00 92.97  ? 743  LYS A O   1 
ATOM   1565 C CB  . LYS A 1 248 ? 6.863   22.011 -1.441 1.00 93.35  ? 743  LYS A CB  1 
ATOM   1566 C CG  . LYS A 1 248 ? 7.827   22.901 -0.646 1.00 93.63  ? 743  LYS A CG  1 
ATOM   1567 C CD  . LYS A 1 248 ? 7.153   24.151 -0.043 1.00 100.72 ? 743  LYS A CD  1 
ATOM   1568 C CE  . LYS A 1 248 ? 6.767   25.257 -1.017 1.00 113.62 ? 743  LYS A CE  1 
ATOM   1569 N NZ  . LYS A 1 248 ? 7.939   25.983 -1.579 1.00 123.28 ? 743  LYS A NZ  1 
ATOM   1570 N N   . LEU A 1 249 ? 6.003   19.001 -0.505 1.00 92.84  ? 744  LEU A N   1 
ATOM   1571 C CA  . LEU A 1 249 ? 5.661   18.061 0.567  1.00 91.43  ? 744  LEU A CA  1 
ATOM   1572 C C   . LEU A 1 249 ? 6.446   16.750 0.484  1.00 98.74  ? 744  LEU A C   1 
ATOM   1573 O O   . LEU A 1 249 ? 6.923   16.248 1.505  1.00 96.58  ? 744  LEU A O   1 
ATOM   1574 C CB  . LEU A 1 249 ? 4.146   17.830 0.661  1.00 91.63  ? 744  LEU A CB  1 
ATOM   1575 C CG  . LEU A 1 249 ? 3.352   19.009 1.213  1.00 92.93  ? 744  LEU A CG  1 
ATOM   1576 C CD1 . LEU A 1 249 ? 1.886   18.852 0.944  1.00 94.11  ? 744  LEU A CD1 1 
ATOM   1577 C CD2 . LEU A 1 249 ? 3.623   19.229 2.689  1.00 91.40  ? 744  LEU A CD2 1 
ATOM   1578 N N   . HIS A 1 250 ? 6.633   16.236 -0.732 1.00 100.28 ? 745  HIS A N   1 
ATOM   1579 C CA  . HIS A 1 250 ? 7.411   15.034 -0.978 1.00 103.37 ? 745  HIS A CA  1 
ATOM   1580 C C   . HIS A 1 250 ? 8.859   15.225 -0.526 1.00 108.13 ? 745  HIS A C   1 
ATOM   1581 O O   . HIS A 1 250 ? 9.449   14.279 -0.008 1.00 108.67 ? 745  HIS A O   1 
ATOM   1582 C CB  . HIS A 1 250 ? 7.359   14.672 -2.464 1.00 108.60 ? 745  HIS A CB  1 
ATOM   1583 C CG  . HIS A 1 250 ? 6.093   13.982 -2.867 1.00 114.99 ? 745  HIS A CG  1 
ATOM   1584 N ND1 . HIS A 1 250 ? 6.113   12.734 -3.464 1.00 120.71 ? 745  HIS A ND1 1 
ATOM   1585 C CD2 . HIS A 1 250 ? 4.805   14.377 -2.723 1.00 116.21 ? 745  HIS A CD2 1 
ATOM   1586 C CE1 . HIS A 1 250 ? 4.845   12.420 -3.676 1.00 122.05 ? 745  HIS A CE1 1 
ATOM   1587 N NE2 . HIS A 1 250 ? 4.023   13.379 -3.247 1.00 119.76 ? 745  HIS A NE2 1 
ATOM   1588 N N   . ALA A 1 251 ? 9.405   16.458 -0.673 1.00 103.85 ? 746  ALA A N   1 
ATOM   1589 C CA  . ALA A 1 251 ? 10.779  16.823 -0.303 1.00 102.17 ? 746  ALA A CA  1 
ATOM   1590 C C   . ALA A 1 251 ? 11.048  16.821 1.199  1.00 104.54 ? 746  ALA A C   1 
ATOM   1591 O O   . ALA A 1 251 ? 12.150  16.438 1.613  1.00 104.72 ? 746  ALA A O   1 
ATOM   1592 C CB  . ALA A 1 251 ? 11.144  18.171 -0.890 1.00 102.12 ? 746  ALA A CB  1 
ATOM   1593 N N   . ILE A 1 252 ? 10.065  17.276 2.008  1.00 98.65  ? 747  ILE A N   1 
ATOM   1594 C CA  . ILE A 1 252 ? 10.180  17.326 3.466  1.00 95.80  ? 747  ILE A CA  1 
ATOM   1595 C C   . ILE A 1 252 ? 10.258  15.906 4.023  1.00 103.16 ? 747  ILE A C   1 
ATOM   1596 O O   . ILE A 1 252 ? 11.073  15.632 4.906  1.00 100.82 ? 747  ILE A O   1 
ATOM   1597 C CB  . ILE A 1 252 ? 9.016   18.139 4.092  1.00 96.68  ? 747  ILE A CB  1 
ATOM   1598 C CG1 . ILE A 1 252 ? 9.067   19.613 3.642  1.00 95.81  ? 747  ILE A CG1 1 
ATOM   1599 C CG2 . ILE A 1 252 ? 9.023   18.032 5.623  1.00 94.94  ? 747  ILE A CG2 1 
ATOM   1600 C CD1 . ILE A 1 252 ? 7.733   20.261 3.514  1.00 101.75 ? 747  ILE A CD1 1 
ATOM   1601 N N   . ILE A 1 253 ? 9.428   15.004 3.477  1.00 105.02 ? 748  ILE A N   1 
ATOM   1602 C CA  . ILE A 1 253 ? 9.353   13.604 3.899  1.00 107.49 ? 748  ILE A CA  1 
ATOM   1603 C C   . ILE A 1 253 ? 10.367  12.688 3.206  1.00 116.01 ? 748  ILE A C   1 
ATOM   1604 O O   . ILE A 1 253 ? 10.368  11.488 3.484  1.00 118.13 ? 748  ILE A O   1 
ATOM   1605 C CB  . ILE A 1 253 ? 7.895   13.059 3.849  1.00 112.44 ? 748  ILE A CB  1 
ATOM   1606 C CG1 . ILE A 1 253 ? 7.323   13.078 2.401  1.00 116.26 ? 748  ILE A CG1 1 
ATOM   1607 C CG2 . ILE A 1 253 ? 7.004   13.820 4.842  1.00 110.49 ? 748  ILE A CG2 1 
ATOM   1608 C CD1 . ILE A 1 253 ? 5.948   12.349 2.135  1.00 127.30 ? 748  ILE A CD1 1 
ATOM   1609 N N   . ASP A 1 254 ? 11.232  13.243 2.325  1.00 114.31 ? 749  ASP A N   1 
ATOM   1610 C CA  . ASP A 1 254 ? 12.240  12.474 1.584  1.00 117.77 ? 749  ASP A CA  1 
ATOM   1611 C C   . ASP A 1 254 ? 13.633  12.572 2.227  1.00 121.29 ? 749  ASP A C   1 
ATOM   1612 O O   . ASP A 1 254 ? 14.262  13.630 2.121  1.00 119.30 ? 749  ASP A O   1 
ATOM   1613 C CB  . ASP A 1 254 ? 12.286  12.907 0.106  1.00 122.37 ? 749  ASP A CB  1 
ATOM   1614 C CG  . ASP A 1 254 ? 13.094  12.012 -0.818 1.00 139.45 ? 749  ASP A CG  1 
ATOM   1615 O OD1 . ASP A 1 254 ? 13.338  10.833 -0.451 1.00 141.69 ? 749  ASP A OD1 1 
ATOM   1616 O OD2 . ASP A 1 254 ? 13.442  12.471 -1.930 1.00 148.68 ? 749  ASP A OD2 1 
ATOM   1617 N N   . PRO A 1 255 ? 14.148  11.479 2.867  1.00 119.08 ? 750  PRO A N   1 
ATOM   1618 C CA  . PRO A 1 255 ? 15.475  11.558 3.519  1.00 117.29 ? 750  PRO A CA  1 
ATOM   1619 C C   . PRO A 1 255 ? 16.636  11.716 2.541  1.00 122.27 ? 750  PRO A C   1 
ATOM   1620 O O   . PRO A 1 255 ? 17.664  12.305 2.899  1.00 120.16 ? 750  PRO A O   1 
ATOM   1621 C CB  . PRO A 1 255 ? 15.564  10.253 4.325  1.00 119.84 ? 750  PRO A CB  1 
ATOM   1622 C CG  . PRO A 1 255 ? 14.168  9.708  4.361  1.00 125.37 ? 750  PRO A CG  1 
ATOM   1623 C CD  . PRO A 1 255 ? 13.539  10.151 3.079  1.00 122.68 ? 750  PRO A CD  1 
ATOM   1624 N N   . ASN A 1 256 ? 16.448  11.220 1.295  1.00 121.29 ? 751  ASN A N   1 
ATOM   1625 C CA  . ASN A 1 256 ? 17.416  11.310 0.199  1.00 122.60 ? 751  ASN A CA  1 
ATOM   1626 C C   . ASN A 1 256 ? 17.521  12.752 -0.317 1.00 124.16 ? 751  ASN A C   1 
ATOM   1627 O O   . ASN A 1 256 ? 18.574  13.137 -0.843 1.00 123.80 ? 751  ASN A O   1 
ATOM   1628 C CB  . ASN A 1 256 ? 17.049  10.349 -0.929 1.00 125.30 ? 751  ASN A CB  1 
ATOM   1629 C CG  . ASN A 1 256 ? 16.653  8.987  -0.437 1.00 136.49 ? 751  ASN A CG  1 
ATOM   1630 O OD1 . ASN A 1 256 ? 17.425  8.291  0.226  1.00 124.59 ? 751  ASN A OD1 1 
ATOM   1631 N ND2 . ASN A 1 256 ? 15.413  8.612  -0.698 1.00 130.90 ? 751  ASN A ND2 1 
ATOM   1632 N N   . HIS A 1 257 ? 16.433  13.549 -0.155 1.00 118.60 ? 752  HIS A N   1 
ATOM   1633 C CA  . HIS A 1 257 ? 16.439  14.962 -0.527 1.00 116.87 ? 752  HIS A CA  1 
ATOM   1634 C C   . HIS A 1 257 ? 17.138  15.713 0.607  1.00 116.93 ? 752  HIS A C   1 
ATOM   1635 O O   . HIS A 1 257 ? 16.512  16.083 1.606  1.00 113.92 ? 752  HIS A O   1 
ATOM   1636 C CB  . HIS A 1 257 ? 15.027  15.515 -0.786 1.00 117.20 ? 752  HIS A CB  1 
ATOM   1637 C CG  . HIS A 1 257 ? 15.050  16.908 -1.341 1.00 119.78 ? 752  HIS A CG  1 
ATOM   1638 N ND1 . HIS A 1 257 ? 15.311  18.007 -0.535 1.00 118.25 ? 752  HIS A ND1 1 
ATOM   1639 C CD2 . HIS A 1 257 ? 14.878  17.333 -2.613 1.00 123.84 ? 752  HIS A CD2 1 
ATOM   1640 C CE1 . HIS A 1 257 ? 15.279  19.057 -1.337 1.00 118.18 ? 752  HIS A CE1 1 
ATOM   1641 N NE2 . HIS A 1 257 ? 15.022  18.703 -2.596 1.00 121.89 ? 752  HIS A NE2 1 
ATOM   1642 N N   . GLU A 1 258 ? 18.456  15.885 0.460  1.00 112.97 ? 753  GLU A N   1 
ATOM   1643 C CA  . GLU A 1 258 ? 19.298  16.529 1.453  1.00 109.58 ? 753  GLU A CA  1 
ATOM   1644 C C   . GLU A 1 258 ? 19.067  18.032 1.577  1.00 110.37 ? 753  GLU A C   1 
ATOM   1645 O O   . GLU A 1 258 ? 19.073  18.745 0.572  1.00 111.18 ? 753  GLU A O   1 
ATOM   1646 C CB  . GLU A 1 258 ? 20.777  16.194 1.200  1.00 112.08 ? 753  GLU A CB  1 
ATOM   1647 C CG  . GLU A 1 258 ? 21.173  14.831 1.750  1.00 122.27 ? 753  GLU A CG  1 
ATOM   1648 C CD  . GLU A 1 258 ? 22.464  14.233 1.221  1.00 139.54 ? 753  GLU A CD  1 
ATOM   1649 O OE1 . GLU A 1 258 ? 23.495  14.945 1.205  1.00 124.54 ? 753  GLU A OE1 1 
ATOM   1650 O OE2 . GLU A 1 258 ? 22.455  13.031 0.867  1.00 131.74 ? 753  GLU A OE2 1 
ATOM   1651 N N   . ILE A 1 259 ? 18.837  18.503 2.815  1.00 103.39 ? 754  ILE A N   1 
ATOM   1652 C CA  . ILE A 1 259 ? 18.694  19.927 3.105  1.00 101.21 ? 754  ILE A CA  1 
ATOM   1653 C C   . ILE A 1 259 ? 20.132  20.477 3.185  1.00 105.85 ? 754  ILE A C   1 
ATOM   1654 O O   . ILE A 1 259 ? 20.981  19.903 3.881  1.00 104.86 ? 754  ILE A O   1 
ATOM   1655 C CB  . ILE A 1 259 ? 17.848  20.206 4.380  1.00 101.20 ? 754  ILE A CB  1 
ATOM   1656 N N   . GLU A 1 260 ? 20.419  21.526 2.398  1.00 103.65 ? 755  GLU A N   1 
ATOM   1657 C CA  . GLU A 1 260 ? 21.747  22.133 2.313  1.00 103.79 ? 755  GLU A CA  1 
ATOM   1658 C C   . GLU A 1 260 ? 22.000  23.149 3.414  1.00 103.85 ? 755  GLU A C   1 
ATOM   1659 O O   . GLU A 1 260 ? 21.133  23.970 3.705  1.00 101.81 ? 755  GLU A O   1 
ATOM   1660 C CB  . GLU A 1 260 ? 21.953  22.778 0.932  1.00 107.69 ? 755  GLU A CB  1 
ATOM   1661 N N   . PHE A 1 261 ? 23.198  23.107 4.014  1.00 99.16  ? 756  PHE A N   1 
ATOM   1662 C CA  . PHE A 1 261 ? 23.591  24.056 5.056  1.00 96.91  ? 756  PHE A CA  1 
ATOM   1663 C C   . PHE A 1 261 ? 24.867  24.810 4.627  1.00 101.03 ? 756  PHE A C   1 
ATOM   1664 O O   . PHE A 1 261 ? 25.960  24.471 5.098  1.00 100.35 ? 756  PHE A O   1 
ATOM   1665 C CB  . PHE A 1 261 ? 23.735  23.365 6.428  1.00 97.01  ? 756  PHE A CB  1 
ATOM   1666 C CG  . PHE A 1 261 ? 22.445  22.789 6.960  1.00 97.14  ? 756  PHE A CG  1 
ATOM   1667 C CD1 . PHE A 1 261 ? 22.063  21.490 6.645  1.00 100.72 ? 756  PHE A CD1 1 
ATOM   1668 C CD2 . PHE A 1 261 ? 21.601  23.550 7.761  1.00 97.37  ? 756  PHE A CD2 1 
ATOM   1669 C CE1 . PHE A 1 261 ? 20.861  20.961 7.128  1.00 100.88 ? 756  PHE A CE1 1 
ATOM   1670 C CE2 . PHE A 1 261 ? 20.400  23.018 8.243  1.00 98.74  ? 756  PHE A CE2 1 
ATOM   1671 C CZ  . PHE A 1 261 ? 20.042  21.726 7.930  1.00 97.61  ? 756  PHE A CZ  1 
ATOM   1672 N N   . PRO A 1 262 ? 24.751  25.808 3.698  1.00 98.41  ? 757  PRO A N   1 
ATOM   1673 C CA  . PRO A 1 262 ? 25.960  26.522 3.221  1.00 99.70  ? 757  PRO A CA  1 
ATOM   1674 C C   . PRO A 1 262 ? 26.831  27.119 4.327  1.00 103.25 ? 757  PRO A C   1 
ATOM   1675 O O   . PRO A 1 262 ? 26.305  27.781 5.219  1.00 101.18 ? 757  PRO A O   1 
ATOM   1676 C CB  . PRO A 1 262 ? 25.400  27.602 2.288  1.00 102.30 ? 757  PRO A CB  1 
ATOM   1677 C CG  . PRO A 1 262 ? 24.070  27.095 1.868  1.00 106.34 ? 757  PRO A CG  1 
ATOM   1678 C CD  . PRO A 1 262 ? 23.532  26.293 3.010  1.00 99.56  ? 757  PRO A CD  1 
ATOM   1679 N N   . ASP A 1 263 ? 28.162  26.849 4.274  1.00 101.88 ? 758  ASP A N   1 
ATOM   1680 C CA  . ASP A 1 263 ? 29.191  27.302 5.225  1.00 101.32 ? 758  ASP A CA  1 
ATOM   1681 C C   . ASP A 1 263 ? 29.088  28.800 5.586  1.00 105.21 ? 758  ASP A C   1 
ATOM   1682 O O   . ASP A 1 263 ? 29.041  29.669 4.705  1.00 105.90 ? 758  ASP A O   1 
ATOM   1683 C CB  . ASP A 1 263 ? 30.599  26.919 4.740  1.00 105.06 ? 758  ASP A CB  1 
ATOM   1684 N N   . ILE A 1 264 ? 28.986  29.075 6.893  1.00 100.46 ? 759  ILE A N   1 
ATOM   1685 C CA  . ILE A 1 264 ? 28.829  30.420 7.451  1.00 99.97  ? 759  ILE A CA  1 
ATOM   1686 C C   . ILE A 1 264 ? 29.851  30.676 8.570  1.00 103.40 ? 759  ILE A C   1 
ATOM   1687 O O   . ILE A 1 264 ? 30.380  29.698 9.118  1.00 102.13 ? 759  ILE A O   1 
ATOM   1688 C CB  . ILE A 1 264 ? 27.360  30.695 7.908  1.00 101.27 ? 759  ILE A CB  1 
ATOM   1689 C CG1 . ILE A 1 264 ? 26.672  29.433 8.503  1.00 100.02 ? 759  ILE A CG1 1 
ATOM   1690 C CG2 . ILE A 1 264 ? 26.545  31.328 6.775  1.00 102.56 ? 759  ILE A CG2 1 
ATOM   1691 C CD1 . ILE A 1 264 ? 25.511  29.711 9.479  1.00 105.46 ? 759  ILE A CD1 1 
ATOM   1692 N N   . PRO A 1 265 ? 30.160  31.966 8.918  1.00 100.55 ? 760  PRO A N   1 
ATOM   1693 C CA  . PRO A 1 265 ? 31.120  32.227 10.009 1.00 100.92 ? 760  PRO A CA  1 
ATOM   1694 C C   . PRO A 1 265 ? 30.649  31.629 11.336 1.00 104.27 ? 760  PRO A C   1 
ATOM   1695 O O   . PRO A 1 265 ? 31.459  31.070 12.085 1.00 105.31 ? 760  PRO A O   1 
ATOM   1696 C CB  . PRO A 1 265 ? 31.176  33.757 10.082 1.00 103.61 ? 760  PRO A CB  1 
ATOM   1697 C CG  . PRO A 1 265 ? 30.640  34.233 8.797  1.00 108.72 ? 760  PRO A CG  1 
ATOM   1698 C CD  . PRO A 1 265 ? 29.627  33.233 8.378  1.00 102.58 ? 760  PRO A CD  1 
ATOM   1699 N N   . GLU A 1 266 ? 29.324  31.695 11.591 1.00 97.66  ? 761  GLU A N   1 
ATOM   1700 C CA  . GLU A 1 266 ? 28.702  31.151 12.788 1.00 94.47  ? 761  GLU A CA  1 
ATOM   1701 C C   . GLU A 1 266 ? 28.539  29.636 12.617 1.00 95.40  ? 761  GLU A C   1 
ATOM   1702 O O   . GLU A 1 266 ? 27.474  29.166 12.226 1.00 93.53  ? 761  GLU A O   1 
ATOM   1703 C CB  . GLU A 1 266 ? 27.357  31.853 13.069 1.00 94.35  ? 761  GLU A CB  1 
ATOM   1704 C CG  . GLU A 1 266 ? 27.408  33.372 13.159 1.00 102.44 ? 761  GLU A CG  1 
ATOM   1705 C CD  . GLU A 1 266 ? 26.465  33.964 14.192 1.00 118.42 ? 761  GLU A CD  1 
ATOM   1706 O OE1 . GLU A 1 266 ? 26.785  33.885 15.402 1.00 104.95 ? 761  GLU A OE1 1 
ATOM   1707 O OE2 . GLU A 1 266 ? 25.394  34.479 13.796 1.00 118.06 ? 761  GLU A OE2 1 
ATOM   1708 N N   . LYS A 1 267 ? 29.620  28.877 12.866 1.00 92.71  ? 762  LYS A N   1 
ATOM   1709 C CA  . LYS A 1 267 ? 29.634  27.406 12.752 1.00 92.16  ? 762  LYS A CA  1 
ATOM   1710 C C   . LYS A 1 267 ? 28.636  26.754 13.731 1.00 94.92  ? 762  LYS A C   1 
ATOM   1711 O O   . LYS A 1 267 ? 28.054  25.707 13.422 1.00 94.39  ? 762  LYS A O   1 
ATOM   1712 C CB  . LYS A 1 267 ? 31.056  26.842 12.949 1.00 94.87  ? 762  LYS A CB  1 
ATOM   1713 N N   . ASP A 1 268 ? 28.440  27.400 14.899 1.00 90.24  ? 763  ASP A N   1 
ATOM   1714 C CA  . ASP A 1 268 ? 27.523  26.995 15.957 1.00 88.57  ? 763  ASP A CA  1 
ATOM   1715 C C   . ASP A 1 268 ? 26.097  27.030 15.412 1.00 89.66  ? 763  ASP A C   1 
ATOM   1716 O O   . ASP A 1 268 ? 25.368  26.040 15.513 1.00 88.43  ? 763  ASP A O   1 
ATOM   1717 C CB  . ASP A 1 268 ? 27.641  27.973 17.144 1.00 90.99  ? 763  ASP A CB  1 
ATOM   1718 C CG  . ASP A 1 268 ? 28.770  27.715 18.131 1.00 103.04 ? 763  ASP A CG  1 
ATOM   1719 O OD1 . ASP A 1 268 ? 29.469  26.673 17.987 1.00 102.44 ? 763  ASP A OD1 1 
ATOM   1720 O OD2 . ASP A 1 268 ? 28.929  28.532 19.077 1.00 111.36 ? 763  ASP A OD2 1 
ATOM   1721 N N   . LEU A 1 269 ? 25.731  28.173 14.802 1.00 84.78  ? 764  LEU A N   1 
ATOM   1722 C CA  . LEU A 1 269 ? 24.444  28.458 14.176 1.00 82.73  ? 764  LEU A CA  1 
ATOM   1723 C C   . LEU A 1 269 ? 24.109  27.404 13.113 1.00 85.16  ? 764  LEU A C   1 
ATOM   1724 O O   . LEU A 1 269 ? 22.953  27.006 13.009 1.00 84.20  ? 764  LEU A O   1 
ATOM   1725 C CB  . LEU A 1 269 ? 24.477  29.896 13.601 1.00 83.37  ? 764  LEU A CB  1 
ATOM   1726 C CG  . LEU A 1 269 ? 23.327  30.438 12.731 1.00 87.62  ? 764  LEU A CG  1 
ATOM   1727 C CD1 . LEU A 1 269 ? 21.969  30.289 13.400 1.00 85.86  ? 764  LEU A CD1 1 
ATOM   1728 C CD2 . LEU A 1 269 ? 23.562  31.894 12.383 1.00 90.57  ? 764  LEU A CD2 1 
ATOM   1729 N N   . GLN A 1 270 ? 25.117  26.922 12.372 1.00 81.92  ? 765  GLN A N   1 
ATOM   1730 C CA  . GLN A 1 270 ? 24.939  25.876 11.366 1.00 82.14  ? 765  GLN A CA  1 
ATOM   1731 C C   . GLN A 1 270 ? 24.532  24.565 12.057 1.00 83.83  ? 765  GLN A C   1 
ATOM   1732 O O   . GLN A 1 270 ? 23.581  23.926 11.615 1.00 82.75  ? 765  GLN A O   1 
ATOM   1733 C CB  . GLN A 1 270 ? 26.233  25.685 10.555 1.00 85.58  ? 765  GLN A CB  1 
ATOM   1734 C CG  . GLN A 1 270 ? 26.010  25.192 9.131  1.00 98.48  ? 765  GLN A CG  1 
ATOM   1735 C CD  . GLN A 1 270 ? 27.327  24.900 8.456  1.00 110.87 ? 765  GLN A CD  1 
ATOM   1736 O OE1 . GLN A 1 270 ? 28.005  25.801 7.957  1.00 102.98 ? 765  GLN A OE1 1 
ATOM   1737 N NE2 . GLN A 1 270 ? 27.722  23.632 8.435  1.00 103.89 ? 765  GLN A NE2 1 
ATOM   1738 N N   . ASP A 1 271 ? 25.226  24.198 13.166 1.00 79.73  ? 766  ASP A N   1 
ATOM   1739 C CA  . ASP A 1 271 ? 24.948  22.985 13.947 1.00 78.58  ? 766  ASP A CA  1 
ATOM   1740 C C   . ASP A 1 271 ? 23.523  22.985 14.514 1.00 79.77  ? 766  ASP A C   1 
ATOM   1741 O O   . ASP A 1 271 ? 22.860  21.950 14.440 1.00 79.97  ? 766  ASP A O   1 
ATOM   1742 C CB  . ASP A 1 271 ? 25.995  22.758 15.055 1.00 80.54  ? 766  ASP A CB  1 
ATOM   1743 C CG  . ASP A 1 271 ? 25.759  21.500 15.879 1.00 86.70  ? 766  ASP A CG  1 
ATOM   1744 O OD1 . ASP A 1 271 ? 26.148  20.402 15.416 1.00 87.11  ? 766  ASP A OD1 1 
ATOM   1745 O OD2 . ASP A 1 271 ? 25.168  21.612 16.978 1.00 90.60  ? 766  ASP A OD2 1 
ATOM   1746 N N   . VAL A 1 272 ? 23.045  24.146 15.037 1.00 72.39  ? 767  VAL A N   1 
ATOM   1747 C CA  . VAL A 1 272 ? 21.688  24.323 15.568 1.00 69.17  ? 767  VAL A CA  1 
ATOM   1748 C C   . VAL A 1 272 ? 20.696  23.954 14.481 1.00 72.88  ? 767  VAL A C   1 
ATOM   1749 O O   . VAL A 1 272 ? 19.801  23.156 14.738 1.00 72.67  ? 767  VAL A O   1 
ATOM   1750 C CB  . VAL A 1 272 ? 21.436  25.763 16.056 1.00 71.03  ? 767  VAL A CB  1 
ATOM   1751 C CG1 . VAL A 1 272 ? 19.969  25.978 16.389 1.00 69.28  ? 767  VAL A CG1 1 
ATOM   1752 C CG2 . VAL A 1 272 ? 22.304  26.090 17.250 1.00 70.91  ? 767  VAL A CG2 1 
ATOM   1753 N N   . LEU A 1 273 ? 20.875  24.518 13.265 1.00 69.60  ? 768  LEU A N   1 
ATOM   1754 C CA  . LEU A 1 273 ? 20.027  24.276 12.092 1.00 69.54  ? 768  LEU A CA  1 
ATOM   1755 C C   . LEU A 1 273 ? 20.045  22.813 11.722 1.00 75.43  ? 768  LEU A C   1 
ATOM   1756 O O   . LEU A 1 273 ? 18.992  22.189 11.593 1.00 75.67  ? 768  LEU A O   1 
ATOM   1757 C CB  . LEU A 1 273 ? 20.462  25.138 10.895 1.00 70.16  ? 768  LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 273 ? 20.391  26.646 11.081 1.00 73.47  ? 768  LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 273 ? 21.034  27.347 9.921  1.00 74.40  ? 768  LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 273 ? 18.958  27.116 11.328 1.00 73.85  ? 768  LEU A CD2 1 
ATOM   1761 N N   . LYS A 1 274 ? 21.245  22.248 11.648 1.00 73.44  ? 769  LYS A N   1 
ATOM   1762 C CA  . LYS A 1 274 ? 21.451  20.835 11.369 1.00 74.69  ? 769  LYS A CA  1 
ATOM   1763 C C   . LYS A 1 274 ? 20.734  19.962 12.429 1.00 79.82  ? 769  LYS A C   1 
ATOM   1764 O O   . LYS A 1 274 ? 20.158  18.946 12.057 1.00 80.79  ? 769  LYS A O   1 
ATOM   1765 C CB  . LYS A 1 274 ? 22.961  20.522 11.263 1.00 77.27  ? 769  LYS A CB  1 
ATOM   1766 C CG  . LYS A 1 274 ? 23.635  21.073 9.997  1.00 76.56  ? 769  LYS A CG  1 
ATOM   1767 N N   . CYS A 1 275 ? 20.702  20.403 13.718 1.00 76.39  ? 770  CYS A N   1 
ATOM   1768 C CA  . CYS A 1 275 ? 20.039  19.718 14.847 1.00 76.49  ? 770  CYS A CA  1 
ATOM   1769 C C   . CYS A 1 275 ? 18.509  19.806 14.779 1.00 81.31  ? 770  CYS A C   1 
ATOM   1770 O O   . CYS A 1 275 ? 17.814  18.810 14.991 1.00 81.31  ? 770  CYS A O   1 
ATOM   1771 C CB  . CYS A 1 275 ? 20.549  20.252 16.183 1.00 75.98  ? 770  CYS A CB  1 
ATOM   1772 S SG  . CYS A 1 275 ? 22.251  19.794 16.570 1.00 81.08  ? 770  CYS A SG  1 
ATOM   1773 N N   . CYS A 1 276 ? 17.991  21.016 14.547 1.00 78.37  ? 771  CYS A N   1 
ATOM   1774 C CA  . CYS A 1 276 ? 16.554  21.287 14.463 1.00 77.72  ? 771  CYS A CA  1 
ATOM   1775 C C   . CYS A 1 276 ? 15.916  20.623 13.222 1.00 82.31  ? 771  CYS A C   1 
ATOM   1776 O O   . CYS A 1 276 ? 14.835  20.033 13.331 1.00 83.36  ? 771  CYS A O   1 
ATOM   1777 C CB  . CYS A 1 276 ? 16.283  22.793 14.509 1.00 76.65  ? 771  CYS A CB  1 
ATOM   1778 S SG  . CYS A 1 276 ? 16.728  23.584 16.084 1.00 79.39  ? 771  CYS A SG  1 
ATOM   1779 N N   . LEU A 1 277 ? 16.618  20.661 12.071 1.00 76.43  ? 772  LEU A N   1 
ATOM   1780 C CA  . LEU A 1 277 ? 16.124  20.114 10.814 1.00 76.08  ? 772  LEU A CA  1 
ATOM   1781 C C   . LEU A 1 277 ? 16.350  18.588 10.573 1.00 82.98  ? 772  LEU A C   1 
ATOM   1782 O O   . LEU A 1 277 ? 16.278  18.134 9.427  1.00 84.78  ? 772  LEU A O   1 
ATOM   1783 C CB  . LEU A 1 277 ? 16.642  20.985 9.671  1.00 76.14  ? 772  LEU A CB  1 
ATOM   1784 C CG  . LEU A 1 277 ? 15.868  22.275 9.312  1.00 79.43  ? 772  LEU A CG  1 
ATOM   1785 C CD1 . LEU A 1 277 ? 15.368  23.041 10.521 1.00 77.73  ? 772  LEU A CD1 1 
ATOM   1786 C CD2 . LEU A 1 277 ? 16.731  23.200 8.527  1.00 80.83  ? 772  LEU A CD2 1 
ATOM   1787 N N   . LYS A 1 278 ? 16.563  17.787 11.656 1.00 79.06  ? 773  LYS A N   1 
ATOM   1788 C CA  . LYS A 1 278 ? 16.712  16.324 11.580 1.00 79.66  ? 773  LYS A CA  1 
ATOM   1789 C C   . LYS A 1 278 ? 15.292  15.736 11.472 1.00 84.99  ? 773  LYS A C   1 
ATOM   1790 O O   . LYS A 1 278 ? 14.478  15.950 12.371 1.00 82.36  ? 773  LYS A O   1 
ATOM   1791 C CB  . LYS A 1 278 ? 17.449  15.776 12.826 1.00 80.27  ? 773  LYS A CB  1 
ATOM   1792 C CG  . LYS A 1 278 ? 18.974  15.811 12.749 1.00 78.63  ? 773  LYS A CG  1 
ATOM   1793 N N   . ARG A 1 279 ? 14.983  15.048 10.353 1.00 86.24  ? 774  ARG A N   1 
ATOM   1794 C CA  . ARG A 1 279 ? 13.656  14.457 10.060 1.00 88.38  ? 774  ARG A CA  1 
ATOM   1795 C C   . ARG A 1 279 ? 13.054  13.505 11.111 1.00 93.27  ? 774  ARG A C   1 
ATOM   1796 O O   . ARG A 1 279 ? 11.834  13.533 11.302 1.00 92.63  ? 774  ARG A O   1 
ATOM   1797 C CB  . ARG A 1 279 ? 13.596  13.843 8.648  1.00 92.83  ? 774  ARG A CB  1 
ATOM   1798 C CG  . ARG A 1 279 ? 13.475  14.883 7.536  1.00 102.72 ? 774  ARG A CG  1 
ATOM   1799 C CD  . ARG A 1 279 ? 13.922  14.347 6.192  1.00 110.02 ? 774  ARG A CD  1 
ATOM   1800 N NE  . ARG A 1 279 ? 13.747  15.346 5.135  1.00 112.65 ? 774  ARG A NE  1 
ATOM   1801 C CZ  . ARG A 1 279 ? 14.669  15.651 4.225  1.00 124.94 ? 774  ARG A CZ  1 
ATOM   1802 N NH1 . ARG A 1 279 ? 15.832  15.015 4.200  1.00 113.57 ? 774  ARG A NH1 1 
ATOM   1803 N NH2 . ARG A 1 279 ? 14.408  16.568 3.298  1.00 107.30 ? 774  ARG A NH2 1 
ATOM   1804 N N   . ASP A 1 280 ? 13.891  12.667 11.778 1.00 90.76  ? 775  ASP A N   1 
ATOM   1805 C CA  . ASP A 1 280 ? 13.431  11.754 12.833 1.00 91.13  ? 775  ASP A CA  1 
ATOM   1806 C C   . ASP A 1 280 ? 13.228  12.545 14.132 1.00 90.75  ? 775  ASP A C   1 
ATOM   1807 O O   . ASP A 1 280 ? 14.217  13.037 14.687 1.00 88.79  ? 775  ASP A O   1 
ATOM   1808 C CB  . ASP A 1 280 ? 14.429  10.601 13.059 1.00 95.62  ? 775  ASP A CB  1 
ATOM   1809 C CG  . ASP A 1 280 ? 13.942  9.445  13.941 1.00 112.15 ? 775  ASP A CG  1 
ATOM   1810 O OD1 . ASP A 1 280 ? 12.700  9.273  14.084 1.00 113.31 ? 775  ASP A OD1 1 
ATOM   1811 O OD2 . ASP A 1 280 ? 14.801  8.671  14.432 1.00 120.00 ? 775  ASP A OD2 1 
ATOM   1812 N N   . PRO A 1 281 ? 11.969  12.707 14.629 1.00 85.43  ? 776  PRO A N   1 
ATOM   1813 C CA  . PRO A 1 281 ? 11.759  13.460 15.881 1.00 82.48  ? 776  PRO A CA  1 
ATOM   1814 C C   . PRO A 1 281 ? 12.574  12.869 17.011 1.00 85.66  ? 776  PRO A C   1 
ATOM   1815 O O   . PRO A 1 281 ? 13.038  13.612 17.872 1.00 83.53  ? 776  PRO A O   1 
ATOM   1816 C CB  . PRO A 1 281 ? 10.261  13.307 16.149 1.00 84.29  ? 776  PRO A CB  1 
ATOM   1817 C CG  . PRO A 1 281 ? 9.681   13.012 14.837 1.00 90.66  ? 776  PRO A CG  1 
ATOM   1818 C CD  . PRO A 1 281 ? 10.690  12.185 14.113 1.00 88.28  ? 776  PRO A CD  1 
ATOM   1819 N N   . LYS A 1 282 ? 12.786  11.525 16.959 1.00 83.60  ? 777  LYS A N   1 
ATOM   1820 C CA  . LYS A 1 282 ? 13.591  10.755 17.898 1.00 83.46  ? 777  LYS A CA  1 
ATOM   1821 C C   . LYS A 1 282 ? 15.052  11.267 17.880 1.00 84.32  ? 777  LYS A C   1 
ATOM   1822 O O   . LYS A 1 282 ? 15.662  11.375 18.945 1.00 82.90  ? 777  LYS A O   1 
ATOM   1823 C CB  . LYS A 1 282 ? 13.503  9.256  17.566 1.00 88.56  ? 777  LYS A CB  1 
ATOM   1824 N N   . GLN A 1 283 ? 15.569  11.659 16.684 1.00 79.80  ? 778  GLN A N   1 
ATOM   1825 C CA  . GLN A 1 283 ? 16.934  12.168 16.476 1.00 78.78  ? 778  GLN A CA  1 
ATOM   1826 C C   . GLN A 1 283 ? 16.999  13.724 16.299 1.00 81.69  ? 778  GLN A C   1 
ATOM   1827 O O   . GLN A 1 283 ? 17.960  14.271 15.749 1.00 81.19  ? 778  GLN A O   1 
ATOM   1828 C CB  . GLN A 1 283 ? 17.636  11.396 15.332 1.00 81.60  ? 778  GLN A CB  1 
ATOM   1829 N N   . ARG A 1 284 ? 15.984  14.436 16.804 1.00 76.95  ? 779  ARG A N   1 
ATOM   1830 C CA  . ARG A 1 284 ? 15.933  15.901 16.742 1.00 74.33  ? 779  ARG A CA  1 
ATOM   1831 C C   . ARG A 1 284 ? 16.250  16.491 18.130 1.00 76.97  ? 779  ARG A C   1 
ATOM   1832 O O   . ARG A 1 284 ? 15.852  15.900 19.143 1.00 79.03  ? 779  ARG A O   1 
ATOM   1833 C CB  . ARG A 1 284 ? 14.542  16.337 16.283 1.00 72.27  ? 779  ARG A CB  1 
ATOM   1834 C CG  . ARG A 1 284 ? 14.460  17.773 15.805 1.00 74.69  ? 779  ARG A CG  1 
ATOM   1835 C CD  . ARG A 1 284 ? 13.061  18.081 15.324 1.00 70.93  ? 779  ARG A CD  1 
ATOM   1836 N NE  . ARG A 1 284 ? 12.743  17.371 14.085 1.00 71.54  ? 779  ARG A NE  1 
ATOM   1837 C CZ  . ARG A 1 284 ? 11.520  16.987 13.739 1.00 81.47  ? 779  ARG A CZ  1 
ATOM   1838 N NH1 . ARG A 1 284 ? 10.488  17.243 14.525 1.00 61.48  ? 779  ARG A NH1 1 
ATOM   1839 N NH2 . ARG A 1 284 ? 11.325  16.338 12.600 1.00 77.00  ? 779  ARG A NH2 1 
ATOM   1840 N N   . ILE A 1 285 ? 16.961  17.637 18.183 1.00 69.59  ? 780  ILE A N   1 
ATOM   1841 C CA  . ILE A 1 285 ? 17.328  18.302 19.447 1.00 68.05  ? 780  ILE A CA  1 
ATOM   1842 C C   . ILE A 1 285 ? 16.075  18.739 20.267 1.00 70.58  ? 780  ILE A C   1 
ATOM   1843 O O   . ILE A 1 285 ? 15.069  19.132 19.672 1.00 70.80  ? 780  ILE A O   1 
ATOM   1844 C CB  . ILE A 1 285 ? 18.321  19.467 19.173 1.00 70.43  ? 780  ILE A CB  1 
ATOM   1845 C CG1 . ILE A 1 285 ? 18.891  20.052 20.486 1.00 70.21  ? 780  ILE A CG1 1 
ATOM   1846 C CG2 . ILE A 1 285 ? 17.707  20.554 18.248 1.00 71.02  ? 780  ILE A CG2 1 
ATOM   1847 C CD1 . ILE A 1 285 ? 20.208  20.844 20.341 1.00 76.43  ? 780  ILE A CD1 1 
ATOM   1848 N N   . SER A 1 286 ? 16.112  18.626 21.609 1.00 64.38  ? 781  SER A N   1 
ATOM   1849 C CA  . SER A 1 286 ? 14.985  19.098 22.414 1.00 61.98  ? 781  SER A CA  1 
ATOM   1850 C C   . SER A 1 286 ? 15.170  20.597 22.766 1.00 66.69  ? 781  SER A C   1 
ATOM   1851 O O   . SER A 1 286 ? 16.275  21.141 22.622 1.00 67.25  ? 781  SER A O   1 
ATOM   1852 C CB  . SER A 1 286 ? 14.789  18.235 23.657 1.00 63.31  ? 781  SER A CB  1 
ATOM   1853 O OG  . SER A 1 286 ? 15.750  18.399 24.685 1.00 64.97  ? 781  SER A OG  1 
ATOM   1854 N N   . ILE A 1 287 ? 14.089  21.283 23.158 1.00 62.47  ? 782  ILE A N   1 
ATOM   1855 C CA  . ILE A 1 287 ? 14.194  22.696 23.541 1.00 61.05  ? 782  ILE A CA  1 
ATOM   1856 C C   . ILE A 1 287 ? 15.114  22.911 24.778 1.00 63.92  ? 782  ILE A C   1 
ATOM   1857 O O   . ILE A 1 287 ? 16.004  23.762 24.672 1.00 63.46  ? 782  ILE A O   1 
ATOM   1858 C CB  . ILE A 1 287 ? 12.834  23.459 23.525 1.00 63.21  ? 782  ILE A CB  1 
ATOM   1859 C CG1 . ILE A 1 287 ? 12.502  23.859 22.081 1.00 63.01  ? 782  ILE A CG1 1 
ATOM   1860 C CG2 . ILE A 1 287 ? 12.851  24.703 24.405 1.00 63.60  ? 782  ILE A CG2 1 
ATOM   1861 C CD1 . ILE A 1 287 ? 11.085  23.829 21.740 1.00 71.71  ? 782  ILE A CD1 1 
ATOM   1862 N N   . PRO A 1 288 ? 15.032  22.093 25.881 1.00 59.29  ? 783  PRO A N   1 
ATOM   1863 C CA  . PRO A 1 288 ? 15.991  22.257 27.000 1.00 59.58  ? 783  PRO A CA  1 
ATOM   1864 C C   . PRO A 1 288 ? 17.448  22.159 26.541 1.00 61.71  ? 783  PRO A C   1 
ATOM   1865 O O   . PRO A 1 288 ? 18.290  22.939 27.005 1.00 61.76  ? 783  PRO A O   1 
ATOM   1866 C CB  . PRO A 1 288 ? 15.637  21.108 27.936 1.00 62.47  ? 783  PRO A CB  1 
ATOM   1867 C CG  . PRO A 1 288 ? 14.228  20.815 27.637 1.00 65.90  ? 783  PRO A CG  1 
ATOM   1868 C CD  . PRO A 1 288 ? 14.074  21.010 26.176 1.00 60.36  ? 783  PRO A CD  1 
ATOM   1869 N N   . GLU A 1 289 ? 17.709  21.245 25.571 1.00 55.76  ? 784  GLU A N   1 
ATOM   1870 C CA  . GLU A 1 289 ? 18.988  21.040 24.898 1.00 54.72  ? 784  GLU A CA  1 
ATOM   1871 C C   . GLU A 1 289 ? 19.367  22.268 24.080 1.00 58.88  ? 784  GLU A C   1 
ATOM   1872 O O   . GLU A 1 289 ? 20.509  22.711 24.185 1.00 60.55  ? 784  GLU A O   1 
ATOM   1873 C CB  . GLU A 1 289 ? 18.967  19.783 24.022 1.00 55.60  ? 784  GLU A CB  1 
ATOM   1874 C CG  . GLU A 1 289 ? 19.640  18.595 24.672 1.00 60.83  ? 784  GLU A CG  1 
ATOM   1875 C CD  . GLU A 1 289 ? 18.997  17.263 24.366 1.00 91.61  ? 784  GLU A CD  1 
ATOM   1876 O OE1 . GLU A 1 289 ? 18.963  16.883 23.172 1.00 96.28  ? 784  GLU A OE1 1 
ATOM   1877 O OE2 . GLU A 1 289 ? 18.523  16.601 25.320 1.00 89.76  ? 784  GLU A OE2 1 
ATOM   1878 N N   . LEU A 1 290 ? 18.434  22.850 23.310 1.00 54.34  ? 785  LEU A N   1 
ATOM   1879 C CA  . LEU A 1 290 ? 18.753  24.075 22.550 1.00 54.70  ? 785  LEU A CA  1 
ATOM   1880 C C   . LEU A 1 290 ? 19.135  25.259 23.471 1.00 62.44  ? 785  LEU A C   1 
ATOM   1881 O O   . LEU A 1 290 ? 20.102  25.988 23.172 1.00 64.24  ? 785  LEU A O   1 
ATOM   1882 C CB  . LEU A 1 290 ? 17.614  24.497 21.607 1.00 53.05  ? 785  LEU A CB  1 
ATOM   1883 C CG  . LEU A 1 290 ? 17.477  23.711 20.342 1.00 56.57  ? 785  LEU A CG  1 
ATOM   1884 C CD1 . LEU A 1 290 ? 16.085  23.794 19.838 1.00 55.98  ? 785  LEU A CD1 1 
ATOM   1885 C CD2 . LEU A 1 290 ? 18.463  24.178 19.308 1.00 58.00  ? 785  LEU A CD2 1 
ATOM   1886 N N   . LEU A 1 291 ? 18.400  25.423 24.609 1.00 57.72  ? 786  LEU A N   1 
ATOM   1887 C CA  . LEU A 1 291 ? 18.656  26.491 25.586 1.00 57.18  ? 786  LEU A CA  1 
ATOM   1888 C C   . LEU A 1 291 ? 20.036  26.345 26.257 1.00 63.20  ? 786  LEU A C   1 
ATOM   1889 O O   . LEU A 1 291 ? 20.513  27.290 26.881 1.00 63.94  ? 786  LEU A O   1 
ATOM   1890 C CB  . LEU A 1 291 ? 17.526  26.584 26.629 1.00 56.39  ? 786  LEU A CB  1 
ATOM   1891 C CG  . LEU A 1 291 ? 16.155  26.988 26.107 1.00 57.89  ? 786  LEU A CG  1 
ATOM   1892 C CD1 . LEU A 1 291 ? 15.061  26.318 26.873 1.00 56.90  ? 786  LEU A CD1 1 
ATOM   1893 C CD2 . LEU A 1 291 ? 15.989  28.471 26.118 1.00 58.97  ? 786  LEU A CD2 1 
ATOM   1894 N N   . ALA A 1 292 ? 20.686  25.177 26.099 1.00 60.06  ? 787  ALA A N   1 
ATOM   1895 C CA  . ALA A 1 292 ? 22.025  24.922 26.610 1.00 60.99  ? 787  ALA A CA  1 
ATOM   1896 C C   . ALA A 1 292 ? 23.061  24.808 25.453 1.00 66.67  ? 787  ALA A C   1 
ATOM   1897 O O   . ALA A 1 292 ? 24.225  24.486 25.728 1.00 68.64  ? 787  ALA A O   1 
ATOM   1898 C CB  . ALA A 1 292 ? 22.020  23.664 27.451 1.00 62.19  ? 787  ALA A CB  1 
ATOM   1899 N N   . HIS A 1 293 ? 22.659  25.088 24.169 1.00 61.10  ? 788  HIS A N   1 
ATOM   1900 C CA  . HIS A 1 293 ? 23.587  24.998 23.026 1.00 61.21  ? 788  HIS A CA  1 
ATOM   1901 C C   . HIS A 1 293 ? 24.542  26.166 23.009 1.00 68.12  ? 788  HIS A C   1 
ATOM   1902 O O   . HIS A 1 293 ? 24.109  27.271 23.328 1.00 66.87  ? 788  HIS A O   1 
ATOM   1903 C CB  . HIS A 1 293 ? 22.831  24.937 21.700 1.00 60.80  ? 788  HIS A CB  1 
ATOM   1904 C CG  . HIS A 1 293 ? 23.670  24.611 20.500 1.00 64.82  ? 788  HIS A CG  1 
ATOM   1905 N ND1 . HIS A 1 293 ? 24.555  25.531 19.959 1.00 67.59  ? 788  HIS A ND1 1 
ATOM   1906 C CD2 . HIS A 1 293 ? 23.658  23.511 19.713 1.00 67.19  ? 788  HIS A CD2 1 
ATOM   1907 C CE1 . HIS A 1 293 ? 25.105  24.933 18.913 1.00 67.89  ? 788  HIS A CE1 1 
ATOM   1908 N NE2 . HIS A 1 293 ? 24.577  23.724 18.708 1.00 67.94  ? 788  HIS A NE2 1 
ATOM   1909 N N   . PRO A 1 294 ? 25.827  25.968 22.596 1.00 69.75  ? 789  PRO A N   1 
ATOM   1910 C CA  . PRO A 1 294 ? 26.780  27.100 22.559 1.00 72.01  ? 789  PRO A CA  1 
ATOM   1911 C C   . PRO A 1 294 ? 26.331  28.339 21.775 1.00 78.51  ? 789  PRO A C   1 
ATOM   1912 O O   . PRO A 1 294 ? 26.669  29.447 22.183 1.00 79.73  ? 789  PRO A O   1 
ATOM   1913 C CB  . PRO A 1 294 ? 28.037  26.476 21.949 1.00 74.58  ? 789  PRO A CB  1 
ATOM   1914 C CG  . PRO A 1 294 ? 27.961  25.031 22.315 1.00 78.07  ? 789  PRO A CG  1 
ATOM   1915 C CD  . PRO A 1 294 ? 26.504  24.699 22.235 1.00 71.99  ? 789  PRO A CD  1 
ATOM   1916 N N   . TYR A 1 295 ? 25.550  28.162 20.672 1.00 74.70  ? 790  TYR A N   1 
ATOM   1917 C CA  . TYR A 1 295 ? 25.034  29.277 19.859 1.00 73.82  ? 790  TYR A CA  1 
ATOM   1918 C C   . TYR A 1 295 ? 24.289  30.268 20.721 1.00 76.73  ? 790  TYR A C   1 
ATOM   1919 O O   . TYR A 1 295 ? 24.470  31.461 20.566 1.00 78.02  ? 790  TYR A O   1 
ATOM   1920 C CB  . TYR A 1 295 ? 24.113  28.788 18.723 1.00 73.73  ? 790  TYR A CB  1 
ATOM   1921 C CG  . TYR A 1 295 ? 23.473  29.909 17.928 1.00 75.81  ? 790  TYR A CG  1 
ATOM   1922 C CD1 . TYR A 1 295 ? 24.248  30.803 17.197 1.00 79.55  ? 790  TYR A CD1 1 
ATOM   1923 C CD2 . TYR A 1 295 ? 22.093  30.076 17.906 1.00 75.38  ? 790  TYR A CD2 1 
ATOM   1924 C CE1 . TYR A 1 295 ? 23.668  31.858 16.493 1.00 80.78  ? 790  TYR A CE1 1 
ATOM   1925 C CE2 . TYR A 1 295 ? 21.498  31.107 17.173 1.00 76.21  ? 790  TYR A CE2 1 
ATOM   1926 C CZ  . TYR A 1 295 ? 22.292  32.005 16.479 1.00 85.01  ? 790  TYR A CZ  1 
ATOM   1927 O OH  . TYR A 1 295 ? 21.735  33.043 15.766 1.00 86.91  ? 790  TYR A OH  1 
ATOM   1928 N N   . VAL A 1 296 ? 23.481  29.766 21.649 1.00 72.04  ? 791  VAL A N   1 
ATOM   1929 C CA  . VAL A 1 296 ? 22.641  30.537 22.569 1.00 71.54  ? 791  VAL A CA  1 
ATOM   1930 C C   . VAL A 1 296 ? 23.393  30.992 23.823 1.00 77.33  ? 791  VAL A C   1 
ATOM   1931 O O   . VAL A 1 296 ? 23.124  32.078 24.333 1.00 77.78  ? 791  VAL A O   1 
ATOM   1932 C CB  . VAL A 1 296 ? 21.374  29.704 22.913 1.00 73.84  ? 791  VAL A CB  1 
ATOM   1933 C CG1 . VAL A 1 296 ? 20.565  30.335 24.033 1.00 73.65  ? 791  VAL A CG1 1 
ATOM   1934 C CG2 . VAL A 1 296 ? 20.506  29.499 21.674 1.00 72.74  ? 791  VAL A CG2 1 
ATOM   1935 N N   . GLN A 1 297 ? 24.320  30.168 24.322 1.00 74.50  ? 792  GLN A N   1 
ATOM   1936 C CA  . GLN A 1 297 ? 25.020  30.460 25.568 1.00 75.47  ? 792  GLN A CA  1 
ATOM   1937 C C   . GLN A 1 297 ? 26.316  31.217 25.444 1.00 81.27  ? 792  GLN A C   1 
ATOM   1938 O O   . GLN A 1 297 ? 26.685  31.932 26.379 1.00 82.51  ? 792  GLN A O   1 
ATOM   1939 C CB  . GLN A 1 297 ? 25.263  29.167 26.361 1.00 76.67  ? 792  GLN A CB  1 
ATOM   1940 C CG  . GLN A 1 297 ? 24.015  28.495 26.910 1.00 73.77  ? 792  GLN A CG  1 
ATOM   1941 C CD  . GLN A 1 297 ? 23.241  29.373 27.862 1.00 83.68  ? 792  GLN A CD  1 
ATOM   1942 O OE1 . GLN A 1 297 ? 23.791  30.182 28.631 1.00 81.96  ? 792  GLN A OE1 1 
ATOM   1943 N NE2 . GLN A 1 297 ? 21.941  29.217 27.844 1.00 68.30  ? 792  GLN A NE2 1 
ATOM   1944 N N   . ILE A 1 298 ? 27.037  31.015 24.332 1.00 78.31  ? 793  ILE A N   1 
ATOM   1945 C CA  . ILE A 1 298 ? 28.369  31.579 24.106 1.00 80.00  ? 793  ILE A CA  1 
ATOM   1946 C C   . ILE A 1 298 ? 28.391  32.859 23.294 1.00 86.37  ? 793  ILE A C   1 
ATOM   1947 O O   . ILE A 1 298 ? 27.737  32.956 22.247 1.00 84.42  ? 793  ILE A O   1 
ATOM   1948 C CB  . ILE A 1 298 ? 29.319  30.469 23.575 1.00 82.76  ? 793  ILE A CB  1 
ATOM   1949 C CG1 . ILE A 1 298 ? 29.808  29.597 24.733 1.00 83.85  ? 793  ILE A CG1 1 
ATOM   1950 C CG2 . ILE A 1 298 ? 30.472  30.988 22.729 1.00 84.89  ? 793  ILE A CG2 1 
ATOM   1951 C CD1 . ILE A 1 298 ? 30.015  28.220 24.377 1.00 91.99  ? 793  ILE A CD1 1 
ATOM   1952 N N   . GLN A 1 299 ? 29.186  33.836 23.799 1.00 86.62  ? 794  GLN A N   1 
ATOM   1953 C CA  . GLN A 1 299 ? 29.470  35.154 23.214 1.00 112.38 ? 794  GLN A CA  1 
ATOM   1954 C C   . GLN A 1 299 ? 30.554  34.997 22.134 1.00 119.71 ? 794  GLN A C   1 
ATOM   1955 O O   . GLN A 1 299 ? 30.694  35.837 21.248 1.00 79.52  ? 794  GLN A O   1 
ATOM   1956 C CB  . GLN A 1 299 ? 29.971  36.123 24.304 1.00 116.05 ? 794  GLN A CB  1 
ATOM   1957 C CG  . GLN A 1 299 ? 28.937  36.451 25.383 1.00 126.22 ? 794  GLN A CG  1 
ATOM   1958 C CD  . GLN A 1 299 ? 29.102  35.604 26.625 1.00 140.06 ? 794  GLN A CD  1 
ATOM   1959 O OE1 . GLN A 1 299 ? 28.933  34.376 26.605 1.00 132.74 ? 794  GLN A OE1 1 
ATOM   1960 N NE2 . GLN A 1 299 ? 29.401  36.252 27.744 1.00 132.00 ? 794  GLN A NE2 1 
HETATM 1961 C C1  . EDO B 2 .   ? 1.803   48.662 13.413 1.00 90.05  ? 1795 EDO A C1  1 
HETATM 1962 O O1  . EDO B 2 .   ? 1.415   47.310 13.227 1.00 91.15  ? 1795 EDO A O1  1 
HETATM 1963 C C2  . EDO B 2 .   ? 1.759   49.033 14.915 1.00 88.54  ? 1795 EDO A C2  1 
HETATM 1964 O O2  . EDO B 2 .   ? 2.453   50.261 15.106 1.00 88.33  ? 1795 EDO A O2  1 
HETATM 1965 O O19 . 7PE C 3 .   ? -6.489  33.523 16.052 1.00 90.55  ? 1796 7PE A O19 1 
HETATM 1966 C C18 . 7PE C 3 .   ? -7.382  34.522 15.517 1.00 89.37  ? 1796 7PE A C18 1 
HETATM 1967 C C17 . 7PE C 3 .   ? -8.858  34.297 15.935 1.00 85.61  ? 1796 7PE A C17 1 
HETATM 1968 O O16 . 7PE C 3 .   ? -9.043  33.591 17.184 1.00 83.09  ? 1796 7PE A O16 1 
HETATM 1969 C C15 . 7PE C 3 .   ? -10.128 34.170 17.920 1.00 80.84  ? 1796 7PE A C15 1 
HETATM 1970 C C14 . 7PE C 3 .   ? -9.866  34.476 19.401 1.00 79.39  ? 1796 7PE A C14 1 
HETATM 1971 O O13 . 7PE C 3 .   ? -8.938  33.593 20.048 1.00 79.74  ? 1796 7PE A O13 1 
HETATM 1972 C C12 . 7PE C 3 .   ? -8.053  34.367 20.932 1.00 79.50  ? 1796 7PE A C12 1 
HETATM 1973 C C11 . 7PE C 3 .   ? -6.574  34.358 20.520 1.00 77.99  ? 1796 7PE A C11 1 
HETATM 1974 O O10 . 7PE C 3 .   ? -5.655  35.093 21.366 1.00 77.22  ? 1796 7PE A O10 1 
HETATM 1975 C C9  . 7PE C 3 .   ? -5.018  36.242 20.716 1.00 77.51  ? 1796 7PE A C9  1 
HETATM 1976 C C8  . 7PE C 3 .   ? -3.917  35.951 19.660 1.00 75.96  ? 1796 7PE A C8  1 
HETATM 1977 O O7  . 7PE C 3 .   ? -3.819  36.971 18.630 1.00 73.18  ? 1796 7PE A O7  1 
HETATM 1978 C C6  . 7PE C 3 .   ? -4.118  36.412 17.324 1.00 73.27  ? 1796 7PE A C6  1 
HETATM 1979 C C5  . 7PE C 3 .   ? -4.236  37.505 16.235 1.00 73.38  ? 1796 7PE A C5  1 
HETATM 1980 O O4  . 7PE C 3 .   ? -5.414  37.314 15.412 1.00 72.86  ? 1796 7PE A O4  1 
HETATM 1981 C CAO . ZO8 D 4 .   ? -0.721  42.143 17.031 1.00 95.12  ? 1797 ZO8 A CAO 1 
HETATM 1982 C CAN . ZO8 D 4 .   ? -0.836  42.549 18.394 1.00 94.09  ? 1797 ZO8 A CAN 1 
HETATM 1983 C CAH . ZO8 D 4 .   ? -1.730  41.823 19.207 1.00 91.52  ? 1797 ZO8 A CAH 1 
HETATM 1984 C CAF . ZO8 D 4 .   ? -2.346  40.446 17.497 1.00 90.89  ? 1797 ZO8 A CAF 1 
HETATM 1985 C CAL . ZO8 D 4 .   ? -1.519  41.051 16.604 1.00 91.53  ? 1797 ZO8 A CAL 1 
HETATM 1986 C CAC . ZO8 D 4 .   ? 1.361   43.701 14.332 1.00 100.90 ? 1797 ZO8 A CAC 1 
HETATM 1987 C CAG . ZO8 D 4 .   ? 0.516   42.729 14.732 1.00 100.43 ? 1797 ZO8 A CAG 1 
HETATM 1988 C CAM . ZO8 D 4 .   ? 0.147   42.885 16.148 1.00 99.58  ? 1797 ZO8 A CAM 1 
HETATM 1989 C CAJ . ZO8 D 4 .   ? 0.787   44.014 16.764 1.00 100.53 ? 1797 ZO8 A CAJ 1 
HETATM 1990 N NAC . ZO8 D 4 .   ? 0.694   44.397 18.043 1.00 99.17  ? 1797 ZO8 A NAC 1 
HETATM 1991 S SAK . ZO8 D 4 .   ? 1.758   44.822 15.579 1.00 102.16 ? 1797 ZO8 A SAK 1 
HETATM 1992 C CAK . ZO8 D 4 .   ? -0.087  43.673 18.821 1.00 97.04  ? 1797 ZO8 A CAK 1 
HETATM 1993 N N   . ZO8 D 4 .   ? -2.468  40.800 18.784 1.00 91.15  ? 1797 ZO8 A N   1 
HETATM 1994 C C1  . EDO E 2 .   ? 21.602  38.720 22.635 1.00 80.64  ? 1798 EDO A C1  1 
HETATM 1995 O O1  . EDO E 2 .   ? 22.696  38.095 21.997 1.00 79.85  ? 1798 EDO A O1  1 
HETATM 1996 C C2  . EDO E 2 .   ? 21.461  38.225 24.092 1.00 83.27  ? 1798 EDO A C2  1 
HETATM 1997 O O2  . EDO E 2 .   ? 20.374  38.910 24.704 1.00 84.99  ? 1798 EDO A O2  1 
HETATM 1998 O O   . HOH F 5 .   ? -5.759  47.757 31.590 1.00 56.11  ? 2001 HOH A O   1 
HETATM 1999 O O   . HOH F 5 .   ? 15.588  39.712 20.966 1.00 89.22  ? 2002 HOH A O   1 
HETATM 2000 O O   . HOH F 5 .   ? 10.220  21.524 25.669 1.00 63.27  ? 2003 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLN A 21  ? 1.3417 1.2315 2.0466 0.1412  0.1830  0.4256  516 GLN A N   
2    C CA  . GLN A 21  ? 1.3230 1.2298 1.9769 0.1389  0.1673  0.4017  516 GLN A CA  
3    C C   . GLN A 21  ? 1.3595 1.2332 1.9939 0.1231  0.1556  0.3487  516 GLN A C   
4    O O   . GLN A 21  ? 1.3740 1.2165 2.0285 0.1124  0.1564  0.3284  516 GLN A O   
5    C CB  . GLN A 21  ? 1.3172 1.2752 1.9176 0.1376  0.1526  0.4158  516 GLN A CB  
6    N N   . SER A 22  ? 1.2759 1.1597 1.8737 0.1227  0.1454  0.3277  517 SER A N   
7    C CA  . SER A 22  ? 1.2605 1.1203 1.8371 0.1121  0.1358  0.2813  517 SER A CA  
8    C C   . SER A 22  ? 1.2795 1.1660 1.7992 0.1066  0.1202  0.2678  517 SER A C   
9    O O   . SER A 22  ? 1.2700 1.1928 1.7704 0.1104  0.1162  0.2914  517 SER A O   
10   C CB  . SER A 22  ? 1.3174 1.1467 1.9307 0.1218  0.1475  0.2640  517 SER A CB  
11   O OG  . SER A 22  ? 1.4129 1.2219 2.0074 0.1137  0.1388  0.2181  517 SER A OG  
12   N N   . MET A 23  ? 1.2099 1.0805 1.7058 0.0976  0.1115  0.2305  518 MET A N   
13   C CA  . MET A 23  ? 1.1796 1.0705 1.6305 0.0938  0.1003  0.2174  518 MET A CA  
14   C C   . MET A 23  ? 1.2020 1.0720 1.6407 0.0918  0.0974  0.1790  518 MET A C   
15   O O   . MET A 23  ? 1.2118 1.0548 1.6689 0.0888  0.0988  0.1576  518 MET A O   
16   C CB  . MET A 23  ? 1.1865 1.0987 1.6028 0.0814  0.0875  0.2224  518 MET A CB  
17   C CG  . MET A 23  ? 1.2334 1.1273 1.6525 0.0707  0.0842  0.2124  518 MET A CG  
18   S SD  . MET A 23  ? 1.2687 1.1873 1.6433 0.0577  0.0695  0.2136  518 MET A SD  
19   C CE  . MET A 23  ? 1.2282 1.1765 1.6150 0.0642  0.0735  0.2538  518 MET A CE  
20   N N   . SER A 24  ? 1.1202 1.0063 1.5295 0.0940  0.0932  0.1705  519 SER A N   
21   C CA  . SER A 24  ? 1.1165 0.9912 1.5084 0.0951  0.0908  0.1370  519 SER A CA  
22   C C   . SER A 24  ? 1.1290 1.0209 1.4780 0.0855  0.0794  0.1302  519 SER A C   
23   O O   . SER A 24  ? 1.1206 1.0369 1.4538 0.0842  0.0770  0.1469  519 SER A O   
24   C CB  . SER A 24  ? 1.1753 1.0535 1.5749 0.1106  0.1002  0.1336  519 SER A CB  
25   O OG  . SER A 24  ? 1.3014 1.1812 1.6736 0.1136  0.0972  0.1060  519 SER A OG  
26   N N   . VAL A 25  ? 1.0557 0.9359 1.3894 0.0791  0.0728  0.1050  520 VAL A N   
27   C CA  . VAL A 25  ? 1.0263 0.9209 1.3224 0.0724  0.0643  0.0986  520 VAL A CA  
28   C C   . VAL A 25  ? 1.1032 0.9968 1.3849 0.0821  0.0660  0.0727  520 VAL A C   
29   O O   . VAL A 25  ? 1.1214 1.0000 1.4088 0.0840  0.0643  0.0472  520 VAL A O   
30   C CB  . VAL A 25  ? 1.0492 0.9366 1.3367 0.0591  0.0553  0.0933  520 VAL A CB  
31   C CG1 . VAL A 25  ? 1.0293 0.9278 1.2812 0.0545  0.0480  0.0832  520 VAL A CG1 
32   C CG2 . VAL A 25  ? 1.0320 0.9274 1.3277 0.0516  0.0538  0.1200  520 VAL A CG2 
33   N N   . LYS A 26  ? 1.0504 0.9636 1.3140 0.0887  0.0692  0.0791  521 LYS A N   
34   C CA  . LYS A 26  ? 1.0568 0.9754 1.3061 0.1023  0.0734  0.0586  521 LYS A CA  
35   C C   . LYS A 26  ? 1.1363 1.0382 1.4131 0.1143  0.0809  0.0430  521 LYS A C   
36   O O   . LYS A 26  ? 1.1408 1.0367 1.4456 0.1165  0.0875  0.0600  521 LYS A O   
37   C CB  . LYS A 26  ? 1.0639 0.9834 1.2873 0.0994  0.0653  0.0369  521 LYS A CB  
38   C CG  . LYS A 26  ? 1.0850 1.0245 1.2802 0.0945  0.0627  0.0514  521 LYS A CG  
39   C CD  . LYS A 26  ? 1.1659 1.1174 1.3329 0.1034  0.0611  0.0324  521 LYS A CD  
40   C CE  . LYS A 26  ? 1.1777 1.1454 1.3230 0.0978  0.0600  0.0497  521 LYS A CE  
41   N NZ  . LYS A 26  ? 1.1528 1.1301 1.3085 0.0940  0.0661  0.0770  521 LYS A NZ  
42   N N   . GLY A 27  ? 1.0969 0.9930 1.3678 0.1229  0.0801  0.0103  522 GLY A N   
43   C CA  . GLY A 27  ? 1.1157 0.9940 1.4167 0.1343  0.0872  -0.0098 522 GLY A CA  
44   C C   . GLY A 27  ? 1.1420 0.9919 1.4853 0.1250  0.0874  -0.0084 522 GLY A C   
45   O O   . GLY A 27  ? 1.1440 0.9804 1.5222 0.1318  0.0975  -0.0006 522 GLY A O   
46   N N   . ARG A 28  ? 1.0649 0.9071 1.4074 0.1102  0.0775  -0.0132 523 ARG A N   
47   C CA  . ARG A 28  ? 1.0566 0.8724 1.4420 0.1021  0.0783  -0.0165 523 ARG A CA  
48   C C   . ARG A 28  ? 1.0747 0.8863 1.4854 0.0977  0.0854  0.0232  523 ARG A C   
49   O O   . ARG A 28  ? 1.0338 0.8656 1.4229 0.0965  0.0850  0.0512  523 ARG A O   
50   C CB  . ARG A 28  ? 1.0361 0.8492 1.4131 0.0884  0.0658  -0.0330 523 ARG A CB  
51   N N   . ILE A 29  ? 1.0579 0.8452 1.5175 0.0964  0.0922  0.0250  524 ILE A N   
52   C CA  . ILE A 29  ? 1.0476 0.8327 1.5365 0.0955  0.1010  0.0646  524 ILE A CA  
53   C C   . ILE A 29  ? 1.0812 0.8552 1.5916 0.0820  0.0981  0.0729  524 ILE A C   
54   O O   . ILE A 29  ? 1.0809 0.8343 1.6167 0.0764  0.0963  0.0467  524 ILE A O   
55   C CB  . ILE A 29  ? 1.1143 0.8806 1.6520 0.1089  0.1166  0.0687  524 ILE A CB  
56   C CG1 . ILE A 29  ? 1.1386 0.9104 1.6604 0.1235  0.1199  0.0475  524 ILE A CG1 
57   C CG2 . ILE A 29  ? 1.1105 0.8888 1.6649 0.1136  0.1260  0.1162  524 ILE A CG2 
58   C CD1 . ILE A 29  ? 1.2422 1.0461 1.7265 0.1287  0.1192  0.0728  524 ILE A CD1 
59   N N   . TYR A 30  ? 1.0065 0.7976 1.5069 0.0772  0.0975  0.1085  525 TYR A N   
60   C CA  . TYR A 30  ? 0.9820 0.7696 1.4955 0.0657  0.0952  0.1214  525 TYR A CA  
61   C C   . TYR A 30  ? 1.0155 0.8077 1.5620 0.0711  0.1074  0.1637  525 TYR A C   
62   O O   . TYR A 30  ? 0.9962 0.8145 1.5232 0.0772  0.1083  0.1915  525 TYR A O   
63   C CB  . TYR A 30  ? 0.9659 0.7750 1.4285 0.0551  0.0812  0.1211  525 TYR A CB  
64   C CG  . TYR A 30  ? 0.9777 0.7847 1.4101 0.0507  0.0701  0.0833  525 TYR A CG  
65   C CD1 . TYR A 30  ? 0.9984 0.8183 1.3972 0.0578  0.0673  0.0718  525 TYR A CD1 
66   C CD2 . TYR A 30  ? 0.9831 0.7794 1.4213 0.0408  0.0629  0.0614  525 TYR A CD2 
67   C CE1 . TYR A 30  ? 1.0137 0.8366 1.3845 0.0571  0.0587  0.0406  525 TYR A CE1 
68   C CE2 . TYR A 30  ? 0.9947 0.7947 1.4047 0.0393  0.0525  0.0280  525 TYR A CE2 
69   C CZ  . TYR A 30  ? 1.1087 0.9227 1.4839 0.0484  0.0508  0.0185  525 TYR A CZ  
70   O OH  . TYR A 30  ? 1.1667 0.9896 1.5126 0.0498  0.0419  -0.0106 525 TYR A OH  
71   N N   . SER A 31  ? 0.9817 0.7513 1.5809 0.0692  0.1170  0.1689  526 SER A N   
72   C CA  . SER A 31  ? 0.9821 0.7546 1.6221 0.0761  0.1318  0.2120  526 SER A CA  
73   C C   . SER A 31  ? 0.9894 0.7847 1.6085 0.0686  0.1267  0.2363  526 SER A C   
74   O O   . SER A 31  ? 0.9667 0.7534 1.5825 0.0558  0.1192  0.2182  526 SER A O   
75   C CB  . SER A 31  ? 1.0669 0.8032 1.7782 0.0764  0.1455  0.2054  526 SER A CB  
76   O OG  . SER A 31  ? 1.2127 0.9270 1.9434 0.0838  0.1497  0.1767  526 SER A OG  
77   N N   . ILE A 32  ? 0.9411 0.7685 1.5461 0.0774  0.1302  0.2757  527 ILE A N   
78   C CA  . ILE A 32  ? 0.9358 0.7894 1.5183 0.0728  0.1255  0.2976  527 ILE A CA  
79   C C   . ILE A 32  ? 1.0241 0.8680 1.6592 0.0744  0.1404  0.3245  527 ILE A C   
80   O O   . ILE A 32  ? 1.0620 0.9027 1.7424 0.0873  0.1574  0.3538  527 ILE A O   
81   C CB  . ILE A 32  ? 0.9634 0.8616 1.5049 0.0809  0.1201  0.3228  527 ILE A CB  
82   C CG1 . ILE A 32  ? 0.9528 0.8593 1.4493 0.0774  0.1063  0.2961  527 ILE A CG1 
83   C CG2 . ILE A 32  ? 0.9629 0.8889 1.4791 0.0768  0.1145  0.3393  527 ILE A CG2 
84   C CD1 . ILE A 32  ? 1.0608 0.9890 1.5576 0.0907  0.1102  0.3145  527 ILE A CD1 
85   N N   . LEU A 33  ? 0.9656 0.8054 1.5982 0.0622  0.1356  0.3164  528 LEU A N   
86   C CA  . LEU A 33  ? 0.9689 0.8007 1.6537 0.0620  0.1500  0.3416  528 LEU A CA  
87   C C   . LEU A 33  ? 1.0346 0.9072 1.6994 0.0702  0.1537  0.3837  528 LEU A C   
88   O O   . LEU A 33  ? 1.0514 0.9333 1.7578 0.0824  0.1720  0.4258  528 LEU A O   
89   C CB  . LEU A 33  ? 0.9590 0.7657 1.6568 0.0443  0.1427  0.3077  528 LEU A CB  
90   C CG  . LEU A 33  ? 1.0254 0.7903 1.7839 0.0386  0.1489  0.2807  528 LEU A CG  
91   C CD1 . LEU A 33  ? 1.0289 0.7793 1.7815 0.0448  0.1466  0.2559  528 LEU A CD1 
92   C CD2 . LEU A 33  ? 1.0433 0.7941 1.8017 0.0212  0.1363  0.2423  528 LEU A CD2 
93   N N   . LYS A 34  ? 0.9764 0.8744 1.5791 0.0643  0.1371  0.3715  529 LYS A N   
94   C CA  . LYS A 34  ? 0.9682 0.9092 1.5380 0.0711  0.1356  0.3997  529 LYS A CA  
95   C C   . LYS A 34  ? 1.0394 1.0004 1.5414 0.0642  0.1150  0.3737  529 LYS A C   
96   O O   . LYS A 34  ? 1.0288 0.9679 1.5121 0.0530  0.1033  0.3363  529 LYS A O   
97   C CB  . LYS A 34  ? 0.9864 0.9275 1.5802 0.0673  0.1437  0.4153  529 LYS A CB  
98   C CG  . LYS A 34  ? 0.9859 0.8931 1.5886 0.0481  0.1357  0.3771  529 LYS A CG  
99   C CD  . LYS A 34  ? 1.0184 0.9432 1.6107 0.0441  0.1355  0.3875  529 LYS A CD  
100  C CE  . LYS A 34  ? 1.1136 1.0080 1.7321 0.0274  0.1318  0.3591  529 LYS A CE  
101  N NZ  . LYS A 34  ? 1.2387 1.1506 1.8574 0.0251  0.1351  0.3748  529 LYS A NZ  
102  N N   . GLN A 35  ? 1.0172 1.0211 1.4846 0.0720  0.1113  0.3934  530 GLN A N   
103  C CA  . GLN A 35  ? 1.0141 1.0384 1.4242 0.0657  0.0931  0.3703  530 GLN A CA  
104  C C   . GLN A 35  ? 1.1034 1.1324 1.4933 0.0577  0.0882  0.3623  530 GLN A C   
105  O O   . GLN A 35  ? 1.1103 1.1639 1.5067 0.0667  0.0967  0.3906  530 GLN A O   
106  C CB  . GLN A 35  ? 1.0326 1.1022 1.4191 0.0794  0.0896  0.3890  530 GLN A CB  
107  C CG  . GLN A 35  ? 1.2397 1.3323 1.5752 0.0732  0.0709  0.3644  530 GLN A CG  
108  C CD  . GLN A 35  ? 1.6460 1.7835 1.9688 0.0862  0.0672  0.3809  530 GLN A CD  
109  O OE1 . GLN A 35  ? 1.6425 1.7954 1.9918 0.1016  0.0786  0.4123  530 GLN A OE1 
110  N NE2 . GLN A 35  ? 1.5960 1.7572 1.8809 0.0805  0.0512  0.3598  530 GLN A NE2 
111  N N   . ILE A 36  ? 1.0745 1.0785 1.4458 0.0422  0.0768  0.3260  531 ILE A N   
112  C CA  . ILE A 36  ? 1.0764 1.0800 1.4295 0.0336  0.0715  0.3138  531 ILE A CA  
113  C C   . ILE A 36  ? 1.1919 1.2349 1.5000 0.0384  0.0632  0.3169  531 ILE A C   
114  O O   . ILE A 36  ? 1.2044 1.2711 1.5107 0.0454  0.0689  0.3368  531 ILE A O   
115  C CB  . ILE A 36  ? 1.0928 1.0621 1.4404 0.0181  0.0622  0.2763  531 ILE A CB  
116  C CG1 . ILE A 36  ? 1.1013 1.0366 1.4986 0.0141  0.0703  0.2712  531 ILE A CG1 
117  C CG2 . ILE A 36  ? 1.0809 1.0556 1.4061 0.0113  0.0564  0.2662  531 ILE A CG2 
118  C CD1 . ILE A 36  ? 1.1408 1.0487 1.5348 0.0018  0.0609  0.2338  531 ILE A CD1 
119  N N   . GLY A 37  ? 1.1817 1.2332 1.4569 0.0353  0.0508  0.2973  532 GLY A N   
120  C CA  . GLY A 37  ? 1.1998 1.2873 1.4374 0.0385  0.0419  0.2944  532 GLY A CA  
121  C C   . GLY A 37  ? 1.3010 1.4052 1.5204 0.0392  0.0321  0.2842  532 GLY A C   
122  O O   . GLY A 37  ? 1.2887 1.3721 1.5197 0.0352  0.0316  0.2759  532 GLY A O   
123  N N   . SER A 38  ? 1.3115 1.4565 1.5048 0.0450  0.0245  0.2845  533 SER A N   
124  C CA  . SER A 38  ? 1.3234 1.4864 1.5000 0.0424  0.0125  0.2686  533 SER A CA  
125  C C   . SER A 38  ? 1.4175 1.5924 1.5639 0.0350  0.0005  0.2423  533 SER A C   
126  O O   . SER A 38  ? 1.4279 1.6324 1.5587 0.0424  -0.0005 0.2468  533 SER A O   
127  C CB  . SER A 38  ? 1.3718 1.5815 1.5518 0.0584  0.0133  0.2929  533 SER A CB  
128  N N   . GLY A 39  ? 1.3857 1.5382 1.5257 0.0215  -0.0073 0.2155  534 GLY A N   
129  C CA  . GLY A 39  ? 1.3875 1.5505 1.5061 0.0140  -0.0184 0.1895  534 GLY A CA  
130  C C   . GLY A 39  ? 1.4385 1.6494 1.5479 0.0194  -0.0287 0.1849  534 GLY A C   
131  O O   . GLY A 39  ? 1.4495 1.6860 1.5408 0.0207  -0.0361 0.1706  534 GLY A O   
132  N N   . GLY A 40  ? 1.3743 1.5990 1.4973 0.0228  -0.0298 0.1950  535 GLY A N   
133  C CA  . GLY A 40  ? 1.3735 1.6482 1.4921 0.0282  -0.0407 0.1910  535 GLY A CA  
134  C C   . GLY A 40  ? 1.3896 1.6639 1.5279 0.0259  -0.0418 0.1953  535 GLY A C   
135  O O   . GLY A 40  ? 1.3868 1.6900 1.5346 0.0386  -0.0395 0.2180  535 GLY A O   
136  N N   . SER A 41  ? 1.3031 1.5459 1.4488 0.0111  -0.0440 0.1756  536 SER A N   
137  C CA  . SER A 41  ? 1.2673 1.5012 1.4329 0.0087  -0.0417 0.1806  536 SER A CA  
138  C C   . SER A 41  ? 1.2473 1.4350 1.4220 0.0091  -0.0284 0.1918  536 SER A C   
139  O O   . SER A 41  ? 1.2304 1.4061 1.4202 0.0091  -0.0240 0.1963  536 SER A O   
140  C CB  . SER A 41  ? 1.2970 1.5242 1.4686 -0.0063 -0.0494 0.1551  536 SER A CB  
141  O OG  . SER A 41  ? 1.3780 1.5608 1.5445 -0.0161 -0.0444 0.1428  536 SER A OG  
142  N N   . SER A 42  ? 1.1571 1.3213 1.3236 0.0096  -0.0225 0.1940  537 SER A N   
143  C CA  . SER A 42  ? 1.1197 1.2413 1.2952 0.0083  -0.0121 0.1980  537 SER A CA  
144  C C   . SER A 42  ? 1.0900 1.2125 1.2750 0.0194  -0.0029 0.2214  537 SER A C   
145  O O   . SER A 42  ? 1.0948 1.2422 1.2712 0.0256  -0.0037 0.2309  537 SER A O   
146  C CB  . SER A 42  ? 1.1667 1.2592 1.3295 -0.0026 -0.0136 0.1781  537 SER A CB  
147  O OG  . SER A 42  ? 1.3444 1.4334 1.5046 -0.0121 -0.0194 0.1599  537 SER A OG  
148  N N   . LYS A 43  ? 0.9763 1.0729 1.1818 0.0227  0.0069  0.2307  538 LYS A N   
149  C CA  . LYS A 43  ? 0.9499 1.0408 1.1758 0.0323  0.0183  0.2537  538 LYS A CA  
150  C C   . LYS A 43  ? 0.9643 1.0094 1.2043 0.0260  0.0247  0.2427  538 LYS A C   
151  O O   . LYS A 43  ? 0.9751 0.9992 1.2187 0.0222  0.0245  0.2283  538 LYS A O   
152  C CB  . LYS A 43  ? 0.9661 1.0784 1.2127 0.0461  0.0246  0.2788  538 LYS A CB  
153  N N   . VAL A 44  ? 0.8703 0.9038 1.1159 0.0245  0.0291  0.2465  539 VAL A N   
154  C CA  . VAL A 44  ? 0.8444 0.8403 1.1066 0.0182  0.0336  0.2344  539 VAL A CA  
155  C C   . VAL A 44  ? 0.9094 0.8956 1.2121 0.0261  0.0470  0.2561  539 VAL A C   
156  O O   . VAL A 44  ? 0.9094 0.9159 1.2225 0.0342  0.0538  0.2825  539 VAL A O   
157  C CB  . VAL A 44  ? 0.8648 0.8522 1.1105 0.0091  0.0286  0.2196  539 VAL A CB  
158  C CG1 . VAL A 44  ? 0.8607 0.8143 1.1172 0.0017  0.0286  0.1988  539 VAL A CG1 
159  C CG2 . VAL A 44  ? 0.8495 0.8522 1.0600 0.0038  0.0178  0.2050  539 VAL A CG2 
160  N N   . PHE A 45  ? 0.8796 0.8375 1.2070 0.0257  0.0518  0.2463  540 PHE A N   
161  C CA  . PHE A 45  ? 0.8985 0.8411 1.2728 0.0324  0.0656  0.2632  540 PHE A CA  
162  C C   . PHE A 45  ? 0.9591 0.8671 1.3577 0.0238  0.0670  0.2414  540 PHE A C   
163  O O   . PHE A 45  ? 0.9622 0.8577 1.3397 0.0155  0.0573  0.2114  540 PHE A O   
164  C CB  . PHE A 45  ? 0.9304 0.8720 1.3212 0.0422  0.0714  0.2704  540 PHE A CB  
165  C CG  . PHE A 45  ? 0.9494 0.9288 1.3183 0.0506  0.0680  0.2887  540 PHE A CG  
166  C CD1 . PHE A 45  ? 1.0008 1.0096 1.3823 0.0631  0.0758  0.3242  540 PHE A CD1 
167  C CD2 . PHE A 45  ? 0.9629 0.9528 1.3000 0.0466  0.0570  0.2709  540 PHE A CD2 
168  C CE1 . PHE A 45  ? 1.0072 1.0577 1.3671 0.0712  0.0702  0.3380  540 PHE A CE1 
169  C CE2 . PHE A 45  ? 0.9950 1.0227 1.3160 0.0527  0.0521  0.2846  540 PHE A CE2 
170  C CZ  . PHE A 45  ? 0.9793 1.0383 1.3106 0.0650  0.0577  0.3163  540 PHE A CZ  
171  N N   . GLN A 46  ? 0.9146 0.8095 1.3602 0.0263  0.0793  0.2570  541 GLN A N   
172  C CA  . GLN A 46  ? 0.9197 0.7826 1.3995 0.0182  0.0810  0.2346  541 GLN A CA  
173  C C   . GLN A 46  ? 0.9890 0.8313 1.5025 0.0248  0.0888  0.2290  541 GLN A C   
174  O O   . GLN A 46  ? 1.0010 0.8487 1.5421 0.0360  0.1016  0.2587  541 GLN A O   
175  C CB  . GLN A 46  ? 0.9437 0.8035 1.4634 0.0160  0.0909  0.2543  541 GLN A CB  
176  C CG  . GLN A 46  ? 1.0823 0.9119 1.6380 0.0050  0.0895  0.2251  541 GLN A CG  
177  C CD  . GLN A 46  ? 1.3501 1.1762 1.9541 0.0019  0.1006  0.2456  541 GLN A CD  
178  O OE1 . GLN A 46  ? 1.3228 1.1531 1.9198 -0.0071 0.0948  0.2375  541 GLN A OE1 
179  N NE2 . GLN A 46  ? 1.2740 1.0931 1.9307 0.0102  0.1183  0.2746  541 GLN A NE2 
180  N N   . VAL A 47  ? 0.9279 0.7502 1.4374 0.0198  0.0815  0.1914  542 VAL A N   
181  C CA  . VAL A 47  ? 0.9258 0.7296 1.4609 0.0270  0.0876  0.1792  542 VAL A CA  
182  C C   . VAL A 47  ? 0.9881 0.7607 1.5642 0.0215  0.0881  0.1447  542 VAL A C   
183  O O   . VAL A 47  ? 0.9848 0.7513 1.5683 0.0106  0.0817  0.1274  542 VAL A O   
184  C CB  . VAL A 47  ? 0.9467 0.7643 1.4353 0.0324  0.0801  0.1689  542 VAL A CB  
185  C CG1 . VAL A 47  ? 0.9263 0.7751 1.3881 0.0383  0.0805  0.2017  542 VAL A CG1 
186  C CG2 . VAL A 47  ? 0.9291 0.7483 1.3763 0.0240  0.0654  0.1358  542 VAL A CG2 
187  N N   . LEU A 48  ? 0.9525 0.7076 1.5566 0.0298  0.0955  0.1335  543 LEU A N   
188  C CA  . LEU A 48  ? 0.9698 0.6970 1.6135 0.0271  0.0958  0.0953  543 LEU A CA  
189  C C   . LEU A 48  ? 1.0155 0.7416 1.6360 0.0370  0.0929  0.0696  543 LEU A C   
190  O O   . LEU A 48  ? 1.0080 0.7412 1.6218 0.0486  0.1009  0.0916  543 LEU A O   
191  C CB  . LEU A 48  ? 0.9983 0.7007 1.7198 0.0300  0.1138  0.1119  543 LEU A CB  
192  C CG  . LEU A 48  ? 1.0590 0.7517 1.8292 0.0188  0.1187  0.1224  543 LEU A CG  
193  C CD1 . LEU A 48  ? 1.0748 0.7435 1.9236 0.0243  0.1396  0.1437  543 LEU A CD1 
194  C CD2 . LEU A 48  ? 1.1066 0.7885 1.8853 0.0052  0.1052  0.0753  543 LEU A CD2 
195  N N   . ASN A 49  ? 0.9809 0.7012 1.5906 0.0340  0.0821  0.0241  544 ASN A N   
196  C CA  . ASN A 49  ? 0.9972 0.7191 1.5855 0.0457  0.0807  -0.0013 544 ASN A CA  
197  C C   . ASN A 49  ? 1.1062 0.7995 1.7538 0.0525  0.0911  -0.0239 544 ASN A C   
198  O O   . ASN A 49  ? 1.1113 0.7829 1.8201 0.0490  0.1025  -0.0095 544 ASN A O   
199  C CB  . ASN A 49  ? 1.0084 0.7476 1.5452 0.0436  0.0643  -0.0357 544 ASN A CB  
200  C CG  . ASN A 49  ? 1.3392 1.0705 1.8971 0.0339  0.0544  -0.0725 544 ASN A CG  
201  O OD1 . ASN A 49  ? 1.2894 1.0123 1.8789 0.0221  0.0547  -0.0626 544 ASN A OD1 
202  N ND2 . ASN A 49  ? 1.2700 1.0082 1.8101 0.0393  0.0451  -0.1155 544 ASN A ND2 
203  N N   . GLU A 50  ? 1.0885 0.7825 1.7202 0.0635  0.0888  -0.0577 545 GLU A N   
204  C CA  . GLU A 50  ? 1.1148 0.7827 1.7988 0.0719  0.0979  -0.0863 545 GLU A CA  
205  C C   . GLU A 50  ? 1.1462 0.7969 1.8722 0.0608  0.0902  -0.1297 545 GLU A C   
206  O O   . GLU A 50  ? 1.1600 0.7816 1.9526 0.0617  0.1001  -0.1453 545 GLU A O   
207  C CB  . GLU A 50  ? 1.1465 0.8250 1.7972 0.0893  0.0984  -0.1086 545 GLU A CB  
208  C CG  . GLU A 50  ? 1.2461 0.9370 1.8759 0.1011  0.1094  -0.0667 545 GLU A CG  
209  C CD  . GLU A 50  ? 1.5257 1.2514 2.0834 0.1030  0.0999  -0.0561 545 GLU A CD  
210  O OE1 . GLU A 50  ? 1.4315 1.1713 1.9575 0.0907  0.0876  -0.0533 545 GLU A OE1 
211  O OE2 . GLU A 50  ? 1.4416 1.1802 1.9780 0.1171  0.1057  -0.0500 545 GLU A OE2 
212  N N   . LYS A 51  ? 1.0752 0.7447 1.7664 0.0501  0.0730  -0.1479 546 LYS A N   
213  C CA  . LYS A 51  ? 1.0823 0.7445 1.8081 0.0377  0.0622  -0.1877 546 LYS A CA  
214  C C   . LYS A 51  ? 1.1172 0.7658 1.8908 0.0215  0.0676  -0.1566 546 LYS A C   
215  O O   . LYS A 51  ? 1.1233 0.7682 1.9291 0.0085  0.0589  -0.1820 546 LYS A O   
216  C CB  . LYS A 51  ? 1.1017 0.7962 1.7653 0.0368  0.0417  -0.2181 546 LYS A CB  
217  N N   . LYS A 52  ? 1.0533 0.6979 1.8333 0.0236  0.0824  -0.1013 547 LYS A N   
218  C CA  . LYS A 52  ? 1.0424 0.6792 1.8635 0.0132  0.0917  -0.0617 547 LYS A CA  
219  C C   . LYS A 52  ? 1.1112 0.7677 1.9046 -0.0008 0.0782  -0.0592 547 LYS A C   
220  O O   . LYS A 52  ? 1.1197 0.7666 1.9628 -0.0124 0.0818  -0.0511 547 LYS A O   
221  C CB  . LYS A 52  ? 1.0936 0.6954 2.0100 0.0099  0.1065  -0.0668 547 LYS A CB  
222  N N   . GLN A 53  ? 1.0600 0.7444 1.7765 0.0011  0.0643  -0.0630 548 GLN A N   
223  C CA  . GLN A 53  ? 1.0378 0.7432 1.7188 -0.0093 0.0519  -0.0585 548 GLN A CA  
224  C C   . GLN A 53  ? 1.0568 0.7783 1.6996 -0.0069 0.0576  -0.0083 548 GLN A C   
225  O O   . GLN A 53  ? 1.0312 0.7596 1.6441 0.0037  0.0625  0.0101  548 GLN A O   
226  C CB  . GLN A 53  ? 1.0539 0.7807 1.6785 -0.0076 0.0336  -0.0963 548 GLN A CB  
227  C CG  . GLN A 53  ? 1.3300 1.0511 1.9783 -0.0061 0.0251  -0.1513 548 GLN A CG  
228  C CD  . GLN A 53  ? 1.5687 1.3179 2.1511 0.0021  0.0102  -0.1788 548 GLN A CD  
229  O OE1 . GLN A 53  ? 1.4717 1.2284 2.0177 0.0160  0.0129  -0.1799 548 GLN A OE1 
230  N NE2 . GLN A 53  ? 1.4725 1.2408 2.0396 -0.0053 -0.0045 -0.1981 548 GLN A NE2 
231  N N   . ILE A 54  ? 1.0026 0.7326 1.6479 -0.0166 0.0562  0.0114  549 ILE A N   
232  C CA  . ILE A 54  ? 0.9702 0.7176 1.5853 -0.0150 0.0609  0.0551  549 ILE A CA  
233  C C   . ILE A 54  ? 1.0119 0.7831 1.5541 -0.0148 0.0475  0.0505  549 ILE A C   
234  O O   . ILE A 54  ? 1.0199 0.7978 1.5430 -0.0210 0.0350  0.0239  549 ILE A O   
235  C CB  . ILE A 54  ? 1.0033 0.7477 1.6643 -0.0230 0.0693  0.0798  549 ILE A CB  
236  C CG1 . ILE A 54  ? 0.9965 0.7546 1.6516 -0.0157 0.0819  0.1310  549 ILE A CG1 
237  C CG2 . ILE A 54  ? 1.0007 0.7547 1.6519 -0.0349 0.0569  0.0620  549 ILE A CG2 
238  C CD1 . ILE A 54  ? 1.0501 0.7987 1.7724 -0.0168 0.0988  0.1609  549 ILE A CD1 
239  N N   . TYR A 55  ? 0.9466 0.7318 1.4517 -0.0071 0.0505  0.0755  550 TYR A N   
240  C CA  . TYR A 55  ? 0.9151 0.7211 1.3576 -0.0066 0.0404  0.0746  550 TYR A CA  
241  C C   . TYR A 55  ? 0.9619 0.7857 1.3841 -0.0043 0.0447  0.1117  550 TYR A C   
242  O O   . TYR A 55  ? 0.9836 0.8071 1.4361 -0.0006 0.0558  0.1396  550 TYR A O   
243  C CB  . TYR A 55  ? 0.9220 0.7298 1.3377 0.0019  0.0374  0.0564  550 TYR A CB  
244  C CG  . TYR A 55  ? 0.9580 0.7578 1.3784 0.0025  0.0304  0.0155  550 TYR A CG  
245  C CD1 . TYR A 55  ? 0.9814 0.7933 1.3708 -0.0013 0.0181  -0.0059 550 TYR A CD1 
246  C CD2 . TYR A 55  ? 0.9947 0.7781 1.4491 0.0089  0.0360  -0.0024 550 TYR A CD2 
247  C CE1 . TYR A 55  ? 1.0209 0.8332 1.4116 0.0016  0.0105  -0.0445 550 TYR A CE1 
248  C CE2 . TYR A 55  ? 1.0283 0.8092 1.4848 0.0111  0.0283  -0.0444 550 TYR A CE2 
249  C CZ  . TYR A 55  ? 1.1312 0.9290 1.5541 0.0079  0.0149  -0.0654 550 TYR A CZ  
250  O OH  . TYR A 55  ? 1.1772 0.9801 1.5991 0.0122  0.0061  -0.1074 550 TYR A OH  
251  N N   . ALA A 56  ? 0.8844 0.7258 1.2575 -0.0055 0.0364  0.1118  551 ALA A N   
252  C CA  . ALA A 56  ? 0.8647 0.7267 1.2154 -0.0034 0.0379  0.1396  551 ALA A CA  
253  C C   . ALA A 56  ? 0.8987 0.7720 1.2163 0.0012  0.0341  0.1372  551 ALA A C   
254  O O   . ALA A 56  ? 0.8934 0.7678 1.1829 -0.0014 0.0266  0.1182  551 ALA A O   
255  C CB  . ALA A 56  ? 0.8615 0.7340 1.1912 -0.0105 0.0320  0.1415  551 ALA A CB  
256  N N   . ILE A 57  ? 0.8578 0.7406 1.1830 0.0091  0.0403  0.1569  552 ILE A N   
257  C CA  . ILE A 57  ? 0.8552 0.7511 1.1547 0.0128  0.0371  0.1555  552 ILE A CA  
258  C C   . ILE A 57  ? 0.9012 0.8234 1.1779 0.0116  0.0330  0.1722  552 ILE A C   
259  O O   . ILE A 57  ? 0.9198 0.8563 1.2069 0.0151  0.0367  0.1946  552 ILE A O   
260  C CB  . ILE A 57  ? 0.9037 0.7946 1.2214 0.0227  0.0443  0.1570  552 ILE A CB  
261  C CG1 . ILE A 57  ? 0.9253 0.7929 1.2555 0.0238  0.0452  0.1293  552 ILE A CG1 
262  C CG2 . ILE A 57  ? 0.8972 0.8079 1.1899 0.0257  0.0411  0.1602  552 ILE A CG2 
263  C CD1 . ILE A 57  ? 1.0409 0.9000 1.3947 0.0344  0.0539  0.1288  552 ILE A CD1 
264  N N   . LYS A 58  ? 0.8198 0.7504 1.0673 0.0074  0.0257  0.1610  553 LYS A N   
265  C CA  . LYS A 58  ? 0.7967 0.7518 1.0247 0.0049  0.0202  0.1699  553 LYS A CA  
266  C C   . LYS A 58  ? 0.8549 0.8265 1.0819 0.0092  0.0201  0.1753  553 LYS A C   
267  O O   . LYS A 58  ? 0.8445 0.8092 1.0663 0.0092  0.0203  0.1638  553 LYS A O   
268  C CB  . LYS A 58  ? 0.8006 0.7527 1.0038 -0.0039 0.0131  0.1540  553 LYS A CB  
269  C CG  . LYS A 58  ? 0.7900 0.7643 0.9775 -0.0075 0.0073  0.1591  553 LYS A CG  
270  C CD  . LYS A 58  ? 0.8130 0.7794 0.9816 -0.0152 0.0025  0.1436  553 LYS A CD  
271  C CE  . LYS A 58  ? 0.8468 0.8338 1.0026 -0.0186 -0.0031 0.1441  553 LYS A CE  
272  N NZ  . LYS A 58  ? 0.8703 0.8487 1.0124 -0.0257 -0.0065 0.1291  553 LYS A NZ  
273  N N   . TYR A 59  ? 0.8202 0.8173 1.0527 0.0141  0.0201  0.1939  554 TYR A N   
274  C CA  . TYR A 59  ? 0.8184 0.8378 1.0516 0.0174  0.0182  0.1995  554 TYR A CA  
275  C C   . TYR A 59  ? 0.8540 0.8965 1.0675 0.0094  0.0078  0.1927  554 TYR A C   
276  O O   . TYR A 59  ? 0.8381 0.8894 1.0412 0.0068  0.0037  0.1933  554 TYR A O   
277  C CB  . TYR A 59  ? 0.8416 0.8798 1.0958 0.0295  0.0242  0.2239  554 TYR A CB  
278  C CG  . TYR A 59  ? 0.8629 0.9337 1.1176 0.0328  0.0200  0.2310  554 TYR A CG  
279  C CD1 . TYR A 59  ? 0.8802 0.9461 1.1402 0.0333  0.0220  0.2242  554 TYR A CD1 
280  C CD2 . TYR A 59  ? 0.8752 0.9858 1.1246 0.0356  0.0132  0.2429  554 TYR A CD2 
281  C CE1 . TYR A 59  ? 0.8868 0.9847 1.1520 0.0357  0.0182  0.2312  554 TYR A CE1 
282  C CE2 . TYR A 59  ? 0.8849 1.0297 1.1377 0.0378  0.0074  0.2468  554 TYR A CE2 
283  C CZ  . TYR A 59  ? 0.9859 1.1233 1.2486 0.0370  0.0101  0.2415  554 TYR A CZ  
284  O OH  . TYR A 59  ? 1.0251 1.1982 1.2960 0.0387  0.0046  0.2462  554 TYR A OH  
285  N N   . VAL A 60  ? 0.8137 0.8648 1.0250 0.0053  0.0042  0.1848  555 VAL A N   
286  C CA  . VAL A 60  ? 0.8079 0.8789 1.0092 -0.0037 -0.0052 0.1750  555 VAL A CA  
287  C C   . VAL A 60  ? 0.9077 1.0067 1.1232 -0.0015 -0.0075 0.1812  555 VAL A C   
288  O O   . VAL A 60  ? 0.9112 1.0019 1.1377 0.0024  -0.0010 0.1847  555 VAL A O   
289  C CB  . VAL A 60  ? 0.8310 0.8788 1.0213 -0.0136 -0.0060 0.1570  555 VAL A CB  
290  C CG1 . VAL A 60  ? 0.8188 0.8836 1.0073 -0.0235 -0.0142 0.1459  555 VAL A CG1 
291  C CG2 . VAL A 60  ? 0.8262 0.8499 1.0045 -0.0148 -0.0041 0.1516  555 VAL A CG2 
292  N N   . ASN A 61  ? 0.8862 1.0205 1.1017 -0.0033 -0.0169 0.1812  556 ASN A N   
293  C CA  . ASN A 61  ? 0.8945 1.0603 1.1263 -0.0016 -0.0205 0.1864  556 ASN A CA  
294  C C   . ASN A 61  ? 0.9630 1.1371 1.2002 -0.0151 -0.0281 0.1682  556 ASN A C   
295  O O   . ASN A 61  ? 0.9691 1.1558 1.1992 -0.0225 -0.0375 0.1540  556 ASN A O   
296  C CB  . ASN A 61  ? 0.9149 1.1228 1.1473 0.0077  -0.0267 0.1995  556 ASN A CB  
297  C CG  . ASN A 61  ? 1.2257 1.4755 1.4746 0.0085  -0.0342 0.2016  556 ASN A CG  
298  O OD1 . ASN A 61  ? 1.1790 1.4436 1.4329 -0.0032 -0.0437 0.1836  556 ASN A OD1 
299  N ND2 . ASN A 61  ? 1.1171 1.3870 1.3786 0.0223  -0.0295 0.2238  556 ASN A ND2 
300  N N   . LEU A 62  ? 0.9142 1.0827 1.1675 -0.0174 -0.0230 0.1690  557 LEU A N   
301  C CA  . LEU A 62  ? 0.9029 1.0728 1.1693 -0.0305 -0.0261 0.1550  557 LEU A CA  
302  C C   . LEU A 62  ? 1.0026 1.2157 1.2921 -0.0342 -0.0356 0.1534  557 LEU A C   
303  O O   . LEU A 62  ? 1.0073 1.2262 1.3177 -0.0455 -0.0379 0.1431  557 LEU A O   
304  C CB  . LEU A 62  ? 0.8865 1.0301 1.1595 -0.0295 -0.0135 0.1596  557 LEU A CB  
305  C CG  . LEU A 62  ? 0.9146 1.0193 1.1663 -0.0261 -0.0054 0.1575  557 LEU A CG  
306  C CD1 . LEU A 62  ? 0.9041 0.9932 1.1617 -0.0228 0.0063  0.1616  557 LEU A CD1 
307  C CD2 . LEU A 62  ? 0.8982 0.9912 1.1388 -0.0363 -0.0109 0.1428  557 LEU A CD2 
308  N N   . GLU A 63  ? 0.9806 1.2264 1.2697 -0.0241 -0.0408 0.1647  558 GLU A N   
309  C CA  . GLU A 63  ? 0.9794 1.2722 1.2917 -0.0243 -0.0496 0.1665  558 GLU A CA  
310  C C   . GLU A 63  ? 1.0033 1.3202 1.3263 -0.0389 -0.0641 0.1418  558 GLU A C   
311  O O   . GLU A 63  ? 0.9904 1.3327 1.3429 -0.0467 -0.0696 0.1357  558 GLU A O   
312  C CB  . GLU A 63  ? 1.0076 1.3348 1.3138 -0.0082 -0.0527 0.1846  558 GLU A CB  
313  C CG  . GLU A 63  ? 1.1883 1.4963 1.4958 0.0068  -0.0378 0.2094  558 GLU A CG  
314  C CD  . GLU A 63  ? 1.5250 1.8334 1.8571 0.0072  -0.0306 0.2160  558 GLU A CD  
315  O OE1 . GLU A 63  ? 1.5858 1.8926 1.9316 -0.0062 -0.0330 0.2021  558 GLU A OE1 
316  O OE2 . GLU A 63  ? 1.4385 1.7491 1.7787 0.0215  -0.0214 0.2360  558 GLU A OE2 
317  N N   . GLU A 64  ? 0.9704 1.2806 1.2728 -0.0427 -0.0703 0.1265  559 GLU A N   
318  C CA  . GLU A 64  ? 0.9869 1.3187 1.3005 -0.0561 -0.0843 0.0984  559 GLU A CA  
319  C C   . GLU A 64  ? 1.0622 1.3497 1.3665 -0.0661 -0.0793 0.0833  559 GLU A C   
320  O O   . GLU A 64  ? 1.0582 1.3447 1.3414 -0.0658 -0.0847 0.0703  559 GLU A O   
321  C CB  . GLU A 64  ? 1.0150 1.3944 1.3118 -0.0479 -0.0989 0.0917  559 GLU A CB  
322  N N   . ALA A 65  ? 1.0349 1.2884 1.3559 -0.0733 -0.0678 0.0869  560 ALA A N   
323  C CA  . ALA A 65  ? 1.0406 1.2509 1.3540 -0.0801 -0.0600 0.0785  560 ALA A CA  
324  C C   . ALA A 65  ? 1.0939 1.2937 1.4433 -0.0951 -0.0572 0.0667  560 ALA A C   
325  O O   . ALA A 65  ? 1.0733 1.2753 1.4491 -0.0972 -0.0502 0.0779  560 ALA A O   
326  C CB  . ALA A 65  ? 1.0445 1.2187 1.3374 -0.0700 -0.0453 0.0989  560 ALA A CB  
327  N N   . ASP A 66  ? 1.0768 1.2632 1.4291 -0.1046 -0.0606 0.0456  561 ASP A N   
328  C CA  . ASP A 66  ? 1.0905 1.2629 1.4822 -0.1191 -0.0561 0.0346  561 ASP A CA  
329  C C   . ASP A 66  ? 1.0988 1.2330 1.4901 -0.1152 -0.0368 0.0566  561 ASP A C   
330  O O   . ASP A 66  ? 1.0772 1.1919 1.4338 -0.1035 -0.0299 0.0709  561 ASP A O   
331  C CB  . ASP A 66  ? 1.1489 1.3132 1.5415 -0.1277 -0.0633 0.0061  561 ASP A CB  
332  C CG  . ASP A 66  ? 1.5112 1.6405 1.8659 -0.1200 -0.0557 0.0108  561 ASP A CG  
333  O OD1 . ASP A 66  ? 1.5513 1.6603 1.8840 -0.1099 -0.0447 0.0345  561 ASP A OD1 
334  O OD2 . ASP A 66  ? 1.6623 1.7870 2.0104 -0.1235 -0.0615 -0.0110 561 ASP A OD2 
335  N N   . ASN A 67  ? 1.0477 1.1744 1.4807 -0.1247 -0.0282 0.0588  562 ASN A N   
336  C CA  . ASN A 67  ? 1.0358 1.1305 1.4710 -0.1199 -0.0087 0.0800  562 ASN A CA  
337  C C   . ASN A 67  ? 1.0828 1.1440 1.5004 -0.1194 -0.0034 0.0742  562 ASN A C   
338  O O   . ASN A 67  ? 1.0902 1.1283 1.4919 -0.1100 0.0104  0.0925  562 ASN A O   
339  C CB  . ASN A 67  ? 1.0388 1.1393 1.5275 -0.1283 0.0015  0.0896  562 ASN A CB  
340  C CG  . ASN A 67  ? 1.3795 1.5173 1.8881 -0.1290 -0.0050 0.0940  562 ASN A CG  
341  O OD1 . ASN A 67  ? 1.3219 1.4659 1.8138 -0.1162 0.0018  0.1150  562 ASN A OD1 
342  N ND2 . ASN A 67  ? 1.2566 1.4225 1.7993 -0.1429 -0.0197 0.0718  562 ASN A ND2 
343  N N   . GLN A 68  ? 1.0266 1.0883 1.4441 -0.1276 -0.0149 0.0481  563 GLN A N   
344  C CA  . GLN A 68  ? 1.0195 1.0521 1.4180 -0.1260 -0.0112 0.0409  563 GLN A CA  
345  C C   . GLN A 68  ? 1.0306 1.0616 1.3752 -0.1126 -0.0152 0.0473  563 GLN A C   
346  O O   . GLN A 68  ? 1.0289 1.0353 1.3503 -0.1043 -0.0059 0.0590  563 GLN A O   
347  C CB  . GLN A 68  ? 1.0495 1.0857 1.4684 -0.1381 -0.0217 0.0087  563 GLN A CB  
348  N N   . THR A 69  ? 0.9445 1.0048 1.2731 -0.1098 -0.0284 0.0412  564 THR A N   
349  C CA  . THR A 69  ? 0.9122 0.9756 1.1988 -0.0975 -0.0317 0.0497  564 THR A CA  
350  C C   . THR A 69  ? 0.9171 0.9637 1.1915 -0.0874 -0.0194 0.0740  564 THR A C   
351  O O   . THR A 69  ? 0.9230 0.9502 1.1703 -0.0798 -0.0150 0.0798  564 THR A O   
352  C CB  . THR A 69  ? 0.9663 1.0693 1.2484 -0.0952 -0.0453 0.0446  564 THR A CB  
353  O OG1 . THR A 69  ? 0.9715 1.0958 1.2683 -0.1044 -0.0577 0.0180  564 THR A OG1 
354  C CG2 . THR A 69  ? 0.9449 1.0517 1.1903 -0.0825 -0.0470 0.0551  564 THR A CG2 
355  N N   . LEU A 70  ? 0.8265 0.8820 1.1229 -0.0873 -0.0137 0.0863  565 LEU A N   
356  C CA  . LEU A 70  ? 0.8091 0.8528 1.0953 -0.0763 -0.0018 0.1065  565 LEU A CA  
357  C C   . LEU A 70  ? 0.8447 0.8601 1.1222 -0.0730 0.0094  0.1116  565 LEU A C   
358  O O   . LEU A 70  ? 0.8095 0.8126 1.0606 -0.0623 0.0139  0.1191  565 LEU A O   
359  C CB  . LEU A 70  ? 0.8110 0.8712 1.1262 -0.0765 0.0040  0.1184  565 LEU A CB  
360  C CG  . LEU A 70  ? 0.8718 0.9629 1.1932 -0.0746 -0.0044 0.1204  565 LEU A CG  
361  C CD1 . LEU A 70  ? 0.8722 0.9776 1.2229 -0.0735 0.0038  0.1343  565 LEU A CD1 
362  C CD2 . LEU A 70  ? 0.9100 0.9992 1.1990 -0.0619 -0.0062 0.1269  565 LEU A CD2 
363  N N   . ASP A 71  ? 0.8366 0.8429 1.1390 -0.0818 0.0140  0.1071  566 ASP A N   
364  C CA  . ASP A 71  ? 0.8469 0.8293 1.1433 -0.0770 0.0258  0.1152  566 ASP A CA  
365  C C   . ASP A 71  ? 0.8490 0.8161 1.1115 -0.0726 0.0214  0.1073  566 ASP A C   
366  O O   . ASP A 71  ? 0.8436 0.7998 1.0847 -0.0619 0.0281  0.1173  566 ASP A O   
367  C CB  . ASP A 71  ? 0.8954 0.8703 1.2328 -0.0858 0.0350  0.1170  566 ASP A CB  
368  C CG  . ASP A 71  ? 1.2003 1.1550 1.5311 -0.0767 0.0495  0.1319  566 ASP A CG  
369  O OD1 . ASP A 71  ? 1.2107 1.1687 1.5307 -0.0641 0.0600  0.1514  566 ASP A OD1 
370  O OD2 . ASP A 71  ? 1.3756 1.3136 1.7077 -0.0801 0.0499  0.1236  566 ASP A OD2 
371  N N   . SER A 72  ? 0.7759 0.7471 1.0323 -0.0792 0.0096  0.0896  567 SER A N   
372  C CA  . SER A 72  ? 0.7699 0.7298 0.9962 -0.0746 0.0059  0.0837  567 SER A CA  
373  C C   . SER A 72  ? 0.8149 0.7756 1.0131 -0.0636 0.0055  0.0935  567 SER A C   
374  O O   . SER A 72  ? 0.8206 0.7674 1.0002 -0.0569 0.0092  0.0970  567 SER A O   
375  C CB  . SER A 72  ? 0.8229 0.7938 1.0472 -0.0813 -0.0060 0.0643  567 SER A CB  
376  O OG  . SER A 72  ? 0.9741 0.9689 1.1891 -0.0792 -0.0152 0.0639  567 SER A OG  
377  N N   . TYR A 73  ? 0.7440 0.7216 0.9437 -0.0617 0.0016  0.0978  568 TYR A N   
378  C CA  . TYR A 73  ? 0.7188 0.6965 0.9010 -0.0518 0.0022  0.1061  568 TYR A CA  
379  C C   . TYR A 73  ? 0.7514 0.7166 0.9273 -0.0432 0.0122  0.1147  568 TYR A C   
380  O O   . TYR A 73  ? 0.7551 0.7098 0.9126 -0.0369 0.0126  0.1135  568 TYR A O   
381  C CB  . TYR A 73  ? 0.7230 0.7219 0.9151 -0.0505 -0.0015 0.1111  568 TYR A CB  
382  C CG  . TYR A 73  ? 0.7545 0.7733 0.9463 -0.0544 -0.0122 0.1043  568 TYR A CG  
383  C CD1 . TYR A 73  ? 0.7899 0.8056 0.9690 -0.0573 -0.0174 0.0942  568 TYR A CD1 
384  C CD2 . TYR A 73  ? 0.7622 0.8068 0.9646 -0.0528 -0.0168 0.1093  568 TYR A CD2 
385  C CE1 . TYR A 73  ? 0.8172 0.8568 0.9926 -0.0578 -0.0268 0.0883  568 TYR A CE1 
386  C CE2 . TYR A 73  ? 0.7780 0.8479 0.9774 -0.0533 -0.0269 0.1046  568 TYR A CE2 
387  C CZ  . TYR A 73  ? 0.9091 0.9773 1.0938 -0.0553 -0.0317 0.0939  568 TYR A CZ  
388  O OH  . TYR A 73  ? 0.9589 1.0570 1.1373 -0.0532 -0.0411 0.0895  568 TYR A OH  
389  N N   . ARG A 74  ? 0.6890 0.6580 0.8816 -0.0424 0.0204  0.1230  569 ARG A N   
390  C CA  . ARG A 74  ? 0.6858 0.6505 0.8719 -0.0313 0.0312  0.1331  569 ARG A CA  
391  C C   . ARG A 74  ? 0.7703 0.7215 0.9434 -0.0281 0.0346  0.1323  569 ARG A C   
392  O O   . ARG A 74  ? 0.7802 0.7297 0.9349 -0.0166 0.0382  0.1346  569 ARG A O   
393  C CB  . ARG A 74  ? 0.6382 0.6131 0.8492 -0.0311 0.0411  0.1456  569 ARG A CB  
394  C CG  . ARG A 74  ? 0.5702 0.5622 0.8017 -0.0363 0.0377  0.1470  569 ARG A CG  
395  C CD  . ARG A 74  ? 0.6361 0.6394 0.8817 -0.0284 0.0498  0.1624  569 ARG A CD  
396  N NE  . ARG A 74  ? 0.7229 0.7452 0.9967 -0.0352 0.0476  0.1653  569 ARG A NE  
397  C CZ  . ARG A 74  ? 0.9044 0.9342 1.2131 -0.0472 0.0486  0.1664  569 ARG A CZ  
398  N NH1 . ARG A 74  ? 0.9069 0.9233 1.2280 -0.0532 0.0538  0.1663  569 ARG A NH1 
399  N NH2 . ARG A 74  ? 0.6558 0.7071 0.9909 -0.0535 0.0445  0.1671  569 ARG A NH2 
400  N N   . ASN A 75  ? 0.7325 0.6760 0.9164 -0.0373 0.0335  0.1279  570 ASN A N   
401  C CA  . ASN A 75  ? 0.7403 0.6715 0.9152 -0.0338 0.0374  0.1287  570 ASN A CA  
402  C C   . ASN A 75  ? 0.7973 0.7237 0.9456 -0.0302 0.0295  0.1196  570 ASN A C   
403  O O   . ASN A 75  ? 0.8074 0.7334 0.9396 -0.0198 0.0324  0.1228  570 ASN A O   
404  C CB  . ASN A 75  ? 0.7438 0.6661 0.9407 -0.0445 0.0386  0.1239  570 ASN A CB  
405  C CG  . ASN A 75  ? 0.9946 0.9057 1.1923 -0.0384 0.0483  0.1324  570 ASN A CG  
406  O OD1 . ASN A 75  ? 0.8558 0.7574 1.0422 -0.0386 0.0450  0.1250  570 ASN A OD1 
407  N ND2 . ASN A 75  ? 0.9275 0.8421 1.1381 -0.0306 0.0618  0.1508  570 ASN A ND2 
408  N N   . GLU A 76  ? 0.7145 0.6415 0.8599 -0.0377 0.0195  0.1088  571 GLU A N   
409  C CA  . GLU A 76  ? 0.6895 0.6132 0.8170 -0.0358 0.0128  0.1022  571 GLU A CA  
410  C C   . GLU A 76  ? 0.7234 0.6486 0.8397 -0.0265 0.0133  0.1039  571 GLU A C   
411  O O   . GLU A 76  ? 0.7319 0.6528 0.8365 -0.0220 0.0119  0.1002  571 GLU A O   
412  C CB  . GLU A 76  ? 0.7013 0.6325 0.8312 -0.0427 0.0047  0.0960  571 GLU A CB  
413  C CG  . GLU A 76  ? 0.8195 0.7499 0.9369 -0.0404 -0.0001 0.0937  571 GLU A CG  
414  C CD  . GLU A 76  ? 0.9298 0.8556 1.0398 -0.0427 -0.0022 0.0879  571 GLU A CD  
415  O OE1 . GLU A 76  ? 1.0100 0.9437 1.1220 -0.0473 -0.0060 0.0824  571 GLU A OE1 
416  O OE2 . GLU A 76  ? 0.7193 0.6370 0.8214 -0.0387 -0.0008 0.0878  571 GLU A OE2 
417  N N   . ILE A 77  ? 0.6532 0.5859 0.7756 -0.0231 0.0155  0.1082  572 ILE A N   
418  C CA  . ILE A 77  ? 0.6442 0.5789 0.7595 -0.0133 0.0167  0.1066  572 ILE A CA  
419  C C   . ILE A 77  ? 0.7300 0.6664 0.8329 -0.0028 0.0217  0.1067  572 ILE A C   
420  O O   . ILE A 77  ? 0.7212 0.6563 0.8133 0.0023  0.0179  0.0975  572 ILE A O   
421  C CB  . ILE A 77  ? 0.6677 0.6109 0.7939 -0.0110 0.0194  0.1118  572 ILE A CB  
422  C CG1 . ILE A 77  ? 0.6665 0.6125 0.8017 -0.0177 0.0131  0.1118  572 ILE A CG1 
423  C CG2 . ILE A 77  ? 0.6483 0.5932 0.7677 0.0013  0.0226  0.1078  572 ILE A CG2 
424  C CD1 . ILE A 77  ? 0.6880 0.6470 0.8379 -0.0181 0.0144  0.1192  572 ILE A CD1 
425  N N   . ALA A 78  ? 0.7267 0.6692 0.8338 0.0011  0.0304  0.1177  573 ALA A N   
426  C CA  . ALA A 78  ? 0.7463 0.6973 0.8415 0.0143  0.0373  0.1230  573 ALA A CA  
427  C C   . ALA A 78  ? 0.8297 0.7768 0.9125 0.0156  0.0330  0.1174  573 ALA A C   
428  O O   . ALA A 78  ? 0.8379 0.7950 0.9050 0.0268  0.0312  0.1112  573 ALA A O   
429  C CB  . ALA A 78  ? 0.7581 0.7148 0.8674 0.0162  0.0494  0.1409  573 ALA A CB  
430  N N   . TYR A 79  ? 0.7830 0.7182 0.8734 0.0045  0.0304  0.1173  574 TYR A N   
431  C CA  . TYR A 79  ? 0.7847 0.7161 0.8664 0.0049  0.0268  0.1131  574 TYR A CA  
432  C C   . TYR A 79  ? 0.8238 0.7559 0.8961 0.0051  0.0169  0.0986  574 TYR A C   
433  O O   . TYR A 79  ? 0.8379 0.7781 0.8992 0.0131  0.0145  0.0939  574 TYR A O   
434  C CB  . TYR A 79  ? 0.8109 0.7296 0.9039 -0.0061 0.0269  0.1141  574 TYR A CB  
435  C CG  . TYR A 79  ? 0.8640 0.7807 0.9665 -0.0021 0.0377  0.1272  574 TYR A CG  
436  C CD1 . TYR A 79  ? 0.8981 0.8206 0.9904 0.0093  0.0415  0.1339  574 TYR A CD1 
437  C CD2 . TYR A 79  ? 0.8807 0.7917 1.0060 -0.0089 0.0447  0.1341  574 TYR A CD2 
438  C CE1 . TYR A 79  ? 0.9281 0.8494 1.0325 0.0152  0.0539  0.1503  574 TYR A CE1 
439  C CE2 . TYR A 79  ? 0.9074 0.8148 1.0490 -0.0049 0.0571  0.1485  574 TYR A CE2 
440  C CZ  . TYR A 79  ? 1.0352 0.9469 1.1660 0.0079  0.0625  0.1583  574 TYR A CZ  
441  O OH  . TYR A 79  ? 1.0637 0.9718 1.2134 0.0137  0.0767  0.1762  574 TYR A OH  
442  N N   . LEU A 80  ? 0.7458 0.6720 0.8254 -0.0027 0.0117  0.0922  575 LEU A N   
443  C CA  . LEU A 80  ? 0.7218 0.6464 0.8019 -0.0037 0.0043  0.0805  575 LEU A CA  
444  C C   . LEU A 80  ? 0.8178 0.7516 0.8918 0.0071  0.0034  0.0711  575 LEU A C   
445  O O   . LEU A 80  ? 0.8239 0.7600 0.8976 0.0088  -0.0027 0.0585  575 LEU A O   
446  C CB  . LEU A 80  ? 0.6984 0.6168 0.7909 -0.0120 0.0019  0.0814  575 LEU A CB  
447  C CG  . LEU A 80  ? 0.7266 0.6418 0.8288 -0.0119 -0.0021 0.0733  575 LEU A CG  
448  C CD1 . LEU A 80  ? 0.7134 0.6258 0.8188 -0.0158 -0.0066 0.0683  575 LEU A CD1 
449  C CD2 . LEU A 80  ? 0.7201 0.6337 0.8351 -0.0154 -0.0009 0.0801  575 LEU A CD2 
450  N N   . ASN A 81  ? 0.8016 0.7428 0.8722 0.0148  0.0096  0.0761  576 ASN A N   
451  C CA  . ASN A 81  ? 0.8160 0.7705 0.8774 0.0282  0.0101  0.0666  576 ASN A CA  
452  C C   . ASN A 81  ? 0.8759 0.8472 0.9204 0.0395  0.0102  0.0661  576 ASN A C   
453  O O   . ASN A 81  ? 0.8675 0.8503 0.9049 0.0469  0.0036  0.0490  576 ASN A O   
454  C CB  . ASN A 81  ? 0.8192 0.7792 0.8827 0.0340  0.0186  0.0760  576 ASN A CB  
455  C CG  . ASN A 81  ? 1.2154 1.1939 1.2659 0.0513  0.0223  0.0696  576 ASN A CG  
456  O OD1 . ASN A 81  ? 1.1578 1.1448 1.1998 0.0589  0.0160  0.0506  576 ASN A OD1 
457  N ND2 . ASN A 81  ? 1.1837 1.1712 1.2347 0.0580  0.0326  0.0841  576 ASN A ND2 
458  N N   . LYS A 82  ? 0.8422 0.8160 0.8834 0.0409  0.0174  0.0841  577 LYS A N   
459  C CA  . LYS A 82  ? 0.8543 0.8459 0.8814 0.0535  0.0199  0.0902  577 LYS A CA  
460  C C   . LYS A 82  ? 0.9260 0.9194 0.9499 0.0510  0.0097  0.0777  577 LYS A C   
461  O O   . LYS A 82  ? 0.9359 0.9520 0.9463 0.0638  0.0060  0.0710  577 LYS A O   
462  C CB  . LYS A 82  ? 0.8770 0.8643 0.9112 0.0530  0.0317  0.1142  577 LYS A CB  
463  C CG  . LYS A 82  ? 1.0520 1.0588 1.0750 0.0686  0.0375  0.1271  577 LYS A CG  
464  N N   . LEU A 83  ? 0.8735 0.8469 0.9101 0.0356  0.0055  0.0755  578 LEU A N   
465  C CA  . LEU A 83  ? 0.8622 0.8358 0.9004 0.0315  -0.0024 0.0673  578 LEU A CA  
466  C C   . LEU A 83  ? 0.9422 0.9191 0.9871 0.0288  -0.0133 0.0453  578 LEU A C   
467  O O   . LEU A 83  ? 0.9404 0.9210 0.9904 0.0257  -0.0201 0.0377  578 LEU A O   
468  C CB  . LEU A 83  ? 0.8393 0.7935 0.8879 0.0187  -0.0001 0.0761  578 LEU A CB  
469  C CG  . LEU A 83  ? 0.8871 0.8403 0.9337 0.0220  0.0076  0.0915  578 LEU A CG  
470  C CD1 . LEU A 83  ? 0.8873 0.8419 0.9342 0.0282  0.0187  0.1067  578 LEU A CD1 
471  C CD2 . LEU A 83  ? 0.9327 0.8678 0.9896 0.0097  0.0083  0.0934  578 LEU A CD2 
472  N N   . GLN A 84  ? 0.9259 0.9021 0.9742 0.0306  -0.0143 0.0346  579 GLN A N   
473  C CA  . GLN A 84  ? 0.9416 0.9188 1.0027 0.0285  -0.0232 0.0114  579 GLN A CA  
474  C C   . GLN A 84  ? 1.0326 1.0355 1.0847 0.0385  -0.0315 -0.0042 579 GLN A C   
475  O O   . GLN A 84  ? 1.0342 1.0381 1.1018 0.0318  -0.0402 -0.0179 579 GLN A O   
476  C CB  . GLN A 84  ? 0.9699 0.9471 1.0323 0.0345  -0.0209 0.0021  579 GLN A CB  
477  C CG  . GLN A 84  ? 1.0488 1.0054 1.1239 0.0263  -0.0143 0.0137  579 GLN A CG  
478  C CD  . GLN A 84  ? 1.1984 1.1379 1.2995 0.0145  -0.0182 0.0073  579 GLN A CD  
479  O OE1 . GLN A 84  ? 1.1126 1.0487 1.2302 0.0155  -0.0211 -0.0100 579 GLN A OE1 
480  N NE2 . GLN A 84  ? 1.0906 1.0201 1.1978 0.0040  -0.0173 0.0213  579 GLN A NE2 
481  N N   . GLN A 85  ? 1.0099 1.0375 1.0385 0.0555  -0.0284 -0.0009 580 GLN A N   
482  C CA  . GLN A 85  ? 1.0297 1.0913 1.0449 0.0695  -0.0366 -0.0153 580 GLN A CA  
483  C C   . GLN A 85  ? 1.0760 1.1469 1.0923 0.0675  -0.0412 -0.0095 580 GLN A C   
484  O O   . GLN A 85  ? 1.0977 1.1932 1.1149 0.0724  -0.0527 -0.0291 580 GLN A O   
485  C CB  . GLN A 85  ? 1.0663 1.1577 1.0550 0.0915  -0.0307 -0.0103 580 GLN A CB  
486  C CG  . GLN A 85  ? 1.2893 1.3746 1.2684 0.0961  -0.0147 0.0236  580 GLN A CG  
487  N N   . HIS A 86  ? 0.9948 1.0467 1.0139 0.0599  -0.0330 0.0145  581 HIS A N   
488  C CA  . HIS A 86  ? 0.9734 1.0326 0.9939 0.0593  -0.0353 0.0222  581 HIS A CA  
489  C C   . HIS A 86  ? 0.9839 1.0322 1.0274 0.0442  -0.0441 0.0095  581 HIS A C   
490  O O   . HIS A 86  ? 0.9921 1.0622 1.0392 0.0475  -0.0529 -0.0004 581 HIS A O   
491  C CB  . HIS A 86  ? 0.9726 1.0190 0.9878 0.0605  -0.0219 0.0513  581 HIS A CB  
492  C CG  . HIS A 86  ? 1.0237 1.0869 1.0216 0.0777  -0.0118 0.0678  581 HIS A CG  
493  N ND1 . HIS A 86  ? 1.0513 1.1163 1.0428 0.0826  -0.0079 0.0656  581 HIS A ND1 
494  C CD2 . HIS A 86  ? 1.0546 1.1350 1.0430 0.0922  -0.0036 0.0886  581 HIS A CD2 
495  C CE1 . HIS A 86  ? 1.0570 1.1414 1.0352 0.0997  0.0027  0.0856  581 HIS A CE1 
496  N NE2 . HIS A 86  ? 1.0647 1.1586 1.0416 0.1061  0.0061  0.1010  581 HIS A NE2 
497  N N   . SER A 87  ? 0.8977 0.9165 0.9581 0.0289  -0.0413 0.0116  582 SER A N   
498  C CA  . SER A 87  ? 0.8748 0.8865 0.9592 0.0164  -0.0472 0.0041  582 SER A CA  
499  C C   . SER A 87  ? 0.9201 0.9159 1.0286 0.0057  -0.0499 -0.0090 582 SER A C   
500  O O   . SER A 87  ? 0.9115 0.8914 1.0182 0.0040  -0.0441 -0.0042 582 SER A O   
501  C CB  . SER A 87  ? 0.8849 0.8817 0.9708 0.0098  -0.0401 0.0239  582 SER A CB  
502  O OG  . SER A 87  ? 0.9595 0.9553 1.0683 0.0003  -0.0449 0.0186  582 SER A OG  
503  N N   . ASP A 88  ? 0.8737 0.8747 1.0089 -0.0014 -0.0582 -0.0243 583 ASP A N   
504  C CA  . ASP A 88  ? 0.8704 0.8558 1.0391 -0.0121 -0.0595 -0.0353 583 ASP A CA  
505  C C   . ASP A 88  ? 0.8996 0.8636 1.0818 -0.0227 -0.0507 -0.0134 583 ASP A C   
506  O O   . ASP A 88  ? 0.8936 0.8418 1.1012 -0.0298 -0.0473 -0.0126 583 ASP A O   
507  C CB  . ASP A 88  ? 0.9129 0.9146 1.1113 -0.0157 -0.0714 -0.0609 583 ASP A CB  
508  C CG  . ASP A 88  ? 1.1260 1.1417 1.3350 -0.0195 -0.0753 -0.0561 583 ASP A CG  
509  O OD1 . ASP A 88  ? 1.1455 1.1752 1.3263 -0.0110 -0.0743 -0.0439 583 ASP A OD1 
510  O OD2 . ASP A 88  ? 1.2167 1.2309 1.4656 -0.0302 -0.0789 -0.0646 583 ASP A OD2 
511  N N   . LYS A 89  ? 0.8331 0.7985 0.9983 -0.0217 -0.0462 0.0050  584 LYS A N   
512  C CA  . LYS A 89  ? 0.8052 0.7570 0.9756 -0.0284 -0.0381 0.0249  584 LYS A CA  
513  C C   . LYS A 89  ? 0.8325 0.7709 0.9835 -0.0271 -0.0305 0.0380  584 LYS A C   
514  O O   . LYS A 89  ? 0.8414 0.7738 0.9887 -0.0300 -0.0246 0.0525  584 LYS A O   
515  C CB  . LYS A 89  ? 0.8216 0.7830 0.9863 -0.0273 -0.0373 0.0336  584 LYS A CB  
516  C CG  . LYS A 89  ? 0.8880 0.8680 1.0727 -0.0282 -0.0458 0.0210  584 LYS A CG  
517  C CD  . LYS A 89  ? 0.8714 0.8484 1.0987 -0.0386 -0.0477 0.0147  584 LYS A CD  
518  C CE  . LYS A 89  ? 0.8655 0.8632 1.1173 -0.0409 -0.0564 0.0020  584 LYS A CE  
519  N NZ  . LYS A 89  ? 1.0648 1.0812 1.3118 -0.0351 -0.0687 -0.0233 584 LYS A NZ  
520  N N   . ILE A 90  ? 0.7659 0.7029 0.9061 -0.0222 -0.0309 0.0315  585 ILE A N   
521  C CA  . ILE A 90  ? 0.7479 0.6752 0.8748 -0.0211 -0.0247 0.0416  585 ILE A CA  
522  C C   . ILE A 90  ? 0.8089 0.7285 0.9528 -0.0226 -0.0245 0.0354  585 ILE A C   
523  O O   . ILE A 90  ? 0.8142 0.7385 0.9642 -0.0187 -0.0291 0.0186  585 ILE A O   
524  C CB  . ILE A 90  ? 0.7757 0.7100 0.8770 -0.0124 -0.0228 0.0441  585 ILE A CB  
525  C CG1 . ILE A 90  ? 0.7666 0.6995 0.8583 -0.0133 -0.0187 0.0564  585 ILE A CG1 
526  C CG2 . ILE A 90  ? 0.7862 0.7156 0.8802 -0.0096 -0.0181 0.0480  585 ILE A CG2 
527  C CD1 . ILE A 90  ? 0.8241 0.7636 0.8997 -0.0049 -0.0153 0.0618  585 ILE A CD1 
528  N N   . ILE A 91  ? 0.7644 0.6746 0.9183 -0.0271 -0.0193 0.0480  586 ILE A N   
529  C CA  . ILE A 91  ? 0.7745 0.6765 0.9489 -0.0276 -0.0169 0.0466  586 ILE A CA  
530  C C   . ILE A 91  ? 0.8281 0.7310 0.9954 -0.0205 -0.0183 0.0329  586 ILE A C   
531  O O   . ILE A 91  ? 0.8310 0.7387 0.9748 -0.0155 -0.0165 0.0369  586 ILE A O   
532  C CB  . ILE A 91  ? 0.8160 0.7144 0.9950 -0.0299 -0.0105 0.0666  586 ILE A CB  
533  C CG1 . ILE A 91  ? 0.8401 0.7305 1.0440 -0.0285 -0.0065 0.0682  586 ILE A CG1 
534  C CG2 . ILE A 91  ? 0.8144 0.7175 0.9669 -0.0281 -0.0090 0.0747  586 ILE A CG2 
535  C CD1 . ILE A 91  ? 0.9787 0.8708 1.1931 -0.0289 -0.0001 0.0897  586 ILE A CD1 
536  N N   . ARG A 92  ? 0.7806 0.6798 0.9706 -0.0196 -0.0208 0.0159  587 ARG A N   
537  C CA  . ARG A 92  ? 0.7787 0.6805 0.9637 -0.0110 -0.0218 -0.0006 587 ARG A CA  
538  C C   . ARG A 92  ? 0.7986 0.6935 0.9808 -0.0083 -0.0141 0.0136  587 ARG A C   
539  O O   . ARG A 92  ? 0.7695 0.6545 0.9719 -0.0129 -0.0092 0.0273  587 ARG A O   
540  C CB  . ARG A 92  ? 0.7868 0.6835 1.0046 -0.0117 -0.0258 -0.0249 587 ARG A CB  
541  C CG  . ARG A 92  ? 0.9178 0.8231 1.1499 -0.0159 -0.0350 -0.0435 587 ARG A CG  
542  C CD  . ARG A 92  ? 1.0628 0.9917 1.2625 -0.0075 -0.0428 -0.0560 587 ARG A CD  
543  N NE  . ARG A 92  ? 1.0881 1.0235 1.2678 -0.0098 -0.0420 -0.0364 587 ARG A NE  
544  C CZ  . ARG A 92  ? 1.2288 1.1811 1.3756 -0.0011 -0.0432 -0.0328 587 ARG A CZ  
545  N NH1 . ARG A 92  ? 1.1406 1.1089 1.2679 0.0116  -0.0452 -0.0453 587 ARG A NH1 
546  N NH2 . ARG A 92  ? 0.9361 0.8906 1.0706 -0.0034 -0.0413 -0.0155 587 ARG A NH2 
547  N N   . LEU A 93  ? 0.7585 0.6623 0.9166 0.0002  -0.0124 0.0129  588 LEU A N   
548  C CA  . LEU A 93  ? 0.7453 0.6475 0.8999 0.0043  -0.0055 0.0245  588 LEU A CA  
549  C C   . LEU A 93  ? 0.8565 0.7630 1.0106 0.0154  -0.0052 0.0051  588 LEU A C   
550  O O   . LEU A 93  ? 0.8613 0.7832 0.9925 0.0244  -0.0068 -0.0032 588 LEU A O   
551  C CB  . LEU A 93  ? 0.7215 0.6323 0.8523 0.0046  -0.0027 0.0407  588 LEU A CB  
552  C CG  . LEU A 93  ? 0.7838 0.6987 0.9109 0.0095  0.0039  0.0512  588 LEU A CG  
553  C CD1 . LEU A 93  ? 0.7847 0.6931 0.9304 0.0046  0.0067  0.0637  588 LEU A CD1 
554  C CD2 . LEU A 93  ? 0.8152 0.7392 0.9244 0.0097  0.0068  0.0632  588 LEU A CD2 
555  N N   . TYR A 94  ? 0.8301 0.7245 1.0115 0.0162  -0.0026 -0.0025 589 TYR A N   
556  C CA  . TYR A 94  ? 0.8429 0.7387 1.0299 0.0270  -0.0018 -0.0249 589 TYR A CA  
557  C C   . TYR A 94  ? 0.9314 0.8355 1.1027 0.0381  0.0056  -0.0171 589 TYR A C   
558  O O   . TYR A 94  ? 0.9683 0.8856 1.1247 0.0506  0.0053  -0.0348 589 TYR A O   
559  C CB  . TYR A 94  ? 0.8538 0.7305 1.0828 0.0235  -0.0005 -0.0366 589 TYR A CB  
560  C CG  . TYR A 94  ? 0.8580 0.7295 1.1080 0.0133  -0.0077 -0.0478 589 TYR A CG  
561  C CD1 . TYR A 94  ? 0.8840 0.7669 1.1304 0.0158  -0.0175 -0.0780 589 TYR A CD1 
562  C CD2 . TYR A 94  ? 0.8576 0.7179 1.1294 0.0021  -0.0049 -0.0268 589 TYR A CD2 
563  C CE1 . TYR A 94  ? 0.8740 0.7557 1.1418 0.0057  -0.0247 -0.0877 589 TYR A CE1 
564  C CE2 . TYR A 94  ? 0.8715 0.7292 1.1645 -0.0071 -0.0102 -0.0344 589 TYR A CE2 
565  C CZ  . TYR A 94  ? 0.9666 0.8344 1.2589 -0.0062 -0.0204 -0.0649 589 TYR A CZ  
566  O OH  . TYR A 94  ? 1.0033 0.8717 1.3187 -0.0158 -0.0262 -0.0720 589 TYR A OH  
567  N N   . ASP A 95  ? 0.8617 0.7617 1.0372 0.0348  0.0123  0.0082  590 ASP A N   
568  C CA  . ASP A 95  ? 0.8577 0.7667 1.0246 0.0444  0.0201  0.0178  590 ASP A CA  
569  C C   . ASP A 95  ? 0.8721 0.7823 1.0426 0.0371  0.0236  0.0457  590 ASP A C   
570  O O   . ASP A 95  ? 0.8636 0.7662 1.0461 0.0271  0.0211  0.0558  590 ASP A O   
571  C CB  . ASP A 95  ? 0.9037 0.8044 1.0920 0.0539  0.0250  0.0035  590 ASP A CB  
572  C CG  . ASP A 95  ? 1.0740 0.9877 1.2512 0.0686  0.0329  0.0039  590 ASP A CG  
573  O OD1 . ASP A 95  ? 1.0912 1.0226 1.2440 0.0720  0.0353  0.0164  590 ASP A OD1 
574  O OD2 . ASP A 95  ? 1.1405 1.0466 1.3363 0.0772  0.0380  -0.0077 590 ASP A OD2 
575  N N   . TYR A 96  ? 0.8155 0.7384 0.9772 0.0429  0.0295  0.0576  591 TYR A N   
576  C CA  . TYR A 96  ? 0.8002 0.7295 0.9679 0.0366  0.0316  0.0805  591 TYR A CA  
577  C C   . TYR A 96  ? 0.8704 0.8120 1.0424 0.0453  0.0396  0.0901  591 TYR A C   
578  O O   . TYR A 96  ? 0.8827 0.8327 1.0432 0.0562  0.0445  0.0836  591 TYR A O   
579  C CB  . TYR A 96  ? 0.8029 0.7381 0.9568 0.0263  0.0273  0.0894  591 TYR A CB  
580  C CG  . TYR A 96  ? 0.8310 0.7763 0.9656 0.0307  0.0297  0.0884  591 TYR A CG  
581  C CD1 . TYR A 96  ? 0.8544 0.8134 0.9892 0.0352  0.0370  0.1005  591 TYR A CD1 
582  C CD2 . TYR A 96  ? 0.8471 0.7904 0.9666 0.0298  0.0257  0.0796  591 TYR A CD2 
583  C CE1 . TYR A 96  ? 0.8810 0.8504 1.0026 0.0403  0.0418  0.1048  591 TYR A CE1 
584  C CE2 . TYR A 96  ? 0.8690 0.8238 0.9727 0.0356  0.0296  0.0837  591 TYR A CE2 
585  C CZ  . TYR A 96  ? 1.0033 0.9707 1.1087 0.0411  0.0385  0.0973  591 TYR A CZ  
586  O OH  . TYR A 96  ? 1.0610 1.0408 1.1552 0.0481  0.0450  0.1059  591 TYR A OH  
587  N N   . GLU A 97  ? 0.8361 0.7827 1.0244 0.0419  0.0409  0.1067  592 GLU A N   
588  C CA  . GLU A 97  ? 0.8428 0.8048 1.0399 0.0485  0.0477  0.1192  592 GLU A CA  
589  C C   . GLU A 97  ? 0.8858 0.8632 1.0845 0.0374  0.0439  0.1349  592 GLU A C   
590  O O   . GLU A 97  ? 0.8854 0.8632 1.0889 0.0283  0.0373  0.1403  592 GLU A O   
591  C CB  . GLU A 97  ? 0.8646 0.8223 1.0850 0.0559  0.0524  0.1240  592 GLU A CB  
592  C CG  . GLU A 97  ? 0.8961 0.8694 1.1272 0.0661  0.0607  0.1348  592 GLU A CG  
593  C CD  . GLU A 97  ? 1.2707 1.2371 1.5269 0.0751  0.0664  0.1394  592 GLU A CD  
594  O OE1 . GLU A 97  ? 1.3318 1.2808 1.5937 0.0844  0.0711  0.1228  592 GLU A OE1 
595  O OE2 . GLU A 97  ? 1.2807 1.2599 1.5526 0.0733  0.0661  0.1590  592 GLU A OE2 
596  N N   . ILE A 98  ? 0.8296 0.8211 1.0255 0.0384  0.0481  0.1409  593 ILE A N   
597  C CA  . ILE A 98  ? 0.8180 0.8240 1.0217 0.0268  0.0444  0.1517  593 ILE A CA  
598  C C   . ILE A 98  ? 0.8804 0.9074 1.1012 0.0307  0.0509  0.1644  593 ILE A C   
599  O O   . ILE A 98  ? 0.8933 0.9250 1.1118 0.0406  0.0606  0.1665  593 ILE A O   
600  C CB  . ILE A 98  ? 0.8495 0.8497 1.0409 0.0172  0.0408  0.1471  593 ILE A CB  
601  C CG1 . ILE A 98  ? 0.8522 0.8665 1.0585 0.0046  0.0370  0.1544  593 ILE A CG1 
602  C CG2 . ILE A 98  ? 0.8587 0.8563 1.0362 0.0261  0.0486  0.1441  593 ILE A CG2 
603  C CD1 . ILE A 98  ? 0.9931 0.9987 1.1922 -0.0056 0.0328  0.1486  593 ILE A CD1 
604  N N   . THR A 99  ? 0.8188 0.8620 1.0573 0.0247  0.0458  0.1734  594 THR A N   
605  C CA  . THR A 99  ? 0.8106 0.8785 1.0710 0.0262  0.0496  0.1859  594 THR A CA  
606  C C   . THR A 99  ? 0.8642 0.9489 1.1381 0.0102  0.0401  0.1872  594 THR A C   
607  O O   . THR A 99  ? 0.8573 0.9323 1.1202 0.0005  0.0319  0.1781  594 THR A O   
608  C CB  . THR A 99  ? 0.8156 0.8929 1.0888 0.0365  0.0515  0.1942  594 THR A CB  
609  O OG1 . THR A 99  ? 0.8220 0.9029 1.0965 0.0308  0.0416  0.1956  594 THR A OG1 
610  C CG2 . THR A 99  ? 0.7556 0.8139 1.0206 0.0521  0.0607  0.1886  594 THR A CG2 
611  N N   . ASP A 100 ? 0.8174 0.9286 1.1169 0.0077  0.0411  0.1967  595 ASP A N   
612  C CA  . ASP A 100 ? 0.8106 0.9434 1.1307 -0.0074 0.0313  0.1947  595 ASP A CA  
613  C C   . ASP A 100 ? 0.8524 0.9993 1.1689 -0.0102 0.0178  0.1912  595 ASP A C   
614  O O   . ASP A 100 ? 0.8626 1.0217 1.1842 -0.0226 0.0066  0.1815  595 ASP A O   
615  C CB  . ASP A 100 ? 0.8419 1.0028 1.1943 -0.0071 0.0362  0.2063  595 ASP A CB  
616  C CG  . ASP A 100 ? 1.0558 1.2106 1.4180 -0.0053 0.0504  0.2133  595 ASP A CG  
617  O OD1 . ASP A 100 ? 1.0776 1.2343 1.4583 -0.0183 0.0498  0.2109  595 ASP A OD1 
618  O OD2 . ASP A 100 ? 1.1742 1.3249 1.5286 0.0102  0.0629  0.2220  595 ASP A OD2 
619  N N   . GLN A 101 ? 0.7816 0.9270 1.0899 0.0025  0.0199  0.1989  596 GLN A N   
620  C CA  . GLN A 101 ? 0.7707 0.9336 1.0774 0.0053  0.0110  0.2032  596 GLN A CA  
621  C C   . GLN A 101 ? 0.8217 0.9624 1.1049 0.0058  0.0081  0.1976  596 GLN A C   
622  O O   . GLN A 101 ? 0.8234 0.9831 1.1037 0.0055  -0.0006 0.2001  596 GLN A O   
623  C CB  . GLN A 101 ? 0.7878 0.9662 1.1087 0.0203  0.0172  0.2204  596 GLN A CB  
624  C CG  . GLN A 101 ? 1.0350 1.2276 1.3775 0.0243  0.0253  0.2281  596 GLN A CG  
625  C CD  . GLN A 101 ? 1.3575 1.5213 1.6926 0.0352  0.0405  0.2283  596 GLN A CD  
626  O OE1 . GLN A 101 ? 1.2946 1.4339 1.6172 0.0455  0.0463  0.2268  596 GLN A OE1 
627  N NE2 . GLN A 101 ? 1.2696 1.4386 1.6149 0.0340  0.0478  0.2296  596 GLN A NE2 
628  N N   . TYR A 102 ? 0.7623 0.8674 1.0299 0.0080  0.0154  0.1909  597 TYR A N   
629  C CA  . TYR A 102 ? 0.7478 0.8314 0.9982 0.0085  0.0138  0.1862  597 TYR A CA  
630  C C   . TYR A 102 ? 0.8061 0.8566 1.0403 0.0070  0.0185  0.1736  597 TYR A C   
631  O O   . TYR A 102 ? 0.8198 0.8631 1.0535 0.0091  0.0250  0.1703  597 TYR A O   
632  C CB  . TYR A 102 ? 0.7576 0.8398 1.0163 0.0214  0.0191  0.1993  597 TYR A CB  
633  C CG  . TYR A 102 ? 0.7774 0.8442 1.0449 0.0326  0.0307  0.2011  597 TYR A CG  
634  C CD1 . TYR A 102 ? 0.8044 0.8394 1.0629 0.0358  0.0366  0.1890  597 TYR A CD1 
635  C CD2 . TYR A 102 ? 0.7881 0.8751 1.0739 0.0412  0.0355  0.2134  597 TYR A CD2 
636  C CE1 . TYR A 102 ? 0.8135 0.8370 1.0790 0.0474  0.0466  0.1862  597 TYR A CE1 
637  C CE2 . TYR A 102 ? 0.8048 0.8785 1.0982 0.0531  0.0470  0.2134  597 TYR A CE2 
638  C CZ  . TYR A 102 ? 0.8844 0.9262 1.1669 0.0565  0.0524  0.1985  597 TYR A CZ  
639  O OH  . TYR A 102 ? 0.9372 0.9683 1.2261 0.0696  0.0631  0.1944  597 TYR A OH  
640  N N   . ILE A 103 ? 0.7436 0.7776 0.9653 0.0051  0.0158  0.1682  598 ILE A N   
641  C CA  . ILE A 103 ? 0.7369 0.7435 0.9444 0.0047  0.0185  0.1562  598 ILE A CA  
642  C C   . ILE A 103 ? 0.8597 0.8521 1.0715 0.0108  0.0209  0.1580  598 ILE A C   
643  O O   . ILE A 103 ? 0.8684 0.8705 1.0859 0.0106  0.0181  0.1679  598 ILE A O   
644  C CB  . ILE A 103 ? 0.7518 0.7533 0.9447 -0.0061 0.0124  0.1468  598 ILE A CB  
645  C CG1 . ILE A 103 ? 0.7401 0.7522 0.9366 -0.0132 0.0117  0.1449  598 ILE A CG1 
646  C CG2 . ILE A 103 ? 0.7495 0.7268 0.9287 -0.0050 0.0142  0.1361  598 ILE A CG2 
647  C CD1 . ILE A 103 ? 0.6459 0.6550 0.8350 -0.0242 0.0060  0.1359  598 ILE A CD1 
648  N N   . TYR A 104 ? 0.8497 0.8215 1.0612 0.0169  0.0264  0.1484  599 TYR A N   
649  C CA  . TYR A 104 ? 0.8534 0.8068 1.0751 0.0206  0.0290  0.1449  599 TYR A CA  
650  C C   . TYR A 104 ? 0.8668 0.8036 1.0738 0.0172  0.0265  0.1264  599 TYR A C   
651  O O   . TYR A 104 ? 0.8659 0.8027 1.0604 0.0202  0.0278  0.1166  599 TYR A O   
652  C CB  . TYR A 104 ? 0.8972 0.8435 1.1384 0.0323  0.0375  0.1459  599 TYR A CB  
653  C CG  . TYR A 104 ? 0.9539 0.9157 1.2152 0.0384  0.0414  0.1672  599 TYR A CG  
654  C CD1 . TYR A 104 ? 0.9751 0.9524 1.2402 0.0351  0.0377  0.1839  599 TYR A CD1 
655  C CD2 . TYR A 104 ? 0.9807 0.9444 1.2574 0.0497  0.0495  0.1712  599 TYR A CD2 
656  C CE1 . TYR A 104 ? 0.9898 0.9874 1.2726 0.0432  0.0412  0.2055  599 TYR A CE1 
657  C CE2 . TYR A 104 ? 0.9957 0.9764 1.2922 0.0570  0.0535  0.1930  599 TYR A CE2 
658  C CZ  . TYR A 104 ? 1.0940 1.0929 1.3933 0.0539  0.0491  0.2108  599 TYR A CZ  
659  O OH  . TYR A 104 ? 1.1329 1.1543 1.4512 0.0635  0.0530  0.2341  599 TYR A OH  
660  N N   . MET A 105 ? 0.7938 0.7207 1.0024 0.0119  0.0232  0.1235  600 MET A N   
661  C CA  . MET A 105 ? 0.7837 0.6984 0.9811 0.0085  0.0196  0.1065  600 MET A CA  
662  C C   . MET A 105 ? 0.8344 0.7331 1.0538 0.0094  0.0212  0.1001  600 MET A C   
663  O O   . MET A 105 ? 0.8323 0.7306 1.0691 0.0074  0.0232  0.1142  600 MET A O   
664  C CB  . MET A 105 ? 0.8060 0.7264 0.9868 -0.0006 0.0137  0.1091  600 MET A CB  
665  C CG  . MET A 105 ? 0.8571 0.7889 1.0217 -0.0027 0.0127  0.1108  600 MET A CG  
666  S SD  . MET A 105 ? 0.9093 0.8492 1.0628 -0.0131 0.0068  0.1149  600 MET A SD  
667  C CE  . MET A 105 ? 0.8709 0.7996 1.0082 -0.0141 0.0058  0.1021  600 MET A CE  
668  N N   . VAL A 106 ? 0.7900 0.6782 1.0115 0.0135  0.0210  0.0790  601 VAL A N   
669  C CA  . VAL A 106 ? 0.7844 0.6563 1.0330 0.0131  0.0216  0.0663  601 VAL A CA  
670  C C   . VAL A 106 ? 0.8271 0.6981 1.0659 0.0059  0.0140  0.0539  601 VAL A C   
671  O O   . VAL A 106 ? 0.8277 0.7034 1.0479 0.0086  0.0092  0.0353  601 VAL A O   
672  C CB  . VAL A 106 ? 0.8353 0.6994 1.0959 0.0229  0.0250  0.0461  601 VAL A CB  
673  C CG1 . VAL A 106 ? 0.8466 0.6926 1.1424 0.0209  0.0252  0.0289  601 VAL A CG1 
674  C CG2 . VAL A 106 ? 0.8323 0.6990 1.1024 0.0312  0.0335  0.0609  601 VAL A CG2 
675  N N   . MET A 107 ? 0.7821 0.6512 1.0317 -0.0017 0.0135  0.0664  602 MET A N   
676  C CA  . MET A 107 ? 0.7843 0.6543 1.0271 -0.0085 0.0071  0.0577  602 MET A CA  
677  C C   . MET A 107 ? 0.8188 0.6767 1.0994 -0.0130 0.0080  0.0515  602 MET A C   
678  O O   . MET A 107 ? 0.8176 0.6646 1.1313 -0.0109 0.0150  0.0570  602 MET A O   
679  C CB  . MET A 107 ? 0.8035 0.6843 1.0265 -0.0137 0.0057  0.0759  602 MET A CB  
680  C CG  . MET A 107 ? 0.8502 0.7419 1.0438 -0.0116 0.0048  0.0807  602 MET A CG  
681  S SD  . MET A 107 ? 0.9017 0.8059 1.0819 -0.0171 0.0039  0.0995  602 MET A SD  
682  C CE  . MET A 107 ? 0.8605 0.7693 1.0653 -0.0139 0.0099  0.1199  602 MET A CE  
683  N N   . GLU A 108 ? 0.7610 0.6212 1.0408 -0.0190 0.0019  0.0416  603 GLU A N   
684  C CA  . GLU A 108 ? 0.7621 0.6129 1.0825 -0.0250 0.0027  0.0367  603 GLU A CA  
685  C C   . GLU A 108 ? 0.8336 0.6848 1.1709 -0.0281 0.0109  0.0675  603 GLU A C   
686  O O   . GLU A 108 ? 0.7969 0.6604 1.1060 -0.0275 0.0114  0.0858  603 GLU A O   
687  C CB  . GLU A 108 ? 0.7781 0.6358 1.0945 -0.0296 -0.0072 0.0152  603 GLU A CB  
688  C CG  . GLU A 108 ? 0.8513 0.7209 1.1441 -0.0337 -0.0100 0.0280  603 GLU A CG  
689  C CD  . GLU A 108 ? 1.0919 0.9706 1.3849 -0.0369 -0.0194 0.0082  603 GLU A CD  
690  O OE1 . GLU A 108 ? 1.0643 0.9389 1.3954 -0.0418 -0.0221 -0.0077 603 GLU A OE1 
691  O OE2 . GLU A 108 ? 1.1325 1.0237 1.3903 -0.0343 -0.0240 0.0081  603 GLU A OE2 
692  N N   . CYS A 109 ? 0.8465 0.6858 1.2326 -0.0303 0.0182  0.0732  604 CYS A N   
693  C CA  . CYS A 109 ? 0.8495 0.6926 1.2563 -0.0306 0.0282  0.1057  604 CYS A CA  
694  C C   . CYS A 109 ? 0.8897 0.7369 1.3129 -0.0383 0.0271  0.1074  604 CYS A C   
695  O O   . CYS A 109 ? 0.8839 0.7219 1.3393 -0.0448 0.0237  0.0869  604 CYS A O   
696  C CB  . CYS A 109 ? 0.8728 0.7028 1.3262 -0.0261 0.0407  0.1201  604 CYS A CB  
697  S SG  . CYS A 109 ? 0.9258 0.7711 1.3909 -0.0196 0.0548  0.1686  604 CYS A SG  
698  N N   . GLY A 110 ? 0.8388 0.7024 1.2375 -0.0373 0.0286  0.1285  605 GLY A N   
699  C CA  . GLY A 110 ? 0.8364 0.7076 1.2475 -0.0427 0.0293  0.1349  605 GLY A CA  
700  C C   . GLY A 110 ? 0.9079 0.7813 1.3608 -0.0402 0.0440  0.1668  605 GLY A C   
701  O O   . GLY A 110 ? 0.9217 0.7938 1.3861 -0.0330 0.0529  0.1858  605 GLY A O   
702  N N   . ASN A 111 ? 0.8594 0.7385 1.3376 -0.0450 0.0477  0.1752  606 ASN A N   
703  C CA  . ASN A 111 ? 0.8600 0.7451 1.3812 -0.0416 0.0640  0.2100  606 ASN A CA  
704  C C   . ASN A 111 ? 0.9287 0.8403 1.4115 -0.0301 0.0699  0.2406  606 ASN A C   
705  O O   . ASN A 111 ? 0.9373 0.8563 1.4315 -0.0204 0.0811  0.2683  606 ASN A O   
706  C CB  . ASN A 111 ? 0.8149 0.7008 1.3762 -0.0504 0.0661  0.2089  606 ASN A CB  
707  C CG  . ASN A 111 ? 1.1938 1.0610 1.7867 -0.0621 0.0559  0.1717  606 ASN A CG  
708  O OD1 . ASN A 111 ? 1.1028 0.9733 1.6648 -0.0666 0.0410  0.1428  606 ASN A OD1 
709  N ND2 . ASN A 111 ? 1.2129 1.0619 1.8696 -0.0661 0.0640  0.1713  606 ASN A ND2 
710  N N   . ILE A 112 ? 0.8847 0.8121 1.3218 -0.0301 0.0620  0.2340  607 ILE A N   
711  C CA  . ILE A 112 ? 0.8822 0.8375 1.2819 -0.0194 0.0658  0.2561  607 ILE A CA  
712  C C   . ILE A 112 ? 0.9297 0.8920 1.2762 -0.0215 0.0531  0.2342  607 ILE A C   
713  O O   . ILE A 112 ? 0.9254 0.8758 1.2711 -0.0302 0.0449  0.2112  607 ILE A O   
714  C CB  . ILE A 112 ? 0.9281 0.9007 1.3611 -0.0144 0.0809  0.2885  607 ILE A CB  
715  C CG1 . ILE A 112 ? 0.9397 0.9482 1.3373 0.0003  0.0868  0.3141  607 ILE A CG1 
716  C CG2 . ILE A 112 ? 0.9246 0.8905 1.3810 -0.0248 0.0788  0.2762  607 ILE A CG2 
717  C CD1 . ILE A 112 ? 1.0606 1.0914 1.4903 0.0093  0.1045  0.3518  607 ILE A CD1 
718  N N   . ASP A 113 ? 0.8795 0.8631 1.1848 -0.0130 0.0517  0.2415  608 ASP A N   
719  C CA  . ASP A 113 ? 0.8680 0.8579 1.1290 -0.0143 0.0420  0.2226  608 ASP A CA  
720  C C   . ASP A 113 ? 0.9042 0.9075 1.1686 -0.0124 0.0473  0.2314  608 ASP A C   
721  O O   . ASP A 113 ? 0.8903 0.9071 1.1820 -0.0068 0.0593  0.2576  608 ASP A O   
722  C CB  . ASP A 113 ? 0.8953 0.9048 1.1183 -0.0066 0.0385  0.2240  608 ASP A CB  
723  C CG  . ASP A 113 ? 1.1148 1.1568 1.3379 0.0066  0.0481  0.2528  608 ASP A CG  
724  O OD1 . ASP A 113 ? 1.1777 1.2238 1.4288 0.0120  0.0570  0.2757  608 ASP A OD1 
725  O OD2 . ASP A 113 ? 1.1700 1.2350 1.3662 0.0129  0.0477  0.2530  608 ASP A OD2 
726  N N   . LEU A 114 ? 0.8678 0.8680 1.1076 -0.0162 0.0398  0.2118  609 LEU A N   
727  C CA  . LEU A 114 ? 0.8726 0.8852 1.1136 -0.0140 0.0443  0.2175  609 LEU A CA  
728  C C   . LEU A 114 ? 0.9327 0.9768 1.1589 -0.0007 0.0535  0.2397  609 LEU A C   
729  O O   . LEU A 114 ? 0.9270 0.9857 1.1753 0.0040  0.0643  0.2604  609 LEU A O   
730  C CB  . LEU A 114 ? 0.8651 0.8687 1.0796 -0.0184 0.0348  0.1924  609 LEU A CB  
731  C CG  . LEU A 114 ? 0.9181 0.9319 1.1339 -0.0165 0.0384  0.1945  609 LEU A CG  
732  C CD1 . LEU A 114 ? 0.9183 0.9258 1.1774 -0.0239 0.0402  0.1977  609 LEU A CD1 
733  C CD2 . LEU A 114 ? 0.9449 0.9512 1.1292 -0.0174 0.0304  0.1723  609 LEU A CD2 
734  N N   . ASN A 115 ? 0.9015 0.9590 1.0936 0.0061  0.0495  0.2359  610 ASN A N   
735  C CA  . ASN A 115 ? 0.9173 1.0112 1.0878 0.0209  0.0552  0.2515  610 ASN A CA  
736  C C   . ASN A 115 ? 1.0053 1.1207 1.2047 0.0311  0.0697  0.2883  610 ASN A C   
737  O O   . ASN A 115 ? 1.0258 1.1670 1.2254 0.0417  0.0798  0.3067  610 ASN A O   
738  C CB  . ASN A 115 ? 0.8989 1.0033 1.0352 0.0241  0.0457  0.2368  610 ASN A CB  
739  C CG  . ASN A 115 ? 1.1189 1.2547 1.2204 0.0353  0.0446  0.2302  610 ASN A CG  
740  O OD1 . ASN A 115 ? 0.9128 1.0758 1.0134 0.0473  0.0544  0.2484  610 ASN A OD1 
741  N ND2 . ASN A 115 ? 1.0860 1.2186 1.1602 0.0316  0.0331  0.2023  610 ASN A ND2 
742  N N   . SER A 116 ? 0.9627 1.0677 1.1890 0.0292  0.0725  0.3009  611 SER A N   
743  C CA  . SER A 116 ? 0.9712 1.0931 1.2331 0.0393  0.0885  0.3395  611 SER A CA  
744  C C   . SER A 116 ? 1.0608 1.1727 1.3686 0.0344  0.0998  0.3544  611 SER A C   
745  O O   . SER A 116 ? 1.0789 1.2167 1.4069 0.0463  0.1157  0.3886  611 SER A O   
746  C CB  . SER A 116 ? 0.9945 1.1015 1.2785 0.0373  0.0887  0.3458  611 SER A CB  
747  O OG  . SER A 116 ? 1.0895 1.2094 1.3347 0.0417  0.0781  0.3332  611 SER A OG  
748  N N   . TRP A 117 ? 1.0283 1.1068 1.3528 0.0178  0.0919  0.3293  612 TRP A N   
749  C CA  . TRP A 117 ? 1.0372 1.1059 1.4080 0.0102  0.0992  0.3361  612 TRP A CA  
750  C C   . TRP A 117 ? 1.0845 1.1793 1.4399 0.0179  0.1050  0.3453  612 TRP A C   
751  O O   . TRP A 117 ? 1.0867 1.1950 1.4808 0.0218  0.1199  0.3732  612 TRP A O   
752  C CB  . TRP A 117 ? 1.0218 1.0558 1.4055 -0.0074 0.0857  0.3018  612 TRP A CB  
753  C CG  . TRP A 117 ? 1.0443 1.0721 1.4700 -0.0167 0.0884  0.2999  612 TRP A CG  
754  C CD1 . TRP A 117 ? 1.0782 1.1046 1.4896 -0.0227 0.0795  0.2787  612 TRP A CD1 
755  C CD2 . TRP A 117 ? 1.0571 1.0808 1.5507 -0.0212 0.1009  0.3202  612 TRP A CD2 
756  N NE1 . TRP A 117 ? 1.0769 1.1012 1.5414 -0.0309 0.0841  0.2831  612 TRP A NE1 
757  C CE2 . TRP A 117 ? 1.1039 1.1253 1.6216 -0.0312 0.0972  0.3073  612 TRP A CE2 
758  C CE3 . TRP A 117 ? 1.0922 1.1145 1.6330 -0.0174 0.1159  0.3492  612 TRP A CE3 
759  C CZ2 . TRP A 117 ? 1.1062 1.1241 1.6954 -0.0393 0.1067  0.3196  612 TRP A CZ2 
760  C CZ3 . TRP A 117 ? 1.1225 1.1384 1.7358 -0.0248 0.1273  0.3638  612 TRP A CZ3 
761  C CH2 . TRP A 117 ? 1.1259 1.1397 1.7639 -0.0365 0.1222  0.3477  612 TRP A CH2 
762  N N   . LEU A 118 ? 1.0369 1.1391 1.3393 0.0207  0.0947  0.3228  613 LEU A N   
763  C CA  . LEU A 118 ? 1.0394 1.1663 1.3224 0.0297  0.0999  0.3276  613 LEU A CA  
764  C C   . LEU A 118 ? 1.1110 1.2800 1.3820 0.0502  0.1137  0.3598  613 LEU A C   
765  O O   . LEU A 118 ? 1.1146 1.3070 1.4021 0.0592  0.1277  0.3842  613 LEU A O   
766  C CB  . LEU A 118 ? 1.0309 1.1505 1.2658 0.0273  0.0860  0.2931  613 LEU A CB  
767  N N   . LYS A 119 ? 1.0789 1.2608 1.3245 0.0585  0.1104  0.3621  614 LYS A N   
768  C CA  . LYS A 119 ? 1.0961 1.3245 1.3266 0.0803  0.1217  0.3921  614 LYS A CA  
769  C C   . LYS A 119 ? 1.1730 1.4155 1.4564 0.0882  0.1431  0.4391  614 LYS A C   
770  O O   . LYS A 119 ? 1.1880 1.4733 1.4650 0.1078  0.1572  0.4687  614 LYS A O   
771  C CB  . LYS A 119 ? 1.1216 1.3603 1.3219 0.0855  0.1120  0.3839  614 LYS A CB  
772  N N   . LYS A 120 ? 1.1285 1.3363 1.4665 0.0738  0.1463  0.4456  615 LYS A N   
773  C CA  . LYS A 120 ? 1.1378 1.3526 1.5379 0.0786  0.1677  0.4891  615 LYS A CA  
774  C C   . LYS A 120 ? 1.2242 1.4404 1.6612 0.0744  0.1787  0.5005  615 LYS A C   
775  O O   . LYS A 120 ? 1.2433 1.4972 1.6894 0.0916  0.1970  0.5377  615 LYS A O   
776  C CB  . LYS A 120 ? 1.1509 1.3342 1.5992 0.0691  0.1699  0.4957  615 LYS A CB  
777  C CG  . LYS A 120 ? 1.2044 1.3372 1.6833 0.0442  0.1575  0.4609  615 LYS A CG  
778  N N   . LYS A 121 ? 1.1832 1.3643 1.6382 0.0535  0.1673  0.4691  616 LYS A N   
779  C CA  . LYS A 121 ? 1.1879 1.3711 1.6826 0.0478  0.1758  0.4776  616 LYS A CA  
780  C C   . LYS A 121 ? 1.2818 1.4984 1.7372 0.0608  0.1794  0.4800  616 LYS A C   
781  O O   . LYS A 121 ? 1.2612 1.4767 1.6599 0.0613  0.1646  0.4481  616 LYS A O   
782  C CB  . LYS A 121 ? 1.1915 1.3335 1.7289 0.0230  0.1641  0.4478  616 LYS A CB  
783  C CG  . LYS A 121 ? 1.1786 1.3016 1.6711 0.0121  0.1416  0.4007  616 LYS A CG  
784  N N   . LYS A 122 ? 1.2930 1.5396 1.7831 0.0722  0.2008  0.5199  617 LYS A N   
785  C CA  . LYS A 122 ? 1.3155 1.5978 1.7783 0.0870  0.2088  0.5287  617 LYS A CA  
786  C C   . LYS A 122 ? 1.3722 1.6363 1.8458 0.0717  0.1997  0.5016  617 LYS A C   
787  O O   . LYS A 122 ? 1.3742 1.6528 1.8009 0.0798  0.1949  0.4849  617 LYS A O   
788  C CB  . LYS A 122 ? 1.3714 1.6940 1.8738 0.1054  0.2373  0.5850  617 LYS A CB  
789  N N   . SER A 123 ? 1.3213 1.5563 1.8586 0.0509  0.1975  0.4968  618 SER A N   
790  C CA  . SER A 123 ? 1.3045 1.5258 1.8594 0.0359  0.1876  0.4720  618 SER A CA  
791  C C   . SER A 123 ? 1.3169 1.4969 1.8701 0.0150  0.1643  0.4286  618 SER A C   
792  O O   . SER A 123 ? 1.3115 1.4684 1.9037 0.0034  0.1621  0.4269  618 SER A O   
793  C CB  . SER A 123 ? 1.3603 1.5925 1.9948 0.0303  0.2044  0.5016  618 SER A CB  
794  O OG  . SER A 123 ? 1.4364 1.6605 2.0900 0.0163  0.1938  0.4774  618 SER A OG  
795  N N   . ILE A 124 ? 1.2462 1.4190 1.7556 0.0119  0.1484  0.3948  619 ILE A N   
796  C CA  . ILE A 124 ? 1.2211 1.3617 1.7217 -0.0045 0.1266  0.3543  619 ILE A CA  
797  C C   . ILE A 124 ? 1.2454 1.3856 1.7776 -0.0158 0.1198  0.3395  619 ILE A C   
798  O O   . ILE A 124 ? 1.2402 1.3988 1.7534 -0.0080 0.1225  0.3409  619 ILE A O   
799  C CB  . ILE A 124 ? 1.2528 1.3831 1.6802 0.0011  0.1132  0.3281  619 ILE A CB  
800  C CG1 . ILE A 124 ? 1.2374 1.3404 1.6535 -0.0128 0.0928  0.2895  619 ILE A CG1 
801  C CG2 . ILE A 124 ? 1.2775 1.4328 1.6562 0.0182  0.1190  0.3324  619 ILE A CG2 
802  C CD1 . ILE A 124 ? 1.2752 1.3522 1.7070 -0.0242 0.0837  0.2757  619 ILE A CD1 
803  N N   . ASP A 125 ? 1.1856 1.3073 1.7682 -0.0333 0.1111  0.3247  620 ASP A N   
804  C CA  . ASP A 125 ? 1.1759 1.2999 1.7982 -0.0460 0.1020  0.3077  620 ASP A CA  
805  C C   . ASP A 125 ? 1.2063 1.3287 1.7773 -0.0446 0.0852  0.2771  620 ASP A C   
806  O O   . ASP A 125 ? 1.2007 1.3035 1.7336 -0.0467 0.0715  0.2523  620 ASP A O   
807  C CB  . ASP A 125 ? 1.2039 1.3080 1.8872 -0.0641 0.0945  0.2925  620 ASP A CB  
808  C CG  . ASP A 125 ? 1.3291 1.4360 2.0557 -0.0793 0.0799  0.2655  620 ASP A CG  
809  O OD1 . ASP A 125 ? 1.3343 1.4633 2.0620 -0.0769 0.0796  0.2676  620 ASP A OD1 
810  O OD2 . ASP A 125 ? 1.3911 1.4808 2.1540 -0.0929 0.0692  0.2423  620 ASP A OD2 
811  N N   . PRO A 126 ? 1.1526 1.2964 1.7260 -0.0405 0.0872  0.2804  621 PRO A N   
812  C CA  . PRO A 126 ? 1.1385 1.2818 1.6679 -0.0375 0.0732  0.2550  621 PRO A CA  
813  C C   . PRO A 126 ? 1.1580 1.2838 1.6834 -0.0486 0.0522  0.2208  621 PRO A C   
814  O O   . PRO A 126 ? 1.1385 1.2556 1.6123 -0.0428 0.0431  0.2035  621 PRO A O   
815  C CB  . PRO A 126 ? 1.1623 1.3329 1.7221 -0.0355 0.0786  0.2657  621 PRO A CB  
816  C CG  . PRO A 126 ? 1.2312 1.4188 1.8194 -0.0289 0.1004  0.3022  621 PRO A CG  
817  C CD  . PRO A 126 ? 1.1784 1.3495 1.7956 -0.0367 0.1041  0.3104  621 PRO A CD  
818  N N   . TRP A 127 ? 1.1097 1.2316 1.6914 -0.0635 0.0457  0.2110  622 TRP A N   
819  C CA  . TRP A 127 ? 1.1043 1.2141 1.6876 -0.0732 0.0261  0.1771  622 TRP A CA  
820  C C   . TRP A 127 ? 1.1111 1.1946 1.6557 -0.0711 0.0239  0.1696  622 TRP A C   
821  O O   . TRP A 127 ? 1.1207 1.1961 1.6242 -0.0687 0.0112  0.1475  622 TRP A O   
822  C CB  . TRP A 127 ? 1.1062 1.2205 1.7665 -0.0895 0.0209  0.1667  622 TRP A CB  
823  C CG  . TRP A 127 ? 1.1342 1.2339 1.7996 -0.0986 0.0033  0.1317  622 TRP A CG  
824  C CD1 . TRP A 127 ? 1.1792 1.2532 1.8426 -0.1015 0.0040  0.1261  622 TRP A CD1 
825  C CD2 . TRP A 127 ? 1.1410 1.2553 1.8166 -0.1044 -0.0172 0.0975  622 TRP A CD2 
826  N NE1 . TRP A 127 ? 1.1802 1.2502 1.8481 -0.1081 -0.0144 0.0893  622 TRP A NE1 
827  C CE2 . TRP A 127 ? 1.2010 1.2972 1.8767 -0.1099 -0.0280 0.0707  622 TRP A CE2 
828  C CE3 . TRP A 127 ? 1.1588 1.3035 1.8430 -0.1040 -0.0276 0.0870  622 TRP A CE3 
829  C CZ2 . TRP A 127 ? 1.2018 1.3112 1.8840 -0.1143 -0.0490 0.0325  622 TRP A CZ2 
830  C CZ3 . TRP A 127 ? 1.1862 1.3454 1.8774 -0.1085 -0.0491 0.0505  622 TRP A CZ3 
831  C CH2 . TRP A 127 ? 1.2034 1.3459 1.8922 -0.1132 -0.0597 0.0229  622 TRP A CH2 
832  N N   . GLU A 128 ? 1.0126 1.0851 1.5744 -0.0714 0.0367  0.1897  623 GLU A N   
833  C CA  . GLU A 128 ? 0.9871 1.0376 1.5196 -0.0690 0.0366  0.1872  623 GLU A CA  
834  C C   . GLU A 128 ? 0.9780 1.0260 1.4385 -0.0574 0.0338  0.1830  623 GLU A C   
835  O O   . GLU A 128 ? 0.9799 1.0127 1.4096 -0.0579 0.0236  0.1637  623 GLU A O   
836  C CB  . GLU A 128 ? 1.0145 1.0638 1.5746 -0.0662 0.0549  0.2194  623 GLU A CB  
837  C CG  . GLU A 128 ? 1.1629 1.1909 1.7151 -0.0663 0.0553  0.2182  623 GLU A CG  
838  C CD  . GLU A 128 ? 1.3932 1.4258 1.9601 -0.0583 0.0745  0.2548  623 GLU A CD  
839  O OE1 . GLU A 128 ? 1.2723 1.3220 1.8786 -0.0562 0.0892  0.2825  623 GLU A OE1 
840  O OE2 . GLU A 128 ? 1.2254 1.2474 1.7655 -0.0530 0.0753  0.2575  623 GLU A OE2 
841  N N   . ARG A 129 ? 0.8867 0.9505 1.3243 -0.0471 0.0428  0.1994  624 ARG A N   
842  C CA  . ARG A 129 ? 0.8654 0.9282 1.2424 -0.0359 0.0419  0.1950  624 ARG A CA  
843  C C   . ARG A 129 ? 0.8866 0.9454 1.2411 -0.0369 0.0278  0.1701  624 ARG A C   
844  O O   . ARG A 129 ? 0.8783 0.9228 1.1947 -0.0343 0.0217  0.1570  624 ARG A O   
845  C CB  . ARG A 129 ? 0.8476 0.9312 1.2156 -0.0242 0.0561  0.2171  624 ARG A CB  
846  C CG  . ARG A 129 ? 0.8687 0.9524 1.1812 -0.0125 0.0561  0.2097  624 ARG A CG  
847  C CD  . ARG A 129 ? 0.9052 1.0124 1.2121 0.0003  0.0706  0.2291  624 ARG A CD  
848  N NE  . ARG A 129 ? 0.9666 1.0920 1.3155 -0.0018 0.0755  0.2407  624 ARG A NE  
849  C CZ  . ARG A 129 ? 1.1251 1.2744 1.4928 0.0063  0.0912  0.2664  624 ARG A CZ  
850  N NH1 . ARG A 129 ? 0.9515 1.1122 1.2964 0.0186  0.1029  0.2828  624 ARG A NH1 
851  N NH2 . ARG A 129 ? 0.9761 1.1424 1.3866 0.0032  0.0952  0.2764  624 ARG A NH2 
852  N N   . LYS A 130 ? 0.8381 0.9126 1.2185 -0.0396 0.0235  0.1655  625 LYS A N   
853  C CA  . LYS A 130 ? 0.8177 0.8963 1.1821 -0.0382 0.0107  0.1455  625 LYS A CA  
854  C C   . LYS A 130 ? 0.8875 0.9518 1.2439 -0.0439 -0.0026 0.1234  625 LYS A C   
855  O O   . LYS A 130 ? 0.8909 0.9498 1.2103 -0.0379 -0.0088 0.1121  625 LYS A O   
856  C CB  . LYS A 130 ? 0.8056 0.9086 1.2114 -0.0420 0.0070  0.1447  625 LYS A CB  
857  C CG  . LYS A 130 ? 0.7027 0.8188 1.0853 -0.0335 0.0005  0.1365  625 LYS A CG  
858  C CD  . LYS A 130 ? 0.8033 0.9478 1.2297 -0.0383 -0.0073 0.1311  625 LYS A CD  
859  C CE  . LYS A 130 ? 0.8289 0.9935 1.2682 -0.0315 0.0040  0.1508  625 LYS A CE  
860  N NZ  . LYS A 130 ? 0.8916 1.0811 1.3316 -0.0252 -0.0046 0.1435  625 LYS A NZ  
861  N N   . SER A 131 ? 0.8416 0.8994 1.2346 -0.0543 -0.0049 0.1190  626 SER A N   
862  C CA  . SER A 131 ? 0.8310 0.8758 1.2226 -0.0595 -0.0156 0.0979  626 SER A CA  
863  C C   . SER A 131 ? 0.8941 0.9190 1.2399 -0.0535 -0.0122 0.1007  626 SER A C   
864  O O   . SER A 131 ? 0.8936 0.9143 1.2084 -0.0495 -0.0203 0.0861  626 SER A O   
865  C CB  . SER A 131 ? 0.8518 0.8913 1.2982 -0.0710 -0.0147 0.0960  626 SER A CB  
866  O OG  . SER A 131 ? 0.9704 1.0032 1.4192 -0.0752 -0.0277 0.0688  626 SER A OG  
867  N N   . TYR A 132 ? 0.8583 0.8750 1.2007 -0.0517 0.0001  0.1207  627 TYR A N   
868  C CA  . TYR A 132 ? 0.8533 0.8554 1.1574 -0.0466 0.0036  0.1245  627 TYR A CA  
869  C C   . TYR A 132 ? 0.8631 0.8639 1.1213 -0.0385 0.0014  0.1188  627 TYR A C   
870  O O   . TYR A 132 ? 0.8566 0.8451 1.0885 -0.0370 -0.0024 0.1100  627 TYR A O   
871  C CB  . TYR A 132 ? 0.8825 0.8867 1.1920 -0.0434 0.0171  0.1488  627 TYR A CB  
872  C CG  . TYR A 132 ? 0.9299 0.9284 1.2819 -0.0498 0.0215  0.1574  627 TYR A CG  
873  C CD1 . TYR A 132 ? 0.9607 0.9472 1.3377 -0.0583 0.0127  0.1389  627 TYR A CD1 
874  C CD2 . TYR A 132 ? 0.9514 0.9579 1.3196 -0.0457 0.0355  0.1846  627 TYR A CD2 
875  C CE1 . TYR A 132 ? 0.9852 0.9634 1.4069 -0.0640 0.0180  0.1457  627 TYR A CE1 
876  C CE2 . TYR A 132 ? 0.9734 0.9735 1.3856 -0.0503 0.0419  0.1961  627 TYR A CE2 
877  C CZ  . TYR A 132 ? 1.1012 1.0848 1.5424 -0.0602 0.0333  0.1760  627 TYR A CZ  
878  O OH  . TYR A 132 ? 1.1699 1.1439 1.6602 -0.0648 0.0407  0.1858  627 TYR A OH  
879  N N   . TRP A 133 ? 0.8024 0.8159 1.0557 -0.0332 0.0047  0.1242  628 TRP A N   
880  C CA  . TRP A 133 ? 0.7878 0.8000 1.0062 -0.0248 0.0048  0.1202  628 TRP A CA  
881  C C   . TRP A 133 ? 0.8040 0.8134 1.0127 -0.0245 -0.0056 0.1044  628 TRP A C   
882  O O   . TRP A 133 ? 0.7905 0.7879 0.9712 -0.0206 -0.0061 0.0998  628 TRP A O   
883  C CB  . TRP A 133 ? 0.7753 0.8039 1.0003 -0.0189 0.0107  0.1290  628 TRP A CB  
884  C CG  . TRP A 133 ? 0.7940 0.8193 0.9887 -0.0093 0.0128  0.1257  628 TRP A CG  
885  C CD1 . TRP A 133 ? 0.8316 0.8663 1.0268 -0.0038 0.0100  0.1227  628 TRP A CD1 
886  C CD2 . TRP A 133 ? 0.7989 0.8110 0.9627 -0.0036 0.0186  0.1246  628 TRP A CD2 
887  N NE1 . TRP A 133 ? 0.8275 0.8527 0.9960 0.0053  0.0156  0.1222  628 TRP A NE1 
888  C CE2 . TRP A 133 ? 0.8474 0.8576 0.9976 0.0046  0.0204  0.1212  628 TRP A CE2 
889  C CE3 . TRP A 133 ? 0.8162 0.8203 0.9653 -0.0042 0.0224  0.1258  628 TRP A CE3 
890  C CZ2 . TRP A 133 ? 0.8450 0.8419 0.9717 0.0108  0.0264  0.1170  628 TRP A CZ2 
891  C CZ3 . TRP A 133 ? 0.8424 0.8373 0.9655 0.0016  0.0261  0.1195  628 TRP A CZ3 
892  C CH2 . TRP A 133 ? 0.8548 0.8443 0.9688 0.0083  0.0284  0.1142  628 TRP A CH2 
893  N N   . LYS A 134 ? 0.7499 0.7732 0.9838 -0.0280 -0.0140 0.0960  629 LYS A N   
894  C CA  . LYS A 134 ? 0.7451 0.7746 0.9706 -0.0253 -0.0248 0.0806  629 LYS A CA  
895  C C   . LYS A 134 ? 0.7843 0.7975 0.9931 -0.0267 -0.0279 0.0718  629 LYS A C   
896  O O   . LYS A 134 ? 0.7939 0.8054 0.9767 -0.0196 -0.0298 0.0679  629 LYS A O   
897  C CB  . LYS A 134 ? 0.7775 0.8290 1.0387 -0.0304 -0.0350 0.0691  629 LYS A CB  
898  N N   . ASN A 135 ? 0.7331 0.7349 0.9582 -0.0345 -0.0262 0.0721  630 ASN A N   
899  C CA  . ASN A 135 ? 0.7335 0.7203 0.9471 -0.0358 -0.0277 0.0656  630 ASN A CA  
900  C C   . ASN A 135 ? 0.7906 0.7639 0.9702 -0.0309 -0.0209 0.0746  630 ASN A C   
901  O O   . ASN A 135 ? 0.7946 0.7605 0.9572 -0.0286 -0.0229 0.0687  630 ASN A O   
902  C CB  . ASN A 135 ? 0.7318 0.7104 0.9768 -0.0443 -0.0255 0.0674  630 ASN A CB  
903  C CG  . ASN A 135 ? 1.0245 1.0124 1.3107 -0.0512 -0.0329 0.0534  630 ASN A CG  
904  O OD1 . ASN A 135 ? 1.0128 1.0176 1.3034 -0.0498 -0.0422 0.0393  630 ASN A OD1 
905  N ND2 . ASN A 135 ? 0.9179 0.8965 1.2384 -0.0584 -0.0290 0.0564  630 ASN A ND2 
906  N N   . MET A 136 ? 0.7387 0.7114 0.9111 -0.0289 -0.0128 0.0874  631 MET A N   
907  C CA  . MET A 136 ? 0.7382 0.7007 0.8840 -0.0251 -0.0069 0.0923  631 MET A CA  
908  C C   . MET A 136 ? 0.8036 0.7643 0.9297 -0.0182 -0.0068 0.0889  631 MET A C   
909  O O   . MET A 136 ? 0.8252 0.7747 0.9342 -0.0164 -0.0037 0.0886  631 MET A O   
910  C CB  . MET A 136 ? 0.7724 0.7399 0.9184 -0.0234 0.0010  0.1033  631 MET A CB  
911  C CG  . MET A 136 ? 0.8308 0.7984 0.9844 -0.0264 0.0045  0.1115  631 MET A CG  
912  S SD  . MET A 136 ? 0.8993 0.8801 1.0449 -0.0199 0.0142  0.1241  631 MET A SD  
913  C CE  . MET A 136 ? 0.8570 0.8520 1.0402 -0.0224 0.0183  0.1382  631 MET A CE  
914  N N   . LEU A 137 ? 0.7361 0.7092 0.8678 -0.0138 -0.0092 0.0880  632 LEU A N   
915  C CA  . LEU A 137 ? 0.7273 0.7012 0.8440 -0.0048 -0.0073 0.0891  632 LEU A CA  
916  C C   . LEU A 137 ? 0.8151 0.7906 0.9241 -0.0022 -0.0127 0.0830  632 LEU A C   
917  O O   . LEU A 137 ? 0.8247 0.7910 0.9191 0.0027  -0.0080 0.0866  632 LEU A O   
918  C CB  . LEU A 137 ? 0.7182 0.7095 0.8437 0.0012  -0.0076 0.0926  632 LEU A CB  
919  C CG  . LEU A 137 ? 0.7610 0.7547 0.8943 0.0012  -0.0008 0.0998  632 LEU A CG  
920  C CD1 . LEU A 137 ? 0.7552 0.7710 0.9047 0.0053  -0.0035 0.1024  632 LEU A CD1 
921  C CD2 . LEU A 137 ? 0.7817 0.7607 0.8981 0.0067  0.0091  0.1034  632 LEU A CD2 
922  N N   . GLU A 138 ? 0.7897 0.7774 0.9113 -0.0053 -0.0220 0.0732  633 GLU A N   
923  C CA  . GLU A 138 ? 0.8100 0.8044 0.9236 -0.0011 -0.0280 0.0643  633 GLU A CA  
924  C C   . GLU A 138 ? 0.8901 0.8660 0.9910 -0.0029 -0.0235 0.0661  633 GLU A C   
925  O O   . GLU A 138 ? 0.8940 0.8722 0.9800 0.0049  -0.0218 0.0678  633 GLU A O   
926  C CB  . GLU A 138 ? 0.8346 0.8431 0.9689 -0.0060 -0.0390 0.0481  633 GLU A CB  
927  C CG  . GLU A 138 ? 1.0534 1.0816 1.1775 0.0032  -0.0471 0.0356  633 GLU A CG  
928  C CD  . GLU A 138 ? 1.3623 1.3978 1.5024 -0.0012 -0.0573 0.0137  633 GLU A CD  
929  O OE1 . GLU A 138 ? 1.1356 1.1717 1.3065 -0.0114 -0.0621 0.0046  633 GLU A OE1 
930  O OE2 . GLU A 138 ? 1.3458 1.3887 1.4698 0.0067  -0.0601 0.0052  633 GLU A OE2 
931  N N   . ALA A 139 ? 0.8450 0.8060 0.9532 -0.0120 -0.0208 0.0676  634 ALA A N   
932  C CA  . ALA A 139 ? 0.8345 0.7812 0.9343 -0.0145 -0.0174 0.0694  634 ALA A CA  
933  C C   . ALA A 139 ? 0.8913 0.8293 0.9762 -0.0106 -0.0098 0.0776  634 ALA A C   
934  O O   . ALA A 139 ? 0.9198 0.8567 0.9959 -0.0057 -0.0077 0.0792  634 ALA A O   
935  C CB  . ALA A 139 ? 0.8363 0.7752 0.9484 -0.0229 -0.0161 0.0718  634 ALA A CB  
936  N N   . VAL A 140 ? 0.8080 0.7416 0.8929 -0.0115 -0.0050 0.0825  635 VAL A N   
937  C CA  . VAL A 140 ? 0.7897 0.7128 0.8673 -0.0087 0.0025  0.0868  635 VAL A CA  
938  C C   . VAL A 140 ? 0.8404 0.7672 0.9140 0.0012  0.0061  0.0926  635 VAL A C   
939  O O   . VAL A 140 ? 0.8342 0.7525 0.9062 0.0035  0.0120  0.0971  635 VAL A O   
940  C CB  . VAL A 140 ? 0.8248 0.7446 0.9034 -0.0102 0.0067  0.0869  635 VAL A CB  
941  C CG1 . VAL A 140 ? 0.8259 0.7327 0.9023 -0.0086 0.0139  0.0861  635 VAL A CG1 
942  C CG2 . VAL A 140 ? 0.8157 0.7382 0.8968 -0.0168 0.0042  0.0851  635 VAL A CG2 
943  N N   . HIS A 141 ? 0.8034 0.7463 0.8782 0.0077  0.0026  0.0937  636 HIS A N   
944  C CA  . HIS A 141 ? 0.8109 0.7648 0.8808 0.0202  0.0058  0.1019  636 HIS A CA  
945  C C   . HIS A 141 ? 0.8782 0.8363 0.9405 0.0249  0.0060  0.1038  636 HIS A C   
946  O O   . HIS A 141 ? 0.8986 0.8571 0.9584 0.0344  0.0147  0.1163  636 HIS A O   
947  C CB  . HIS A 141 ? 0.8179 0.7959 0.8905 0.0264  -0.0012 0.1000  636 HIS A CB  
948  C CG  . HIS A 141 ? 0.8744 0.8692 0.9416 0.0420  0.0028  0.1116  636 HIS A CG  
949  N ND1 . HIS A 141 ? 0.9041 0.9299 0.9675 0.0511  -0.0060 0.1079  636 HIS A ND1 
950  C CD2 . HIS A 141 ? 0.9100 0.8965 0.9777 0.0509  0.0151  0.1270  636 HIS A CD2 
951  C CE1 . HIS A 141 ? 0.9097 0.9482 0.9682 0.0666  0.0013  0.1239  636 HIS A CE1 
952  N NE2 . HIS A 141 ? 0.9185 0.9319 0.9814 0.0669  0.0151  0.1371  636 HIS A NE2 
953  N N   . THR A 142 ? 0.8143 0.7757 0.8752 0.0194  -0.0017 0.0929  637 THR A N   
954  C CA  . THR A 142 ? 0.8125 0.7807 0.8651 0.0256  -0.0010 0.0937  637 THR A CA  
955  C C   . THR A 142 ? 0.8482 0.7980 0.9023 0.0223  0.0084  0.1024  637 THR A C   
956  O O   . THR A 142 ? 0.8661 0.8213 0.9166 0.0319  0.0159  0.1139  637 THR A O   
957  C CB  . THR A 142 ? 0.9443 0.9262 0.9963 0.0247  -0.0120 0.0777  637 THR A CB  
958  O OG1 . THR A 142 ? 0.9763 0.9437 1.0404 0.0111  -0.0160 0.0690  637 THR A OG1 
959  C CG2 . THR A 142 ? 0.9773 0.9855 1.0293 0.0321  -0.0208 0.0696  637 THR A CG2 
960  N N   . ILE A 143 ? 0.7614 0.6927 0.8231 0.0099  0.0089  0.0986  638 ILE A N   
961  C CA  . ILE A 143 ? 0.7523 0.6690 0.8198 0.0053  0.0161  0.1036  638 ILE A CA  
962  C C   . ILE A 143 ? 0.7771 0.6867 0.8519 0.0109  0.0271  0.1153  638 ILE A C   
963  O O   . ILE A 143 ? 0.7680 0.6732 0.8503 0.0136  0.0356  0.1251  638 ILE A O   
964  C CB  . ILE A 143 ? 0.7921 0.6977 0.8648 -0.0076 0.0124  0.0950  638 ILE A CB  
965  C CG1 . ILE A 143 ? 0.7957 0.6956 0.8712 -0.0117 0.0124  0.0912  638 ILE A CG1 
966  C CG2 . ILE A 143 ? 0.7975 0.7092 0.8683 -0.0111 0.0044  0.0878  638 ILE A CG2 
967  C CD1 . ILE A 143 ? 0.8196 0.7132 0.8989 -0.0208 0.0113  0.0846  638 ILE A CD1 
968  N N   . HIS A 144 ? 0.7243 0.6338 0.8000 0.0140  0.0280  0.1160  639 HIS A N   
969  C CA  . HIS A 144 ? 0.7228 0.6244 0.8088 0.0207  0.0392  0.1271  639 HIS A CA  
970  C C   . HIS A 144 ? 0.7705 0.6847 0.8559 0.0352  0.0471  0.1449  639 HIS A C   
971  O O   . HIS A 144 ? 0.7806 0.6842 0.8814 0.0386  0.0598  0.1580  639 HIS A O   
972  C CB  . HIS A 144 ? 0.7293 0.6325 0.8148 0.0231  0.0380  0.1244  639 HIS A CB  
973  C CG  . HIS A 144 ? 0.7727 0.6615 0.8628 0.0127  0.0368  0.1118  639 HIS A CG  
974  N ND1 . HIS A 144 ? 0.8023 0.6913 0.8935 0.0153  0.0381  0.1094  639 HIS A ND1 
975  C CD2 . HIS A 144 ? 0.7908 0.6696 0.8835 0.0016  0.0344  0.1011  639 HIS A CD2 
976  C CE1 . HIS A 144 ? 0.7928 0.6729 0.8849 0.0066  0.0365  0.0969  639 HIS A CE1 
977  N NE2 . HIS A 144 ? 0.7917 0.6665 0.8846 -0.0018 0.0337  0.0913  639 HIS A NE2 
978  N N   . GLN A 145 ? 0.7127 0.6516 0.7825 0.0441  0.0398  0.1451  640 GLN A N   
979  C CA  . GLN A 145 ? 0.7291 0.6898 0.7926 0.0614  0.0458  0.1617  640 GLN A CA  
980  C C   . GLN A 145 ? 0.8372 0.7943 0.9052 0.0627  0.0543  0.1714  640 GLN A C   
981  O O   . GLN A 145 ? 0.8637 0.8334 0.9341 0.0777  0.0658  0.1923  640 GLN A O   
982  C CB  . GLN A 145 ? 0.7401 0.7312 0.7854 0.0690  0.0329  0.1518  640 GLN A CB  
983  C CG  . GLN A 145 ? 0.7938 0.7996 0.8379 0.0743  0.0275  0.1502  640 GLN A CG  
984  C CD  . GLN A 145 ? 1.1031 1.1380 1.1355 0.0775  0.0122  0.1339  640 GLN A CD  
985  O OE1 . GLN A 145 ? 1.0978 1.1368 1.1239 0.0738  0.0052  0.1205  640 GLN A OE1 
986  N NE2 . GLN A 145 ? 1.0572 1.1143 1.0894 0.0850  0.0067  0.1336  640 GLN A NE2 
987  N N   . HIS A 146 ? 0.8026 0.7459 0.8731 0.0486  0.0495  0.1586  641 HIS A N   
988  C CA  . HIS A 146 ? 0.8088 0.7497 0.8863 0.0481  0.0567  0.1664  641 HIS A CA  
989  C C   . HIS A 146 ? 0.8529 0.7685 0.9569 0.0373  0.0665  0.1712  641 HIS A C   
990  O O   . HIS A 146 ? 0.8612 0.7732 0.9774 0.0337  0.0721  0.1764  641 HIS A O   
991  C CB  . HIS A 146 ? 0.8198 0.7663 0.8851 0.0420  0.0456  0.1503  641 HIS A CB  
992  C CG  . HIS A 146 ? 0.8792 0.8535 0.9239 0.0554  0.0387  0.1457  641 HIS A CG  
993  N ND1 . HIS A 146 ? 0.9068 0.8916 0.9424 0.0568  0.0280  0.1338  641 HIS A ND1 
994  C CD2 . HIS A 146 ? 0.9144 0.9109 0.9476 0.0694  0.0419  0.1516  641 HIS A CD2 
995  C CE1 . HIS A 146 ? 0.9067 0.9197 0.9267 0.0704  0.0233  0.1295  641 HIS A CE1 
996  N NE2 . HIS A 146 ? 0.9172 0.9387 0.9329 0.0791  0.0313  0.1394  641 HIS A NE2 
997  N N   . GLY A 147 ? 0.8022 0.7022 0.9174 0.0330  0.0687  0.1685  642 GLY A N   
998  C CA  . GLY A 147 ? 0.8048 0.6807 0.9483 0.0226  0.0768  0.1672  642 GLY A CA  
999  C C   . GLY A 147 ? 0.8471 0.7104 0.9921 0.0054  0.0661  0.1435  642 GLY A C   
1000 O O   . GLY A 147 ? 0.8589 0.7052 1.0266 -0.0033 0.0704  0.1364  642 GLY A O   
1001 N N   . ILE A 148 ? 0.7770 0.6502 0.9005 0.0010  0.0527  0.1307  643 ILE A N   
1002 C CA  . ILE A 148 ? 0.7596 0.6268 0.8832 -0.0125 0.0435  0.1122  643 ILE A CA  
1003 C C   . ILE A 148 ? 0.7955 0.6577 0.9146 -0.0147 0.0399  0.1011  643 ILE A C   
1004 O O   . ILE A 148 ? 0.7957 0.6647 0.9026 -0.0077 0.0381  0.1041  643 ILE A O   
1005 C CB  . ILE A 148 ? 0.7750 0.6534 0.8848 -0.0164 0.0334  0.1064  643 ILE A CB  
1006 C CG1 . ILE A 148 ? 0.7754 0.6615 0.8867 -0.0113 0.0377  0.1172  643 ILE A CG1 
1007 C CG2 . ILE A 148 ? 0.7593 0.6359 0.8723 -0.0281 0.0261  0.0925  643 ILE A CG2 
1008 C CD1 . ILE A 148 ? 0.8730 0.7727 0.9651 -0.0042 0.0315  0.1164  643 ILE A CD1 
1009 N N   . VAL A 149 ? 0.7331 0.5867 0.8629 -0.0236 0.0388  0.0876  644 VAL A N   
1010 C CA  . VAL A 149 ? 0.7220 0.5755 0.8449 -0.0251 0.0348  0.0750  644 VAL A CA  
1011 C C   . VAL A 149 ? 0.7875 0.6510 0.9031 -0.0333 0.0250  0.0629  644 VAL A C   
1012 O O   . VAL A 149 ? 0.7779 0.6403 0.9060 -0.0404 0.0238  0.0553  644 VAL A O   
1013 C CB  . VAL A 149 ? 0.7689 0.6071 0.9118 -0.0265 0.0423  0.0662  644 VAL A CB  
1014 C CG1 . VAL A 149 ? 0.7702 0.6113 0.9029 -0.0253 0.0390  0.0526  644 VAL A CG1 
1015 C CG2 . VAL A 149 ? 0.7711 0.5984 0.9287 -0.0175 0.0551  0.0826  644 VAL A CG2 
1016 N N   . HIS A 150 ? 0.7756 0.6510 0.8743 -0.0319 0.0184  0.0627  645 HIS A N   
1017 C CA  . HIS A 150 ? 0.7861 0.6742 0.8785 -0.0369 0.0106  0.0570  645 HIS A CA  
1018 C C   . HIS A 150 ? 0.9136 0.8065 1.0089 -0.0406 0.0083  0.0410  645 HIS A C   
1019 O O   . HIS A 150 ? 0.9142 0.8160 1.0134 -0.0459 0.0034  0.0342  645 HIS A O   
1020 C CB  . HIS A 150 ? 0.7818 0.6809 0.8618 -0.0337 0.0066  0.0631  645 HIS A CB  
1021 C CG  . HIS A 150 ? 0.8102 0.7236 0.8864 -0.0366 0.0009  0.0625  645 HIS A CG  
1022 N ND1 . HIS A 150 ? 0.8312 0.7561 0.9049 -0.0382 -0.0019 0.0528  645 HIS A ND1 
1023 C CD2 . HIS A 150 ? 0.8219 0.7418 0.8978 -0.0368 -0.0021 0.0706  645 HIS A CD2 
1024 C CE1 . HIS A 150 ? 0.8248 0.7652 0.8954 -0.0382 -0.0061 0.0581  645 HIS A CE1 
1025 N NE2 . HIS A 150 ? 0.8219 0.7570 0.8956 -0.0378 -0.0055 0.0696  645 HIS A NE2 
1026 N N   . SER A 151 ? 0.9342 0.8241 1.0276 -0.0369 0.0115  0.0335  646 SER A N   
1027 C CA  . SER A 151 ? 0.9760 0.8687 1.0746 -0.0390 0.0103  0.0131  646 SER A CA  
1028 C C   . SER A 151 ? 1.0546 0.9728 1.1366 -0.0373 0.0029  0.0057  646 SER A C   
1029 O O   . SER A 151 ? 1.0682 0.9958 1.1483 -0.0358 0.0010  -0.0130 646 SER A O   
1030 C CB  . SER A 151 ? 1.0516 0.9378 1.1717 -0.0475 0.0096  0.0032  646 SER A CB  
1031 O OG  . SER A 151 ? 1.1954 1.0977 1.3108 -0.0516 0.0020  0.0070  646 SER A OG  
1032 N N   . ASP A 152 ? 1.0063 0.9376 1.0777 -0.0361 -0.0008 0.0203  647 ASP A N   
1033 C CA  . ASP A 152 ? 1.0102 0.9688 1.0675 -0.0319 -0.0056 0.0196  647 ASP A CA  
1034 C C   . ASP A 152 ? 1.0178 0.9826 1.0688 -0.0277 -0.0040 0.0406  647 ASP A C   
1035 O O   . ASP A 152 ? 0.9980 0.9734 1.0493 -0.0285 -0.0070 0.0507  647 ASP A O   
1036 C CB  . ASP A 152 ? 1.0487 1.0237 1.1091 -0.0363 -0.0132 0.0117  647 ASP A CB  
1037 C CG  . ASP A 152 ? 1.2557 1.2639 1.3013 -0.0294 -0.0175 0.0164  647 ASP A CG  
1038 O OD1 . ASP A 152 ? 1.3045 1.3325 1.3390 -0.0232 -0.0191 0.0031  647 ASP A OD1 
1039 O OD2 . ASP A 152 ? 1.2858 1.3018 1.3315 -0.0287 -0.0185 0.0338  647 ASP A OD2 
1040 N N   . LEU A 153 ? 0.9433 0.9013 0.9926 -0.0235 0.0012  0.0470  648 LEU A N   
1041 C CA  . LEU A 153 ? 0.9129 0.8775 0.9629 -0.0206 0.0030  0.0647  648 LEU A CA  
1042 C C   . LEU A 153 ? 0.9646 0.9560 1.0061 -0.0134 0.0042  0.0708  648 LEU A C   
1043 O O   . LEU A 153 ? 0.9812 0.9865 1.0117 -0.0080 0.0046  0.0598  648 LEU A O   
1044 C CB  . LEU A 153 ? 0.9045 0.8561 0.9595 -0.0189 0.0073  0.0692  648 LEU A CB  
1045 C CG  . LEU A 153 ? 0.9419 0.8742 1.0047 -0.0231 0.0066  0.0697  648 LEU A CG  
1046 C CD1 . LEU A 153 ? 0.9532 0.8766 1.0182 -0.0190 0.0110  0.0699  648 LEU A CD1 
1047 C CD2 . LEU A 153 ? 0.9359 0.8692 1.0058 -0.0256 0.0037  0.0798  648 LEU A CD2 
1048 N N   . LYS A 154 ? 0.8985 0.8981 0.9475 -0.0123 0.0056  0.0890  649 LYS A N   
1049 C CA  . LYS A 154 ? 0.8931 0.9198 0.9398 -0.0041 0.0095  0.1041  649 LYS A CA  
1050 C C   . LYS A 154 ? 0.9171 0.9375 0.9856 -0.0064 0.0133  0.1240  649 LYS A C   
1051 O O   . LYS A 154 ? 0.8868 0.8865 0.9664 -0.0139 0.0101  0.1216  649 LYS A O   
1052 C CB  . LYS A 154 ? 0.9243 0.9730 0.9631 -0.0012 0.0051  0.1042  649 LYS A CB  
1053 C CG  . LYS A 154 ? 1.0176 1.0751 1.0413 -0.0012 -0.0014 0.0801  649 LYS A CG  
1054 C CD  . LYS A 154 ? 1.1357 1.2155 1.1560 -0.0005 -0.0083 0.0784  649 LYS A CD  
1055 C CE  . LYS A 154 ? 1.1919 1.2569 1.2269 -0.0081 -0.0107 0.0873  649 LYS A CE  
1056 N NZ  . LYS A 154 ? 1.3032 1.3351 1.3472 -0.0190 -0.0125 0.0746  649 LYS A NZ  
1057 N N   . PRO A 155 ? 0.8851 0.9238 0.9630 0.0003  0.0207  0.1437  650 PRO A N   
1058 C CA  . PRO A 155 ? 0.8792 0.9092 0.9865 -0.0037 0.0245  0.1600  650 PRO A CA  
1059 C C   . PRO A 155 ? 0.9375 0.9607 1.0556 -0.0074 0.0217  0.1646  650 PRO A C   
1060 O O   . PRO A 155 ? 0.9346 0.9391 1.0746 -0.0143 0.0208  0.1647  650 PRO A O   
1061 C CB  . PRO A 155 ? 0.9055 0.9603 1.0231 0.0056  0.0350  0.1827  650 PRO A CB  
1062 C CG  . PRO A 155 ? 0.9703 1.0436 1.0601 0.0146  0.0361  0.1741  650 PRO A CG  
1063 C CD  . PRO A 155 ? 0.9162 0.9856 0.9819 0.0125  0.0268  0.1522  650 PRO A CD  
1064 N N   . ALA A 156 ? 0.8859 0.9256 0.9883 -0.0025 0.0194  0.1653  651 ALA A N   
1065 C CA  . ALA A 156 ? 0.8670 0.9053 0.9766 -0.0039 0.0169  0.1701  651 ALA A CA  
1066 C C   . ALA A 156 ? 0.8905 0.8991 1.0069 -0.0141 0.0111  0.1554  651 ALA A C   
1067 O O   . ALA A 156 ? 0.8931 0.8929 1.0282 -0.0159 0.0123  0.1627  651 ALA A O   
1068 C CB  . ALA A 156 ? 0.8832 0.9462 0.9702 0.0019  0.0121  0.1649  651 ALA A CB  
1069 N N   . ASN A 157 ? 0.8140 0.8083 0.9165 -0.0192 0.0061  0.1359  652 ASN A N   
1070 C CA  . ASN A 157 ? 0.7834 0.7544 0.8875 -0.0261 0.0017  0.1225  652 ASN A CA  
1071 C C   . ASN A 157 ? 0.8055 0.7623 0.9291 -0.0292 0.0028  0.1237  652 ASN A C   
1072 O O   . ASN A 157 ? 0.8154 0.7582 0.9399 -0.0324 -0.0007 0.1137  652 ASN A O   
1073 C CB  . ASN A 157 ? 0.7586 0.7230 0.8465 -0.0276 -0.0006 0.1073  652 ASN A CB  
1074 C CG  . ASN A 157 ? 1.0434 1.0176 1.1175 -0.0271 -0.0035 0.0985  652 ASN A CG  
1075 O OD1 . ASN A 157 ? 0.9433 0.9349 1.0074 -0.0225 -0.0029 0.0965  652 ASN A OD1 
1076 N ND2 . ASN A 157 ? 0.9944 0.9607 1.0698 -0.0314 -0.0067 0.0920  652 ASN A ND2 
1077 N N   . PHE A 158 ? 0.7334 0.6962 0.8732 -0.0277 0.0074  0.1344  653 PHE A N   
1078 C CA  . PHE A 158 ? 0.7204 0.6730 0.8846 -0.0318 0.0073  0.1326  653 PHE A CA  
1079 C C   . PHE A 158 ? 0.8297 0.7822 1.0248 -0.0321 0.0122  0.1458  653 PHE A C   
1080 O O   . PHE A 158 ? 0.8609 0.8271 1.0605 -0.0270 0.0188  0.1642  653 PHE A O   
1081 C CB  . PHE A 158 ? 0.7291 0.6877 0.8964 -0.0313 0.0091  0.1333  653 PHE A CB  
1082 C CG  . PHE A 158 ? 0.7286 0.6827 0.8723 -0.0307 0.0049  0.1193  653 PHE A CG  
1083 C CD1 . PHE A 158 ? 0.7485 0.6933 0.8939 -0.0332 -0.0006 0.1069  653 PHE A CD1 
1084 C CD2 . PHE A 158 ? 0.7312 0.6921 0.8524 -0.0264 0.0069  0.1184  653 PHE A CD2 
1085 C CE1 . PHE A 158 ? 0.7451 0.6870 0.8717 -0.0306 -0.0023 0.0988  653 PHE A CE1 
1086 C CE2 . PHE A 158 ? 0.7543 0.7080 0.8600 -0.0255 0.0050  0.1070  653 PHE A CE2 
1087 C CZ  . PHE A 158 ? 0.7293 0.6733 0.8385 -0.0273 0.0013  0.0997  653 PHE A CZ  
1088 N N   . LEU A 159 ? 0.7963 0.7352 1.0141 -0.0370 0.0094  0.1365  654 LEU A N   
1089 C CA  . LEU A 159 ? 0.8070 0.7404 1.0611 -0.0380 0.0146  0.1457  654 LEU A CA  
1090 C C   . LEU A 159 ? 0.8472 0.7736 1.1375 -0.0443 0.0136  0.1373  654 LEU A C   
1091 O O   . LEU A 159 ? 0.8462 0.7666 1.1315 -0.0477 0.0048  0.1152  654 LEU A O   
1092 C CB  . LEU A 159 ? 0.8189 0.7415 1.0669 -0.0373 0.0114  0.1368  654 LEU A CB  
1093 C CG  . LEU A 159 ? 0.9069 0.8177 1.1929 -0.0383 0.0155  0.1386  654 LEU A CG  
1094 C CD1 . LEU A 159 ? 0.9293 0.8488 1.2328 -0.0326 0.0264  0.1668  654 LEU A CD1 
1095 C CD2 . LEU A 159 ? 0.9381 0.8378 1.2136 -0.0375 0.0102  0.1212  654 LEU A CD2 
1096 N N   . ILE A 160 ? 0.8041 0.7341 1.1330 -0.0451 0.0227  0.1552  655 ILE A N   
1097 C CA  . ILE A 160 ? 0.8038 0.7281 1.1774 -0.0528 0.0219  0.1466  655 ILE A CA  
1098 C C   . ILE A 160 ? 0.8884 0.7947 1.2921 -0.0564 0.0203  0.1329  655 ILE A C   
1099 O O   . ILE A 160 ? 0.8837 0.7842 1.2970 -0.0522 0.0279  0.1471  655 ILE A O   
1100 C CB  . ILE A 160 ? 0.8372 0.7728 1.2475 -0.0530 0.0337  0.1717  655 ILE A CB  
1101 C CG1 . ILE A 160 ? 0.8246 0.7794 1.2038 -0.0485 0.0345  0.1801  655 ILE A CG1 
1102 C CG2 . ILE A 160 ? 0.8506 0.7790 1.3176 -0.0631 0.0324  0.1602  655 ILE A CG2 
1103 C CD1 . ILE A 160 ? 0.8392 0.8119 1.2075 -0.0386 0.0465  0.2099  655 ILE A CD1 
1104 N N   . VAL A 161 ? 0.8847 0.7851 1.2983 -0.0622 0.0096  0.1033  656 VAL A N   
1105 C CA  . VAL A 161 ? 0.9158 0.8008 1.3577 -0.0653 0.0059  0.0816  656 VAL A CA  
1106 C C   . VAL A 161 ? 1.0259 0.9142 1.5043 -0.0739 -0.0019 0.0589  656 VAL A C   
1107 O O   . VAL A 161 ? 1.0248 0.9249 1.4767 -0.0738 -0.0138 0.0387  656 VAL A O   
1108 C CB  . VAL A 161 ? 0.9697 0.8507 1.3711 -0.0600 -0.0027 0.0607  656 VAL A CB  
1109 C CG1 . VAL A 161 ? 0.9838 0.8483 1.4158 -0.0597 -0.0009 0.0475  656 VAL A CG1 
1110 C CG2 . VAL A 161 ? 0.9580 0.8445 1.3095 -0.0528 -0.0002 0.0775  656 VAL A CG2 
1111 N N   . ASP A 162 ? 1.0197 0.8997 1.5621 -0.0809 0.0052  0.0630  657 ASP A N   
1112 C CA  . ASP A 162 ? 1.0313 0.9155 1.6213 -0.0911 -0.0023 0.0396  657 ASP A CA  
1113 C C   . ASP A 162 ? 1.0553 0.9619 1.6272 -0.0926 -0.0076 0.0436  657 ASP A C   
1114 O O   . ASP A 162 ? 1.0381 0.9582 1.5925 -0.0936 -0.0222 0.0166  657 ASP A O   
1115 C CB  . ASP A 162 ? 1.0731 0.9528 1.6654 -0.0925 -0.0167 -0.0043 657 ASP A CB  
1116 C CG  . ASP A 162 ? 1.2249 1.0857 1.8087 -0.0861 -0.0126 -0.0083 657 ASP A CG  
1117 O OD1 . ASP A 162 ? 1.2303 1.0728 1.8606 -0.0879 0.0003  0.0065  657 ASP A OD1 
1118 O OD2 . ASP A 162 ? 1.2859 1.1513 1.8178 -0.0782 -0.0207 -0.0231 657 ASP A OD2 
1119 N N   . GLY A 163 ? 1.0046 0.9178 1.5760 -0.0902 0.0053  0.0790  658 GLY A N   
1120 C CA  . GLY A 163 ? 0.9935 0.9271 1.5492 -0.0894 0.0048  0.0900  658 GLY A CA  
1121 C C   . GLY A 163 ? 1.0269 0.9715 1.5185 -0.0830 -0.0065 0.0768  658 GLY A C   
1122 O O   . GLY A 163 ? 1.0300 0.9914 1.5117 -0.0823 -0.0093 0.0787  658 GLY A O   
1123 N N   . MET A 164 ? 0.9550 0.8903 1.4062 -0.0774 -0.0116 0.0655  659 MET A N   
1124 C CA  . MET A 164 ? 0.9332 0.8759 1.3290 -0.0706 -0.0205 0.0539  659 MET A CA  
1125 C C   . MET A 164 ? 0.9577 0.8935 1.3099 -0.0631 -0.0136 0.0717  659 MET A C   
1126 O O   . MET A 164 ? 0.9603 0.8836 1.3156 -0.0619 -0.0091 0.0762  659 MET A O   
1127 C CB  . MET A 164 ? 0.9718 0.9138 1.3668 -0.0709 -0.0331 0.0214  659 MET A CB  
1128 C CG  . MET A 164 ? 1.0234 0.9715 1.3643 -0.0618 -0.0398 0.0125  659 MET A CG  
1129 S SD  . MET A 164 ? 1.1006 1.0568 1.4447 -0.0595 -0.0542 -0.0258 659 MET A SD  
1130 C CE  . MET A 164 ? 1.0642 1.0442 1.4470 -0.0664 -0.0650 -0.0435 659 MET A CE  
1131 N N   . LEU A 165 ? 0.8853 0.8302 1.2010 -0.0578 -0.0125 0.0811  660 LEU A N   
1132 C CA  . LEU A 165 ? 0.8708 0.8122 1.1471 -0.0515 -0.0075 0.0937  660 LEU A CA  
1133 C C   . LEU A 165 ? 0.9297 0.8650 1.1737 -0.0479 -0.0141 0.0788  660 LEU A C   
1134 O O   . LEU A 165 ? 0.9449 0.8856 1.1790 -0.0463 -0.0220 0.0630  660 LEU A O   
1135 C CB  . LEU A 165 ? 0.8633 0.8159 1.1173 -0.0471 -0.0036 0.1052  660 LEU A CB  
1136 C CG  . LEU A 165 ? 0.9249 0.8860 1.1901 -0.0450 0.0074  0.1286  660 LEU A CG  
1137 C CD1 . LEU A 165 ? 0.9190 0.8896 1.1517 -0.0384 0.0103  0.1338  660 LEU A CD1 
1138 C CD2 . LEU A 165 ? 0.9840 0.9410 1.2503 -0.0429 0.0135  0.1417  660 LEU A CD2 
1139 N N   . LYS A 166 ? 0.8623 0.7897 1.0904 -0.0454 -0.0105 0.0855  661 LYS A N   
1140 C CA  . LYS A 166 ? 0.8467 0.7692 1.0476 -0.0417 -0.0146 0.0750  661 LYS A CA  
1141 C C   . LYS A 166 ? 0.8935 0.8154 1.0678 -0.0388 -0.0104 0.0861  661 LYS A C   
1142 O O   . LYS A 166 ? 0.8881 0.8119 1.0675 -0.0388 -0.0050 0.0999  661 LYS A O   
1143 C CB  . LYS A 166 ? 0.8659 0.7801 1.0825 -0.0422 -0.0167 0.0641  661 LYS A CB  
1144 C CG  . LYS A 166 ? 0.8161 0.7309 1.0661 -0.0461 -0.0217 0.0480  661 LYS A CG  
1145 C CD  . LYS A 166 ? 0.8017 0.7135 1.0494 -0.0429 -0.0272 0.0277  661 LYS A CD  
1146 C CE  . LYS A 166 ? 0.8599 0.7740 1.1431 -0.0469 -0.0336 0.0061  661 LYS A CE  
1147 N NZ  . LYS A 166 ? 1.0438 0.9615 1.3155 -0.0405 -0.0406 -0.0184 661 LYS A NZ  
1148 N N   . LEU A 167 ? 0.8521 0.7737 1.0006 -0.0357 -0.0125 0.0803  662 LEU A N   
1149 C CA  . LEU A 167 ? 0.8499 0.7706 0.9777 -0.0342 -0.0096 0.0861  662 LEU A CA  
1150 C C   . LEU A 167 ? 0.8928 0.8095 1.0212 -0.0342 -0.0091 0.0872  662 LEU A C   
1151 O O   . LEU A 167 ? 0.9010 0.8138 1.0301 -0.0324 -0.0112 0.0792  662 LEU A O   
1152 C CB  . LEU A 167 ? 0.8483 0.7683 0.9577 -0.0310 -0.0103 0.0808  662 LEU A CB  
1153 C CG  . LEU A 167 ? 0.8908 0.8078 0.9854 -0.0307 -0.0072 0.0830  662 LEU A CG  
1154 C CD1 . LEU A 167 ? 0.8779 0.7999 0.9699 -0.0318 -0.0048 0.0871  662 LEU A CD1 
1155 C CD2 . LEU A 167 ? 0.9120 0.8260 0.9972 -0.0265 -0.0058 0.0803  662 LEU A CD2 
1156 N N   . ILE A 168 ? 0.8259 0.7475 0.9544 -0.0346 -0.0063 0.0972  663 ILE A N   
1157 C CA  . ILE A 168 ? 0.8161 0.7384 0.9474 -0.0338 -0.0054 0.1016  663 ILE A CA  
1158 C C   . ILE A 168 ? 0.8888 0.8103 1.0044 -0.0337 -0.0066 0.0963  663 ILE A C   
1159 O O   . ILE A 168 ? 0.8867 0.8048 1.0048 -0.0322 -0.0065 0.0943  663 ILE A O   
1160 C CB  . ILE A 168 ? 0.8477 0.7830 0.9851 -0.0322 -0.0022 0.1165  663 ILE A CB  
1161 C CG1 . ILE A 168 ? 0.8610 0.7964 1.0228 -0.0314 0.0021  0.1266  663 ILE A CG1 
1162 C CG2 . ILE A 168 ? 0.8411 0.7835 0.9784 -0.0301 -0.0019 0.1223  663 ILE A CG2 
1163 C CD1 . ILE A 168 ? 1.0852 1.0084 1.2705 -0.0319 0.0032  0.1241  663 ILE A CD1 
1164 N N   . ASP A 169 ? 0.8689 0.7938 0.9720 -0.0351 -0.0069 0.0943  664 ASP A N   
1165 C CA  . ASP A 169 ? 0.8773 0.8012 0.9736 -0.0365 -0.0069 0.0902  664 ASP A CA  
1166 C C   . ASP A 169 ? 0.9243 0.8426 1.0133 -0.0371 -0.0055 0.0847  664 ASP A C   
1167 O O   . ASP A 169 ? 0.9170 0.8349 1.0030 -0.0360 -0.0052 0.0839  664 ASP A O   
1168 C CB  . ASP A 169 ? 0.9117 0.8489 1.0087 -0.0383 -0.0086 0.0926  664 ASP A CB  
1169 C CG  . ASP A 169 ? 1.1064 1.0546 1.1975 -0.0376 -0.0095 0.0928  664 ASP A CG  
1170 O OD1 . ASP A 169 ? 1.1029 1.0579 1.1981 -0.0344 -0.0081 0.1020  664 ASP A OD1 
1171 O OD2 . ASP A 169 ? 1.2514 1.2003 1.3361 -0.0394 -0.0102 0.0838  664 ASP A OD2 
1172 N N   . PHE A 170 ? 0.8886 0.8029 0.9785 -0.0384 -0.0034 0.0823  665 PHE A N   
1173 C CA  . PHE A 170 ? 0.8906 0.7970 0.9798 -0.0382 0.0004  0.0792  665 PHE A CA  
1174 C C   . PHE A 170 ? 0.9477 0.8555 1.0426 -0.0434 0.0003  0.0716  665 PHE A C   
1175 O O   . PHE A 170 ? 0.9570 0.8552 1.0586 -0.0439 0.0050  0.0686  665 PHE A O   
1176 C CB  . PHE A 170 ? 0.9147 0.8153 1.0061 -0.0339 0.0055  0.0843  665 PHE A CB  
1177 C CG  . PHE A 170 ? 0.9436 0.8478 1.0293 -0.0280 0.0041  0.0869  665 PHE A CG  
1178 C CD1 . PHE A 170 ? 0.9975 0.9043 1.0797 -0.0264 -0.0001 0.0839  665 PHE A CD1 
1179 C CD2 . PHE A 170 ? 0.9870 0.8938 1.0735 -0.0234 0.0073  0.0910  665 PHE A CD2 
1180 C CE1 . PHE A 170 ? 1.0153 0.9261 1.0966 -0.0217 -0.0027 0.0810  665 PHE A CE1 
1181 C CE2 . PHE A 170 ? 1.0344 0.9468 1.1149 -0.0165 0.0053  0.0888  665 PHE A CE2 
1182 C CZ  . PHE A 170 ? 1.0087 0.9225 1.0875 -0.0163 -0.0004 0.0819  665 PHE A CZ  
1183 N N   . GLY A 171 ? 0.8951 0.8162 0.9893 -0.0462 -0.0049 0.0682  666 GLY A N   
1184 C CA  . GLY A 171 ? 0.8994 0.8290 0.9991 -0.0509 -0.0079 0.0564  666 GLY A CA  
1185 C C   . GLY A 171 ? 0.9449 0.8687 1.0628 -0.0566 -0.0057 0.0519  666 GLY A C   
1186 O O   . GLY A 171 ? 0.9556 0.8784 1.0842 -0.0612 -0.0062 0.0384  666 GLY A O   
1187 N N   . ILE A 172 ? 0.8824 0.8025 1.0068 -0.0560 -0.0025 0.0627  667 ILE A N   
1188 C CA  . ILE A 172 ? 0.8693 0.7863 1.0148 -0.0605 0.0017  0.0642  667 ILE A CA  
1189 C C   . ILE A 172 ? 0.9951 0.9314 1.1491 -0.0652 -0.0051 0.0606  667 ILE A C   
1190 O O   . ILE A 172 ? 1.0242 0.9657 1.1989 -0.0728 -0.0068 0.0509  667 ILE A O   
1191 C CB  . ILE A 172 ? 0.8724 0.7805 1.0193 -0.0544 0.0103  0.0795  667 ILE A CB  
1192 C CG1 . ILE A 172 ? 0.8467 0.7419 0.9858 -0.0477 0.0168  0.0847  667 ILE A CG1 
1193 C CG2 . ILE A 172 ? 0.8765 0.7858 1.0489 -0.0585 0.0162  0.0843  667 ILE A CG2 
1194 C CD1 . ILE A 172 ? 0.7136 0.6090 0.8470 -0.0378 0.0236  0.0991  667 ILE A CD1 
1195 N N   . ALA A 173 ? 0.9645 0.9119 1.1068 -0.0606 -0.0086 0.0688  668 ALA A N   
1196 C CA  . ALA A 173 ? 0.9686 0.9376 1.1181 -0.0625 -0.0146 0.0690  668 ALA A CA  
1197 C C   . ALA A 173 ? 1.0657 1.0548 1.2127 -0.0655 -0.0236 0.0550  668 ALA A C   
1198 O O   . ALA A 173 ? 1.0746 1.0633 1.2058 -0.0621 -0.0249 0.0512  668 ALA A O   
1199 C CB  . ALA A 173 ? 0.9680 0.9413 1.1074 -0.0550 -0.0143 0.0820  668 ALA A CB  
1200 N N   . ASN A 174 ? 1.0360 1.0456 1.1994 -0.0711 -0.0298 0.0464  669 ASN A N   
1201 C CA  . ASN A 174 ? 1.4945 1.5314 1.6578 -0.0734 -0.0403 0.0287  669 ASN A CA  
1202 C C   . ASN A 174 ? 1.8214 1.8821 1.9605 -0.0635 -0.0454 0.0342  669 ASN A C   
1203 O O   . ASN A 174 ? 1.2885 1.3445 1.4166 -0.0561 -0.0408 0.0534  669 ASN A O   
1204 C CB  . ASN A 174 ? 1.4844 1.5437 1.6735 -0.0809 -0.0470 0.0198  669 ASN A CB  
1205 C CG  . ASN A 174 ? 1.6704 1.7128 1.8914 -0.0924 -0.0431 0.0083  669 ASN A CG  
1206 O OD1 . ASN A 174 ? 1.5676 1.5788 1.7929 -0.0933 -0.0325 0.0140  669 ASN A OD1 
1207 N ND2 . ASN A 174 ? 1.5717 1.6366 1.8194 -0.1009 -0.0511 -0.0070 669 ASN A ND2 
1208 N N   . GLN A 188 ? 1.4468 1.6229 1.5014 0.0341  0.0074  0.1913  683 GLN A N   
1209 C CA  . GLN A 188 ? 1.4538 1.6473 1.4826 0.0374  0.0025  0.1696  683 GLN A CA  
1210 C C   . GLN A 188 ? 1.4988 1.6709 1.5203 0.0241  -0.0089 0.1347  683 GLN A C   
1211 O O   . GLN A 188 ? 1.4796 1.6117 1.5135 0.0117  -0.0088 0.1274  683 GLN A O   
1212 C CB  . GLN A 188 ? 1.4693 1.6535 1.4993 0.0398  0.0118  0.1759  683 GLN A CB  
1213 N N   . VAL A 189 ? 1.4623 1.6641 1.4665 0.0276  -0.0184 0.1136  684 VAL A N   
1214 C CA  . VAL A 189 ? 1.4508 1.6378 1.4542 0.0156  -0.0286 0.0801  684 VAL A CA  
1215 C C   . VAL A 189 ? 1.4840 1.7074 1.4680 0.0227  -0.0367 0.0539  684 VAL A C   
1216 O O   . VAL A 189 ? 1.4789 1.7500 1.4475 0.0379  -0.0381 0.0620  684 VAL A O   
1217 C CB  . VAL A 189 ? 1.4906 1.6682 1.5096 0.0061  -0.0348 0.0788  684 VAL A CB  
1218 N N   . GLY A 190 ? 1.4277 1.6294 1.4144 0.0128  -0.0412 0.0229  685 GLY A N   
1219 C CA  . GLY A 190 ? 1.4387 1.6663 1.4127 0.0170  -0.0490 -0.0102 685 GLY A CA  
1220 C C   . GLY A 190 ? 1.4732 1.6958 1.4339 0.0246  -0.0414 -0.0168 685 GLY A C   
1221 O O   . GLY A 190 ? 1.4907 1.7086 1.4505 0.0222  -0.0451 -0.0494 685 GLY A O   
1222 N N   . THR A 191 ? 1.3799 1.6019 1.3345 0.0336  -0.0298 0.0145  686 THR A N   
1223 C CA  . THR A 191 ? 1.3579 1.5794 1.3014 0.0430  -0.0203 0.0167  686 THR A CA  
1224 C C   . THR A 191 ? 1.3722 1.5571 1.3221 0.0346  -0.0192 -0.0102 686 THR A C   
1225 O O   . THR A 191 ? 1.3587 1.5001 1.3275 0.0213  -0.0170 -0.0083 686 THR A O   
1226 C CB  . THR A 191 ? 1.3376 1.5595 1.2853 0.0498  -0.0079 0.0575  686 THR A CB  
1227 O OG1 . THR A 191 ? 1.3069 1.5543 1.2388 0.0656  0.0005  0.0636  686 THR A OG1 
1228 C CG2 . THR A 191 ? 1.2484 1.4204 1.2192 0.0357  -0.0028 0.0701  686 THR A CG2 
1229 N N   . VAL A 192 ? 1.3030 1.5086 1.2375 0.0443  -0.0203 -0.0357 687 VAL A N   
1230 C CA  . VAL A 192 ? 1.2803 1.4548 1.2226 0.0393  -0.0177 -0.0624 687 VAL A CA  
1231 C C   . VAL A 192 ? 1.2774 1.4378 1.2164 0.0468  -0.0043 -0.0457 687 VAL A C   
1232 O O   . VAL A 192 ? 1.2801 1.4127 1.2274 0.0441  -0.0001 -0.0624 687 VAL A O   
1233 C CB  . VAL A 192 ? 1.3470 1.5449 1.2817 0.0436  -0.0267 -0.1061 687 VAL A CB  
1234 C CG1 . VAL A 192 ? 1.3404 1.5417 1.2900 0.0310  -0.0402 -0.1255 687 VAL A CG1 
1235 C CG2 . VAL A 192 ? 1.3661 1.6213 1.2692 0.0654  -0.0268 -0.1081 687 VAL A CG2 
1236 N N   . ASN A 193 ? 1.1834 1.3628 1.1150 0.0558  0.0031  -0.0114 688 ASN A N   
1237 C CA  . ASN A 193 ? 1.1603 1.3344 1.0923 0.0634  0.0158  0.0087  688 ASN A CA  
1238 C C   . ASN A 193 ? 1.1571 1.2833 1.1110 0.0509  0.0203  0.0154  688 ASN A C   
1239 O O   . ASN A 193 ? 1.1506 1.2707 1.1064 0.0566  0.0294  0.0225  688 ASN A O   
1240 C CB  . ASN A 193 ? 1.1473 1.3517 1.0762 0.0734  0.0228  0.0463  688 ASN A CB  
1241 C CG  . ASN A 193 ? 1.3772 1.6379 1.2810 0.0925  0.0226  0.0462  688 ASN A CG  
1242 O OD1 . ASN A 193 ? 1.2846 1.5707 1.1711 0.1080  0.0287  0.0394  688 ASN A OD1 
1243 N ND2 . ASN A 193 ? 1.2778 1.5623 1.1783 0.0934  0.0159  0.0545  688 ASN A ND2 
1244 N N   . TYR A 194 ? 1.0709 1.1675 1.0408 0.0355  0.0141  0.0144  689 TYR A N   
1245 C CA  . TYR A 194 ? 1.0355 1.0921 1.0246 0.0247  0.0169  0.0216  689 TYR A CA  
1246 C C   . TYR A 194 ? 1.0868 1.1139 1.0863 0.0160  0.0137  -0.0032 689 TYR A C   
1247 O O   . TYR A 194 ? 1.0606 1.0577 1.0750 0.0089  0.0162  0.0031  689 TYR A O   
1248 C CB  . TYR A 194 ? 1.0129 1.0619 1.0138 0.0165  0.0145  0.0445  689 TYR A CB  
1249 C CG  . TYR A 194 ? 1.0107 1.0834 1.0117 0.0237  0.0196  0.0716  689 TYR A CG  
1250 C CD1 . TYR A 194 ? 1.0417 1.1474 1.0329 0.0309  0.0180  0.0798  689 TYR A CD1 
1251 C CD2 . TYR A 194 ? 1.0054 1.0690 1.0206 0.0232  0.0264  0.0905  689 TYR A CD2 
1252 C CE1 . TYR A 194 ? 1.0455 1.1728 1.0423 0.0386  0.0254  0.1090  689 TYR A CE1 
1253 C CE2 . TYR A 194 ? 1.0120 1.0958 1.0360 0.0287  0.0326  0.1166  689 TYR A CE2 
1254 C CZ  . TYR A 194 ? 1.1226 1.2367 1.1382 0.0366  0.0332  0.1273  689 TYR A CZ  
1255 O OH  . TYR A 194 ? 1.1731 1.3070 1.2023 0.0431  0.0419  0.1571  689 TYR A OH  
1256 N N   . MET A 195 ? 1.0712 1.1094 1.0652 0.0174  0.0086  -0.0310 690 MET A N   
1257 C CA  . MET A 195 ? 1.0828 1.0959 1.0936 0.0086  0.0061  -0.0564 690 MET A CA  
1258 C C   . MET A 195 ? 1.1419 1.1301 1.1625 0.0122  0.0154  -0.0663 690 MET A C   
1259 O O   . MET A 195 ? 1.1455 1.1493 1.1533 0.0240  0.0196  -0.0757 690 MET A O   
1260 C CB  . MET A 195 ? 1.1385 1.1774 1.1437 0.0092  -0.0034 -0.0860 690 MET A CB  
1261 C CG  . MET A 195 ? 1.1982 1.2165 1.2285 -0.0046 -0.0090 -0.1059 690 MET A CG  
1262 S SD  . MET A 195 ? 1.2786 1.3375 1.3038 -0.0050 -0.0240 -0.1387 690 MET A SD  
1263 C CE  . MET A 195 ? 1.2111 1.2859 1.2325 -0.0104 -0.0306 -0.1093 690 MET A CE  
1264 N N   . PRO A 196 ? 1.1056 1.0575 1.1494 0.0039  0.0197  -0.0634 691 PRO A N   
1265 C CA  . PRO A 196 ? 1.1179 1.0461 1.1749 0.0089  0.0300  -0.0707 691 PRO A CA  
1266 C C   . PRO A 196 ? 1.1975 1.1213 1.2662 0.0095  0.0300  -0.1075 691 PRO A C   
1267 O O   . PRO A 196 ? 1.2070 1.1354 1.2845 0.0008  0.0215  -0.1264 691 PRO A O   
1268 C CB  . PRO A 196 ? 1.1269 1.0242 1.2052 0.0014  0.0345  -0.0527 691 PRO A CB  
1269 C CG  . PRO A 196 ? 1.1762 1.0761 1.2587 -0.0097 0.0261  -0.0504 691 PRO A CG  
1270 C CD  . PRO A 196 ? 1.1151 1.0489 1.1744 -0.0080 0.0169  -0.0512 691 PRO A CD  
1271 N N   . PRO A 197 ? 1.1680 1.0832 1.2401 0.0195  0.0391  -0.1201 692 PRO A N   
1272 C CA  . PRO A 197 ? 1.2020 1.1125 1.2886 0.0204  0.0388  -0.1603 692 PRO A CA  
1273 C C   . PRO A 197 ? 1.2802 1.1621 1.4050 0.0059  0.0377  -0.1756 692 PRO A C   
1274 O O   . PRO A 197 ? 1.2955 1.1869 1.4300 0.0010  0.0297  -0.2103 692 PRO A O   
1275 C CB  . PRO A 197 ? 1.2397 1.1375 1.3294 0.0336  0.0521  -0.1628 692 PRO A CB  
1276 C CG  . PRO A 197 ? 1.2720 1.1869 1.3369 0.0423  0.0555  -0.1288 692 PRO A CG  
1277 C CD  . PRO A 197 ? 1.1804 1.0927 1.2454 0.0310  0.0496  -0.1002 692 PRO A CD  
1278 N N   . GLU A 198 ? 1.2403 1.0915 1.3875 -0.0004 0.0454  -0.1495 693 GLU A N   
1279 C CA  . GLU A 198 ? 1.2503 1.0736 1.4383 -0.0132 0.0479  -0.1549 693 GLU A CA  
1280 C C   . GLU A 198 ? 1.3124 1.1525 1.5026 -0.0264 0.0341  -0.1639 693 GLU A C   
1281 O O   . GLU A 198 ? 1.3321 1.1603 1.5575 -0.0370 0.0326  -0.1866 693 GLU A O   
1282 C CB  . GLU A 198 ? 1.2503 1.0452 1.4563 -0.0126 0.0605  -0.1193 693 GLU A CB  
1283 C CG  . GLU A 198 ? 1.2863 1.0947 1.4659 -0.0119 0.0567  -0.0841 693 GLU A CG  
1284 C CD  . GLU A 198 ? 1.2947 1.1116 1.4501 0.0007  0.0612  -0.0636 693 GLU A CD  
1285 O OE1 . GLU A 198 ? 0.9653 0.7924 1.1081 0.0098  0.0628  -0.0774 693 GLU A OE1 
1286 O OE2 . GLU A 198 ? 1.1973 1.0132 1.3475 0.0019  0.0629  -0.0345 693 GLU A OE2 
1287 N N   . ALA A 199 ? 1.2467 1.1149 1.4034 -0.0256 0.0248  -0.1461 694 ALA A N   
1288 C CA  . ALA A 199 ? 1.2422 1.1321 1.3960 -0.0351 0.0118  -0.1510 694 ALA A CA  
1289 C C   . ALA A 199 ? 1.3418 1.2606 1.4908 -0.0343 0.0006  -0.1914 694 ALA A C   
1290 O O   . ALA A 199 ? 1.3459 1.2738 1.5139 -0.0449 -0.0088 -0.2108 694 ALA A O   
1291 C CB  . ALA A 199 ? 1.2230 1.1347 1.3438 -0.0313 0.0071  -0.1212 694 ALA A CB  
1292 N N   . ILE A 200 ? 1.3268 1.2623 1.4522 -0.0208 0.0018  -0.2050 695 ILE A N   
1293 C CA  . ILE A 200 ? 1.3587 1.3275 1.4733 -0.0154 -0.0082 -0.2449 695 ILE A CA  
1294 C C   . ILE A 200 ? 1.4683 1.4148 1.6237 -0.0223 -0.0069 -0.2868 695 ILE A C   
1295 O O   . ILE A 200 ? 1.4842 1.4535 1.6498 -0.0278 -0.0198 -0.3227 695 ILE A O   
1296 C CB  . ILE A 200 ? 1.4007 1.3994 1.4739 0.0039  -0.0057 -0.2408 695 ILE A CB  
1297 C CG1 . ILE A 200 ? 1.3697 1.3914 1.4123 0.0083  -0.0073 -0.2001 695 ILE A CG1 
1298 C CG2 . ILE A 200 ? 1.4431 1.4827 1.5012 0.0130  -0.0158 -0.2837 695 ILE A CG2 
1299 C CD1 . ILE A 200 ? 1.4096 1.4429 1.4258 0.0235  0.0015  -0.1790 695 ILE A CD1 
1300 N N   . LYS A 201 ? 1.4544 1.3573 1.6374 -0.0221 0.0086  -0.2816 696 LYS A N   
1301 C CA  . LYS A 201 ? 1.4958 1.3690 1.7263 -0.0279 0.0143  -0.3170 696 LYS A CA  
1302 C C   . LYS A 201 ? 1.5767 1.4378 1.8556 -0.0475 0.0082  -0.3341 696 LYS A C   
1303 O O   . LYS A 201 ? 1.6119 1.4465 1.9393 -0.0543 0.0135  -0.3638 696 LYS A O   
1304 C CB  . LYS A 201 ? 1.5296 1.3600 1.7793 -0.0211 0.0345  -0.2977 696 LYS A CB  
1305 N N   . ASP A 202 ? 1.5069 1.3892 1.7756 -0.0563 -0.0027 -0.3169 697 ASP A N   
1306 C CA  . ASP A 202 ? 1.7098 1.5882 2.0211 -0.0744 -0.0093 -0.3284 697 ASP A CA  
1307 C C   . ASP A 202 ? 1.7425 1.6727 2.0351 -0.0773 -0.0310 -0.3549 697 ASP A C   
1308 O O   . ASP A 202 ? 1.1733 1.1299 1.4612 -0.0730 -0.0413 -0.3990 697 ASP A O   
1309 C CB  . ASP A 202 ? 1.6979 1.5543 2.0194 -0.0813 -0.0007 -0.2806 697 ASP A CB  
1310 C CG  . ASP A 202 ? 1.8039 1.6136 2.1513 -0.0786 0.0204  -0.2537 697 ASP A CG  
1311 O OD1 . ASP A 202 ? 1.8426 1.6276 2.2203 -0.0767 0.0299  -0.2755 697 ASP A OD1 
1312 O OD2 . ASP A 202 ? 1.8294 1.6286 2.1691 -0.0778 0.0277  -0.2116 697 ASP A OD2 
1313 N N   . ILE A 216 ? 1.1445 0.9001 1.4196 -0.0384 0.0715  -0.0446 711 ILE A N   
1314 C CA  . ILE A 216 ? 1.1200 0.8978 1.3563 -0.0358 0.0629  -0.0235 711 ILE A CA  
1315 C C   . ILE A 216 ? 1.1307 0.9026 1.3668 -0.0284 0.0722  0.0126  711 ILE A C   
1316 O O   . ILE A 216 ? 1.1380 0.9047 1.3929 -0.0322 0.0768  0.0269  711 ILE A O   
1317 C CB  . ILE A 216 ? 1.1514 0.9521 1.3727 -0.0458 0.0475  -0.0352 711 ILE A CB  
1318 C CG1 . ILE A 216 ? 1.1817 0.9992 1.3918 -0.0474 0.0373  -0.0686 711 ILE A CG1 
1319 C CG2 . ILE A 216 ? 1.1176 0.9366 1.3053 -0.0424 0.0410  -0.0127 711 ILE A CG2 
1320 C CD1 . ILE A 216 ? 1.3618 1.1752 1.6071 -0.0585 0.0339  -0.1012 711 ILE A CD1 
1321 N N   . SER A 217 ? 1.0234 0.8004 1.2383 -0.0168 0.0747  0.0262  712 SER A N   
1322 C CA  . SER A 217 ? 0.9850 0.7640 1.1944 -0.0061 0.0818  0.0562  712 SER A CA  
1323 C C   . SER A 217 ? 0.9764 0.7788 1.1487 -0.0028 0.0706  0.0620  712 SER A C   
1324 O O   . SER A 217 ? 0.9870 0.7997 1.1428 -0.0066 0.0616  0.0454  712 SER A O   
1325 C CB  . SER A 217 ? 1.0342 0.7986 1.2602 0.0055  0.0955  0.0629  712 SER A CB  
1326 O OG  . SER A 217 ? 1.0873 0.8580 1.2959 0.0097  0.0917  0.0486  712 SER A OG  
1327 N N   . PRO A 218 ? 0.8598 0.6732 1.0207 0.0057  0.0714  0.0843  713 PRO A N   
1328 C CA  . PRO A 218 ? 0.8227 0.6571 0.9563 0.0076  0.0608  0.0864  713 PRO A CA  
1329 C C   . PRO A 218 ? 0.8758 0.7155 1.0000 0.0099  0.0587  0.0756  713 PRO A C   
1330 O O   . PRO A 218 ? 0.8707 0.7266 0.9778 0.0074  0.0496  0.0728  713 PRO A O   
1331 C CB  . PRO A 218 ? 0.8404 0.6846 0.9714 0.0192  0.0647  0.1083  713 PRO A CB  
1332 C CG  . PRO A 218 ? 0.9139 0.7484 1.0621 0.0205  0.0735  0.1199  713 PRO A CG  
1333 C CD  . PRO A 218 ? 0.8763 0.6872 1.0501 0.0147  0.0818  0.1082  713 PRO A CD  
1334 N N   . LYS A 219 ? 0.8362 0.6625 0.9743 0.0153  0.0683  0.0699  714 LYS A N   
1335 C CA  . LYS A 219 ? 0.8339 0.6656 0.9642 0.0196  0.0686  0.0588  714 LYS A CA  
1336 C C   . LYS A 219 ? 0.9217 0.7635 1.0381 0.0114  0.0592  0.0393  714 LYS A C   
1337 O O   . LYS A 219 ? 0.9420 0.7996 1.0439 0.0151  0.0565  0.0367  714 LYS A O   
1338 C CB  . LYS A 219 ? 0.8688 0.6811 1.0202 0.0271  0.0817  0.0528  714 LYS A CB  
1339 C CG  . LYS A 219 ? 0.9728 0.7801 1.1379 0.0396  0.0930  0.0762  714 LYS A CG  
1340 C CD  . LYS A 219 ? 1.0697 0.8979 1.2201 0.0498  0.0913  0.0884  714 LYS A CD  
1341 C CE  . LYS A 219 ? 1.2310 1.0610 1.3936 0.0635  0.1008  0.1128  714 LYS A CE  
1342 N NZ  . LYS A 219 ? 1.3662 1.1806 1.5489 0.0749  0.1156  0.1131  714 LYS A NZ  
1343 N N   . SER A 220 ? 0.8780 0.7149 0.9997 0.0013  0.0546  0.0281  715 SER A N   
1344 C CA  . SER A 220 ? 0.8731 0.7249 0.9818 -0.0053 0.0450  0.0114  715 SER A CA  
1345 C C   . SER A 220 ? 0.9146 0.7879 1.0026 -0.0057 0.0370  0.0246  715 SER A C   
1346 O O   . SER A 220 ? 0.9275 0.8191 1.0012 -0.0035 0.0333  0.0192  715 SER A O   
1347 C CB  . SER A 220 ? 0.9105 0.7551 1.0333 -0.0158 0.0414  0.0008  715 SER A CB  
1348 O OG  . SER A 220 ? 1.0315 0.8527 1.1833 -0.0168 0.0506  -0.0065 715 SER A OG  
1349 N N   . ASP A 221 ? 0.8381 0.7103 0.9267 -0.0070 0.0354  0.0421  716 ASP A N   
1350 C CA  . ASP A 221 ? 0.8039 0.6925 0.8809 -0.0081 0.0286  0.0531  716 ASP A CA  
1351 C C   . ASP A 221 ? 0.8650 0.7646 0.9375 -0.0011 0.0306  0.0602  716 ASP A C   
1352 O O   . ASP A 221 ? 0.8676 0.7829 0.9344 -0.0023 0.0264  0.0651  716 ASP A O   
1353 C CB  . ASP A 221 ? 0.8014 0.6867 0.8817 -0.0107 0.0261  0.0646  716 ASP A CB  
1354 C CG  . ASP A 221 ? 0.8145 0.6953 0.8985 -0.0183 0.0230  0.0599  716 ASP A CG  
1355 O OD1 . ASP A 221 ? 0.8255 0.7132 0.9061 -0.0230 0.0188  0.0493  716 ASP A OD1 
1356 O OD2 . ASP A 221 ? 0.7611 0.6350 0.8514 -0.0184 0.0250  0.0675  716 ASP A OD2 
1357 N N   . VAL A 222 ? 0.8251 0.7176 0.9038 0.0065  0.0381  0.0621  717 VAL A N   
1358 C CA  . VAL A 222 ? 0.8189 0.7237 0.8962 0.0142  0.0410  0.0688  717 VAL A CA  
1359 C C   . VAL A 222 ? 0.8788 0.7949 0.9474 0.0165  0.0424  0.0590  717 VAL A C   
1360 O O   . VAL A 222 ? 0.8722 0.8065 0.9376 0.0189  0.0417  0.0672  717 VAL A O   
1361 C CB  . VAL A 222 ? 0.8702 0.7670 0.9573 0.0238  0.0494  0.0752  717 VAL A CB  
1362 C CG1 . VAL A 222 ? 0.8667 0.7797 0.9540 0.0317  0.0522  0.0819  717 VAL A CG1 
1363 C CG2 . VAL A 222 ? 0.8589 0.7528 0.9518 0.0248  0.0483  0.0877  717 VAL A CG2 
1364 N N   . TRP A 223 ? 0.8517 0.7601 0.9180 0.0162  0.0443  0.0413  718 TRP A N   
1365 C CA  . TRP A 223 ? 0.8715 0.7968 0.9257 0.0209  0.0450  0.0295  718 TRP A CA  
1366 C C   . TRP A 223 ? 0.9099 0.8583 0.9531 0.0179  0.0385  0.0379  718 TRP A C   
1367 O O   . TRP A 223 ? 0.8827 0.8525 0.9190 0.0248  0.0414  0.0454  718 TRP A O   
1368 C CB  . TRP A 223 ? 0.8825 0.7991 0.9379 0.0198  0.0451  0.0038  718 TRP A CB  
1369 C CG  . TRP A 223 ? 0.9139 0.8552 0.9527 0.0267  0.0441  -0.0105 718 TRP A CG  
1370 C CD1 . TRP A 223 ? 0.9525 0.9190 0.9766 0.0254  0.0369  -0.0111 718 TRP A CD1 
1371 C CD2 . TRP A 223 ? 0.9418 0.8902 0.9753 0.0388  0.0516  -0.0229 718 TRP A CD2 
1372 N NE1 . TRP A 223 ? 0.9666 0.9584 0.9748 0.0368  0.0392  -0.0226 718 TRP A NE1 
1373 C CE2 . TRP A 223 ? 1.0003 0.9810 1.0133 0.0450  0.0481  -0.0316 718 TRP A CE2 
1374 C CE3 . TRP A 223 ? 0.9710 0.9032 1.0153 0.0468  0.0618  -0.0267 718 TRP A CE3 
1375 C CZ2 . TRP A 223 ? 1.0110 1.0094 1.0119 0.0591  0.0540  -0.0467 718 TRP A CZ2 
1376 C CZ3 . TRP A 223 ? 1.0114 0.9573 1.0463 0.0596  0.0678  -0.0424 718 TRP A CZ3 
1377 C CH2 . TRP A 223 ? 1.0271 1.0065 1.0394 0.0658  0.0638  -0.0530 718 TRP A CH2 
1378 N N   . SER A 224 ? 0.8738 0.8185 0.9181 0.0087  0.0313  0.0383  719 SER A N   
1379 C CA  . SER A 224 ? 0.8665 0.8295 0.9048 0.0056  0.0258  0.0473  719 SER A CA  
1380 C C   . SER A 224 ? 0.9027 0.8745 0.9479 0.0063  0.0271  0.0686  719 SER A C   
1381 O O   . SER A 224 ? 0.8947 0.8883 0.9369 0.0108  0.0292  0.0784  719 SER A O   
1382 C CB  . SER A 224 ? 0.9111 0.8645 0.9532 -0.0038 0.0191  0.0437  719 SER A CB  
1383 O OG  . SER A 224 ? 1.0854 1.0334 1.1272 -0.0057 0.0176  0.0230  719 SER A OG  
1384 N N   . LEU A 225 ? 0.8342 0.7919 0.8910 0.0030  0.0265  0.0753  720 LEU A N   
1385 C CA  . LEU A 225 ? 0.8090 0.7743 0.8786 0.0020  0.0260  0.0902  720 LEU A CA  
1386 C C   . LEU A 225 ? 0.8820 0.8640 0.9547 0.0097  0.0326  0.0979  720 LEU A C   
1387 O O   . LEU A 225 ? 0.8875 0.8839 0.9724 0.0089  0.0337  0.1114  720 LEU A O   
1388 C CB  . LEU A 225 ? 0.7950 0.7477 0.8731 -0.0002 0.0232  0.0911  720 LEU A CB  
1389 C CG  . LEU A 225 ? 0.8398 0.7836 0.9200 -0.0071 0.0167  0.0900  720 LEU A CG  
1390 C CD1 . LEU A 225 ? 0.8367 0.7720 0.9190 -0.0049 0.0160  0.0894  720 LEU A CD1 
1391 C CD2 . LEU A 225 ? 0.8746 0.8276 0.9676 -0.0118 0.0125  0.0973  720 LEU A CD2 
1392 N N   . GLY A 226 ? 0.8544 0.8345 0.9195 0.0174  0.0383  0.0899  721 GLY A N   
1393 C CA  . GLY A 226 ? 0.8701 0.8673 0.9360 0.0270  0.0461  0.0961  721 GLY A CA  
1394 C C   . GLY A 226 ? 0.9602 0.9806 1.0170 0.0317  0.0493  0.1009  721 GLY A C   
1395 O O   . GLY A 226 ? 0.9680 1.0079 1.0351 0.0355  0.0545  0.1177  721 GLY A O   
1396 N N   . CYS A 227 ? 0.9255 0.9474 0.9654 0.0320  0.0462  0.0878  722 CYS A N   
1397 C CA  . CYS A 227 ? 0.9284 0.9785 0.9563 0.0388  0.0482  0.0930  722 CYS A CA  
1398 C C   . CYS A 227 ? 0.9611 1.0217 1.0055 0.0344  0.0484  0.1175  722 CYS A C   
1399 O O   . CYS A 227 ? 0.9625 1.0495 1.0091 0.0429  0.0559  0.1347  722 CYS A O   
1400 C CB  . CYS A 227 ? 0.9397 0.9907 0.9510 0.0375  0.0415  0.0735  722 CYS A CB  
1401 S SG  . CYS A 227 ? 1.0107 1.0551 1.0084 0.0439  0.0425  0.0410  722 CYS A SG  
1402 N N   . ILE A 228 ? 0.8904 0.9309 0.9485 0.0222  0.0413  0.1193  723 ILE A N   
1403 C CA  . ILE A 228 ? 0.8690 0.9131 0.9488 0.0165  0.0411  0.1383  723 ILE A CA  
1404 C C   . ILE A 228 ? 0.9324 0.9865 1.0352 0.0185  0.0481  0.1546  723 ILE A C   
1405 O O   . ILE A 228 ? 0.9444 1.0177 1.0621 0.0221  0.0552  0.1749  723 ILE A O   
1406 C CB  . ILE A 228 ? 0.8849 0.9053 0.9742 0.0044  0.0322  0.1322  723 ILE A CB  
1407 C CG1 . ILE A 228 ? 0.8900 0.9053 0.9614 0.0026  0.0266  0.1200  723 ILE A CG1 
1408 C CG2 . ILE A 228 ? 0.8787 0.9009 0.9962 -0.0011 0.0328  0.1487  723 ILE A CG2 
1409 C CD1 . ILE A 228 ? 0.9572 0.9483 1.0317 -0.0068 0.0191  0.1098  723 ILE A CD1 
1410 N N   . LEU A 229 ? 0.8750 0.9188 0.9829 0.0173  0.0472  0.1474  724 LEU A N   
1411 C CA  . LEU A 229 ? 0.8673 0.9228 0.9996 0.0188  0.0527  0.1606  724 LEU A CA  
1412 C C   . LEU A 229 ? 0.9274 1.0098 1.0549 0.0317  0.0648  0.1739  724 LEU A C   
1413 O O   . LEU A 229 ? 0.9168 1.0164 1.0698 0.0326  0.0719  0.1949  724 LEU A O   
1414 C CB  . LEU A 229 ? 0.8622 0.9058 0.9972 0.0174  0.0487  0.1499  724 LEU A CB  
1415 C CG  . LEU A 229 ? 0.9123 0.9673 1.0780 0.0155  0.0499  0.1600  724 LEU A CG  
1416 C CD1 . LEU A 229 ? 0.8997 0.9543 1.0971 0.0038  0.0442  0.1658  724 LEU A CD1 
1417 C CD2 . LEU A 229 ? 0.9462 0.9932 1.1084 0.0171  0.0454  0.1495  724 LEU A CD2 
1418 N N   . TYR A 230 ? 0.9004 0.9876 0.9973 0.0421  0.0675  0.1612  725 TYR A N   
1419 C CA  . TYR A 230 ? 0.9169 1.0329 1.0003 0.0577  0.0786  0.1685  725 TYR A CA  
1420 C C   . TYR A 230 ? 0.9722 1.1141 1.0607 0.0623  0.0844  0.1911  725 TYR A C   
1421 O O   . TYR A 230 ? 0.9702 1.1403 1.0675 0.0731  0.0965  0.2121  725 TYR A O   
1422 C CB  . TYR A 230 ? 0.9555 1.0681 1.0051 0.0656  0.0766  0.1427  725 TYR A CB  
1423 C CG  . TYR A 230 ? 1.0214 1.1618 1.0548 0.0835  0.0875  0.1424  725 TYR A CG  
1424 C CD1 . TYR A 230 ? 1.0668 1.2423 1.0852 0.0959  0.0932  0.1524  725 TYR A CD1 
1425 C CD2 . TYR A 230 ? 1.0515 1.1860 1.0837 0.0904  0.0928  0.1326  725 TYR A CD2 
1426 C CE1 . TYR A 230 ? 1.1122 1.3183 1.1137 0.1150  0.1039  0.1524  725 TYR A CE1 
1427 C CE2 . TYR A 230 ? 1.0940 1.2549 1.1107 0.1086  0.1035  0.1306  725 TYR A CE2 
1428 C CZ  . TYR A 230 ? 1.2431 1.4408 1.2433 0.1211  0.1089  0.1397  725 TYR A CZ  
1429 O OH  . TYR A 230 ? 1.3407 1.5694 1.3234 0.1414  0.1202  0.1380  725 TYR A OH  
1430 N N   . TYR A 231 ? 0.9245 1.0585 1.0101 0.0552  0.0771  0.1894  726 TYR A N   
1431 C CA  . TYR A 231 ? 0.9258 1.0824 1.0193 0.0599  0.0828  0.2129  726 TYR A CA  
1432 C C   . TYR A 231 ? 0.9385 1.0943 1.0774 0.0530  0.0894  0.2391  726 TYR A C   
1433 O O   . TYR A 231 ? 0.9560 1.1389 1.1099 0.0623  0.1019  0.2670  726 TYR A O   
1434 C CB  . TYR A 231 ? 0.9566 1.1037 1.0368 0.0542  0.0728  0.2028  726 TYR A CB  
1435 C CG  . TYR A 231 ? 1.0154 1.1875 1.1017 0.0611  0.0784  0.2276  726 TYR A CG  
1436 C CD1 . TYR A 231 ? 1.0632 1.2769 1.1404 0.0796  0.0905  0.2482  726 TYR A CD1 
1437 C CD2 . TYR A 231 ? 1.0242 1.1816 1.1229 0.0518  0.0724  0.2308  726 TYR A CD2 
1438 C CE1 . TYR A 231 ? 1.0856 1.3260 1.1692 0.0886  0.0972  0.2753  726 TYR A CE1 
1439 C CE2 . TYR A 231 ? 1.0481 1.2289 1.1547 0.0598  0.0788  0.2561  726 TYR A CE2 
1440 C CZ  . TYR A 231 ? 1.1637 1.3866 1.2632 0.0784  0.0913  0.2796  726 TYR A CZ  
1441 O OH  . TYR A 231 ? 1.1915 1.4407 1.2996 0.0887  0.0990  0.3084  726 TYR A OH  
1442 N N   . MET A 232 ? 0.8459 0.9741 1.0090 0.0380  0.0819  0.2303  727 MET A N   
1443 C CA  . MET A 232 ? 0.8163 0.9431 1.0283 0.0294  0.0861  0.2487  727 MET A CA  
1444 C C   . MET A 232 ? 0.8691 1.0130 1.0998 0.0345  0.0952  0.2598  727 MET A C   
1445 O O   . MET A 232 ? 0.8603 1.0095 1.1367 0.0285  0.1007  0.2771  727 MET A O   
1446 C CB  . MET A 232 ? 0.8243 0.9207 1.0543 0.0126  0.0728  0.2313  727 MET A CB  
1447 C CG  . MET A 232 ? 0.8613 0.9392 1.0715 0.0077  0.0635  0.2178  727 MET A CG  
1448 S SD  . MET A 232 ? 0.8914 0.9389 1.1195 -0.0085 0.0492  0.1975  727 MET A SD  
1449 C CE  . MET A 232 ? 0.8471 0.8880 1.0545 -0.0079 0.0424  0.1775  727 MET A CE  
1450 N N   . THR A 233 ? 0.8380 0.9905 1.0374 0.0453  0.0973  0.2492  728 THR A N   
1451 C CA  . THR A 233 ? 0.8390 1.0089 1.0520 0.0523  0.1064  0.2584  728 THR A CA  
1452 C C   . THR A 233 ? 0.9038 1.1095 1.1044 0.0713  0.1225  0.2792  728 THR A C   
1453 O O   . THR A 233 ? 0.8880 1.1161 1.1215 0.0754  0.1354  0.3060  728 THR A O   
1454 C CB  . THR A 233 ? 0.9236 1.0775 1.1147 0.0525  0.0987  0.2328  728 THR A CB  
1455 O OG1 . THR A 233 ? 0.9169 1.0465 1.1258 0.0372  0.0858  0.2201  728 THR A OG1 
1456 C CG2 . THR A 233 ? 0.8925 1.0663 1.0897 0.0636  0.1091  0.2406  728 THR A CG2 
1457 N N   . TYR A 234 ? 0.8961 1.1099 1.0510 0.0833  0.1219  0.2664  729 TYR A N   
1458 C CA  . TYR A 234 ? 0.9240 1.1769 1.0564 0.1049  0.1354  0.2798  729 TYR A CA  
1459 C C   . TYR A 234 ? 0.9931 1.2709 1.1180 0.1135  0.1405  0.2995  729 TYR A C   
1460 O O   . TYR A 234 ? 1.0100 1.3280 1.1186 0.1339  0.1532  0.3157  729 TYR A O   
1461 C CB  . TYR A 234 ? 0.9563 1.2104 1.0455 0.1165  0.1328  0.2501  729 TYR A CB  
1462 C CG  . TYR A 234 ? 0.9847 1.2244 1.0845 0.1143  0.1335  0.2401  729 TYR A CG  
1463 C CD1 . TYR A 234 ? 1.0158 1.2765 1.1433 0.1205  0.1466  0.2638  729 TYR A CD1 
1464 C CD2 . TYR A 234 ? 0.9917 1.1990 1.0766 0.1072  0.1223  0.2092  729 TYR A CD2 
1465 C CE1 . TYR A 234 ? 1.0243 1.2751 1.1631 0.1195  0.1470  0.2560  729 TYR A CE1 
1466 C CE2 . TYR A 234 ? 1.0028 1.1998 1.0977 0.1078  0.1241  0.2029  729 TYR A CE2 
1467 C CZ  . TYR A 234 ? 1.1117 1.3312 1.2326 0.1141  0.1358  0.2258  729 TYR A CZ  
1468 O OH  . TYR A 234 ? 1.1421 1.3551 1.2743 0.1158  0.1374  0.2210  729 TYR A OH  
1469 N N   . GLY A 235 ? 0.9340 1.1914 1.0713 0.1001  0.1317  0.2998  730 GLY A N   
1470 C CA  . GLY A 235 ? 0.9331 1.2117 1.0683 0.1075  0.1361  0.3206  730 GLY A CA  
1471 C C   . GLY A 235 ? 0.9891 1.2821 1.0752 0.1176  0.1279  0.3004  730 GLY A C   
1472 O O   . GLY A 235 ? 0.9944 1.3113 1.0756 0.1264  0.1311  0.3181  730 GLY A O   
1473 N N   . LYS A 236 ? 0.9486 1.2280 1.0019 0.1166  0.1174  0.2632  731 LYS A N   
1474 C CA  . LYS A 236 ? 0.9579 1.2482 0.9687 0.1236  0.1074  0.2354  731 LYS A CA  
1475 C C   . LYS A 236 ? 0.9955 1.2441 0.9963 0.1090  0.0932  0.1960  731 LYS A C   
1476 O O   . LYS A 236 ? 0.9768 1.1992 0.9946 0.1005  0.0940  0.1919  731 LYS A O   
1477 C CB  . LYS A 236 ? 1.0162 1.3534 0.9954 0.1486  0.1167  0.2345  731 LYS A CB  
1478 N N   . THR A 237 ? 0.9627 1.2079 0.9384 0.1072  0.0811  0.1682  732 THR A N   
1479 C CA  . THR A 237 ? 0.9613 1.1692 0.9317 0.0953  0.0708  0.1337  732 THR A CA  
1480 C C   . THR A 237 ? 1.0407 1.2601 0.9919 0.1087  0.0760  0.1136  732 THR A C   
1481 O O   . THR A 237 ? 1.0511 1.3118 0.9855 0.1274  0.0843  0.1217  732 THR A O   
1482 C CB  . THR A 237 ? 1.0999 1.2972 1.0597 0.0862  0.0569  0.1118  732 THR A CB  
1483 O OG1 . THR A 237 ? 1.1468 1.3828 1.0785 0.1004  0.0541  0.0981  732 THR A OG1 
1484 C CG2 . THR A 237 ? 1.0653 1.2491 1.0452 0.0740  0.0528  0.1308  732 THR A CG2 
1485 N N   . PRO A 238 ? 1.0084 1.1945 0.9625 0.1018  0.0730  0.0892  733 PRO A N   
1486 C CA  . PRO A 238 ? 1.0247 1.2203 0.9641 0.1159  0.0797  0.0702  733 PRO A CA  
1487 C C   . PRO A 238 ? 1.1060 1.3380 1.0140 0.1317  0.0777  0.0471  733 PRO A C   
1488 O O   . PRO A 238 ? 1.1248 1.3850 1.0178 0.1501  0.0871  0.0444  733 PRO A O   
1489 C CB  . PRO A 238 ? 1.0384 1.1885 0.9892 0.1039  0.0749  0.0468  733 PRO A CB  
1490 C CG  . PRO A 238 ? 1.0669 1.1898 1.0409 0.0868  0.0701  0.0647  733 PRO A CG  
1491 C CD  . PRO A 238 ? 1.0085 1.1489 0.9803 0.0832  0.0651  0.0797  733 PRO A CD  
1492 N N   . PHE A 239 ? 1.0611 1.2965 0.9595 0.1255  0.0652  0.0302  734 PHE A N   
1493 C CA  . PHE A 239 ? 1.0843 1.3570 0.9544 0.1389  0.0595  0.0024  734 PHE A CA  
1494 C C   . PHE A 239 ? 1.1322 1.4528 0.9871 0.1488  0.0574  0.0230  734 PHE A C   
1495 O O   . PHE A 239 ? 1.1504 1.5092 0.9802 0.1608  0.0506  0.0000  734 PHE A O   
1496 C CB  . PHE A 239 ? 1.1142 1.3583 0.9876 0.1264  0.0466  -0.0415 734 PHE A CB  
1497 C CG  . PHE A 239 ? 1.1365 1.3369 1.0265 0.1206  0.0516  -0.0589 734 PHE A CG  
1498 C CD1 . PHE A 239 ? 1.2121 1.4220 1.0911 0.1354  0.0577  -0.0849 734 PHE A CD1 
1499 C CD2 . PHE A 239 ? 1.1319 1.2849 1.0487 0.1029  0.0516  -0.0467 734 PHE A CD2 
1500 C CE1 . PHE A 239 ? 1.2232 1.3929 1.1207 0.1319  0.0644  -0.0970 734 PHE A CE1 
1501 C CE2 . PHE A 239 ? 1.1680 1.2852 1.1009 0.1004  0.0577  -0.0575 734 PHE A CE2 
1502 C CZ  . PHE A 239 ? 1.1765 1.3009 1.1011 0.1147  0.0646  -0.0814 734 PHE A CZ  
1503 N N   . GLN A 240 ? 1.0687 1.3911 0.9403 0.1458  0.0643  0.0664  735 GLN A N   
1504 C CA  . GLN A 240 ? 1.0711 1.4367 0.9357 0.1564  0.0662  0.0958  735 GLN A CA  
1505 C C   . GLN A 240 ? 1.1788 1.6079 1.0116 0.1848  0.0732  0.0968  735 GLN A C   
1506 O O   . GLN A 240 ? 1.1974 1.6712 1.0119 0.1968  0.0689  0.1016  735 GLN A O   
1507 C CB  . GLN A 240 ? 1.0579 1.4122 0.9537 0.1506  0.0774  0.1428  735 GLN A CB  
1508 C CG  . GLN A 240 ? 1.1715 1.5488 1.0735 0.1528  0.0769  0.1717  735 GLN A CG  
1509 C CD  . GLN A 240 ? 1.3976 1.7569 1.3382 0.1449  0.0879  0.2130  735 GLN A CD  
1510 O OE1 . GLN A 240 ? 1.3723 1.6848 1.3386 0.1241  0.0827  0.2101  735 GLN A OE1 
1511 N NE2 . GLN A 240 ? 1.2418 1.6399 1.1899 0.1618  0.1035  0.2520  735 GLN A NE2 
1512 N N   . GLN A 241 ? 1.1583 1.5940 0.9838 0.1970  0.0841  0.0920  736 GLN A N   
1513 C CA  . GLN A 241 ? 1.1892 1.6845 0.9836 0.2264  0.0934  0.0915  736 GLN A CA  
1514 C C   . GLN A 241 ? 1.2580 1.7926 1.0158 0.2391  0.0798  0.0488  736 GLN A C   
1515 O O   . GLN A 241 ? 1.2832 1.8809 1.0116 0.2662  0.0858  0.0543  736 GLN A O   
1516 C CB  . GLN A 241 ? 1.2111 1.6948 1.0087 0.2335  0.1063  0.0874  736 GLN A CB  
1517 N N   . ILE A 242 ? 1.1981 1.6993 0.9594 0.2206  0.0620  0.0064  737 ILE A N   
1518 C CA  . ILE A 242 ? 1.2202 1.7557 0.9543 0.2292  0.0469  -0.0409 737 ILE A CA  
1519 C C   . ILE A 242 ? 1.2464 1.7961 0.9803 0.2202  0.0303  -0.0457 737 ILE A C   
1520 O O   . ILE A 242 ? 1.2158 1.7181 0.9730 0.1955  0.0194  -0.0612 737 ILE A O   
1521 C CB  . ILE A 242 ? 1.2782 1.7855 1.0118 0.2251  0.0418  -0.0958 737 ILE A CB  
1522 C CG1 . ILE A 242 ? 1.2446 1.6738 1.0152 0.1955  0.0384  -0.1053 737 ILE A CG1 
1523 C CG2 . ILE A 242 ? 1.3234 1.8528 1.0403 0.2483  0.0581  -0.0950 737 ILE A CG2 
1524 C CD1 . ILE A 242 ? 1.2898 1.6906 1.0663 0.1914  0.0342  -0.1569 737 ILE A CD1 
1525 N N   . ILE A 243 ? 1.2192 1.8386 0.9266 0.2426  0.0296  -0.0303 738 ILE A N   
1526 C CA  . ILE A 243 ? 1.2120 1.8613 0.9153 0.2408  0.0156  -0.0281 738 ILE A CA  
1527 C C   . ILE A 243 ? 1.2651 1.8950 0.9749 0.2222  -0.0065 -0.0827 738 ILE A C   
1528 O O   . ILE A 243 ? 1.2278 1.8132 0.9653 0.1981  -0.0134 -0.0780 738 ILE A O   
1529 C CB  . ILE A 243 ? 1.2782 2.0170 0.9461 0.2745  0.0192  -0.0082 738 ILE A CB  
1530 N N   . ASN A 244 ? 1.2593 1.9219 0.9466 0.2335  -0.0169 -0.1355 739 ASN A N   
1531 C CA  . ASN A 244 ? 1.2668 1.9189 0.9635 0.2181  -0.0378 -0.1942 739 ASN A CA  
1532 C C   . ASN A 244 ? 1.2880 1.8544 1.0273 0.1848  -0.0395 -0.2041 739 ASN A C   
1533 O O   . ASN A 244 ? 1.2806 1.7999 1.0328 0.1787  -0.0296 -0.2122 739 ASN A O   
1534 C CB  . ASN A 244 ? 1.3040 1.9923 0.9766 0.2356  -0.0432 -0.2492 739 ASN A CB  
1535 C CG  . ASN A 244 ? 1.6324 2.3154 1.3189 0.2214  -0.0646 -0.3159 739 ASN A CG  
1536 O OD1 . ASN A 244 ? 1.6310 2.3231 1.3101 0.2294  -0.0680 -0.3666 739 ASN A OD1 
1537 N ND2 . ASN A 244 ? 1.4835 2.1548 1.1932 0.2009  -0.0791 -0.3192 739 ASN A ND2 
1538 N N   . GLN A 245 ? 1.2279 1.7777 0.9887 0.1654  -0.0511 -0.2007 740 GLN A N   
1539 C CA  . GLN A 245 ? 1.1967 1.6720 0.9976 0.1354  -0.0524 -0.2043 740 GLN A CA  
1540 C C   . GLN A 245 ? 1.2461 1.6833 1.0673 0.1231  -0.0570 -0.2568 740 GLN A C   
1541 O O   . GLN A 245 ? 1.2218 1.5957 1.0697 0.1074  -0.0481 -0.2506 740 GLN A O   
1542 C CB  . GLN A 245 ? 1.1926 1.6674 1.0101 0.1206  -0.0636 -0.1912 740 GLN A CB  
1543 C CG  . GLN A 245 ? 1.3851 1.8828 1.1927 0.1302  -0.0556 -0.1341 740 GLN A CG  
1544 C CD  . GLN A 245 ? 1.6454 2.0837 1.4767 0.1157  -0.0423 -0.0942 740 GLN A CD  
1545 O OE1 . GLN A 245 ? 1.5879 1.9951 1.4223 0.1162  -0.0292 -0.0835 740 GLN A OE1 
1546 N NE2 . GLN A 245 ? 1.5491 1.9756 1.3971 0.1045  -0.0455 -0.0707 740 GLN A NE2 
1547 N N   . ILE A 246 ? 1.2169 1.6946 1.0270 0.1318  -0.0699 -0.3083 741 ILE A N   
1548 C CA  . ILE A 246 ? 1.2291 1.6724 1.0627 0.1221  -0.0729 -0.3612 741 ILE A CA  
1549 C C   . ILE A 246 ? 1.2981 1.7210 1.1215 0.1350  -0.0551 -0.3576 741 ILE A C   
1550 O O   . ILE A 246 ? 1.2932 1.6541 1.1467 0.1212  -0.0464 -0.3630 741 ILE A O   
1551 C CB  . ILE A 246 ? 1.2993 1.7904 1.1307 0.1254  -0.0933 -0.4219 741 ILE A CB  
1552 C CG1 . ILE A 246 ? 1.2864 1.7728 1.1472 0.1035  -0.1090 -0.4268 741 ILE A CG1 
1553 C CG2 . ILE A 246 ? 1.3322 1.7947 1.1848 0.1221  -0.0929 -0.4790 741 ILE A CG2 
1554 C CD1 . ILE A 246 ? 1.4014 1.9576 1.2510 0.1106  -0.1309 -0.4658 741 ILE A CD1 
1555 N N   . SER A 247 ? 1.2638 1.7396 1.0464 0.1624  -0.0479 -0.3417 742 SER A N   
1556 C CA  . SER A 247 ? 1.2661 1.7300 1.0374 0.1772  -0.0297 -0.3326 742 SER A CA  
1557 C C   . SER A 247 ? 1.2547 1.6609 1.0473 0.1641  -0.0142 -0.2818 742 SER A C   
1558 O O   . SER A 247 ? 1.2497 1.6159 1.0555 0.1631  -0.0020 -0.2844 742 SER A O   
1559 C CB  . SER A 247 ? 1.3394 1.8778 1.0641 0.2100  -0.0241 -0.3189 742 SER A CB  
1560 O OG  . SER A 247 ? 1.4821 2.0704 1.1846 0.2271  -0.0348 -0.3747 742 SER A OG  
1561 N N   . LYS A 248 ? 1.1694 1.5713 0.9680 0.1540  -0.0153 -0.2386 743 LYS A N   
1562 C CA  . LYS A 248 ? 1.1260 1.4768 0.9465 0.1405  -0.0034 -0.1945 743 LYS A CA  
1563 C C   . LYS A 248 ? 1.1609 1.4446 1.0187 0.1170  -0.0050 -0.2138 743 LYS A C   
1564 O O   . LYS A 248 ? 1.1391 1.3810 1.0124 0.1120  0.0070  -0.1944 743 LYS A O   
1565 C CB  . LYS A 248 ? 1.1210 1.4843 0.9416 0.1357  -0.0050 -0.1497 743 LYS A CB  
1566 C CG  . LYS A 248 ? 1.1300 1.4650 0.9626 0.1325  0.0099  -0.0999 743 LYS A CG  
1567 C CD  . LYS A 248 ? 1.2173 1.5474 1.0621 0.1217  0.0075  -0.0627 743 LYS A CD  
1568 C CE  . LYS A 248 ? 1.3677 1.7570 1.1923 0.1384  0.0073  -0.0370 743 LYS A CE  
1569 N NZ  . LYS A 248 ? 1.4843 1.9014 1.2982 0.1576  0.0239  -0.0005 743 LYS A NZ  
1570 N N   . LEU A 249 ? 1.1253 1.4024 0.9997 0.1039  -0.0192 -0.2514 744 LEU A N   
1571 C CA  . LEU A 249 ? 1.1141 1.3311 1.0286 0.0824  -0.0196 -0.2689 744 LEU A CA  
1572 C C   . LEU A 249 ? 1.2114 1.4017 1.1386 0.0869  -0.0112 -0.3012 744 LEU A C   
1573 O O   . LEU A 249 ? 1.1925 1.3302 1.1468 0.0772  -0.0009 -0.2908 744 LEU A O   
1574 C CB  . LEU A 249 ? 1.1091 1.3288 1.0437 0.0662  -0.0360 -0.2943 744 LEU A CB  
1575 C CG  . LEU A 249 ? 1.1235 1.3486 1.0587 0.0567  -0.0412 -0.2578 744 LEU A CG  
1576 C CD1 . LEU A 249 ? 1.1272 1.3728 1.0758 0.0461  -0.0585 -0.2853 744 LEU A CD1 
1577 C CD2 . LEU A 249 ? 1.1149 1.2841 1.0738 0.0420  -0.0311 -0.2230 744 LEU A CD2 
1578 N N   . HIS A 250 ? 1.2247 1.4543 1.1313 0.1040  -0.0145 -0.3382 745 HIS A N   
1579 C CA  . HIS A 250 ? 1.2671 1.4771 1.1833 0.1120  -0.0058 -0.3717 745 HIS A CA  
1580 C C   . HIS A 250 ? 1.3367 1.5247 1.2471 0.1216  0.0135  -0.3343 745 HIS A C   
1581 O O   . HIS A 250 ? 1.3496 1.4938 1.2855 0.1189  0.0239  -0.3447 745 HIS A O   
1582 C CB  . HIS A 250 ? 1.3238 1.5917 1.2107 0.1325  -0.0136 -0.4162 745 HIS A CB  
1583 C CG  . HIS A 250 ? 1.3946 1.6751 1.2995 0.1221  -0.0322 -0.4701 745 HIS A CG  
1584 N ND1 . HIS A 250 ? 1.4626 1.7426 1.3811 0.1269  -0.0352 -0.5304 745 HIS A ND1 
1585 C CD2 . HIS A 250 ? 1.4021 1.6956 1.3176 0.1069  -0.0482 -0.4724 745 HIS A CD2 
1586 C CE1 . HIS A 250 ? 1.4682 1.7625 1.4066 0.1136  -0.0539 -0.5686 745 HIS A CE1 
1587 N NE2 . HIS A 250 ? 1.4367 1.7405 1.3733 0.1015  -0.0621 -0.5344 745 HIS A NE2 
1588 N N   . ALA A 251 ? 1.2820 1.4999 1.1641 0.1321  0.0187  -0.2891 746 ALA A N   
1589 C CA  . ALA A 251 ? 1.2660 1.4719 1.1440 0.1410  0.0357  -0.2506 746 ALA A CA  
1590 C C   . ALA A 251 ? 1.3046 1.4523 1.2153 0.1228  0.0421  -0.2222 746 ALA A C   
1591 O O   . ALA A 251 ? 1.3115 1.4356 1.2318 0.1280  0.0554  -0.2109 746 ALA A O   
1592 C CB  . ALA A 251 ? 1.2593 1.5140 1.1068 0.1549  0.0389  -0.2110 746 ALA A CB  
1593 N N   . ILE A 252 ? 1.2309 1.3598 1.1575 0.1034  0.0331  -0.2096 747 ILE A N   
1594 C CA  . ILE A 252 ? 1.2017 1.2815 1.1566 0.0873  0.0377  -0.1835 747 ILE A CA  
1595 C C   . ILE A 252 ? 1.2994 1.3342 1.2859 0.0814  0.0432  -0.2095 747 ILE A C   
1596 O O   . ILE A 252 ? 1.2750 1.2778 1.2780 0.0807  0.0543  -0.1897 747 ILE A O   
1597 C CB  . ILE A 252 ? 1.2118 1.2879 1.1737 0.0705  0.0268  -0.1675 747 ILE A CB  
1598 C CG1 . ILE A 252 ? 1.1959 1.3115 1.1329 0.0772  0.0247  -0.1350 747 ILE A CG1 
1599 C CG2 . ILE A 252 ? 1.1963 1.2238 1.1874 0.0551  0.0309  -0.1471 747 ILE A CG2 
1600 C CD1 . ILE A 252 ? 1.2661 1.4000 1.2002 0.0687  0.0117  -0.1350 747 ILE A CD1 
1601 N N   . ILE A 253 ? 1.3192 1.3543 1.3166 0.0782  0.0357  -0.2540 748 ILE A N   
1602 C CA  . ILE A 253 ? 1.3522 1.3444 1.3875 0.0720  0.0414  -0.2826 748 ILE A CA  
1603 C C   . ILE A 253 ? 1.4609 1.4531 1.4938 0.0896  0.0523  -0.3077 748 ILE A C   
1604 O O   . ILE A 253 ? 1.4882 1.4438 1.5562 0.0862  0.0589  -0.3327 748 ILE A O   
1605 C CB  . ILE A 253 ? 1.4084 1.3941 1.4696 0.0560  0.0287  -0.3177 748 ILE A CB  
1606 C CG1 . ILE A 253 ? 1.4478 1.4848 1.4846 0.0640  0.0145  -0.3579 748 ILE A CG1 
1607 C CG2 . ILE A 253 ? 1.3840 1.3576 1.4566 0.0383  0.0224  -0.2881 748 ILE A CG2 
1608 C CD1 . ILE A 253 ? 1.5786 1.6112 1.6472 0.0488  0.0015  -0.4005 748 ILE A CD1 
1609 N N   . ASP A 254 ? 1.4384 1.4712 1.4334 0.1090  0.0557  -0.2998 749 ASP A N   
1610 C CA  . ASP A 254 ? 1.4824 1.5222 1.4702 0.1289  0.0667  -0.3225 749 ASP A CA  
1611 C C   . ASP A 254 ? 1.5321 1.5536 1.5227 0.1376  0.0838  -0.2841 749 ASP A C   
1612 O O   . ASP A 254 ? 1.5059 1.5557 1.4713 0.1449  0.0863  -0.2480 749 ASP A O   
1613 C CB  . ASP A 254 ? 1.5340 1.6370 1.4785 0.1481  0.0606  -0.3418 749 ASP A CB  
1614 C CG  . ASP A 254 ? 1.7490 1.8654 1.6840 0.1700  0.0698  -0.3767 749 ASP A CG  
1615 O OD1 . ASP A 254 ? 1.7806 1.8539 1.7492 0.1678  0.0780  -0.4010 749 ASP A OD1 
1616 O OD2 . ASP A 254 ? 1.8608 2.0325 1.7560 0.1905  0.0694  -0.3804 749 ASP A OD2 
1617 N N   . PRO A 255 ? 1.5078 1.4845 1.5322 0.1376  0.0962  -0.2907 750 PRO A N   
1618 C CA  . PRO A 255 ? 1.4882 1.4515 1.5169 0.1464  0.1115  -0.2531 750 PRO A CA  
1619 C C   . PRO A 255 ? 1.5485 1.5488 1.5483 0.1703  0.1208  -0.2522 750 PRO A C   
1620 O O   . PRO A 255 ? 1.5211 1.5298 1.5147 0.1769  0.1293  -0.2132 750 PRO A O   
1621 C CB  . PRO A 255 ? 1.5232 1.4331 1.5970 0.1424  0.1224  -0.2641 750 PRO A CB  
1622 C CG  . PRO A 255 ? 1.5917 1.4819 1.6898 0.1257  0.1120  -0.2975 750 PRO A CG  
1623 C CD  . PRO A 255 ? 1.5533 1.4897 1.6183 0.1293  0.0976  -0.3293 750 PRO A CD  
1624 N N   . ASN A 256 ? 1.5330 1.5595 1.5158 0.1836  0.1186  -0.2959 751 ASN A N   
1625 C CA  . ASN A 256 ? 1.5459 1.6148 1.4975 0.2093  0.1274  -0.3009 751 ASN A CA  
1626 C C   . ASN A 256 ? 1.5605 1.6825 1.4744 0.2151  0.1227  -0.2672 751 ASN A C   
1627 O O   . ASN A 256 ? 1.5519 1.7061 1.4460 0.2343  0.1340  -0.2472 751 ASN A O   
1628 C CB  . ASN A 256 ? 1.5776 1.6613 1.5221 0.2218  0.1247  -0.3618 751 ASN A CB  
1629 C CG  . ASN A 256 ? 1.7222 1.7514 1.7122 0.2116  0.1270  -0.3989 751 ASN A CG  
1630 O OD1 . ASN A 256 ? 1.5750 1.5645 1.5945 0.2145  0.1422  -0.3887 751 ASN A OD1 
1631 N ND2 . ASN A 256 ? 1.6486 1.6752 1.6497 0.1989  0.1122  -0.4399 751 ASN A ND2 
1632 N N   . HIS A 257 ? 1.4891 1.6203 1.3970 0.1990  0.1075  -0.2589 752 HIS A N   
1633 C CA  . HIS A 257 ? 1.4614 1.6374 1.3415 0.2026  0.1041  -0.2228 752 HIS A CA  
1634 C C   . HIS A 257 ? 1.4637 1.6172 1.3617 0.1925  0.1109  -0.1710 752 HIS A C   
1635 O O   . HIS A 257 ? 1.4290 1.5543 1.3451 0.1718  0.1030  -0.1554 752 HIS A O   
1636 C CB  . HIS A 257 ? 1.4630 1.6579 1.3323 0.1910  0.0861  -0.2336 752 HIS A CB  
1637 C CG  . HIS A 257 ? 1.4881 1.7333 1.3296 0.1991  0.0849  -0.1976 752 HIS A CG  
1638 N ND1 . HIS A 257 ? 1.4685 1.7035 1.3209 0.1883  0.0878  -0.1480 752 HIS A ND1 
1639 C CD2 . HIS A 257 ? 1.5309 1.8370 1.3375 0.2183  0.0825  -0.2042 752 HIS A CD2 
1640 C CE1 . HIS A 257 ? 1.4588 1.7446 1.2870 0.2001  0.0882  -0.1249 752 HIS A CE1 
1641 N NE2 . HIS A 257 ? 1.5004 1.8319 1.2989 0.2193  0.0855  -0.1550 752 HIS A NE2 
1642 N N   . GLU A 258 ? 1.4100 1.5778 1.3045 0.2077  0.1255  -0.1468 753 GLU A N   
1643 C CA  . GLU A 258 ? 1.3657 1.5182 1.2797 0.2005  0.1322  -0.1018 753 GLU A CA  
1644 C C   . GLU A 258 ? 1.3698 1.5452 1.2786 0.1919  0.1266  -0.0638 753 GLU A C   
1645 O O   . GLU A 258 ? 1.3725 1.5940 1.2579 0.2043  0.1281  -0.0546 753 GLU A O   
1646 C CB  . GLU A 258 ? 1.3929 1.5566 1.3091 0.2198  0.1495  -0.0900 753 GLU A CB  
1647 C CG  . GLU A 258 ? 1.5283 1.6497 1.4676 0.2213  0.1567  -0.1118 753 GLU A CG  
1648 C CD  . GLU A 258 ? 1.7431 1.8780 1.6809 0.2447  0.1740  -0.1136 753 GLU A CD  
1649 O OE1 . GLU A 258 ? 1.5446 1.7051 1.4820 0.2529  0.1830  -0.0775 753 GLU A OE1 
1650 O OE2 . GLU A 258 ? 1.6485 1.7667 1.5901 0.2544  0.1791  -0.1512 753 GLU A OE2 
1651 N N   . ILE A 259 ? 1.2842 1.4282 1.2161 0.1718  0.1208  -0.0422 754 ILE A N   
1652 C CA  . ILE A 259 ? 1.2507 1.4094 1.1855 0.1623  0.1165  -0.0067 754 ILE A CA  
1653 C C   . ILE A 259 ? 1.2998 1.4754 1.2465 0.1709  0.1293  0.0278  754 ILE A C   
1654 O O   . ILE A 259 ? 1.2882 1.4424 1.2535 0.1709  0.1354  0.0316  754 ILE A O   
1655 C CB  . ILE A 259 ? 1.2566 1.3781 1.2105 0.1388  0.1047  -0.0015 754 ILE A CB  
1656 N N   . GLU A 260 ? 1.2610 1.4783 1.1987 0.1800  0.1347  0.0529  755 GLU A N   
1657 C CA  . GLU A 260 ? 1.2502 1.4900 1.2033 0.1885  0.1480  0.0871  755 GLU A CA  
1658 C C   . GLU A 260 ? 1.2452 1.4696 1.2312 0.1699  0.1442  0.1179  755 GLU A C   
1659 O O   . GLU A 260 ? 1.2198 1.4393 1.2093 0.1567  0.1349  0.1256  755 GLU A O   
1660 C CB  . GLU A 260 ? 1.2881 1.5824 1.2213 0.2084  0.1580  0.1031  755 GLU A CB  
1661 N N   . PHE A 261 ? 1.1789 1.3983 1.1902 0.1698  0.1511  0.1342  756 PHE A N   
1662 C CA  . PHE A 261 ? 1.1420 1.3522 1.1880 0.1533  0.1470  0.1600  756 PHE A CA  
1663 C C   . PHE A 261 ? 1.1748 1.4200 1.2441 0.1620  0.1607  0.1931  756 PHE A C   
1664 O O   . PHE A 261 ? 1.1594 1.4041 1.2493 0.1644  0.1660  0.2002  756 PHE A O   
1665 C CB  . PHE A 261 ? 1.1506 1.3234 1.2121 0.1417  0.1391  0.1489  756 PHE A CB  
1666 C CG  . PHE A 261 ? 1.1683 1.3072 1.2153 0.1312  0.1269  0.1229  756 PHE A CG  
1667 C CD1 . PHE A 261 ? 1.2251 1.3486 1.2534 0.1394  0.1285  0.0939  756 PHE A CD1 
1668 C CD2 . PHE A 261 ? 1.1738 1.2965 1.2294 0.1132  0.1145  0.1269  756 PHE A CD2 
1669 C CE1 . PHE A 261 ? 1.2395 1.3324 1.2612 0.1288  0.1184  0.0715  756 PHE A CE1 
1670 C CE2 . PHE A 261 ? 1.2044 1.2983 1.2489 0.1042  0.1046  0.1052  756 PHE A CE2 
1671 C CZ  . PHE A 261 ? 1.2000 1.2793 1.2294 0.1114  0.1068  0.0787  756 PHE A CZ  
1672 N N   . PRO A 262 ? 1.1308 1.4092 1.1993 0.1682  0.1679  0.2153  757 PRO A N   
1673 C CA  . PRO A 262 ? 1.1262 1.4400 1.2219 0.1773  0.1837  0.2500  757 PRO A CA  
1674 C C   . PRO A 262 ? 1.1583 1.4615 1.3031 0.1611  0.1810  0.2681  757 PRO A C   
1675 O O   . PRO A 262 ? 1.1333 1.4139 1.2970 0.1412  0.1684  0.2679  757 PRO A O   
1676 C CB  . PRO A 262 ? 1.1504 1.4944 1.2420 0.1828  0.1896  0.2727  757 PRO A CB  
1677 C CG  . PRO A 262 ? 1.2186 1.5553 1.2667 0.1860  0.1798  0.2441  757 PRO A CG  
1678 C CD  . PRO A 262 ? 1.1498 1.4385 1.1946 0.1692  0.1634  0.2123  757 PRO A CD  
1679 N N   . ASP A 263 ? 1.1280 1.4497 1.2932 0.1703  0.1924  0.2812  758 ASP A N   
1680 C CA  . ASP A 263 ? 1.1047 1.4259 1.3189 0.1579  0.1906  0.2970  758 ASP A CA  
1681 C C   . ASP A 263 ? 1.1385 1.4632 1.3960 0.1397  0.1868  0.3197  758 ASP A C   
1682 O O   . ASP A 263 ? 1.1350 1.4850 1.4037 0.1451  0.1986  0.3451  758 ASP A O   
1683 C CB  . ASP A 263 ? 1.1367 1.4890 1.3660 0.1749  0.2073  0.3131  758 ASP A CB  
1684 N N   . ILE A 264 ? 1.0788 1.3782 1.3602 0.1193  0.1706  0.3095  759 ILE A N   
1685 C CA  . ILE A 264 ? 1.0592 1.3548 1.3842 0.0997  0.1638  0.3222  759 ILE A CA  
1686 C C   . ILE A 264 ? 1.0856 1.3837 1.4594 0.0864  0.1559  0.3233  759 ILE A C   
1687 O O   . ILE A 264 ? 1.0738 1.3691 1.4376 0.0911  0.1516  0.3100  759 ILE A O   
1688 C CB  . ILE A 264 ? 1.0934 1.3577 1.3965 0.0874  0.1493  0.3041  759 ILE A CB  
1689 C CG1 . ILE A 264 ? 1.1023 1.3374 1.3607 0.0886  0.1372  0.2716  759 ILE A CG1 
1690 C CG2 . ILE A 264 ? 1.1107 1.3870 1.3989 0.0948  0.1589  0.3194  759 ILE A CG2 
1691 C CD1 . ILE A 264 ? 1.1839 1.3872 1.4361 0.0719  0.1199  0.2534  759 ILE A CD1 
1692 N N   . PRO A 265 ? 1.0284 1.3338 1.4581 0.0705  0.1541  0.3383  760 PRO A N   
1693 C CA  . PRO A 265 ? 1.0148 1.3269 1.4929 0.0571  0.1439  0.3344  760 PRO A CA  
1694 C C   . PRO A 265 ? 1.0730 1.3595 1.5291 0.0487  0.1225  0.3028  760 PRO A C   
1695 O O   . PRO A 265 ? 1.0795 1.3756 1.5463 0.0494  0.1157  0.2952  760 PRO A O   
1696 C CB  . PRO A 265 ? 1.0270 1.3441 1.5657 0.0403  0.1446  0.3499  760 PRO A CB  
1697 C CG  . PRO A 265 ? 1.0928 1.4170 1.6211 0.0504  0.1625  0.3743  760 PRO A CG  
1698 C CD  . PRO A 265 ? 1.0451 1.3530 1.4996 0.0640  0.1607  0.3579  760 PRO A CD  
1699 N N   . GLU A 266 ? 1.0098 1.2668 1.4338 0.0429  0.1132  0.2866  761 GLU A N   
1700 C CA  . GLU A 266 ? 0.9856 1.2185 1.3854 0.0367  0.0952  0.2597  761 GLU A CA  
1701 C C   . GLU A 266 ? 1.0174 1.2406 1.3667 0.0529  0.0986  0.2493  761 GLU A C   
1702 O O   . GLU A 266 ? 1.0143 1.2166 1.3227 0.0572  0.0993  0.2395  761 GLU A O   
1703 C CB  . GLU A 266 ? 0.9960 1.2032 1.3856 0.0249  0.0862  0.2490  761 GLU A CB  
1704 C CG  . GLU A 266 ? 1.0794 1.2912 1.5215 0.0096  0.0849  0.2585  761 GLU A CG  
1705 C CD  . GLU A 266 ? 1.2891 1.4773 1.7330 -0.0049 0.0685  0.2379  761 GLU A CD  
1706 O OE1 . GLU A 266 ? 1.1138 1.3034 1.5704 -0.0122 0.0534  0.2195  761 GLU A OE1 
1707 O OE2 . GLU A 266 ? 1.2941 1.4657 1.7260 -0.0073 0.0708  0.2402  761 GLU A OE2 
1708 N N   . LYS A 267 ? 0.9756 1.2151 1.3320 0.0622  0.1015  0.2516  762 LYS A N   
1709 C CA  . LYS A 267 ? 0.9846 1.2147 1.3023 0.0786  0.1067  0.2428  762 LYS A CA  
1710 C C   . LYS A 267 ? 1.0396 1.2392 1.3276 0.0751  0.0939  0.2213  762 LYS A C   
1711 O O   . LYS A 267 ? 1.0513 1.2314 1.3035 0.0851  0.0988  0.2112  762 LYS A O   
1712 C CB  . LYS A 267 ? 1.0033 1.2589 1.3423 0.0891  0.1122  0.2521  762 LYS A CB  
1713 N N   . ASP A 268 ? 0.9752 1.1724 1.2812 0.0611  0.0781  0.2141  763 ASP A N   
1714 C CA  . ASP A 268 ? 0.9691 1.1434 1.2529 0.0572  0.0657  0.1972  763 ASP A CA  
1715 C C   . ASP A 268 ? 1.0027 1.1489 1.2553 0.0538  0.0670  0.1889  763 ASP A C   
1716 O O   . ASP A 268 ? 1.0046 1.1289 1.2263 0.0598  0.0679  0.1784  763 ASP A O   
1717 C CB  . ASP A 268 ? 0.9864 1.1714 1.2996 0.0429  0.0491  0.1911  763 ASP A CB  
1718 C CG  . ASP A 268 ? 1.1222 1.3347 1.4583 0.0465  0.0413  0.1914  763 ASP A CG  
1719 O OD1 . ASP A 268 ? 1.1143 1.3354 1.4426 0.0614  0.0497  0.1989  763 ASP A OD1 
1720 O OD2 . ASP A 268 ? 1.2143 1.4409 1.5759 0.0355  0.0264  0.1826  763 ASP A OD2 
1721 N N   . LEU A 269 ? 0.9357 1.0844 1.2010 0.0446  0.0679  0.1950  764 LEU A N   
1722 C CA  . LEU A 269 ? 0.9235 1.0538 1.1658 0.0412  0.0690  0.1907  764 LEU A CA  
1723 C C   . LEU A 269 ? 0.9682 1.0923 1.1751 0.0552  0.0802  0.1876  764 LEU A C   
1724 O O   . LEU A 269 ? 0.9722 1.0757 1.1513 0.0545  0.0774  0.1747  764 LEU A O   
1725 C CB  . LEU A 269 ? 0.9176 1.0602 1.1898 0.0325  0.0719  0.2052  764 LEU A CB  
1726 C CG  . LEU A 269 ? 0.9797 1.1135 1.2358 0.0312  0.0759  0.2087  764 LEU A CG  
1727 C CD1 . LEU A 269 ? 0.9749 1.0815 1.2058 0.0245  0.0646  0.1904  764 LEU A CD1 
1728 C CD2 . LEU A 269 ? 0.9990 1.1460 1.2961 0.0231  0.0799  0.2272  764 LEU A CD2 
1729 N N   . GLN A 270 ? 0.9200 1.0630 1.1297 0.0681  0.0925  0.1971  765 GLN A N   
1730 C CA  . GLN A 270 ? 0.9340 1.0745 1.1123 0.0834  0.1033  0.1901  765 GLN A CA  
1731 C C   . GLN A 270 ? 0.9707 1.0851 1.1292 0.0870  0.0996  0.1713  765 GLN A C   
1732 O O   . GLN A 270 ? 0.9717 1.0685 1.1037 0.0898  0.1003  0.1557  765 GLN A O   
1733 C CB  . GLN A 270 ? 0.9642 1.1333 1.1540 0.0975  0.1177  0.2050  765 GLN A CB  
1734 C CG  . GLN A 270 ? 1.1340 1.3130 1.2949 0.1134  0.1304  0.2018  765 GLN A CG  
1735 C CD  . GLN A 270 ? 1.2780 1.4853 1.4491 0.1294  0.1455  0.2157  765 GLN A CD  
1736 O OE1 . GLN A 270 ? 1.1607 1.3965 1.3557 0.1306  0.1533  0.2392  765 GLN A OE1 
1737 N NE2 . GLN A 270 ? 1.1968 1.3966 1.3539 0.1426  0.1512  0.2028  765 GLN A NE2 
1738 N N   . ASP A 271 ? 0.9136 1.0276 1.0883 0.0870  0.0954  0.1735  766 ASP A N   
1739 C CA  . ASP A 271 ? 0.9103 1.0022 1.0733 0.0921  0.0941  0.1622  766 ASP A CA  
1740 C C   . ASP A 271 ? 0.9393 1.0047 1.0869 0.0817  0.0845  0.1493  766 ASP A C   
1741 O O   . ASP A 271 ? 0.9548 0.9975 1.0862 0.0865  0.0881  0.1369  766 ASP A O   
1742 C CB  . ASP A 271 ? 0.9233 1.0286 1.1082 0.0957  0.0910  0.1718  766 ASP A CB  
1743 C CG  . ASP A 271 ? 1.0108 1.0964 1.1869 0.1038  0.0922  0.1661  766 ASP A CG  
1744 O OD1 . ASP A 271 ? 1.0198 1.0990 1.1911 0.1181  0.1046  0.1647  766 ASP A OD1 
1745 O OD2 . ASP A 271 ? 1.0635 1.1402 1.2386 0.0970  0.0821  0.1636  766 ASP A OD2 
1746 N N   . VAL A 272 ? 0.8421 0.9101 0.9982 0.0676  0.0733  0.1517  767 VAL A N   
1747 C CA  . VAL A 272 ? 0.8128 0.8592 0.9562 0.0578  0.0644  0.1412  767 VAL A CA  
1748 C C   . VAL A 272 ? 0.8719 0.9046 0.9925 0.0593  0.0693  0.1303  767 VAL A C   
1749 O O   . VAL A 272 ? 0.8810 0.8916 0.9886 0.0592  0.0686  0.1182  767 VAL A O   
1750 C CB  . VAL A 272 ? 0.8287 0.8827 0.9874 0.0440  0.0536  0.1448  767 VAL A CB  
1751 C CG1 . VAL A 272 ? 0.8186 0.8515 0.9621 0.0355  0.0466  0.1345  767 VAL A CG1 
1752 C CG2 . VAL A 272 ? 0.8145 0.8839 0.9959 0.0418  0.0456  0.1490  767 VAL A CG2 
1753 N N   . LEU A 273 ? 0.8256 0.8749 0.9437 0.0617  0.0748  0.1353  768 LEU A N   
1754 C CA  . LEU A 273 ? 0.8332 0.8805 0.9286 0.0654  0.0786  0.1248  768 LEU A CA  
1755 C C   . LEU A 273 ? 0.9164 0.9517 0.9977 0.0766  0.0858  0.1087  768 LEU A C   
1756 O O   . LEU A 273 ? 0.9301 0.9474 0.9977 0.0746  0.0833  0.0909  768 LEU A O   
1757 C CB  . LEU A 273 ? 0.8308 0.9070 0.9280 0.0705  0.0854  0.1386  768 LEU A CB  
1758 C CG  . LEU A 273 ? 0.8623 0.9492 0.9799 0.0597  0.0809  0.1556  768 LEU A CG  
1759 C CD1 . LEU A 273 ? 0.8614 0.9789 0.9868 0.0678  0.0918  0.1747  768 LEU A CD1 
1760 C CD2 . LEU A 273 ? 0.8755 0.9468 0.9835 0.0493  0.0716  0.1477  768 LEU A CD2 
1761 N N   . LYS A 274 ? 0.8856 0.9299 0.9750 0.0879  0.0946  0.1144  769 LYS A N   
1762 C CA  . LYS A 274 ? 0.9080 0.9396 0.9904 0.1002  0.1035  0.0999  769 LYS A CA  
1763 C C   . LYS A 274 ? 0.9824 0.9818 1.0688 0.0952  0.0997  0.0901  769 LYS A C   
1764 O O   . LYS A 274 ? 1.0031 0.9836 1.0829 0.0992  0.1040  0.0710  769 LYS A O   
1765 C CB  . LYS A 274 ? 0.9304 0.9796 1.0257 0.1134  0.1139  0.1126  769 LYS A CB  
1766 C CG  . LYS A 274 ? 0.9124 0.9937 1.0027 0.1228  0.1224  0.1210  769 LYS A CG  
1767 N N   . CYS A 275 ? 0.9362 0.9314 1.0347 0.0866  0.0917  0.1023  770 CYS A N   
1768 C CA  . CYS A 275 ? 0.9442 0.9147 1.0475 0.0834  0.0892  0.0993  770 CYS A CA  
1769 C C   . CYS A 275 ? 1.0148 0.9669 1.1079 0.0723  0.0827  0.0855  770 CYS A C   
1770 O O   . CYS A 275 ? 1.0218 0.9502 1.1175 0.0729  0.0864  0.0747  770 CYS A O   
1771 C CB  . CYS A 275 ? 0.9299 0.9108 1.0462 0.0807  0.0824  0.1162  770 CYS A CB  
1772 S SG  . CYS A 275 ? 0.9821 0.9834 1.1153 0.0952  0.0896  0.1320  770 CYS A SG  
1773 N N   . CYS A 276 ? 0.9761 0.9394 1.0623 0.0621  0.0738  0.0875  771 CYS A N   
1774 C CA  . CYS A 276 ? 0.9747 0.9263 1.0520 0.0517  0.0668  0.0769  771 CYS A CA  
1775 C C   . CYS A 276 ? 1.0382 0.9856 1.1035 0.0547  0.0703  0.0561  771 CYS A C   
1776 O O   . CYS A 276 ? 1.0576 0.9865 1.1233 0.0494  0.0682  0.0419  771 CYS A O   
1777 C CB  . CYS A 276 ? 0.9564 0.9232 1.0329 0.0423  0.0580  0.0864  771 CYS A CB  
1778 S SG  . CYS A 276 ? 0.9846 0.9553 1.0767 0.0365  0.0503  0.1013  771 CYS A SG  
1779 N N   . LEU A 277 ? 0.9601 0.9272 1.0167 0.0641  0.0759  0.0536  772 LEU A N   
1780 C CA  . LEU A 277 ? 0.9587 0.9310 1.0010 0.0696  0.0781  0.0314  772 LEU A CA  
1781 C C   . LEU A 277 ? 1.0503 1.0047 1.0979 0.0788  0.0871  0.0108  772 LEU A C   
1782 O O   . LEU A 277 ? 1.0735 1.0383 1.1095 0.0870  0.0901  -0.0098 772 LEU A O   
1783 C CB  . LEU A 277 ? 0.9524 0.9595 0.9810 0.0771  0.0803  0.0398  772 LEU A CB  
1784 C CG  . LEU A 277 ? 0.9908 1.0162 1.0110 0.0699  0.0724  0.0489  772 LEU A CG  
1785 C CD1 . LEU A 277 ? 0.9699 0.9803 1.0032 0.0553  0.0641  0.0619  772 LEU A CD1 
1786 C CD2 . LEU A 277 ? 0.9985 1.0570 1.0159 0.0785  0.0785  0.0687  772 LEU A CD2 
1787 N N   . LYS A 278 ? 1.0029 0.9313 1.0697 0.0785  0.0916  0.0156  773 LYS A N   
1788 C CA  . LYS A 278 ? 1.0135 0.9192 1.0938 0.0866  0.1018  -0.0014 773 LYS A CA  
1789 C C   . LYS A 278 ? 1.0859 0.9706 1.1728 0.0767  0.0973  -0.0255 773 LYS A C   
1790 O O   . LYS A 278 ? 1.0540 0.9254 1.1498 0.0654  0.0919  -0.0170 773 LYS A O   
1791 C CB  . LYS A 278 ? 1.0197 0.9093 1.1209 0.0914  0.1095  0.0189  773 LYS A CB  
1792 C CG  . LYS A 278 ? 0.9925 0.9002 1.0949 0.1051  0.1174  0.0346  773 LYS A CG  
1793 N N   . ARG A 279 ? 1.1026 0.9881 1.1860 0.0811  0.0989  -0.0567 774 ARG A N   
1794 C CA  . ARG A 279 ? 1.1313 1.0019 1.2247 0.0713  0.0934  -0.0858 774 ARG A CA  
1795 C C   . ARG A 279 ? 1.1945 1.0265 1.3229 0.0636  0.0987  -0.0855 774 ARG A C   
1796 O O   . ARG A 279 ? 1.1860 1.0098 1.3236 0.0505  0.0913  -0.0943 774 ARG A O   
1797 C CB  . ARG A 279 ? 1.1865 1.0695 1.2710 0.0797  0.0938  -0.1236 774 ARG A CB  
1798 C CG  . ARG A 279 ? 1.3089 1.2355 1.3583 0.0834  0.0844  -0.1274 774 ARG A CG  
1799 C CD  . ARG A 279 ? 1.3993 1.3481 1.4331 0.0994  0.0883  -0.1568 774 ARG A CD  
1800 N NE  . ARG A 279 ? 1.4284 1.4239 1.4281 0.1054  0.0805  -0.1562 774 ARG A NE  
1801 C CZ  . ARG A 279 ? 1.5804 1.6100 1.5565 0.1232  0.0868  -0.1521 774 ARG A CZ  
1802 N NH1 . ARG A 279 ? 1.4371 1.4590 1.4192 0.1364  0.1003  -0.1515 774 ARG A NH1 
1803 N NH2 . ARG A 279 ? 1.3517 1.4258 1.2993 0.1295  0.0808  -0.1476 774 ARG A NH2 
1804 N N   . ASP A 280 ? 1.1626 0.9733 1.3126 0.0727  0.1125  -0.0735 775 ASP A N   
1805 C CA  . ASP A 280 ? 1.1666 0.9427 1.3531 0.0686  0.1211  -0.0659 775 ASP A CA  
1806 C C   . ASP A 280 ? 1.1618 0.9414 1.3449 0.0626  0.1169  -0.0310 775 ASP A C   
1807 O O   . ASP A 280 ? 1.1361 0.9295 1.3080 0.0705  0.1185  -0.0054 775 ASP A O   
1808 C CB  . ASP A 280 ? 1.2221 0.9778 1.4333 0.0835  0.1388  -0.0619 775 ASP A CB  
1809 C CG  . ASP A 280 ? 1.4289 1.1470 1.6855 0.0820  0.1517  -0.0563 775 ASP A CG  
1810 O OD1 . ASP A 280 ? 1.4421 1.1460 1.7171 0.0681  0.1476  -0.0675 775 ASP A OD1 
1811 O OD2 . ASP A 280 ? 1.5260 1.2298 1.8035 0.0956  0.1672  -0.0406 775 ASP A OD2 
1812 N N   . PRO A 281 ? 1.0941 0.8647 1.2870 0.0490  0.1108  -0.0309 776 PRO A N   
1813 C CA  . PRO A 281 ? 1.0566 0.8328 1.2445 0.0453  0.1072  0.0001  776 PRO A CA  
1814 C C   . PRO A 281 ? 1.0944 0.8608 1.2993 0.0573  0.1201  0.0277  776 PRO A C   
1815 O O   . PRO A 281 ? 1.0664 0.8499 1.2575 0.0607  0.1164  0.0526  776 PRO A O   
1816 C CB  . PRO A 281 ? 1.0783 0.8410 1.2835 0.0315  0.1036  -0.0077 776 PRO A CB  
1817 C CG  . PRO A 281 ? 1.1584 0.9211 1.3651 0.0252  0.0981  -0.0443 776 PRO A CG  
1818 C CD  . PRO A 281 ? 1.1286 0.8854 1.3402 0.0373  0.1074  -0.0595 776 PRO A CD  
1819 N N   . LYS A 282 ? 1.0663 0.8073 1.3027 0.0647  0.1353  0.0219  777 LYS A N   
1820 C CA  . LYS A 282 ? 1.0608 0.7919 1.3185 0.0794  0.1508  0.0485  777 LYS A CA  
1821 C C   . LYS A 282 ? 1.0708 0.8275 1.3054 0.0922  0.1495  0.0626  777 LYS A C   
1822 O O   . LYS A 282 ? 1.0488 0.8171 1.2841 0.1017  0.1529  0.0923  777 LYS A O   
1823 C CB  . LYS A 282 ? 1.1228 0.8199 1.4223 0.0843  0.1678  0.0341  777 LYS A CB  
1824 N N   . GLN A 283 ? 1.0160 0.7863 1.2297 0.0926  0.1438  0.0417  778 GLN A N   
1825 C CA  . GLN A 283 ? 1.0006 0.7968 1.1959 0.1035  0.1430  0.0527  778 GLN A CA  
1826 C C   . GLN A 283 ? 1.0373 0.8652 1.2012 0.0949  0.1264  0.0568  778 GLN A C   
1827 O O   . GLN A 283 ? 1.0283 0.8789 1.1778 0.1003  0.1246  0.0585  778 GLN A O   
1828 C CB  . GLN A 283 ? 1.0367 0.8272 1.2367 0.1143  0.1529  0.0315  778 GLN A CB  
1829 N N   . ARG A 284 ? 0.9791 0.8083 1.1363 0.0820  0.1159  0.0604  779 ARG A N   
1830 C CA  . ARG A 284 ? 0.9452 0.7998 1.0792 0.0734  0.1016  0.0651  779 ARG A CA  
1831 C C   . ARG A 284 ? 0.9740 0.8417 1.1087 0.0746  0.0971  0.0904  779 ARG A C   
1832 O O   . ARG A 284 ? 0.9998 0.8552 1.1477 0.0775  0.1022  0.1019  779 ARG A O   
1833 C CB  . ARG A 284 ? 0.9236 0.7726 1.0497 0.0592  0.0925  0.0487  779 ARG A CB  
1834 C CG  . ARG A 284 ? 0.9533 0.8267 1.0579 0.0518  0.0803  0.0493  779 ARG A CG  
1835 C CD  . ARG A 284 ? 0.9091 0.7783 1.0077 0.0400  0.0725  0.0337  779 ARG A CD  
1836 N NE  . ARG A 284 ? 0.9184 0.7843 1.0157 0.0415  0.0749  0.0078  779 ARG A NE  
1837 C CZ  . ARG A 284 ? 1.0456 0.9013 1.1485 0.0333  0.0713  -0.0119 779 ARG A CZ  
1838 N NH1 . ARG A 284 ? 0.7928 0.6395 0.9036 0.0229  0.0664  -0.0057 779 ARG A NH1 
1839 N NH2 . ARG A 284 ? 0.9888 0.8461 1.0908 0.0358  0.0721  -0.0393 779 ARG A NH2 
1840 N N   . ILE A 285 ? 0.8756 0.7700 0.9985 0.0732  0.0882  0.0988  780 ILE A N   
1841 C CA  . ILE A 285 ? 0.8499 0.7624 0.9735 0.0741  0.0813  0.1169  780 ILE A CA  
1842 C C   . ILE A 285 ? 0.8854 0.7913 1.0049 0.0648  0.0741  0.1176  780 ILE A C   
1843 O O   . ILE A 285 ? 0.8937 0.7903 1.0061 0.0537  0.0694  0.1048  780 ILE A O   
1844 C CB  . ILE A 285 ? 0.8718 0.8132 0.9911 0.0723  0.0732  0.1209  780 ILE A CB  
1845 C CG1 . ILE A 285 ? 0.8597 0.8241 0.9840 0.0748  0.0653  0.1351  780 ILE A CG1 
1846 C CG2 . ILE A 285 ? 0.8817 0.8265 0.9901 0.0596  0.0654  0.1100  780 ILE A CG2 
1847 C CD1 . ILE A 285 ? 0.9259 0.9202 1.0580 0.0763  0.0603  0.1409  780 ILE A CD1 
1848 N N   . SER A 286 ? 0.8031 0.7164 0.9267 0.0711  0.0738  0.1331  781 SER A N   
1849 C CA  . SER A 286 ? 0.7752 0.6864 0.8935 0.0643  0.0677  0.1344  781 SER A CA  
1850 C C   . SER A 286 ? 0.8304 0.7656 0.9380 0.0574  0.0526  0.1322  781 SER A C   
1851 O O   . SER A 286 ? 0.8302 0.7855 0.9395 0.0591  0.0478  0.1333  781 SER A O   
1852 C CB  . SER A 286 ? 0.7895 0.6993 0.9167 0.0761  0.0762  0.1524  781 SER A CB  
1853 O OG  . SER A 286 ? 0.8014 0.7399 0.9273 0.0888  0.0737  0.1678  781 SER A OG  
1854 N N   . ILE A 287 ? 0.7801 0.7126 0.8809 0.0490  0.0459  0.1280  782 ILE A N   
1855 C CA  . ILE A 287 ? 0.7574 0.7095 0.8527 0.0427  0.0326  0.1237  782 ILE A CA  
1856 C C   . ILE A 287 ? 0.7837 0.7644 0.8807 0.0530  0.0272  0.1320  782 ILE A C   
1857 O O   . ILE A 287 ? 0.7696 0.7695 0.8721 0.0500  0.0188  0.1275  782 ILE A O   
1858 C CB  . ILE A 287 ? 0.7902 0.7325 0.8790 0.0317  0.0270  0.1154  782 ILE A CB  
1859 C CG1 . ILE A 287 ? 0.7915 0.7230 0.8795 0.0212  0.0265  0.1053  782 ILE A CG1 
1860 C CG2 . ILE A 287 ? 0.7895 0.7511 0.8759 0.0294  0.0153  0.1122  782 ILE A CG2 
1861 C CD1 . ILE A 287 ? 0.9083 0.8238 0.9925 0.0138  0.0271  0.0992  782 ILE A CD1 
1862 N N   . PRO A 288 ? 0.7232 0.7107 0.8186 0.0663  0.0326  0.1451  783 PRO A N   
1863 C CA  . PRO A 288 ? 0.7153 0.7381 0.8105 0.0786  0.0264  0.1525  783 PRO A CA  
1864 C C   . PRO A 288 ? 0.7336 0.7716 0.8396 0.0823  0.0257  0.1544  783 PRO A C   
1865 O O   . PRO A 288 ? 0.7227 0.7910 0.8330 0.0827  0.0139  0.1495  783 PRO A O   
1866 C CB  . PRO A 288 ? 0.7520 0.7760 0.8456 0.0949  0.0379  0.1719  783 PRO A CB  
1867 C CG  . PRO A 288 ? 0.8061 0.7989 0.8989 0.0872  0.0454  0.1706  783 PRO A CG  
1868 C CD  . PRO A 288 ? 0.7431 0.7105 0.8398 0.0716  0.0450  0.1552  783 PRO A CD  
1869 N N   . GLU A 289 ? 0.6631 0.6799 0.7757 0.0840  0.0381  0.1588  784 GLU A N   
1870 C CA  . GLU A 289 ? 0.6433 0.6694 0.7664 0.0878  0.0409  0.1611  784 GLU A CA  
1871 C C   . GLU A 289 ? 0.6922 0.7254 0.8195 0.0739  0.0314  0.1482  784 GLU A C   
1872 O O   . GLU A 289 ? 0.7008 0.7603 0.8397 0.0759  0.0259  0.1498  784 GLU A O   
1873 C CB  . GLU A 289 ? 0.6620 0.6605 0.7902 0.0932  0.0573  0.1650  784 GLU A CB  
1874 C CG  . GLU A 289 ? 0.7228 0.7283 0.8603 0.1123  0.0685  0.1837  784 GLU A CG  
1875 C CD  . GLU A 289 ? 1.1213 1.0926 1.2671 0.1179  0.0857  0.1885  784 GLU A CD  
1876 O OE1 . GLU A 289 ? 1.1865 1.1352 1.3366 0.1135  0.0926  0.1767  784 GLU A OE1 
1877 O OE2 . GLU A 289 ? 1.0972 1.0660 1.2474 0.1274  0.0928  0.2038  784 GLU A OE2 
1878 N N   . LEU A 290 ? 0.6434 0.6567 0.7647 0.0604  0.0296  0.1371  785 LEU A N   
1879 C CA  . LEU A 290 ? 0.6426 0.6640 0.7716 0.0487  0.0226  0.1294  785 LEU A CA  
1880 C C   . LEU A 290 ? 0.7285 0.7757 0.8680 0.0439  0.0084  0.1246  785 LEU A C   
1881 O O   . LEU A 290 ? 0.7390 0.8050 0.8970 0.0399  0.0039  0.1237  785 LEU A O   
1882 C CB  . LEU A 290 ? 0.6320 0.6310 0.7526 0.0374  0.0238  0.1211  785 LEU A CB  
1883 C CG  . LEU A 290 ? 0.6841 0.6666 0.7988 0.0396  0.0348  0.1196  785 LEU A CG  
1884 C CD1 . LEU A 290 ? 0.6870 0.6495 0.7906 0.0317  0.0348  0.1109  785 LEU A CD1 
1885 C CD2 . LEU A 290 ? 0.6946 0.6913 0.8178 0.0393  0.0371  0.1220  785 LEU A CD2 
1886 N N   . LEU A 291 ? 0.6708 0.7211 0.8012 0.0453  0.0017  0.1208  786 LEU A N   
1887 C CA  . LEU A 291 ? 0.6526 0.7286 0.7915 0.0422  -0.0129 0.1108  786 LEU A CA  
1888 C C   . LEU A 291 ? 0.7124 0.8247 0.8643 0.0516  -0.0188 0.1139  786 LEU A C   
1889 O O   . LEU A 291 ? 0.7083 0.8464 0.8745 0.0474  -0.0323 0.1018  786 LEU A O   
1890 C CB  . LEU A 291 ? 0.6487 0.7226 0.7711 0.0450  -0.0171 0.1060  786 LEU A CB  
1891 C CG  . LEU A 291 ? 0.6803 0.7249 0.7945 0.0344  -0.0144 0.1005  786 LEU A CG  
1892 C CD1 . LEU A 291 ? 0.6768 0.7124 0.7729 0.0419  -0.0096 0.1058  786 LEU A CD1 
1893 C CD2 . LEU A 291 ? 0.6883 0.7373 0.8150 0.0225  -0.0252 0.0856  786 LEU A CD2 
1894 N N   . ALA A 292 ? 0.6723 0.7873 0.8222 0.0641  -0.0088 0.1288  787 ALA A N   
1895 C CA  . ALA A 292 ? 0.6680 0.8186 0.8309 0.0748  -0.0125 0.1352  787 ALA A CA  
1896 C C   . ALA A 292 ? 0.7340 0.8842 0.9150 0.0725  -0.0054 0.1413  787 ALA A C   
1897 O O   . ALA A 292 ? 0.7450 0.9241 0.9391 0.0820  -0.0064 0.1488  787 ALA A O   
1898 C CB  . ALA A 292 ? 0.6852 0.8435 0.8343 0.0946  -0.0049 0.1514  787 ALA A CB  
1899 N N   . HIS A 293 ? 0.6725 0.7949 0.8541 0.0615  0.0020  0.1389  788 HIS A N   
1900 C CA  . HIS A 293 ? 0.6682 0.7930 0.8645 0.0613  0.0104  0.1457  788 HIS A CA  
1901 C C   . HIS A 293 ? 0.7361 0.8893 0.9630 0.0520  0.0005  0.1416  788 HIS A C   
1902 O O   . HIS A 293 ? 0.7165 0.8715 0.9526 0.0397  -0.0103 0.1297  788 HIS A O   
1903 C CB  . HIS A 293 ? 0.6772 0.7707 0.8623 0.0551  0.0208  0.1443  788 HIS A CB  
1904 C CG  . HIS A 293 ? 0.7246 0.8210 0.9174 0.0597  0.0324  0.1521  788 HIS A CG  
1905 N ND1 . HIS A 293 ? 0.7446 0.8617 0.9619 0.0536  0.0310  0.1559  788 HIS A ND1 
1906 C CD2 . HIS A 293 ? 0.7639 0.8447 0.9442 0.0699  0.0462  0.1556  788 HIS A CD2 
1907 C CE1 . HIS A 293 ? 0.7489 0.8659 0.9649 0.0621  0.0442  0.1638  788 HIS A CE1 
1908 N NE2 . HIS A 293 ? 0.7647 0.8595 0.9575 0.0720  0.0532  0.1618  788 HIS A NE2 
1909 N N   . PRO A 294 ? 0.7426 0.9176 0.9899 0.0573  0.0050  0.1512  789 PRO A N   
1910 C CA  . PRO A 294 ? 0.7490 0.9528 1.0342 0.0471  -0.0037 0.1481  789 PRO A CA  
1911 C C   . PRO A 294 ? 0.8306 1.0206 1.1319 0.0303  -0.0036 0.1436  789 PRO A C   
1912 O O   . PRO A 294 ? 0.8291 1.0369 1.1634 0.0188  -0.0144 0.1351  789 PRO A O   
1913 C CB  . PRO A 294 ? 0.7710 0.9926 1.0703 0.0573  0.0069  0.1633  789 PRO A CB  
1914 C CG  . PRO A 294 ? 0.8260 1.0412 1.0991 0.0754  0.0141  0.1709  789 PRO A CG  
1915 C CD  . PRO A 294 ? 0.7726 0.9489 1.0139 0.0734  0.0183  0.1650  789 PRO A CD  
1916 N N   . TYR A 295 ? 0.7989 0.9594 1.0800 0.0297  0.0087  0.1489  790 TYR A N   
1917 C CA  . TYR A 295 ? 0.7873 0.9363 1.0813 0.0170  0.0109  0.1491  790 TYR A CA  
1918 C C   . TYR A 295 ? 0.8229 0.9670 1.1254 0.0049  -0.0028 0.1339  790 TYR A C   
1919 O O   . TYR A 295 ? 0.8255 0.9764 1.1626 -0.0069 -0.0063 0.1319  790 TYR A O   
1920 C CB  . TYR A 295 ? 0.8051 0.9277 1.0685 0.0209  0.0237  0.1543  790 TYR A CB  
1921 C CG  . TYR A 295 ? 0.8310 0.9448 1.1047 0.0104  0.0261  0.1573  790 TYR A CG  
1922 C CD1 . TYR A 295 ? 0.8609 0.9918 1.1699 0.0059  0.0320  0.1702  790 TYR A CD1 
1923 C CD2 . TYR A 295 ? 0.8409 0.9311 1.0921 0.0061  0.0239  0.1497  790 TYR A CD2 
1924 C CE1 . TYR A 295 ? 0.8742 0.9985 1.1964 -0.0019 0.0362  0.1772  790 TYR A CE1 
1925 C CE2 . TYR A 295 ? 0.8499 0.9343 1.1115 -0.0015 0.0270  0.1551  790 TYR A CE2 
1926 C CZ  . TYR A 295 ? 0.9438 1.0451 1.2411 -0.0049 0.0335  0.1697  790 TYR A CZ  
1927 O OH  . TYR A 295 ? 0.9645 1.0616 1.2759 -0.0106 0.0386  0.1793  790 TYR A OH  
1928 N N   . VAL A 296 ? 0.7763 0.9099 1.0508 0.0089  -0.0095 0.1236  791 VAL A N   
1929 C CA  . VAL A 296 ? 0.7717 0.9004 1.0460 0.0010  -0.0218 0.1074  791 VAL A CA  
1930 C C   . VAL A 296 ? 0.8272 0.9874 1.1237 0.0000  -0.0376 0.0934  791 VAL A C   
1931 O O   . VAL A 296 ? 0.8250 0.9884 1.1418 -0.0105 -0.0482 0.0774  791 VAL A O   
1932 C CB  . VAL A 296 ? 0.8229 0.9268 1.0561 0.0072  -0.0189 0.1055  791 VAL A CB  
1933 C CG1 . VAL A 296 ? 0.8230 0.9242 1.0512 0.0026  -0.0304 0.0898  791 VAL A CG1 
1934 C CG2 . VAL A 296 ? 0.8229 0.9004 1.0405 0.0059  -0.0062 0.1142  791 VAL A CG2 
1935 N N   . GLN A 297 ? 0.7831 0.9690 1.0784 0.0114  -0.0394 0.0982  792 GLN A N   
1936 C CA  . GLN A 297 ? 0.7776 1.0007 1.0892 0.0134  -0.0559 0.0840  792 GLN A CA  
1937 C C   . GLN A 297 ? 0.8246 1.0782 1.1850 0.0051  -0.0626 0.0802  792 GLN A C   
1938 O O   . GLN A 297 ? 0.8231 1.1046 1.2072 0.0001  -0.0794 0.0599  792 GLN A O   
1939 C CB  . GLN A 297 ? 0.7963 1.0368 1.0799 0.0328  -0.0556 0.0921  792 GLN A CB  
1940 C CG  . GLN A 297 ? 0.7803 0.9996 1.0231 0.0416  -0.0521 0.0933  792 GLN A CG  
1941 C CD  . GLN A 297 ? 0.9054 1.1301 1.1441 0.0364  -0.0659 0.0724  792 GLN A CD  
1942 O OE1 . GLN A 297 ? 0.8655 1.1225 1.1262 0.0327  -0.0820 0.0538  792 GLN A OE1 
1943 N NE2 . GLN A 297 ? 0.7293 0.9246 0.9411 0.0368  -0.0602 0.0732  792 GLN A NE2 
1944 N N   . ILE A 298 ? 0.7825 1.0342 1.1587 0.0049  -0.0495 0.0987  793 ILE A N   
1945 C CA  . ILE A 298 ? 0.7771 1.0593 1.2031 -0.0016 -0.0522 0.1010  793 ILE A CA  
1946 C C   . ILE A 298 ? 0.8471 1.1186 1.3160 -0.0193 -0.0486 0.1009  793 ILE A C   
1947 O O   . ILE A 298 ? 0.8364 1.0777 1.2935 -0.0214 -0.0342 0.1143  793 ILE A O   
1948 C CB  . ILE A 298 ? 0.8101 1.1045 1.2297 0.0126  -0.0394 0.1233  793 ILE A CB  
1949 C CG1 . ILE A 298 ? 0.8213 1.1430 1.2215 0.0288  -0.0478 0.1213  793 ILE A CG1 
1950 C CG2 . ILE A 298 ? 0.8132 1.1296 1.2828 0.0058  -0.0343 0.1340  793 ILE A CG2 
1951 C CD1 . ILE A 298 ? 0.9320 1.2517 1.3115 0.0455  -0.0337 0.1413  793 ILE A CD1 
1952 N N   . GLN A 299 ? 0.8229 1.1228 1.3455 -0.0314 -0.0616 0.0861  794 GLN A N   
1953 C CA  . GLN A 299 ? 1.1304 1.4275 1.7120 -0.0494 -0.0590 0.0856  794 GLN A CA  
1954 C C   . GLN A 299 ? 1.2085 1.5194 1.8207 -0.0481 -0.0434 0.1127  794 GLN A C   
1955 O O   . GLN A 299 ? 0.6883 0.9915 1.3417 -0.0586 -0.0326 0.1253  794 GLN A O   
1956 C CB  . GLN A 299 ? 1.1509 1.4765 1.7820 -0.0621 -0.0805 0.0549  794 GLN A CB  
1957 C CG  . GLN A 299 ? 1.2912 1.6069 1.8977 -0.0634 -0.0958 0.0255  794 GLN A CG  
1958 C CD  . GLN A 299 ? 1.4679 1.8154 2.0385 -0.0487 -0.1115 0.0107  794 GLN A CD  
1959 O OE1 . GLN A 299 ? 1.3928 1.7377 1.9130 -0.0316 -0.1041 0.0279  794 GLN A OE1 
1960 N NE2 . GLN A 299 ? 1.3463 1.7256 1.9436 -0.0540 -0.1330 -0.0221 794 GLN A NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   496 ?   ?   ?   A . n 
A 1 2   HIS 2   497 ?   ?   ?   A . n 
A 1 3   HIS 3   498 ?   ?   ?   A . n 
A 1 4   HIS 4   499 ?   ?   ?   A . n 
A 1 5   HIS 5   500 ?   ?   ?   A . n 
A 1 6   HIS 6   501 ?   ?   ?   A . n 
A 1 7   HIS 7   502 ?   ?   ?   A . n 
A 1 8   SER 8   503 ?   ?   ?   A . n 
A 1 9   SER 9   504 ?   ?   ?   A . n 
A 1 10  GLY 10  505 ?   ?   ?   A . n 
A 1 11  VAL 11  506 ?   ?   ?   A . n 
A 1 12  ASP 12  507 ?   ?   ?   A . n 
A 1 13  LEU 13  508 ?   ?   ?   A . n 
A 1 14  GLY 14  509 ?   ?   ?   A . n 
A 1 15  THR 15  510 ?   ?   ?   A . n 
A 1 16  GLU 16  511 ?   ?   ?   A . n 
A 1 17  ASN 17  512 ?   ?   ?   A . n 
A 1 18  LEU 18  513 ?   ?   ?   A . n 
A 1 19  TYR 19  514 ?   ?   ?   A . n 
A 1 20  PHE 20  515 ?   ?   ?   A . n 
A 1 21  GLN 21  516 516 GLN GLN A . n 
A 1 22  SER 22  517 517 SER SER A . n 
A 1 23  MET 23  518 518 MET MET A . n 
A 1 24  SER 24  519 519 SER SER A . n 
A 1 25  VAL 25  520 520 VAL VAL A . n 
A 1 26  LYS 26  521 521 LYS LYS A . n 
A 1 27  GLY 27  522 522 GLY GLY A . n 
A 1 28  ARG 28  523 523 ARG ARG A . n 
A 1 29  ILE 29  524 524 ILE ILE A . n 
A 1 30  TYR 30  525 525 TYR TYR A . n 
A 1 31  SER 31  526 526 SER SER A . n 
A 1 32  ILE 32  527 527 ILE ILE A . n 
A 1 33  LEU 33  528 528 LEU LEU A . n 
A 1 34  LYS 34  529 529 LYS LYS A . n 
A 1 35  GLN 35  530 530 GLN GLN A . n 
A 1 36  ILE 36  531 531 ILE ILE A . n 
A 1 37  GLY 37  532 532 GLY GLY A . n 
A 1 38  SER 38  533 533 SER SER A . n 
A 1 39  GLY 39  534 534 GLY GLY A . n 
A 1 40  GLY 40  535 535 GLY GLY A . n 
A 1 41  SER 41  536 536 SER SER A . n 
A 1 42  SER 42  537 537 SER SER A . n 
A 1 43  LYS 43  538 538 LYS LYS A . n 
A 1 44  VAL 44  539 539 VAL VAL A . n 
A 1 45  PHE 45  540 540 PHE PHE A . n 
A 1 46  GLN 46  541 541 GLN GLN A . n 
A 1 47  VAL 47  542 542 VAL VAL A . n 
A 1 48  LEU 48  543 543 LEU LEU A . n 
A 1 49  ASN 49  544 544 ASN ASN A . n 
A 1 50  GLU 50  545 545 GLU GLU A . n 
A 1 51  LYS 51  546 546 LYS LYS A . n 
A 1 52  LYS 52  547 547 LYS LYS A . n 
A 1 53  GLN 53  548 548 GLN GLN A . n 
A 1 54  ILE 54  549 549 ILE ILE A . n 
A 1 55  TYR 55  550 550 TYR TYR A . n 
A 1 56  ALA 56  551 551 ALA ALA A . n 
A 1 57  ILE 57  552 552 ILE ILE A . n 
A 1 58  LYS 58  553 553 LYS LYS A . n 
A 1 59  TYR 59  554 554 TYR TYR A . n 
A 1 60  VAL 60  555 555 VAL VAL A . n 
A 1 61  ASN 61  556 556 ASN ASN A . n 
A 1 62  LEU 62  557 557 LEU LEU A . n 
A 1 63  GLU 63  558 558 GLU GLU A . n 
A 1 64  GLU 64  559 559 GLU GLU A . n 
A 1 65  ALA 65  560 560 ALA ALA A . n 
A 1 66  ASP 66  561 561 ASP ASP A . n 
A 1 67  ASN 67  562 562 ASN ASN A . n 
A 1 68  GLN 68  563 563 GLN GLN A . n 
A 1 69  THR 69  564 564 THR THR A . n 
A 1 70  LEU 70  565 565 LEU LEU A . n 
A 1 71  ASP 71  566 566 ASP ASP A . n 
A 1 72  SER 72  567 567 SER SER A . n 
A 1 73  TYR 73  568 568 TYR TYR A . n 
A 1 74  ARG 74  569 569 ARG ARG A . n 
A 1 75  ASN 75  570 570 ASN ASN A . n 
A 1 76  GLU 76  571 571 GLU GLU A . n 
A 1 77  ILE 77  572 572 ILE ILE A . n 
A 1 78  ALA 78  573 573 ALA ALA A . n 
A 1 79  TYR 79  574 574 TYR TYR A . n 
A 1 80  LEU 80  575 575 LEU LEU A . n 
A 1 81  ASN 81  576 576 ASN ASN A . n 
A 1 82  LYS 82  577 577 LYS LYS A . n 
A 1 83  LEU 83  578 578 LEU LEU A . n 
A 1 84  GLN 84  579 579 GLN GLN A . n 
A 1 85  GLN 85  580 580 GLN GLN A . n 
A 1 86  HIS 86  581 581 HIS HIS A . n 
A 1 87  SER 87  582 582 SER SER A . n 
A 1 88  ASP 88  583 583 ASP ASP A . n 
A 1 89  LYS 89  584 584 LYS LYS A . n 
A 1 90  ILE 90  585 585 ILE ILE A . n 
A 1 91  ILE 91  586 586 ILE ILE A . n 
A 1 92  ARG 92  587 587 ARG ARG A . n 
A 1 93  LEU 93  588 588 LEU LEU A . n 
A 1 94  TYR 94  589 589 TYR TYR A . n 
A 1 95  ASP 95  590 590 ASP ASP A . n 
A 1 96  TYR 96  591 591 TYR TYR A . n 
A 1 97  GLU 97  592 592 GLU GLU A . n 
A 1 98  ILE 98  593 593 ILE ILE A . n 
A 1 99  THR 99  594 594 THR THR A . n 
A 1 100 ASP 100 595 595 ASP ASP A . n 
A 1 101 GLN 101 596 596 GLN GLN A . n 
A 1 102 TYR 102 597 597 TYR TYR A . n 
A 1 103 ILE 103 598 598 ILE ILE A . n 
A 1 104 TYR 104 599 599 TYR TYR A . n 
A 1 105 MET 105 600 600 MET MET A . n 
A 1 106 VAL 106 601 601 VAL VAL A . n 
A 1 107 MET 107 602 602 MET MET A . n 
A 1 108 GLU 108 603 603 GLU GLU A . n 
A 1 109 CYS 109 604 604 CYS CYS A . n 
A 1 110 GLY 110 605 605 GLY GLY A . n 
A 1 111 ASN 111 606 606 ASN ASN A . n 
A 1 112 ILE 112 607 607 ILE ILE A . n 
A 1 113 ASP 113 608 608 ASP ASP A . n 
A 1 114 LEU 114 609 609 LEU LEU A . n 
A 1 115 ASN 115 610 610 ASN ASN A . n 
A 1 116 SER 116 611 611 SER SER A . n 
A 1 117 TRP 117 612 612 TRP TRP A . n 
A 1 118 LEU 118 613 613 LEU LEU A . n 
A 1 119 LYS 119 614 614 LYS LYS A . n 
A 1 120 LYS 120 615 615 LYS LYS A . n 
A 1 121 LYS 121 616 616 LYS LYS A . n 
A 1 122 LYS 122 617 617 LYS LYS A . n 
A 1 123 SER 123 618 618 SER SER A . n 
A 1 124 ILE 124 619 619 ILE ILE A . n 
A 1 125 ASP 125 620 620 ASP ASP A . n 
A 1 126 PRO 126 621 621 PRO PRO A . n 
A 1 127 TRP 127 622 622 TRP TRP A . n 
A 1 128 GLU 128 623 623 GLU GLU A . n 
A 1 129 ARG 129 624 624 ARG ARG A . n 
A 1 130 LYS 130 625 625 LYS LYS A . n 
A 1 131 SER 131 626 626 SER SER A . n 
A 1 132 TYR 132 627 627 TYR TYR A . n 
A 1 133 TRP 133 628 628 TRP TRP A . n 
A 1 134 LYS 134 629 629 LYS LYS A . n 
A 1 135 ASN 135 630 630 ASN ASN A . n 
A 1 136 MET 136 631 631 MET MET A . n 
A 1 137 LEU 137 632 632 LEU LEU A . n 
A 1 138 GLU 138 633 633 GLU GLU A . n 
A 1 139 ALA 139 634 634 ALA ALA A . n 
A 1 140 VAL 140 635 635 VAL VAL A . n 
A 1 141 HIS 141 636 636 HIS HIS A . n 
A 1 142 THR 142 637 637 THR THR A . n 
A 1 143 ILE 143 638 638 ILE ILE A . n 
A 1 144 HIS 144 639 639 HIS HIS A . n 
A 1 145 GLN 145 640 640 GLN GLN A . n 
A 1 146 HIS 146 641 641 HIS HIS A . n 
A 1 147 GLY 147 642 642 GLY GLY A . n 
A 1 148 ILE 148 643 643 ILE ILE A . n 
A 1 149 VAL 149 644 644 VAL VAL A . n 
A 1 150 HIS 150 645 645 HIS HIS A . n 
A 1 151 SER 151 646 646 SER SER A . n 
A 1 152 ASP 152 647 647 ASP ASP A . n 
A 1 153 LEU 153 648 648 LEU LEU A . n 
A 1 154 LYS 154 649 649 LYS LYS A . n 
A 1 155 PRO 155 650 650 PRO PRO A . n 
A 1 156 ALA 156 651 651 ALA ALA A . n 
A 1 157 ASN 157 652 652 ASN ASN A . n 
A 1 158 PHE 158 653 653 PHE PHE A . n 
A 1 159 LEU 159 654 654 LEU LEU A . n 
A 1 160 ILE 160 655 655 ILE ILE A . n 
A 1 161 VAL 161 656 656 VAL VAL A . n 
A 1 162 ASP 162 657 657 ASP ASP A . n 
A 1 163 GLY 163 658 658 GLY GLY A . n 
A 1 164 MET 164 659 659 MET MET A . n 
A 1 165 LEU 165 660 660 LEU LEU A . n 
A 1 166 LYS 166 661 661 LYS LYS A . n 
A 1 167 LEU 167 662 662 LEU LEU A . n 
A 1 168 ILE 168 663 663 ILE ILE A . n 
A 1 169 ASP 169 664 664 ASP ASP A . n 
A 1 170 PHE 170 665 665 PHE PHE A . n 
A 1 171 GLY 171 666 666 GLY GLY A . n 
A 1 172 ILE 172 667 667 ILE ILE A . n 
A 1 173 ALA 173 668 668 ALA ALA A . n 
A 1 174 ASN 174 669 669 ASN ASN A . n 
A 1 175 GLN 175 670 ?   ?   ?   A . n 
A 1 176 MET 176 671 ?   ?   ?   A . n 
A 1 177 GLN 177 672 ?   ?   ?   A . n 
A 1 178 PRO 178 673 ?   ?   ?   A . n 
A 1 179 ASP 179 674 ?   ?   ?   A . n 
A 1 180 THR 180 675 ?   ?   ?   A . n 
A 1 181 THR 181 676 ?   ?   ?   A . n 
A 1 182 SER 182 677 ?   ?   ?   A . n 
A 1 183 VAL 183 678 ?   ?   ?   A . n 
A 1 184 VAL 184 679 ?   ?   ?   A . n 
A 1 185 LYS 185 680 ?   ?   ?   A . n 
A 1 186 ASP 186 681 ?   ?   ?   A . n 
A 1 187 SER 187 682 ?   ?   ?   A . n 
A 1 188 GLN 188 683 683 GLN GLN A . n 
A 1 189 VAL 189 684 684 VAL VAL A . n 
A 1 190 GLY 190 685 685 GLY GLY A . n 
A 1 191 THR 191 686 686 THR THR A . n 
A 1 192 VAL 192 687 687 VAL VAL A . n 
A 1 193 ASN 193 688 688 ASN ASN A . n 
A 1 194 TYR 194 689 689 TYR TYR A . n 
A 1 195 MET 195 690 690 MET MET A . n 
A 1 196 PRO 196 691 691 PRO PRO A . n 
A 1 197 PRO 197 692 692 PRO PRO A . n 
A 1 198 GLU 198 693 693 GLU GLU A . n 
A 1 199 ALA 199 694 694 ALA ALA A . n 
A 1 200 ILE 200 695 695 ILE ILE A . n 
A 1 201 LYS 201 696 696 LYS LYS A . n 
A 1 202 ASP 202 697 697 ASP ASP A . n 
A 1 203 MET 203 698 ?   ?   ?   A . n 
A 1 204 SER 204 699 ?   ?   ?   A . n 
A 1 205 SER 205 700 ?   ?   ?   A . n 
A 1 206 SER 206 701 ?   ?   ?   A . n 
A 1 207 ARG 207 702 ?   ?   ?   A . n 
A 1 208 GLU 208 703 ?   ?   ?   A . n 
A 1 209 ASN 209 704 ?   ?   ?   A . n 
A 1 210 GLY 210 705 ?   ?   ?   A . n 
A 1 211 LYS 211 706 ?   ?   ?   A . n 
A 1 212 SER 212 707 ?   ?   ?   A . n 
A 1 213 LYS 213 708 ?   ?   ?   A . n 
A 1 214 SER 214 709 ?   ?   ?   A . n 
A 1 215 LYS 215 710 ?   ?   ?   A . n 
A 1 216 ILE 216 711 711 ILE ILE A . n 
A 1 217 SER 217 712 712 SER SER A . n 
A 1 218 PRO 218 713 713 PRO PRO A . n 
A 1 219 LYS 219 714 714 LYS LYS A . n 
A 1 220 SER 220 715 715 SER SER A . n 
A 1 221 ASP 221 716 716 ASP ASP A . n 
A 1 222 VAL 222 717 717 VAL VAL A . n 
A 1 223 TRP 223 718 718 TRP TRP A . n 
A 1 224 SER 224 719 719 SER SER A . n 
A 1 225 LEU 225 720 720 LEU LEU A . n 
A 1 226 GLY 226 721 721 GLY GLY A . n 
A 1 227 CYS 227 722 722 CYS CYS A . n 
A 1 228 ILE 228 723 723 ILE ILE A . n 
A 1 229 LEU 229 724 724 LEU LEU A . n 
A 1 230 TYR 230 725 725 TYR TYR A . n 
A 1 231 TYR 231 726 726 TYR TYR A . n 
A 1 232 MET 232 727 727 MET MET A . n 
A 1 233 THR 233 728 728 THR THR A . n 
A 1 234 TYR 234 729 729 TYR TYR A . n 
A 1 235 GLY 235 730 730 GLY GLY A . n 
A 1 236 LYS 236 731 731 LYS LYS A . n 
A 1 237 THR 237 732 732 THR THR A . n 
A 1 238 PRO 238 733 733 PRO PRO A . n 
A 1 239 PHE 239 734 734 PHE PHE A . n 
A 1 240 GLN 240 735 735 GLN GLN A . n 
A 1 241 GLN 241 736 736 GLN GLN A . n 
A 1 242 ILE 242 737 737 ILE ILE A . n 
A 1 243 ILE 243 738 738 ILE ILE A . n 
A 1 244 ASN 244 739 739 ASN ASN A . n 
A 1 245 GLN 245 740 740 GLN GLN A . n 
A 1 246 ILE 246 741 741 ILE ILE A . n 
A 1 247 SER 247 742 742 SER SER A . n 
A 1 248 LYS 248 743 743 LYS LYS A . n 
A 1 249 LEU 249 744 744 LEU LEU A . n 
A 1 250 HIS 250 745 745 HIS HIS A . n 
A 1 251 ALA 251 746 746 ALA ALA A . n 
A 1 252 ILE 252 747 747 ILE ILE A . n 
A 1 253 ILE 253 748 748 ILE ILE A . n 
A 1 254 ASP 254 749 749 ASP ASP A . n 
A 1 255 PRO 255 750 750 PRO PRO A . n 
A 1 256 ASN 256 751 751 ASN ASN A . n 
A 1 257 HIS 257 752 752 HIS HIS A . n 
A 1 258 GLU 258 753 753 GLU GLU A . n 
A 1 259 ILE 259 754 754 ILE ILE A . n 
A 1 260 GLU 260 755 755 GLU GLU A . n 
A 1 261 PHE 261 756 756 PHE PHE A . n 
A 1 262 PRO 262 757 757 PRO PRO A . n 
A 1 263 ASP 263 758 758 ASP ASP A . n 
A 1 264 ILE 264 759 759 ILE ILE A . n 
A 1 265 PRO 265 760 760 PRO PRO A . n 
A 1 266 GLU 266 761 761 GLU GLU A . n 
A 1 267 LYS 267 762 762 LYS LYS A . n 
A 1 268 ASP 268 763 763 ASP ASP A . n 
A 1 269 LEU 269 764 764 LEU LEU A . n 
A 1 270 GLN 270 765 765 GLN GLN A . n 
A 1 271 ASP 271 766 766 ASP ASP A . n 
A 1 272 VAL 272 767 767 VAL VAL A . n 
A 1 273 LEU 273 768 768 LEU LEU A . n 
A 1 274 LYS 274 769 769 LYS LYS A . n 
A 1 275 CYS 275 770 770 CYS CYS A . n 
A 1 276 CYS 276 771 771 CYS CYS A . n 
A 1 277 LEU 277 772 772 LEU LEU A . n 
A 1 278 LYS 278 773 773 LYS LYS A . n 
A 1 279 ARG 279 774 774 ARG ARG A . n 
A 1 280 ASP 280 775 775 ASP ASP A . n 
A 1 281 PRO 281 776 776 PRO PRO A . n 
A 1 282 LYS 282 777 777 LYS LYS A . n 
A 1 283 GLN 283 778 778 GLN GLN A . n 
A 1 284 ARG 284 779 779 ARG ARG A . n 
A 1 285 ILE 285 780 780 ILE ILE A . n 
A 1 286 SER 286 781 781 SER SER A . n 
A 1 287 ILE 287 782 782 ILE ILE A . n 
A 1 288 PRO 288 783 783 PRO PRO A . n 
A 1 289 GLU 289 784 784 GLU GLU A . n 
A 1 290 LEU 290 785 785 LEU LEU A . n 
A 1 291 LEU 291 786 786 LEU LEU A . n 
A 1 292 ALA 292 787 787 ALA ALA A . n 
A 1 293 HIS 293 788 788 HIS HIS A . n 
A 1 294 PRO 294 789 789 PRO PRO A . n 
A 1 295 TYR 295 790 790 TYR TYR A . n 
A 1 296 VAL 296 791 791 VAL VAL A . n 
A 1 297 GLN 297 792 792 GLN GLN A . n 
A 1 298 ILE 298 793 793 ILE ILE A . n 
A 1 299 GLN 299 794 794 GLN GLN A . n 
A 1 300 THR 300 795 ?   ?   ?   A . n 
A 1 301 HIS 301 796 ?   ?   ?   A . n 
A 1 302 PRO 302 797 ?   ?   ?   A . n 
A 1 303 VAL 303 798 ?   ?   ?   A . n 
A 1 304 ASN 304 799 ?   ?   ?   A . n 
A 1 305 GLN 305 800 ?   ?   ?   A . n 
A 1 306 MET 306 801 ?   ?   ?   A . n 
A 1 307 ALA 307 802 ?   ?   ?   A . n 
A 1 308 LYS 308 803 ?   ?   ?   A . n 
A 1 309 GLY 309 804 ?   ?   ?   A . n 
A 1 310 THR 310 805 ?   ?   ?   A . n 
A 1 311 THR 311 806 ?   ?   ?   A . n 
A 1 312 GLU 312 807 ?   ?   ?   A . n 
A 1 313 GLU 313 808 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDO 1 1795 1795 EDO EDO A . 
C 3 7PE 1 1796 1796 7PE 7PE A . 
D 4 ZO8 1 1797 1797 ZO8 ZO8 A . 
E 2 EDO 1 1798 1798 EDO EDO A . 
F 5 HOH 1 2001 2001 HOH HOH A . 
F 5 HOH 2 2002 2002 HOH HOH A . 
F 5 HOH 3 2003 2003 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-05-22 
2 'Structure model' 1 1 2013-06-05 
3 'Structure model' 1 2 2019-05-08 
4 'Structure model' 1 3 2019-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Data collection'          
3 3 'Structure model' 'Experimental preparation' 
4 3 'Structure model' Other                      
5 4 'Structure model' 'Data collection'          
6 4 'Structure model' 'Experimental preparation' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow   
2 3 'Structure model' pdbx_database_proc   
3 3 'Structure model' pdbx_database_status 
4 4 'Structure model' exptl_crystal_grow   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'                  
2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3 4 'Structure model' '_exptl_crystal_grow.temp'                    
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         4.9296 
_pdbx_refine_tls.origin_y         32.2326 
_pdbx_refine_tls.origin_z         16.6268 
_pdbx_refine_tls.T[1][1]          -0.1425 
_pdbx_refine_tls.T[2][2]          -0.1932 
_pdbx_refine_tls.T[3][3]          -0.0492 
_pdbx_refine_tls.T[1][2]          -0.0289 
_pdbx_refine_tls.T[1][3]          0.0005 
_pdbx_refine_tls.T[2][3]          0.1026 
_pdbx_refine_tls.L[1][1]          4.9942 
_pdbx_refine_tls.L[2][2]          1.5926 
_pdbx_refine_tls.L[3][3]          1.4667 
_pdbx_refine_tls.L[1][2]          -1.5026 
_pdbx_refine_tls.L[1][3]          -0.8414 
_pdbx_refine_tls.L[2][3]          -0.3436 
_pdbx_refine_tls.S[1][1]          0.0519 
_pdbx_refine_tls.S[1][2]          0.4209 
_pdbx_refine_tls.S[1][3]          0.2480 
_pdbx_refine_tls.S[2][1]          -0.1030 
_pdbx_refine_tls.S[2][2]          -0.0828 
_pdbx_refine_tls.S[2][3]          -0.1060 
_pdbx_refine_tls.S[3][1]          0.0709 
_pdbx_refine_tls.S[3][2]          0.0289 
_pdbx_refine_tls.S[3][3]          0.0309 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   'CHAIN A' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER refinement       2.11.2 ? 1 
MOSFLM 'data reduction' .      ? 2 
SCALA  'data scaling'   .      ? 3 
PHASER phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             4BI2 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE SEQUENCE INCLUDING HEXAHISTIDINE TAG IS AS DESCRIBED
IN NAT. CHEM. BIOL. 2010, 6, 259-368.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    561 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   THR 
_pdbx_validate_close_contact.auth_seq_id_2    564 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 521 ? ? 60.90  -132.33 
2 1 SER A 646 ? ? 69.57  -18.49  
3 1 LYS A 696 ? ? -58.39 3.47    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 516  ? CG  ? A GLN 21  CG  
2   1 Y 1 A GLN 516  ? CD  ? A GLN 21  CD  
3   1 Y 1 A GLN 516  ? OE1 ? A GLN 21  OE1 
4   1 Y 1 A GLN 516  ? NE2 ? A GLN 21  NE2 
5   1 Y 1 A ARG 523  ? CG  ? A ARG 28  CG  
6   1 Y 1 A ARG 523  ? CD  ? A ARG 28  CD  
7   1 Y 1 A ARG 523  ? NE  ? A ARG 28  NE  
8   1 Y 1 A ARG 523  ? CZ  ? A ARG 28  CZ  
9   1 Y 1 A ARG 523  ? NH1 ? A ARG 28  NH1 
10  1 Y 1 A ARG 523  ? NH2 ? A ARG 28  NH2 
11  1 Y 1 A SER 533  ? OG  ? A SER 38  OG  
12  1 Y 1 A LYS 538  ? CG  ? A LYS 43  CG  
13  1 Y 1 A LYS 538  ? CD  ? A LYS 43  CD  
14  1 Y 1 A LYS 538  ? CE  ? A LYS 43  CE  
15  1 Y 1 A LYS 538  ? NZ  ? A LYS 43  NZ  
16  1 Y 1 A LYS 546  ? CG  ? A LYS 51  CG  
17  1 Y 1 A LYS 546  ? CD  ? A LYS 51  CD  
18  1 Y 1 A LYS 546  ? CE  ? A LYS 51  CE  
19  1 Y 1 A LYS 546  ? NZ  ? A LYS 51  NZ  
20  1 Y 1 A LYS 547  ? CG  ? A LYS 52  CG  
21  1 Y 1 A LYS 547  ? CD  ? A LYS 52  CD  
22  1 Y 1 A LYS 547  ? CE  ? A LYS 52  CE  
23  1 Y 1 A LYS 547  ? NZ  ? A LYS 52  NZ  
24  1 Y 1 A GLU 559  ? CG  ? A GLU 64  CG  
25  1 Y 1 A GLU 559  ? CD  ? A GLU 64  CD  
26  1 Y 1 A GLU 559  ? OE1 ? A GLU 64  OE1 
27  1 Y 1 A GLU 559  ? OE2 ? A GLU 64  OE2 
28  1 Y 1 A GLN 563  ? CG  ? A GLN 68  CG  
29  1 Y 1 A GLN 563  ? CD  ? A GLN 68  CD  
30  1 Y 1 A GLN 563  ? OE1 ? A GLN 68  OE1 
31  1 Y 1 A GLN 563  ? NE2 ? A GLN 68  NE2 
32  1 Y 1 A LYS 577  ? CD  ? A LYS 82  CD  
33  1 Y 1 A LYS 577  ? CE  ? A LYS 82  CE  
34  1 Y 1 A LYS 577  ? NZ  ? A LYS 82  NZ  
35  1 Y 1 A GLN 580  ? CD  ? A GLN 85  CD  
36  1 Y 1 A GLN 580  ? OE1 ? A GLN 85  OE1 
37  1 Y 1 A GLN 580  ? NE2 ? A GLN 85  NE2 
38  1 Y 1 A LEU 613  ? CG  ? A LEU 118 CG  
39  1 Y 1 A LEU 613  ? CD1 ? A LEU 118 CD1 
40  1 Y 1 A LEU 613  ? CD2 ? A LEU 118 CD2 
41  1 Y 1 A LYS 614  ? CG  ? A LYS 119 CG  
42  1 Y 1 A LYS 614  ? CD  ? A LYS 119 CD  
43  1 Y 1 A LYS 614  ? CE  ? A LYS 119 CE  
44  1 Y 1 A LYS 614  ? NZ  ? A LYS 119 NZ  
45  1 Y 1 A LYS 615  ? CD  ? A LYS 120 CD  
46  1 Y 1 A LYS 615  ? CE  ? A LYS 120 CE  
47  1 Y 1 A LYS 615  ? NZ  ? A LYS 120 NZ  
48  1 Y 1 A LYS 616  ? CD  ? A LYS 121 CD  
49  1 Y 1 A LYS 616  ? CE  ? A LYS 121 CE  
50  1 Y 1 A LYS 616  ? NZ  ? A LYS 121 NZ  
51  1 Y 1 A LYS 617  ? CG  ? A LYS 122 CG  
52  1 Y 1 A LYS 617  ? CD  ? A LYS 122 CD  
53  1 Y 1 A LYS 617  ? CE  ? A LYS 122 CE  
54  1 Y 1 A LYS 617  ? NZ  ? A LYS 122 NZ  
55  1 Y 1 A LYS 629  ? CG  ? A LYS 134 CG  
56  1 Y 1 A LYS 629  ? CD  ? A LYS 134 CD  
57  1 Y 1 A LYS 629  ? CE  ? A LYS 134 CE  
58  1 Y 1 A LYS 629  ? NZ  ? A LYS 134 NZ  
59  1 Y 1 A GLN 683  ? CG  ? A GLN 188 CG  
60  1 Y 1 A GLN 683  ? CD  ? A GLN 188 CD  
61  1 Y 1 A GLN 683  ? OE1 ? A GLN 188 OE1 
62  1 Y 1 A GLN 683  ? NE2 ? A GLN 188 NE2 
63  1 Y 1 A VAL 684  ? CG1 ? A VAL 189 CG1 
64  1 Y 1 A VAL 684  ? CG2 ? A VAL 189 CG2 
65  1 Y 1 A LYS 696  ? CG  ? A LYS 201 CG  
66  1 Y 1 A LYS 696  ? CD  ? A LYS 201 CD  
67  1 Y 1 A LYS 696  ? CE  ? A LYS 201 CE  
68  1 Y 1 A LYS 696  ? NZ  ? A LYS 201 NZ  
69  1 Y 1 A LYS 731  ? CG  ? A LYS 236 CG  
70  1 Y 1 A LYS 731  ? CD  ? A LYS 236 CD  
71  1 Y 1 A LYS 731  ? CE  ? A LYS 236 CE  
72  1 Y 1 A LYS 731  ? NZ  ? A LYS 236 NZ  
73  1 Y 1 A GLN 736  ? CG  ? A GLN 241 CG  
74  1 Y 1 A GLN 736  ? CD  ? A GLN 241 CD  
75  1 Y 1 A GLN 736  ? OE1 ? A GLN 241 OE1 
76  1 Y 1 A GLN 736  ? NE2 ? A GLN 241 NE2 
77  1 Y 1 A ILE 738  ? CG1 ? A ILE 243 CG1 
78  1 Y 1 A ILE 738  ? CG2 ? A ILE 243 CG2 
79  1 Y 1 A ILE 738  ? CD1 ? A ILE 243 CD1 
80  1 Y 1 A ILE 754  ? CG1 ? A ILE 259 CG1 
81  1 Y 1 A ILE 754  ? CG2 ? A ILE 259 CG2 
82  1 Y 1 A ILE 754  ? CD1 ? A ILE 259 CD1 
83  1 Y 1 A GLU 755  ? CG  ? A GLU 260 CG  
84  1 Y 1 A GLU 755  ? CD  ? A GLU 260 CD  
85  1 Y 1 A GLU 755  ? OE1 ? A GLU 260 OE1 
86  1 Y 1 A GLU 755  ? OE2 ? A GLU 260 OE2 
87  1 Y 1 A ASP 758  ? CG  ? A ASP 263 CG  
88  1 Y 1 A ASP 758  ? OD1 ? A ASP 263 OD1 
89  1 Y 1 A ASP 758  ? OD2 ? A ASP 263 OD2 
90  1 Y 1 A LYS 762  ? CG  ? A LYS 267 CG  
91  1 Y 1 A LYS 762  ? CD  ? A LYS 267 CD  
92  1 Y 1 A LYS 762  ? CE  ? A LYS 267 CE  
93  1 Y 1 A LYS 762  ? NZ  ? A LYS 267 NZ  
94  1 Y 1 A LYS 769  ? CD  ? A LYS 274 CD  
95  1 Y 1 A LYS 769  ? CE  ? A LYS 274 CE  
96  1 Y 1 A LYS 769  ? NZ  ? A LYS 274 NZ  
97  1 Y 1 A LYS 773  ? CD  ? A LYS 278 CD  
98  1 Y 1 A LYS 773  ? CE  ? A LYS 278 CE  
99  1 Y 1 A LYS 773  ? NZ  ? A LYS 278 NZ  
100 1 Y 1 A LYS 777  ? CG  ? A LYS 282 CG  
101 1 Y 1 A LYS 777  ? CD  ? A LYS 282 CD  
102 1 Y 1 A LYS 777  ? CE  ? A LYS 282 CE  
103 1 Y 1 A LYS 777  ? NZ  ? A LYS 282 NZ  
104 1 Y 1 A GLN 778  ? CG  ? A GLN 283 CG  
105 1 Y 1 A GLN 778  ? CD  ? A GLN 283 CD  
106 1 Y 1 A GLN 778  ? OE1 ? A GLN 283 OE1 
107 1 Y 1 A GLN 778  ? NE2 ? A GLN 283 NE2 
108 1 N 1 A 7PE 1796 ? C21 ? C 7PE 1   C21 
109 1 N 1 A 7PE 1796 ? C20 ? C 7PE 1   C20 
110 1 N 1 A 7PE 1796 ? C3  ? C 7PE 1   C3  
111 1 N 1 A 7PE 1796 ? C2  ? C 7PE 1   C2  
112 1 N 1 A 7PE 1796 ? O1  ? C 7PE 1   O1  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 496 ? A MET 1   
2  1 Y 1 A HIS 497 ? A HIS 2   
3  1 Y 1 A HIS 498 ? A HIS 3   
4  1 Y 1 A HIS 499 ? A HIS 4   
5  1 Y 1 A HIS 500 ? A HIS 5   
6  1 Y 1 A HIS 501 ? A HIS 6   
7  1 Y 1 A HIS 502 ? A HIS 7   
8  1 Y 1 A SER 503 ? A SER 8   
9  1 Y 1 A SER 504 ? A SER 9   
10 1 Y 1 A GLY 505 ? A GLY 10  
11 1 Y 1 A VAL 506 ? A VAL 11  
12 1 Y 1 A ASP 507 ? A ASP 12  
13 1 Y 1 A LEU 508 ? A LEU 13  
14 1 Y 1 A GLY 509 ? A GLY 14  
15 1 Y 1 A THR 510 ? A THR 15  
16 1 Y 1 A GLU 511 ? A GLU 16  
17 1 Y 1 A ASN 512 ? A ASN 17  
18 1 Y 1 A LEU 513 ? A LEU 18  
19 1 Y 1 A TYR 514 ? A TYR 19  
20 1 Y 1 A PHE 515 ? A PHE 20  
21 1 Y 1 A GLN 670 ? A GLN 175 
22 1 Y 1 A MET 671 ? A MET 176 
23 1 Y 1 A GLN 672 ? A GLN 177 
24 1 Y 1 A PRO 673 ? A PRO 178 
25 1 Y 1 A ASP 674 ? A ASP 179 
26 1 Y 1 A THR 675 ? A THR 180 
27 1 Y 1 A THR 676 ? A THR 181 
28 1 Y 1 A SER 677 ? A SER 182 
29 1 Y 1 A VAL 678 ? A VAL 183 
30 1 Y 1 A VAL 679 ? A VAL 184 
31 1 Y 1 A LYS 680 ? A LYS 185 
32 1 Y 1 A ASP 681 ? A ASP 186 
33 1 Y 1 A SER 682 ? A SER 187 
34 1 Y 1 A MET 698 ? A MET 203 
35 1 Y 1 A SER 699 ? A SER 204 
36 1 Y 1 A SER 700 ? A SER 205 
37 1 Y 1 A SER 701 ? A SER 206 
38 1 Y 1 A ARG 702 ? A ARG 207 
39 1 Y 1 A GLU 703 ? A GLU 208 
40 1 Y 1 A ASN 704 ? A ASN 209 
41 1 Y 1 A GLY 705 ? A GLY 210 
42 1 Y 1 A LYS 706 ? A LYS 211 
43 1 Y 1 A SER 707 ? A SER 212 
44 1 Y 1 A LYS 708 ? A LYS 213 
45 1 Y 1 A SER 709 ? A SER 214 
46 1 Y 1 A LYS 710 ? A LYS 215 
47 1 Y 1 A THR 795 ? A THR 300 
48 1 Y 1 A HIS 796 ? A HIS 301 
49 1 Y 1 A PRO 797 ? A PRO 302 
50 1 Y 1 A VAL 798 ? A VAL 303 
51 1 Y 1 A ASN 799 ? A ASN 304 
52 1 Y 1 A GLN 800 ? A GLN 305 
53 1 Y 1 A MET 801 ? A MET 306 
54 1 Y 1 A ALA 802 ? A ALA 307 
55 1 Y 1 A LYS 803 ? A LYS 308 
56 1 Y 1 A GLY 804 ? A GLY 309 
57 1 Y 1 A THR 805 ? A THR 310 
58 1 Y 1 A THR 806 ? A THR 311 
59 1 Y 1 A GLU 807 ? A GLU 312 
60 1 Y 1 A GLU 808 ? A GLU 313 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL                                                      EDO 
3 '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 7PE 
4 'thieno[2,3-c][2,7]naphthyridine'                                   ZO8 
5 water                                                               HOH 
#