data_4BM9
# 
_entry.id   4BM9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BM9         
PDBE  EBI-56782    
WWPDB D_1290056782 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BM9 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-07 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wauer, T.'    1 
'Komander, D.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure of the Human Parkin Ligase Domain in an Autoinhibited State.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            32 
_citation.page_first                2099 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23727886 
_citation.pdbx_database_id_DOI      10.1038/EMBOJ.2013.125 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wauer, T.'    1 
primary 'Komander, D.' 2 
# 
_cell.entry_id           4BM9 
_cell.length_a           168.420 
_cell.length_b           168.420 
_cell.length_c           97.181 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BM9 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'E3 UBIQUITIN-PROTEIN LIGASE PARKIN' 36821.051 1  6.3.2.- ? 'UPD AND RBR DOMAIN, RESIDUES 137-465' ? 
2 non-polymer syn 'ZINC ION'                           65.409    8  ?       ? ?                                      ? 
3 non-polymer syn 'SULFATE ION'                        96.063    3  ?       ? ?                                      ? 
4 non-polymer syn GLYCEROL                             92.094    1  ?       ? ?                                      ? 
5 water       nat water                                18.015    87 ?       ? ?                                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PARKINSON JUVENILE DISEASE PROTEIN 2, PARKINSON DISEASE PROTEIN 2, PARKIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHP
TSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNS
LIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGE
CSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRV
CMGDHWFDV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHP
TSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNS
LIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGE
CSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRV
CMGDHWFDV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ALA n 
1 3   GLY n 
1 4   ARG n 
1 5   SER n 
1 6   ILE n 
1 7   TYR n 
1 8   ASN n 
1 9   SER n 
1 10  PHE n 
1 11  TYR n 
1 12  VAL n 
1 13  TYR n 
1 14  CYS n 
1 15  LYS n 
1 16  GLY n 
1 17  PRO n 
1 18  CYS n 
1 19  GLN n 
1 20  ARG n 
1 21  VAL n 
1 22  GLN n 
1 23  PRO n 
1 24  GLY n 
1 25  LYS n 
1 26  LEU n 
1 27  ARG n 
1 28  VAL n 
1 29  GLN n 
1 30  CYS n 
1 31  SER n 
1 32  THR n 
1 33  CYS n 
1 34  ARG n 
1 35  GLN n 
1 36  ALA n 
1 37  THR n 
1 38  LEU n 
1 39  THR n 
1 40  LEU n 
1 41  THR n 
1 42  GLN n 
1 43  GLY n 
1 44  PRO n 
1 45  SER n 
1 46  CYS n 
1 47  TRP n 
1 48  ASP n 
1 49  ASP n 
1 50  VAL n 
1 51  LEU n 
1 52  ILE n 
1 53  PRO n 
1 54  ASN n 
1 55  ARG n 
1 56  MET n 
1 57  SER n 
1 58  GLY n 
1 59  GLU n 
1 60  CYS n 
1 61  GLN n 
1 62  SER n 
1 63  PRO n 
1 64  HIS n 
1 65  CYS n 
1 66  PRO n 
1 67  GLY n 
1 68  THR n 
1 69  SER n 
1 70  ALA n 
1 71  GLU n 
1 72  PHE n 
1 73  PHE n 
1 74  PHE n 
1 75  LYS n 
1 76  CYS n 
1 77  GLY n 
1 78  ALA n 
1 79  HIS n 
1 80  PRO n 
1 81  THR n 
1 82  SER n 
1 83  ASP n 
1 84  LYS n 
1 85  GLU n 
1 86  THR n 
1 87  SER n 
1 88  VAL n 
1 89  ALA n 
1 90  LEU n 
1 91  HIS n 
1 92  LEU n 
1 93  ILE n 
1 94  ALA n 
1 95  THR n 
1 96  ASN n 
1 97  SER n 
1 98  ARG n 
1 99  ASN n 
1 100 ILE n 
1 101 THR n 
1 102 CYS n 
1 103 ILE n 
1 104 THR n 
1 105 CYS n 
1 106 THR n 
1 107 ASP n 
1 108 VAL n 
1 109 ARG n 
1 110 SER n 
1 111 PRO n 
1 112 VAL n 
1 113 LEU n 
1 114 VAL n 
1 115 PHE n 
1 116 GLN n 
1 117 CYS n 
1 118 ASN n 
1 119 SER n 
1 120 ARG n 
1 121 HIS n 
1 122 VAL n 
1 123 ILE n 
1 124 CYS n 
1 125 LEU n 
1 126 ASP n 
1 127 CYS n 
1 128 PHE n 
1 129 HIS n 
1 130 LEU n 
1 131 TYR n 
1 132 CYS n 
1 133 VAL n 
1 134 THR n 
1 135 ARG n 
1 136 LEU n 
1 137 ASN n 
1 138 ASP n 
1 139 ARG n 
1 140 GLN n 
1 141 PHE n 
1 142 VAL n 
1 143 HIS n 
1 144 ASP n 
1 145 PRO n 
1 146 GLN n 
1 147 LEU n 
1 148 GLY n 
1 149 TYR n 
1 150 SER n 
1 151 LEU n 
1 152 PRO n 
1 153 CYS n 
1 154 VAL n 
1 155 ALA n 
1 156 GLY n 
1 157 CYS n 
1 158 PRO n 
1 159 ASN n 
1 160 SER n 
1 161 LEU n 
1 162 ILE n 
1 163 LYS n 
1 164 GLU n 
1 165 LEU n 
1 166 HIS n 
1 167 HIS n 
1 168 PHE n 
1 169 ARG n 
1 170 ILE n 
1 171 LEU n 
1 172 GLY n 
1 173 GLU n 
1 174 GLU n 
1 175 GLN n 
1 176 TYR n 
1 177 ASN n 
1 178 ARG n 
1 179 TYR n 
1 180 GLN n 
1 181 GLN n 
1 182 TYR n 
1 183 GLY n 
1 184 ALA n 
1 185 GLU n 
1 186 GLU n 
1 187 CYS n 
1 188 VAL n 
1 189 LEU n 
1 190 GLN n 
1 191 MET n 
1 192 GLY n 
1 193 GLY n 
1 194 VAL n 
1 195 LEU n 
1 196 CYS n 
1 197 PRO n 
1 198 ARG n 
1 199 PRO n 
1 200 GLY n 
1 201 CYS n 
1 202 GLY n 
1 203 ALA n 
1 204 GLY n 
1 205 LEU n 
1 206 LEU n 
1 207 PRO n 
1 208 GLU n 
1 209 PRO n 
1 210 ASP n 
1 211 GLN n 
1 212 ARG n 
1 213 LYS n 
1 214 VAL n 
1 215 THR n 
1 216 CYS n 
1 217 GLU n 
1 218 GLY n 
1 219 GLY n 
1 220 ASN n 
1 221 GLY n 
1 222 LEU n 
1 223 GLY n 
1 224 CYS n 
1 225 GLY n 
1 226 PHE n 
1 227 ALA n 
1 228 PHE n 
1 229 CYS n 
1 230 ARG n 
1 231 GLU n 
1 232 CYS n 
1 233 LYS n 
1 234 GLU n 
1 235 ALA n 
1 236 TYR n 
1 237 HIS n 
1 238 GLU n 
1 239 GLY n 
1 240 GLU n 
1 241 CYS n 
1 242 SER n 
1 243 ALA n 
1 244 VAL n 
1 245 PHE n 
1 246 GLU n 
1 247 ALA n 
1 248 SER n 
1 249 GLY n 
1 250 THR n 
1 251 THR n 
1 252 THR n 
1 253 GLN n 
1 254 ALA n 
1 255 TYR n 
1 256 ARG n 
1 257 VAL n 
1 258 ASP n 
1 259 GLU n 
1 260 ARG n 
1 261 ALA n 
1 262 ALA n 
1 263 GLU n 
1 264 GLN n 
1 265 ALA n 
1 266 ARG n 
1 267 TRP n 
1 268 GLU n 
1 269 ALA n 
1 270 ALA n 
1 271 SER n 
1 272 LYS n 
1 273 GLU n 
1 274 THR n 
1 275 ILE n 
1 276 LYS n 
1 277 LYS n 
1 278 THR n 
1 279 THR n 
1 280 LYS n 
1 281 PRO n 
1 282 CYS n 
1 283 PRO n 
1 284 ARG n 
1 285 CYS n 
1 286 HIS n 
1 287 VAL n 
1 288 PRO n 
1 289 VAL n 
1 290 GLU n 
1 291 LYS n 
1 292 ASN n 
1 293 GLY n 
1 294 GLY n 
1 295 CYS n 
1 296 MET n 
1 297 HIS n 
1 298 MET n 
1 299 LYS n 
1 300 CYS n 
1 301 PRO n 
1 302 GLN n 
1 303 PRO n 
1 304 GLN n 
1 305 CYS n 
1 306 ARG n 
1 307 LEU n 
1 308 GLU n 
1 309 TRP n 
1 310 CYS n 
1 311 TRP n 
1 312 ASN n 
1 313 CYS n 
1 314 GLY n 
1 315 CYS n 
1 316 GLU n 
1 317 TRP n 
1 318 ASN n 
1 319 ARG n 
1 320 VAL n 
1 321 CYS n 
1 322 MET n 
1 323 GLY n 
1 324 ASP n 
1 325 HIS n 
1 326 TRP n 
1 327 PHE n 
1 328 ASP n 
1 329 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ROSETTA2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRKN2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          O60260 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4BM9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 329 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O60260 
_struct_ref_seq.db_align_beg                  137 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  465 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       137 
_struct_ref_seq.pdbx_auth_seq_align_end       465 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
_exptl.entry_id          4BM9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3 
_exptl_crystal.density_percent_sol   58.8 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '1.6 M LITHIUM SULPHATE, 10 MM MAGNESIUM CHLORIDE, 50 MM MES (PH 5.4)' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PIXEL' 
_diffrn_detector.pdbx_collection_date   2013-02-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             1.000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BM9 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             58.33 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   24502 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.30 
_reflns.B_iso_Wilson_estimate        42.75 
_reflns.pdbx_redundancy              5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.37 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.64 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.30 
_reflns_shell.pdbx_redundancy        5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BM9 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     24502 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.619 
_refine.ls_d_res_high                            2.250 
_refine.ls_percent_reflns_obs                    97.48 
_refine.ls_R_factor_obs                          0.1918 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1903 
_refine.ls_R_factor_R_free                       0.2178 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1246 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.21 
_refine.pdbx_overall_phase_error                 23.60 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2279 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             87 
_refine_hist.number_atoms_total               2395 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        48.619 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 2361 'X-RAY DIFFRACTION' ? 
f_angle_d          0.974  ? ? 3212 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.629 ? ? 832  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.066  ? ? 344  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 418  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.2501 2.3401  2591 0.2696 99.00 0.3016 . . 151 . . 
'X-RAY DIFFRACTION' . 2.3401 2.4466  2571 0.2385 99.00 0.2556 . . 147 . . 
'X-RAY DIFFRACTION' . 2.4466 2.5756  2598 0.2267 99.00 0.2348 . . 150 . . 
'X-RAY DIFFRACTION' . 2.5756 2.7370  2586 0.2183 98.00 0.2778 . . 128 . . 
'X-RAY DIFFRACTION' . 2.7370 2.9483  2605 0.2224 98.00 0.2569 . . 134 . . 
'X-RAY DIFFRACTION' . 2.9483 3.2449  2600 0.2042 98.00 0.2338 . . 126 . . 
'X-RAY DIFFRACTION' . 3.2449 3.7143  2560 0.1773 97.00 0.2063 . . 127 . . 
'X-RAY DIFFRACTION' . 3.7143 4.6791  2577 0.1542 96.00 0.1749 . . 147 . . 
'X-RAY DIFFRACTION' . 4.6791 48.6300 2568 0.1811 94.00 0.2080 . . 136 . . 
# 
_struct.entry_id                  4BM9 
_struct.title                     'Structure of the autoinhibited Parkin catalytic domain' 
_struct.pdbx_descriptor           'E3 UBIQUITIN-PROTEIN LIGASE PARKIN (E.C.6.3.2.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BM9 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'LIGASE, NEURODEGENERATIVE DISEASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 46  ? ILE A 52  ? CYS A 182 ILE A 188 1 ? 7  
HELX_P HELX_P2 2 LEU A 125 ? ASP A 138 ? LEU A 261 ASP A 274 1 ? 14 
HELX_P HELX_P3 3 GLU A 164 ? LEU A 171 ? GLU A 300 LEU A 307 5 ? 8  
HELX_P HELX_P4 4 GLY A 172 ? GLN A 181 ? GLY A 308 GLN A 317 1 ? 10 
HELX_P HELX_P5 5 GLN A 181 ? MET A 191 ? GLN A 317 MET A 327 1 ? 11 
HELX_P HELX_P6 6 SER A 242 ? GLU A 246 ? SER A 378 GLU A 382 5 ? 5  
HELX_P HELX_P7 7 ASP A 258 ? ALA A 265 ? ASP A 394 ALA A 401 1 ? 8  
HELX_P HELX_P8 8 ASN A 318 ? TRP A 326 ? ASN A 454 TRP A 462 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 14  SG  ? ? A ZN 1466 A CYS 150 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc2  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 18  SG  ? ? A ZN 1466 A CYS 154 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc3  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 76  SG  ? ? A ZN 1466 A CYS 212 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc4  metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 79  NE2 ? ? A ZN 1466 A HIS 215 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc5  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 117 SG  ? ? A ZN 1467 A CYS 253 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc6  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 121 ND1 ? ? A ZN 1467 A HIS 257 1_555 ? ? ? ? ? ? ? 1.828 ? 
metalc7  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 157 SG  ? ? A ZN 1467 A CYS 293 1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc8  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 153 SG  ? ? A ZN 1467 A CYS 289 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc9  metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 310 SG  ? ? A ZN 1468 A CYS 446 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc10 metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 313 SG  ? ? A ZN 1468 A CYS 449 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc11 metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 321 SG  ? ? A ZN 1468 A CYS 457 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc12 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 325 NE2 ? ? A ZN 1468 A HIS 461 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc13 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 60  SG  ? ? A ZN 1469 A CYS 196 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc14 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 65  SG  ? ? A ZN 1469 A CYS 201 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc15 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 30  SG  ? ? A ZN 1469 A CYS 166 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc16 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 33  SG  ? ? A ZN 1469 A CYS 169 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc17 metalc ? ? F ZN . ZN ? ? ? 1_555 A CYS 105 SG  ? ? A ZN 1470 A CYS 241 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc18 metalc ? ? F ZN . ZN ? ? ? 1_555 A CYS 124 SG  ? ? A ZN 1470 A CYS 260 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc19 metalc ? ? F ZN . ZN ? ? ? 1_555 A CYS 127 SG  ? ? A ZN 1470 A CYS 263 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc20 metalc ? ? F ZN . ZN ? ? ? 1_555 A CYS 102 SG  ? ? A ZN 1470 A CYS 238 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc21 metalc ? ? G ZN . ZN ? ? ? 1_555 A CYS 201 SG  ? ? A ZN 1471 A CYS 337 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc22 metalc ? ? G ZN . ZN ? ? ? 1_555 A CYS 216 SG  ? ? A ZN 1471 A CYS 352 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc23 metalc ? ? G ZN . ZN ? ? ? 1_555 A CYS 196 SG  ? ? A ZN 1471 A CYS 332 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc24 metalc ? ? H ZN . ZN ? ? ? 1_555 A HIS 237 NE2 ? ? A ZN 1472 A HIS 373 1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc25 metalc ? ? H ZN . ZN ? ? ? 1_555 A CYS 229 SG  ? ? A ZN 1472 A CYS 365 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc26 metalc ? ? H ZN . ZN ? ? ? 1_555 A CYS 241 SG  ? ? A ZN 1472 A CYS 377 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc27 metalc ? ? I ZN . ZN ? ? ? 1_555 A CYS 285 SG  ? ? A ZN 1473 A CYS 421 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc28 metalc ? ? I ZN . ZN ? ? ? 1_555 A CYS 300 SG  ? ? A ZN 1473 A CYS 436 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc29 metalc ? ? I ZN . ZN ? ? ? 1_555 A CYS 305 SG  ? ? A ZN 1473 A CYS 441 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc30 metalc ? ? I ZN . ZN ? ? ? 1_555 A CYS 282 SG  ? ? A ZN 1473 A CYS 418 1_555 ? ? ? ? ? ? ? 2.320 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 16  A . ? GLY 152 A PRO 17  A ? PRO 153 A 1 1.67  
2 SER 110 A . ? SER 246 A PRO 111 A ? PRO 247 A 1 -1.11 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 2 ? 
AC ? 3 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ALA A 70  ? CYS A 76  ? ALA A 206 CYS A 212 
AA 2 ARG A 20  ? CYS A 30  ? ARG A 156 CYS A 166 
AA 3 TYR A 11  ? CYS A 14  ? TYR A 147 CYS A 150 
AA 4 VAL A 88  ? ALA A 89  ? VAL A 224 ALA A 225 
AB 1 LEU A 38  ? LEU A 40  ? LEU A 174 LEU A 176 
AB 2 GLY A 58  ? CYS A 60  ? GLY A 194 CYS A 196 
AC 1 ILE A 93  ? ALA A 94  ? ILE A 229 ALA A 230 
AC 2 VAL A 112 ? VAL A 114 ? VAL A 248 VAL A 250 
AC 3 VAL A 122 ? CYS A 124 ? VAL A 258 CYS A 260 
AD 1 VAL A 142 ? ASP A 144 ? VAL A 278 ASP A 280 
AD 2 GLY A 148 ? SER A 150 ? GLY A 284 SER A 286 
AE 1 VAL A 194 ? LEU A 195 ? VAL A 330 LEU A 331 
AE 2 GLY A 204 ? LEU A 205 ? GLY A 340 LEU A 341 
AF 1 LYS A 213 ? THR A 215 ? LYS A 349 THR A 351 
AF 2 ALA A 227 ? CYS A 229 ? ALA A 363 CYS A 365 
AG 1 THR A 279 ? PRO A 281 ? THR A 415 PRO A 417 
AG 2 PRO A 288 ? GLU A 290 ? PRO A 424 GLU A 426 
AH 1 HIS A 297 ? LYS A 299 ? HIS A 433 LYS A 435 
AH 2 GLU A 308 ? CYS A 310 ? GLU A 444 CYS A 446 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LYS A 75  ? N LYS A 211 O LYS A 25  ? O LYS A 161 
AA 2 3 N GLN A 22  ? N GLN A 158 O VAL A 12  ? O VAL A 148 
AA 3 4 N TYR A 13  ? N TYR A 149 O VAL A 88  ? O VAL A 224 
AB 1 2 N THR A 39  ? N THR A 175 O GLU A 59  ? O GLU A 195 
AC 1 2 N ALA A 94  ? N ALA A 230 O VAL A 112 ? O VAL A 248 
AC 2 3 N LEU A 113 ? N LEU A 249 O ILE A 123 ? O ILE A 259 
AD 1 2 N ASP A 144 ? N ASP A 280 O GLY A 148 ? O GLY A 284 
AE 1 2 N VAL A 194 ? N VAL A 330 O LEU A 205 ? O LEU A 341 
AF 1 2 N VAL A 214 ? N VAL A 350 O PHE A 228 ? O PHE A 364 
AG 1 2 N LYS A 280 ? N LYS A 416 O VAL A 289 ? O VAL A 425 
AH 1 2 N MET A 298 ? N MET A 434 O TRP A 309 ? O TRP A 445 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1466'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1467'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1468'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1469'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1470'  
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN A 1471'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1472'  
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1473'  
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1474' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1475' 
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 1476' 
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 1477' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 14  ? CYS A 150  . ? 1_555 ? 
2  AC1 4 CYS A 18  ? CYS A 154  . ? 1_555 ? 
3  AC1 4 CYS A 76  ? CYS A 212  . ? 1_555 ? 
4  AC1 4 HIS A 79  ? HIS A 215  . ? 1_555 ? 
5  AC2 4 CYS A 117 ? CYS A 253  . ? 1_555 ? 
6  AC2 4 HIS A 121 ? HIS A 257  . ? 1_555 ? 
7  AC2 4 CYS A 153 ? CYS A 289  . ? 1_555 ? 
8  AC2 4 CYS A 157 ? CYS A 293  . ? 1_555 ? 
9  AC3 4 CYS A 310 ? CYS A 446  . ? 1_555 ? 
10 AC3 4 CYS A 313 ? CYS A 449  . ? 1_555 ? 
11 AC3 4 CYS A 321 ? CYS A 457  . ? 1_555 ? 
12 AC3 4 HIS A 325 ? HIS A 461  . ? 1_555 ? 
13 AC4 4 CYS A 30  ? CYS A 166  . ? 1_555 ? 
14 AC4 4 CYS A 33  ? CYS A 169  . ? 1_555 ? 
15 AC4 4 CYS A 60  ? CYS A 196  . ? 1_555 ? 
16 AC4 4 CYS A 65  ? CYS A 201  . ? 1_555 ? 
17 AC5 4 CYS A 102 ? CYS A 238  . ? 1_555 ? 
18 AC5 4 CYS A 105 ? CYS A 241  . ? 1_555 ? 
19 AC5 4 CYS A 124 ? CYS A 260  . ? 1_555 ? 
20 AC5 4 CYS A 127 ? CYS A 263  . ? 1_555 ? 
21 AC6 3 CYS A 196 ? CYS A 332  . ? 1_555 ? 
22 AC6 3 CYS A 201 ? CYS A 337  . ? 1_555 ? 
23 AC6 3 CYS A 216 ? CYS A 352  . ? 1_555 ? 
24 AC7 4 CYS A 229 ? CYS A 365  . ? 1_555 ? 
25 AC7 4 CYS A 232 ? CYS A 368  . ? 1_555 ? 
26 AC7 4 HIS A 237 ? HIS A 373  . ? 1_555 ? 
27 AC7 4 CYS A 241 ? CYS A 377  . ? 1_555 ? 
28 AC8 4 CYS A 282 ? CYS A 418  . ? 1_555 ? 
29 AC8 4 CYS A 285 ? CYS A 421  . ? 1_555 ? 
30 AC8 4 CYS A 300 ? CYS A 436  . ? 1_555 ? 
31 AC8 4 CYS A 305 ? CYS A 441  . ? 1_555 ? 
32 AC9 4 ARG A 27  ? ARG A 163  . ? 1_555 ? 
33 AC9 4 LYS A 75  ? LYS A 211  . ? 1_555 ? 
34 AC9 4 ARG A 284 ? ARG A 420  . ? 6_556 ? 
35 AC9 4 HOH N .   ? HOH A 2045 . ? 1_555 ? 
36 BC1 4 ASN A 318 ? ASN A 454  . ? 1_555 ? 
37 BC1 4 ASN A 318 ? ASN A 454  . ? 6_556 ? 
38 BC1 4 ARG A 319 ? ARG A 455  . ? 1_555 ? 
39 BC1 4 ARG A 319 ? ARG A 455  . ? 6_556 ? 
40 BC2 5 LYS A 15  ? LYS A 151  . ? 1_555 ? 
41 BC2 5 HIS A 166 ? HIS A 302  . ? 1_555 ? 
42 BC2 5 ARG A 169 ? ARG A 305  . ? 1_555 ? 
43 BC2 5 TYR A 176 ? TYR A 312  . ? 1_555 ? 
44 BC2 5 HOH N .   ? HOH A 2087 . ? 1_555 ? 
45 BC3 3 LYS A 280 ? LYS A 416  . ? 1_555 ? 
46 BC3 3 TRP A 311 ? TRP A 447  . ? 1_555 ? 
47 BC3 3 ASN A 312 ? ASN A 448  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BM9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BM9 
_atom_sites.fract_transf_matrix[1][1]   0.005938 
_atom_sites.fract_transf_matrix[1][2]   0.003428 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006856 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010290 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 6   ? -3.983  18.656 47.434 1.00 69.82  ? 142  ILE A N   1 
ATOM   2    C  CA  . ILE A 1 6   ? -4.502  19.874 46.814 1.00 66.86  ? 142  ILE A CA  1 
ATOM   3    C  C   . ILE A 1 6   ? -3.905  20.105 45.429 1.00 57.10  ? 142  ILE A C   1 
ATOM   4    O  O   . ILE A 1 6   ? -2.779  19.690 45.150 1.00 61.85  ? 142  ILE A O   1 
ATOM   5    C  CB  . ILE A 1 6   ? -4.226  21.118 47.676 1.00 68.62  ? 142  ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 6   ? -2.729  21.410 47.734 1.00 71.83  ? 142  ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 6   ? -4.787  20.938 49.077 1.00 68.96  ? 142  ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 6   ? -2.424  22.845 48.060 1.00 76.44  ? 142  ILE A CD1 1 
ATOM   9    N  N   . TYR A 1 7   ? -4.658  20.772 44.560 1.00 42.73  ? 143  TYR A N   1 
ATOM   10   C  CA  . TYR A 1 7   ? -4.191  21.013 43.201 1.00 36.31  ? 143  TYR A CA  1 
ATOM   11   C  C   . TYR A 1 7   ? -3.778  22.477 42.975 1.00 35.61  ? 143  TYR A C   1 
ATOM   12   O  O   . TYR A 1 7   ? -4.620  23.385 43.006 1.00 29.60  ? 143  TYR A O   1 
ATOM   13   C  CB  . TYR A 1 7   ? -5.262  20.588 42.199 1.00 37.91  ? 143  TYR A CB  1 
ATOM   14   C  CG  . TYR A 1 7   ? -4.791  20.608 40.772 1.00 47.91  ? 143  TYR A CG  1 
ATOM   15   C  CD1 . TYR A 1 7   ? -3.531  20.142 40.439 1.00 53.95  ? 143  TYR A CD1 1 
ATOM   16   C  CD2 . TYR A 1 7   ? -5.608  21.077 39.753 1.00 54.98  ? 143  TYR A CD2 1 
ATOM   17   C  CE1 . TYR A 1 7   ? -3.091  20.149 39.140 1.00 59.59  ? 143  TYR A CE1 1 
ATOM   18   C  CE2 . TYR A 1 7   ? -5.175  21.089 38.444 1.00 59.39  ? 143  TYR A CE2 1 
ATOM   19   C  CZ  . TYR A 1 7   ? -3.915  20.622 38.149 1.00 65.84  ? 143  TYR A CZ  1 
ATOM   20   O  OH  . TYR A 1 7   ? -3.465  20.617 36.858 1.00 75.82  ? 143  TYR A OH  1 
ATOM   21   N  N   . ASN A 1 8   ? -2.481  22.698 42.762 1.00 30.52  ? 144  ASN A N   1 
ATOM   22   C  CA  . ASN A 1 8   ? -1.950  24.038 42.489 1.00 29.81  ? 144  ASN A CA  1 
ATOM   23   C  C   . ASN A 1 8   ? -1.597  24.227 41.025 1.00 29.55  ? 144  ASN A C   1 
ATOM   24   O  O   . ASN A 1 8   ? -0.720  23.546 40.518 1.00 34.44  ? 144  ASN A O   1 
ATOM   25   C  CB  . ASN A 1 8   ? -0.689  24.278 43.322 1.00 30.26  ? 144  ASN A CB  1 
ATOM   26   C  CG  . ASN A 1 8   ? -0.992  24.490 44.785 1.00 34.86  ? 144  ASN A CG  1 
ATOM   27   O  OD1 . ASN A 1 8   ? -1.746  25.394 45.146 1.00 36.28  ? 144  ASN A OD1 1 
ATOM   28   N  ND2 . ASN A 1 8   ? -0.422  23.650 45.635 1.00 36.87  ? 144  ASN A ND2 1 
ATOM   29   N  N   . SER A 1 9   ? -2.245  25.155 40.332 1.00 29.77  ? 145  SER A N   1 
ATOM   30   C  CA  . SER A 1 9   ? -1.872  25.363 38.936 1.00 29.80  ? 145  SER A CA  1 
ATOM   31   C  C   . SER A 1 9   ? -0.968  26.583 38.769 1.00 30.89  ? 145  SER A C   1 
ATOM   32   O  O   . SER A 1 9   ? -0.460  26.836 37.674 1.00 34.98  ? 145  SER A O   1 
ATOM   33   C  CB  . SER A 1 9   ? -3.103  25.424 38.024 1.00 24.07  ? 145  SER A CB  1 
ATOM   34   O  OG  . SER A 1 9   ? -3.958  26.479 38.387 1.00 42.57  ? 145  SER A OG  1 
ATOM   35   N  N   . PHE A 1 10  ? -0.743  27.313 39.865 1.00 27.48  ? 146  PHE A N   1 
ATOM   36   C  CA  . PHE A 1 10  ? 0.020   28.565 39.810 1.00 23.23  ? 146  PHE A CA  1 
ATOM   37   C  C   . PHE A 1 10  ? 1.217   28.546 40.765 1.00 23.12  ? 146  PHE A C   1 
ATOM   38   O  O   . PHE A 1 10  ? 1.082   28.173 41.937 1.00 25.79  ? 146  PHE A O   1 
ATOM   39   C  CB  . PHE A 1 10  ? -0.870  29.763 40.177 1.00 15.98  ? 146  PHE A CB  1 
ATOM   40   C  CG  . PHE A 1 10  ? -2.236  29.733 39.543 1.00 17.78  ? 146  PHE A CG  1 
ATOM   41   C  CD1 . PHE A 1 10  ? -2.377  29.719 38.161 1.00 17.19  ? 146  PHE A CD1 1 
ATOM   42   C  CD2 . PHE A 1 10  ? -3.378  29.741 40.330 1.00 15.06  ? 146  PHE A CD2 1 
ATOM   43   C  CE1 . PHE A 1 10  ? -3.643  29.689 37.568 1.00 19.91  ? 146  PHE A CE1 1 
ATOM   44   C  CE2 . PHE A 1 10  ? -4.639  29.715 39.753 1.00 21.80  ? 146  PHE A CE2 1 
ATOM   45   C  CZ  . PHE A 1 10  ? -4.776  29.691 38.370 1.00 20.89  ? 146  PHE A CZ  1 
ATOM   46   N  N   . TYR A 1 11  ? 2.376   28.965 40.262 1.00 23.50  ? 147  TYR A N   1 
ATOM   47   C  CA  . TYR A 1 11  ? 3.578   29.103 41.076 1.00 22.76  ? 147  TYR A CA  1 
ATOM   48   C  C   . TYR A 1 11  ? 4.132   30.505 40.911 1.00 25.01  ? 147  TYR A C   1 
ATOM   49   O  O   . TYR A 1 11  ? 4.146   31.051 39.806 1.00 26.28  ? 147  TYR A O   1 
ATOM   50   C  CB  . TYR A 1 11  ? 4.624   28.048 40.686 1.00 23.78  ? 147  TYR A CB  1 
ATOM   51   C  CG  . TYR A 1 11  ? 4.171   26.673 41.091 1.00 26.22  ? 147  TYR A CG  1 
ATOM   52   C  CD1 . TYR A 1 11  ? 4.426   26.194 42.363 1.00 24.14  ? 147  TYR A CD1 1 
ATOM   53   C  CD2 . TYR A 1 11  ? 3.432   25.880 40.225 1.00 28.77  ? 147  TYR A CD2 1 
ATOM   54   C  CE1 . TYR A 1 11  ? 3.987   24.953 42.760 1.00 20.05  ? 147  TYR A CE1 1 
ATOM   55   C  CE2 . TYR A 1 11  ? 2.980   24.637 40.615 1.00 28.46  ? 147  TYR A CE2 1 
ATOM   56   C  CZ  . TYR A 1 11  ? 3.263   24.185 41.884 1.00 27.65  ? 147  TYR A CZ  1 
ATOM   57   O  OH  . TYR A 1 11  ? 2.820   22.951 42.285 1.00 32.60  ? 147  TYR A OH  1 
ATOM   58   N  N   . VAL A 1 12  ? 4.588   31.092 42.010 1.00 25.28  ? 148  VAL A N   1 
ATOM   59   C  CA  . VAL A 1 12  ? 5.075   32.467 41.980 1.00 22.37  ? 148  VAL A CA  1 
ATOM   60   C  C   . VAL A 1 12  ? 6.476   32.502 42.560 1.00 28.96  ? 148  VAL A C   1 
ATOM   61   O  O   . VAL A 1 12  ? 6.918   31.526 43.182 1.00 27.96  ? 148  VAL A O   1 
ATOM   62   C  CB  . VAL A 1 12  ? 4.155   33.380 42.811 1.00 19.82  ? 148  VAL A CB  1 
ATOM   63   C  CG1 . VAL A 1 12  ? 2.742   33.354 42.236 1.00 20.83  ? 148  VAL A CG1 1 
ATOM   64   C  CG2 . VAL A 1 12  ? 4.137   32.913 44.281 1.00 21.07  ? 148  VAL A CG2 1 
ATOM   65   N  N   . TYR A 1 13  ? 7.189   33.607 42.362 1.00 28.73  ? 149  TYR A N   1 
ATOM   66   C  CA  . TYR A 1 13  ? 8.411   33.800 43.133 1.00 25.78  ? 149  TYR A CA  1 
ATOM   67   C  C   . TYR A 1 13  ? 8.126   34.724 44.303 1.00 26.38  ? 149  TYR A C   1 
ATOM   68   O  O   . TYR A 1 13  ? 7.871   35.917 44.103 1.00 31.88  ? 149  TYR A O   1 
ATOM   69   C  CB  . TYR A 1 13  ? 9.565   34.358 42.297 1.00 26.63  ? 149  TYR A CB  1 
ATOM   70   C  CG  . TYR A 1 13  ? 10.863  34.229 43.041 1.00 28.92  ? 149  TYR A CG  1 
ATOM   71   C  CD1 . TYR A 1 13  ? 11.562  33.028 43.036 1.00 32.32  ? 149  TYR A CD1 1 
ATOM   72   C  CD2 . TYR A 1 13  ? 11.358  35.273 43.804 1.00 28.61  ? 149  TYR A CD2 1 
ATOM   73   C  CE1 . TYR A 1 13  ? 12.737  32.876 43.738 1.00 31.61  ? 149  TYR A CE1 1 
ATOM   74   C  CE2 . TYR A 1 13  ? 12.548  35.131 44.522 1.00 37.02  ? 149  TYR A CE2 1 
ATOM   75   C  CZ  . TYR A 1 13  ? 13.227  33.929 44.481 1.00 39.65  ? 149  TYR A CZ  1 
ATOM   76   O  OH  . TYR A 1 13  ? 14.402  33.772 45.178 1.00 50.68  ? 149  TYR A OH  1 
ATOM   77   N  N   . CYS A 1 14  ? 8.146   34.177 45.519 1.00 25.26  ? 150  CYS A N   1 
ATOM   78   C  CA  . CYS A 1 14  ? 7.971   35.013 46.706 1.00 28.69  ? 150  CYS A CA  1 
ATOM   79   C  C   . CYS A 1 14  ? 9.309   35.627 47.119 1.00 33.58  ? 150  CYS A C   1 
ATOM   80   O  O   . CYS A 1 14  ? 10.225  34.904 47.501 1.00 28.99  ? 150  CYS A O   1 
ATOM   81   C  CB  . CYS A 1 14  ? 7.390   34.201 47.854 1.00 19.80  ? 150  CYS A CB  1 
ATOM   82   S  SG  . CYS A 1 14  ? 7.242   35.116 49.409 1.00 30.20  ? 150  CYS A SG  1 
ATOM   83   N  N   . LYS A 1 15  ? 9.412   36.955 47.056 1.00 32.20  ? 151  LYS A N   1 
ATOM   84   C  CA  . LYS A 1 15  ? 10.681  37.640 47.322 1.00 34.68  ? 151  LYS A CA  1 
ATOM   85   C  C   . LYS A 1 15  ? 11.013  37.743 48.809 1.00 39.31  ? 151  LYS A C   1 
ATOM   86   O  O   . LYS A 1 15  ? 12.153  38.021 49.190 1.00 45.83  ? 151  LYS A O   1 
ATOM   87   C  CB  . LYS A 1 15  ? 10.681  39.023 46.668 1.00 29.42  ? 151  LYS A CB  1 
ATOM   88   C  CG  . LYS A 1 15  ? 10.859  38.953 45.156 1.00 41.18  ? 151  LYS A CG  1 
ATOM   89   C  CD  . LYS A 1 15  ? 10.310  40.176 44.437 1.00 47.11  ? 151  LYS A CD  1 
ATOM   90   C  CE  . LYS A 1 15  ? 11.014  41.452 44.838 1.00 56.13  ? 151  LYS A CE  1 
ATOM   91   N  NZ  . LYS A 1 15  ? 10.538  42.596 44.000 1.00 66.81  ? 151  LYS A NZ  1 
ATOM   92   N  N   . GLY A 1 16  ? 10.011  37.501 49.640 1.00 38.72  ? 152  GLY A N   1 
ATOM   93   C  CA  . GLY A 1 16  ? 10.165  37.548 51.081 1.00 35.85  ? 152  GLY A CA  1 
ATOM   94   C  C   . GLY A 1 16  ? 8.782   37.328 51.656 1.00 39.88  ? 152  GLY A C   1 
ATOM   95   O  O   . GLY A 1 16  ? 7.801   37.806 51.088 1.00 39.70  ? 152  GLY A O   1 
ATOM   96   N  N   . PRO A 1 17  ? 8.688   36.594 52.772 1.00 35.60  ? 153  PRO A N   1 
ATOM   97   C  CA  . PRO A 1 17  ? 9.812   36.006 53.516 1.00 36.36  ? 153  PRO A CA  1 
ATOM   98   C  C   . PRO A 1 17  ? 10.368  34.703 52.927 1.00 39.00  ? 153  PRO A C   1 
ATOM   99   O  O   . PRO A 1 17  ? 11.406  34.246 53.394 1.00 37.04  ? 153  PRO A O   1 
ATOM   100  C  CB  . PRO A 1 17  ? 9.189   35.702 54.877 1.00 36.99  ? 153  PRO A CB  1 
ATOM   101  C  CG  . PRO A 1 17  ? 7.737   35.394 54.547 1.00 37.98  ? 153  PRO A CG  1 
ATOM   102  C  CD  . PRO A 1 17  ? 7.395   36.381 53.452 1.00 29.27  ? 153  PRO A CD  1 
ATOM   103  N  N   . CYS A 1 18  ? 9.705   34.118 51.935 1.00 39.93  ? 154  CYS A N   1 
ATOM   104  C  CA  . CYS A 1 18  ? 10.110  32.807 51.420 1.00 35.82  ? 154  CYS A CA  1 
ATOM   105  C  C   . CYS A 1 18  ? 11.417  32.811 50.619 1.00 36.67  ? 154  CYS A C   1 
ATOM   106  O  O   . CYS A 1 18  ? 12.245  31.905 50.772 1.00 34.39  ? 154  CYS A O   1 
ATOM   107  C  CB  . CYS A 1 18  ? 8.984   32.204 50.582 1.00 21.32  ? 154  CYS A CB  1 
ATOM   108  S  SG  . CYS A 1 18  ? 7.517   31.831 51.549 1.00 27.84  ? 154  CYS A SG  1 
ATOM   109  N  N   . GLN A 1 19  ? 11.592  33.821 49.768 1.00 32.89  ? 155  GLN A N   1 
ATOM   110  C  CA  . GLN A 1 19  ? 12.781  33.932 48.926 1.00 39.00  ? 155  GLN A CA  1 
ATOM   111  C  C   . GLN A 1 19  ? 12.959  32.686 48.051 1.00 39.41  ? 155  GLN A C   1 
ATOM   112  O  O   . GLN A 1 19  ? 14.073  32.207 47.867 1.00 37.70  ? 155  GLN A O   1 
ATOM   113  C  CB  . GLN A 1 19  ? 14.033  34.190 49.778 1.00 34.16  ? 155  GLN A CB  1 
ATOM   114  N  N   . ARG A 1 20  ? 11.853  32.171 47.515 1.00 39.37  ? 156  ARG A N   1 
ATOM   115  C  CA  . ARG A 1 20  ? 11.886  30.986 46.651 1.00 34.35  ? 156  ARG A CA  1 
ATOM   116  C  C   . ARG A 1 20  ? 10.576  30.812 45.888 1.00 31.97  ? 156  ARG A C   1 
ATOM   117  O  O   . ARG A 1 20  ? 9.635   31.583 46.068 1.00 29.20  ? 156  ARG A O   1 
ATOM   118  C  CB  . ARG A 1 20  ? 12.196  29.722 47.460 1.00 36.68  ? 156  ARG A CB  1 
ATOM   119  C  CG  . ARG A 1 20  ? 11.151  29.340 48.506 1.00 33.81  ? 156  ARG A CG  1 
ATOM   120  C  CD  . ARG A 1 20  ? 11.689  28.216 49.398 1.00 41.27  ? 156  ARG A CD  1 
ATOM   121  N  NE  . ARG A 1 20  ? 10.757  27.789 50.444 1.00 49.18  ? 156  ARG A NE  1 
ATOM   122  C  CZ  . ARG A 1 20  ? 10.772  28.244 51.697 1.00 55.96  ? 156  ARG A CZ  1 
ATOM   123  N  NH1 . ARG A 1 20  ? 11.664  29.159 52.069 1.00 53.43  ? 156  ARG A NH1 1 
ATOM   124  N  NH2 . ARG A 1 20  ? 9.893   27.788 52.582 1.00 54.12  ? 156  ARG A NH2 1 
ATOM   125  N  N   . VAL A 1 21  ? 10.524  29.806 45.020 1.00 32.61  ? 157  VAL A N   1 
ATOM   126  C  CA  . VAL A 1 21  ? 9.309   29.503 44.269 1.00 25.49  ? 157  VAL A CA  1 
ATOM   127  C  C   . VAL A 1 21  ? 8.292   28.901 45.228 1.00 26.83  ? 157  VAL A C   1 
ATOM   128  O  O   . VAL A 1 21  ? 8.637   28.034 46.027 1.00 28.88  ? 157  VAL A O   1 
ATOM   129  C  CB  . VAL A 1 21  ? 9.600   28.527 43.111 1.00 28.62  ? 157  VAL A CB  1 
ATOM   130  C  CG1 . VAL A 1 21  ? 8.317   28.024 42.475 1.00 25.78  ? 157  VAL A CG1 1 
ATOM   131  C  CG2 . VAL A 1 21  ? 10.484  29.194 42.065 1.00 20.99  ? 157  VAL A CG2 1 
ATOM   132  N  N   . GLN A 1 22  ? 7.051   29.387 45.178 1.00 28.37  ? 158  GLN A N   1 
ATOM   133  C  CA  . GLN A 1 22  ? 5.982   28.854 46.023 1.00 21.99  ? 158  GLN A CA  1 
ATOM   134  C  C   . GLN A 1 22  ? 4.690   28.761 45.239 1.00 22.14  ? 158  GLN A C   1 
ATOM   135  O  O   . GLN A 1 22  ? 4.505   29.499 44.271 1.00 29.00  ? 158  GLN A O   1 
ATOM   136  C  CB  . GLN A 1 22  ? 5.764   29.748 47.248 1.00 22.17  ? 158  GLN A CB  1 
ATOM   137  C  CG  . GLN A 1 22  ? 6.935   29.789 48.234 1.00 26.24  ? 158  GLN A CG  1 
ATOM   138  C  CD  . GLN A 1 22  ? 6.880   28.669 49.256 1.00 32.63  ? 158  GLN A CD  1 
ATOM   139  O  OE1 . GLN A 1 22  ? 6.599   27.515 48.921 1.00 28.58  ? 158  GLN A OE1 1 
ATOM   140  N  NE2 . GLN A 1 22  ? 7.143   29.007 50.516 1.00 37.29  ? 158  GLN A NE2 1 
ATOM   141  N  N   . PRO A 1 23  ? 3.809   27.827 45.631 1.00 24.26  ? 159  PRO A N   1 
ATOM   142  C  CA  . PRO A 1 23  ? 2.446   27.789 45.091 1.00 25.65  ? 159  PRO A CA  1 
ATOM   143  C  C   . PRO A 1 23  ? 1.791   29.141 45.347 1.00 29.03  ? 159  PRO A C   1 
ATOM   144  O  O   . PRO A 1 23  ? 1.929   29.669 46.453 1.00 33.46  ? 159  PRO A O   1 
ATOM   145  C  CB  . PRO A 1 23  ? 1.757   26.726 45.959 1.00 28.57  ? 159  PRO A CB  1 
ATOM   146  C  CG  . PRO A 1 23  ? 2.850   25.814 46.377 1.00 29.67  ? 159  PRO A CG  1 
ATOM   147  C  CD  . PRO A 1 23  ? 4.099   26.672 46.503 1.00 24.20  ? 159  PRO A CD  1 
ATOM   148  N  N   . GLY A 1 24  ? 1.099   29.697 44.360 1.00 27.56  ? 160  GLY A N   1 
ATOM   149  C  CA  . GLY A 1 24  ? 0.486   31.000 44.542 1.00 25.11  ? 160  GLY A CA  1 
ATOM   150  C  C   . GLY A 1 24  ? -1.026  30.967 44.508 1.00 25.84  ? 160  GLY A C   1 
ATOM   151  O  O   . GLY A 1 24  ? -1.628  29.968 44.090 1.00 25.05  ? 160  GLY A O   1 
ATOM   152  N  N   . LYS A 1 25  ? -1.644  32.060 44.948 1.00 26.50  ? 161  LYS A N   1 
ATOM   153  C  CA  . LYS A 1 25  ? -3.097  32.194 44.923 1.00 23.32  ? 161  LYS A CA  1 
ATOM   154  C  C   . LYS A 1 25  ? -3.462  33.214 43.866 1.00 26.19  ? 161  LYS A C   1 
ATOM   155  O  O   . LYS A 1 25  ? -2.908  34.313 43.862 1.00 23.58  ? 161  LYS A O   1 
ATOM   156  C  CB  . LYS A 1 25  ? -3.607  32.707 46.267 1.00 25.45  ? 161  LYS A CB  1 
ATOM   157  C  CG  . LYS A 1 25  ? -3.198  31.866 47.456 1.00 36.28  ? 161  LYS A CG  1 
ATOM   158  C  CD  . LYS A 1 25  ? -3.890  30.523 47.464 1.00 39.80  ? 161  LYS A CD  1 
ATOM   159  C  CE  . LYS A 1 25  ? -5.159  30.547 48.291 1.00 48.50  ? 161  LYS A CE  1 
ATOM   160  N  NZ  . LYS A 1 25  ? -5.713  29.167 48.495 1.00 49.24  ? 161  LYS A NZ  1 
ATOM   161  N  N   . LEU A 1 26  ? -4.385  32.867 42.973 1.00 23.45  ? 162  LEU A N   1 
ATOM   162  C  CA  . LEU A 1 26  ? -4.822  33.814 41.949 1.00 26.16  ? 162  LEU A CA  1 
ATOM   163  C  C   . LEU A 1 26  ? -5.944  34.673 42.528 1.00 29.49  ? 162  LEU A C   1 
ATOM   164  O  O   . LEU A 1 26  ? -6.863  34.141 43.142 1.00 26.53  ? 162  LEU A O   1 
ATOM   165  C  CB  . LEU A 1 26  ? -5.316  33.074 40.704 1.00 28.33  ? 162  LEU A CB  1 
ATOM   166  C  CG  . LEU A 1 26  ? -6.013  33.909 39.627 1.00 25.78  ? 162  LEU A CG  1 
ATOM   167  C  CD1 . LEU A 1 26  ? -5.090  35.019 39.120 1.00 22.89  ? 162  LEU A CD1 1 
ATOM   168  C  CD2 . LEU A 1 26  ? -6.438  33.011 38.483 1.00 23.54  ? 162  LEU A CD2 1 
ATOM   169  N  N   . ARG A 1 27  ? -5.851  35.992 42.363 1.00 26.01  ? 163  ARG A N   1 
ATOM   170  C  CA  . ARG A 1 27  ? -6.889  36.907 42.853 1.00 28.11  ? 163  ARG A CA  1 
ATOM   171  C  C   . ARG A 1 27  ? -7.385  37.811 41.728 1.00 30.29  ? 163  ARG A C   1 
ATOM   172  O  O   . ARG A 1 27  ? -6.653  38.065 40.762 1.00 31.33  ? 163  ARG A O   1 
ATOM   173  C  CB  . ARG A 1 27  ? -6.360  37.804 43.981 1.00 34.21  ? 163  ARG A CB  1 
ATOM   174  C  CG  . ARG A 1 27  ? -5.812  37.087 45.199 1.00 40.28  ? 163  ARG A CG  1 
ATOM   175  C  CD  . ARG A 1 27  ? -6.739  36.007 45.630 1.00 42.17  ? 163  ARG A CD  1 
ATOM   176  N  NE  . ARG A 1 27  ? -6.446  35.486 46.957 1.00 37.82  ? 163  ARG A NE  1 
ATOM   177  C  CZ  . ARG A 1 27  ? -6.906  34.317 47.385 1.00 32.97  ? 163  ARG A CZ  1 
ATOM   178  N  NH1 . ARG A 1 27  ? -7.642  33.579 46.570 1.00 33.15  ? 163  ARG A NH1 1 
ATOM   179  N  NH2 . ARG A 1 27  ? -6.632  33.882 48.607 1.00 30.45  ? 163  ARG A NH2 1 
ATOM   180  N  N   . VAL A 1 28  ? -8.619  38.302 41.859 1.00 26.95  ? 164  VAL A N   1 
ATOM   181  C  CA  . VAL A 1 28  ? -9.156  39.306 40.940 1.00 25.88  ? 164  VAL A CA  1 
ATOM   182  C  C   . VAL A 1 28  ? -9.678  40.501 41.693 1.00 28.76  ? 164  VAL A C   1 
ATOM   183  O  O   . VAL A 1 28  ? -10.210 40.365 42.807 1.00 29.89  ? 164  VAL A O   1 
ATOM   184  C  CB  . VAL A 1 28  ? -10.420 38.835 40.215 1.00 39.76  ? 164  VAL A CB  1 
ATOM   185  C  CG1 . VAL A 1 28  ? -10.306 39.094 38.723 1.00 36.43  ? 164  VAL A CG1 1 
ATOM   186  C  CG2 . VAL A 1 28  ? -10.730 37.401 40.539 1.00 50.99  ? 164  VAL A CG2 1 
ATOM   187  N  N   . GLN A 1 29  ? -9.612  41.659 41.044 1.00 27.16  ? 165  GLN A N   1 
ATOM   188  C  CA  . GLN A 1 29  ? -10.283 42.840 41.549 1.00 27.74  ? 165  GLN A CA  1 
ATOM   189  C  C   . GLN A 1 29  ? -10.817 43.669 40.381 1.00 28.08  ? 165  GLN A C   1 
ATOM   190  O  O   . GLN A 1 29  ? -10.402 43.486 39.228 1.00 25.01  ? 165  GLN A O   1 
ATOM   191  C  CB  . GLN A 1 29  ? -9.311  43.662 42.397 1.00 32.63  ? 165  GLN A CB  1 
ATOM   192  C  CG  . GLN A 1 29  ? -8.139  44.248 41.612 1.00 33.46  ? 165  GLN A CG  1 
ATOM   193  C  CD  . GLN A 1 29  ? -7.165  45.017 42.504 1.00 41.68  ? 165  GLN A CD  1 
ATOM   194  O  OE1 . GLN A 1 29  ? -7.031  44.723 43.695 1.00 40.96  ? 165  GLN A OE1 1 
ATOM   195  N  NE2 . GLN A 1 29  ? -6.485  46.008 41.930 1.00 43.05  ? 165  GLN A NE2 1 
ATOM   196  N  N   . CYS A 1 30  ? -11.750 44.563 40.675 1.00 26.59  ? 166  CYS A N   1 
ATOM   197  C  CA  . CYS A 1 30  ? -12.203 45.521 39.683 1.00 29.39  ? 166  CYS A CA  1 
ATOM   198  C  C   . CYS A 1 30  ? -11.048 46.466 39.371 1.00 29.31  ? 166  CYS A C   1 
ATOM   199  O  O   . CYS A 1 30  ? -10.442 47.027 40.284 1.00 34.82  ? 166  CYS A O   1 
ATOM   200  C  CB  . CYS A 1 30  ? -13.389 46.314 40.233 1.00 30.50  ? 166  CYS A CB  1 
ATOM   201  S  SG  . CYS A 1 30  ? -13.837 47.711 39.212 1.00 37.07  ? 166  CYS A SG  1 
ATOM   202  N  N   . SER A 1 31  ? -10.729 46.633 38.094 1.00 33.67  ? 167  SER A N   1 
ATOM   203  C  CA  . SER A 1 31  ? -9.601  47.485 37.712 1.00 31.38  ? 167  SER A CA  1 
ATOM   204  C  C   . SER A 1 31  ? -9.842  48.964 38.030 1.00 35.45  ? 167  SER A C   1 
ATOM   205  O  O   . SER A 1 31  ? -8.887  49.726 38.174 1.00 34.60  ? 167  SER A O   1 
ATOM   206  C  CB  . SER A 1 31  ? -9.271  47.315 36.231 1.00 30.37  ? 167  SER A CB  1 
ATOM   207  O  OG  . SER A 1 31  ? -10.332 47.796 35.429 1.00 41.75  ? 167  SER A OG  1 
ATOM   208  N  N   . THR A 1 32  ? -11.100 49.385 38.149 1.00 40.18  ? 168  THR A N   1 
ATOM   209  C  CA  . THR A 1 32  ? -11.359 50.814 38.359 1.00 48.45  ? 168  THR A CA  1 
ATOM   210  C  C   . THR A 1 32  ? -11.416 51.237 39.830 1.00 42.67  ? 168  THR A C   1 
ATOM   211  O  O   . THR A 1 32  ? -10.918 52.297 40.179 1.00 44.41  ? 168  THR A O   1 
ATOM   212  C  CB  . THR A 1 32  ? -12.625 51.308 37.626 1.00 66.28  ? 168  THR A CB  1 
ATOM   213  O  OG1 . THR A 1 32  ? -13.776 51.099 38.449 1.00 73.81  ? 168  THR A OG1 1 
ATOM   214  C  CG2 . THR A 1 32  ? -12.791 50.586 36.323 1.00 37.30  ? 168  THR A CG2 1 
ATOM   215  N  N   . CYS A 1 33  ? -12.021 50.423 40.689 1.00 47.03  ? 169  CYS A N   1 
ATOM   216  C  CA  . CYS A 1 33  ? -12.102 50.779 42.106 1.00 49.23  ? 169  CYS A CA  1 
ATOM   217  C  C   . CYS A 1 33  ? -11.112 49.999 42.977 1.00 52.64  ? 169  CYS A C   1 
ATOM   218  O  O   . CYS A 1 33  ? -11.035 50.226 44.185 1.00 53.04  ? 169  CYS A O   1 
ATOM   219  C  CB  . CYS A 1 33  ? -13.529 50.606 42.637 1.00 49.95  ? 169  CYS A CB  1 
ATOM   220  S  SG  . CYS A 1 33  ? -14.127 48.894 42.688 1.00 39.06  ? 169  CYS A SG  1 
ATOM   221  N  N   . ARG A 1 34  ? -10.347 49.101 42.354 1.00 48.29  ? 170  ARG A N   1 
ATOM   222  C  CA  . ARG A 1 34  ? -9.344  48.280 43.047 1.00 43.06  ? 170  ARG A CA  1 
ATOM   223  C  C   . ARG A 1 34  ? -9.913  47.479 44.224 1.00 43.68  ? 170  ARG A C   1 
ATOM   224  O  O   . ARG A 1 34  ? -9.199  47.210 45.187 1.00 49.56  ? 170  ARG A O   1 
ATOM   225  C  CB  . ARG A 1 34  ? -8.150  49.118 43.543 1.00 38.96  ? 170  ARG A CB  1 
ATOM   226  C  CG  . ARG A 1 34  ? -7.825  50.376 42.740 1.00 60.24  ? 170  ARG A CG  1 
ATOM   227  C  CD  . ARG A 1 34  ? -6.815  51.280 43.490 1.00 75.84  ? 170  ARG A CD  1 
ATOM   228  N  NE  . ARG A 1 34  ? -7.077  51.356 44.932 1.00 86.05  ? 170  ARG A NE  1 
ATOM   229  C  CZ  . ARG A 1 34  ? -6.169  51.122 45.880 1.00 86.92  ? 170  ARG A CZ  1 
ATOM   230  N  NH1 . ARG A 1 34  ? -4.921  50.808 45.553 1.00 85.04  ? 170  ARG A NH1 1 
ATOM   231  N  NH2 . ARG A 1 34  ? -6.508  51.206 47.161 1.00 86.23  ? 170  ARG A NH2 1 
ATOM   232  N  N   . GLN A 1 35  ? -11.185 47.098 44.148 1.00 48.33  ? 171  GLN A N   1 
ATOM   233  C  CA  . GLN A 1 35  ? -11.829 46.334 45.220 1.00 47.84  ? 171  GLN A CA  1 
ATOM   234  C  C   . GLN A 1 35  ? -12.142 44.914 44.764 1.00 40.56  ? 171  GLN A C   1 
ATOM   235  O  O   . GLN A 1 35  ? -12.320 44.666 43.572 1.00 38.03  ? 171  GLN A O   1 
ATOM   236  C  CB  . GLN A 1 35  ? -13.115 47.028 45.668 1.00 60.79  ? 171  GLN A CB  1 
ATOM   237  C  CG  . GLN A 1 35  ? -13.122 47.453 47.137 1.00 74.48  ? 171  GLN A CG  1 
ATOM   238  C  CD  . GLN A 1 35  ? -12.051 48.480 47.469 1.00 78.52  ? 171  GLN A CD  1 
ATOM   239  O  OE1 . GLN A 1 35  ? -11.848 49.442 46.732 1.00 80.21  ? 171  GLN A OE1 1 
ATOM   240  N  NE2 . GLN A 1 35  ? -11.360 48.277 48.586 1.00 78.96  ? 171  GLN A NE2 1 
ATOM   241  N  N   . ALA A 1 36  ? -12.211 43.981 45.710 1.00 40.89  ? 172  ALA A N   1 
ATOM   242  C  CA  . ALA A 1 36  ? -12.459 42.578 45.381 1.00 46.21  ? 172  ALA A CA  1 
ATOM   243  C  C   . ALA A 1 36  ? -13.953 42.329 45.201 1.00 49.53  ? 172  ALA A C   1 
ATOM   244  O  O   . ALA A 1 36  ? -14.531 41.470 45.863 1.00 51.52  ? 172  ALA A O   1 
ATOM   245  C  CB  . ALA A 1 36  ? -11.896 41.670 46.468 1.00 44.89  ? 172  ALA A CB  1 
ATOM   246  N  N   . THR A 1 37  ? -14.559 43.080 44.288 1.00 47.79  ? 173  THR A N   1 
ATOM   247  C  CA  . THR A 1 37  ? -16.003 43.076 44.092 1.00 45.82  ? 173  THR A CA  1 
ATOM   248  C  C   . THR A 1 37  ? -16.360 42.753 42.651 1.00 41.57  ? 173  THR A C   1 
ATOM   249  O  O   . THR A 1 37  ? -17.504 42.948 42.230 1.00 44.16  ? 173  THR A O   1 
ATOM   250  C  CB  . THR A 1 37  ? -16.584 44.453 44.419 1.00 48.74  ? 173  THR A CB  1 
ATOM   251  O  OG1 . THR A 1 37  ? -15.793 45.458 43.770 1.00 44.24  ? 173  THR A OG1 1 
ATOM   252  C  CG2 . THR A 1 37  ? -16.557 44.701 45.916 1.00 50.18  ? 173  THR A CG2 1 
ATOM   253  N  N   . LEU A 1 38  ? -15.373 42.276 41.897 1.00 39.54  ? 174  LEU A N   1 
ATOM   254  C  CA  . LEU A 1 38  ? -15.554 41.991 40.476 1.00 41.57  ? 174  LEU A CA  1 
ATOM   255  C  C   . LEU A 1 38  ? -15.933 40.526 40.264 1.00 42.01  ? 174  LEU A C   1 
ATOM   256  O  O   . LEU A 1 38  ? -15.137 39.620 40.525 1.00 29.51  ? 174  LEU A O   1 
ATOM   257  C  CB  . LEU A 1 38  ? -14.281 42.327 39.697 1.00 33.33  ? 174  LEU A CB  1 
ATOM   258  C  CG  . LEU A 1 38  ? -14.355 42.604 38.187 1.00 38.00  ? 174  LEU A CG  1 
ATOM   259  C  CD1 . LEU A 1 38  ? -14.368 41.324 37.378 1.00 46.57  ? 174  LEU A CD1 1 
ATOM   260  C  CD2 . LEU A 1 38  ? -15.563 43.457 37.836 1.00 43.11  ? 174  LEU A CD2 1 
ATOM   261  N  N   . THR A 1 39  ? -17.158 40.312 39.801 1.00 40.45  ? 175  THR A N   1 
ATOM   262  C  CA  . THR A 1 39  ? -17.652 38.979 39.505 1.00 42.13  ? 175  THR A CA  1 
ATOM   263  C  C   . THR A 1 39  ? -17.472 38.728 38.020 1.00 39.99  ? 175  THR A C   1 
ATOM   264  O  O   . THR A 1 39  ? -18.010 39.466 37.190 1.00 41.52  ? 175  THR A O   1 
ATOM   265  C  CB  . THR A 1 39  ? -19.139 38.865 39.863 1.00 43.56  ? 175  THR A CB  1 
ATOM   266  O  OG1 . THR A 1 39  ? -19.285 38.988 41.284 1.00 45.88  ? 175  THR A OG1 1 
ATOM   267  C  CG2 . THR A 1 39  ? -19.688 37.524 39.417 1.00 41.13  ? 175  THR A CG2 1 
ATOM   268  N  N   . LEU A 1 40  ? -16.715 37.695 37.679 1.00 33.32  ? 176  LEU A N   1 
ATOM   269  C  CA  . LEU A 1 40  ? -16.394 37.444 36.279 1.00 41.37  ? 176  LEU A CA  1 
ATOM   270  C  C   . LEU A 1 40  ? -17.570 36.899 35.476 1.00 45.97  ? 176  LEU A C   1 
ATOM   271  O  O   . LEU A 1 40  ? -18.257 35.966 35.914 1.00 39.95  ? 176  LEU A O   1 
ATOM   272  C  CB  . LEU A 1 40  ? -15.182 36.520 36.169 1.00 32.40  ? 176  LEU A CB  1 
ATOM   273  C  CG  . LEU A 1 40  ? -13.871 37.261 36.439 1.00 31.60  ? 176  LEU A CG  1 
ATOM   274  C  CD1 . LEU A 1 40  ? -12.684 36.321 36.459 1.00 32.25  ? 176  LEU A CD1 1 
ATOM   275  C  CD2 . LEU A 1 40  ? -13.668 38.330 35.392 1.00 37.13  ? 176  LEU A CD2 1 
ATOM   276  N  N   . THR A 1 41  ? -17.798 37.502 34.307 1.00 49.39  ? 177  THR A N   1 
ATOM   277  C  CA  . THR A 1 41  ? -18.789 37.007 33.353 1.00 57.73  ? 177  THR A CA  1 
ATOM   278  C  C   . THR A 1 41  ? -18.480 35.549 33.022 1.00 55.79  ? 177  THR A C   1 
ATOM   279  O  O   . THR A 1 41  ? -19.380 34.704 32.969 1.00 42.51  ? 177  THR A O   1 
ATOM   280  C  CB  . THR A 1 41  ? -18.796 37.837 32.050 1.00 64.91  ? 177  THR A CB  1 
ATOM   281  O  OG1 . THR A 1 41  ? -19.192 39.187 32.333 1.00 71.10  ? 177  THR A OG1 1 
ATOM   282  C  CG2 . THR A 1 41  ? -19.766 37.231 31.041 1.00 67.45  ? 177  THR A CG2 1 
ATOM   283  N  N   . GLN A 1 42  ? -17.194 35.281 32.795 1.00 57.51  ? 178  GLN A N   1 
ATOM   284  C  CA  . GLN A 1 42  ? -16.673 33.931 32.628 1.00 59.20  ? 178  GLN A CA  1 
ATOM   285  C  C   . GLN A 1 42  ? -15.246 33.932 33.174 1.00 50.15  ? 178  GLN A C   1 
ATOM   286  O  O   . GLN A 1 42  ? -14.587 34.975 33.175 1.00 49.65  ? 178  GLN A O   1 
ATOM   287  C  CB  . GLN A 1 42  ? -16.688 33.513 31.154 1.00 64.90  ? 178  GLN A CB  1 
ATOM   288  C  CG  . GLN A 1 42  ? -15.680 34.248 30.278 1.00 65.28  ? 178  GLN A CG  1 
ATOM   289  C  CD  . GLN A 1 42  ? -15.681 33.746 28.845 1.00 76.56  ? 178  GLN A CD  1 
ATOM   290  O  OE1 . GLN A 1 42  ? -16.414 32.814 28.500 1.00 84.14  ? 178  GLN A OE1 1 
ATOM   291  N  NE2 . GLN A 1 42  ? -14.860 34.364 28.000 1.00 76.39  ? 178  GLN A NE2 1 
ATOM   292  N  N   . GLY A 1 43  ? -14.774 32.781 33.652 1.00 34.02  ? 179  GLY A N   1 
ATOM   293  C  CA  . GLY A 1 43  ? -13.454 32.705 34.259 1.00 29.52  ? 179  GLY A CA  1 
ATOM   294  C  C   . GLY A 1 43  ? -12.312 32.681 33.263 1.00 25.15  ? 179  GLY A C   1 
ATOM   295  O  O   . GLY A 1 43  ? -12.533 32.456 32.071 1.00 33.68  ? 179  GLY A O   1 
ATOM   296  N  N   . PRO A 1 44  ? -11.081 32.921 33.741 1.00 23.18  ? 180  PRO A N   1 
ATOM   297  C  CA  . PRO A 1 44  ? -9.917  32.858 32.852 1.00 20.24  ? 180  PRO A CA  1 
ATOM   298  C  C   . PRO A 1 44  ? -9.703  31.425 32.397 1.00 29.11  ? 180  PRO A C   1 
ATOM   299  O  O   . PRO A 1 44  ? -10.000 30.497 33.158 1.00 25.54  ? 180  PRO A O   1 
ATOM   300  C  CB  . PRO A 1 44  ? -8.763  33.282 33.761 1.00 25.64  ? 180  PRO A CB  1 
ATOM   301  C  CG  . PRO A 1 44  ? -9.221  32.956 35.150 1.00 24.45  ? 180  PRO A CG  1 
ATOM   302  C  CD  . PRO A 1 44  ? -10.702 33.193 35.141 1.00 26.60  ? 180  PRO A CD  1 
ATOM   303  N  N   . SER A 1 45  ? -9.190  31.244 31.186 1.00 28.49  ? 181  SER A N   1 
ATOM   304  C  CA  . SER A 1 45  ? -9.044  29.907 30.630 1.00 31.33  ? 181  SER A CA  1 
ATOM   305  C  C   . SER A 1 45  ? -7.616  29.615 30.160 1.00 33.91  ? 181  SER A C   1 
ATOM   306  O  O   . SER A 1 45  ? -7.346  28.536 29.627 1.00 41.15  ? 181  SER A O   1 
ATOM   307  C  CB  . SER A 1 45  ? -10.034 29.711 29.482 1.00 28.70  ? 181  SER A CB  1 
ATOM   308  O  OG  . SER A 1 45  ? -9.726  30.569 28.398 1.00 32.34  ? 181  SER A OG  1 
ATOM   309  N  N   . CYS A 1 46  ? -6.713  30.574 30.379 1.00 30.43  ? 182  CYS A N   1 
ATOM   310  C  CA  . CYS A 1 46  ? -5.324  30.487 29.926 1.00 31.07  ? 182  CYS A CA  1 
ATOM   311  C  C   . CYS A 1 46  ? -4.493  31.621 30.534 1.00 32.77  ? 182  CYS A C   1 
ATOM   312  O  O   . CYS A 1 46  ? -5.052  32.530 31.147 1.00 31.89  ? 182  CYS A O   1 
ATOM   313  C  CB  . CYS A 1 46  ? -5.268  30.568 28.402 1.00 28.64  ? 182  CYS A CB  1 
ATOM   314  S  SG  . CYS A 1 46  ? -5.864  32.144 27.721 1.00 37.38  ? 182  CYS A SG  1 
ATOM   315  N  N   . TRP A 1 47  ? -3.171  31.587 30.356 1.00 30.97  ? 183  TRP A N   1 
ATOM   316  C  CA  . TRP A 1 47  ? -2.308  32.622 30.935 1.00 26.85  ? 183  TRP A CA  1 
ATOM   317  C  C   . TRP A 1 47  ? -2.600  34.038 30.403 1.00 26.71  ? 183  TRP A C   1 
ATOM   318  O  O   . TRP A 1 47  ? -2.625  34.997 31.175 1.00 26.78  ? 183  TRP A O   1 
ATOM   319  C  CB  . TRP A 1 47  ? -0.820  32.260 30.778 1.00 23.60  ? 183  TRP A CB  1 
ATOM   320  C  CG  . TRP A 1 47  ? -0.398  31.268 31.811 1.00 28.98  ? 183  TRP A CG  1 
ATOM   321  C  CD1 . TRP A 1 47  ? -0.155  29.932 31.629 1.00 20.09  ? 183  TRP A CD1 1 
ATOM   322  C  CD2 . TRP A 1 47  ? -0.235  31.520 33.218 1.00 24.25  ? 183  TRP A CD2 1 
ATOM   323  N  NE1 . TRP A 1 47  ? 0.169   29.346 32.838 1.00 23.47  ? 183  TRP A NE1 1 
ATOM   324  C  CE2 . TRP A 1 47  ? 0.122   30.297 33.825 1.00 23.63  ? 183  TRP A CE2 1 
ATOM   325  C  CE3 . TRP A 1 47  ? -0.347  32.662 34.016 1.00 20.20  ? 183  TRP A CE3 1 
ATOM   326  C  CZ2 . TRP A 1 47  ? 0.377   30.192 35.197 1.00 24.53  ? 183  TRP A CZ2 1 
ATOM   327  C  CZ3 . TRP A 1 47  ? -0.101  32.557 35.371 1.00 19.99  ? 183  TRP A CZ3 1 
ATOM   328  C  CH2 . TRP A 1 47  ? 0.256   31.331 35.951 1.00 20.06  ? 183  TRP A CH2 1 
ATOM   329  N  N   . ASP A 1 48  ? -2.835  34.169 29.100 1.00 28.68  ? 184  ASP A N   1 
ATOM   330  C  CA  . ASP A 1 48  ? -3.136  35.479 28.513 1.00 34.26  ? 184  ASP A CA  1 
ATOM   331  C  C   . ASP A 1 48  ? -4.318  36.187 29.195 1.00 35.72  ? 184  ASP A C   1 
ATOM   332  O  O   . ASP A 1 48  ? -4.307  37.411 29.339 1.00 33.33  ? 184  ASP A O   1 
ATOM   333  C  CB  . ASP A 1 48  ? -3.372  35.357 27.000 1.00 39.17  ? 184  ASP A CB  1 
ATOM   334  C  CG  . ASP A 1 48  ? -2.077  35.215 26.214 1.00 46.96  ? 184  ASP A CG  1 
ATOM   335  O  OD1 . ASP A 1 48  ? -1.011  35.584 26.750 1.00 41.14  ? 184  ASP A OD1 1 
ATOM   336  O  OD2 . ASP A 1 48  ? -2.123  34.745 25.057 1.00 53.76  ? 184  ASP A OD2 1 
ATOM   337  N  N   . ASP A 1 49  ? -5.314  35.415 29.636 1.00 32.06  ? 185  ASP A N   1 
ATOM   338  C  CA  . ASP A 1 49  ? -6.506  35.975 30.284 1.00 26.95  ? 185  ASP A CA  1 
ATOM   339  C  C   . ASP A 1 49  ? -6.208  36.671 31.612 1.00 30.19  ? 185  ASP A C   1 
ATOM   340  O  O   . ASP A 1 49  ? -6.943  37.580 32.008 1.00 30.78  ? 185  ASP A O   1 
ATOM   341  C  CB  . ASP A 1 49  ? -7.561  34.890 30.534 1.00 24.92  ? 185  ASP A CB  1 
ATOM   342  C  CG  . ASP A 1 49  ? -8.319  34.500 29.282 1.00 33.78  ? 185  ASP A CG  1 
ATOM   343  O  OD1 . ASP A 1 49  ? -8.190  35.205 28.263 1.00 36.44  ? 185  ASP A OD1 1 
ATOM   344  O  OD2 . ASP A 1 49  ? -9.058  33.487 29.328 1.00 38.86  ? 185  ASP A OD2 1 
ATOM   345  N  N   . VAL A 1 50  ? -5.154  36.236 32.308 1.00 20.56  ? 186  VAL A N   1 
ATOM   346  C  CA  . VAL A 1 50  ? -4.804  36.824 33.609 1.00 23.34  ? 186  VAL A CA  1 
ATOM   347  C  C   . VAL A 1 50  ? -3.551  37.700 33.558 1.00 26.43  ? 186  VAL A C   1 
ATOM   348  O  O   . VAL A 1 50  ? -3.243  38.405 34.521 1.00 35.63  ? 186  VAL A O   1 
ATOM   349  C  CB  . VAL A 1 50  ? -4.579  35.748 34.703 1.00 29.47  ? 186  VAL A CB  1 
ATOM   350  C  CG1 . VAL A 1 50  ? -5.842  34.957 34.956 1.00 22.52  ? 186  VAL A CG1 1 
ATOM   351  C  CG2 . VAL A 1 50  ? -3.420  34.826 34.319 1.00 27.74  ? 186  VAL A CG2 1 
ATOM   352  N  N   . LEU A 1 51  ? -2.828  37.657 32.441 1.00 26.06  ? 187  LEU A N   1 
ATOM   353  C  CA  . LEU A 1 51  ? -1.564  38.401 32.318 1.00 27.11  ? 187  LEU A CA  1 
ATOM   354  C  C   . LEU A 1 51  ? -1.694  39.679 31.480 1.00 32.17  ? 187  LEU A C   1 
ATOM   355  O  O   . LEU A 1 51  ? -1.012  40.677 31.733 1.00 33.24  ? 187  LEU A O   1 
ATOM   356  C  CB  . LEU A 1 51  ? -0.463  37.495 31.744 1.00 29.18  ? 187  LEU A CB  1 
ATOM   357  C  CG  . LEU A 1 51  ? 0.582   36.900 32.697 1.00 32.62  ? 187  LEU A CG  1 
ATOM   358  C  CD1 . LEU A 1 51  ? -0.007  36.596 34.051 1.00 26.66  ? 187  LEU A CD1 1 
ATOM   359  C  CD2 . LEU A 1 51  ? 1.225   35.642 32.111 1.00 33.65  ? 187  LEU A CD2 1 
ATOM   360  N  N   . ILE A 1 52  ? -2.572  39.648 30.486 1.00 32.74  ? 188  ILE A N   1 
ATOM   361  C  CA  . ILE A 1 52  ? -2.761  40.789 29.601 1.00 32.80  ? 188  ILE A CA  1 
ATOM   362  C  C   . ILE A 1 52  ? -3.885  41.698 30.118 1.00 26.90  ? 188  ILE A C   1 
ATOM   363  O  O   . ILE A 1 52  ? -5.007  41.241 30.303 1.00 29.86  ? 188  ILE A O   1 
ATOM   364  C  CB  . ILE A 1 52  ? -3.083  40.317 28.174 1.00 34.01  ? 188  ILE A CB  1 
ATOM   365  C  CG1 . ILE A 1 52  ? -1.924  39.477 27.621 1.00 37.49  ? 188  ILE A CG1 1 
ATOM   366  C  CG2 . ILE A 1 52  ? -3.367  41.505 27.272 1.00 31.90  ? 188  ILE A CG2 1 
ATOM   367  C  CD1 . ILE A 1 52  ? -2.224  38.814 26.288 1.00 38.77  ? 188  ILE A CD1 1 
ATOM   368  N  N   . PRO A 1 53  ? -3.573  42.989 30.357 1.00 26.50  ? 189  PRO A N   1 
ATOM   369  C  CA  . PRO A 1 53  ? -4.534  43.976 30.868 1.00 27.30  ? 189  PRO A CA  1 
ATOM   370  C  C   . PRO A 1 53  ? -5.868  43.942 30.138 1.00 31.23  ? 189  PRO A C   1 
ATOM   371  O  O   . PRO A 1 53  ? -5.883  43.885 28.910 1.00 38.29  ? 189  PRO A O   1 
ATOM   372  C  CB  . PRO A 1 53  ? -3.840  45.314 30.586 1.00 27.20  ? 189  PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 53  ? -2.368  44.999 30.736 1.00 26.72  ? 189  PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 53  ? -2.203  43.545 30.280 1.00 25.70  ? 189  PRO A CD  1 
ATOM   375  N  N   . ASN A 1 54  ? -6.961  43.941 30.895 1.00 29.87  ? 190  ASN A N   1 
ATOM   376  C  CA  . ASN A 1 54  ? -8.291  44.146 30.336 1.00 37.06  ? 190  ASN A CA  1 
ATOM   377  C  C   . ASN A 1 54  ? -8.784  43.030 29.414 1.00 35.37  ? 190  ASN A C   1 
ATOM   378  O  O   . ASN A 1 54  ? -9.726  43.233 28.647 1.00 40.72  ? 190  ASN A O   1 
ATOM   379  C  CB  . ASN A 1 54  ? -8.347  45.505 29.621 1.00 38.86  ? 190  ASN A CB  1 
ATOM   380  C  CG  . ASN A 1 54  ? -7.845  46.636 30.491 1.00 38.38  ? 190  ASN A CG  1 
ATOM   381  O  OD1 . ASN A 1 54  ? -8.439  46.951 31.521 1.00 50.51  ? 190  ASN A OD1 1 
ATOM   382  N  ND2 . ASN A 1 54  ? -6.758  47.264 30.075 1.00 38.62  ? 190  ASN A ND2 1 
ATOM   383  N  N   . ARG A 1 55  ? -8.157  41.858 29.496 1.00 29.39  ? 191  ARG A N   1 
ATOM   384  C  CA  . ARG A 1 55  ? -8.567  40.712 28.689 1.00 32.85  ? 191  ARG A CA  1 
ATOM   385  C  C   . ARG A 1 55  ? -9.998  40.281 28.997 1.00 37.70  ? 191  ARG A C   1 
ATOM   386  O  O   . ARG A 1 55  ? -10.722 39.824 28.111 1.00 44.32  ? 191  ARG A O   1 
ATOM   387  C  CB  . ARG A 1 55  ? -7.648  39.527 28.959 1.00 38.49  ? 191  ARG A CB  1 
ATOM   388  C  CG  . ARG A 1 55  ? -6.718  39.176 27.821 1.00 53.27  ? 191  ARG A CG  1 
ATOM   389  C  CD  . ARG A 1 55  ? -7.477  38.617 26.635 1.00 64.42  ? 191  ARG A CD  1 
ATOM   390  N  NE  . ARG A 1 55  ? -6.612  37.767 25.822 1.00 73.33  ? 191  ARG A NE  1 
ATOM   391  C  CZ  . ARG A 1 55  ? -5.808  38.214 24.860 1.00 79.08  ? 191  ARG A CZ  1 
ATOM   392  N  NH1 . ARG A 1 55  ? -5.752  39.512 24.575 1.00 79.86  ? 191  ARG A NH1 1 
ATOM   393  N  NH2 . ARG A 1 55  ? -5.055  37.358 24.183 1.00 82.06  ? 191  ARG A NH2 1 
ATOM   394  N  N   . MET A 1 56  ? -10.396 40.420 30.258 1.00 31.98  ? 192  MET A N   1 
ATOM   395  C  CA  . MET A 1 56  ? -11.646 39.829 30.735 1.00 34.80  ? 192  MET A CA  1 
ATOM   396  C  C   . MET A 1 56  ? -12.594 40.838 31.375 1.00 36.16  ? 192  MET A C   1 
ATOM   397  O  O   . MET A 1 56  ? -12.156 41.805 32.009 1.00 33.14  ? 192  MET A O   1 
ATOM   398  C  CB  . MET A 1 56  ? -11.343 38.695 31.710 1.00 28.26  ? 192  MET A CB  1 
ATOM   399  C  CG  . MET A 1 56  ? -10.435 37.642 31.096 1.00 30.19  ? 192  MET A CG  1 
ATOM   400  S  SD  . MET A 1 56  ? -11.052 36.004 31.436 1.00 53.93  ? 192  MET A SD  1 
ATOM   401  C  CE  . MET A 1 56  ? -11.081 36.125 33.205 1.00 49.83  ? 192  MET A CE  1 
ATOM   402  N  N   . SER A 1 57  ? -13.891 40.595 31.212 1.00 26.80  ? 193  SER A N   1 
ATOM   403  C  CA  . SER A 1 57  ? -14.908 41.520 31.690 1.00 35.66  ? 193  SER A CA  1 
ATOM   404  C  C   . SER A 1 57  ? -15.792 40.880 32.745 1.00 42.55  ? 193  SER A C   1 
ATOM   405  O  O   . SER A 1 57  ? -15.907 39.651 32.820 1.00 43.57  ? 193  SER A O   1 
ATOM   406  C  CB  . SER A 1 57  ? -15.781 42.001 30.532 1.00 34.84  ? 193  SER A CB  1 
ATOM   407  O  OG  . SER A 1 57  ? -14.996 42.637 29.544 1.00 39.20  ? 193  SER A OG  1 
ATOM   408  N  N   . GLY A 1 58  ? -16.424 41.721 33.554 1.00 40.46  ? 194  GLY A N   1 
ATOM   409  C  CA  . GLY A 1 58  ? -17.320 41.241 34.585 1.00 41.16  ? 194  GLY A CA  1 
ATOM   410  C  C   . GLY A 1 58  ? -18.174 42.363 35.135 1.00 43.40  ? 194  GLY A C   1 
ATOM   411  O  O   . GLY A 1 58  ? -18.359 43.405 34.491 1.00 40.38  ? 194  GLY A O   1 
ATOM   412  N  N   . GLU A 1 59  ? -18.694 42.145 36.336 1.00 41.49  ? 195  GLU A N   1 
ATOM   413  C  CA  . GLU A 1 59  ? -19.557 43.120 36.983 1.00 40.81  ? 195  GLU A CA  1 
ATOM   414  C  C   . GLU A 1 59  ? -18.990 43.467 38.345 1.00 43.09  ? 195  GLU A C   1 
ATOM   415  O  O   . GLU A 1 59  ? -18.720 42.578 39.158 1.00 42.75  ? 195  GLU A O   1 
ATOM   416  C  CB  . GLU A 1 59  ? -20.961 42.545 37.160 1.00 35.13  ? 195  GLU A CB  1 
ATOM   417  N  N   . CYS A 1 60  ? -18.794 44.755 38.596 1.00 46.88  ? 196  CYS A N   1 
ATOM   418  C  CA  . CYS A 1 60  ? -18.372 45.181 39.916 1.00 47.28  ? 196  CYS A CA  1 
ATOM   419  C  C   . CYS A 1 60  ? -19.606 45.285 40.791 1.00 49.23  ? 196  CYS A C   1 
ATOM   420  O  O   . CYS A 1 60  ? -20.616 45.849 40.372 1.00 54.99  ? 196  CYS A O   1 
ATOM   421  C  CB  . CYS A 1 60  ? -17.679 46.535 39.841 1.00 44.00  ? 196  CYS A CB  1 
ATOM   422  S  SG  . CYS A 1 60  ? -16.942 47.041 41.391 1.00 43.94  ? 196  CYS A SG  1 
ATOM   423  N  N   . GLN A 1 61  ? -19.535 44.740 42.000 1.00 51.37  ? 197  GLN A N   1 
ATOM   424  C  CA  . GLN A 1 61  ? -20.668 44.832 42.918 1.00 56.99  ? 197  GLN A CA  1 
ATOM   425  C  C   . GLN A 1 61  ? -20.517 45.991 43.905 1.00 60.71  ? 197  GLN A C   1 
ATOM   426  O  O   . GLN A 1 61  ? -21.355 46.164 44.786 1.00 64.47  ? 197  GLN A O   1 
ATOM   427  C  CB  . GLN A 1 61  ? -20.887 43.510 43.663 1.00 50.28  ? 197  GLN A CB  1 
ATOM   428  N  N   . SER A 1 62  ? -19.455 46.783 43.760 1.00 61.75  ? 198  SER A N   1 
ATOM   429  C  CA  . SER A 1 62  ? -19.294 47.988 44.580 1.00 65.47  ? 198  SER A CA  1 
ATOM   430  C  C   . SER A 1 62  ? -20.409 48.991 44.292 1.00 69.88  ? 198  SER A C   1 
ATOM   431  O  O   . SER A 1 62  ? -20.832 49.121 43.141 1.00 67.24  ? 198  SER A O   1 
ATOM   432  C  CB  . SER A 1 62  ? -17.928 48.638 44.350 1.00 62.63  ? 198  SER A CB  1 
ATOM   433  O  OG  . SER A 1 62  ? -16.902 47.906 44.996 1.00 57.41  ? 198  SER A OG  1 
ATOM   434  N  N   . PRO A 1 63  ? -20.879 49.699 45.341 1.00 76.24  ? 199  PRO A N   1 
ATOM   435  C  CA  . PRO A 1 63  ? -21.993 50.657 45.334 1.00 80.85  ? 199  PRO A CA  1 
ATOM   436  C  C   . PRO A 1 63  ? -22.140 51.479 44.054 1.00 78.34  ? 199  PRO A C   1 
ATOM   437  O  O   . PRO A 1 63  ? -23.058 51.237 43.268 1.00 76.99  ? 199  PRO A O   1 
ATOM   438  C  CB  . PRO A 1 63  ? -21.640 51.581 46.499 1.00 83.97  ? 199  PRO A CB  1 
ATOM   439  C  CG  . PRO A 1 63  ? -21.001 50.675 47.482 1.00 80.98  ? 199  PRO A CG  1 
ATOM   440  C  CD  . PRO A 1 63  ? -20.273 49.606 46.685 1.00 76.69  ? 199  PRO A CD  1 
ATOM   441  N  N   . HIS A 1 64  ? -21.248 52.442 43.852 1.00 74.79  ? 200  HIS A N   1 
ATOM   442  C  CA  . HIS A 1 64  ? -21.381 53.354 42.724 1.00 74.24  ? 200  HIS A CA  1 
ATOM   443  C  C   . HIS A 1 64  ? -20.271 53.182 41.681 1.00 67.43  ? 200  HIS A C   1 
ATOM   444  O  O   . HIS A 1 64  ? -19.979 54.106 40.922 1.00 68.26  ? 200  HIS A O   1 
ATOM   445  C  CB  . HIS A 1 64  ? -21.425 54.802 43.223 1.00 82.25  ? 200  HIS A CB  1 
ATOM   446  C  CG  . HIS A 1 64  ? -22.083 54.960 44.561 1.00 92.32  ? 200  HIS A CG  1 
ATOM   447  N  ND1 . HIS A 1 64  ? -23.427 54.728 44.763 1.00 95.66  ? 200  HIS A ND1 1 
ATOM   448  C  CD2 . HIS A 1 64  ? -21.580 55.333 45.762 1.00 96.53  ? 200  HIS A CD2 1 
ATOM   449  C  CE1 . HIS A 1 64  ? -23.722 54.946 46.033 1.00 99.04  ? 200  HIS A CE1 1 
ATOM   450  N  NE2 . HIS A 1 64  ? -22.620 55.314 46.660 1.00 100.05 ? 200  HIS A NE2 1 
ATOM   451  N  N   . CYS A 1 65  ? -19.663 52.000 41.641 1.00 53.85  ? 201  CYS A N   1 
ATOM   452  C  CA  . CYS A 1 65  ? -18.612 51.733 40.668 1.00 48.08  ? 201  CYS A CA  1 
ATOM   453  C  C   . CYS A 1 65  ? -19.179 51.146 39.374 1.00 45.93  ? 201  CYS A C   1 
ATOM   454  O  O   . CYS A 1 65  ? -19.906 50.156 39.400 1.00 46.62  ? 201  CYS A O   1 
ATOM   455  C  CB  . CYS A 1 65  ? -17.552 50.797 41.246 1.00 43.58  ? 201  CYS A CB  1 
ATOM   456  S  SG  . CYS A 1 65  ? -16.177 50.582 40.119 1.00 41.06  ? 201  CYS A SG  1 
ATOM   457  N  N   . PRO A 1 66  ? -18.849 51.768 38.235 1.00 46.54  ? 202  PRO A N   1 
ATOM   458  C  CA  . PRO A 1 66  ? -19.267 51.299 36.913 1.00 46.02  ? 202  PRO A CA  1 
ATOM   459  C  C   . PRO A 1 66  ? -18.263 50.310 36.333 1.00 42.69  ? 202  PRO A C   1 
ATOM   460  O  O   . PRO A 1 66  ? -18.472 49.832 35.224 1.00 48.41  ? 202  PRO A O   1 
ATOM   461  C  CB  . PRO A 1 66  ? -19.254 52.583 36.087 1.00 48.71  ? 202  PRO A CB  1 
ATOM   462  C  CG  . PRO A 1 66  ? -18.124 53.375 36.685 1.00 55.50  ? 202  PRO A CG  1 
ATOM   463  C  CD  . PRO A 1 66  ? -18.069 53.016 38.155 1.00 48.22  ? 202  PRO A CD  1 
ATOM   464  N  N   . GLY A 1 67  ? -17.202 50.006 37.079 1.00 40.74  ? 203  GLY A N   1 
ATOM   465  C  CA  . GLY A 1 67  ? -16.147 49.118 36.613 1.00 37.85  ? 203  GLY A CA  1 
ATOM   466  C  C   . GLY A 1 67  ? -16.625 47.790 36.057 1.00 40.82  ? 203  GLY A C   1 
ATOM   467  O  O   . GLY A 1 67  ? -17.510 47.134 36.616 1.00 44.91  ? 203  GLY A O   1 
ATOM   468  N  N   . THR A 1 68  ? -16.010 47.386 34.954 1.00 38.57  ? 204  THR A N   1 
ATOM   469  C  CA  . THR A 1 68  ? -16.450 46.225 34.204 1.00 34.92  ? 204  THR A CA  1 
ATOM   470  C  C   . THR A 1 68  ? -15.235 45.342 33.840 1.00 40.04  ? 204  THR A C   1 
ATOM   471  O  O   . THR A 1 68  ? -15.382 44.203 33.404 1.00 46.73  ? 204  THR A O   1 
ATOM   472  C  CB  . THR A 1 68  ? -17.217 46.711 32.957 1.00 44.14  ? 204  THR A CB  1 
ATOM   473  O  OG1 . THR A 1 68  ? -18.530 46.128 32.928 1.00 61.19  ? 204  THR A OG1 1 
ATOM   474  C  CG2 . THR A 1 68  ? -16.465 46.406 31.678 1.00 38.15  ? 204  THR A CG2 1 
ATOM   475  N  N   . SER A 1 69  ? -14.032 45.867 34.054 1.00 31.00  ? 205  SER A N   1 
ATOM   476  C  CA  . SER A 1 69  ? -12.813 45.146 33.691 1.00 29.08  ? 205  SER A CA  1 
ATOM   477  C  C   . SER A 1 69  ? -12.138 44.474 34.875 1.00 33.75  ? 205  SER A C   1 
ATOM   478  O  O   . SER A 1 69  ? -12.069 45.039 35.972 1.00 28.80  ? 205  SER A O   1 
ATOM   479  C  CB  . SER A 1 69  ? -11.816 46.068 32.992 1.00 29.84  ? 205  SER A CB  1 
ATOM   480  O  OG  . SER A 1 69  ? -12.370 46.570 31.796 1.00 37.14  ? 205  SER A OG  1 
ATOM   481  N  N   . ALA A 1 70  ? -11.630 43.270 34.631 1.00 25.51  ? 206  ALA A N   1 
ATOM   482  C  CA  . ALA A 1 70  ? -10.943 42.489 35.656 1.00 30.65  ? 206  ALA A CA  1 
ATOM   483  C  C   . ALA A 1 70  ? -9.451  42.789 35.668 1.00 32.48  ? 206  ALA A C   1 
ATOM   484  O  O   . ALA A 1 70  ? -8.836  42.974 34.614 1.00 30.83  ? 206  ALA A O   1 
ATOM   485  C  CB  . ALA A 1 70  ? -11.158 41.007 35.424 1.00 22.66  ? 206  ALA A CB  1 
ATOM   486  N  N   . GLU A 1 71  ? -8.876  42.796 36.867 1.00 28.11  ? 207  GLU A N   1 
ATOM   487  C  CA  . GLU A 1 71  ? -7.440  42.954 37.059 1.00 31.53  ? 207  GLU A CA  1 
ATOM   488  C  C   . GLU A 1 71  ? -6.997  41.796 37.940 1.00 29.76  ? 207  GLU A C   1 
ATOM   489  O  O   . GLU A 1 71  ? -7.456  41.668 39.081 1.00 23.89  ? 207  GLU A O   1 
ATOM   490  C  CB  . GLU A 1 71  ? -7.168  44.283 37.758 1.00 35.70  ? 207  GLU A CB  1 
ATOM   491  C  CG  . GLU A 1 71  ? -5.720  44.557 38.127 1.00 42.76  ? 207  GLU A CG  1 
ATOM   492  C  CD  . GLU A 1 71  ? -5.512  46.020 38.513 1.00 53.73  ? 207  GLU A CD  1 
ATOM   493  O  OE1 . GLU A 1 71  ? -5.687  46.364 39.700 1.00 56.76  ? 207  GLU A OE1 1 
ATOM   494  O  OE2 . GLU A 1 71  ? -5.194  46.832 37.621 1.00 55.12  ? 207  GLU A OE2 1 
ATOM   495  N  N   . PHE A 1 72  ? -6.130  40.939 37.413 1.00 26.15  ? 208  PHE A N   1 
ATOM   496  C  CA  . PHE A 1 72  ? -5.689  39.767 38.155 1.00 30.24  ? 208  PHE A CA  1 
ATOM   497  C  C   . PHE A 1 72  ? -4.340  40.016 38.807 1.00 25.73  ? 208  PHE A C   1 
ATOM   498  O  O   . PHE A 1 72  ? -3.543  40.802 38.307 1.00 23.31  ? 208  PHE A O   1 
ATOM   499  C  CB  . PHE A 1 72  ? -5.589  38.552 37.229 1.00 26.81  ? 208  PHE A CB  1 
ATOM   500  C  CG  . PHE A 1 72  ? -6.918  38.055 36.735 1.00 25.66  ? 208  PHE A CG  1 
ATOM   501  C  CD1 . PHE A 1 72  ? -7.632  37.128 37.467 1.00 22.39  ? 208  PHE A CD1 1 
ATOM   502  C  CD2 . PHE A 1 72  ? -7.451  38.512 35.532 1.00 26.14  ? 208  PHE A CD2 1 
ATOM   503  C  CE1 . PHE A 1 72  ? -8.856  36.656 37.023 1.00 26.18  ? 208  PHE A CE1 1 
ATOM   504  C  CE2 . PHE A 1 72  ? -8.682  38.044 35.079 1.00 20.96  ? 208  PHE A CE2 1 
ATOM   505  C  CZ  . PHE A 1 72  ? -9.387  37.123 35.839 1.00 20.84  ? 208  PHE A CZ  1 
ATOM   506  N  N   . PHE A 1 73  ? -4.093  39.338 39.925 1.00 25.96  ? 209  PHE A N   1 
ATOM   507  C  CA  . PHE A 1 73  ? -2.778  39.344 40.561 1.00 28.92  ? 209  PHE A CA  1 
ATOM   508  C  C   . PHE A 1 73  ? -2.609  38.071 41.382 1.00 29.82  ? 209  PHE A C   1 
ATOM   509  O  O   . PHE A 1 73  ? -3.598  37.399 41.710 1.00 25.48  ? 209  PHE A O   1 
ATOM   510  C  CB  . PHE A 1 73  ? -2.563  40.597 41.420 1.00 23.82  ? 209  PHE A CB  1 
ATOM   511  C  CG  . PHE A 1 73  ? -3.508  40.712 42.596 1.00 29.33  ? 209  PHE A CG  1 
ATOM   512  C  CD1 . PHE A 1 73  ? -4.729  41.363 42.461 1.00 31.33  ? 209  PHE A CD1 1 
ATOM   513  C  CD2 . PHE A 1 73  ? -3.161  40.191 43.842 1.00 30.69  ? 209  PHE A CD2 1 
ATOM   514  C  CE1 . PHE A 1 73  ? -5.610  41.481 43.548 1.00 33.71  ? 209  PHE A CE1 1 
ATOM   515  C  CE2 . PHE A 1 73  ? -4.023  40.304 44.931 1.00 32.25  ? 209  PHE A CE2 1 
ATOM   516  C  CZ  . PHE A 1 73  ? -5.251  40.955 44.786 1.00 32.95  ? 209  PHE A CZ  1 
ATOM   517  N  N   . PHE A 1 74  ? -1.363  37.733 41.703 1.00 27.35  ? 210  PHE A N   1 
ATOM   518  C  CA  . PHE A 1 74  ? -1.083  36.500 42.435 1.00 24.97  ? 210  PHE A CA  1 
ATOM   519  C  C   . PHE A 1 74  ? -0.474  36.808 43.796 1.00 25.05  ? 210  PHE A C   1 
ATOM   520  O  O   . PHE A 1 74  ? 0.171   37.845 43.973 1.00 28.06  ? 210  PHE A O   1 
ATOM   521  C  CB  . PHE A 1 74  ? -0.118  35.628 41.624 1.00 24.69  ? 210  PHE A CB  1 
ATOM   522  C  CG  . PHE A 1 74  ? -0.701  35.125 40.335 1.00 22.62  ? 210  PHE A CG  1 
ATOM   523  C  CD1 . PHE A 1 74  ? -0.644  35.897 39.178 1.00 22.93  ? 210  PHE A CD1 1 
ATOM   524  C  CD2 . PHE A 1 74  ? -1.312  33.883 40.283 1.00 19.93  ? 210  PHE A CD2 1 
ATOM   525  C  CE1 . PHE A 1 74  ? -1.192  35.431 37.989 1.00 25.97  ? 210  PHE A CE1 1 
ATOM   526  C  CE2 . PHE A 1 74  ? -1.862  33.409 39.098 1.00 26.51  ? 210  PHE A CE2 1 
ATOM   527  C  CZ  . PHE A 1 74  ? -1.799  34.181 37.949 1.00 19.72  ? 210  PHE A CZ  1 
ATOM   528  N  N   . LYS A 1 75  ? -0.666  35.910 44.757 1.00 28.04  ? 211  LYS A N   1 
ATOM   529  C  CA  . LYS A 1 75  ? -0.027  36.069 46.064 1.00 31.39  ? 211  LYS A CA  1 
ATOM   530  C  C   . LYS A 1 75  ? 0.600   34.760 46.531 1.00 33.18  ? 211  LYS A C   1 
ATOM   531  O  O   . LYS A 1 75  ? 0.080   33.681 46.228 1.00 30.58  ? 211  LYS A O   1 
ATOM   532  C  CB  . LYS A 1 75  ? -1.031  36.590 47.097 1.00 23.36  ? 211  LYS A CB  1 
ATOM   533  C  CG  . LYS A 1 75  ? -1.632  37.949 46.716 1.00 30.55  ? 211  LYS A CG  1 
ATOM   534  C  CD  . LYS A 1 75  ? -1.711  38.924 47.893 1.00 33.41  ? 211  LYS A CD  1 
ATOM   535  C  CE  . LYS A 1 75  ? -2.897  38.628 48.792 1.00 43.08  ? 211  LYS A CE  1 
ATOM   536  N  NZ  . LYS A 1 75  ? -2.932  39.558 49.962 1.00 38.57  ? 211  LYS A NZ  1 
ATOM   537  N  N   . CYS A 1 76  ? 1.719   34.851 47.249 1.00 25.24  ? 212  CYS A N   1 
ATOM   538  C  CA  . CYS A 1 76  ? 2.327   33.656 47.817 1.00 30.57  ? 212  CYS A CA  1 
ATOM   539  C  C   . CYS A 1 76  ? 1.343   33.062 48.802 1.00 26.44  ? 212  CYS A C   1 
ATOM   540  O  O   . CYS A 1 76  ? 0.726   33.797 49.561 1.00 24.98  ? 212  CYS A O   1 
ATOM   541  C  CB  . CYS A 1 76  ? 3.642   33.975 48.528 1.00 28.52  ? 212  CYS A CB  1 
ATOM   542  S  SG  . CYS A 1 76  ? 4.413   32.472 49.226 1.00 25.91  ? 212  CYS A SG  1 
ATOM   543  N  N   . GLY A 1 77  ? 1.176   31.741 48.784 1.00 30.88  ? 213  GLY A N   1 
ATOM   544  C  CA  . GLY A 1 77  ? 0.200   31.102 49.656 1.00 19.24  ? 213  GLY A CA  1 
ATOM   545  C  C   . GLY A 1 77  ? 0.777   30.450 50.906 1.00 27.73  ? 213  GLY A C   1 
ATOM   546  O  O   . GLY A 1 77  ? 0.041   29.908 51.722 1.00 29.76  ? 213  GLY A O   1 
ATOM   547  N  N   . ALA A 1 78  ? 2.091   30.510 51.092 1.00 29.25  ? 214  ALA A N   1 
ATOM   548  C  CA  . ALA A 1 78  ? 2.683   29.782 52.216 1.00 27.72  ? 214  ALA A CA  1 
ATOM   549  C  C   . ALA A 1 78  ? 2.579   30.506 53.564 1.00 24.49  ? 214  ALA A C   1 
ATOM   550  O  O   . ALA A 1 78  ? 3.046   29.981 54.575 1.00 33.88  ? 214  ALA A O   1 
ATOM   551  C  CB  . ALA A 1 78  ? 4.134   29.418 51.915 1.00 28.82  ? 214  ALA A CB  1 
ATOM   552  N  N   . HIS A 1 79  ? 1.968   31.694 53.581 1.00 22.98  ? 215  HIS A N   1 
ATOM   553  C  CA  . HIS A 1 79  ? 1.942   32.543 54.784 1.00 27.82  ? 215  HIS A CA  1 
ATOM   554  C  C   . HIS A 1 79  ? 0.980   33.716 54.595 1.00 27.84  ? 215  HIS A C   1 
ATOM   555  O  O   . HIS A 1 79  ? 0.571   33.995 53.466 1.00 25.87  ? 215  HIS A O   1 
ATOM   556  C  CB  . HIS A 1 79  ? 3.353   33.067 55.087 1.00 30.22  ? 215  HIS A CB  1 
ATOM   557  C  CG  . HIS A 1 79  ? 4.018   33.710 53.910 1.00 25.80  ? 215  HIS A CG  1 
ATOM   558  N  ND1 . HIS A 1 79  ? 3.561   34.880 53.341 1.00 21.28  ? 215  HIS A ND1 1 
ATOM   559  C  CD2 . HIS A 1 79  ? 5.094   33.332 53.179 1.00 25.38  ? 215  HIS A CD2 1 
ATOM   560  C  CE1 . HIS A 1 79  ? 4.329   35.196 52.311 1.00 23.87  ? 215  HIS A CE1 1 
ATOM   561  N  NE2 . HIS A 1 79  ? 5.266   34.270 52.194 1.00 26.92  ? 215  HIS A NE2 1 
ATOM   562  N  N   . PRO A 1 80  ? 0.602   34.401 55.695 1.00 30.20  ? 216  PRO A N   1 
ATOM   563  C  CA  . PRO A 1 80  ? -0.272  35.572 55.507 1.00 30.93  ? 216  PRO A CA  1 
ATOM   564  C  C   . PRO A 1 80  ? 0.383   36.603 54.585 1.00 34.56  ? 216  PRO A C   1 
ATOM   565  O  O   . PRO A 1 80  ? 1.613   36.725 54.602 1.00 35.39  ? 216  PRO A O   1 
ATOM   566  C  CB  . PRO A 1 80  ? -0.390  36.154 56.922 1.00 26.17  ? 216  PRO A CB  1 
ATOM   567  C  CG  . PRO A 1 80  ? -0.112  34.992 57.842 1.00 32.80  ? 216  PRO A CG  1 
ATOM   568  C  CD  . PRO A 1 80  ? 0.902   34.149 57.121 1.00 31.22  ? 216  PRO A CD  1 
ATOM   569  N  N   . THR A 1 81  ? -0.402  37.308 53.777 1.00 28.27  ? 217  THR A N   1 
ATOM   570  C  CA  . THR A 1 81  ? 0.140   38.427 53.003 1.00 33.68  ? 217  THR A CA  1 
ATOM   571  C  C   . THR A 1 81  ? -0.647  39.713 53.230 1.00 38.58  ? 217  THR A C   1 
ATOM   572  O  O   . THR A 1 81  ? -1.864  39.684 53.441 1.00 35.85  ? 217  THR A O   1 
ATOM   573  C  CB  . THR A 1 81  ? 0.196   38.139 51.491 1.00 34.47  ? 217  THR A CB  1 
ATOM   574  O  OG1 . THR A 1 81  ? -1.025  37.518 51.071 1.00 36.77  ? 217  THR A OG1 1 
ATOM   575  C  CG2 . THR A 1 81  ? 1.390   37.234 51.149 1.00 34.79  ? 217  THR A CG2 1 
ATOM   576  N  N   . SER A 1 82  ? 0.051   40.842 53.180 1.00 40.28  ? 218  SER A N   1 
ATOM   577  C  CA  . SER A 1 82  ? -0.611  42.134 53.268 1.00 45.31  ? 218  SER A CA  1 
ATOM   578  C  C   . SER A 1 82  ? -1.429  42.382 52.003 1.00 42.70  ? 218  SER A C   1 
ATOM   579  O  O   . SER A 1 82  ? -1.346  41.608 51.043 1.00 30.21  ? 218  SER A O   1 
ATOM   580  C  CB  . SER A 1 82  ? 0.411   43.244 53.473 1.00 41.47  ? 218  SER A CB  1 
ATOM   581  O  OG  . SER A 1 82  ? 1.135   43.030 54.665 1.00 42.91  ? 218  SER A OG  1 
ATOM   582  N  N   . ASP A 1 83  ? -2.203  43.459 51.999 1.00 43.13  ? 219  ASP A N   1 
ATOM   583  C  CA  . ASP A 1 83  ? -3.144  43.709 50.912 1.00 50.34  ? 219  ASP A CA  1 
ATOM   584  C  C   . ASP A 1 83  ? -2.470  43.743 49.536 1.00 40.94  ? 219  ASP A C   1 
ATOM   585  O  O   . ASP A 1 83  ? -2.990  43.173 48.575 1.00 33.53  ? 219  ASP A O   1 
ATOM   586  C  CB  . ASP A 1 83  ? -3.904  45.013 51.167 1.00 63.21  ? 219  ASP A CB  1 
ATOM   587  C  CG  . ASP A 1 83  ? -5.048  45.220 50.198 1.00 72.63  ? 219  ASP A CG  1 
ATOM   588  O  OD1 . ASP A 1 83  ? -5.838  44.271 49.998 1.00 73.96  ? 219  ASP A OD1 1 
ATOM   589  O  OD2 . ASP A 1 83  ? -5.157  46.335 49.639 1.00 80.75  ? 219  ASP A OD2 1 
ATOM   590  N  N   . LYS A 1 84  ? -1.315  44.399 49.451 1.00 39.46  ? 220  LYS A N   1 
ATOM   591  C  CA  . LYS A 1 84  ? -0.614  44.552 48.176 1.00 43.01  ? 220  LYS A CA  1 
ATOM   592  C  C   . LYS A 1 84  ? 0.698   43.764 48.083 1.00 34.71  ? 220  LYS A C   1 
ATOM   593  O  O   . LYS A 1 84  ? 1.526   44.039 47.214 1.00 38.68  ? 220  LYS A O   1 
ATOM   594  C  CB  . LYS A 1 84  ? -0.356  46.035 47.887 1.00 47.74  ? 220  LYS A CB  1 
ATOM   595  C  CG  . LYS A 1 84  ? -1.626  46.856 47.729 1.00 56.87  ? 220  LYS A CG  1 
ATOM   596  C  CD  . LYS A 1 84  ? -1.316  48.329 47.492 1.00 65.20  ? 220  LYS A CD  1 
ATOM   597  C  CE  . LYS A 1 84  ? -2.599  49.130 47.324 1.00 69.14  ? 220  LYS A CE  1 
ATOM   598  N  NZ  . LYS A 1 84  ? -2.330  50.586 47.170 1.00 73.28  ? 220  LYS A NZ  1 
ATOM   599  N  N   . GLU A 1 85  ? 0.888   42.803 48.981 1.00 33.61  ? 221  GLU A N   1 
ATOM   600  C  CA  . GLU A 1 85  ? 2.019   41.877 48.906 1.00 31.58  ? 221  GLU A CA  1 
ATOM   601  C  C   . GLU A 1 85  ? 1.806   40.910 47.754 1.00 26.12  ? 221  GLU A C   1 
ATOM   602  O  O   . GLU A 1 85  ? 1.448   39.749 47.976 1.00 26.46  ? 221  GLU A O   1 
ATOM   603  C  CB  . GLU A 1 85  ? 2.084   41.027 50.176 1.00 42.42  ? 221  GLU A CB  1 
ATOM   604  C  CG  . GLU A 1 85  ? 3.071   41.464 51.227 1.00 50.64  ? 221  GLU A CG  1 
ATOM   605  C  CD  . GLU A 1 85  ? 3.403   40.346 52.191 1.00 44.79  ? 221  GLU A CD  1 
ATOM   606  O  OE1 . GLU A 1 85  ? 4.306   39.546 51.879 1.00 44.81  ? 221  GLU A OE1 1 
ATOM   607  O  OE2 . GLU A 1 85  ? 2.761   40.266 53.258 1.00 45.84  ? 221  GLU A OE2 1 
ATOM   608  N  N   . THR A 1 86  ? 2.009   41.354 46.524 1.00 20.98  ? 222  THR A N   1 
ATOM   609  C  CA  . THR A 1 86  ? 1.806   40.448 45.392 1.00 29.17  ? 222  THR A CA  1 
ATOM   610  C  C   . THR A 1 86  ? 3.130   39.810 44.969 1.00 32.74  ? 222  THR A C   1 
ATOM   611  O  O   . THR A 1 86  ? 4.208   40.333 45.271 1.00 32.98  ? 222  THR A O   1 
ATOM   612  C  CB  . THR A 1 86  ? 1.221   41.189 44.186 1.00 28.30  ? 222  THR A CB  1 
ATOM   613  O  OG1 . THR A 1 86  ? 2.196   42.106 43.693 1.00 29.18  ? 222  THR A OG1 1 
ATOM   614  C  CG2 . THR A 1 86  ? -0.051  41.961 44.571 1.00 27.16  ? 222  THR A CG2 1 
ATOM   615  N  N   . SER A 1 87  ? 3.049   38.692 44.256 1.00 28.46  ? 223  SER A N   1 
ATOM   616  C  CA  . SER A 1 87  ? 4.248   38.073 43.700 1.00 28.18  ? 223  SER A CA  1 
ATOM   617  C  C   . SER A 1 87  ? 4.062   37.827 42.207 1.00 28.26  ? 223  SER A C   1 
ATOM   618  O  O   . SER A 1 87  ? 2.924   37.730 41.728 1.00 28.65  ? 223  SER A O   1 
ATOM   619  C  CB  . SER A 1 87  ? 4.563   36.763 44.426 1.00 25.92  ? 223  SER A CB  1 
ATOM   620  O  OG  . SER A 1 87  ? 4.780   36.984 45.804 1.00 27.88  ? 223  SER A OG  1 
ATOM   621  N  N   . VAL A 1 88  ? 5.174   37.727 41.483 1.00 26.22  ? 224  VAL A N   1 
ATOM   622  C  CA  . VAL A 1 88  ? 5.153   37.517 40.032 1.00 26.85  ? 224  VAL A CA  1 
ATOM   623  C  C   . VAL A 1 88  ? 4.899   36.053 39.679 1.00 25.94  ? 224  VAL A C   1 
ATOM   624  O  O   . VAL A 1 88  ? 5.553   35.155 40.215 1.00 31.85  ? 224  VAL A O   1 
ATOM   625  C  CB  . VAL A 1 88  ? 6.484   37.943 39.388 1.00 37.45  ? 224  VAL A CB  1 
ATOM   626  C  CG1 . VAL A 1 88  ? 6.430   37.756 37.878 1.00 39.31  ? 224  VAL A CG1 1 
ATOM   627  C  CG2 . VAL A 1 88  ? 6.785   39.390 39.727 1.00 41.42  ? 224  VAL A CG2 1 
ATOM   628  N  N   . ALA A 1 89  ? 3.958   35.811 38.770 1.00 22.53  ? 225  ALA A N   1 
ATOM   629  C  CA  . ALA A 1 89  ? 3.649   34.452 38.347 1.00 27.47  ? 225  ALA A CA  1 
ATOM   630  C  C   . ALA A 1 89  ? 4.749   33.915 37.437 1.00 26.58  ? 225  ALA A C   1 
ATOM   631  O  O   . ALA A 1 89  ? 5.189   34.596 36.519 1.00 27.19  ? 225  ALA A O   1 
ATOM   632  C  CB  . ALA A 1 89  ? 2.306   34.406 37.638 1.00 21.46  ? 225  ALA A CB  1 
ATOM   633  N  N   . LEU A 1 90  ? 5.195   32.692 37.694 1.00 25.24  ? 226  LEU A N   1 
ATOM   634  C  CA  . LEU A 1 90  ? 6.179   32.065 36.823 1.00 28.67  ? 226  LEU A CA  1 
ATOM   635  C  C   . LEU A 1 90  ? 5.428   31.023 36.000 1.00 30.90  ? 226  LEU A C   1 
ATOM   636  O  O   . LEU A 1 90  ? 5.288   29.864 36.417 1.00 31.51  ? 226  LEU A O   1 
ATOM   637  C  CB  . LEU A 1 90  ? 7.301   31.427 37.646 1.00 26.71  ? 226  LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 90  ? 8.117   32.373 38.537 1.00 35.59  ? 226  LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 90  ? 9.172   31.611 39.344 1.00 34.23  ? 226  LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 90  ? 8.778   33.476 37.710 1.00 31.44  ? 226  LEU A CD2 1 
ATOM   641  N  N   . HIS A 1 91  ? 4.941   31.438 34.832 1.00 26.34  ? 227  HIS A N   1 
ATOM   642  C  CA  . HIS A 1 91  ? 3.956   30.641 34.102 1.00 28.80  ? 227  HIS A CA  1 
ATOM   643  C  C   . HIS A 1 91  ? 4.521   29.376 33.461 1.00 35.60  ? 227  HIS A C   1 
ATOM   644  O  O   . HIS A 1 91  ? 3.756   28.495 33.054 1.00 36.36  ? 227  HIS A O   1 
ATOM   645  C  CB  . HIS A 1 91  ? 3.225   31.500 33.069 1.00 28.04  ? 227  HIS A CB  1 
ATOM   646  C  CG  . HIS A 1 91  ? 4.111   32.048 31.995 1.00 39.14  ? 227  HIS A CG  1 
ATOM   647  N  ND1 . HIS A 1 91  ? 4.529   31.295 30.918 1.00 41.59  ? 227  HIS A ND1 1 
ATOM   648  C  CD2 . HIS A 1 91  ? 4.639   33.285 31.818 1.00 41.65  ? 227  HIS A CD2 1 
ATOM   649  C  CE1 . HIS A 1 91  ? 5.286   32.040 30.130 1.00 40.99  ? 227  HIS A CE1 1 
ATOM   650  N  NE2 . HIS A 1 91  ? 5.369   33.250 30.654 1.00 42.86  ? 227  HIS A NE2 1 
ATOM   651  N  N   . LEU A 1 92  ? 5.850   29.279 33.384 1.00 32.38  ? 228  LEU A N   1 
ATOM   652  C  CA  . LEU A 1 92  ? 6.495   28.090 32.827 1.00 32.18  ? 228  LEU A CA  1 
ATOM   653  C  C   . LEU A 1 92  ? 6.484   26.932 33.822 1.00 31.87  ? 228  LEU A C   1 
ATOM   654  O  O   . LEU A 1 92  ? 6.734   25.776 33.460 1.00 32.85  ? 228  LEU A O   1 
ATOM   655  C  CB  . LEU A 1 92  ? 7.939   28.399 32.427 1.00 31.59  ? 228  LEU A CB  1 
ATOM   656  C  CG  . LEU A 1 92  ? 8.156   29.460 31.347 1.00 35.08  ? 228  LEU A CG  1 
ATOM   657  C  CD1 . LEU A 1 92  ? 9.643   29.675 31.104 1.00 31.38  ? 228  LEU A CD1 1 
ATOM   658  C  CD2 . LEU A 1 92  ? 7.448   29.062 30.058 1.00 32.49  ? 228  LEU A CD2 1 
ATOM   659  N  N   . ILE A 1 93  ? 6.203   27.245 35.082 1.00 26.40  ? 229  ILE A N   1 
ATOM   660  C  CA  . ILE A 1 93  ? 6.316   26.256 36.148 1.00 23.81  ? 229  ILE A CA  1 
ATOM   661  C  C   . ILE A 1 93  ? 4.962   25.601 36.428 1.00 23.66  ? 229  ILE A C   1 
ATOM   662  O  O   . ILE A 1 93  ? 3.961   26.297 36.603 1.00 31.03  ? 229  ILE A O   1 
ATOM   663  C  CB  . ILE A 1 93  ? 6.908   26.906 37.417 1.00 23.95  ? 229  ILE A CB  1 
ATOM   664  C  CG1 . ILE A 1 93  ? 8.330   27.395 37.115 1.00 24.09  ? 229  ILE A CG1 1 
ATOM   665  C  CG2 . ILE A 1 93  ? 6.902   25.936 38.584 1.00 20.98  ? 229  ILE A CG2 1 
ATOM   666  C  CD1 . ILE A 1 93  ? 9.052   28.007 38.286 1.00 26.63  ? 229  ILE A CD1 1 
ATOM   667  N  N   . ALA A 1 94  ? 4.934   24.269 36.464 1.00 29.66  ? 230  ALA A N   1 
ATOM   668  C  CA  . ALA A 1 94  ? 3.677   23.529 36.625 1.00 32.21  ? 230  ALA A CA  1 
ATOM   669  C  C   . ALA A 1 94  ? 3.818   22.319 37.532 1.00 37.80  ? 230  ALA A C   1 
ATOM   670  O  O   . ALA A 1 94  ? 4.913   21.782 37.704 1.00 40.90  ? 230  ALA A O   1 
ATOM   671  C  CB  . ALA A 1 94  ? 3.138   23.091 35.266 1.00 32.34  ? 230  ALA A CB  1 
ATOM   672  N  N   . THR A 1 95  ? 2.699   21.876 38.096 1.00 41.00  ? 231  THR A N   1 
ATOM   673  C  CA  . THR A 1 95  ? 2.678   20.616 38.824 1.00 45.13  ? 231  THR A CA  1 
ATOM   674  C  C   . THR A 1 95  ? 2.953   19.478 37.865 1.00 41.83  ? 231  THR A C   1 
ATOM   675  O  O   . THR A 1 95  ? 2.389   19.434 36.769 1.00 40.81  ? 231  THR A O   1 
ATOM   676  C  CB  . THR A 1 95  ? 1.318   20.352 39.441 1.00 50.91  ? 231  THR A CB  1 
ATOM   677  O  OG1 . THR A 1 95  ? 0.296   20.694 38.495 1.00 64.68  ? 231  THR A OG1 1 
ATOM   678  C  CG2 . THR A 1 95  ? 1.156   21.184 40.649 1.00 42.46  ? 231  THR A CG2 1 
ATOM   679  N  N   . ASN A 1 96  ? 3.808   18.552 38.273 1.00 39.18  ? 232  ASN A N   1 
ATOM   680  C  CA  . ASN A 1 96  ? 4.143   17.433 37.406 1.00 45.62  ? 232  ASN A CA  1 
ATOM   681  C  C   . ASN A 1 96  ? 3.175   16.271 37.603 1.00 48.78  ? 232  ASN A C   1 
ATOM   682  O  O   . ASN A 1 96  ? 3.529   15.262 38.211 1.00 51.81  ? 232  ASN A O   1 
ATOM   683  C  CB  . ASN A 1 96  ? 5.579   16.988 37.657 1.00 43.27  ? 232  ASN A CB  1 
ATOM   684  C  CG  . ASN A 1 96  ? 6.091   16.038 36.593 1.00 45.13  ? 232  ASN A CG  1 
ATOM   685  O  OD1 . ASN A 1 96  ? 5.369   15.679 35.658 1.00 43.57  ? 232  ASN A OD1 1 
ATOM   686  N  ND2 . ASN A 1 96  ? 7.352   15.641 36.719 1.00 45.32  ? 232  ASN A ND2 1 
ATOM   687  N  N   . SER A 1 97  ? 1.962   16.419 37.074 1.00 53.60  ? 233  SER A N   1 
ATOM   688  C  CA  . SER A 1 97  ? 0.899   15.434 37.254 1.00 57.10  ? 233  SER A CA  1 
ATOM   689  C  C   . SER A 1 97  ? 1.197   14.118 36.551 1.00 66.87  ? 233  SER A C   1 
ATOM   690  O  O   . SER A 1 97  ? 0.872   13.046 37.060 1.00 72.99  ? 233  SER A O   1 
ATOM   691  C  CB  . SER A 1 97  ? -0.421  15.980 36.712 1.00 59.88  ? 233  SER A CB  1 
ATOM   692  O  OG  . SER A 1 97  ? -0.803  17.171 37.367 1.00 59.92  ? 233  SER A OG  1 
ATOM   693  N  N   . ARG A 1 98  ? 1.805   14.208 35.373 1.00 65.64  ? 234  ARG A N   1 
ATOM   694  C  CA  . ARG A 1 98  ? 2.009   13.043 34.526 1.00 65.13  ? 234  ARG A CA  1 
ATOM   695  C  C   . ARG A 1 98  ? 3.296   12.326 34.897 1.00 60.25  ? 234  ARG A C   1 
ATOM   696  O  O   . ARG A 1 98  ? 3.645   11.304 34.297 1.00 58.20  ? 234  ARG A O   1 
ATOM   697  C  CB  . ARG A 1 98  ? 2.056   13.480 33.067 1.00 74.08  ? 234  ARG A CB  1 
ATOM   698  C  CG  . ARG A 1 98  ? 0.917   14.412 32.691 1.00 82.12  ? 234  ARG A CG  1 
ATOM   699  C  CD  . ARG A 1 98  ? 1.197   15.167 31.400 1.00 90.68  ? 234  ARG A CD  1 
ATOM   700  N  NE  . ARG A 1 98  ? -0.035  15.700 30.821 1.00 100.48 ? 234  ARG A NE  1 
ATOM   701  C  CZ  . ARG A 1 98  ? -0.102  16.376 29.678 1.00 103.70 ? 234  ARG A CZ  1 
ATOM   702  N  NH1 . ARG A 1 98  ? 1.000   16.615 28.979 1.00 102.36 ? 234  ARG A NH1 1 
ATOM   703  N  NH2 . ARG A 1 98  ? -1.272  16.815 29.234 1.00 104.68 ? 234  ARG A NH2 1 
ATOM   704  N  N   . ASN A 1 99  ? 3.995   12.874 35.890 1.00 59.59  ? 235  ASN A N   1 
ATOM   705  C  CA  . ASN A 1 99  ? 5.262   12.320 36.354 1.00 56.96  ? 235  ASN A CA  1 
ATOM   706  C  C   . ASN A 1 99  ? 6.306   12.243 35.249 1.00 51.34  ? 235  ASN A C   1 
ATOM   707  O  O   . ASN A 1 99  ? 6.959   11.218 35.074 1.00 51.13  ? 235  ASN A O   1 
ATOM   708  C  CB  . ASN A 1 99  ? 5.050   10.943 36.989 1.00 58.72  ? 235  ASN A CB  1 
ATOM   709  C  CG  . ASN A 1 99  ? 4.022   10.973 38.095 1.00 62.22  ? 235  ASN A CG  1 
ATOM   710  O  OD1 . ASN A 1 99  ? 4.285   11.489 39.182 1.00 59.91  ? 235  ASN A OD1 1 
ATOM   711  N  ND2 . ASN A 1 99  ? 2.841   10.418 37.827 1.00 62.52  ? 235  ASN A ND2 1 
ATOM   712  N  N   . ILE A 1 100 ? 6.452   13.330 34.501 1.00 47.65  ? 236  ILE A N   1 
ATOM   713  C  CA  . ILE A 1 100 ? 7.483   13.408 33.476 1.00 51.75  ? 236  ILE A CA  1 
ATOM   714  C  C   . ILE A 1 100 ? 8.861   13.463 34.146 1.00 52.97  ? 236  ILE A C   1 
ATOM   715  O  O   . ILE A 1 100 ? 9.040   14.154 35.153 1.00 51.37  ? 236  ILE A O   1 
ATOM   716  C  CB  . ILE A 1 100 ? 7.306   14.658 32.586 1.00 49.64  ? 236  ILE A CB  1 
ATOM   717  C  CG1 . ILE A 1 100 ? 5.828   14.903 32.269 1.00 46.19  ? 236  ILE A CG1 1 
ATOM   718  C  CG2 . ILE A 1 100 ? 8.131   14.528 31.310 1.00 47.23  ? 236  ILE A CG2 1 
ATOM   719  C  CD1 . ILE A 1 100 ? 5.224   13.890 31.339 1.00 49.89  ? 236  ILE A CD1 1 
ATOM   720  N  N   . THR A 1 101 ? 9.827   12.734 33.593 1.00 46.23  ? 237  THR A N   1 
ATOM   721  C  CA  . THR A 1 101 ? 11.187  12.751 34.118 1.00 40.96  ? 237  THR A CA  1 
ATOM   722  C  C   . THR A 1 101 ? 11.882  14.070 33.748 1.00 43.62  ? 237  THR A C   1 
ATOM   723  O  O   . THR A 1 101 ? 11.550  14.687 32.740 1.00 51.91  ? 237  THR A O   1 
ATOM   724  C  CB  . THR A 1 101 ? 11.993  11.530 33.607 1.00 45.33  ? 237  THR A CB  1 
ATOM   725  O  OG1 . THR A 1 101 ? 11.913  11.455 32.177 1.00 44.62  ? 237  THR A OG1 1 
ATOM   726  C  CG2 . THR A 1 101 ? 11.433  10.241 34.183 1.00 46.74  ? 237  THR A CG2 1 
ATOM   727  N  N   . CYS A 1 102 ? 12.819  14.517 34.581 1.00 35.53  ? 238  CYS A N   1 
ATOM   728  C  CA  . CYS A 1 102 ? 13.618  15.709 34.271 1.00 35.69  ? 238  CYS A CA  1 
ATOM   729  C  C   . CYS A 1 102 ? 14.587  15.414 33.114 1.00 39.75  ? 238  CYS A C   1 
ATOM   730  O  O   . CYS A 1 102 ? 15.183  14.342 33.066 1.00 37.96  ? 238  CYS A O   1 
ATOM   731  C  CB  . CYS A 1 102 ? 14.383  16.163 35.519 1.00 32.70  ? 238  CYS A CB  1 
ATOM   732  S  SG  . CYS A 1 102 ? 15.645  17.430 35.255 1.00 28.38  ? 238  CYS A SG  1 
ATOM   733  N  N   . ILE A 1 103 ? 14.735  16.352 32.180 1.00 41.45  ? 239  ILE A N   1 
ATOM   734  C  CA  . ILE A 1 103 ? 15.575  16.138 30.994 1.00 41.44  ? 239  ILE A CA  1 
ATOM   735  C  C   . ILE A 1 103 ? 17.043  15.940 31.367 1.00 45.46  ? 239  ILE A C   1 
ATOM   736  O  O   . ILE A 1 103 ? 17.800  15.288 30.649 1.00 49.60  ? 239  ILE A O   1 
ATOM   737  C  CB  . ILE A 1 103 ? 15.424  17.314 29.984 1.00 37.20  ? 239  ILE A CB  1 
ATOM   738  C  CG1 . ILE A 1 103 ? 16.223  17.057 28.701 1.00 41.27  ? 239  ILE A CG1 1 
ATOM   739  C  CG2 . ILE A 1 103 ? 15.847  18.618 30.619 1.00 28.51  ? 239  ILE A CG2 1 
ATOM   740  C  CD1 . ILE A 1 103 ? 16.037  18.115 27.627 1.00 39.43  ? 239  ILE A CD1 1 
ATOM   741  N  N   . THR A 1 104 ? 17.430  16.485 32.515 1.00 43.04  ? 240  THR A N   1 
ATOM   742  C  CA  . THR A 1 104 ? 18.822  16.446 32.939 1.00 40.37  ? 240  THR A CA  1 
ATOM   743  C  C   . THR A 1 104 ? 19.093  15.324 33.953 1.00 38.14  ? 240  THR A C   1 
ATOM   744  O  O   . THR A 1 104 ? 19.997  14.510 33.747 1.00 40.01  ? 240  THR A O   1 
ATOM   745  C  CB  . THR A 1 104 ? 19.254  17.826 33.506 1.00 45.21  ? 240  THR A CB  1 
ATOM   746  O  OG1 . THR A 1 104 ? 19.254  18.798 32.453 1.00 42.04  ? 240  THR A OG1 1 
ATOM   747  C  CG2 . THR A 1 104 ? 20.646  17.761 34.092 1.00 43.41  ? 240  THR A CG2 1 
ATOM   748  N  N   . CYS A 1 105 ? 18.316  15.266 35.036 1.00 34.62  ? 241  CYS A N   1 
ATOM   749  C  CA  . CYS A 1 105 ? 18.587  14.282 36.098 1.00 41.12  ? 241  CYS A CA  1 
ATOM   750  C  C   . CYS A 1 105 ? 17.735  13.006 36.044 1.00 42.82  ? 241  CYS A C   1 
ATOM   751  O  O   . CYS A 1 105 ? 17.937  12.089 36.844 1.00 49.64  ? 241  CYS A O   1 
ATOM   752  C  CB  . CYS A 1 105 ? 18.484  14.928 37.486 1.00 39.62  ? 241  CYS A CB  1 
ATOM   753  S  SG  . CYS A 1 105 ? 16.806  15.238 38.055 1.00 40.79  ? 241  CYS A SG  1 
ATOM   754  N  N   . THR A 1 106 ? 16.792  12.955 35.103 1.00 44.55  ? 242  THR A N   1 
ATOM   755  C  CA  . THR A 1 106 ? 15.858  11.822 34.938 1.00 48.08  ? 242  THR A CA  1 
ATOM   756  C  C   . THR A 1 106 ? 14.940  11.532 36.125 1.00 47.99  ? 242  THR A C   1 
ATOM   757  O  O   . THR A 1 106 ? 14.113  10.625 36.049 1.00 46.37  ? 242  THR A O   1 
ATOM   758  C  CB  . THR A 1 106 ? 16.560  10.497 34.525 1.00 52.24  ? 242  THR A CB  1 
ATOM   759  O  OG1 . THR A 1 106 ? 17.241  9.931  35.654 1.00 53.51  ? 242  THR A OG1 1 
ATOM   760  C  CG2 . THR A 1 106 ? 17.534  10.738 33.395 1.00 53.54  ? 242  THR A CG2 1 
ATOM   761  N  N   . ASP A 1 107 ? 15.070  12.288 37.209 1.00 38.37  ? 243  ASP A N   1 
ATOM   762  C  CA  . ASP A 1 107 ? 14.185  12.093 38.353 1.00 45.73  ? 243  ASP A CA  1 
ATOM   763  C  C   . ASP A 1 107 ? 12.790  12.641 38.077 1.00 43.53  ? 243  ASP A C   1 
ATOM   764  O  O   . ASP A 1 107 ? 12.616  13.548 37.257 1.00 43.41  ? 243  ASP A O   1 
ATOM   765  C  CB  . ASP A 1 107 ? 14.744  12.775 39.600 1.00 50.61  ? 243  ASP A CB  1 
ATOM   766  C  CG  . ASP A 1 107 ? 16.030  12.144 40.087 1.00 62.31  ? 243  ASP A CG  1 
ATOM   767  O  OD1 . ASP A 1 107 ? 16.330  11.003 39.682 1.00 62.17  ? 243  ASP A OD1 1 
ATOM   768  O  OD2 . ASP A 1 107 ? 16.732  12.793 40.894 1.00 70.20  ? 243  ASP A OD2 1 
ATOM   769  N  N   . VAL A 1 108 ? 11.796  12.089 38.765 1.00 45.84  ? 244  VAL A N   1 
ATOM   770  C  CA  . VAL A 1 108 ? 10.450  12.642 38.722 1.00 44.44  ? 244  VAL A CA  1 
ATOM   771  C  C   . VAL A 1 108 ? 10.321  13.615 39.883 1.00 43.95  ? 244  VAL A C   1 
ATOM   772  O  O   . VAL A 1 108 ? 10.399  13.223 41.046 1.00 45.90  ? 244  VAL A O   1 
ATOM   773  C  CB  . VAL A 1 108 ? 9.367   11.549 38.823 1.00 49.41  ? 244  VAL A CB  1 
ATOM   774  C  CG1 . VAL A 1 108 ? 8.005   12.177 39.046 1.00 41.56  ? 244  VAL A CG1 1 
ATOM   775  C  CG2 . VAL A 1 108 ? 9.360   10.687 37.562 1.00 44.69  ? 244  VAL A CG2 1 
ATOM   776  N  N   . ARG A 1 109 ? 10.156  14.890 39.565 1.00 44.82  ? 245  ARG A N   1 
ATOM   777  C  CA  . ARG A 1 109 ? 10.059  15.912 40.592 1.00 47.92  ? 245  ARG A CA  1 
ATOM   778  C  C   . ARG A 1 109 ? 8.815   16.751 40.344 1.00 43.91  ? 245  ARG A C   1 
ATOM   779  O  O   . ARG A 1 109 ? 8.218   16.680 39.266 1.00 40.91  ? 245  ARG A O   1 
ATOM   780  C  CB  . ARG A 1 109 ? 11.310  16.799 40.583 1.00 54.56  ? 245  ARG A CB  1 
ATOM   781  C  CG  . ARG A 1 109 ? 12.188  16.682 41.837 1.00 58.13  ? 245  ARG A CG  1 
ATOM   782  C  CD  . ARG A 1 109 ? 13.230  15.583 41.738 1.00 56.18  ? 245  ARG A CD  1 
ATOM   783  N  NE  . ARG A 1 109 ? 13.485  14.960 43.039 1.00 71.74  ? 245  ARG A NE  1 
ATOM   784  C  CZ  . ARG A 1 109 ? 14.584  14.273 43.352 1.00 80.99  ? 245  ARG A CZ  1 
ATOM   785  N  NH1 . ARG A 1 109 ? 15.564  14.133 42.470 1.00 83.27  ? 245  ARG A NH1 1 
ATOM   786  N  NH2 . ARG A 1 109 ? 14.714  13.736 44.559 1.00 82.59  ? 245  ARG A NH2 1 
ATOM   787  N  N   . SER A 1 110 ? 8.418   17.529 41.346 1.00 42.78  ? 246  SER A N   1 
ATOM   788  C  CA  . SER A 1 110 ? 7.322   18.480 41.191 1.00 44.60  ? 246  SER A CA  1 
ATOM   789  C  C   . SER A 1 110 ? 7.538   19.647 42.148 1.00 45.32  ? 246  SER A C   1 
ATOM   790  O  O   . SER A 1 110 ? 7.925   19.441 43.300 1.00 49.39  ? 246  SER A O   1 
ATOM   791  C  CB  . SER A 1 110 ? 5.968   17.807 41.460 1.00 43.54  ? 246  SER A CB  1 
ATOM   792  O  OG  . SER A 1 110 ? 4.937   18.395 40.685 1.00 42.78  ? 246  SER A OG  1 
ATOM   793  N  N   . PRO A 1 111 ? 7.301   20.882 41.678 1.00 41.11  ? 247  PRO A N   1 
ATOM   794  C  CA  . PRO A 1 111 ? 6.873   21.221 40.316 1.00 36.89  ? 247  PRO A CA  1 
ATOM   795  C  C   . PRO A 1 111 ? 8.035   21.179 39.336 1.00 37.01  ? 247  PRO A C   1 
ATOM   796  O  O   . PRO A 1 111 ? 9.180   20.960 39.750 1.00 38.19  ? 247  PRO A O   1 
ATOM   797  C  CB  . PRO A 1 111 ? 6.386   22.666 40.463 1.00 38.48  ? 247  PRO A CB  1 
ATOM   798  C  CG  . PRO A 1 111 ? 7.231   23.219 41.569 1.00 39.77  ? 247  PRO A CG  1 
ATOM   799  C  CD  . PRO A 1 111 ? 7.417   22.078 42.535 1.00 41.20  ? 247  PRO A CD  1 
ATOM   800  N  N   . VAL A 1 112 ? 7.734   21.368 38.052 1.00 28.13  ? 248  VAL A N   1 
ATOM   801  C  CA  . VAL A 1 112 ? 8.759   21.400 37.015 1.00 31.47  ? 248  VAL A CA  1 
ATOM   802  C  C   . VAL A 1 112 ? 8.620   22.641 36.143 1.00 31.65  ? 248  VAL A C   1 
ATOM   803  O  O   . VAL A 1 112 ? 7.547   23.246 36.083 1.00 33.66  ? 248  VAL A O   1 
ATOM   804  C  CB  . VAL A 1 112 ? 8.677   20.161 36.101 1.00 30.67  ? 248  VAL A CB  1 
ATOM   805  C  CG1 . VAL A 1 112 ? 9.057   18.908 36.859 1.00 32.31  ? 248  VAL A CG1 1 
ATOM   806  C  CG2 . VAL A 1 112 ? 7.272   20.028 35.516 1.00 27.98  ? 248  VAL A CG2 1 
ATOM   807  N  N   . LEU A 1 113 ? 9.710   23.022 35.477 1.00 33.63  ? 249  LEU A N   1 
ATOM   808  C  CA  . LEU A 1 113 ? 9.663   24.081 34.467 1.00 31.48  ? 249  LEU A CA  1 
ATOM   809  C  C   . LEU A 1 113 ? 9.552   23.438 33.089 1.00 29.87  ? 249  LEU A C   1 
ATOM   810  O  O   . LEU A 1 113 ? 10.289  22.497 32.778 1.00 33.57  ? 249  LEU A O   1 
ATOM   811  C  CB  . LEU A 1 113 ? 10.907  24.974 34.545 1.00 26.51  ? 249  LEU A CB  1 
ATOM   812  C  CG  . LEU A 1 113 ? 10.994  26.205 33.629 1.00 29.65  ? 249  LEU A CG  1 
ATOM   813  C  CD1 . LEU A 1 113 ? 11.755  27.320 34.324 1.00 29.78  ? 249  LEU A CD1 1 
ATOM   814  C  CD2 . LEU A 1 113 ? 11.655  25.888 32.292 1.00 34.21  ? 249  LEU A CD2 1 
ATOM   815  N  N   . VAL A 1 114 ? 8.625   23.933 32.273 1.00 32.64  ? 250  VAL A N   1 
ATOM   816  C  CA  . VAL A 1 114 ? 8.419   23.396 30.930 1.00 32.45  ? 250  VAL A CA  1 
ATOM   817  C  C   . VAL A 1 114 ? 8.860   24.428 29.909 1.00 37.66  ? 250  VAL A C   1 
ATOM   818  O  O   . VAL A 1 114 ? 8.250   25.496 29.811 1.00 36.92  ? 250  VAL A O   1 
ATOM   819  C  CB  . VAL A 1 114 ? 6.932   23.099 30.660 1.00 35.37  ? 250  VAL A CB  1 
ATOM   820  C  CG1 . VAL A 1 114 ? 6.792   22.182 29.458 1.00 36.32  ? 250  VAL A CG1 1 
ATOM   821  C  CG2 . VAL A 1 114 ? 6.284   22.474 31.877 1.00 36.71  ? 250  VAL A CG2 1 
ATOM   822  N  N   . PHE A 1 115 ? 9.906   24.120 29.145 1.00 38.15  ? 251  PHE A N   1 
ATOM   823  C  CA  . PHE A 1 115 ? 10.374  25.051 28.119 1.00 38.87  ? 251  PHE A CA  1 
ATOM   824  C  C   . PHE A 1 115 ? 9.351   25.162 26.985 1.00 46.06  ? 251  PHE A C   1 
ATOM   825  O  O   . PHE A 1 115 ? 8.503   24.279 26.819 1.00 43.42  ? 251  PHE A O   1 
ATOM   826  C  CB  . PHE A 1 115 ? 11.738  24.629 27.570 1.00 37.46  ? 251  PHE A CB  1 
ATOM   827  C  CG  . PHE A 1 115 ? 12.882  24.844 28.532 1.00 37.49  ? 251  PHE A CG  1 
ATOM   828  C  CD1 . PHE A 1 115 ? 13.407  26.116 28.737 1.00 31.79  ? 251  PHE A CD1 1 
ATOM   829  C  CD2 . PHE A 1 115 ? 13.456  23.772 29.201 1.00 41.54  ? 251  PHE A CD2 1 
ATOM   830  C  CE1 . PHE A 1 115 ? 14.471  26.318 29.607 1.00 37.70  ? 251  PHE A CE1 1 
ATOM   831  C  CE2 . PHE A 1 115 ? 14.521  23.966 30.076 1.00 40.67  ? 251  PHE A CE2 1 
ATOM   832  C  CZ  . PHE A 1 115 ? 15.026  25.240 30.279 1.00 40.04  ? 251  PHE A CZ  1 
ATOM   833  N  N   . GLN A 1 116 ? 9.429   26.252 26.224 1.00 47.63  ? 252  GLN A N   1 
ATOM   834  C  CA  . GLN A 1 116 ? 8.471   26.525 25.153 1.00 54.02  ? 252  GLN A CA  1 
ATOM   835  C  C   . GLN A 1 116 ? 9.010   26.046 23.812 1.00 59.01  ? 252  GLN A C   1 
ATOM   836  O  O   . GLN A 1 116 ? 8.646   26.574 22.756 1.00 62.28  ? 252  GLN A O   1 
ATOM   837  C  CB  . GLN A 1 116 ? 8.148   28.022 25.076 1.00 53.76  ? 252  GLN A CB  1 
ATOM   838  C  CG  . GLN A 1 116 ? 7.275   28.550 26.205 1.00 53.94  ? 252  GLN A CG  1 
ATOM   839  C  CD  . GLN A 1 116 ? 5.846   28.067 26.108 1.00 64.32  ? 252  GLN A CD  1 
ATOM   840  O  OE1 . GLN A 1 116 ? 5.015   28.676 25.426 1.00 69.78  ? 252  GLN A OE1 1 
ATOM   841  N  NE2 . GLN A 1 116 ? 5.546   26.969 26.793 1.00 65.92  ? 252  GLN A NE2 1 
ATOM   842  N  N   . CYS A 1 117 ? 9.898   25.059 23.861 1.00 51.16  ? 253  CYS A N   1 
ATOM   843  C  CA  . CYS A 1 117 ? 10.383  24.424 22.649 1.00 46.26  ? 253  CYS A CA  1 
ATOM   844  C  C   . CYS A 1 117 ? 9.296   23.484 22.139 1.00 48.35  ? 253  CYS A C   1 
ATOM   845  O  O   . CYS A 1 117 ? 8.374   23.131 22.884 1.00 46.06  ? 253  CYS A O   1 
ATOM   846  C  CB  . CYS A 1 117 ? 11.683  23.664 22.922 1.00 45.17  ? 253  CYS A CB  1 
ATOM   847  S  SG  . CYS A 1 117 ? 11.555  22.351 24.147 1.00 58.71  ? 253  CYS A SG  1 
ATOM   848  N  N   . ASN A 1 118 ? 9.403   23.089 20.874 1.00 53.52  ? 254  ASN A N   1 
ATOM   849  C  CA  . ASN A 1 118 ? 8.439   22.186 20.254 1.00 60.23  ? 254  ASN A CA  1 
ATOM   850  C  C   . ASN A 1 118 ? 8.213   20.886 21.028 1.00 61.14  ? 254  ASN A C   1 
ATOM   851  O  O   . ASN A 1 118 ? 7.115   20.327 21.006 1.00 57.81  ? 254  ASN A O   1 
ATOM   852  C  CB  . ASN A 1 118 ? 8.850   21.872 18.812 1.00 67.03  ? 254  ASN A CB  1 
ATOM   853  C  CG  . ASN A 1 118 ? 8.420   22.952 17.832 1.00 76.96  ? 254  ASN A CG  1 
ATOM   854  O  OD1 . ASN A 1 118 ? 7.228   23.203 17.657 1.00 82.80  ? 254  ASN A OD1 1 
ATOM   855  N  ND2 . ASN A 1 118 ? 9.388   23.585 17.179 1.00 79.62  ? 254  ASN A ND2 1 
ATOM   856  N  N   . SER A 1 119 ? 9.250   20.412 21.711 1.00 58.27  ? 255  SER A N   1 
ATOM   857  C  CA  . SER A 1 119 ? 9.172   19.147 22.431 1.00 62.54  ? 255  SER A CA  1 
ATOM   858  C  C   . SER A 1 119 ? 8.588   19.324 23.822 1.00 61.67  ? 255  SER A C   1 
ATOM   859  O  O   . SER A 1 119 ? 8.227   18.342 24.474 1.00 70.16  ? 255  SER A O   1 
ATOM   860  C  CB  . SER A 1 119 ? 10.558  18.524 22.541 1.00 61.57  ? 255  SER A CB  1 
ATOM   861  O  OG  . SER A 1 119 ? 11.255  18.636 21.318 1.00 65.70  ? 255  SER A OG  1 
ATOM   862  N  N   . ARG A 1 120 ? 8.509   20.578 24.263 1.00 54.68  ? 256  ARG A N   1 
ATOM   863  C  CA  . ARG A 1 120 ? 8.053   20.927 25.607 1.00 49.63  ? 256  ARG A CA  1 
ATOM   864  C  C   . ARG A 1 120 ? 8.852   20.209 26.696 1.00 46.64  ? 256  ARG A C   1 
ATOM   865  O  O   . ARG A 1 120 ? 8.278   19.653 27.629 1.00 48.83  ? 256  ARG A O   1 
ATOM   866  C  CB  . ARG A 1 120 ? 6.550   20.647 25.763 1.00 47.50  ? 256  ARG A CB  1 
ATOM   867  N  N   . HIS A 1 121 ? 10.177  20.226 26.578 1.00 45.12  ? 257  HIS A N   1 
ATOM   868  C  CA  . HIS A 1 121 ? 11.035  19.546 27.547 1.00 43.29  ? 257  HIS A CA  1 
ATOM   869  C  C   . HIS A 1 121 ? 10.783  20.048 28.964 1.00 39.08  ? 257  HIS A C   1 
ATOM   870  O  O   . HIS A 1 121 ? 10.550  21.244 29.173 1.00 40.78  ? 257  HIS A O   1 
ATOM   871  C  CB  . HIS A 1 121 ? 12.509  19.753 27.205 1.00 44.55  ? 257  HIS A CB  1 
ATOM   872  C  CG  . HIS A 1 121 ? 12.913  19.182 25.881 1.00 52.87  ? 257  HIS A CG  1 
ATOM   873  N  ND1 . HIS A 1 121 ? 13.341  19.973 24.839 1.00 53.14  ? 257  HIS A ND1 1 
ATOM   874  C  CD2 . HIS A 1 121 ? 12.975  17.905 25.436 1.00 55.42  ? 257  HIS A CD2 1 
ATOM   875  C  CE1 . HIS A 1 121 ? 13.639  19.209 23.803 1.00 57.51  ? 257  HIS A CE1 1 
ATOM   876  N  NE2 . HIS A 1 121 ? 13.429  17.950 24.138 1.00 56.27  ? 257  HIS A NE2 1 
ATOM   877  N  N   . VAL A 1 122 ? 10.824  19.140 29.937 1.00 32.80  ? 258  VAL A N   1 
ATOM   878  C  CA  . VAL A 1 122 ? 10.646  19.550 31.324 1.00 40.06  ? 258  VAL A CA  1 
ATOM   879  C  C   . VAL A 1 122 ? 11.957  19.412 32.087 1.00 37.13  ? 258  VAL A C   1 
ATOM   880  O  O   . VAL A 1 122 ? 12.777  18.529 31.797 1.00 40.29  ? 258  VAL A O   1 
ATOM   881  C  CB  . VAL A 1 122 ? 9.484   18.801 32.032 1.00 30.81  ? 258  VAL A CB  1 
ATOM   882  C  CG1 . VAL A 1 122 ? 8.392   18.417 31.020 1.00 32.43  ? 258  VAL A CG1 1 
ATOM   883  C  CG2 . VAL A 1 122 ? 9.985   17.583 32.760 1.00 34.13  ? 258  VAL A CG2 1 
ATOM   884  N  N   . ILE A 1 123 ? 12.159  20.314 33.041 1.00 28.96  ? 259  ILE A N   1 
ATOM   885  C  CA  . ILE A 1 123 ? 13.359  20.304 33.856 1.00 29.03  ? 259  ILE A CA  1 
ATOM   886  C  C   . ILE A 1 123 ? 12.927  20.590 35.286 1.00 32.90  ? 259  ILE A C   1 
ATOM   887  O  O   . ILE A 1 123 ? 12.079  21.465 35.519 1.00 29.20  ? 259  ILE A O   1 
ATOM   888  C  CB  . ILE A 1 123 ? 14.393  21.346 33.339 1.00 24.34  ? 259  ILE A CB  1 
ATOM   889  C  CG1 . ILE A 1 123 ? 15.714  21.245 34.109 1.00 23.68  ? 259  ILE A CG1 1 
ATOM   890  C  CG2 . ILE A 1 123 ? 13.826  22.762 33.397 1.00 21.25  ? 259  ILE A CG2 1 
ATOM   891  C  CD1 . ILE A 1 123 ? 16.881  21.892 33.398 1.00 21.00  ? 259  ILE A CD1 1 
ATOM   892  N  N   . CYS A 1 124 ? 13.463  19.829 36.238 1.00 29.24  ? 260  CYS A N   1 
ATOM   893  C  CA  . CYS A 1 124 ? 13.126  20.061 37.639 1.00 29.86  ? 260  CYS A CA  1 
ATOM   894  C  C   . CYS A 1 124 ? 13.794  21.360 38.082 1.00 31.98  ? 260  CYS A C   1 
ATOM   895  O  O   . CYS A 1 124 ? 14.725  21.832 37.427 1.00 31.79  ? 260  CYS A O   1 
ATOM   896  C  CB  . CYS A 1 124 ? 13.542  18.875 38.520 1.00 29.79  ? 260  CYS A CB  1 
ATOM   897  S  SG  . CYS A 1 124 ? 15.310  18.771 38.948 1.00 34.29  ? 260  CYS A SG  1 
ATOM   898  N  N   . LEU A 1 125 ? 13.313  21.948 39.173 1.00 30.32  ? 261  LEU A N   1 
ATOM   899  C  CA  . LEU A 1 125 ? 13.790  23.267 39.574 1.00 28.70  ? 261  LEU A CA  1 
ATOM   900  C  C   . LEU A 1 125 ? 15.248  23.256 40.042 1.00 28.40  ? 261  LEU A C   1 
ATOM   901  O  O   . LEU A 1 125 ? 15.993  24.217 39.810 1.00 27.83  ? 261  LEU A O   1 
ATOM   902  C  CB  . LEU A 1 125 ? 12.874  23.863 40.641 1.00 27.87  ? 261  LEU A CB  1 
ATOM   903  C  CG  . LEU A 1 125 ? 11.443  24.127 40.173 1.00 32.96  ? 261  LEU A CG  1 
ATOM   904  C  CD1 . LEU A 1 125 ? 10.674  24.962 41.183 1.00 26.76  ? 261  LEU A CD1 1 
ATOM   905  C  CD2 . LEU A 1 125 ? 11.437  24.800 38.806 1.00 30.02  ? 261  LEU A CD2 1 
ATOM   906  N  N   . ASP A 1 126 ? 15.649  22.166 40.683 1.00 29.30  ? 262  ASP A N   1 
ATOM   907  C  CA  . ASP A 1 126 ? 17.020  22.003 41.138 1.00 28.02  ? 262  ASP A CA  1 
ATOM   908  C  C   . ASP A 1 126 ? 17.946  22.060 39.935 1.00 30.96  ? 262  ASP A C   1 
ATOM   909  O  O   . ASP A 1 126 ? 18.968  22.748 39.954 1.00 36.38  ? 262  ASP A O   1 
ATOM   910  C  CB  . ASP A 1 126 ? 17.188  20.665 41.873 1.00 25.45  ? 262  ASP A CB  1 
ATOM   911  C  CG  . ASP A 1 126 ? 16.518  20.658 43.234 1.00 41.70  ? 262  ASP A CG  1 
ATOM   912  O  OD1 . ASP A 1 126 ? 16.279  21.749 43.788 1.00 50.66  ? 262  ASP A OD1 1 
ATOM   913  O  OD2 . ASP A 1 126 ? 16.249  19.559 43.762 1.00 56.57  ? 262  ASP A OD2 1 
ATOM   914  N  N   . CYS A 1 127 ? 17.576  21.352 38.875 1.00 30.36  ? 263  CYS A N   1 
ATOM   915  C  CA  . CYS A 1 127 ? 18.389  21.363 37.664 1.00 33.03  ? 263  CYS A CA  1 
ATOM   916  C  C   . CYS A 1 127 ? 18.319  22.697 36.913 1.00 32.68  ? 263  CYS A C   1 
ATOM   917  O  O   . CYS A 1 127 ? 19.327  23.147 36.372 1.00 30.75  ? 263  CYS A O   1 
ATOM   918  C  CB  . CYS A 1 127 ? 18.021  20.200 36.748 1.00 27.17  ? 263  CYS A CB  1 
ATOM   919  S  SG  . CYS A 1 127 ? 18.564  18.576 37.376 1.00 36.05  ? 263  CYS A SG  1 
ATOM   920  N  N   . PHE A 1 128 ? 17.149  23.337 36.885 1.00 22.19  ? 264  PHE A N   1 
ATOM   921  C  CA  . PHE A 1 128 ? 17.047  24.635 36.222 1.00 20.72  ? 264  PHE A CA  1 
ATOM   922  C  C   . PHE A 1 128 ? 17.952  25.628 36.934 1.00 23.34  ? 264  PHE A C   1 
ATOM   923  O  O   . PHE A 1 128 ? 18.616  26.451 36.299 1.00 27.36  ? 264  PHE A O   1 
ATOM   924  C  CB  . PHE A 1 128 ? 15.604  25.159 36.196 1.00 26.22  ? 264  PHE A CB  1 
ATOM   925  C  CG  . PHE A 1 128 ? 15.453  26.477 35.468 1.00 26.79  ? 264  PHE A CG  1 
ATOM   926  C  CD1 . PHE A 1 128 ? 15.625  26.553 34.085 1.00 29.33  ? 264  PHE A CD1 1 
ATOM   927  C  CD2 . PHE A 1 128 ? 15.137  27.639 36.162 1.00 27.69  ? 264  PHE A CD2 1 
ATOM   928  C  CE1 . PHE A 1 128 ? 15.493  27.776 33.407 1.00 26.89  ? 264  PHE A CE1 1 
ATOM   929  C  CE2 . PHE A 1 128 ? 14.997  28.869 35.494 1.00 22.00  ? 264  PHE A CE2 1 
ATOM   930  C  CZ  . PHE A 1 128 ? 15.178  28.934 34.118 1.00 23.56  ? 264  PHE A CZ  1 
ATOM   931  N  N   . HIS A 1 129 ? 17.983  25.534 38.260 1.00 20.46  ? 265  HIS A N   1 
ATOM   932  C  CA  . HIS A 1 129 ? 18.796  26.433 39.064 1.00 25.11  ? 265  HIS A CA  1 
ATOM   933  C  C   . HIS A 1 129 ? 20.274  26.287 38.710 1.00 27.30  ? 265  HIS A C   1 
ATOM   934  O  O   . HIS A 1 129 ? 20.980  27.283 38.507 1.00 27.81  ? 265  HIS A O   1 
ATOM   935  C  CB  . HIS A 1 129 ? 18.577  26.150 40.555 1.00 24.97  ? 265  HIS A CB  1 
ATOM   936  C  CG  . HIS A 1 129 ? 19.542  26.862 41.448 1.00 35.10  ? 265  HIS A CG  1 
ATOM   937  N  ND1 . HIS A 1 129 ? 19.438  28.206 41.735 1.00 45.46  ? 265  HIS A ND1 1 
ATOM   938  C  CD2 . HIS A 1 129 ? 20.639  26.421 42.107 1.00 44.41  ? 265  HIS A CD2 1 
ATOM   939  C  CE1 . HIS A 1 129 ? 20.428  28.562 42.535 1.00 45.61  ? 265  HIS A CE1 1 
ATOM   940  N  NE2 . HIS A 1 129 ? 21.171  27.499 42.777 1.00 46.47  ? 265  HIS A NE2 1 
ATOM   941  N  N   . LEU A 1 130 ? 20.740  25.043 38.638 1.00 25.45  ? 266  LEU A N   1 
ATOM   942  C  CA  . LEU A 1 130 ? 22.148  24.781 38.350 1.00 31.43  ? 266  LEU A CA  1 
ATOM   943  C  C   . LEU A 1 130 ? 22.484  25.224 36.926 1.00 30.98  ? 266  LEU A C   1 
ATOM   944  O  O   . LEU A 1 130 ? 23.566  25.752 36.662 1.00 33.20  ? 266  LEU A O   1 
ATOM   945  C  CB  . LEU A 1 130 ? 22.473  23.299 38.556 1.00 29.25  ? 266  LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 130 ? 23.962  22.962 38.526 1.00 35.48  ? 266  LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 130 ? 24.709  23.742 39.608 1.00 37.42  ? 266  LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 130 ? 24.186  21.471 38.700 1.00 29.84  ? 266  LEU A CD2 1 
ATOM   949  N  N   . TYR A 1 131 ? 21.539  25.015 36.016 1.00 27.73  ? 267  TYR A N   1 
ATOM   950  C  CA  . TYR A 1 131 ? 21.670  25.460 34.631 1.00 28.45  ? 267  TYR A CA  1 
ATOM   951  C  C   . TYR A 1 131 ? 21.886  26.972 34.580 1.00 28.62  ? 267  TYR A C   1 
ATOM   952  O  O   . TYR A 1 131 ? 22.826  27.444 33.942 1.00 28.98  ? 267  TYR A O   1 
ATOM   953  C  CB  . TYR A 1 131 ? 20.403  25.055 33.863 1.00 29.70  ? 267  TYR A CB  1 
ATOM   954  C  CG  . TYR A 1 131 ? 20.272  25.545 32.432 1.00 30.47  ? 267  TYR A CG  1 
ATOM   955  C  CD1 . TYR A 1 131 ? 21.243  25.265 31.477 1.00 31.93  ? 267  TYR A CD1 1 
ATOM   956  C  CD2 . TYR A 1 131 ? 19.134  26.237 32.024 1.00 29.14  ? 267  TYR A CD2 1 
ATOM   957  C  CE1 . TYR A 1 131 ? 21.098  25.700 30.163 1.00 33.41  ? 267  TYR A CE1 1 
ATOM   958  C  CE2 . TYR A 1 131 ? 18.979  26.671 30.714 1.00 25.25  ? 267  TYR A CE2 1 
ATOM   959  C  CZ  . TYR A 1 131 ? 19.961  26.399 29.792 1.00 31.31  ? 267  TYR A CZ  1 
ATOM   960  O  OH  . TYR A 1 131 ? 19.805  26.836 28.495 1.00 34.10  ? 267  TYR A OH  1 
ATOM   961  N  N   . CYS A 1 132 ? 21.032  27.736 35.261 1.00 24.78  ? 268  CYS A N   1 
ATOM   962  C  CA  . CYS A 1 132 ? 21.163  29.198 35.222 1.00 26.13  ? 268  CYS A CA  1 
ATOM   963  C  C   . CYS A 1 132 ? 22.472  29.679 35.851 1.00 29.60  ? 268  CYS A C   1 
ATOM   964  O  O   . CYS A 1 132 ? 23.131  30.568 35.315 1.00 30.19  ? 268  CYS A O   1 
ATOM   965  C  CB  . CYS A 1 132 ? 19.978  29.863 35.912 1.00 27.02  ? 268  CYS A CB  1 
ATOM   966  S  SG  . CYS A 1 132 ? 18.394  29.526 35.102 1.00 30.18  ? 268  CYS A SG  1 
ATOM   967  N  N   . VAL A 1 133 ? 22.844  29.069 36.976 1.00 27.26  ? 269  VAL A N   1 
ATOM   968  C  CA  . VAL A 1 133 ? 24.049  29.442 37.707 1.00 28.25  ? 269  VAL A CA  1 
ATOM   969  C  C   . VAL A 1 133 ? 25.320  29.178 36.902 1.00 33.42  ? 269  VAL A C   1 
ATOM   970  O  O   . VAL A 1 133 ? 26.231  30.009 36.883 1.00 31.03  ? 269  VAL A O   1 
ATOM   971  C  CB  . VAL A 1 133 ? 24.110  28.724 39.069 1.00 37.42  ? 269  VAL A CB  1 
ATOM   972  C  CG1 . VAL A 1 133 ? 25.483  28.819 39.671 1.00 42.64  ? 269  VAL A CG1 1 
ATOM   973  C  CG2 . VAL A 1 133 ? 23.080  29.325 40.020 1.00 41.96  ? 269  VAL A CG2 1 
ATOM   974  N  N   . THR A 1 134 ? 25.380  28.039 36.218 1.00 31.48  ? 270  THR A N   1 
ATOM   975  C  CA  . THR A 1 134 ? 26.579  27.709 35.450 1.00 35.37  ? 270  THR A CA  1 
ATOM   976  C  C   . THR A 1 134 ? 26.704  28.583 34.209 1.00 34.99  ? 270  THR A C   1 
ATOM   977  O  O   . THR A 1 134 ? 27.805  29.012 33.861 1.00 30.53  ? 270  THR A O   1 
ATOM   978  C  CB  . THR A 1 134 ? 26.649  26.216 35.064 1.00 40.31  ? 270  THR A CB  1 
ATOM   979  O  OG1 . THR A 1 134 ? 25.504  25.862 34.277 1.00 39.23  ? 270  THR A OG1 1 
ATOM   980  C  CG2 . THR A 1 134 ? 26.711  25.346 36.314 1.00 38.66  ? 270  THR A CG2 1 
ATOM   981  N  N   . ARG A 1 135 ? 25.577  28.849 33.553 1.00 31.58  ? 271  ARG A N   1 
ATOM   982  C  CA  . ARG A 1 135 ? 25.562  29.704 32.360 1.00 32.56  ? 271  ARG A CA  1 
ATOM   983  C  C   . ARG A 1 135 ? 25.908  31.146 32.703 1.00 28.78  ? 271  ARG A C   1 
ATOM   984  O  O   . ARG A 1 135 ? 26.560  31.839 31.921 1.00 33.54  ? 271  ARG A O   1 
ATOM   985  C  CB  . ARG A 1 135 ? 24.193  29.651 31.670 1.00 33.62  ? 271  ARG A CB  1 
ATOM   986  C  CG  . ARG A 1 135 ? 24.137  28.714 30.473 1.00 36.84  ? 271  ARG A CG  1 
ATOM   987  C  CD  . ARG A 1 135 ? 24.828  27.404 30.778 1.00 43.87  ? 271  ARG A CD  1 
ATOM   988  N  NE  . ARG A 1 135 ? 24.609  26.399 29.745 1.00 46.21  ? 271  ARG A NE  1 
ATOM   989  C  CZ  . ARG A 1 135 ? 24.688  25.092 29.967 1.00 53.57  ? 271  ARG A CZ  1 
ATOM   990  N  NH1 . ARG A 1 135 ? 24.979  24.647 31.184 1.00 47.43  ? 271  ARG A NH1 1 
ATOM   991  N  NH2 . ARG A 1 135 ? 24.470  24.232 28.982 1.00 60.24  ? 271  ARG A NH2 1 
ATOM   992  N  N   . LEU A 1 136 ? 25.461  31.592 33.873 1.00 29.78  ? 272  LEU A N   1 
ATOM   993  C  CA  . LEU A 1 136 ? 25.766  32.934 34.355 1.00 31.90  ? 272  LEU A CA  1 
ATOM   994  C  C   . LEU A 1 136 ? 27.262  33.052 34.613 1.00 32.00  ? 272  LEU A C   1 
ATOM   995  O  O   . LEU A 1 136 ? 27.925  33.938 34.075 1.00 32.75  ? 272  LEU A O   1 
ATOM   996  C  CB  . LEU A 1 136 ? 24.979  33.237 35.636 1.00 26.10  ? 272  LEU A CB  1 
ATOM   997  C  CG  . LEU A 1 136 ? 25.302  34.569 36.316 1.00 28.74  ? 272  LEU A CG  1 
ATOM   998  C  CD1 . LEU A 1 136 ? 25.096  35.714 35.350 1.00 27.51  ? 272  LEU A CD1 1 
ATOM   999  C  CD2 . LEU A 1 136 ? 24.449  34.775 37.561 1.00 29.89  ? 272  LEU A CD2 1 
ATOM   1000 N  N   . ASN A 1 137 ? 27.793  32.152 35.432 1.00 37.70  ? 273  ASN A N   1 
ATOM   1001 C  CA  . ASN A 1 137 ? 29.221  32.164 35.757 1.00 35.83  ? 273  ASN A CA  1 
ATOM   1002 C  C   . ASN A 1 137 ? 30.117  32.009 34.525 1.00 33.74  ? 273  ASN A C   1 
ATOM   1003 O  O   . ASN A 1 137 ? 31.177  32.635 34.434 1.00 35.76  ? 273  ASN A O   1 
ATOM   1004 C  CB  . ASN A 1 137 ? 29.550  31.080 36.790 1.00 34.71  ? 273  ASN A CB  1 
ATOM   1005 C  CG  . ASN A 1 137 ? 30.971  31.192 37.322 1.00 49.06  ? 273  ASN A CG  1 
ATOM   1006 O  OD1 . ASN A 1 137 ? 31.912  30.629 36.753 1.00 53.75  ? 273  ASN A OD1 1 
ATOM   1007 N  ND2 . ASN A 1 137 ? 31.134  31.926 38.417 1.00 49.77  ? 273  ASN A ND2 1 
ATOM   1008 N  N   . ASP A 1 138 ? 29.689  31.185 33.572 1.00 35.70  ? 274  ASP A N   1 
ATOM   1009 C  CA  . ASP A 1 138 ? 30.505  30.920 32.391 1.00 38.18  ? 274  ASP A CA  1 
ATOM   1010 C  C   . ASP A 1 138 ? 30.191  31.890 31.247 1.00 35.30  ? 274  ASP A C   1 
ATOM   1011 O  O   . ASP A 1 138 ? 30.666  31.711 30.121 1.00 37.14  ? 274  ASP A O   1 
ATOM   1012 C  CB  . ASP A 1 138 ? 30.336  29.465 31.937 1.00 42.93  ? 274  ASP A CB  1 
ATOM   1013 C  CG  . ASP A 1 138 ? 30.699  28.460 33.030 1.00 54.07  ? 274  ASP A CG  1 
ATOM   1014 O  OD1 . ASP A 1 138 ? 31.507  28.798 33.926 1.00 58.45  ? 274  ASP A OD1 1 
ATOM   1015 O  OD2 . ASP A 1 138 ? 30.179  27.322 32.987 1.00 56.44  ? 274  ASP A OD2 1 
ATOM   1016 N  N   . ARG A 1 139 ? 29.389  32.912 31.548 1.00 28.45  ? 275  ARG A N   1 
ATOM   1017 C  CA  . ARG A 1 139 ? 29.019  33.949 30.578 1.00 29.69  ? 275  ARG A CA  1 
ATOM   1018 C  C   . ARG A 1 139 ? 28.406  33.361 29.311 1.00 35.97  ? 275  ARG A C   1 
ATOM   1019 O  O   . ARG A 1 139 ? 28.843  33.678 28.210 1.00 34.83  ? 275  ARG A O   1 
ATOM   1020 C  CB  . ARG A 1 139 ? 30.229  34.821 30.211 1.00 32.42  ? 275  ARG A CB  1 
ATOM   1021 C  CG  . ARG A 1 139 ? 31.065  35.255 31.416 1.00 30.84  ? 275  ARG A CG  1 
ATOM   1022 C  CD  . ARG A 1 139 ? 30.179  35.856 32.492 1.00 35.60  ? 275  ARG A CD  1 
ATOM   1023 N  NE  . ARG A 1 139 ? 29.583  37.119 32.073 1.00 35.03  ? 275  ARG A NE  1 
ATOM   1024 C  CZ  . ARG A 1 139 ? 28.622  37.746 32.744 1.00 34.67  ? 275  ARG A CZ  1 
ATOM   1025 N  NH1 . ARG A 1 139 ? 28.139  37.212 33.858 1.00 25.83  ? 275  ARG A NH1 1 
ATOM   1026 N  NH2 . ARG A 1 139 ? 28.145  38.906 32.303 1.00 31.93  ? 275  ARG A NH2 1 
ATOM   1027 N  N   . GLN A 1 140 ? 27.386  32.519 29.466 1.00 36.54  ? 276  GLN A N   1 
ATOM   1028 C  CA  . GLN A 1 140 ? 26.788  31.838 28.321 1.00 36.66  ? 276  GLN A CA  1 
ATOM   1029 C  C   . GLN A 1 140 ? 25.305  32.171 28.146 1.00 41.13  ? 276  GLN A C   1 
ATOM   1030 O  O   . GLN A 1 140 ? 24.560  31.416 27.521 1.00 39.71  ? 276  GLN A O   1 
ATOM   1031 C  CB  . GLN A 1 140 ? 26.983  30.324 28.440 1.00 38.90  ? 276  GLN A CB  1 
ATOM   1032 C  CG  . GLN A 1 140 ? 28.417  29.857 28.242 1.00 48.14  ? 276  GLN A CG  1 
ATOM   1033 C  CD  . GLN A 1 140 ? 28.946  30.184 26.857 1.00 61.42  ? 276  GLN A CD  1 
ATOM   1034 O  OE1 . GLN A 1 140 ? 28.371  29.775 25.849 1.00 68.25  ? 276  GLN A OE1 1 
ATOM   1035 N  NE2 . GLN A 1 140 ? 30.047  30.928 26.801 1.00 67.82  ? 276  GLN A NE2 1 
ATOM   1036 N  N   . PHE A 1 141 ? 24.874  33.296 28.703 1.00 38.93  ? 277  PHE A N   1 
ATOM   1037 C  CA  . PHE A 1 141 ? 23.526  33.777 28.444 1.00 31.71  ? 277  PHE A CA  1 
ATOM   1038 C  C   . PHE A 1 141 ? 23.437  34.296 27.018 1.00 38.33  ? 277  PHE A C   1 
ATOM   1039 O  O   . PHE A 1 141 ? 24.447  34.704 26.437 1.00 34.31  ? 277  PHE A O   1 
ATOM   1040 C  CB  . PHE A 1 141 ? 23.138  34.870 29.436 1.00 26.13  ? 277  PHE A CB  1 
ATOM   1041 C  CG  . PHE A 1 141 ? 22.458  34.347 30.664 1.00 26.43  ? 277  PHE A CG  1 
ATOM   1042 C  CD1 . PHE A 1 141 ? 23.148  33.563 31.576 1.00 26.24  ? 277  PHE A CD1 1 
ATOM   1043 C  CD2 . PHE A 1 141 ? 21.123  34.632 30.904 1.00 26.77  ? 277  PHE A CD2 1 
ATOM   1044 C  CE1 . PHE A 1 141 ? 22.513  33.073 32.710 1.00 23.63  ? 277  PHE A CE1 1 
ATOM   1045 C  CE2 . PHE A 1 141 ? 20.486  34.146 32.033 1.00 28.31  ? 277  PHE A CE2 1 
ATOM   1046 C  CZ  . PHE A 1 141 ? 21.182  33.364 32.936 1.00 25.04  ? 277  PHE A CZ  1 
ATOM   1047 N  N   . VAL A 1 142 ? 22.229  34.261 26.460 1.00 39.01  ? 278  VAL A N   1 
ATOM   1048 C  CA  . VAL A 1 142 ? 21.988  34.701 25.093 1.00 38.88  ? 278  VAL A CA  1 
ATOM   1049 C  C   . VAL A 1 142 ? 21.405  36.103 25.130 1.00 42.99  ? 278  VAL A C   1 
ATOM   1050 O  O   . VAL A 1 142 ? 20.452  36.359 25.873 1.00 41.30  ? 278  VAL A O   1 
ATOM   1051 C  CB  . VAL A 1 142 ? 20.986  33.760 24.382 1.00 38.58  ? 278  VAL A CB  1 
ATOM   1052 C  CG1 . VAL A 1 142 ? 20.489  34.375 23.092 1.00 39.47  ? 278  VAL A CG1 1 
ATOM   1053 C  CG2 . VAL A 1 142 ? 21.609  32.386 24.124 1.00 31.92  ? 278  VAL A CG2 1 
ATOM   1054 N  N   . HIS A 1 143 ? 21.976  37.008 24.339 1.00 50.80  ? 279  HIS A N   1 
ATOM   1055 C  CA  . HIS A 1 143 ? 21.472  38.379 24.250 1.00 53.92  ? 279  HIS A CA  1 
ATOM   1056 C  C   . HIS A 1 143 ? 20.293  38.458 23.282 1.00 59.58  ? 279  HIS A C   1 
ATOM   1057 O  O   . HIS A 1 143 ? 20.381  37.980 22.153 1.00 66.39  ? 279  HIS A O   1 
ATOM   1058 C  CB  . HIS A 1 143 ? 22.591  39.322 23.785 1.00 56.47  ? 279  HIS A CB  1 
ATOM   1059 C  CG  . HIS A 1 143 ? 22.288  40.778 23.964 1.00 60.13  ? 279  HIS A CG  1 
ATOM   1060 N  ND1 . HIS A 1 143 ? 21.064  41.242 24.404 1.00 63.21  ? 279  HIS A ND1 1 
ATOM   1061 C  CD2 . HIS A 1 143 ? 23.054  41.877 23.769 1.00 65.08  ? 279  HIS A CD2 1 
ATOM   1062 C  CE1 . HIS A 1 143 ? 21.092  42.560 24.469 1.00 64.67  ? 279  HIS A CE1 1 
ATOM   1063 N  NE2 . HIS A 1 143 ? 22.290  42.972 24.090 1.00 67.38  ? 279  HIS A NE2 1 
ATOM   1064 N  N   . ASP A 1 144 ? 19.187  39.041 23.736 1.00 57.13  ? 280  ASP A N   1 
ATOM   1065 C  CA  . ASP A 1 144 ? 18.081  39.385 22.853 1.00 62.52  ? 280  ASP A CA  1 
ATOM   1066 C  C   . ASP A 1 144 ? 17.767  40.862 23.070 1.00 64.85  ? 280  ASP A C   1 
ATOM   1067 O  O   . ASP A 1 144 ? 17.281  41.248 24.134 1.00 63.71  ? 280  ASP A O   1 
ATOM   1068 C  CB  . ASP A 1 144 ? 16.848  38.515 23.127 1.00 70.60  ? 280  ASP A CB  1 
ATOM   1069 C  CG  . ASP A 1 144 ? 15.853  38.522 21.970 1.00 77.83  ? 280  ASP A CG  1 
ATOM   1070 O  OD1 . ASP A 1 144 ? 15.806  39.524 21.222 1.00 82.21  ? 280  ASP A OD1 1 
ATOM   1071 O  OD2 . ASP A 1 144 ? 15.118  37.524 21.808 1.00 76.62  ? 280  ASP A OD2 1 
ATOM   1072 N  N   . PRO A 1 145 ? 18.056  41.692 22.056 1.00 69.70  ? 281  PRO A N   1 
ATOM   1073 C  CA  . PRO A 1 145 ? 17.953  43.157 22.094 1.00 74.86  ? 281  PRO A CA  1 
ATOM   1074 C  C   . PRO A 1 145 ? 16.641  43.690 22.682 1.00 73.48  ? 281  PRO A C   1 
ATOM   1075 O  O   . PRO A 1 145 ? 16.653  44.721 23.358 1.00 71.77  ? 281  PRO A O   1 
ATOM   1076 C  CB  . PRO A 1 145 ? 18.062  43.551 20.614 1.00 82.19  ? 281  PRO A CB  1 
ATOM   1077 C  CG  . PRO A 1 145 ? 17.857  42.267 19.833 1.00 79.73  ? 281  PRO A CG  1 
ATOM   1078 C  CD  . PRO A 1 145 ? 18.429  41.215 20.715 1.00 71.43  ? 281  PRO A CD  1 
ATOM   1079 N  N   . GLN A 1 146 ? 15.530  43.008 22.421 1.00 74.64  ? 282  GLN A N   1 
ATOM   1080 C  CA  . GLN A 1 146 ? 14.238  43.423 22.959 1.00 78.81  ? 282  GLN A CA  1 
ATOM   1081 C  C   . GLN A 1 146 ? 14.070  42.984 24.414 1.00 77.51  ? 282  GLN A C   1 
ATOM   1082 O  O   . GLN A 1 146 ? 13.740  43.791 25.286 1.00 78.69  ? 282  GLN A O   1 
ATOM   1083 C  CB  . GLN A 1 146 ? 13.100  42.856 22.108 1.00 78.49  ? 282  GLN A CB  1 
ATOM   1084 N  N   . LEU A 1 147 ? 14.304  41.699 24.666 1.00 72.49  ? 283  LEU A N   1 
ATOM   1085 C  CA  . LEU A 1 147 ? 14.148  41.130 26.000 1.00 61.66  ? 283  LEU A CA  1 
ATOM   1086 C  C   . LEU A 1 147 ? 15.271  41.555 26.937 1.00 56.46  ? 283  LEU A C   1 
ATOM   1087 O  O   . LEU A 1 147 ? 15.032  42.148 27.992 1.00 55.24  ? 283  LEU A O   1 
ATOM   1088 C  CB  . LEU A 1 147 ? 14.100  39.601 25.919 1.00 55.17  ? 283  LEU A CB  1 
ATOM   1089 N  N   . GLY A 1 148 ? 16.500  41.251 26.537 1.00 50.60  ? 284  GLY A N   1 
ATOM   1090 C  CA  . GLY A 1 148 ? 17.650  41.416 27.402 1.00 43.07  ? 284  GLY A CA  1 
ATOM   1091 C  C   . GLY A 1 148 ? 18.456  40.134 27.354 1.00 47.62  ? 284  GLY A C   1 
ATOM   1092 O  O   . GLY A 1 148 ? 18.702  39.594 26.273 1.00 56.45  ? 284  GLY A O   1 
ATOM   1093 N  N   . TYR A 1 149 ? 18.859  39.628 28.513 1.00 43.50  ? 285  TYR A N   1 
ATOM   1094 C  CA  . TYR A 1 149 ? 19.633  38.394 28.538 1.00 39.48  ? 285  TYR A CA  1 
ATOM   1095 C  C   . TYR A 1 149 ? 18.800  37.227 29.046 1.00 37.74  ? 285  TYR A C   1 
ATOM   1096 O  O   . TYR A 1 149 ? 18.101  37.342 30.056 1.00 36.61  ? 285  TYR A O   1 
ATOM   1097 C  CB  . TYR A 1 149 ? 20.923  38.579 29.342 1.00 28.69  ? 285  TYR A CB  1 
ATOM   1098 C  CG  . TYR A 1 149 ? 21.905  39.505 28.642 1.00 37.12  ? 285  TYR A CG  1 
ATOM   1099 C  CD1 . TYR A 1 149 ? 21.841  40.890 28.816 1.00 32.82  ? 285  TYR A CD1 1 
ATOM   1100 C  CD2 . TYR A 1 149 ? 22.879  38.997 27.788 1.00 39.41  ? 285  TYR A CD2 1 
ATOM   1101 C  CE1 . TYR A 1 149 ? 22.728  41.739 28.166 1.00 35.34  ? 285  TYR A CE1 1 
ATOM   1102 C  CE2 . TYR A 1 149 ? 23.773  39.837 27.138 1.00 40.30  ? 285  TYR A CE2 1 
ATOM   1103 C  CZ  . TYR A 1 149 ? 23.691  41.204 27.331 1.00 42.83  ? 285  TYR A CZ  1 
ATOM   1104 O  OH  . TYR A 1 149 ? 24.576  42.037 26.686 1.00 47.77  ? 285  TYR A OH  1 
ATOM   1105 N  N   . SER A 1 150 ? 18.865  36.109 28.329 1.00 36.89  ? 286  SER A N   1 
ATOM   1106 C  CA  . SER A 1 150 ? 18.061  34.935 28.666 1.00 34.78  ? 286  SER A CA  1 
ATOM   1107 C  C   . SER A 1 150 ? 18.748  33.619 28.284 1.00 37.77  ? 286  SER A C   1 
ATOM   1108 O  O   . SER A 1 150 ? 19.886  33.615 27.804 1.00 38.82  ? 286  SER A O   1 
ATOM   1109 C  CB  . SER A 1 150 ? 16.696  35.026 27.986 1.00 30.30  ? 286  SER A CB  1 
ATOM   1110 O  OG  . SER A 1 150 ? 15.884  33.927 28.340 1.00 33.35  ? 286  SER A OG  1 
ATOM   1111 N  N   . LEU A 1 151 ? 18.051  32.508 28.521 1.00 32.67  ? 287  LEU A N   1 
ATOM   1112 C  CA  . LEU A 1 151 ? 18.523  31.176 28.154 1.00 29.16  ? 287  LEU A CA  1 
ATOM   1113 C  C   . LEU A 1 151 ? 17.399  30.410 27.473 1.00 36.19  ? 287  LEU A C   1 
ATOM   1114 O  O   . LEU A 1 151 ? 16.230  30.570 27.833 1.00 36.94  ? 287  LEU A O   1 
ATOM   1115 C  CB  . LEU A 1 151 ? 18.959  30.385 29.384 1.00 26.21  ? 287  LEU A CB  1 
ATOM   1116 C  CG  . LEU A 1 151 ? 20.211  30.831 30.113 1.00 28.08  ? 287  LEU A CG  1 
ATOM   1117 C  CD1 . LEU A 1 151 ? 20.394  30.009 31.376 1.00 23.40  ? 287  LEU A CD1 1 
ATOM   1118 C  CD2 . LEU A 1 151 ? 21.419  30.701 29.181 1.00 24.87  ? 287  LEU A CD2 1 
ATOM   1119 N  N   . PRO A 1 152 ? 17.749  29.558 26.498 1.00 36.04  ? 288  PRO A N   1 
ATOM   1120 C  CA  . PRO A 1 152 ? 16.767  28.710 25.820 1.00 36.64  ? 288  PRO A CA  1 
ATOM   1121 C  C   . PRO A 1 152 ? 16.631  27.388 26.568 1.00 41.01  ? 288  PRO A C   1 
ATOM   1122 O  O   . PRO A 1 152 ? 17.134  27.262 27.691 1.00 39.05  ? 288  PRO A O   1 
ATOM   1123 C  CB  . PRO A 1 152 ? 17.441  28.446 24.479 1.00 37.64  ? 288  PRO A CB  1 
ATOM   1124 C  CG  . PRO A 1 152 ? 18.907  28.331 24.848 1.00 32.02  ? 288  PRO A CG  1 
ATOM   1125 C  CD  . PRO A 1 152 ? 19.114  29.340 25.975 1.00 33.39  ? 288  PRO A CD  1 
ATOM   1126 N  N   . CYS A 1 153 ? 15.973  26.412 25.949 1.00 38.46  ? 289  CYS A N   1 
ATOM   1127 C  CA  . CYS A 1 153 ? 15.943  25.051 26.481 1.00 38.10  ? 289  CYS A CA  1 
ATOM   1128 C  C   . CYS A 1 153 ? 17.349  24.450 26.595 1.00 35.85  ? 289  CYS A C   1 
ATOM   1129 O  O   . CYS A 1 153 ? 18.180  24.622 25.699 1.00 37.94  ? 289  CYS A O   1 
ATOM   1130 C  CB  . CYS A 1 153 ? 15.093  24.149 25.583 1.00 34.28  ? 289  CYS A CB  1 
ATOM   1131 S  SG  . CYS A 1 153 ? 15.051  22.422 26.111 1.00 52.15  ? 289  CYS A SG  1 
ATOM   1132 N  N   . VAL A 1 154 ? 17.598  23.722 27.685 1.00 31.19  ? 290  VAL A N   1 
ATOM   1133 C  CA  . VAL A 1 154 ? 18.896  23.076 27.910 1.00 39.96  ? 290  VAL A CA  1 
ATOM   1134 C  C   . VAL A 1 154 ? 19.328  22.194 26.739 1.00 39.31  ? 290  VAL A C   1 
ATOM   1135 O  O   . VAL A 1 154 ? 20.515  21.957 26.547 1.00 41.26  ? 290  VAL A O   1 
ATOM   1136 C  CB  . VAL A 1 154 ? 18.896  22.236 29.201 1.00 49.19  ? 290  VAL A CB  1 
ATOM   1137 C  CG1 . VAL A 1 154 ? 18.640  23.119 30.408 1.00 55.75  ? 290  VAL A CG1 1 
ATOM   1138 C  CG2 . VAL A 1 154 ? 17.848  21.127 29.123 1.00 46.24  ? 290  VAL A CG2 1 
ATOM   1139 N  N   . ALA A 1 155 ? 18.359  21.718 25.960 1.00 42.53  ? 291  ALA A N   1 
ATOM   1140 C  CA  . ALA A 1 155 ? 18.636  20.908 24.775 1.00 47.65  ? 291  ALA A CA  1 
ATOM   1141 C  C   . ALA A 1 155 ? 19.029  21.767 23.578 1.00 47.95  ? 291  ALA A C   1 
ATOM   1142 O  O   . ALA A 1 155 ? 19.401  21.243 22.524 1.00 49.01  ? 291  ALA A O   1 
ATOM   1143 C  CB  . ALA A 1 155 ? 17.435  20.045 24.428 1.00 49.40  ? 291  ALA A CB  1 
ATOM   1144 N  N   . GLY A 1 156 ? 18.927  23.084 23.736 1.00 47.01  ? 292  GLY A N   1 
ATOM   1145 C  CA  . GLY A 1 156 ? 19.354  24.002 22.695 1.00 47.63  ? 292  GLY A CA  1 
ATOM   1146 C  C   . GLY A 1 156 ? 18.382  24.075 21.540 1.00 51.77  ? 292  GLY A C   1 
ATOM   1147 O  O   . GLY A 1 156 ? 18.770  24.397 20.416 1.00 54.06  ? 292  GLY A O   1 
ATOM   1148 N  N   . CYS A 1 157 ? 17.116  23.775 21.819 1.00 53.21  ? 293  CYS A N   1 
ATOM   1149 C  CA  . CYS A 1 157 ? 16.069  23.843 20.805 1.00 55.62  ? 293  CYS A CA  1 
ATOM   1150 C  C   . CYS A 1 157 ? 15.819  25.284 20.375 1.00 59.09  ? 293  CYS A C   1 
ATOM   1151 O  O   . CYS A 1 157 ? 15.899  26.207 21.190 1.00 55.02  ? 293  CYS A O   1 
ATOM   1152 C  CB  . CYS A 1 157 ? 14.769  23.233 21.328 1.00 48.09  ? 293  CYS A CB  1 
ATOM   1153 S  SG  . CYS A 1 157 ? 14.961  21.582 22.013 1.00 52.65  ? 293  CYS A SG  1 
ATOM   1154 N  N   . PRO A 1 158 ? 15.526  25.481 19.083 1.00 67.47  ? 294  PRO A N   1 
ATOM   1155 C  CA  . PRO A 1 158 ? 15.245  26.817 18.547 1.00 68.71  ? 294  PRO A CA  1 
ATOM   1156 C  C   . PRO A 1 158 ? 13.921  27.355 19.066 1.00 65.57  ? 294  PRO A C   1 
ATOM   1157 O  O   . PRO A 1 158 ? 13.048  26.563 19.425 1.00 67.45  ? 294  PRO A O   1 
ATOM   1158 C  CB  . PRO A 1 158 ? 15.152  26.576 17.035 1.00 73.22  ? 294  PRO A CB  1 
ATOM   1159 C  CG  . PRO A 1 158 ? 14.776  25.135 16.898 1.00 71.85  ? 294  PRO A CG  1 
ATOM   1160 C  CD  . PRO A 1 158 ? 15.451  24.436 18.044 1.00 69.20  ? 294  PRO A CD  1 
ATOM   1161 N  N   . ASN A 1 159 ? 13.785  28.678 19.100 1.00 65.24  ? 295  ASN A N   1 
ATOM   1162 C  CA  . ASN A 1 159 ? 12.556  29.336 19.534 1.00 60.81  ? 295  ASN A CA  1 
ATOM   1163 C  C   . ASN A 1 159 ? 12.127  28.915 20.935 1.00 56.27  ? 295  ASN A C   1 
ATOM   1164 O  O   . ASN A 1 159 ? 10.939  28.701 21.194 1.00 51.42  ? 295  ASN A O   1 
ATOM   1165 C  CB  . ASN A 1 159 ? 11.427  29.098 18.524 1.00 63.88  ? 295  ASN A CB  1 
ATOM   1166 N  N   . SER A 1 160 ? 13.095  28.803 21.841 1.00 50.56  ? 296  SER A N   1 
ATOM   1167 C  CA  . SER A 1 160 ? 12.796  28.382 23.202 1.00 46.77  ? 296  SER A CA  1 
ATOM   1168 C  C   . SER A 1 160 ? 13.300  29.371 24.239 1.00 46.94  ? 296  SER A C   1 
ATOM   1169 O  O   . SER A 1 160 ? 13.291  29.074 25.438 1.00 44.17  ? 296  SER A O   1 
ATOM   1170 C  CB  . SER A 1 160 ? 13.364  26.985 23.478 1.00 49.80  ? 296  SER A CB  1 
ATOM   1171 O  OG  . SER A 1 160 ? 14.766  26.951 23.298 1.00 48.02  ? 296  SER A OG  1 
ATOM   1172 N  N   . LEU A 1 161 ? 13.731  30.545 23.783 1.00 50.23  ? 297  LEU A N   1 
ATOM   1173 C  CA  . LEU A 1 161 ? 14.205  31.589 24.696 1.00 45.18  ? 297  LEU A CA  1 
ATOM   1174 C  C   . LEU A 1 161 ? 13.146  31.968 25.732 1.00 40.33  ? 297  LEU A C   1 
ATOM   1175 O  O   . LEU A 1 161 ? 12.011  32.293 25.392 1.00 41.04  ? 297  LEU A O   1 
ATOM   1176 C  CB  . LEU A 1 161 ? 14.642  32.837 23.921 1.00 51.22  ? 297  LEU A CB  1 
ATOM   1177 C  CG  . LEU A 1 161 ? 16.128  32.979 23.598 1.00 56.14  ? 297  LEU A CG  1 
ATOM   1178 C  CD1 . LEU A 1 161 ? 16.440  34.348 23.011 1.00 56.81  ? 297  LEU A CD1 1 
ATOM   1179 C  CD2 . LEU A 1 161 ? 16.950  32.737 24.844 1.00 56.81  ? 297  LEU A CD2 1 
ATOM   1180 N  N   . ILE A 1 162 ? 13.523  31.909 27.002 1.00 39.73  ? 298  ILE A N   1 
ATOM   1181 C  CA  . ILE A 1 162 ? 12.635  32.314 28.081 1.00 37.34  ? 298  ILE A CA  1 
ATOM   1182 C  C   . ILE A 1 162 ? 12.325  33.810 27.963 1.00 44.37  ? 298  ILE A C   1 
ATOM   1183 O  O   . ILE A 1 162 ? 13.243  34.616 27.814 1.00 40.95  ? 298  ILE A O   1 
ATOM   1184 C  CB  . ILE A 1 162 ? 13.269  31.971 29.443 1.00 29.50  ? 298  ILE A CB  1 
ATOM   1185 C  CG1 . ILE A 1 162 ? 13.298  30.445 29.619 1.00 35.46  ? 298  ILE A CG1 1 
ATOM   1186 C  CG2 . ILE A 1 162 ? 12.520  32.667 30.581 1.00 22.37  ? 298  ILE A CG2 1 
ATOM   1187 C  CD1 . ILE A 1 162 ? 13.855  29.963 30.941 1.00 33.33  ? 298  ILE A CD1 1 
ATOM   1188 N  N   . LYS A 1 163 ? 11.038  34.168 28.009 1.00 45.83  ? 299  LYS A N   1 
ATOM   1189 C  CA  . LYS A 1 163 ? 10.588  35.549 27.796 1.00 44.90  ? 299  LYS A CA  1 
ATOM   1190 C  C   . LYS A 1 163 ? 10.263  36.298 29.090 1.00 38.30  ? 299  LYS A C   1 
ATOM   1191 O  O   . LYS A 1 163 ? 10.524  37.498 29.210 1.00 38.67  ? 299  LYS A O   1 
ATOM   1192 C  CB  . LYS A 1 163 ? 9.360   35.572 26.879 1.00 47.72  ? 299  LYS A CB  1 
ATOM   1193 C  CG  . LYS A 1 163 ? 9.645   36.010 25.450 1.00 58.05  ? 299  LYS A CG  1 
ATOM   1194 C  CD  . LYS A 1 163 ? 10.581  35.048 24.747 1.00 63.35  ? 299  LYS A CD  1 
ATOM   1195 C  CE  . LYS A 1 163 ? 11.018  35.586 23.389 1.00 70.50  ? 299  LYS A CE  1 
ATOM   1196 N  NZ  . LYS A 1 163 ? 11.859  34.594 22.657 1.00 73.21  ? 299  LYS A NZ  1 
ATOM   1197 N  N   . GLU A 1 164 ? 9.669   35.593 30.045 1.00 31.38  ? 300  GLU A N   1 
ATOM   1198 C  CA  . GLU A 1 164 ? 9.380   36.182 31.345 1.00 36.51  ? 300  GLU A CA  1 
ATOM   1199 C  C   . GLU A 1 164 ? 10.623  36.027 32.208 1.00 36.37  ? 300  GLU A C   1 
ATOM   1200 O  O   . GLU A 1 164 ? 10.881  34.947 32.757 1.00 32.09  ? 300  GLU A O   1 
ATOM   1201 C  CB  . GLU A 1 164 ? 8.162   35.504 31.987 1.00 34.00  ? 300  GLU A CB  1 
ATOM   1202 C  CG  . GLU A 1 164 ? 7.933   35.874 33.436 1.00 41.87  ? 300  GLU A CG  1 
ATOM   1203 C  CD  . GLU A 1 164 ? 7.963   37.371 33.663 1.00 51.66  ? 300  GLU A CD  1 
ATOM   1204 O  OE1 . GLU A 1 164 ? 6.997   38.058 33.277 1.00 60.59  ? 300  GLU A OE1 1 
ATOM   1205 O  OE2 . GLU A 1 164 ? 8.956   37.863 34.234 1.00 47.57  ? 300  GLU A OE2 1 
ATOM   1206 N  N   . LEU A 1 165 ? 11.393  37.109 32.320 1.00 35.64  ? 301  LEU A N   1 
ATOM   1207 C  CA  . LEU A 1 165 ? 12.736  37.042 32.890 1.00 33.61  ? 301  LEU A CA  1 
ATOM   1208 C  C   . LEU A 1 165 ? 12.753  36.819 34.394 1.00 28.45  ? 301  LEU A C   1 
ATOM   1209 O  O   . LEU A 1 165 ? 13.793  36.481 34.954 1.00 25.57  ? 301  LEU A O   1 
ATOM   1210 C  CB  . LEU A 1 165 ? 13.544  38.292 32.528 1.00 31.99  ? 301  LEU A CB  1 
ATOM   1211 C  CG  . LEU A 1 165 ? 13.695  38.582 31.033 1.00 34.62  ? 301  LEU A CG  1 
ATOM   1212 C  CD1 . LEU A 1 165 ? 14.496  39.862 30.805 1.00 33.81  ? 301  LEU A CD1 1 
ATOM   1213 C  CD2 . LEU A 1 165 ? 14.342  37.411 30.305 1.00 28.98  ? 301  LEU A CD2 1 
ATOM   1214 N  N   . HIS A 1 166 ? 11.613  36.990 35.053 1.00 25.72  ? 302  HIS A N   1 
ATOM   1215 C  CA  . HIS A 1 166 ? 11.553  36.753 36.497 1.00 23.98  ? 302  HIS A CA  1 
ATOM   1216 C  C   . HIS A 1 166 ? 11.765  35.275 36.837 1.00 21.97  ? 302  HIS A C   1 
ATOM   1217 O  O   . HIS A 1 166 ? 11.962  34.928 38.000 1.00 21.35  ? 302  HIS A O   1 
ATOM   1218 C  CB  . HIS A 1 166 ? 10.237  37.274 37.097 1.00 31.16  ? 302  HIS A CB  1 
ATOM   1219 C  CG  . HIS A 1 166 ? 10.129  38.770 37.112 1.00 46.54  ? 302  HIS A CG  1 
ATOM   1220 N  ND1 . HIS A 1 166 ? 9.606   39.489 36.057 1.00 55.25  ? 302  HIS A ND1 1 
ATOM   1221 C  CD2 . HIS A 1 166 ? 10.475  39.682 38.052 1.00 43.49  ? 302  HIS A CD2 1 
ATOM   1222 C  CE1 . HIS A 1 166 ? 9.636   40.778 36.346 1.00 51.53  ? 302  HIS A CE1 1 
ATOM   1223 N  NE2 . HIS A 1 166 ? 10.161  40.923 37.549 1.00 47.43  ? 302  HIS A NE2 1 
ATOM   1224 N  N   . HIS A 1 167 ? 11.730  34.399 35.836 1.00 19.86  ? 303  HIS A N   1 
ATOM   1225 C  CA  . HIS A 1 167 ? 12.094  33.003 36.079 1.00 26.02  ? 303  HIS A CA  1 
ATOM   1226 C  C   . HIS A 1 167 ? 13.542  32.884 36.536 1.00 26.87  ? 303  HIS A C   1 
ATOM   1227 O  O   . HIS A 1 167 ? 13.909  31.907 37.191 1.00 21.35  ? 303  HIS A O   1 
ATOM   1228 C  CB  . HIS A 1 167 ? 11.867  32.139 34.836 1.00 24.90  ? 303  HIS A CB  1 
ATOM   1229 C  CG  . HIS A 1 167 ? 10.427  31.844 34.565 1.00 29.32  ? 303  HIS A CG  1 
ATOM   1230 N  ND1 . HIS A 1 167 ? 9.627   32.671 33.804 1.00 33.69  ? 303  HIS A ND1 1 
ATOM   1231 C  CD2 . HIS A 1 167 ? 9.637   30.818 34.965 1.00 28.69  ? 303  HIS A CD2 1 
ATOM   1232 C  CE1 . HIS A 1 167 ? 8.409   32.162 33.741 1.00 33.45  ? 303  HIS A CE1 1 
ATOM   1233 N  NE2 . HIS A 1 167 ? 8.388   31.040 34.439 1.00 29.98  ? 303  HIS A NE2 1 
ATOM   1234 N  N   . PHE A 1 168 ? 14.367  33.874 36.203 1.00 24.76  ? 304  PHE A N   1 
ATOM   1235 C  CA  . PHE A 1 168 ? 15.765  33.835 36.634 1.00 30.63  ? 304  PHE A CA  1 
ATOM   1236 C  C   . PHE A 1 168 ? 15.935  34.188 38.103 1.00 27.73  ? 304  PHE A C   1 
ATOM   1237 O  O   . PHE A 1 168 ? 17.022  34.076 38.643 1.00 25.84  ? 304  PHE A O   1 
ATOM   1238 C  CB  . PHE A 1 168 ? 16.653  34.684 35.717 1.00 24.68  ? 304  PHE A CB  1 
ATOM   1239 C  CG  . PHE A 1 168 ? 16.677  34.176 34.318 1.00 27.16  ? 304  PHE A CG  1 
ATOM   1240 C  CD1 . PHE A 1 168 ? 17.120  32.882 34.055 1.00 29.79  ? 304  PHE A CD1 1 
ATOM   1241 C  CD2 . PHE A 1 168 ? 16.201  34.951 33.272 1.00 19.74  ? 304  PHE A CD2 1 
ATOM   1242 C  CE1 . PHE A 1 168 ? 17.110  32.375 32.765 1.00 31.90  ? 304  PHE A CE1 1 
ATOM   1243 C  CE2 . PHE A 1 168 ? 16.192  34.450 31.980 1.00 29.14  ? 304  PHE A CE2 1 
ATOM   1244 C  CZ  . PHE A 1 168 ? 16.649  33.161 31.727 1.00 34.79  ? 304  PHE A CZ  1 
ATOM   1245 N  N   . ARG A 1 169 ? 14.847  34.577 38.753 1.00 24.98  ? 305  ARG A N   1 
ATOM   1246 C  CA  . ARG A 1 169 ? 14.867  34.785 40.197 1.00 29.48  ? 305  ARG A CA  1 
ATOM   1247 C  C   . ARG A 1 169 ? 15.316  33.521 40.930 1.00 27.24  ? 305  ARG A C   1 
ATOM   1248 O  O   . ARG A 1 169 ? 15.812  33.595 42.054 1.00 31.80  ? 305  ARG A O   1 
ATOM   1249 C  CB  . ARG A 1 169 ? 13.484  35.209 40.683 1.00 33.99  ? 305  ARG A CB  1 
ATOM   1250 C  CG  . ARG A 1 169 ? 13.484  36.424 41.582 1.00 42.39  ? 305  ARG A CG  1 
ATOM   1251 C  CD  . ARG A 1 169 ? 13.896  37.670 40.872 1.00 52.14  ? 305  ARG A CD  1 
ATOM   1252 N  NE  . ARG A 1 169 ? 13.542  38.875 41.625 1.00 60.73  ? 305  ARG A NE  1 
ATOM   1253 C  CZ  . ARG A 1 169 ? 14.191  39.316 42.702 1.00 60.97  ? 305  ARG A CZ  1 
ATOM   1254 N  NH1 . ARG A 1 169 ? 15.230  38.647 43.192 1.00 60.41  ? 305  ARG A NH1 1 
ATOM   1255 N  NH2 . ARG A 1 169 ? 13.790  40.424 43.304 1.00 61.24  ? 305  ARG A NH2 1 
ATOM   1256 N  N   . ILE A 1 170 ? 15.150  32.368 40.276 1.00 27.11  ? 306  ILE A N   1 
ATOM   1257 C  CA  . ILE A 1 170 ? 15.568  31.062 40.804 1.00 32.41  ? 306  ILE A CA  1 
ATOM   1258 C  C   . ILE A 1 170 ? 17.091  31.008 41.022 1.00 34.68  ? 306  ILE A C   1 
ATOM   1259 O  O   . ILE A 1 170 ? 17.610  30.123 41.710 1.00 36.79  ? 306  ILE A O   1 
ATOM   1260 C  CB  . ILE A 1 170 ? 15.059  29.910 39.872 1.00 24.80  ? 306  ILE A CB  1 
ATOM   1261 C  CG1 . ILE A 1 170 ? 13.535  29.816 39.936 1.00 31.30  ? 306  ILE A CG1 1 
ATOM   1262 C  CG2 . ILE A 1 170 ? 15.612  28.545 40.259 1.00 30.70  ? 306  ILE A CG2 1 
ATOM   1263 C  CD1 . ILE A 1 170 ? 12.916  28.974 38.831 1.00 33.52  ? 306  ILE A CD1 1 
ATOM   1264 N  N   . LEU A 1 171 ? 17.798  31.980 40.454 1.00 32.32  ? 307  LEU A N   1 
ATOM   1265 C  CA  . LEU A 1 171 ? 19.238  32.101 40.655 1.00 30.93  ? 307  LEU A CA  1 
ATOM   1266 C  C   . LEU A 1 171 ? 19.577  32.275 42.123 1.00 35.00  ? 307  LEU A C   1 
ATOM   1267 O  O   . LEU A 1 171 ? 20.574  31.739 42.609 1.00 46.84  ? 307  LEU A O   1 
ATOM   1268 C  CB  . LEU A 1 171 ? 19.783  33.294 39.873 1.00 25.00  ? 307  LEU A CB  1 
ATOM   1269 C  CG  . LEU A 1 171 ? 20.084  33.079 38.396 1.00 21.53  ? 307  LEU A CG  1 
ATOM   1270 C  CD1 . LEU A 1 171 ? 20.252  34.426 37.704 1.00 18.75  ? 307  LEU A CD1 1 
ATOM   1271 C  CD2 . LEU A 1 171 ? 21.346  32.251 38.251 1.00 24.01  ? 307  LEU A CD2 1 
ATOM   1272 N  N   . GLY A 1 172 ? 18.736  33.019 42.830 1.00 35.94  ? 308  GLY A N   1 
ATOM   1273 C  CA  . GLY A 1 172 ? 19.043  33.414 44.192 1.00 35.82  ? 308  GLY A CA  1 
ATOM   1274 C  C   . GLY A 1 172 ? 19.282  34.908 44.210 1.00 42.83  ? 308  GLY A C   1 
ATOM   1275 O  O   . GLY A 1 172 ? 19.628  35.487 43.180 1.00 44.18  ? 308  GLY A O   1 
ATOM   1276 N  N   . GLU A 1 173 ? 19.106  35.527 45.374 1.00 45.56  ? 309  GLU A N   1 
ATOM   1277 C  CA  . GLU A 1 173 ? 19.222  36.977 45.514 1.00 50.29  ? 309  GLU A CA  1 
ATOM   1278 C  C   . GLU A 1 173 ? 20.551  37.521 44.991 1.00 48.60  ? 309  GLU A C   1 
ATOM   1279 O  O   . GLU A 1 173 ? 20.573  38.457 44.187 1.00 46.28  ? 309  GLU A O   1 
ATOM   1280 C  CB  . GLU A 1 173 ? 19.039  37.377 46.981 1.00 61.98  ? 309  GLU A CB  1 
ATOM   1281 C  CG  . GLU A 1 173 ? 17.771  36.813 47.628 1.00 71.99  ? 309  GLU A CG  1 
ATOM   1282 C  CD  . GLU A 1 173 ? 18.024  36.211 49.004 1.00 78.39  ? 309  GLU A CD  1 
ATOM   1283 O  OE1 . GLU A 1 173 ? 18.130  36.980 49.985 1.00 82.43  ? 309  GLU A OE1 1 
ATOM   1284 O  OE2 . GLU A 1 173 ? 18.108  34.966 49.103 1.00 76.98  ? 309  GLU A OE2 1 
ATOM   1285 N  N   . GLU A 1 174 ? 21.652  36.928 45.445 1.00 47.30  ? 310  GLU A N   1 
ATOM   1286 C  CA  . GLU A 1 174 ? 22.978  37.381 45.058 1.00 45.96  ? 310  GLU A CA  1 
ATOM   1287 C  C   . GLU A 1 174 ? 23.219  37.234 43.569 1.00 43.50  ? 310  GLU A C   1 
ATOM   1288 O  O   . GLU A 1 174 ? 23.569  38.208 42.885 1.00 41.89  ? 310  GLU A O   1 
ATOM   1289 N  N   . GLN A 1 175 ? 23.024  36.018 43.061 1.00 33.94  ? 311  GLN A N   1 
ATOM   1290 C  CA  . GLN A 1 175 ? 23.266  35.743 41.648 1.00 26.78  ? 311  GLN A CA  1 
ATOM   1291 C  C   . GLN A 1 175 ? 22.314  36.519 40.743 1.00 27.50  ? 311  GLN A C   1 
ATOM   1292 O  O   . GLN A 1 175 ? 22.674  36.887 39.623 1.00 29.64  ? 311  GLN A O   1 
ATOM   1293 C  CB  . GLN A 1 175 ? 23.165  34.244 41.366 1.00 30.64  ? 311  GLN A CB  1 
ATOM   1294 C  CG  . GLN A 1 175 ? 24.145  33.381 42.165 1.00 39.60  ? 311  GLN A CG  1 
ATOM   1295 C  CD  . GLN A 1 175 ? 25.529  33.356 41.559 1.00 57.88  ? 311  GLN A CD  1 
ATOM   1296 O  OE1 . GLN A 1 175 ? 25.931  32.361 40.955 1.00 66.61  ? 311  GLN A OE1 1 
ATOM   1297 N  NE2 . GLN A 1 175 ? 26.272  34.452 41.716 1.00 61.37  ? 311  GLN A NE2 1 
ATOM   1298 N  N   . TYR A 1 176 ? 21.101  36.776 41.219 1.00 28.06  ? 312  TYR A N   1 
ATOM   1299 C  CA  . TYR A 1 176 ? 20.127  37.493 40.399 1.00 26.87  ? 312  TYR A CA  1 
ATOM   1300 C  C   . TYR A 1 176 ? 20.558  38.933 40.163 1.00 26.39  ? 312  TYR A C   1 
ATOM   1301 O  O   . TYR A 1 176 ? 20.384  39.464 39.066 1.00 36.38  ? 312  TYR A O   1 
ATOM   1302 C  CB  . TYR A 1 176 ? 18.740  37.463 41.044 1.00 26.38  ? 312  TYR A CB  1 
ATOM   1303 C  CG  . TYR A 1 176 ? 17.679  38.120 40.206 1.00 25.85  ? 312  TYR A CG  1 
ATOM   1304 C  CD1 . TYR A 1 176 ? 17.229  37.521 39.032 1.00 23.22  ? 312  TYR A CD1 1 
ATOM   1305 C  CD2 . TYR A 1 176 ? 17.120  39.338 40.584 1.00 22.11  ? 312  TYR A CD2 1 
ATOM   1306 C  CE1 . TYR A 1 176 ? 16.245  38.123 38.249 1.00 27.07  ? 312  TYR A CE1 1 
ATOM   1307 C  CE2 . TYR A 1 176 ? 16.131  39.947 39.811 1.00 27.39  ? 312  TYR A CE2 1 
ATOM   1308 C  CZ  . TYR A 1 176 ? 15.704  39.336 38.647 1.00 33.18  ? 312  TYR A CZ  1 
ATOM   1309 O  OH  . TYR A 1 176 ? 14.731  39.936 37.882 1.00 42.71  ? 312  TYR A OH  1 
ATOM   1310 N  N   . ASN A 1 177 ? 21.111  39.561 41.198 1.00 28.60  ? 313  ASN A N   1 
ATOM   1311 C  CA  . ASN A 1 177 ? 21.659  40.911 41.071 1.00 36.94  ? 313  ASN A CA  1 
ATOM   1312 C  C   . ASN A 1 177 ? 22.763  40.943 40.030 1.00 35.85  ? 313  ASN A C   1 
ATOM   1313 O  O   . ASN A 1 177 ? 22.801  41.837 39.184 1.00 37.85  ? 313  ASN A O   1 
ATOM   1314 C  CB  . ASN A 1 177 ? 22.200  41.410 42.413 1.00 39.88  ? 313  ASN A CB  1 
ATOM   1315 N  N   . ARG A 1 178 ? 23.661  39.962 40.094 1.00 33.24  ? 314  ARG A N   1 
ATOM   1316 C  CA  . ARG A 1 178 ? 24.704  39.844 39.087 1.00 31.00  ? 314  ARG A CA  1 
ATOM   1317 C  C   . ARG A 1 178 ? 24.086  39.730 37.697 1.00 29.95  ? 314  ARG A C   1 
ATOM   1318 O  O   . ARG A 1 178 ? 24.485  40.432 36.767 1.00 25.25  ? 314  ARG A O   1 
ATOM   1319 C  CB  . ARG A 1 178 ? 25.602  38.636 39.356 1.00 29.67  ? 314  ARG A CB  1 
ATOM   1320 C  CG  . ARG A 1 178 ? 26.649  38.461 38.269 1.00 30.53  ? 314  ARG A CG  1 
ATOM   1321 C  CD  . ARG A 1 178 ? 27.631  37.332 38.533 1.00 28.23  ? 314  ARG A CD  1 
ATOM   1322 N  NE  . ARG A 1 178 ? 28.721  37.407 37.561 1.00 36.39  ? 314  ARG A NE  1 
ATOM   1323 C  CZ  . ARG A 1 178 ? 29.637  36.466 37.372 1.00 37.16  ? 314  ARG A CZ  1 
ATOM   1324 N  NH1 . ARG A 1 178 ? 29.611  35.347 38.084 1.00 36.24  ? 314  ARG A NH1 1 
ATOM   1325 N  NH2 . ARG A 1 178 ? 30.574  36.646 36.456 1.00 32.41  ? 314  ARG A NH2 1 
ATOM   1326 N  N   . TYR A 1 179 ? 23.093  38.857 37.567 1.00 27.96  ? 315  TYR A N   1 
ATOM   1327 C  CA  . TYR A 1 179 ? 22.411  38.687 36.294 1.00 25.31  ? 315  TYR A CA  1 
ATOM   1328 C  C   . TYR A 1 179 ? 21.813  40.003 35.782 1.00 27.41  ? 315  TYR A C   1 
ATOM   1329 O  O   . TYR A 1 179 ? 21.823  40.274 34.578 1.00 31.64  ? 315  TYR A O   1 
ATOM   1330 C  CB  . TYR A 1 179 ? 21.320  37.619 36.423 1.00 21.30  ? 315  TYR A CB  1 
ATOM   1331 C  CG  . TYR A 1 179 ? 20.281  37.733 35.342 1.00 23.26  ? 315  TYR A CG  1 
ATOM   1332 C  CD1 . TYR A 1 179 ? 20.516  37.225 34.073 1.00 26.41  ? 315  TYR A CD1 1 
ATOM   1333 C  CD2 . TYR A 1 179 ? 19.072  38.362 35.584 1.00 21.60  ? 315  TYR A CD2 1 
ATOM   1334 C  CE1 . TYR A 1 179 ? 19.567  37.338 33.070 1.00 27.85  ? 315  TYR A CE1 1 
ATOM   1335 C  CE2 . TYR A 1 179 ? 18.120  38.484 34.586 1.00 28.26  ? 315  TYR A CE2 1 
ATOM   1336 C  CZ  . TYR A 1 179 ? 18.376  37.968 33.335 1.00 29.08  ? 315  TYR A CZ  1 
ATOM   1337 O  OH  . TYR A 1 179 ? 17.432  38.087 32.344 1.00 31.44  ? 315  TYR A OH  1 
ATOM   1338 N  N   . GLN A 1 180 ? 21.294  40.822 36.693 1.00 25.46  ? 316  GLN A N   1 
ATOM   1339 C  CA  . GLN A 1 180 ? 20.731  42.119 36.302 1.00 35.19  ? 316  GLN A CA  1 
ATOM   1340 C  C   . GLN A 1 180 ? 21.799  43.069 35.774 1.00 36.66  ? 316  GLN A C   1 
ATOM   1341 O  O   . GLN A 1 180 ? 21.487  44.049 35.098 1.00 39.98  ? 316  GLN A O   1 
ATOM   1342 C  CB  . GLN A 1 180 ? 19.978  42.765 37.471 1.00 39.83  ? 316  GLN A CB  1 
ATOM   1343 C  CG  . GLN A 1 180 ? 18.704  42.025 37.883 1.00 47.68  ? 316  GLN A CG  1 
ATOM   1344 C  CD  . GLN A 1 180 ? 17.908  42.778 38.934 1.00 51.79  ? 316  GLN A CD  1 
ATOM   1345 O  OE1 . GLN A 1 180 ? 18.297  42.837 40.103 1.00 51.31  ? 316  GLN A OE1 1 
ATOM   1346 N  NE2 . GLN A 1 180 ? 16.788  43.362 38.519 1.00 47.74  ? 316  GLN A NE2 1 
ATOM   1347 N  N   . GLN A 1 181 ? 23.058  42.769 36.078 1.00 38.86  ? 317  GLN A N   1 
ATOM   1348 C  CA  . GLN A 1 181 ? 24.177  43.585 35.617 1.00 41.73  ? 317  GLN A CA  1 
ATOM   1349 C  C   . GLN A 1 181 ? 24.874  42.943 34.428 1.00 34.25  ? 317  GLN A C   1 
ATOM   1350 O  O   . GLN A 1 181 ? 26.019  43.269 34.141 1.00 34.97  ? 317  GLN A O   1 
ATOM   1351 C  CB  . GLN A 1 181 ? 25.197  43.758 36.745 1.00 43.10  ? 317  GLN A CB  1 
ATOM   1352 C  CG  . GLN A 1 181 ? 24.778  44.704 37.858 1.00 59.02  ? 317  GLN A CG  1 
ATOM   1353 C  CD  . GLN A 1 181 ? 25.791  44.734 38.995 1.00 72.53  ? 317  GLN A CD  1 
ATOM   1354 O  OE1 . GLN A 1 181 ? 26.760  43.969 38.999 1.00 73.33  ? 317  GLN A OE1 1 
ATOM   1355 N  NE2 . GLN A 1 181 ? 25.573  45.621 39.962 1.00 77.82  ? 317  GLN A NE2 1 
ATOM   1356 N  N   . TYR A 1 182 ? 24.196  42.033 33.736 1.00 32.78  ? 318  TYR A N   1 
ATOM   1357 C  CA  . TYR A 1 182 ? 24.875  41.202 32.739 1.00 33.31  ? 318  TYR A CA  1 
ATOM   1358 C  C   . TYR A 1 182 ? 25.508  42.009 31.621 1.00 32.75  ? 318  TYR A C   1 
ATOM   1359 O  O   . TYR A 1 182 ? 26.672  41.788 31.276 1.00 32.08  ? 318  TYR A O   1 
ATOM   1360 C  CB  . TYR A 1 182 ? 23.933  40.147 32.154 1.00 26.29  ? 318  TYR A CB  1 
ATOM   1361 C  CG  . TYR A 1 182 ? 24.663  39.005 31.479 1.00 23.10  ? 318  TYR A CG  1 
ATOM   1362 C  CD1 . TYR A 1 182 ? 25.137  39.129 30.180 1.00 25.81  ? 318  TYR A CD1 1 
ATOM   1363 C  CD2 . TYR A 1 182 ? 24.878  37.802 32.142 1.00 23.68  ? 318  TYR A CD2 1 
ATOM   1364 C  CE1 . TYR A 1 182 ? 25.807  38.092 29.557 1.00 25.06  ? 318  TYR A CE1 1 
ATOM   1365 C  CE2 . TYR A 1 182 ? 25.548  36.753 31.525 1.00 21.38  ? 318  TYR A CE2 1 
ATOM   1366 C  CZ  . TYR A 1 182 ? 26.009  36.912 30.234 1.00 29.40  ? 318  TYR A CZ  1 
ATOM   1367 O  OH  . TYR A 1 182 ? 26.666  35.887 29.605 1.00 34.61  ? 318  TYR A OH  1 
ATOM   1368 N  N   . GLY A 1 183 ? 24.743  42.940 31.057 1.00 33.70  ? 319  GLY A N   1 
ATOM   1369 C  CA  . GLY A 1 183 ? 25.233  43.769 29.970 1.00 28.85  ? 319  GLY A CA  1 
ATOM   1370 C  C   . GLY A 1 183 ? 26.428  44.596 30.392 1.00 32.41  ? 319  GLY A C   1 
ATOM   1371 O  O   . GLY A 1 183 ? 27.427  44.670 29.676 1.00 35.51  ? 319  GLY A O   1 
ATOM   1372 N  N   . ALA A 1 184 ? 26.332  45.219 31.561 1.00 37.12  ? 320  ALA A N   1 
ATOM   1373 C  CA  . ALA A 1 184 ? 27.428  46.046 32.045 1.00 37.31  ? 320  ALA A CA  1 
ATOM   1374 C  C   . ALA A 1 184 ? 28.676  45.196 32.262 1.00 35.71  ? 320  ALA A C   1 
ATOM   1375 O  O   . ALA A 1 184 ? 29.764  45.559 31.814 1.00 36.23  ? 320  ALA A O   1 
ATOM   1376 C  CB  . ALA A 1 184 ? 27.034  46.768 33.318 1.00 33.13  ? 320  ALA A CB  1 
ATOM   1377 N  N   . GLU A 1 185 ? 28.523  44.062 32.938 1.00 28.22  ? 321  GLU A N   1 
ATOM   1378 C  CA  . GLU A 1 185 ? 29.688  43.234 33.246 1.00 33.84  ? 321  GLU A CA  1 
ATOM   1379 C  C   . GLU A 1 185 ? 30.354  42.690 31.983 1.00 36.90  ? 321  GLU A C   1 
ATOM   1380 O  O   . GLU A 1 185 ? 31.580  42.565 31.920 1.00 42.98  ? 321  GLU A O   1 
ATOM   1381 C  CB  . GLU A 1 185 ? 29.332  42.083 34.199 1.00 32.89  ? 321  GLU A CB  1 
ATOM   1382 C  CG  . GLU A 1 185 ? 30.584  41.332 34.688 1.00 33.57  ? 321  GLU A CG  1 
ATOM   1383 C  CD  . GLU A 1 185 ? 30.270  40.157 35.598 1.00 40.68  ? 321  GLU A CD  1 
ATOM   1384 O  OE1 . GLU A 1 185 ? 29.088  39.981 35.983 1.00 39.31  ? 321  GLU A OE1 1 
ATOM   1385 O  OE2 . GLU A 1 185 ? 31.212  39.401 35.925 1.00 42.89  ? 321  GLU A OE2 1 
ATOM   1386 N  N   . GLU A 1 186 ? 29.546  42.369 30.977 1.00 35.24  ? 322  GLU A N   1 
ATOM   1387 C  CA  . GLU A 1 186 ? 30.084  41.856 29.723 1.00 39.83  ? 322  GLU A CA  1 
ATOM   1388 C  C   . GLU A 1 186 ? 30.999  42.899 29.091 1.00 43.92  ? 322  GLU A C   1 
ATOM   1389 O  O   . GLU A 1 186 ? 32.020  42.558 28.485 1.00 49.22  ? 322  GLU A O   1 
ATOM   1390 C  CB  . GLU A 1 186 ? 28.950  41.451 28.777 1.00 43.09  ? 322  GLU A CB  1 
ATOM   1391 C  CG  . GLU A 1 186 ? 29.289  40.298 27.833 1.00 47.46  ? 322  GLU A CG  1 
ATOM   1392 C  CD  . GLU A 1 186 ? 29.297  38.925 28.505 1.00 47.84  ? 322  GLU A CD  1 
ATOM   1393 O  OE1 . GLU A 1 186 ? 29.437  38.834 29.748 1.00 43.48  ? 322  GLU A OE1 1 
ATOM   1394 O  OE2 . GLU A 1 186 ? 29.171  37.922 27.773 1.00 51.32  ? 322  GLU A OE2 1 
ATOM   1395 N  N   . CYS A 1 187 ? 30.650  44.171 29.265 1.00 36.34  ? 323  CYS A N   1 
ATOM   1396 C  CA  A CYS A 1 187 ? 31.480  45.250 28.764 0.44 40.68  ? 323  CYS A CA  1 
ATOM   1397 C  CA  B CYS A 1 187 ? 31.475  45.281 28.777 0.56 40.91  ? 323  CYS A CA  1 
ATOM   1398 C  C   . CYS A 1 187 ? 32.804  45.343 29.523 1.00 42.04  ? 323  CYS A C   1 
ATOM   1399 O  O   . CYS A 1 187 ? 33.873  45.385 28.918 1.00 46.40  ? 323  CYS A O   1 
ATOM   1400 C  CB  A CYS A 1 187 ? 30.730  46.571 28.861 0.44 42.63  ? 323  CYS A CB  1 
ATOM   1401 C  CB  B CYS A 1 187 ? 30.756  46.626 28.956 0.56 42.77  ? 323  CYS A CB  1 
ATOM   1402 S  SG  A CYS A 1 187 ? 31.576  47.882 28.024 0.44 39.68  ? 323  CYS A SG  1 
ATOM   1403 S  SG  B CYS A 1 187 ? 29.434  46.996 27.781 0.56 62.05  ? 323  CYS A SG  1 
ATOM   1404 N  N   . VAL A 1 188 ? 32.716  45.374 30.848 1.00 41.54  ? 324  VAL A N   1 
ATOM   1405 C  CA  . VAL A 1 188 ? 33.882  45.411 31.725 1.00 45.64  ? 324  VAL A CA  1 
ATOM   1406 C  C   . VAL A 1 188 ? 34.853  44.262 31.425 1.00 46.73  ? 324  VAL A C   1 
ATOM   1407 O  O   . VAL A 1 188 ? 36.063  44.458 31.388 1.00 44.46  ? 324  VAL A O   1 
ATOM   1408 C  CB  . VAL A 1 188 ? 33.426  45.357 33.198 1.00 44.63  ? 324  VAL A CB  1 
ATOM   1409 C  CG1 . VAL A 1 188 ? 34.584  45.057 34.121 1.00 45.87  ? 324  VAL A CG1 1 
ATOM   1410 C  CG2 . VAL A 1 188 ? 32.752  46.667 33.587 1.00 47.20  ? 324  VAL A CG2 1 
ATOM   1411 N  N   . LEU A 1 189 ? 34.305  43.073 31.186 1.00 44.00  ? 325  LEU A N   1 
ATOM   1412 C  CA  . LEU A 1 189 ? 35.105  41.880 30.913 1.00 42.05  ? 325  LEU A CA  1 
ATOM   1413 C  C   . LEU A 1 189 ? 35.843  41.936 29.573 1.00 45.71  ? 325  LEU A C   1 
ATOM   1414 O  O   . LEU A 1 189 ? 36.991  41.492 29.474 1.00 43.03  ? 325  LEU A O   1 
ATOM   1415 C  CB  . LEU A 1 189 ? 34.223  40.628 30.979 1.00 36.81  ? 325  LEU A CB  1 
ATOM   1416 C  CG  . LEU A 1 189 ? 33.855  40.121 32.375 1.00 37.16  ? 325  LEU A CG  1 
ATOM   1417 C  CD1 . LEU A 1 189 ? 32.623  39.231 32.338 1.00 38.12  ? 325  LEU A CD1 1 
ATOM   1418 C  CD2 . LEU A 1 189 ? 35.025  39.370 32.984 1.00 30.04  ? 325  LEU A CD2 1 
ATOM   1419 N  N   . GLN A 1 190 ? 35.198  42.486 28.548 1.00 50.87  ? 326  GLN A N   1 
ATOM   1420 C  CA  . GLN A 1 190 ? 35.799  42.529 27.217 1.00 54.03  ? 326  GLN A CA  1 
ATOM   1421 C  C   . GLN A 1 190 ? 36.945  43.536 27.160 1.00 60.67  ? 326  GLN A C   1 
ATOM   1422 O  O   . GLN A 1 190 ? 37.755  43.513 26.233 1.00 64.14  ? 326  GLN A O   1 
ATOM   1423 C  CB  . GLN A 1 190 ? 34.745  42.823 26.140 1.00 54.72  ? 326  GLN A CB  1 
ATOM   1424 C  CG  . GLN A 1 190 ? 34.298  44.282 26.058 1.00 66.79  ? 326  GLN A CG  1 
ATOM   1425 C  CD  . GLN A 1 190 ? 33.024  44.459 25.246 1.00 74.56  ? 326  GLN A CD  1 
ATOM   1426 O  OE1 . GLN A 1 190 ? 32.709  43.652 24.372 1.00 79.83  ? 326  GLN A OE1 1 
ATOM   1427 N  NE2 . GLN A 1 190 ? 32.280  45.510 25.544 1.00 76.58  ? 326  GLN A NE2 1 
ATOM   1428 N  N   . MET A 1 191 ? 37.018  44.415 28.155 1.00 62.37  ? 327  MET A N   1 
ATOM   1429 C  CA  . MET A 1 191 ? 38.136  45.342 28.235 1.00 67.64  ? 327  MET A CA  1 
ATOM   1430 C  C   . MET A 1 191 ? 39.210  44.757 29.144 1.00 63.24  ? 327  MET A C   1 
ATOM   1431 O  O   . MET A 1 191 ? 40.254  45.368 29.360 1.00 66.09  ? 327  MET A O   1 
ATOM   1432 C  CB  . MET A 1 191 ? 37.685  46.724 28.720 1.00 73.90  ? 327  MET A CB  1 
ATOM   1433 C  CG  . MET A 1 191 ? 37.614  46.889 30.227 1.00 76.24  ? 327  MET A CG  1 
ATOM   1434 S  SD  . MET A 1 191 ? 37.347  48.611 30.694 1.00 88.86  ? 327  MET A SD  1 
ATOM   1435 C  CE  . MET A 1 191 ? 35.789  48.920 29.890 1.00 64.29  ? 327  MET A CE  1 
ATOM   1436 N  N   . GLY A 1 192 ? 38.951  43.561 29.664 1.00 55.43  ? 328  GLY A N   1 
ATOM   1437 C  CA  . GLY A 1 192 ? 39.904  42.890 30.527 1.00 53.69  ? 328  GLY A CA  1 
ATOM   1438 C  C   . GLY A 1 192 ? 39.735  43.293 31.977 1.00 56.47  ? 328  GLY A C   1 
ATOM   1439 O  O   . GLY A 1 192 ? 40.540  42.917 32.833 1.00 59.93  ? 328  GLY A O   1 
ATOM   1440 N  N   . GLY A 1 193 ? 38.684  44.059 32.254 1.00 53.75  ? 329  GLY A N   1 
ATOM   1441 C  CA  . GLY A 1 193 ? 38.394  44.480 33.612 1.00 47.82  ? 329  GLY A CA  1 
ATOM   1442 C  C   . GLY A 1 193 ? 37.532  43.496 34.386 1.00 46.09  ? 329  GLY A C   1 
ATOM   1443 O  O   . GLY A 1 193 ? 37.076  42.484 33.848 1.00 44.61  ? 329  GLY A O   1 
ATOM   1444 N  N   . VAL A 1 194 ? 37.301  43.801 35.658 1.00 46.69  ? 330  VAL A N   1 
ATOM   1445 C  CA  . VAL A 1 194 ? 36.472  42.959 36.512 1.00 50.79  ? 330  VAL A CA  1 
ATOM   1446 C  C   . VAL A 1 194 ? 35.457  43.820 37.270 1.00 53.55  ? 330  VAL A C   1 
ATOM   1447 O  O   . VAL A 1 194 ? 35.727  44.981 37.592 1.00 53.19  ? 330  VAL A O   1 
ATOM   1448 C  CB  . VAL A 1 194 ? 37.343  42.146 37.494 1.00 60.64  ? 330  VAL A CB  1 
ATOM   1449 C  CG1 . VAL A 1 194 ? 36.487  41.330 38.432 1.00 66.94  ? 330  VAL A CG1 1 
ATOM   1450 C  CG2 . VAL A 1 194 ? 38.280  41.227 36.730 1.00 66.89  ? 330  VAL A CG2 1 
ATOM   1451 N  N   . LEU A 1 195 ? 34.277  43.262 37.525 1.00 48.67  ? 331  LEU A N   1 
ATOM   1452 C  CA  . LEU A 1 195 ? 33.251  43.958 38.291 1.00 47.92  ? 331  LEU A CA  1 
ATOM   1453 C  C   . LEU A 1 195 ? 33.208  43.421 39.721 1.00 54.34  ? 331  LEU A C   1 
ATOM   1454 O  O   . LEU A 1 195 ? 33.149  42.201 39.933 1.00 49.18  ? 331  LEU A O   1 
ATOM   1455 C  CB  . LEU A 1 195 ? 31.891  43.776 37.611 1.00 47.48  ? 331  LEU A CB  1 
ATOM   1456 C  CG  . LEU A 1 195 ? 30.708  44.627 38.056 1.00 51.32  ? 331  LEU A CG  1 
ATOM   1457 C  CD1 . LEU A 1 195 ? 31.198  45.969 38.537 1.00 65.19  ? 331  LEU A CD1 1 
ATOM   1458 C  CD2 . LEU A 1 195 ? 29.753  44.813 36.890 1.00 52.01  ? 331  LEU A CD2 1 
ATOM   1459 N  N   . CYS A 1 196 ? 33.251  44.318 40.704 1.00 52.65  ? 332  CYS A N   1 
ATOM   1460 C  CA  . CYS A 1 196 ? 33.080  43.890 42.087 1.00 57.73  ? 332  CYS A CA  1 
ATOM   1461 C  C   . CYS A 1 196 ? 31.703  43.268 42.251 1.00 61.07  ? 332  CYS A C   1 
ATOM   1462 O  O   . CYS A 1 196 ? 30.712  43.835 41.789 1.00 57.81  ? 332  CYS A O   1 
ATOM   1463 C  CB  . CYS A 1 196 ? 33.229  45.051 43.065 1.00 59.37  ? 332  CYS A CB  1 
ATOM   1464 S  SG  . CYS A 1 196 ? 32.772  44.597 44.758 1.00 68.58  ? 332  CYS A SG  1 
ATOM   1465 N  N   . PRO A 1 197 ? 31.641  42.100 42.915 1.00 64.97  ? 333  PRO A N   1 
ATOM   1466 C  CA  . PRO A 1 197 ? 30.406  41.319 43.054 1.00 67.14  ? 333  PRO A CA  1 
ATOM   1467 C  C   . PRO A 1 197 ? 29.461  41.823 44.148 1.00 71.26  ? 333  PRO A C   1 
ATOM   1468 O  O   . PRO A 1 197 ? 28.248  41.663 43.992 1.00 71.58  ? 333  PRO A O   1 
ATOM   1469 C  CB  . PRO A 1 197 ? 30.922  39.916 43.399 1.00 65.89  ? 333  PRO A CB  1 
ATOM   1470 C  CG  . PRO A 1 197 ? 32.215  40.164 44.109 1.00 68.21  ? 333  PRO A CG  1 
ATOM   1471 C  CD  . PRO A 1 197 ? 32.811  41.393 43.470 1.00 67.67  ? 333  PRO A CD  1 
ATOM   1472 N  N   . ARG A 1 198 ? 29.996  42.406 45.222 1.00 71.79  ? 334  ARG A N   1 
ATOM   1473 C  CA  . ARG A 1 198 ? 29.162  42.955 46.297 1.00 73.58  ? 334  ARG A CA  1 
ATOM   1474 C  C   . ARG A 1 198 ? 28.187  44.000 45.760 1.00 79.65  ? 334  ARG A C   1 
ATOM   1475 O  O   . ARG A 1 198 ? 28.594  44.931 45.071 1.00 80.31  ? 334  ARG A O   1 
ATOM   1476 C  CB  . ARG A 1 198 ? 30.022  43.575 47.397 1.00 68.60  ? 334  ARG A CB  1 
ATOM   1477 N  N   . PRO A 1 199 ? 26.894  43.845 46.085 1.00 83.72  ? 335  PRO A N   1 
ATOM   1478 C  CA  . PRO A 1 199 ? 25.787  44.632 45.524 1.00 82.84  ? 335  PRO A CA  1 
ATOM   1479 C  C   . PRO A 1 199 ? 25.927  46.143 45.711 1.00 84.78  ? 335  PRO A C   1 
ATOM   1480 O  O   . PRO A 1 199 ? 25.737  46.884 44.745 1.00 87.03  ? 335  PRO A O   1 
ATOM   1481 C  CB  . PRO A 1 199 ? 24.568  44.123 46.299 1.00 85.24  ? 335  PRO A CB  1 
ATOM   1482 C  CG  . PRO A 1 199 ? 24.955  42.760 46.761 1.00 85.19  ? 335  PRO A CG  1 
ATOM   1483 C  CD  . PRO A 1 199 ? 26.419  42.852 47.063 1.00 86.50  ? 335  PRO A CD  1 
ATOM   1484 N  N   . GLY A 1 200 ? 26.233  46.590 46.925 1.00 85.40  ? 336  GLY A N   1 
ATOM   1485 C  CA  . GLY A 1 200 ? 26.416  48.009 47.184 1.00 86.55  ? 336  GLY A CA  1 
ATOM   1486 C  C   . GLY A 1 200 ? 27.526  48.597 46.334 1.00 82.55  ? 336  GLY A C   1 
ATOM   1487 O  O   . GLY A 1 200 ? 27.313  49.533 45.558 1.00 82.09  ? 336  GLY A O   1 
ATOM   1488 N  N   . CYS A 1 201 ? 28.718  48.030 46.473 1.00 75.10  ? 337  CYS A N   1 
ATOM   1489 C  CA  . CYS A 1 201 ? 29.849  48.436 45.657 1.00 68.34  ? 337  CYS A CA  1 
ATOM   1490 C  C   . CYS A 1 201 ? 29.800  47.803 44.268 1.00 71.86  ? 337  CYS A C   1 
ATOM   1491 O  O   . CYS A 1 201 ? 30.291  46.690 44.064 1.00 80.28  ? 337  CYS A O   1 
ATOM   1492 C  CB  . CYS A 1 201 ? 31.149  48.053 46.350 1.00 62.33  ? 337  CYS A CB  1 
ATOM   1493 S  SG  . CYS A 1 201 ? 32.568  48.360 45.331 1.00 73.24  ? 337  CYS A SG  1 
ATOM   1494 N  N   . GLY A 1 202 ? 29.213  48.505 43.306 1.00 64.95  ? 338  GLY A N   1 
ATOM   1495 C  CA  . GLY A 1 202 ? 29.175  47.998 41.945 1.00 64.56  ? 338  GLY A CA  1 
ATOM   1496 C  C   . GLY A 1 202 ? 30.385  48.467 41.161 1.00 65.30  ? 338  GLY A C   1 
ATOM   1497 O  O   . GLY A 1 202 ? 30.313  48.656 39.947 1.00 67.51  ? 338  GLY A O   1 
ATOM   1498 N  N   . ALA A 1 203 ? 31.504  48.639 41.862 1.00 63.68  ? 339  ALA A N   1 
ATOM   1499 C  CA  . ALA A 1 203 ? 32.679  49.296 41.296 1.00 58.86  ? 339  ALA A CA  1 
ATOM   1500 C  C   . ALA A 1 203 ? 33.445  48.472 40.271 1.00 55.05  ? 339  ALA A C   1 
ATOM   1501 O  O   . ALA A 1 203 ? 33.736  47.293 40.487 1.00 52.72  ? 339  ALA A O   1 
ATOM   1502 C  CB  . ALA A 1 203 ? 33.615  49.756 42.397 1.00 62.97  ? 339  ALA A CB  1 
ATOM   1503 N  N   . GLY A 1 204 ? 33.777  49.117 39.158 1.00 49.97  ? 340  GLY A N   1 
ATOM   1504 C  CA  . GLY A 1 204 ? 34.637  48.518 38.159 1.00 52.28  ? 340  GLY A CA  1 
ATOM   1505 C  C   . GLY A 1 204 ? 36.067  48.504 38.649 1.00 58.08  ? 340  GLY A C   1 
ATOM   1506 O  O   . GLY A 1 204 ? 36.483  49.393 39.389 1.00 59.61  ? 340  GLY A O   1 
ATOM   1507 N  N   . LEU A 1 205 ? 36.815  47.482 38.248 1.00 60.94  ? 341  LEU A N   1 
ATOM   1508 C  CA  . LEU A 1 205 ? 38.173  47.287 38.735 1.00 62.05  ? 341  LEU A CA  1 
ATOM   1509 C  C   . LEU A 1 205 ? 39.070  46.725 37.644 1.00 63.26  ? 341  LEU A C   1 
ATOM   1510 O  O   . LEU A 1 205 ? 38.666  45.834 36.896 1.00 62.62  ? 341  LEU A O   1 
ATOM   1511 C  CB  . LEU A 1 205 ? 38.171  46.325 39.920 1.00 60.75  ? 341  LEU A CB  1 
ATOM   1512 C  CG  . LEU A 1 205 ? 37.301  46.700 41.113 1.00 58.79  ? 341  LEU A CG  1 
ATOM   1513 C  CD1 . LEU A 1 205 ? 36.853  45.440 41.812 1.00 54.78  ? 341  LEU A CD1 1 
ATOM   1514 C  CD2 . LEU A 1 205 ? 38.051  47.628 42.060 1.00 57.83  ? 341  LEU A CD2 1 
ATOM   1515 N  N   . LEU A 1 206 ? 40.292  47.239 37.560 1.00 69.57  ? 342  LEU A N   1 
ATOM   1516 C  CA  . LEU A 1 206 ? 41.279  46.698 36.633 1.00 75.86  ? 342  LEU A CA  1 
ATOM   1517 C  C   . LEU A 1 206 ? 42.451  46.050 37.381 1.00 81.03  ? 342  LEU A C   1 
ATOM   1518 O  O   . LEU A 1 206 ? 43.183  46.722 38.110 1.00 90.35  ? 342  LEU A O   1 
ATOM   1519 C  CB  . LEU A 1 206 ? 41.771  47.773 35.649 1.00 83.91  ? 342  LEU A CB  1 
ATOM   1520 C  CG  . LEU A 1 206 ? 42.733  48.892 36.080 1.00 97.93  ? 342  LEU A CG  1 
ATOM   1521 C  CD1 . LEU A 1 206 ? 43.236  49.688 34.880 1.00 100.84 ? 342  LEU A CD1 1 
ATOM   1522 C  CD2 . LEU A 1 206 ? 42.122  49.821 37.131 1.00 101.86 ? 342  LEU A CD2 1 
ATOM   1523 N  N   . PRO A 1 207 ? 42.600  44.724 37.243 1.00 72.79  ? 343  PRO A N   1 
ATOM   1524 C  CA  . PRO A 1 207 ? 43.806  44.047 37.730 1.00 72.95  ? 343  PRO A CA  1 
ATOM   1525 C  C   . PRO A 1 207 ? 44.686  43.548 36.577 1.00 76.39  ? 343  PRO A C   1 
ATOM   1526 O  O   . PRO A 1 207 ? 44.310  43.702 35.412 1.00 72.61  ? 343  PRO A O   1 
ATOM   1527 C  CB  . PRO A 1 207 ? 43.228  42.868 38.509 1.00 70.34  ? 343  PRO A CB  1 
ATOM   1528 C  CG  . PRO A 1 207 ? 41.944  42.528 37.768 1.00 62.31  ? 343  PRO A CG  1 
ATOM   1529 C  CD  . PRO A 1 207 ? 41.488  43.778 37.032 1.00 63.07  ? 343  PRO A CD  1 
ATOM   1530 N  N   . GLU A 1 208 ? 45.845  42.973 36.896 1.00 87.34  ? 344  GLU A N   1 
ATOM   1531 C  CA  . GLU A 1 208 ? 46.718  42.388 35.876 1.00 91.81  ? 344  GLU A CA  1 
ATOM   1532 C  C   . GLU A 1 208 ? 46.156  41.040 35.435 1.00 98.77  ? 344  GLU A C   1 
ATOM   1533 O  O   . GLU A 1 208 ? 45.690  40.264 36.269 1.00 99.27  ? 344  GLU A O   1 
ATOM   1534 C  CB  . GLU A 1 208 ? 48.140  42.217 36.411 1.00 89.47  ? 344  GLU A CB  1 
ATOM   1535 N  N   . PRO A 1 209 ? 46.201  40.757 34.120 1.00 103.01 ? 345  PRO A N   1 
ATOM   1536 C  CA  . PRO A 1 209 ? 45.556  39.571 33.537 1.00 103.49 ? 345  PRO A CA  1 
ATOM   1537 C  C   . PRO A 1 209 ? 46.128  38.251 34.052 1.00 107.59 ? 345  PRO A C   1 
ATOM   1538 O  O   . PRO A 1 209 ? 45.518  37.200 33.838 1.00 109.31 ? 345  PRO A O   1 
ATOM   1539 C  CB  . PRO A 1 209 ? 45.845  39.713 32.038 1.00 103.40 ? 345  PRO A CB  1 
ATOM   1540 C  CG  . PRO A 1 209 ? 46.175  41.157 31.836 1.00 105.58 ? 345  PRO A CG  1 
ATOM   1541 C  CD  . PRO A 1 209 ? 46.872  41.574 33.094 1.00 106.19 ? 345  PRO A CD  1 
ATOM   1542 N  N   . ASP A 1 210 ? 47.284  38.311 34.710 1.00 106.26 ? 346  ASP A N   1 
ATOM   1543 C  CA  . ASP A 1 210 ? 47.912  37.130 35.297 1.00 102.47 ? 346  ASP A CA  1 
ATOM   1544 C  C   . ASP A 1 210 ? 47.281  36.758 36.641 1.00 98.90  ? 346  ASP A C   1 
ATOM   1545 O  O   . ASP A 1 210 ? 46.983  35.592 36.895 1.00 96.28  ? 346  ASP A O   1 
ATOM   1546 C  CB  . ASP A 1 210 ? 49.417  37.354 35.468 1.00 101.57 ? 346  ASP A CB  1 
ATOM   1547 N  N   . GLN A 1 211 ? 47.076  37.759 37.493 1.00 99.79  ? 347  GLN A N   1 
ATOM   1548 C  CA  . GLN A 1 211 ? 46.513  37.546 38.826 1.00 98.11  ? 347  GLN A CA  1 
ATOM   1549 C  C   . GLN A 1 211 ? 45.058  37.084 38.771 1.00 91.87  ? 347  GLN A C   1 
ATOM   1550 O  O   . GLN A 1 211 ? 44.292  37.507 37.901 1.00 87.66  ? 347  GLN A O   1 
ATOM   1551 C  CB  . GLN A 1 211 ? 46.601  38.837 39.643 1.00 101.31 ? 347  GLN A CB  1 
ATOM   1552 C  CG  . GLN A 1 211 ? 47.060  38.645 41.082 1.00 107.81 ? 347  GLN A CG  1 
ATOM   1553 C  CD  . GLN A 1 211 ? 48.571  38.545 41.208 1.00 115.21 ? 347  GLN A CD  1 
ATOM   1554 O  OE1 . GLN A 1 211 ? 49.284  38.420 40.213 1.00 115.89 ? 347  GLN A OE1 1 
ATOM   1555 N  NE2 . GLN A 1 211 ? 49.065  38.608 42.439 1.00 120.03 ? 347  GLN A NE2 1 
ATOM   1556 N  N   . ARG A 1 212 ? 44.682  36.220 39.708 1.00 86.64  ? 348  ARG A N   1 
ATOM   1557 C  CA  . ARG A 1 212 ? 43.297  35.785 39.836 1.00 74.72  ? 348  ARG A CA  1 
ATOM   1558 C  C   . ARG A 1 212 ? 42.647  36.479 41.033 1.00 72.72  ? 348  ARG A C   1 
ATOM   1559 O  O   . ARG A 1 212 ? 41.437  36.711 41.053 1.00 67.63  ? 348  ARG A O   1 
ATOM   1560 C  CB  . ARG A 1 212 ? 43.217  34.263 39.977 1.00 70.99  ? 348  ARG A CB  1 
ATOM   1561 C  CG  . ARG A 1 212 ? 42.135  33.624 39.117 1.00 68.50  ? 348  ARG A CG  1 
ATOM   1562 C  CD  . ARG A 1 212 ? 41.930  32.156 39.461 1.00 69.38  ? 348  ARG A CD  1 
ATOM   1563 N  NE  . ARG A 1 212 ? 41.569  31.972 40.864 1.00 72.69  ? 348  ARG A NE  1 
ATOM   1564 C  CZ  . ARG A 1 212 ? 42.351  31.392 41.769 1.00 76.47  ? 348  ARG A CZ  1 
ATOM   1565 N  NH1 . ARG A 1 212 ? 43.542  30.928 41.417 1.00 82.65  ? 348  ARG A NH1 1 
ATOM   1566 N  NH2 . ARG A 1 212 ? 41.942  31.267 43.025 1.00 75.30  ? 348  ARG A NH2 1 
ATOM   1567 N  N   . LYS A 1 213 ? 43.460  36.822 42.026 1.00 76.59  ? 349  LYS A N   1 
ATOM   1568 C  CA  . LYS A 1 213 ? 42.972  37.561 43.184 1.00 75.38  ? 349  LYS A CA  1 
ATOM   1569 C  C   . LYS A 1 213 ? 42.864  39.049 42.865 1.00 75.26  ? 349  LYS A C   1 
ATOM   1570 O  O   . LYS A 1 213 ? 43.802  39.643 42.338 1.00 76.38  ? 349  LYS A O   1 
ATOM   1571 C  CB  . LYS A 1 213 ? 43.906  37.366 44.376 1.00 76.46  ? 349  LYS A CB  1 
ATOM   1572 C  CG  . LYS A 1 213 ? 43.412  38.014 45.656 1.00 80.40  ? 349  LYS A CG  1 
ATOM   1573 C  CD  . LYS A 1 213 ? 44.435  37.849 46.772 1.00 91.95  ? 349  LYS A CD  1 
ATOM   1574 C  CE  . LYS A 1 213 ? 44.024  38.596 48.034 1.00 93.50  ? 349  LYS A CE  1 
ATOM   1575 N  NZ  . LYS A 1 213 ? 45.075  38.533 49.093 1.00 95.10  ? 349  LYS A NZ  1 
ATOM   1576 N  N   . VAL A 1 214 ? 41.714  39.641 43.177 1.00 72.96  ? 350  VAL A N   1 
ATOM   1577 C  CA  . VAL A 1 214 ? 41.515  41.077 43.008 1.00 76.29  ? 350  VAL A CA  1 
ATOM   1578 C  C   . VAL A 1 214 ? 40.806  41.666 44.229 1.00 77.16  ? 350  VAL A C   1 
ATOM   1579 O  O   . VAL A 1 214 ? 39.916  41.032 44.803 1.00 71.26  ? 350  VAL A O   1 
ATOM   1580 C  CB  . VAL A 1 214 ? 40.776  41.421 41.671 1.00 68.87  ? 350  VAL A CB  1 
ATOM   1581 C  CG1 . VAL A 1 214 ? 40.200  40.176 41.035 1.00 52.32  ? 350  VAL A CG1 1 
ATOM   1582 C  CG2 . VAL A 1 214 ? 39.692  42.467 41.885 1.00 64.21  ? 350  VAL A CG2 1 
ATOM   1583 N  N   . THR A 1 215 ? 41.227  42.866 44.629 1.00 79.89  ? 351  THR A N   1 
ATOM   1584 C  CA  . THR A 1 215 ? 40.713  43.519 45.830 1.00 81.75  ? 351  THR A CA  1 
ATOM   1585 C  C   . THR A 1 215 ? 39.959  44.808 45.489 1.00 85.58  ? 351  THR A C   1 
ATOM   1586 O  O   . THR A 1 215 ? 40.319  45.519 44.545 1.00 85.13  ? 351  THR A O   1 
ATOM   1587 C  CB  . THR A 1 215 ? 41.860  43.850 46.807 1.00 84.16  ? 351  THR A CB  1 
ATOM   1588 O  OG1 . THR A 1 215 ? 42.810  42.775 46.823 1.00 85.85  ? 351  THR A OG1 1 
ATOM   1589 C  CG2 . THR A 1 215 ? 41.321  44.072 48.210 1.00 84.85  ? 351  THR A CG2 1 
ATOM   1590 N  N   . CYS A 1 216 ? 38.917  45.108 46.263 1.00 88.92  ? 352  CYS A N   1 
ATOM   1591 C  CA  . CYS A 1 216 ? 38.110  46.307 46.047 1.00 90.79  ? 352  CYS A CA  1 
ATOM   1592 C  C   . CYS A 1 216 ? 37.681  46.960 47.363 1.00 96.99  ? 352  CYS A C   1 
ATOM   1593 O  O   . CYS A 1 216 ? 37.993  46.459 48.447 1.00 105.64 ? 352  CYS A O   1 
ATOM   1594 C  CB  . CYS A 1 216 ? 36.895  45.965 45.191 1.00 87.84  ? 352  CYS A CB  1 
ATOM   1595 S  SG  . CYS A 1 216 ? 35.319  46.536 45.812 1.00 76.51  ? 352  CYS A SG  1 
ATOM   1596 N  N   . GLU A 1 217 ? 36.971  48.080 47.267 1.00 89.08  ? 353  GLU A N   1 
ATOM   1597 C  CA  . GLU A 1 217 ? 36.551  48.811 48.459 1.00 85.28  ? 353  GLU A CA  1 
ATOM   1598 C  C   . GLU A 1 217 ? 35.482  48.049 49.249 1.00 77.07  ? 353  GLU A C   1 
ATOM   1599 O  O   . GLU A 1 217 ? 35.797  47.248 50.142 1.00 72.31  ? 353  GLU A O   1 
ATOM   1600 C  CB  . GLU A 1 217 ? 36.071  50.222 48.089 1.00 79.94  ? 353  GLU A CB  1 
ATOM   1601 N  N   . PHE A 1 226 ? 35.769  44.107 48.346 1.00 102.97 ? 362  PHE A N   1 
ATOM   1602 C  CA  . PHE A 1 226 ? 36.494  43.222 49.251 1.00 98.42  ? 362  PHE A CA  1 
ATOM   1603 C  C   . PHE A 1 226 ? 37.445  42.275 48.518 1.00 85.33  ? 362  PHE A C   1 
ATOM   1604 O  O   . PHE A 1 226 ? 37.850  42.534 47.385 1.00 78.02  ? 362  PHE A O   1 
ATOM   1605 C  CB  . PHE A 1 226 ? 35.521  42.430 50.132 1.00 102.17 ? 362  PHE A CB  1 
ATOM   1606 C  CG  . PHE A 1 226 ? 34.480  41.660 49.368 1.00 101.02 ? 362  PHE A CG  1 
ATOM   1607 C  CD1 . PHE A 1 226 ? 34.791  40.456 48.751 1.00 104.36 ? 362  PHE A CD1 1 
ATOM   1608 C  CD2 . PHE A 1 226 ? 33.180  42.125 49.293 1.00 98.67  ? 362  PHE A CD2 1 
ATOM   1609 C  CE1 . PHE A 1 226 ? 33.832  39.742 48.058 1.00 101.57 ? 362  PHE A CE1 1 
ATOM   1610 C  CE2 . PHE A 1 226 ? 32.216  41.414 48.605 1.00 97.72  ? 362  PHE A CE2 1 
ATOM   1611 C  CZ  . PHE A 1 226 ? 32.542  40.222 47.985 1.00 98.67  ? 362  PHE A CZ  1 
ATOM   1612 N  N   . ALA A 1 227 ? 37.809  41.182 49.178 1.00 80.24  ? 363  ALA A N   1 
ATOM   1613 C  CA  . ALA A 1 227 ? 38.673  40.180 48.572 1.00 76.88  ? 363  ALA A CA  1 
ATOM   1614 C  C   . ALA A 1 227 ? 37.832  39.161 47.809 1.00 77.55  ? 363  ALA A C   1 
ATOM   1615 O  O   . ALA A 1 227 ? 37.046  38.430 48.409 1.00 81.67  ? 363  ALA A O   1 
ATOM   1616 C  CB  . ALA A 1 227 ? 39.497  39.490 49.643 1.00 77.67  ? 363  ALA A CB  1 
ATOM   1617 N  N   . PHE A 1 228 ? 37.987  39.107 46.489 1.00 71.40  ? 364  PHE A N   1 
ATOM   1618 C  CA  . PHE A 1 228 ? 37.244  38.122 45.707 1.00 67.15  ? 364  PHE A CA  1 
ATOM   1619 C  C   . PHE A 1 228 ? 38.052  37.488 44.583 1.00 65.41  ? 364  PHE A C   1 
ATOM   1620 O  O   . PHE A 1 228 ? 39.117  37.980 44.203 1.00 54.95  ? 364  PHE A O   1 
ATOM   1621 C  CB  . PHE A 1 228 ? 35.932  38.703 45.167 1.00 64.12  ? 364  PHE A CB  1 
ATOM   1622 C  CG  . PHE A 1 228 ? 36.107  39.658 44.022 1.00 64.91  ? 364  PHE A CG  1 
ATOM   1623 C  CD1 . PHE A 1 228 ? 36.264  41.017 44.256 1.00 65.21  ? 364  PHE A CD1 1 
ATOM   1624 C  CD2 . PHE A 1 228 ? 36.090  39.205 42.710 1.00 65.54  ? 364  PHE A CD2 1 
ATOM   1625 C  CE1 . PHE A 1 228 ? 36.416  41.908 43.202 1.00 64.99  ? 364  PHE A CE1 1 
ATOM   1626 C  CE2 . PHE A 1 228 ? 36.244  40.087 41.651 1.00 65.10  ? 364  PHE A CE2 1 
ATOM   1627 C  CZ  . PHE A 1 228 ? 36.404  41.443 41.899 1.00 63.59  ? 364  PHE A CZ  1 
ATOM   1628 N  N   . CYS A 1 229 ? 37.527  36.382 44.068 1.00 51.82  ? 365  CYS A N   1 
ATOM   1629 C  CA  . CYS A 1 229 ? 38.164  35.638 42.991 1.00 53.53  ? 365  CYS A CA  1 
ATOM   1630 C  C   . CYS A 1 229 ? 37.669  36.100 41.629 1.00 54.72  ? 365  CYS A C   1 
ATOM   1631 O  O   . CYS A 1 229 ? 36.471  36.289 41.421 1.00 51.06  ? 365  CYS A O   1 
ATOM   1632 C  CB  . CYS A 1 229 ? 37.885  34.144 43.140 1.00 51.94  ? 365  CYS A CB  1 
ATOM   1633 S  SG  . CYS A 1 229 ? 38.408  33.193 41.710 1.00 53.99  ? 365  CYS A SG  1 
ATOM   1634 N  N   . ARG A 1 230 ? 38.600  36.247 40.697 1.00 63.08  ? 366  ARG A N   1 
ATOM   1635 C  CA  . ARG A 1 230 ? 38.308  36.776 39.371 1.00 63.77  ? 366  ARG A CA  1 
ATOM   1636 C  C   . ARG A 1 230 ? 37.368  35.873 38.563 1.00 62.00  ? 366  ARG A C   1 
ATOM   1637 O  O   . ARG A 1 230 ? 36.369  36.338 38.009 1.00 56.33  ? 366  ARG A O   1 
ATOM   1638 C  CB  . ARG A 1 230 ? 39.623  36.956 38.624 1.00 65.71  ? 366  ARG A CB  1 
ATOM   1639 C  CG  . ARG A 1 230 ? 39.554  37.800 37.386 1.00 68.85  ? 366  ARG A CG  1 
ATOM   1640 C  CD  . ARG A 1 230 ? 40.919  37.841 36.729 1.00 68.30  ? 366  ARG A CD  1 
ATOM   1641 N  NE  . ARG A 1 230 ? 40.843  38.293 35.345 1.00 69.88  ? 366  ARG A NE  1 
ATOM   1642 C  CZ  . ARG A 1 230 ? 41.451  39.376 34.875 1.00 74.00  ? 366  ARG A CZ  1 
ATOM   1643 N  NH1 . ARG A 1 230 ? 42.194  40.124 35.677 1.00 79.42  ? 366  ARG A NH1 1 
ATOM   1644 N  NH2 . ARG A 1 230 ? 41.324  39.704 33.599 1.00 75.30  ? 366  ARG A NH2 1 
ATOM   1645 N  N   . GLU A 1 231 ? 37.695  34.585 38.508 1.00 58.56  ? 367  GLU A N   1 
ATOM   1646 C  CA  . GLU A 1 231 ? 36.974  33.633 37.671 1.00 52.93  ? 367  GLU A CA  1 
ATOM   1647 C  C   . GLU A 1 231 ? 35.624  33.255 38.271 1.00 56.10  ? 367  GLU A C   1 
ATOM   1648 O  O   . GLU A 1 231 ? 34.639  33.061 37.556 1.00 56.96  ? 367  GLU A O   1 
ATOM   1649 C  CB  . GLU A 1 231 ? 37.812  32.367 37.489 1.00 55.75  ? 367  GLU A CB  1 
ATOM   1650 C  CG  . GLU A 1 231 ? 39.264  32.612 37.109 1.00 63.39  ? 367  GLU A CG  1 
ATOM   1651 C  CD  . GLU A 1 231 ? 39.440  32.966 35.647 1.00 74.00  ? 367  GLU A CD  1 
ATOM   1652 O  OE1 . GLU A 1 231 ? 38.437  32.933 34.902 1.00 74.42  ? 367  GLU A OE1 1 
ATOM   1653 O  OE2 . GLU A 1 231 ? 40.584  33.271 35.241 1.00 82.31  ? 367  GLU A OE2 1 
ATOM   1654 N  N   . CYS A 1 232 ? 35.590  33.159 39.593 1.00 54.87  ? 368  CYS A N   1 
ATOM   1655 C  CA  . CYS A 1 232 ? 34.426  32.655 40.311 1.00 56.60  ? 368  CYS A CA  1 
ATOM   1656 C  C   . CYS A 1 232 ? 33.511  33.785 40.814 1.00 56.75  ? 368  CYS A C   1 
ATOM   1657 O  O   . CYS A 1 232 ? 32.309  33.580 41.018 1.00 54.19  ? 368  CYS A O   1 
ATOM   1658 C  CB  . CYS A 1 232 ? 34.906  31.760 41.465 1.00 44.79  ? 368  CYS A CB  1 
ATOM   1659 S  SG  . CYS A 1 232 ? 33.987  31.865 42.984 1.00 83.14  ? 368  CYS A SG  1 
ATOM   1660 N  N   . LYS A 1 233 ? 34.089  34.970 41.002 1.00 54.48  ? 369  LYS A N   1 
ATOM   1661 C  CA  . LYS A 1 233 ? 33.362  36.150 41.490 1.00 49.96  ? 369  LYS A CA  1 
ATOM   1662 C  C   . LYS A 1 233 ? 32.829  36.018 42.922 1.00 57.70  ? 369  LYS A C   1 
ATOM   1663 O  O   . LYS A 1 233 ? 32.059  36.867 43.372 1.00 61.33  ? 369  LYS A O   1 
ATOM   1664 C  CB  . LYS A 1 233 ? 32.241  36.573 40.525 1.00 44.52  ? 369  LYS A CB  1 
ATOM   1665 C  CG  . LYS A 1 233 ? 32.689  36.798 39.077 1.00 47.24  ? 369  LYS A CG  1 
ATOM   1666 C  CD  . LYS A 1 233 ? 33.687  37.938 38.971 1.00 51.50  ? 369  LYS A CD  1 
ATOM   1667 C  CE  . LYS A 1 233 ? 33.164  39.192 39.660 1.00 53.98  ? 369  LYS A CE  1 
ATOM   1668 N  NZ  . LYS A 1 233 ? 31.975  39.789 38.975 1.00 51.94  ? 369  LYS A NZ  1 
ATOM   1669 N  N   . GLU A 1 234 ? 33.235  34.966 43.635 1.00 57.89  ? 370  GLU A N   1 
ATOM   1670 C  CA  . GLU A 1 234 ? 32.956  34.881 45.069 1.00 60.28  ? 370  GLU A CA  1 
ATOM   1671 C  C   . GLU A 1 234 ? 34.195  35.268 45.867 1.00 66.08  ? 370  GLU A C   1 
ATOM   1672 O  O   . GLU A 1 234 ? 35.226  35.613 45.290 1.00 70.39  ? 370  GLU A O   1 
ATOM   1673 C  CB  . GLU A 1 234 ? 32.491  33.481 45.473 1.00 65.38  ? 370  GLU A CB  1 
ATOM   1674 N  N   . ALA A 1 235 ? 34.084  35.219 47.192 1.00 63.29  ? 371  ALA A N   1 
ATOM   1675 C  CA  . ALA A 1 235 ? 35.210  35.505 48.079 1.00 66.27  ? 371  ALA A CA  1 
ATOM   1676 C  C   . ALA A 1 235 ? 36.439  34.726 47.626 1.00 69.87  ? 371  ALA A C   1 
ATOM   1677 O  O   . ALA A 1 235 ? 36.319  33.559 47.253 1.00 67.99  ? 371  ALA A O   1 
ATOM   1678 C  CB  . ALA A 1 235 ? 34.851  35.142 49.512 1.00 65.02  ? 371  ALA A CB  1 
ATOM   1679 N  N   . TYR A 1 236 ? 37.607  35.370 47.633 1.00 69.71  ? 372  TYR A N   1 
ATOM   1680 C  CA  . TYR A 1 236 ? 38.829  34.722 47.153 1.00 72.84  ? 372  TYR A CA  1 
ATOM   1681 C  C   . TYR A 1 236 ? 39.052  33.376 47.841 1.00 75.46  ? 372  TYR A C   1 
ATOM   1682 O  O   . TYR A 1 236 ? 38.809  33.243 49.038 1.00 77.76  ? 372  TYR A O   1 
ATOM   1683 C  CB  . TYR A 1 236 ? 40.053  35.623 47.347 1.00 74.54  ? 372  TYR A CB  1 
ATOM   1684 C  CG  . TYR A 1 236 ? 41.333  34.992 46.842 1.00 79.71  ? 372  TYR A CG  1 
ATOM   1685 C  CD1 . TYR A 1 236 ? 41.548  34.812 45.483 1.00 79.52  ? 372  TYR A CD1 1 
ATOM   1686 C  CD2 . TYR A 1 236 ? 42.320  34.567 47.721 1.00 86.45  ? 372  TYR A CD2 1 
ATOM   1687 C  CE1 . TYR A 1 236 ? 42.705  34.230 45.011 1.00 84.25  ? 372  TYR A CE1 1 
ATOM   1688 C  CE2 . TYR A 1 236 ? 43.486  33.985 47.257 1.00 90.38  ? 372  TYR A CE2 1 
ATOM   1689 C  CZ  . TYR A 1 236 ? 43.672  33.821 45.899 1.00 91.11  ? 372  TYR A CZ  1 
ATOM   1690 O  OH  . TYR A 1 236 ? 44.825  33.243 45.418 1.00 97.28  ? 372  TYR A OH  1 
ATOM   1691 N  N   . HIS A 1 237 ? 39.488  32.381 47.071 1.00 74.40  ? 373  HIS A N   1 
ATOM   1692 C  CA  . HIS A 1 237 ? 39.720  31.036 47.597 1.00 72.70  ? 373  HIS A CA  1 
ATOM   1693 C  C   . HIS A 1 237 ? 41.121  30.552 47.245 1.00 77.94  ? 373  HIS A C   1 
ATOM   1694 O  O   . HIS A 1 237 ? 41.733  31.036 46.288 1.00 70.12  ? 373  HIS A O   1 
ATOM   1695 C  CB  . HIS A 1 237 ? 38.674  30.059 47.062 1.00 69.73  ? 373  HIS A CB  1 
ATOM   1696 C  CG  . HIS A 1 237 ? 38.537  30.090 45.574 1.00 66.34  ? 373  HIS A CG  1 
ATOM   1697 N  ND1 . HIS A 1 237 ? 39.384  29.399 44.735 1.00 68.21  ? 373  HIS A ND1 1 
ATOM   1698 C  CD2 . HIS A 1 237 ? 37.668  30.751 44.774 1.00 61.94  ? 373  HIS A CD2 1 
ATOM   1699 C  CE1 . HIS A 1 237 ? 39.037  29.626 43.480 1.00 68.39  ? 373  HIS A CE1 1 
ATOM   1700 N  NE2 . HIS A 1 237 ? 38.000  30.444 43.478 1.00 66.89  ? 373  HIS A NE2 1 
ATOM   1701 N  N   . GLU A 1 238 ? 41.606  29.575 48.009 1.00 90.52  ? 374  GLU A N   1 
ATOM   1702 C  CA  . GLU A 1 238 ? 43.022  29.211 48.009 1.00 99.93  ? 374  GLU A CA  1 
ATOM   1703 C  C   . GLU A 1 238 ? 43.485  28.313 46.861 1.00 101.00 ? 374  GLU A C   1 
ATOM   1704 O  O   . GLU A 1 238 ? 44.683  28.243 46.582 1.00 109.11 ? 374  GLU A O   1 
ATOM   1705 C  CB  . GLU A 1 238 ? 43.394  28.559 49.346 1.00 103.33 ? 374  GLU A CB  1 
ATOM   1706 N  N   . GLY A 1 239 ? 42.556  27.629 46.200 1.00 91.78  ? 375  GLY A N   1 
ATOM   1707 C  CA  . GLY A 1 239 ? 42.939  26.623 45.224 1.00 91.92  ? 375  GLY A CA  1 
ATOM   1708 C  C   . GLY A 1 239 ? 42.210  26.685 43.899 1.00 87.28  ? 375  GLY A C   1 
ATOM   1709 O  O   . GLY A 1 239 ? 42.657  27.353 42.965 1.00 90.82  ? 375  GLY A O   1 
ATOM   1710 N  N   . GLU A 1 240 ? 41.089  25.977 43.810 1.00 76.85  ? 376  GLU A N   1 
ATOM   1711 C  CA  . GLU A 1 240 ? 40.326  25.927 42.569 1.00 71.06  ? 376  GLU A CA  1 
ATOM   1712 C  C   . GLU A 1 240 ? 38.862  26.306 42.778 1.00 65.19  ? 376  GLU A C   1 
ATOM   1713 O  O   . GLU A 1 240 ? 38.291  26.052 43.840 1.00 64.83  ? 376  GLU A O   1 
ATOM   1714 C  CB  . GLU A 1 240 ? 40.431  24.537 41.940 1.00 72.87  ? 376  GLU A CB  1 
ATOM   1715 C  CG  . GLU A 1 240 ? 40.894  24.554 40.492 1.00 79.06  ? 376  GLU A CG  1 
ATOM   1716 C  CD  . GLU A 1 240 ? 41.546  23.251 40.074 1.00 93.62  ? 376  GLU A CD  1 
ATOM   1717 O  OE1 . GLU A 1 240 ? 40.822  22.336 39.624 1.00 94.09  ? 376  GLU A OE1 1 
ATOM   1718 O  OE2 . GLU A 1 240 ? 42.785  23.142 40.196 1.00 103.65 ? 376  GLU A OE2 1 
ATOM   1719 N  N   . CYS A 1 241 ? 38.261  26.918 41.760 1.00 55.08  ? 377  CYS A N   1 
ATOM   1720 C  CA  . CYS A 1 241 ? 36.860  27.322 41.822 1.00 51.84  ? 377  CYS A CA  1 
ATOM   1721 C  C   . CYS A 1 241 ? 35.955  26.086 41.888 1.00 51.05  ? 377  CYS A C   1 
ATOM   1722 O  O   . CYS A 1 241 ? 36.430  24.959 41.728 1.00 52.71  ? 377  CYS A O   1 
ATOM   1723 C  CB  . CYS A 1 241 ? 36.507  28.188 40.611 1.00 48.85  ? 377  CYS A CB  1 
ATOM   1724 S  SG  . CYS A 1 241 ? 37.612  29.640 40.368 1.00 49.87  ? 377  CYS A SG  1 
ATOM   1725 N  N   . SER A 1 242 ? 34.662  26.298 42.140 1.00 48.74  ? 378  SER A N   1 
ATOM   1726 C  CA  . SER A 1 242 ? 33.694  25.199 42.206 1.00 47.97  ? 378  SER A CA  1 
ATOM   1727 C  C   . SER A 1 242 ? 33.748  24.324 40.972 1.00 47.43  ? 378  SER A C   1 
ATOM   1728 O  O   . SER A 1 242 ? 33.841  24.824 39.848 1.00 45.35  ? 378  SER A O   1 
ATOM   1729 C  CB  . SER A 1 242 ? 32.267  25.718 42.390 1.00 46.09  ? 378  SER A CB  1 
ATOM   1730 O  OG  . SER A 1 242 ? 31.949  25.854 43.761 1.00 53.96  ? 378  SER A OG  1 
ATOM   1731 N  N   . ALA A 1 243 ? 33.677  23.017 41.191 1.00 48.35  ? 379  ALA A N   1 
ATOM   1732 C  CA  . ALA A 1 243 ? 33.817  22.046 40.115 1.00 49.82  ? 379  ALA A CA  1 
ATOM   1733 C  C   . ALA A 1 243 ? 32.806  22.273 38.999 1.00 50.96  ? 379  ALA A C   1 
ATOM   1734 O  O   . ALA A 1 243 ? 33.068  21.946 37.845 1.00 53.50  ? 379  ALA A O   1 
ATOM   1735 C  CB  . ALA A 1 243 ? 33.712  20.636 40.660 1.00 50.00  ? 379  ALA A CB  1 
ATOM   1736 N  N   . VAL A 1 244 ? 31.655  22.838 39.345 1.00 48.17  ? 380  VAL A N   1 
ATOM   1737 C  CA  . VAL A 1 244 ? 30.620  23.100 38.352 1.00 46.14  ? 380  VAL A CA  1 
ATOM   1738 C  C   . VAL A 1 244 ? 30.985  24.258 37.419 1.00 48.55  ? 380  VAL A C   1 
ATOM   1739 O  O   . VAL A 1 244 ? 30.435  24.370 36.321 1.00 51.12  ? 380  VAL A O   1 
ATOM   1740 C  CB  . VAL A 1 244 ? 29.250  23.356 39.014 1.00 44.80  ? 380  VAL A CB  1 
ATOM   1741 C  CG1 . VAL A 1 244 ? 28.809  22.132 39.802 1.00 39.87  ? 380  VAL A CG1 1 
ATOM   1742 C  CG2 . VAL A 1 244 ? 29.313  24.581 39.916 1.00 38.64  ? 380  VAL A CG2 1 
ATOM   1743 N  N   . PHE A 1 245 ? 31.924  25.101 37.850 1.00 50.97  ? 381  PHE A N   1 
ATOM   1744 C  CA  . PHE A 1 245 ? 32.308  26.292 37.093 1.00 55.98  ? 381  PHE A CA  1 
ATOM   1745 C  C   . PHE A 1 245 ? 33.535  26.124 36.198 1.00 74.80  ? 381  PHE A C   1 
ATOM   1746 O  O   . PHE A 1 245 ? 34.196  27.107 35.867 1.00 83.91  ? 381  PHE A O   1 
ATOM   1747 C  CB  . PHE A 1 245 ? 32.551  27.463 38.043 1.00 51.51  ? 381  PHE A CB  1 
ATOM   1748 C  CG  . PHE A 1 245 ? 31.321  27.921 38.760 1.00 49.04  ? 381  PHE A CG  1 
ATOM   1749 C  CD1 . PHE A 1 245 ? 30.074  27.812 38.161 1.00 45.13  ? 381  PHE A CD1 1 
ATOM   1750 C  CD2 . PHE A 1 245 ? 31.409  28.459 40.033 1.00 48.81  ? 381  PHE A CD2 1 
ATOM   1751 C  CE1 . PHE A 1 245 ? 28.930  28.235 38.822 1.00 44.88  ? 381  PHE A CE1 1 
ATOM   1752 C  CE2 . PHE A 1 245 ? 30.268  28.887 40.703 1.00 51.26  ? 381  PHE A CE2 1 
ATOM   1753 C  CZ  . PHE A 1 245 ? 29.026  28.771 40.096 1.00 43.28  ? 381  PHE A CZ  1 
ATOM   1754 N  N   . GLU A 1 246 ? 33.842  24.893 35.810 1.00 88.79  ? 382  GLU A N   1 
ATOM   1755 C  CA  . GLU A 1 246 ? 34.959  24.643 34.902 1.00 105.32 ? 382  GLU A CA  1 
ATOM   1756 C  C   . GLU A 1 246 ? 34.821  25.435 33.607 1.00 112.49 ? 382  GLU A C   1 
ATOM   1757 O  O   . GLU A 1 246 ? 35.608  26.344 33.337 1.00 111.07 ? 382  GLU A O   1 
ATOM   1758 C  CB  . GLU A 1 246 ? 35.067  23.152 34.593 1.00 111.25 ? 382  GLU A CB  1 
ATOM   1759 C  CG  . GLU A 1 246 ? 33.781  22.372 34.852 1.00 113.01 ? 382  GLU A CG  1 
ATOM   1760 C  CD  . GLU A 1 246 ? 32.999  22.073 33.593 1.00 112.44 ? 382  GLU A CD  1 
ATOM   1761 O  OE1 . GLU A 1 246 ? 33.616  21.652 32.592 1.00 115.92 ? 382  GLU A OE1 1 
ATOM   1762 O  OE2 . GLU A 1 246 ? 31.762  22.242 33.611 1.00 108.57 ? 382  GLU A OE2 1 
ATOM   1763 N  N   . ALA A 1 247 ? 33.807  25.090 32.818 1.00 79.72  ? 383  ALA A N   1 
ATOM   1764 C  CA  . ALA A 1 247 ? 33.570  25.741 31.535 1.00 84.37  ? 383  ALA A CA  1 
ATOM   1765 C  C   . ALA A 1 247 ? 32.142  25.497 31.056 1.00 83.75  ? 383  ALA A C   1 
ATOM   1766 O  O   . ALA A 1 247 ? 31.901  25.297 29.864 1.00 82.45  ? 383  ALA A O   1 
ATOM   1767 C  CB  . ALA A 1 247 ? 34.577  25.249 30.497 1.00 86.14  ? 383  ALA A CB  1 
ATOM   1768 N  N   . TYR A 1 255 ? 27.022  20.835 27.945 1.00 83.74  ? 391  TYR A N   1 
ATOM   1769 C  CA  . TYR A 1 255 ? 25.742  21.211 27.352 1.00 86.46  ? 391  TYR A CA  1 
ATOM   1770 C  C   . TYR A 1 255 ? 25.167  20.095 26.474 1.00 88.30  ? 391  TYR A C   1 
ATOM   1771 O  O   . TYR A 1 255 ? 24.177  20.295 25.764 1.00 87.05  ? 391  TYR A O   1 
ATOM   1772 C  CB  . TYR A 1 255 ? 25.885  22.505 26.546 1.00 87.06  ? 391  TYR A CB  1 
ATOM   1773 N  N   . ARG A 1 256 ? 25.795  18.923 26.524 1.00 85.83  ? 392  ARG A N   1 
ATOM   1774 C  CA  . ARG A 1 256 ? 25.316  17.768 25.775 1.00 81.25  ? 392  ARG A CA  1 
ATOM   1775 C  C   . ARG A 1 256 ? 24.141  17.128 26.502 1.00 78.66  ? 392  ARG A C   1 
ATOM   1776 O  O   . ARG A 1 256 ? 24.158  16.989 27.726 1.00 81.32  ? 392  ARG A O   1 
ATOM   1777 C  CB  . ARG A 1 256 ? 26.437  16.746 25.585 1.00 82.45  ? 392  ARG A CB  1 
ATOM   1778 N  N   . VAL A 1 257 ? 23.121  16.738 25.746 1.00 71.20  ? 393  VAL A N   1 
ATOM   1779 C  CA  . VAL A 1 257 ? 21.910  16.187 26.332 1.00 61.20  ? 393  VAL A CA  1 
ATOM   1780 C  C   . VAL A 1 257 ? 21.746  14.698 26.025 1.00 57.53  ? 393  VAL A C   1 
ATOM   1781 O  O   . VAL A 1 257 ? 21.811  14.289 24.864 1.00 59.24  ? 393  VAL A O   1 
ATOM   1782 C  CB  . VAL A 1 257 ? 20.673  16.960 25.841 1.00 62.69  ? 393  VAL A CB  1 
ATOM   1783 C  CG1 . VAL A 1 257 ? 19.408  16.368 26.423 1.00 59.97  ? 393  VAL A CG1 1 
ATOM   1784 C  CG2 . VAL A 1 257 ? 20.789  18.422 26.223 1.00 63.87  ? 393  VAL A CG2 1 
ATOM   1785 N  N   . ASP A 1 258 ? 21.541  13.901 27.075 1.00 59.24  ? 394  ASP A N   1 
ATOM   1786 C  CA  . ASP A 1 258 ? 21.273  12.464 26.948 1.00 63.88  ? 394  ASP A CA  1 
ATOM   1787 C  C   . ASP A 1 258 ? 20.041  12.247 26.070 1.00 64.44  ? 394  ASP A C   1 
ATOM   1788 O  O   . ASP A 1 258 ? 18.935  12.654 26.433 1.00 69.64  ? 394  ASP A O   1 
ATOM   1789 C  CB  . ASP A 1 258 ? 21.059  11.847 28.341 1.00 64.85  ? 394  ASP A CB  1 
ATOM   1790 C  CG  . ASP A 1 258 ? 21.097  10.320 28.336 1.00 69.10  ? 394  ASP A CG  1 
ATOM   1791 O  OD1 . ASP A 1 258 ? 20.104  9.690  27.911 1.00 67.70  ? 394  ASP A OD1 1 
ATOM   1792 O  OD2 . ASP A 1 258 ? 22.117  9.748  28.780 1.00 69.46  ? 394  ASP A OD2 1 
ATOM   1793 N  N   . GLU A 1 259 ? 20.241  11.621 24.913 1.00 63.14  ? 395  GLU A N   1 
ATOM   1794 C  CA  . GLU A 1 259 ? 19.182  11.459 23.917 1.00 65.24  ? 395  GLU A CA  1 
ATOM   1795 C  C   . GLU A 1 259 ? 17.935  10.753 24.454 1.00 67.86  ? 395  GLU A C   1 
ATOM   1796 O  O   . GLU A 1 259 ? 16.810  11.092 24.076 1.00 69.38  ? 395  GLU A O   1 
ATOM   1797 C  CB  . GLU A 1 259 ? 19.719  10.711 22.693 1.00 67.65  ? 395  GLU A CB  1 
ATOM   1798 N  N   . ARG A 1 260 ? 18.133  9.773  25.331 1.00 69.03  ? 396  ARG A N   1 
ATOM   1799 C  CA  . ARG A 1 260 ? 17.013  9.024  25.895 1.00 65.31  ? 396  ARG A CA  1 
ATOM   1800 C  C   . ARG A 1 260 ? 16.234  9.875  26.888 1.00 58.19  ? 396  ARG A C   1 
ATOM   1801 O  O   . ARG A 1 260 ? 15.007  9.986  26.798 1.00 54.92  ? 396  ARG A O   1 
ATOM   1802 C  CB  . ARG A 1 260 ? 17.497  7.740  26.574 1.00 59.45  ? 396  ARG A CB  1 
ATOM   1803 N  N   . ALA A 1 261 ? 16.956  10.471 27.832 1.00 51.45  ? 397  ALA A N   1 
ATOM   1804 C  CA  . ALA A 1 261 ? 16.349  11.292 28.878 1.00 55.40  ? 397  ALA A CA  1 
ATOM   1805 C  C   . ALA A 1 261 ? 15.565  12.467 28.298 1.00 55.35  ? 397  ALA A C   1 
ATOM   1806 O  O   . ALA A 1 261 ? 14.542  12.873 28.851 1.00 61.52  ? 397  ALA A O   1 
ATOM   1807 C  CB  . ALA A 1 261 ? 17.417  11.788 29.852 1.00 53.23  ? 397  ALA A CB  1 
ATOM   1808 N  N   . ALA A 1 262 ? 16.051  13.011 27.186 1.00 51.17  ? 398  ALA A N   1 
ATOM   1809 C  CA  . ALA A 1 262 ? 15.399  14.153 26.549 1.00 51.13  ? 398  ALA A CA  1 
ATOM   1810 C  C   . ALA A 1 262 ? 14.080  13.747 25.901 1.00 51.65  ? 398  ALA A C   1 
ATOM   1811 O  O   . ALA A 1 262 ? 13.124  14.520 25.885 1.00 50.43  ? 398  ALA A O   1 
ATOM   1812 C  CB  . ALA A 1 262 ? 16.322  14.784 25.529 1.00 50.58  ? 398  ALA A CB  1 
ATOM   1813 N  N   . GLU A 1 263 ? 14.037  12.534 25.358 1.00 54.16  ? 399  GLU A N   1 
ATOM   1814 C  CA  . GLU A 1 263 ? 12.805  12.008 24.784 1.00 55.74  ? 399  GLU A CA  1 
ATOM   1815 C  C   . GLU A 1 263 ? 11.797  11.718 25.891 1.00 54.34  ? 399  GLU A C   1 
ATOM   1816 O  O   . GLU A 1 263 ? 10.608  11.990 25.742 1.00 57.15  ? 399  GLU A O   1 
ATOM   1817 C  CB  . GLU A 1 263 ? 13.087  10.742 23.969 1.00 54.05  ? 399  GLU A CB  1 
ATOM   1818 N  N   . GLN A 1 264 ? 12.286  11.178 27.006 1.00 54.95  ? 400  GLN A N   1 
ATOM   1819 C  CA  . GLN A 1 264 ? 11.440  10.860 28.156 1.00 56.52  ? 400  GLN A CA  1 
ATOM   1820 C  C   . GLN A 1 264 ? 10.848  12.110 28.805 1.00 54.75  ? 400  GLN A C   1 
ATOM   1821 O  O   . GLN A 1 264 ? 9.780   12.052 29.418 1.00 52.21  ? 400  GLN A O   1 
ATOM   1822 C  CB  . GLN A 1 264 ? 12.240  10.068 29.196 1.00 55.92  ? 400  GLN A CB  1 
ATOM   1823 C  CG  . GLN A 1 264 ? 12.572  8.651  28.772 1.00 59.63  ? 400  GLN A CG  1 
ATOM   1824 C  CD  . GLN A 1 264 ? 11.330  7.852  28.430 1.00 67.19  ? 400  GLN A CD  1 
ATOM   1825 O  OE1 . GLN A 1 264 ? 10.460  7.635  29.276 1.00 69.14  ? 400  GLN A OE1 1 
ATOM   1826 N  NE2 . GLN A 1 264 ? 11.234  7.420  27.179 1.00 71.07  ? 400  GLN A NE2 1 
ATOM   1827 N  N   . ALA A 1 265 ? 11.548  13.234 28.660 1.00 49.66  ? 401  ALA A N   1 
ATOM   1828 C  CA  . ALA A 1 265 ? 11.199  14.460 29.372 1.00 48.90  ? 401  ALA A CA  1 
ATOM   1829 C  C   . ALA A 1 265 ? 10.313  15.404 28.570 1.00 52.67  ? 401  ALA A C   1 
ATOM   1830 O  O   . ALA A 1 265 ? 10.374  16.620 28.755 1.00 55.75  ? 401  ALA A O   1 
ATOM   1831 C  CB  . ALA A 1 265 ? 12.452  15.181 29.808 1.00 47.12  ? 401  ALA A CB  1 
ATOM   1832 N  N   . ARG A 1 266 ? 9.489   14.850 27.689 1.00 59.77  ? 402  ARG A N   1 
ATOM   1833 C  CA  . ARG A 1 266 ? 8.558   15.662 26.913 1.00 63.66  ? 402  ARG A CA  1 
ATOM   1834 C  C   . ARG A 1 266 ? 7.230   15.831 27.660 1.00 63.52  ? 402  ARG A C   1 
ATOM   1835 O  O   . ARG A 1 266 ? 6.818   14.951 28.416 1.00 65.82  ? 402  ARG A O   1 
ATOM   1836 C  CB  . ARG A 1 266 ? 8.329   15.030 25.538 1.00 66.14  ? 402  ARG A CB  1 
ATOM   1837 N  N   . TRP A 1 267 ? 6.565   16.961 27.446 1.00 62.38  ? 403  TRP A N   1 
ATOM   1838 C  CA  . TRP A 1 267 ? 5.328   17.266 28.159 1.00 68.82  ? 403  TRP A CA  1 
ATOM   1839 C  C   . TRP A 1 267 ? 4.090   16.949 27.311 1.00 77.89  ? 403  TRP A C   1 
ATOM   1840 O  O   . TRP A 1 267 ? 3.475   17.842 26.727 1.00 84.20  ? 403  TRP A O   1 
ATOM   1841 C  CB  . TRP A 1 267 ? 5.347   18.736 28.601 1.00 66.34  ? 403  TRP A CB  1 
ATOM   1842 C  CG  . TRP A 1 267 ? 4.150   19.195 29.387 1.00 72.78  ? 403  TRP A CG  1 
ATOM   1843 C  CD1 . TRP A 1 267 ? 3.034   19.813 28.896 1.00 80.23  ? 403  TRP A CD1 1 
ATOM   1844 C  CD2 . TRP A 1 267 ? 3.961   19.098 30.806 1.00 72.00  ? 403  TRP A CD2 1 
ATOM   1845 N  NE1 . TRP A 1 267 ? 2.159   20.095 29.918 1.00 80.97  ? 403  TRP A NE1 1 
ATOM   1846 C  CE2 . TRP A 1 267 ? 2.703   19.666 31.100 1.00 77.58  ? 403  TRP A CE2 1 
ATOM   1847 C  CE3 . TRP A 1 267 ? 4.727   18.579 31.853 1.00 66.54  ? 403  TRP A CE3 1 
ATOM   1848 C  CZ2 . TRP A 1 267 ? 2.197   19.730 32.399 1.00 77.06  ? 403  TRP A CZ2 1 
ATOM   1849 C  CZ3 . TRP A 1 267 ? 4.223   18.646 33.142 1.00 69.95  ? 403  TRP A CZ3 1 
ATOM   1850 C  CH2 . TRP A 1 267 ? 2.971   19.215 33.403 1.00 75.38  ? 403  TRP A CH2 1 
ATOM   1851 N  N   . GLU A 1 268 ? 3.731   15.669 27.243 1.00 84.71  ? 404  GLU A N   1 
ATOM   1852 C  CA  . GLU A 1 268 ? 2.558   15.236 26.479 1.00 96.36  ? 404  GLU A CA  1 
ATOM   1853 C  C   . GLU A 1 268 ? 1.891   13.988 27.063 1.00 103.86 ? 404  GLU A C   1 
ATOM   1854 O  O   . GLU A 1 268 ? 2.305   13.469 28.101 1.00 104.84 ? 404  GLU A O   1 
ATOM   1855 C  CB  . GLU A 1 268 ? 2.914   15.008 25.003 1.00 97.90  ? 404  GLU A CB  1 
ATOM   1856 C  CG  . GLU A 1 268 ? 4.363   14.606 24.732 1.00 98.20  ? 404  GLU A CG  1 
ATOM   1857 C  CD  . GLU A 1 268 ? 4.686   13.177 25.138 1.00 103.19 ? 404  GLU A CD  1 
ATOM   1858 O  OE1 . GLU A 1 268 ? 4.624   12.857 26.344 1.00 104.27 ? 404  GLU A OE1 1 
ATOM   1859 O  OE2 . GLU A 1 268 ? 5.019   12.371 24.245 1.00 106.21 ? 404  GLU A OE2 1 
ATOM   1860 N  N   . LYS A 1 277 ? -14.053 18.767 21.235 1.00 70.58  ? 413  LYS A N   1 
ATOM   1861 C  CA  . LYS A 1 277 ? -14.791 19.383 22.338 1.00 71.59  ? 413  LYS A CA  1 
ATOM   1862 C  C   . LYS A 1 277 ? -14.775 18.493 23.582 1.00 64.54  ? 413  LYS A C   1 
ATOM   1863 O  O   . LYS A 1 277 ? -15.492 17.493 23.643 1.00 71.11  ? 413  LYS A O   1 
ATOM   1864 C  CB  . LYS A 1 277 ? -16.233 19.687 21.915 1.00 70.39  ? 413  LYS A CB  1 
ATOM   1865 N  N   . THR A 1 278 ? -13.963 18.857 24.573 1.00 90.71  ? 414  THR A N   1 
ATOM   1866 C  CA  . THR A 1 278 ? -13.861 18.065 25.798 1.00 75.20  ? 414  THR A CA  1 
ATOM   1867 C  C   . THR A 1 278 ? -15.025 18.339 26.747 1.00 62.94  ? 414  THR A C   1 
ATOM   1868 O  O   . THR A 1 278 ? -15.280 19.484 27.126 1.00 58.68  ? 414  THR A O   1 
ATOM   1869 C  CB  . THR A 1 278 ? -12.536 18.307 26.547 1.00 71.81  ? 414  THR A CB  1 
ATOM   1870 O  OG1 . THR A 1 278 ? -11.634 19.037 25.709 1.00 76.60  ? 414  THR A OG1 1 
ATOM   1871 C  CG2 . THR A 1 278 ? -11.898 16.976 26.943 1.00 70.10  ? 414  THR A CG2 1 
ATOM   1872 N  N   . THR A 1 279 ? -15.732 17.280 27.123 1.00 56.60  ? 415  THR A N   1 
ATOM   1873 C  CA  . THR A 1 279 ? -16.865 17.413 28.025 1.00 50.83  ? 415  THR A CA  1 
ATOM   1874 C  C   . THR A 1 279 ? -16.713 16.501 29.230 1.00 41.53  ? 415  THR A C   1 
ATOM   1875 O  O   . THR A 1 279 ? -15.878 15.600 29.238 1.00 40.48  ? 415  THR A O   1 
ATOM   1876 C  CB  . THR A 1 279 ? -18.191 17.067 27.325 1.00 54.52  ? 415  THR A CB  1 
ATOM   1877 O  OG1 . THR A 1 279 ? -18.236 15.662 27.049 1.00 57.82  ? 415  THR A OG1 1 
ATOM   1878 C  CG2 . THR A 1 279 ? -18.330 17.840 26.026 1.00 56.20  ? 415  THR A CG2 1 
ATOM   1879 N  N   . LYS A 1 280 ? -17.530 16.744 30.246 1.00 37.48  ? 416  LYS A N   1 
ATOM   1880 C  CA  . LYS A 1 280 ? -17.601 15.869 31.401 1.00 38.92  ? 416  LYS A CA  1 
ATOM   1881 C  C   . LYS A 1 280 ? -19.014 15.966 31.978 1.00 37.93  ? 416  LYS A C   1 
ATOM   1882 O  O   . LYS A 1 280 ? -19.630 17.036 31.968 1.00 34.81  ? 416  LYS A O   1 
ATOM   1883 C  CB  . LYS A 1 280 ? -16.542 16.259 32.438 1.00 36.96  ? 416  LYS A CB  1 
ATOM   1884 C  CG  . LYS A 1 280 ? -16.434 15.307 33.614 1.00 38.96  ? 416  LYS A CG  1 
ATOM   1885 C  CD  . LYS A 1 280 ? -15.350 15.738 34.591 1.00 37.94  ? 416  LYS A CD  1 
ATOM   1886 C  CE  . LYS A 1 280 ? -13.957 15.640 33.983 1.00 38.75  ? 416  LYS A CE  1 
ATOM   1887 N  NZ  . LYS A 1 280 ? -12.904 15.992 34.986 1.00 37.85  ? 416  LYS A NZ  1 
ATOM   1888 N  N   . PRO A 1 281 ? -19.559 14.836 32.439 1.00 34.91  ? 417  PRO A N   1 
ATOM   1889 C  CA  . PRO A 1 281 ? -20.926 14.935 32.965 1.00 33.25  ? 417  PRO A CA  1 
ATOM   1890 C  C   . PRO A 1 281 ? -20.992 15.722 34.269 1.00 29.53  ? 417  PRO A C   1 
ATOM   1891 O  O   . PRO A 1 281 ? -20.076 15.656 35.091 1.00 30.13  ? 417  PRO A O   1 
ATOM   1892 C  CB  . PRO A 1 281 ? -21.329 13.470 33.195 1.00 37.00  ? 417  PRO A CB  1 
ATOM   1893 C  CG  . PRO A 1 281 ? -20.044 12.691 33.174 1.00 39.02  ? 417  PRO A CG  1 
ATOM   1894 C  CD  . PRO A 1 281 ? -19.114 13.441 32.277 1.00 34.81  ? 417  PRO A CD  1 
ATOM   1895 N  N   . CYS A 1 282 ? -22.067 16.483 34.433 1.00 33.26  ? 418  CYS A N   1 
ATOM   1896 C  CA  . CYS A 1 282 ? -22.328 17.202 35.670 1.00 31.80  ? 418  CYS A CA  1 
ATOM   1897 C  C   . CYS A 1 282 ? -22.300 16.223 36.842 1.00 25.80  ? 418  CYS A C   1 
ATOM   1898 O  O   . CYS A 1 282 ? -22.958 15.192 36.800 1.00 29.35  ? 418  CYS A O   1 
ATOM   1899 C  CB  . CYS A 1 282 ? -23.705 17.870 35.581 1.00 33.11  ? 418  CYS A CB  1 
ATOM   1900 S  SG  . CYS A 1 282 ? -24.204 18.660 37.090 1.00 29.49  ? 418  CYS A SG  1 
ATOM   1901 N  N   . PRO A 1 283 ? -21.531 16.538 37.893 1.00 26.46  ? 419  PRO A N   1 
ATOM   1902 C  CA  . PRO A 1 283 ? -21.478 15.671 39.079 1.00 29.74  ? 419  PRO A CA  1 
ATOM   1903 C  C   . PRO A 1 283 ? -22.859 15.464 39.698 1.00 27.86  ? 419  PRO A C   1 
ATOM   1904 O  O   . PRO A 1 283 ? -23.073 14.458 40.362 1.00 26.08  ? 419  PRO A O   1 
ATOM   1905 C  CB  . PRO A 1 283 ? -20.613 16.467 40.065 1.00 28.84  ? 419  PRO A CB  1 
ATOM   1906 C  CG  . PRO A 1 283 ? -19.873 17.459 39.244 1.00 24.93  ? 419  PRO A CG  1 
ATOM   1907 C  CD  . PRO A 1 283 ? -20.726 17.759 38.052 1.00 24.04  ? 419  PRO A CD  1 
ATOM   1908 N  N   . ARG A 1 284 ? -23.783 16.400 39.502 1.00 31.78  ? 420  ARG A N   1 
ATOM   1909 C  CA  . ARG A 1 284 ? -25.097 16.269 40.137 1.00 31.21  ? 420  ARG A CA  1 
ATOM   1910 C  C   . ARG A 1 284 ? -26.163 15.656 39.226 1.00 33.16  ? 420  ARG A C   1 
ATOM   1911 O  O   . ARG A 1 284 ? -26.863 14.723 39.635 1.00 28.03  ? 420  ARG A O   1 
ATOM   1912 C  CB  . ARG A 1 284 ? -25.570 17.609 40.718 1.00 30.35  ? 420  ARG A CB  1 
ATOM   1913 C  CG  . ARG A 1 284 ? -26.813 17.485 41.597 1.00 30.88  ? 420  ARG A CG  1 
ATOM   1914 C  CD  . ARG A 1 284 ? -27.020 18.721 42.457 1.00 33.11  ? 420  ARG A CD  1 
ATOM   1915 N  NE  . ARG A 1 284 ? -27.191 19.922 41.648 1.00 35.12  ? 420  ARG A NE  1 
ATOM   1916 C  CZ  . ARG A 1 284 ? -27.163 21.159 42.129 1.00 36.55  ? 420  ARG A CZ  1 
ATOM   1917 N  NH1 . ARG A 1 284 ? -26.976 21.367 43.423 1.00 31.45  ? 420  ARG A NH1 1 
ATOM   1918 N  NH2 . ARG A 1 284 ? -27.333 22.193 41.314 1.00 37.16  ? 420  ARG A NH2 1 
ATOM   1919 N  N   . CYS A 1 285 ? -26.296 16.159 37.999 1.00 29.35  ? 421  CYS A N   1 
ATOM   1920 C  CA  . CYS A 1 285 ? -27.335 15.623 37.108 1.00 31.37  ? 421  CYS A CA  1 
ATOM   1921 C  C   . CYS A 1 285 ? -26.809 14.739 35.967 1.00 28.01  ? 421  CYS A C   1 
ATOM   1922 O  O   . CYS A 1 285 ? -27.600 14.087 35.277 1.00 30.74  ? 421  CYS A O   1 
ATOM   1923 C  CB  . CYS A 1 285 ? -28.179 16.757 36.529 1.00 29.01  ? 421  CYS A CB  1 
ATOM   1924 S  SG  . CYS A 1 285 ? -27.362 17.654 35.222 1.00 31.40  ? 421  CYS A SG  1 
ATOM   1925 N  N   . HIS A 1 286 ? -25.490 14.751 35.762 1.00 27.17  ? 422  HIS A N   1 
ATOM   1926 C  CA  . HIS A 1 286 ? -24.808 13.910 34.762 1.00 32.76  ? 422  HIS A CA  1 
ATOM   1927 C  C   . HIS A 1 286 ? -24.997 14.302 33.289 1.00 36.46  ? 422  HIS A C   1 
ATOM   1928 O  O   . HIS A 1 286 ? -24.574 13.568 32.398 1.00 40.57  ? 422  HIS A O   1 
ATOM   1929 C  CB  . HIS A 1 286 ? -25.137 12.426 34.978 1.00 40.20  ? 422  HIS A CB  1 
ATOM   1930 C  CG  . HIS A 1 286 ? -24.901 11.962 36.381 1.00 45.12  ? 422  HIS A CG  1 
ATOM   1931 N  ND1 . HIS A 1 286 ? -25.865 11.312 37.123 1.00 47.56  ? 422  HIS A ND1 1 
ATOM   1932 C  CD2 . HIS A 1 286 ? -23.813 12.065 37.183 1.00 42.40  ? 422  HIS A CD2 1 
ATOM   1933 C  CE1 . HIS A 1 286 ? -25.378 11.026 38.318 1.00 46.22  ? 422  HIS A CE1 1 
ATOM   1934 N  NE2 . HIS A 1 286 ? -24.135 11.471 38.380 1.00 44.06  ? 422  HIS A NE2 1 
ATOM   1935 N  N   . VAL A 1 287 ? -25.619 15.449 33.025 1.00 32.19  ? 423  VAL A N   1 
ATOM   1936 C  CA  . VAL A 1 287 ? -25.654 15.980 31.662 1.00 37.70  ? 423  VAL A CA  1 
ATOM   1937 C  C   . VAL A 1 287 ? -24.225 16.371 31.270 1.00 39.74  ? 423  VAL A C   1 
ATOM   1938 O  O   . VAL A 1 287 ? -23.486 16.894 32.098 1.00 37.12  ? 423  VAL A O   1 
ATOM   1939 C  CB  . VAL A 1 287 ? -26.600 17.203 31.570 1.00 43.49  ? 423  VAL A CB  1 
ATOM   1940 C  CG1 . VAL A 1 287 ? -26.343 18.012 30.325 1.00 45.00  ? 423  VAL A CG1 1 
ATOM   1941 C  CG2 . VAL A 1 287 ? -28.048 16.752 31.612 1.00 45.21  ? 423  VAL A CG2 1 
ATOM   1942 N  N   . PRO A 1 288 ? -23.812 16.077 30.021 1.00 41.36  ? 424  PRO A N   1 
ATOM   1943 C  CA  . PRO A 1 288 ? -22.467 16.461 29.565 1.00 38.12  ? 424  PRO A CA  1 
ATOM   1944 C  C   . PRO A 1 288 ? -22.281 17.974 29.589 1.00 46.69  ? 424  PRO A C   1 
ATOM   1945 O  O   . PRO A 1 288 ? -23.156 18.697 29.110 1.00 48.63  ? 424  PRO A O   1 
ATOM   1946 C  CB  . PRO A 1 288 ? -22.429 15.977 28.112 1.00 40.12  ? 424  PRO A CB  1 
ATOM   1947 C  CG  . PRO A 1 288 ? -23.479 14.906 28.025 1.00 41.32  ? 424  PRO A CG  1 
ATOM   1948 C  CD  . PRO A 1 288 ? -24.542 15.279 29.018 1.00 40.35  ? 424  PRO A CD  1 
ATOM   1949 N  N   . VAL A 1 289 ? -21.164 18.445 30.136 1.00 43.98  ? 425  VAL A N   1 
ATOM   1950 C  CA  . VAL A 1 289 ? -20.883 19.875 30.165 1.00 42.65  ? 425  VAL A CA  1 
ATOM   1951 C  C   . VAL A 1 289 ? -19.600 20.143 29.396 1.00 45.32  ? 425  VAL A C   1 
ATOM   1952 O  O   . VAL A 1 289 ? -18.608 19.434 29.583 1.00 45.29  ? 425  VAL A O   1 
ATOM   1953 C  CB  . VAL A 1 289 ? -20.726 20.395 31.607 1.00 35.79  ? 425  VAL A CB  1 
ATOM   1954 C  CG1 . VAL A 1 289 ? -20.765 21.919 31.629 1.00 40.04  ? 425  VAL A CG1 1 
ATOM   1955 C  CG2 . VAL A 1 289 ? -21.821 19.843 32.488 1.00 38.74  ? 425  VAL A CG2 1 
ATOM   1956 N  N   . GLU A 1 290 ? -19.619 21.157 28.532 1.00 42.30  ? 426  GLU A N   1 
ATOM   1957 C  CA  . GLU A 1 290 ? -18.438 21.518 27.752 1.00 44.68  ? 426  GLU A CA  1 
ATOM   1958 C  C   . GLU A 1 290 ? -17.457 22.351 28.573 1.00 45.71  ? 426  GLU A C   1 
ATOM   1959 O  O   . GLU A 1 290 ? -17.849 23.275 29.292 1.00 44.41  ? 426  GLU A O   1 
ATOM   1960 C  CB  . GLU A 1 290 ? -18.832 22.268 26.474 1.00 45.72  ? 426  GLU A CB  1 
ATOM   1961 N  N   . LYS A 1 291 ? -16.181 22.006 28.464 1.00 45.08  ? 427  LYS A N   1 
ATOM   1962 C  CA  . LYS A 1 291 ? -15.120 22.718 29.156 1.00 44.44  ? 427  LYS A CA  1 
ATOM   1963 C  C   . LYS A 1 291 ? -14.656 23.843 28.255 1.00 44.26  ? 427  LYS A C   1 
ATOM   1964 O  O   . LYS A 1 291 ? -14.594 23.674 27.038 1.00 45.93  ? 427  LYS A O   1 
ATOM   1965 C  CB  . LYS A 1 291 ? -13.963 21.759 29.413 1.00 47.73  ? 427  LYS A CB  1 
ATOM   1966 C  CG  . LYS A 1 291 ? -12.803 22.301 30.241 1.00 44.90  ? 427  LYS A CG  1 
ATOM   1967 C  CD  . LYS A 1 291 ? -11.674 21.267 30.223 1.00 46.01  ? 427  LYS A CD  1 
ATOM   1968 C  CE  . LYS A 1 291 ? -10.726 21.406 31.390 1.00 43.53  ? 427  LYS A CE  1 
ATOM   1969 N  NZ  . LYS A 1 291 ? -9.844  22.601 31.276 1.00 51.74  ? 427  LYS A NZ  1 
ATOM   1970 N  N   . ASN A 1 292 ? -14.336 24.992 28.838 1.00 39.21  ? 428  ASN A N   1 
ATOM   1971 C  CA  . ASN A 1 292 ? -13.811 26.095 28.046 1.00 43.55  ? 428  ASN A CA  1 
ATOM   1972 C  C   . ASN A 1 292 ? -12.304 26.229 28.234 1.00 46.79  ? 428  ASN A C   1 
ATOM   1973 O  O   . ASN A 1 292 ? -11.844 26.747 29.255 1.00 44.82  ? 428  ASN A O   1 
ATOM   1974 C  CB  . ASN A 1 292 ? -14.527 27.403 28.397 1.00 44.67  ? 428  ASN A CB  1 
ATOM   1975 C  CG  . ASN A 1 292 ? -13.988 28.593 27.618 1.00 50.80  ? 428  ASN A CG  1 
ATOM   1976 O  OD1 . ASN A 1 292 ? -13.421 29.515 28.198 1.00 54.26  ? 428  ASN A OD1 1 
ATOM   1977 N  ND2 . ASN A 1 292 ? -14.162 28.574 26.297 1.00 50.45  ? 428  ASN A ND2 1 
ATOM   1978 N  N   . GLY A 1 293 ? -11.542 25.756 27.249 1.00 45.73  ? 429  GLY A N   1 
ATOM   1979 C  CA  . GLY A 1 293 ? -10.090 25.783 27.323 1.00 39.16  ? 429  GLY A CA  1 
ATOM   1980 C  C   . GLY A 1 293 ? -9.578  25.149 28.601 1.00 42.75  ? 429  GLY A C   1 
ATOM   1981 O  O   . GLY A 1 293 ? -10.033 24.067 29.005 1.00 39.55  ? 429  GLY A O   1 
ATOM   1982 N  N   . GLY A 1 294 ? -8.651  25.838 29.258 1.00 33.15  ? 430  GLY A N   1 
ATOM   1983 C  CA  . GLY A 1 294 ? -8.082  25.336 30.496 1.00 33.26  ? 430  GLY A CA  1 
ATOM   1984 C  C   . GLY A 1 294 ? -8.865  25.722 31.739 1.00 35.25  ? 430  GLY A C   1 
ATOM   1985 O  O   . GLY A 1 294 ? -8.454  25.386 32.859 1.00 33.33  ? 430  GLY A O   1 
ATOM   1986 N  N   . CYS A 1 295 ? -9.986  26.423 31.555 1.00 35.26  ? 431  CYS A N   1 
ATOM   1987 C  CA  . CYS A 1 295 ? -10.774 26.903 32.691 1.00 33.50  ? 431  CYS A CA  1 
ATOM   1988 C  C   . CYS A 1 295 ? -11.428 25.765 33.459 1.00 32.91  ? 431  CYS A C   1 
ATOM   1989 O  O   . CYS A 1 295 ? -12.042 24.871 32.863 1.00 30.68  ? 431  CYS A O   1 
ATOM   1990 C  CB  . CYS A 1 295 ? -11.847 27.886 32.231 1.00 34.67  ? 431  CYS A CB  1 
ATOM   1991 S  SG  . CYS A 1 295 ? -12.753 28.662 33.598 1.00 35.42  ? 431  CYS A SG  1 
ATOM   1992 N  N   . MET A 1 296 ? -11.321 25.816 34.783 1.00 31.99  ? 432  MET A N   1 
ATOM   1993 C  CA  . MET A 1 296 ? -11.842 24.749 35.628 1.00 26.94  ? 432  MET A CA  1 
ATOM   1994 C  C   . MET A 1 296 ? -13.285 24.981 36.069 1.00 29.85  ? 432  MET A C   1 
ATOM   1995 O  O   . MET A 1 296 ? -13.917 24.086 36.627 1.00 31.22  ? 432  MET A O   1 
ATOM   1996 C  CB  . MET A 1 296 ? -10.945 24.553 36.844 1.00 28.93  ? 432  MET A CB  1 
ATOM   1997 C  CG  . MET A 1 296 ? -9.534  24.071 36.521 1.00 36.16  ? 432  MET A CG  1 
ATOM   1998 S  SD  . MET A 1 296 ? -9.475  22.318 36.108 1.00 34.09  ? 432  MET A SD  1 
ATOM   1999 C  CE  . MET A 1 296 ? -9.479  22.463 34.341 1.00 52.94  ? 432  MET A CE  1 
ATOM   2000 N  N   . HIS A 1 297 ? -13.797 26.182 35.824 1.00 30.14  ? 433  HIS A N   1 
ATOM   2001 C  CA  . HIS A 1 297 ? -15.166 26.521 36.196 1.00 29.86  ? 433  HIS A CA  1 
ATOM   2002 C  C   . HIS A 1 297 ? -16.113 25.902 35.178 1.00 32.60  ? 433  HIS A C   1 
ATOM   2003 O  O   . HIS A 1 297 ? -16.063 26.235 33.990 1.00 32.65  ? 433  HIS A O   1 
ATOM   2004 C  CB  . HIS A 1 297 ? -15.334 28.042 36.220 1.00 29.90  ? 433  HIS A CB  1 
ATOM   2005 C  CG  . HIS A 1 297 ? -16.653 28.512 36.759 1.00 39.73  ? 433  HIS A CG  1 
ATOM   2006 N  ND1 . HIS A 1 297 ? -16.954 29.849 36.910 1.00 45.04  ? 433  HIS A ND1 1 
ATOM   2007 C  CD2 . HIS A 1 297 ? -17.742 27.832 37.188 1.00 42.10  ? 433  HIS A CD2 1 
ATOM   2008 C  CE1 . HIS A 1 297 ? -18.172 29.971 37.406 1.00 44.66  ? 433  HIS A CE1 1 
ATOM   2009 N  NE2 . HIS A 1 297 ? -18.672 28.762 37.587 1.00 41.11  ? 433  HIS A NE2 1 
ATOM   2010 N  N   . MET A 1 298 ? -16.960 24.988 35.642 1.00 27.49  ? 434  MET A N   1 
ATOM   2011 C  CA  . MET A 1 298 ? -17.931 24.343 34.774 1.00 31.65  ? 434  MET A CA  1 
ATOM   2012 C  C   . MET A 1 298 ? -19.328 24.858 35.124 1.00 32.39  ? 434  MET A C   1 
ATOM   2013 O  O   . MET A 1 298 ? -19.656 25.038 36.305 1.00 30.92  ? 434  MET A O   1 
ATOM   2014 C  CB  . MET A 1 298 ? -17.881 22.823 34.973 1.00 34.71  ? 434  MET A CB  1 
ATOM   2015 C  CG  . MET A 1 298 ? -16.513 22.186 34.738 1.00 35.53  ? 434  MET A CG  1 
ATOM   2016 S  SD  . MET A 1 298 ? -15.884 22.497 33.064 1.00 34.29  ? 434  MET A SD  1 
ATOM   2017 C  CE  . MET A 1 298 ? -17.143 21.630 32.112 1.00 46.90  ? 434  MET A CE  1 
ATOM   2018 N  N   . LYS A 1 299 ? -20.156 25.091 34.112 1.00 30.51  ? 435  LYS A N   1 
ATOM   2019 C  CA  . LYS A 1 299 ? -21.531 25.520 34.362 1.00 33.01  ? 435  LYS A CA  1 
ATOM   2020 C  C   . LYS A 1 299 ? -22.535 24.601 33.687 1.00 31.88  ? 435  LYS A C   1 
ATOM   2021 O  O   . LYS A 1 299 ? -22.648 24.577 32.457 1.00 35.18  ? 435  LYS A O   1 
ATOM   2022 C  CB  . LYS A 1 299 ? -21.736 26.975 33.927 1.00 36.32  ? 435  LYS A CB  1 
ATOM   2023 C  CG  . LYS A 1 299 ? -20.864 27.962 34.706 1.00 49.86  ? 435  LYS A CG  1 
ATOM   2024 C  CD  . LYS A 1 299 ? -21.356 29.415 34.601 1.00 56.08  ? 435  LYS A CD  1 
ATOM   2025 C  CE  . LYS A 1 299 ? -21.217 29.947 33.193 1.00 57.55  ? 435  LYS A CE  1 
ATOM   2026 N  NZ  . LYS A 1 299 ? -19.831 29.734 32.697 1.00 63.96  ? 435  LYS A NZ  1 
ATOM   2027 N  N   . CYS A 1 300 ? -23.250 23.833 34.502 1.00 26.99  ? 436  CYS A N   1 
ATOM   2028 C  CA  . CYS A 1 300 ? -24.255 22.912 34.000 1.00 34.02  ? 436  CYS A CA  1 
ATOM   2029 C  C   . CYS A 1 300 ? -25.363 23.673 33.291 1.00 36.44  ? 436  CYS A C   1 
ATOM   2030 O  O   . CYS A 1 300 ? -25.899 24.631 33.845 1.00 39.88  ? 436  CYS A O   1 
ATOM   2031 C  CB  . CYS A 1 300 ? -24.845 22.101 35.149 1.00 26.52  ? 436  CYS A CB  1 
ATOM   2032 S  SG  . CYS A 1 300 ? -26.157 20.980 34.614 1.00 34.11  ? 436  CYS A SG  1 
ATOM   2033 N  N   . PRO A 1 301 ? -25.704 23.248 32.059 1.00 37.87  ? 437  PRO A N   1 
ATOM   2034 C  CA  . PRO A 1 301 ? -26.740 23.865 31.218 1.00 40.46  ? 437  PRO A CA  1 
ATOM   2035 C  C   . PRO A 1 301 ? -28.150 23.387 31.549 1.00 42.77  ? 437  PRO A C   1 
ATOM   2036 O  O   . PRO A 1 301 ? -29.118 24.032 31.137 1.00 45.89  ? 437  PRO A O   1 
ATOM   2037 C  CB  . PRO A 1 301 ? -26.366 23.383 29.815 1.00 42.97  ? 437  PRO A CB  1 
ATOM   2038 C  CG  . PRO A 1 301 ? -25.761 22.024 30.053 1.00 39.81  ? 437  PRO A CG  1 
ATOM   2039 C  CD  . PRO A 1 301 ? -24.994 22.163 31.353 1.00 34.98  ? 437  PRO A CD  1 
ATOM   2040 N  N   . GLN A 1 302 ? -28.256 22.274 32.269 1.00 42.37  ? 438  GLN A N   1 
ATOM   2041 C  CA  . GLN A 1 302 ? -29.545 21.684 32.640 1.00 44.68  ? 438  GLN A CA  1 
ATOM   2042 C  C   . GLN A 1 302 ? -30.352 22.596 33.583 1.00 40.68  ? 438  GLN A C   1 
ATOM   2043 O  O   . GLN A 1 302 ? -29.944 22.851 34.717 1.00 45.79  ? 438  GLN A O   1 
ATOM   2044 C  CB  . GLN A 1 302 ? -29.306 20.302 33.260 1.00 49.96  ? 438  GLN A CB  1 
ATOM   2045 C  CG  . GLN A 1 302 ? -30.444 19.759 34.091 1.00 61.16  ? 438  GLN A CG  1 
ATOM   2046 C  CD  . GLN A 1 302 ? -31.681 19.524 33.274 1.00 72.09  ? 438  GLN A CD  1 
ATOM   2047 O  OE1 . GLN A 1 302 ? -32.754 20.032 33.594 1.00 77.77  ? 438  GLN A OE1 1 
ATOM   2048 N  NE2 . GLN A 1 302 ? -31.545 18.743 32.210 1.00 76.81  ? 438  GLN A NE2 1 
ATOM   2049 N  N   . PRO A 1 303 ? -31.506 23.091 33.108 1.00 47.23  ? 439  PRO A N   1 
ATOM   2050 C  CA  . PRO A 1 303 ? -32.257 24.148 33.802 1.00 50.50  ? 439  PRO A CA  1 
ATOM   2051 C  C   . PRO A 1 303 ? -32.782 23.784 35.196 1.00 47.52  ? 439  PRO A C   1 
ATOM   2052 O  O   . PRO A 1 303 ? -33.011 24.703 35.988 1.00 49.71  ? 439  PRO A O   1 
ATOM   2053 C  CB  . PRO A 1 303 ? -33.417 24.451 32.841 1.00 53.87  ? 439  PRO A CB  1 
ATOM   2054 C  CG  . PRO A 1 303 ? -33.530 23.233 31.981 1.00 58.33  ? 439  PRO A CG  1 
ATOM   2055 C  CD  . PRO A 1 303 ? -32.129 22.727 31.825 1.00 52.54  ? 439  PRO A CD  1 
ATOM   2056 N  N   . GLN A 1 304 ? -32.970 22.500 35.498 1.00 44.02  ? 440  GLN A N   1 
ATOM   2057 C  CA  . GLN A 1 304 ? -33.383 22.107 36.847 1.00 44.06  ? 440  GLN A CA  1 
ATOM   2058 C  C   . GLN A 1 304 ? -32.202 21.847 37.769 1.00 44.33  ? 440  GLN A C   1 
ATOM   2059 O  O   . GLN A 1 304 ? -32.391 21.613 38.967 1.00 46.03  ? 440  GLN A O   1 
ATOM   2060 C  CB  . GLN A 1 304 ? -34.294 20.876 36.822 1.00 50.64  ? 440  GLN A CB  1 
ATOM   2061 C  CG  . GLN A 1 304 ? -35.732 21.189 36.451 1.00 62.65  ? 440  GLN A CG  1 
ATOM   2062 C  CD  . GLN A 1 304 ? -35.864 21.682 35.020 1.00 75.55  ? 440  GLN A CD  1 
ATOM   2063 O  OE1 . GLN A 1 304 ? -35.334 21.068 34.091 1.00 81.06  ? 440  GLN A OE1 1 
ATOM   2064 N  NE2 . GLN A 1 304 ? -36.561 22.801 34.836 1.00 79.14  ? 440  GLN A NE2 1 
ATOM   2065 N  N   . CYS A 1 305 ? -30.992 21.876 37.210 1.00 39.92  ? 441  CYS A N   1 
ATOM   2066 C  CA  . CYS A 1 305 ? -29.778 21.632 37.986 1.00 36.50  ? 441  CYS A CA  1 
ATOM   2067 C  C   . CYS A 1 305 ? -28.957 22.909 38.123 1.00 35.00  ? 441  CYS A C   1 
ATOM   2068 O  O   . CYS A 1 305 ? -28.887 23.494 39.206 1.00 37.10  ? 441  CYS A O   1 
ATOM   2069 C  CB  . CYS A 1 305 ? -28.939 20.516 37.350 1.00 27.98  ? 441  CYS A CB  1 
ATOM   2070 S  SG  . CYS A 1 305 ? -27.312 20.269 38.110 1.00 27.29  ? 441  CYS A SG  1 
ATOM   2071 N  N   . ARG A 1 306 ? -28.337 23.329 37.022 1.00 37.83  ? 442  ARG A N   1 
ATOM   2072 C  CA  . ARG A 1 306 ? -27.560 24.573 36.981 1.00 40.14  ? 442  ARG A CA  1 
ATOM   2073 C  C   . ARG A 1 306 ? -26.347 24.558 37.907 1.00 34.06  ? 442  ARG A C   1 
ATOM   2074 O  O   . ARG A 1 306 ? -25.861 25.611 38.305 1.00 33.00  ? 442  ARG A O   1 
ATOM   2075 C  CB  . ARG A 1 306 ? -28.452 25.781 37.299 1.00 44.02  ? 442  ARG A CB  1 
ATOM   2076 C  CG  . ARG A 1 306 ? -29.487 26.068 36.225 1.00 55.29  ? 442  ARG A CG  1 
ATOM   2077 C  CD  . ARG A 1 306 ? -28.778 26.324 34.916 1.00 70.08  ? 442  ARG A CD  1 
ATOM   2078 N  NE  . ARG A 1 306 ? -29.682 26.417 33.777 1.00 83.49  ? 442  ARG A NE  1 
ATOM   2079 C  CZ  . ARG A 1 306 ? -29.305 26.837 32.574 1.00 88.00  ? 442  ARG A CZ  1 
ATOM   2080 N  NH1 . ARG A 1 306 ? -28.044 27.205 32.374 1.00 86.37  ? 442  ARG A NH1 1 
ATOM   2081 N  NH2 . ARG A 1 306 ? -30.182 26.894 31.578 1.00 88.53  ? 442  ARG A NH2 1 
ATOM   2082 N  N   . LEU A 1 307 ? -25.859 23.369 38.248 1.00 33.28  ? 443  LEU A N   1 
ATOM   2083 C  CA  . LEU A 1 307 ? -24.701 23.259 39.132 1.00 34.44  ? 443  LEU A CA  1 
ATOM   2084 C  C   . LEU A 1 307 ? -23.494 23.985 38.541 1.00 33.45  ? 443  LEU A C   1 
ATOM   2085 O  O   . LEU A 1 307 ? -23.192 23.828 37.353 1.00 28.21  ? 443  LEU A O   1 
ATOM   2086 C  CB  . LEU A 1 307 ? -24.341 21.794 39.345 1.00 34.53  ? 443  LEU A CB  1 
ATOM   2087 C  CG  . LEU A 1 307 ? -23.798 21.302 40.697 1.00 31.69  ? 443  LEU A CG  1 
ATOM   2088 C  CD1 . LEU A 1 307 ? -22.687 20.308 40.460 1.00 21.18  ? 443  LEU A CD1 1 
ATOM   2089 C  CD2 . LEU A 1 307 ? -23.347 22.417 41.617 1.00 24.27  ? 443  LEU A CD2 1 
ATOM   2090 N  N   . GLU A 1 308 ? -22.829 24.798 39.363 1.00 32.37  ? 444  GLU A N   1 
ATOM   2091 C  CA  . GLU A 1 308 ? -21.527 25.345 39.001 1.00 30.89  ? 444  GLU A CA  1 
ATOM   2092 C  C   . GLU A 1 308 ? -20.494 24.521 39.731 1.00 26.67  ? 444  GLU A C   1 
ATOM   2093 O  O   . GLU A 1 308 ? -20.584 24.329 40.955 1.00 21.67  ? 444  GLU A O   1 
ATOM   2094 C  CB  . GLU A 1 308 ? -21.407 26.818 39.389 1.00 34.19  ? 444  GLU A CB  1 
ATOM   2095 C  CG  . GLU A 1 308 ? -22.378 27.724 38.633 1.00 43.17  ? 444  GLU A CG  1 
ATOM   2096 C  CD  . GLU A 1 308 ? -22.133 29.192 38.896 1.00 52.48  ? 444  GLU A CD  1 
ATOM   2097 O  OE1 . GLU A 1 308 ? -20.963 29.578 39.134 1.00 51.77  ? 444  GLU A OE1 1 
ATOM   2098 O  OE2 . GLU A 1 308 ? -23.115 29.962 38.859 1.00 59.30  ? 444  GLU A OE2 1 
ATOM   2099 N  N   . TRP A 1 309 ? -19.516 24.007 38.995 1.00 22.90  ? 445  TRP A N   1 
ATOM   2100 C  CA  . TRP A 1 309 ? -18.602 23.054 39.602 1.00 22.85  ? 445  TRP A CA  1 
ATOM   2101 C  C   . TRP A 1 309 ? -17.175 23.112 39.053 1.00 23.96  ? 445  TRP A C   1 
ATOM   2102 O  O   . TRP A 1 309 ? -16.914 23.738 38.019 1.00 26.45  ? 445  TRP A O   1 
ATOM   2103 C  CB  . TRP A 1 309 ? -19.190 21.643 39.515 1.00 24.51  ? 445  TRP A CB  1 
ATOM   2104 C  CG  . TRP A 1 309 ? -19.518 21.185 38.121 1.00 33.79  ? 445  TRP A CG  1 
ATOM   2105 C  CD1 . TRP A 1 309 ? -20.611 21.537 37.368 1.00 32.95  ? 445  TRP A CD1 1 
ATOM   2106 C  CD2 . TRP A 1 309 ? -18.765 20.259 37.326 1.00 28.39  ? 445  TRP A CD2 1 
ATOM   2107 N  NE1 . TRP A 1 309 ? -20.571 20.892 36.153 1.00 28.04  ? 445  TRP A NE1 1 
ATOM   2108 C  CE2 . TRP A 1 309 ? -19.450 20.100 36.101 1.00 29.90  ? 445  TRP A CE2 1 
ATOM   2109 C  CE3 . TRP A 1 309 ? -17.576 19.549 37.533 1.00 28.88  ? 445  TRP A CE3 1 
ATOM   2110 C  CZ2 . TRP A 1 309 ? -18.975 19.265 35.076 1.00 29.13  ? 445  TRP A CZ2 1 
ATOM   2111 C  CZ3 . TRP A 1 309 ? -17.108 18.710 36.521 1.00 31.41  ? 445  TRP A CZ3 1 
ATOM   2112 C  CH2 . TRP A 1 309 ? -17.807 18.578 35.308 1.00 32.79  ? 445  TRP A CH2 1 
ATOM   2113 N  N   . CYS A 1 310 ? -16.257 22.473 39.773 1.00 21.92  ? 446  CYS A N   1 
ATOM   2114 C  CA  . CYS A 1 310 ? -14.852 22.396 39.365 1.00 27.83  ? 446  CYS A CA  1 
ATOM   2115 C  C   . CYS A 1 310 ? -14.583 21.134 38.548 1.00 31.33  ? 446  CYS A C   1 
ATOM   2116 O  O   . CYS A 1 310 ? -14.839 20.023 39.016 1.00 28.40  ? 446  CYS A O   1 
ATOM   2117 C  CB  . CYS A 1 310 ? -13.947 22.410 40.601 1.00 27.40  ? 446  CYS A CB  1 
ATOM   2118 S  SG  . CYS A 1 310 ? -12.170 22.250 40.272 1.00 22.87  ? 446  CYS A SG  1 
ATOM   2119 N  N   . TRP A 1 311 ? -14.069 21.314 37.332 1.00 34.41  ? 447  TRP A N   1 
ATOM   2120 C  CA  . TRP A 1 311 ? -13.646 20.207 36.471 1.00 31.42  ? 447  TRP A CA  1 
ATOM   2121 C  C   . TRP A 1 311 ? -12.737 19.234 37.205 1.00 34.52  ? 447  TRP A C   1 
ATOM   2122 O  O   . TRP A 1 311 ? -12.843 18.018 37.035 1.00 29.18  ? 447  TRP A O   1 
ATOM   2123 C  CB  . TRP A 1 311 ? -12.912 20.758 35.234 1.00 30.51  ? 447  TRP A CB  1 
ATOM   2124 C  CG  . TRP A 1 311 ? -12.222 19.715 34.363 1.00 36.10  ? 447  TRP A CG  1 
ATOM   2125 C  CD1 . TRP A 1 311 ? -10.964 19.201 34.530 1.00 39.98  ? 447  TRP A CD1 1 
ATOM   2126 C  CD2 . TRP A 1 311 ? -12.743 19.108 33.172 1.00 38.21  ? 447  TRP A CD2 1 
ATOM   2127 N  NE1 . TRP A 1 311 ? -10.685 18.297 33.531 1.00 40.87  ? 447  TRP A NE1 1 
ATOM   2128 C  CE2 . TRP A 1 311 ? -11.759 18.223 32.683 1.00 43.16  ? 447  TRP A CE2 1 
ATOM   2129 C  CE3 . TRP A 1 311 ? -13.953 19.217 32.479 1.00 37.55  ? 447  TRP A CE3 1 
ATOM   2130 C  CZ2 . TRP A 1 311 ? -11.950 17.448 31.531 1.00 47.43  ? 447  TRP A CZ2 1 
ATOM   2131 C  CZ3 . TRP A 1 311 ? -14.141 18.453 31.335 1.00 46.18  ? 447  TRP A CZ3 1 
ATOM   2132 C  CH2 . TRP A 1 311 ? -13.146 17.577 30.873 1.00 49.14  ? 447  TRP A CH2 1 
ATOM   2133 N  N   . ASN A 1 312 ? -11.823 19.767 38.006 1.00 37.76  ? 448  ASN A N   1 
ATOM   2134 C  CA  . ASN A 1 312 ? -10.827 18.919 38.634 1.00 37.36  ? 448  ASN A CA  1 
ATOM   2135 C  C   . ASN A 1 312 ? -11.351 18.212 39.868 1.00 35.19  ? 448  ASN A C   1 
ATOM   2136 O  O   . ASN A 1 312 ? -11.139 17.013 40.051 1.00 36.16  ? 448  ASN A O   1 
ATOM   2137 C  CB  . ASN A 1 312 ? -9.584  19.725 38.992 1.00 39.59  ? 448  ASN A CB  1 
ATOM   2138 C  CG  . ASN A 1 312 ? -8.569  18.907 39.769 1.00 41.08  ? 448  ASN A CG  1 
ATOM   2139 O  OD1 . ASN A 1 312 ? -8.536  18.945 40.999 1.00 41.01  ? 448  ASN A OD1 1 
ATOM   2140 N  ND2 . ASN A 1 312 ? -7.738  18.156 39.052 1.00 37.72  ? 448  ASN A ND2 1 
ATOM   2141 N  N   . CYS A 1 313 ? -12.038 18.967 40.713 1.00 34.92  ? 449  CYS A N   1 
ATOM   2142 C  CA  . CYS A 1 313 ? -12.402 18.495 42.041 1.00 29.84  ? 449  CYS A CA  1 
ATOM   2143 C  C   . CYS A 1 313 ? -13.780 17.820 42.094 1.00 31.28  ? 449  CYS A C   1 
ATOM   2144 O  O   . CYS A 1 313 ? -14.069 17.056 43.019 1.00 27.74  ? 449  CYS A O   1 
ATOM   2145 C  CB  . CYS A 1 313 ? -12.347 19.667 43.028 1.00 22.12  ? 449  CYS A CB  1 
ATOM   2146 S  SG  . CYS A 1 313 ? -10.683 20.334 43.266 1.00 29.62  ? 449  CYS A SG  1 
ATOM   2147 N  N   . GLY A 1 314 ? -14.632 18.103 41.111 1.00 32.59  ? 450  GLY A N   1 
ATOM   2148 C  CA  . GLY A 1 314 ? -15.950 17.493 41.053 1.00 29.15  ? 450  GLY A CA  1 
ATOM   2149 C  C   . GLY A 1 314 ? -16.945 18.058 42.054 1.00 32.15  ? 450  GLY A C   1 
ATOM   2150 O  O   . GLY A 1 314 ? -18.086 17.609 42.104 1.00 33.78  ? 450  GLY A O   1 
ATOM   2151 N  N   . CYS A 1 315 ? -16.516 19.036 42.848 1.00 33.53  ? 451  CYS A N   1 
ATOM   2152 C  CA  . CYS A 1 315 ? -17.377 19.662 43.850 1.00 31.78  ? 451  CYS A CA  1 
ATOM   2153 C  C   . CYS A 1 315 ? -17.927 20.971 43.311 1.00 27.35  ? 451  CYS A C   1 
ATOM   2154 O  O   . CYS A 1 315 ? -17.480 21.455 42.272 1.00 32.20  ? 451  CYS A O   1 
ATOM   2155 C  CB  . CYS A 1 315 ? -16.568 19.972 45.100 1.00 28.96  ? 451  CYS A CB  1 
ATOM   2156 S  SG  . CYS A 1 315 ? -15.260 21.160 44.752 1.00 38.78  ? 451  CYS A SG  1 
ATOM   2157 N  N   . GLU A 1 316 ? -18.881 21.572 44.013 1.00 25.84  ? 452  GLU A N   1 
ATOM   2158 C  CA  . GLU A 1 316 ? -19.383 22.853 43.539 1.00 30.27  ? 452  GLU A CA  1 
ATOM   2159 C  C   . GLU A 1 316 ? -18.324 23.962 43.595 1.00 28.94  ? 452  GLU A C   1 
ATOM   2160 O  O   . GLU A 1 316 ? -17.415 23.944 44.426 1.00 26.16  ? 452  GLU A O   1 
ATOM   2161 C  CB  . GLU A 1 316 ? -20.694 23.263 44.215 1.00 40.58  ? 452  GLU A CB  1 
ATOM   2162 C  CG  . GLU A 1 316 ? -20.739 23.184 45.723 1.00 55.35  ? 452  GLU A CG  1 
ATOM   2163 C  CD  . GLU A 1 316 ? -22.151 23.413 46.258 1.00 60.99  ? 452  GLU A CD  1 
ATOM   2164 O  OE1 . GLU A 1 316 ? -22.571 24.588 46.349 1.00 61.09  ? 452  GLU A OE1 1 
ATOM   2165 O  OE2 . GLU A 1 316 ? -22.841 22.419 46.580 1.00 60.16  ? 452  GLU A OE2 1 
ATOM   2166 N  N   . TRP A 1 317 ? -18.443 24.914 42.679 1.00 24.10  ? 453  TRP A N   1 
ATOM   2167 C  CA  . TRP A 1 317 ? -17.461 25.978 42.537 1.00 25.73  ? 453  TRP A CA  1 
ATOM   2168 C  C   . TRP A 1 317 ? -17.382 26.837 43.801 1.00 31.26  ? 453  TRP A C   1 
ATOM   2169 O  O   . TRP A 1 317 ? -18.405 27.121 44.436 1.00 33.12  ? 453  TRP A O   1 
ATOM   2170 C  CB  . TRP A 1 317 ? -17.828 26.841 41.332 1.00 26.20  ? 453  TRP A CB  1 
ATOM   2171 C  CG  . TRP A 1 317 ? -16.714 27.713 40.859 1.00 29.32  ? 453  TRP A CG  1 
ATOM   2172 C  CD1 . TRP A 1 317 ? -16.698 29.080 40.824 1.00 25.16  ? 453  TRP A CD1 1 
ATOM   2173 C  CD2 . TRP A 1 317 ? -15.444 27.280 40.351 1.00 24.02  ? 453  TRP A CD2 1 
ATOM   2174 N  NE1 . TRP A 1 317 ? -15.497 29.520 40.320 1.00 28.01  ? 453  TRP A NE1 1 
ATOM   2175 C  CE2 . TRP A 1 317 ? -14.708 28.434 40.028 1.00 25.64  ? 453  TRP A CE2 1 
ATOM   2176 C  CE3 . TRP A 1 317 ? -14.858 26.021 40.147 1.00 23.82  ? 453  TRP A CE3 1 
ATOM   2177 C  CZ2 . TRP A 1 317 ? -13.411 28.372 39.497 1.00 26.33  ? 453  TRP A CZ2 1 
ATOM   2178 C  CZ3 . TRP A 1 317 ? -13.579 25.958 39.625 1.00 26.34  ? 453  TRP A CZ3 1 
ATOM   2179 C  CH2 . TRP A 1 317 ? -12.865 27.125 39.305 1.00 26.77  ? 453  TRP A CH2 1 
ATOM   2180 N  N   . ASN A 1 318 ? -16.166 27.254 44.151 1.00 28.46  ? 454  ASN A N   1 
ATOM   2181 C  CA  . ASN A 1 318 ? -15.910 27.940 45.416 1.00 25.07  ? 454  ASN A CA  1 
ATOM   2182 C  C   . ASN A 1 318 ? -14.605 28.715 45.342 1.00 31.35  ? 454  ASN A C   1 
ATOM   2183 O  O   . ASN A 1 318 ? -13.888 28.624 44.343 1.00 36.28  ? 454  ASN A O   1 
ATOM   2184 C  CB  . ASN A 1 318 ? -15.859 26.920 46.561 1.00 20.13  ? 454  ASN A CB  1 
ATOM   2185 C  CG  . ASN A 1 318 ? -14.727 25.918 46.400 1.00 23.19  ? 454  ASN A CG  1 
ATOM   2186 O  OD1 . ASN A 1 318 ? -13.599 26.176 46.814 1.00 22.15  ? 454  ASN A OD1 1 
ATOM   2187 N  ND2 . ASN A 1 318 ? -15.023 24.771 45.803 1.00 27.54  ? 454  ASN A ND2 1 
ATOM   2188 N  N   . ARG A 1 319 ? -14.285 29.457 46.400 1.00 32.13  ? 455  ARG A N   1 
ATOM   2189 C  CA  . ARG A 1 319 ? -13.134 30.363 46.385 1.00 29.19  ? 455  ARG A CA  1 
ATOM   2190 C  C   . ARG A 1 319 ? -11.799 29.616 46.420 1.00 25.50  ? 455  ARG A C   1 
ATOM   2191 O  O   . ARG A 1 319 ? -10.772 30.153 46.000 1.00 24.08  ? 455  ARG A O   1 
ATOM   2192 C  CB  . ARG A 1 319 ? -13.202 31.312 47.577 1.00 29.94  ? 455  ARG A CB  1 
ATOM   2193 C  CG  . ARG A 1 319 ? -12.843 30.625 48.892 1.00 37.58  ? 455  ARG A CG  1 
ATOM   2194 C  CD  . ARG A 1 319 ? -13.124 31.482 50.108 1.00 44.44  ? 455  ARG A CD  1 
ATOM   2195 N  NE  . ARG A 1 319 ? -14.548 31.741 50.275 1.00 48.83  ? 455  ARG A NE  1 
ATOM   2196 C  CZ  . ARG A 1 319 ? -15.067 32.956 50.420 1.00 59.21  ? 455  ARG A CZ  1 
ATOM   2197 N  NH1 . ARG A 1 319 ? -14.277 34.018 50.419 1.00 66.52  ? 455  ARG A NH1 1 
ATOM   2198 N  NH2 . ARG A 1 319 ? -16.373 33.111 50.563 1.00 65.37  ? 455  ARG A NH2 1 
ATOM   2199 N  N   . VAL A 1 320 ? -11.803 28.387 46.926 1.00 23.77  ? 456  VAL A N   1 
ATOM   2200 C  CA  . VAL A 1 320 ? -10.558 27.628 47.028 1.00 23.59  ? 456  VAL A CA  1 
ATOM   2201 C  C   . VAL A 1 320 ? -10.083 27.178 45.649 1.00 26.73  ? 456  VAL A C   1 
ATOM   2202 O  O   . VAL A 1 320 ? -8.921  27.387 45.286 1.00 32.88  ? 456  VAL A O   1 
ATOM   2203 C  CB  . VAL A 1 320 ? -10.712 26.418 47.969 1.00 32.03  ? 456  VAL A CB  1 
ATOM   2204 C  CG1 . VAL A 1 320 ? -9.403  25.636 48.054 1.00 31.92  ? 456  VAL A CG1 1 
ATOM   2205 C  CG2 . VAL A 1 320 ? -11.134 26.885 49.349 1.00 30.55  ? 456  VAL A CG2 1 
ATOM   2206 N  N   . CYS A 1 321 ? -10.985 26.568 44.883 1.00 23.40  ? 457  CYS A N   1 
ATOM   2207 C  CA  . CYS A 1 321 ? -10.685 26.182 43.504 1.00 21.25  ? 457  CYS A CA  1 
ATOM   2208 C  C   . CYS A 1 321 ? -10.271 27.390 42.659 1.00 23.12  ? 457  CYS A C   1 
ATOM   2209 O  O   . CYS A 1 321 ? -9.339  27.300 41.853 1.00 28.47  ? 457  CYS A O   1 
ATOM   2210 C  CB  . CYS A 1 321 ? -11.892 25.460 42.879 1.00 17.57  ? 457  CYS A CB  1 
ATOM   2211 S  SG  . CYS A 1 321 ? -12.271 23.854 43.666 1.00 26.05  ? 457  CYS A SG  1 
ATOM   2212 N  N   . MET A 1 322 ? -10.947 28.521 42.855 1.00 20.86  ? 458  MET A N   1 
ATOM   2213 C  CA  . MET A 1 322 ? -10.599 29.755 42.150 1.00 18.08  ? 458  MET A CA  1 
ATOM   2214 C  C   . MET A 1 322 ? -9.176  30.193 42.455 1.00 19.87  ? 458  MET A C   1 
ATOM   2215 O  O   . MET A 1 322 ? -8.399  30.520 41.543 1.00 24.34  ? 458  MET A O   1 
ATOM   2216 C  CB  . MET A 1 322 ? -11.547 30.892 42.548 1.00 23.04  ? 458  MET A CB  1 
ATOM   2217 C  CG  . MET A 1 322 ? -12.966 30.754 42.032 1.00 33.14  ? 458  MET A CG  1 
ATOM   2218 S  SD  . MET A 1 322 ? -14.098 31.901 42.861 1.00 38.13  ? 458  MET A SD  1 
ATOM   2219 C  CE  . MET A 1 322 ? -13.436 33.483 42.367 1.00 27.99  ? 458  MET A CE  1 
ATOM   2220 N  N   . GLY A 1 323 ? -8.833  30.238 43.738 1.00 20.89  ? 459  GLY A N   1 
ATOM   2221 C  CA  . GLY A 1 323 ? -7.501  30.687 44.117 1.00 21.50  ? 459  GLY A CA  1 
ATOM   2222 C  C   . GLY A 1 323 ? -6.414  29.709 43.678 1.00 23.58  ? 459  GLY A C   1 
ATOM   2223 O  O   . GLY A 1 323 ? -5.358  30.128 43.193 1.00 25.59  ? 459  GLY A O   1 
ATOM   2224 N  N   . ASP A 1 324 ? -6.681  28.411 43.834 1.00 19.39  ? 460  ASP A N   1 
ATOM   2225 C  CA  . ASP A 1 324 ? -5.654  27.384 43.617 1.00 27.58  ? 460  ASP A CA  1 
ATOM   2226 C  C   . ASP A 1 324 ? -5.510  26.974 42.160 1.00 28.29  ? 460  ASP A C   1 
ATOM   2227 O  O   . ASP A 1 324 ? -4.399  26.758 41.682 1.00 23.87  ? 460  ASP A O   1 
ATOM   2228 C  CB  . ASP A 1 324 ? -5.969  26.122 44.423 1.00 28.79  ? 460  ASP A CB  1 
ATOM   2229 C  CG  . ASP A 1 324 ? -5.691  26.276 45.903 1.00 32.02  ? 460  ASP A CG  1 
ATOM   2230 O  OD1 . ASP A 1 324 ? -5.085  27.295 46.296 1.00 34.15  ? 460  ASP A OD1 1 
ATOM   2231 O  OD2 . ASP A 1 324 ? -6.068  25.351 46.668 1.00 33.98  ? 460  ASP A OD2 1 
ATOM   2232 N  N   . HIS A 1 325 ? -6.633  26.837 41.459 1.00 25.38  ? 461  HIS A N   1 
ATOM   2233 C  CA  . HIS A 1 325 ? -6.588  26.337 40.086 1.00 22.96  ? 461  HIS A CA  1 
ATOM   2234 C  C   . HIS A 1 325 ? -7.745  26.812 39.229 1.00 25.75  ? 461  HIS A C   1 
ATOM   2235 O  O   . HIS A 1 325 ? -8.456  25.996 38.649 1.00 22.46  ? 461  HIS A O   1 
ATOM   2236 C  CB  . HIS A 1 325 ? -6.530  24.800 40.067 1.00 19.57  ? 461  HIS A CB  1 
ATOM   2237 C  CG  . HIS A 1 325 ? -7.549  24.138 40.940 1.00 21.85  ? 461  HIS A CG  1 
ATOM   2238 N  ND1 . HIS A 1 325 ? -7.225  23.548 42.143 1.00 27.40  ? 461  HIS A ND1 1 
ATOM   2239 C  CD2 . HIS A 1 325 ? -8.885  23.953 40.779 1.00 25.03  ? 461  HIS A CD2 1 
ATOM   2240 C  CE1 . HIS A 1 325 ? -8.316  23.022 42.685 1.00 26.21  ? 461  HIS A CE1 1 
ATOM   2241 N  NE2 . HIS A 1 325 ? -9.335  23.261 41.879 1.00 32.48  ? 461  HIS A NE2 1 
ATOM   2242 N  N   . TRP A 1 326 ? -7.929  28.127 39.135 1.00 27.67  ? 462  TRP A N   1 
ATOM   2243 C  CA  . TRP A 1 326 ? -9.015  28.679 38.341 1.00 23.78  ? 462  TRP A CA  1 
ATOM   2244 C  C   . TRP A 1 326 ? -8.954  28.150 36.911 1.00 27.68  ? 462  TRP A C   1 
ATOM   2245 O  O   . TRP A 1 326 ? -9.982  27.841 36.296 1.00 24.68  ? 462  TRP A O   1 
ATOM   2246 C  CB  . TRP A 1 326 ? -8.936  30.200 38.327 1.00 21.02  ? 462  TRP A CB  1 
ATOM   2247 C  CG  . TRP A 1 326 ? -10.267 30.830 38.123 1.00 26.31  ? 462  TRP A CG  1 
ATOM   2248 C  CD1 . TRP A 1 326 ? -11.318 30.323 37.412 1.00 26.65  ? 462  TRP A CD1 1 
ATOM   2249 C  CD2 . TRP A 1 326 ? -10.711 32.078 38.664 1.00 28.22  ? 462  TRP A CD2 1 
ATOM   2250 N  NE1 . TRP A 1 326 ? -12.382 31.195 37.459 1.00 28.23  ? 462  TRP A NE1 1 
ATOM   2251 C  CE2 . TRP A 1 326 ? -12.035 32.279 38.223 1.00 29.71  ? 462  TRP A CE2 1 
ATOM   2252 C  CE3 . TRP A 1 326 ? -10.110 33.051 39.464 1.00 29.94  ? 462  TRP A CE3 1 
ATOM   2253 C  CZ2 . TRP A 1 326 ? -12.772 33.415 38.563 1.00 35.09  ? 462  TRP A CZ2 1 
ATOM   2254 C  CZ3 . TRP A 1 326 ? -10.842 34.172 39.803 1.00 40.02  ? 462  TRP A CZ3 1 
ATOM   2255 C  CH2 . TRP A 1 326 ? -12.158 34.349 39.349 1.00 38.22  ? 462  TRP A CH2 1 
ATOM   2256 N  N   . PHE A 1 327 ? -7.737  28.049 36.392 1.00 28.30  ? 463  PHE A N   1 
ATOM   2257 C  CA  . PHE A 1 327 ? -7.503  27.382 35.123 1.00 31.53  ? 463  PHE A CA  1 
ATOM   2258 C  C   . PHE A 1 327 ? -6.209  26.592 35.235 1.00 33.60  ? 463  PHE A C   1 
ATOM   2259 O  O   . PHE A 1 327 ? -5.398  26.848 36.130 1.00 31.97  ? 463  PHE A O   1 
ATOM   2260 C  CB  . PHE A 1 327 ? -7.394  28.397 33.985 1.00 25.82  ? 463  PHE A CB  1 
ATOM   2261 C  CG  . PHE A 1 327 ? -6.154  29.253 34.048 1.00 26.96  ? 463  PHE A CG  1 
ATOM   2262 C  CD1 . PHE A 1 327 ? -6.156  30.447 34.763 1.00 25.53  ? 463  PHE A CD1 1 
ATOM   2263 C  CD2 . PHE A 1 327 ? -4.986  28.874 33.378 1.00 28.79  ? 463  PHE A CD2 1 
ATOM   2264 C  CE1 . PHE A 1 327 ? -5.019  31.245 34.823 1.00 27.37  ? 463  PHE A CE1 1 
ATOM   2265 C  CE2 . PHE A 1 327 ? -3.840  29.672 33.440 1.00 27.99  ? 463  PHE A CE2 1 
ATOM   2266 C  CZ  . PHE A 1 327 ? -3.860  30.854 34.161 1.00 27.16  ? 463  PHE A CZ  1 
ATOM   2267 N  N   . ASP A 1 328 ? -6.005  25.648 34.322 1.00 36.93  ? 464  ASP A N   1 
ATOM   2268 C  CA  . ASP A 1 328 ? -4.723  24.960 34.232 1.00 43.78  ? 464  ASP A CA  1 
ATOM   2269 C  C   . ASP A 1 328 ? -4.386  24.661 32.779 1.00 47.11  ? 464  ASP A C   1 
ATOM   2270 O  O   . ASP A 1 328 ? -5.224  24.157 32.029 1.00 53.22  ? 464  ASP A O   1 
ATOM   2271 C  CB  . ASP A 1 328 ? -4.729  23.667 35.054 1.00 53.46  ? 464  ASP A CB  1 
ATOM   2272 C  CG  . ASP A 1 328 ? -3.362  22.990 35.086 1.00 67.54  ? 464  ASP A CG  1 
ATOM   2273 O  OD1 . ASP A 1 328 ? -2.327  23.696 35.075 1.00 68.92  ? 464  ASP A OD1 1 
ATOM   2274 O  OD2 . ASP A 1 328 ? -3.324  21.745 35.121 1.00 72.64  ? 464  ASP A OD2 1 
ATOM   2275 N  N   . VAL A 1 329 ? -3.163  24.995 32.384 1.00 52.51  ? 465  VAL A N   1 
ATOM   2276 C  CA  . VAL A 1 329 ? -2.671  24.720 31.039 1.00 69.77  ? 465  VAL A CA  1 
ATOM   2277 C  C   . VAL A 1 329 ? -1.223  24.253 31.143 1.00 83.04  ? 465  VAL A C   1 
ATOM   2278 O  O   . VAL A 1 329 ? -0.469  24.740 31.991 1.00 82.75  ? 465  VAL A O   1 
ATOM   2279 C  CB  . VAL A 1 329 ? -2.746  25.970 30.120 1.00 66.68  ? 465  VAL A CB  1 
ATOM   2280 C  CG1 . VAL A 1 329 ? -2.087  25.694 28.768 1.00 68.17  ? 465  VAL A CG1 1 
ATOM   2281 C  CG2 . VAL A 1 329 ? -4.195  26.424 29.924 1.00 62.02  ? 465  VAL A CG2 1 
ATOM   2282 O  OXT . VAL A 1 329 ? -0.776  23.384 30.391 1.00 91.89  ? 465  VAL A OXT 1 
HETATM 2283 ZN ZN  . ZN  B 2 .   ? 6.105   33.452 50.516 1.00 28.32  ? 1466 ZN  A ZN  1 
HETATM 2284 ZN ZN  . ZN  C 2 .   ? 13.788  21.619 24.180 1.00 48.57  ? 1467 ZN  A ZN  1 
HETATM 2285 ZN ZN  . ZN  D 2 .   ? -11.203 22.429 42.309 1.00 27.00  ? 1468 ZN  A ZN  1 
HETATM 2286 ZN ZN  . ZN  E 2 .   ? -15.365 48.577 40.880 1.00 38.41  ? 1469 ZN  A ZN  1 
HETATM 2287 ZN ZN  . ZN  F 2 .   ? 16.504  17.487 37.432 1.00 36.04  ? 1470 ZN  A ZN  1 
HETATM 2288 ZN ZN  . ZN  G 2 .   ? 33.263  46.570 46.306 1.00 83.54  ? 1471 ZN  A ZN  1 
HETATM 2289 ZN ZN  . ZN  H 2 .   ? 37.093  31.209 41.961 1.00 53.61  ? 1472 ZN  A ZN  1 
HETATM 2290 ZN ZN  . ZN  I 2 .   ? -26.265 19.373 36.298 1.00 31.50  ? 1473 ZN  A ZN  1 
HETATM 2291 S  S   . SO4 J 3 .   ? -5.766  36.760 50.622 1.00 58.08  ? 1474 SO4 A S   1 
HETATM 2292 O  O1  . SO4 J 3 .   ? -4.760  37.410 51.445 1.00 67.35  ? 1474 SO4 A O1  1 
HETATM 2293 O  O2  . SO4 J 3 .   ? -6.299  37.702 49.650 1.00 66.00  ? 1474 SO4 A O2  1 
HETATM 2294 O  O3  . SO4 J 3 .   ? -5.156  35.651 49.910 1.00 63.54  ? 1474 SO4 A O3  1 
HETATM 2295 O  O4  . SO4 J 3 .   ? -6.836  36.279 51.485 1.00 66.59  ? 1474 SO4 A O4  1 
HETATM 2296 S  S   . SO4 K 3 .   ? -17.402 30.100 48.589 0.45 37.77  ? 1475 SO4 A S   1 
HETATM 2297 O  O1  . SO4 K 3 .   ? -15.959 29.995 48.518 0.45 41.25  ? 1475 SO4 A O1  1 
HETATM 2298 O  O2  . SO4 K 3 .   ? -17.910 30.745 47.392 0.45 41.37  ? 1475 SO4 A O2  1 
HETATM 2299 O  O3  . SO4 K 3 .   ? -17.981 28.777 48.681 0.45 41.47  ? 1475 SO4 A O3  1 
HETATM 2300 O  O4  . SO4 K 3 .   ? -17.751 30.876 49.765 0.45 41.75  ? 1475 SO4 A O4  1 
HETATM 2301 S  S   . SO4 L 3 .   ? 12.253  41.984 40.408 1.00 114.64 ? 1476 SO4 A S   1 
HETATM 2302 O  O1  . SO4 L 3 .   ? 12.623  42.641 39.158 1.00 114.05 ? 1476 SO4 A O1  1 
HETATM 2303 O  O2  . SO4 L 3 .   ? 10.846  42.241 40.699 1.00 114.74 ? 1476 SO4 A O2  1 
HETATM 2304 O  O3  . SO4 L 3 .   ? 12.465  40.546 40.283 1.00 114.99 ? 1476 SO4 A O3  1 
HETATM 2305 O  O4  . SO4 L 3 .   ? 13.075  42.504 41.495 1.00 114.49 ? 1476 SO4 A O4  1 
HETATM 2306 C  C1  . GOL M 4 .   ? -8.933  16.317 36.320 1.00 80.18  ? 1477 GOL A C1  1 
HETATM 2307 O  O1  . GOL M 4 .   ? -8.097  17.451 36.200 1.00 77.30  ? 1477 GOL A O1  1 
HETATM 2308 C  C2  . GOL M 4 .   ? -8.707  15.348 35.159 1.00 79.70  ? 1477 GOL A C2  1 
HETATM 2309 O  O2  . GOL M 4 .   ? -8.258  16.039 34.010 1.00 84.51  ? 1477 GOL A O2  1 
HETATM 2310 C  C3  . GOL M 4 .   ? -10.008 14.617 34.848 1.00 75.08  ? 1477 GOL A C3  1 
HETATM 2311 O  O3  . GOL M 4 .   ? -10.329 14.759 33.482 1.00 73.61  ? 1477 GOL A O3  1 
HETATM 2312 O  O   . HOH N 5 .   ? -0.443  20.775 43.166 1.00 34.15  ? 2001 HOH A O   1 
HETATM 2313 O  O   . HOH N 5 .   ? -6.879  22.904 45.585 1.00 39.67  ? 2002 HOH A O   1 
HETATM 2314 O  O   . HOH N 5 .   ? 0.465   23.465 37.405 1.00 32.15  ? 2003 HOH A O   1 
HETATM 2315 O  O   . HOH N 5 .   ? -2.015  27.279 42.772 1.00 26.82  ? 2004 HOH A O   1 
HETATM 2316 O  O   . HOH N 5 .   ? 2.782   28.986 37.458 1.00 26.54  ? 2005 HOH A O   1 
HETATM 2317 O  O   . HOH N 5 .   ? 6.961   38.432 46.472 1.00 30.33  ? 2006 HOH A O   1 
HETATM 2318 O  O   . HOH N 5 .   ? 7.726   38.314 42.871 1.00 27.91  ? 2007 HOH A O   1 
HETATM 2319 O  O   . HOH N 5 .   ? 16.211  35.652 43.636 1.00 38.33  ? 2008 HOH A O   1 
HETATM 2320 O  O   . HOH N 5 .   ? 4.954   37.276 49.793 1.00 24.48  ? 2009 HOH A O   1 
HETATM 2321 O  O   . HOH N 5 .   ? 14.446  37.533 47.481 1.00 41.99  ? 2010 HOH A O   1 
HETATM 2322 O  O   . HOH N 5 .   ? 13.343  28.191 44.069 1.00 41.10  ? 2011 HOH A O   1 
HETATM 2323 O  O   . HOH N 5 .   ? 7.096   24.945 45.087 1.00 34.72  ? 2012 HOH A O   1 
HETATM 2324 O  O   . HOH N 5 .   ? 1.867   28.108 49.068 1.00 46.63  ? 2013 HOH A O   1 
HETATM 2325 O  O   . HOH N 5 .   ? -10.343 36.993 44.315 1.00 28.80  ? 2014 HOH A O   1 
HETATM 2326 O  O   . HOH N 5 .   ? -13.258 40.533 42.603 1.00 31.04  ? 2015 HOH A O   1 
HETATM 2327 O  O   . HOH N 5 .   ? -9.262  40.777 45.149 1.00 46.99  ? 2016 HOH A O   1 
HETATM 2328 O  O   . HOH N 5 .   ? -13.156 47.704 35.680 1.00 40.89  ? 2017 HOH A O   1 
HETATM 2329 O  O   . HOH N 5 .   ? -10.584 54.459 38.895 1.00 40.51  ? 2018 HOH A O   1 
HETATM 2330 O  O   . HOH N 5 .   ? -12.212 44.616 48.706 1.00 47.45  ? 2019 HOH A O   1 
HETATM 2331 O  O   . HOH N 5 .   ? -14.700 36.920 41.380 1.00 39.74  ? 2020 HOH A O   1 
HETATM 2332 O  O   . HOH N 5 .   ? -15.846 35.599 39.788 1.00 40.02  ? 2021 HOH A O   1 
HETATM 2333 O  O   . HOH N 5 .   ? -19.391 41.043 30.727 1.00 39.12  ? 2022 HOH A O   1 
HETATM 2334 O  O   . HOH N 5 .   ? -16.612 30.802 33.685 1.00 37.91  ? 2023 HOH A O   1 
HETATM 2335 O  O   . HOH N 5 .   ? -15.638 31.827 37.044 1.00 43.91  ? 2024 HOH A O   1 
HETATM 2336 O  O   . HOH N 5 .   ? -8.167  28.692 26.187 1.00 46.87  ? 2025 HOH A O   1 
HETATM 2337 O  O   . HOH N 5 .   ? -1.765  29.663 28.463 1.00 45.31  ? 2026 HOH A O   1 
HETATM 2338 O  O   . HOH N 5 .   ? -2.229  31.933 27.311 1.00 38.10  ? 2027 HOH A O   1 
HETATM 2339 O  O   . HOH N 5 .   ? 1.404   26.891 33.576 1.00 37.73  ? 2028 HOH A O   1 
HETATM 2340 O  O   . HOH N 5 .   ? -6.122  40.214 32.410 1.00 21.69  ? 2029 HOH A O   1 
HETATM 2341 O  O   . HOH N 5 .   ? -4.958  41.376 34.689 1.00 25.10  ? 2030 HOH A O   1 
HETATM 2342 O  O   . HOH N 5 .   ? -6.843  43.113 25.993 1.00 48.53  ? 2031 HOH A O   1 
HETATM 2343 O  O   . HOH N 5 .   ? -3.863  45.206 27.212 1.00 49.62  ? 2032 HOH A O   1 
HETATM 2344 O  O   . HOH N 5 .   ? -8.564  41.259 32.498 1.00 20.79  ? 2033 HOH A O   1 
HETATM 2345 O  O   . HOH N 5 .   ? -6.590  44.063 33.638 1.00 20.93  ? 2034 HOH A O   1 
HETATM 2346 O  O   . HOH N 5 .   ? -11.958 44.079 30.354 1.00 31.72  ? 2035 HOH A O   1 
HETATM 2347 O  O   . HOH N 5 .   ? -14.800 38.623 29.149 1.00 45.06  ? 2036 HOH A O   1 
HETATM 2348 O  O   . HOH N 5 .   ? -20.217 46.937 36.884 1.00 39.39  ? 2037 HOH A O   1 
HETATM 2349 O  O   . HOH N 5 .   ? -10.284 38.057 46.433 1.00 41.00  ? 2038 HOH A O   1 
HETATM 2350 O  O   . HOH N 5 .   ? -14.143 48.619 32.394 0.50 49.69  ? 2039 HOH A O   1 
HETATM 2351 O  O   . HOH N 5 .   ? -3.417  43.219 34.936 1.00 45.71  ? 2040 HOH A O   1 
HETATM 2352 O  O   . HOH N 5 .   ? -1.647  42.716 38.420 1.00 54.77  ? 2041 HOH A O   1 
HETATM 2353 O  O   . HOH N 5 .   ? 1.029   39.276 40.631 1.00 24.88  ? 2042 HOH A O   1 
HETATM 2354 O  O   . HOH N 5 .   ? 2.947   37.340 47.580 1.00 24.48  ? 2043 HOH A O   1 
HETATM 2355 O  O   . HOH N 5 .   ? 0.991   42.033 40.129 1.00 50.08  ? 2044 HOH A O   1 
HETATM 2356 O  O   . HOH N 5 .   ? -3.236  36.447 53.656 1.00 25.52  ? 2045 HOH A O   1 
HETATM 2357 O  O   . HOH N 5 .   ? -0.472  43.024 57.026 1.00 42.70  ? 2046 HOH A O   1 
HETATM 2358 O  O   . HOH N 5 .   ? -2.698  44.815 54.464 1.00 42.09  ? 2047 HOH A O   1 
HETATM 2359 O  O   . HOH N 5 .   ? 7.105   40.665 43.797 1.00 46.09  ? 2048 HOH A O   1 
HETATM 2360 O  O   . HOH N 5 .   ? 4.264   41.050 41.836 1.00 40.31  ? 2049 HOH A O   1 
HETATM 2361 O  O   . HOH N 5 .   ? 2.898   37.962 37.325 1.00 35.39  ? 2050 HOH A O   1 
HETATM 2362 O  O   . HOH N 5 .   ? 8.577   32.674 29.032 1.00 18.12  ? 2051 HOH A O   1 
HETATM 2363 O  O   . HOH N 5 .   ? 2.389   33.075 27.924 1.00 52.99  ? 2052 HOH A O   1 
HETATM 2364 O  O   . HOH N 5 .   ? 10.602  15.569 36.913 1.00 32.36  ? 2053 HOH A O   1 
HETATM 2365 O  O   . HOH N 5 .   ? 14.125  12.449 31.349 1.00 34.81  ? 2054 HOH A O   1 
HETATM 2366 O  O   . HOH N 5 .   ? 18.874  7.654  35.340 1.00 36.26  ? 2055 HOH A O   1 
HETATM 2367 O  O   . HOH N 5 .   ? 19.343  14.657 41.801 1.00 49.68  ? 2056 HOH A O   1 
HETATM 2368 O  O   . HOH N 5 .   ? 9.396   16.573 43.907 1.00 38.67  ? 2057 HOH A O   1 
HETATM 2369 O  O   . HOH N 5 .   ? 11.566  20.377 41.013 1.00 29.53  ? 2058 HOH A O   1 
HETATM 2370 O  O   . HOH N 5 .   ? 11.025  28.242 26.794 1.00 38.05  ? 2059 HOH A O   1 
HETATM 2371 O  O   . HOH N 5 .   ? 12.693  21.334 16.755 1.00 42.48  ? 2060 HOH A O   1 
HETATM 2372 O  O   . HOH N 5 .   ? 20.599  23.199 41.982 1.00 50.69  ? 2061 HOH A O   1 
HETATM 2373 O  O   . HOH N 5 .   ? 16.205  25.004 43.596 1.00 41.76  ? 2062 HOH A O   1 
HETATM 2374 O  O   . HOH N 5 .   ? 32.184  34.349 36.166 1.00 28.39  ? 2063 HOH A O   1 
HETATM 2375 O  O   . HOH N 5 .   ? 29.633  32.181 40.219 1.00 49.06  ? 2064 HOH A O   1 
HETATM 2376 O  O   . HOH N 5 .   ? 26.749  39.360 34.950 1.00 36.51  ? 2065 HOH A O   1 
HETATM 2377 O  O   . HOH N 5 .   ? 18.176  40.652 31.039 1.00 35.34  ? 2066 HOH A O   1 
HETATM 2378 O  O   . HOH N 5 .   ? 13.443  32.344 20.819 1.00 55.29  ? 2067 HOH A O   1 
HETATM 2379 O  O   . HOH N 5 .   ? 9.502   31.286 26.953 1.00 42.59  ? 2068 HOH A O   1 
HETATM 2380 O  O   . HOH N 5 .   ? 10.554  39.948 31.953 1.00 40.20  ? 2069 HOH A O   1 
HETATM 2381 O  O   . HOH N 5 .   ? 23.721  46.035 33.180 1.00 40.75  ? 2070 HOH A O   1 
HETATM 2382 O  O   . HOH N 5 .   ? 28.210  43.610 41.854 1.00 51.20  ? 2071 HOH A O   1 
HETATM 2383 O  O   . HOH N 5 .   ? 21.898  43.581 31.399 1.00 34.01  ? 2072 HOH A O   1 
HETATM 2384 O  O   . HOH N 5 .   ? 46.014  30.642 41.801 1.00 53.01  ? 2073 HOH A O   1 
HETATM 2385 O  O   . HOH N 5 .   ? 35.810  38.242 36.272 1.00 41.42  ? 2074 HOH A O   1 
HETATM 2386 O  O   . HOH N 5 .   ? -25.128 12.689 41.317 1.00 42.57  ? 2075 HOH A O   1 
HETATM 2387 O  O   . HOH N 5 .   ? -29.059 12.919 38.745 1.00 45.22  ? 2076 HOH A O   1 
HETATM 2388 O  O   . HOH N 5 .   ? -18.996 25.368 31.373 1.00 51.05  ? 2077 HOH A O   1 
HETATM 2389 O  O   . HOH N 5 .   ? -6.854  22.395 32.603 1.00 47.05  ? 2078 HOH A O   1 
HETATM 2390 O  O   . HOH N 5 .   ? -14.344 25.453 31.943 1.00 38.10  ? 2079 HOH A O   1 
HETATM 2391 O  O   . HOH N 5 .   ? -16.567 28.689 31.794 1.00 57.73  ? 2080 HOH A O   1 
HETATM 2392 O  O   . HOH N 5 .   ? -23.891 25.914 42.265 1.00 42.83  ? 2081 HOH A O   1 
HETATM 2393 O  O   . HOH N 5 .   ? -12.377 21.438 48.590 0.50 50.84  ? 2082 HOH A O   1 
HETATM 2394 O  O   . HOH N 5 .   ? -20.069 19.686 46.376 1.00 19.33  ? 2083 HOH A O   1 
HETATM 2395 O  O   . HOH N 5 .   ? -22.744 22.718 49.388 1.00 44.62  ? 2084 HOH A O   1 
HETATM 2396 O  O   . HOH N 5 .   ? -16.227 32.448 39.696 1.00 37.29  ? 2085 HOH A O   1 
HETATM 2397 O  O   . HOH N 5 .   ? -5.790  25.312 49.008 1.00 39.10  ? 2086 HOH A O   1 
HETATM 2398 O  O   . HOH N 5 .   ? 14.311  44.068 42.943 1.00 58.98  ? 2087 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 6   ? 0.9414 0.7657 0.9459 -0.0498 0.0719  0.1279  142 ILE A N   
2    C CA  . ILE A 6   ? 0.8916 0.7425 0.9062 -0.0544 0.0735  0.1162  142 ILE A CA  
3    C C   . ILE A 6   ? 0.7758 0.6074 0.7862 -0.0454 0.0741  0.1038  142 ILE A C   
4    O O   . ILE A 6   ? 0.8470 0.6566 0.8465 -0.0291 0.0774  0.1034  142 ILE A O   
5    C CB  . ILE A 6   ? 0.8970 0.7916 0.9185 -0.0478 0.0800  0.1161  142 ILE A CB  
6    C CG1 . ILE A 6   ? 0.9390 0.8350 0.9551 -0.0293 0.0847  0.1163  142 ILE A CG1 
7    C CG2 . ILE A 6   ? 0.8944 0.8093 0.9164 -0.0545 0.0819  0.1269  142 ILE A CG2 
8    C CD1 . ILE A 6   ? 0.9830 0.9152 1.0061 -0.0251 0.0882  0.1103  142 ILE A CD1 
9    N N   . TYR A 7   ? 0.5881 0.4294 0.6059 -0.0547 0.0717  0.0945  143 TYR A N   
10   C CA  . TYR A 7   ? 0.5140 0.3417 0.5239 -0.0474 0.0709  0.0813  143 TYR A CA  
11   C C   . TYR A 7   ? 0.4899 0.3552 0.5081 -0.0398 0.0744  0.0761  143 TYR A C   
12   O O   . TYR A 7   ? 0.4003 0.2911 0.4333 -0.0492 0.0740  0.0760  143 TYR A O   
13   C CB  . TYR A 7   ? 0.5408 0.3501 0.5494 -0.0635 0.0618  0.0734  143 TYR A CB  
14   C CG  . TYR A 7   ? 0.6772 0.4731 0.6699 -0.0548 0.0574  0.0569  143 TYR A CG  
15   C CD1 . TYR A 7   ? 0.7663 0.5425 0.7410 -0.0344 0.0607  0.0508  143 TYR A CD1 
16   C CD2 . TYR A 7   ? 0.7623 0.5690 0.7576 -0.0658 0.0503  0.0484  143 TYR A CD2 
17   C CE1 . TYR A 7   ? 0.8459 0.6144 0.8040 -0.0248 0.0583  0.0357  143 TYR A CE1 
18   C CE2 . TYR A 7   ? 0.8269 0.6251 0.8045 -0.0575 0.0466  0.0339  143 TYR A CE2 
19   C CZ  . TYR A 7   ? 0.9213 0.7007 0.8795 -0.0369 0.0513  0.0272  143 TYR A CZ  
20   O OH  . TYR A 7   ? 1.0558 0.8307 0.9942 -0.0268 0.0493  0.0129  143 TYR A OH  
21   N N   . ASN A 8   ? 0.4267 0.2956 0.4372 -0.0227 0.0776  0.0732  144 ASN A N   
22   C CA  . ASN A 8   ? 0.4044 0.3052 0.4232 -0.0170 0.0797  0.0700  144 ASN A CA  
23   C C   . ASN A 8   ? 0.4045 0.3030 0.4151 -0.0114 0.0772  0.0605  144 ASN A C   
24   O O   . ASN A 8   ? 0.4763 0.3600 0.4722 0.0018  0.0788  0.0569  144 ASN A O   
25   C CB  . ASN A 8   ? 0.4047 0.3209 0.4240 -0.0042 0.0844  0.0763  144 ASN A CB  
26   C CG  . ASN A 8   ? 0.4558 0.3861 0.4826 -0.0095 0.0868  0.0848  144 ASN A CG  
27   O OD1 . ASN A 8   ? 0.4638 0.4128 0.5018 -0.0184 0.0869  0.0833  144 ASN A OD1 
28   N ND2 . ASN A 8   ? 0.4864 0.4086 0.5060 -0.0026 0.0888  0.0939  144 ASN A ND2 
29   N N   . SER A 9   ? 0.3991 0.3140 0.4182 -0.0194 0.0739  0.0571  145 SER A N   
30   C CA  . SER A 9   ? 0.4018 0.3193 0.4111 -0.0138 0.0719  0.0503  145 SER A CA  
31   C C   . SER A 9   ? 0.4024 0.3501 0.4212 -0.0070 0.0751  0.0551  145 SER A C   
32   O O   . SER A 9   ? 0.4536 0.4104 0.4650 -0.0010 0.0752  0.0531  145 SER A O   
33   C CB  . SER A 9   ? 0.3303 0.2448 0.3392 -0.0268 0.0641  0.0450  145 SER A CB  
34   O OG  . SER A 9   ? 0.5499 0.4871 0.5803 -0.0366 0.0625  0.0507  145 SER A OG  
35   N N   . PHE A 10  ? 0.3490 0.3122 0.3830 -0.0085 0.0774  0.0616  146 PHE A N   
36   C CA  . PHE A 10  ? 0.2826 0.2714 0.3287 -0.0065 0.0780  0.0665  146 PHE A CA  
37   C C   . PHE A 10  ? 0.2770 0.2761 0.3254 0.0011  0.0816  0.0715  146 PHE A C   
38   O O   . PHE A 10  ? 0.3125 0.3063 0.3612 0.0002  0.0827  0.0727  146 PHE A O   
39   C CB  . PHE A 10  ? 0.1813 0.1803 0.2454 -0.0168 0.0746  0.0675  146 PHE A CB  
40   C CG  . PHE A 10  ? 0.2054 0.1985 0.2716 -0.0249 0.0705  0.0646  146 PHE A CG  
41   C CD1 . PHE A 10  ? 0.2000 0.1942 0.2591 -0.0252 0.0669  0.0637  146 PHE A CD1 
42   C CD2 . PHE A 10  ? 0.1683 0.1600 0.2439 -0.0320 0.0701  0.0637  146 PHE A CD2 
43   C CE1 . PHE A 10  ? 0.2340 0.2268 0.2957 -0.0336 0.0612  0.0618  146 PHE A CE1 
44   C CE2 . PHE A 10  ? 0.2516 0.2441 0.3327 -0.0399 0.0656  0.0629  146 PHE A CE2 
45   C CZ  . PHE A 10  ? 0.2421 0.2347 0.3167 -0.0413 0.0602  0.0619  146 PHE A CZ  
46   N N   . TYR A 11  ? 0.2747 0.2928 0.3255 0.0077  0.0831  0.0762  147 TYR A N   
47   C CA  . TYR A 11  ? 0.2573 0.2933 0.3142 0.0132  0.0847  0.0827  147 TYR A CA  
48   C C   . TYR A 11  ? 0.2718 0.3327 0.3456 0.0058  0.0812  0.0886  147 TYR A C   
49   O O   . TYR A 11  ? 0.2840 0.3535 0.3611 0.0036  0.0807  0.0915  147 TYR A O   
50   C CB  . TYR A 11  ? 0.2733 0.3114 0.3187 0.0301  0.0901  0.0852  147 TYR A CB  
51   C CG  . TYR A 11  ? 0.3196 0.3269 0.3498 0.0368  0.0919  0.0807  147 TYR A CG  
52   C CD1 . TYR A 11  ? 0.2938 0.2985 0.3248 0.0396  0.0921  0.0860  147 TYR A CD1 
53   C CD2 . TYR A 11  ? 0.3662 0.3459 0.3811 0.0381  0.0920  0.0720  147 TYR A CD2 
54   C CE1 . TYR A 11  ? 0.2562 0.2306 0.2749 0.0439  0.0931  0.0853  147 TYR A CE1 
55   C CE2 . TYR A 11  ? 0.3774 0.3241 0.3800 0.0411  0.0919  0.0689  147 TYR A CE2 
56   C CZ  . TYR A 11  ? 0.3671 0.3108 0.3727 0.0440  0.0928  0.0768  147 TYR A CZ  
57   O OH  . TYR A 11  ? 0.4449 0.3542 0.4397 0.0457  0.0923  0.0772  147 TYR A OH  
58   N N   . VAL A 12  ? 0.2682 0.3403 0.3521 0.0009  0.0778  0.0907  148 VAL A N   
59   C CA  . VAL A 12  ? 0.2217 0.3085 0.3198 -0.0087 0.0697  0.0926  148 VAL A CA  
60   C C   . VAL A 12  ? 0.2947 0.4065 0.3993 -0.0067 0.0680  0.1001  148 VAL A C   
61   O O   . VAL A 12  ? 0.2822 0.3994 0.3806 0.0029  0.0727  0.1031  148 VAL A O   
62   C CB  . VAL A 12  ? 0.1910 0.2657 0.2965 -0.0194 0.0652  0.0857  148 VAL A CB  
63   C CG1 . VAL A 12  ? 0.2114 0.2668 0.3132 -0.0204 0.0659  0.0795  148 VAL A CG1 
64   C CG2 . VAL A 12  ? 0.2088 0.2829 0.3089 -0.0180 0.0667  0.0821  148 VAL A CG2 
65   N N   . TYR A 13  ? 0.2820 0.4096 0.3999 -0.0160 0.0607  0.1048  149 TYR A N   
66   C CA  . TYR A 13  ? 0.2327 0.3863 0.3604 -0.0187 0.0565  0.1117  149 TYR A CA  
67   C C   . TYR A 13  ? 0.2381 0.3885 0.3756 -0.0336 0.0495  0.1072  149 TYR A C   
68   O O   . TYR A 13  ? 0.3073 0.4487 0.4554 -0.0466 0.0425  0.1051  149 TYR A O   
69   C CB  . TYR A 13  ? 0.2321 0.4099 0.3699 -0.0211 0.0521  0.1219  149 TYR A CB  
70   C CG  . TYR A 13  ? 0.2477 0.4567 0.3943 -0.0209 0.0484  0.1305  149 TYR A CG  
71   C CD1 . TYR A 13  ? 0.2872 0.5135 0.4275 -0.0030 0.0552  0.1363  149 TYR A CD1 
72   C CD2 . TYR A 13  ? 0.2349 0.4558 0.3964 -0.0383 0.0375  0.1326  149 TYR A CD2 
73   C CE1 . TYR A 13  ? 0.2645 0.5229 0.4138 -0.0012 0.0511  0.1457  149 TYR A CE1 
74   C CE2 . TYR A 13  ? 0.3276 0.5814 0.4976 -0.0394 0.0324  0.1411  149 TYR A CE2 
75   C CZ  . TYR A 13  ? 0.3561 0.6303 0.5202 -0.0202 0.0393  0.1484  149 TYR A CZ  
76   O OH  . TYR A 13  ? 0.4809 0.7906 0.6539 -0.0198 0.0338  0.1584  149 TYR A OH  
77   N N   . CYS A 14  ? 0.2263 0.3781 0.3551 -0.0301 0.0492  0.1027  150 CYS A N   
78   C CA  . CYS A 14  ? 0.2717 0.4179 0.4004 -0.0415 0.0397  0.0921  150 CYS A CA  
79   C C   . CYS A 14  ? 0.3194 0.4948 0.4617 -0.0523 0.0289  0.0990  150 CYS A C   
80   O O   . CYS A 14  ? 0.2524 0.4550 0.3942 -0.0456 0.0293  0.1079  150 CYS A O   
81   C CB  . CYS A 14  ? 0.1682 0.3059 0.2780 -0.0335 0.0430  0.0843  150 CYS A CB  
82   S SG  . CYS A 14  ? 0.3028 0.4389 0.4056 -0.0442 0.0324  0.0689  150 CYS A SG  
83   N N   . LYS A 15  ? 0.2994 0.4689 0.4551 -0.0693 0.0185  0.0956  151 LYS A N   
84   C CA  . LYS A 15  ? 0.3160 0.5132 0.4883 -0.0844 0.0060  0.1035  151 LYS A CA  
85   C C   . LYS A 15  ? 0.3756 0.5800 0.5381 -0.0901 -0.0047 0.0926  151 LYS A C   
86   O O   . LYS A 15  ? 0.4441 0.6790 0.6183 -0.1012 -0.0156 0.1000  151 LYS A O   
87   C CB  . LYS A 15  ? 0.2477 0.4314 0.4388 -0.1028 -0.0029 0.1056  151 LYS A CB  
88   C CG  . LYS A 15  ? 0.3942 0.5811 0.5894 -0.0956 0.0048  0.1189  151 LYS A CG  
89   C CD  . LYS A 15  ? 0.4772 0.6341 0.6786 -0.1050 -0.0004 0.1167  151 LYS A CD  
90   C CE  . LYS A 15  ? 0.5877 0.7416 0.8035 -0.1260 -0.0163 0.1170  151 LYS A CE  
91   N NZ  . LYS A 15  ? 0.7310 0.8553 0.9521 -0.1318 -0.0201 0.1182  151 LYS A NZ  
92   N N   . GLY A 16  ? 0.3832 0.5638 0.5242 -0.0827 -0.0015 0.0760  152 GLY A N   
93   C CA  . GLY A 16  ? 0.3498 0.5371 0.4753 -0.0858 -0.0101 0.0640  152 GLY A CA  
94   C C   . GLY A 16  ? 0.4176 0.5765 0.5210 -0.0756 -0.0018 0.0477  152 GLY A C   
95   O O   . GLY A 16  ? 0.4242 0.5542 0.5301 -0.0746 0.0030  0.0401  152 GLY A O   
96   N N   . PRO A 17  ? 0.3663 0.5371 0.4494 -0.0677 0.0001  0.0444  153 PRO A N   
97   C CA  . PRO A 17  ? 0.3649 0.5722 0.4444 -0.0673 -0.0065 0.0549  153 PRO A CA  
98   C C   . PRO A 17  ? 0.3893 0.6170 0.4757 -0.0529 0.0031  0.0775  153 PRO A C   
99   O O   . PRO A 17  ? 0.3525 0.6137 0.4412 -0.0509 -0.0026 0.0894  153 PRO A O   
100  C CB  . PRO A 17  ? 0.3823 0.5892 0.4340 -0.0617 -0.0055 0.0430  153 PRO A CB  
101  C CG  . PRO A 17  ? 0.4073 0.5845 0.4512 -0.0515 0.0095  0.0371  153 PRO A CG  
102  C CD  . PRO A 17  ? 0.2994 0.4512 0.3617 -0.0589 0.0085  0.0307  153 PRO A CD  
103  N N   . CYS A 18  ? 0.4067 0.6148 0.4957 -0.0424 0.0165  0.0826  154 CYS A N   
104  C CA  . CYS A 18  ? 0.3505 0.5695 0.4411 -0.0259 0.0262  0.1000  154 CYS A CA  
105  C C   . CYS A 18  ? 0.3440 0.5935 0.4558 -0.0251 0.0238  0.1154  154 CYS A C   
106  O O   . CYS A 18  ? 0.3061 0.5808 0.4196 -0.0123 0.0258  0.1297  154 CYS A O   
107  C CB  . CYS A 18  ? 0.1795 0.3663 0.2644 -0.0167 0.0393  0.0981  154 CYS A CB  
108  S SG  . CYS A 18  ? 0.2776 0.4398 0.3404 -0.0145 0.0450  0.0872  154 CYS A SG  
109  N N   . GLN A 19  ? 0.2906 0.5396 0.4194 -0.0377 0.0200  0.1142  155 GLN A N   
110  C CA  . GLN A 19  ? 0.3493 0.6322 0.5004 -0.0387 0.0190  0.1306  155 GLN A CA  
111  C C   . GLN A 19  ? 0.3533 0.6415 0.5026 -0.0159 0.0336  0.1423  155 GLN A C   
112  O O   . GLN A 19  ? 0.3155 0.6406 0.4764 -0.0063 0.0350  0.1573  155 GLN A O   
113  C CB  . GLN A 19  ? 0.2701 0.5956 0.4324 -0.0475 0.0057  0.1388  155 GLN A CB  
114  N N   . ARG A 20  ? 0.3699 0.6214 0.5047 -0.0069 0.0440  0.1345  156 ARG A N   
115  C CA  . ARG A 20  ? 0.3100 0.5566 0.4386 0.0143  0.0568  0.1408  156 ARG A CA  
116  C C   . ARG A 20  ? 0.2977 0.5034 0.4137 0.0156  0.0641  0.1300  156 ARG A C   
117  O O   . ARG A 20  ? 0.2704 0.4547 0.3844 0.0020  0.0602  0.1194  156 ARG A O   
118  C CB  . ARG A 20  ? 0.3421 0.5920 0.4596 0.0321  0.0598  0.1469  156 ARG A CB  
119  C CG  . ARG A 20  ? 0.3221 0.5419 0.4205 0.0301  0.0588  0.1381  156 ARG A CG  
120  C CD  . ARG A 20  ? 0.4156 0.6461 0.5064 0.0457  0.0593  0.1496  156 ARG A CD  
121  N NE  . ARG A 20  ? 0.5294 0.7371 0.6021 0.0436  0.0590  0.1456  156 ARG A NE  
122  C CZ  . ARG A 20  ? 0.6121 0.8353 0.6790 0.0337  0.0506  0.1439  156 ARG A CZ  
123  N NH1 . ARG A 20  ? 0.5648 0.8224 0.6430 0.0232  0.0397  0.1441  156 ARG A NH1 
124  N NH2 . ARG A 20  ? 0.6003 0.8062 0.6497 0.0334  0.0526  0.1423  156 ARG A NH2 
125  N N   . VAL A 21  ? 0.3119 0.5076 0.4194 0.0327  0.0742  0.1321  157 VAL A N   
126  C CA  . VAL A 21  ? 0.2385 0.3973 0.3328 0.0336  0.0796  0.1220  157 VAL A CA  
127  C C   . VAL A 21  ? 0.2702 0.3989 0.3502 0.0328  0.0793  0.1148  157 VAL A C   
128  O O   . VAL A 21  ? 0.2982 0.4277 0.3716 0.0427  0.0801  0.1202  157 VAL A O   
129  C CB  . VAL A 21  ? 0.2823 0.4373 0.3678 0.0525  0.0892  0.1238  157 VAL A CB  
130  C CG1 . VAL A 21  ? 0.2652 0.3801 0.3342 0.0525  0.0924  0.1122  157 VAL A CG1 
131  C CG2 . VAL A 21  ? 0.1735 0.3555 0.2686 0.0518  0.0868  0.1282  157 VAL A CG2 
132  N N   . GLN A 22  ? 0.2983 0.4042 0.3753 0.0211  0.0780  0.1050  158 GLN A N   
133  C CA  . GLN A 22  ? 0.2292 0.3116 0.2946 0.0190  0.0789  0.0999  158 GLN A CA  
134  C C   . GLN A 22  ? 0.2413 0.2974 0.3023 0.0144  0.0816  0.0922  158 GLN A C   
135  O O   . GLN A 22  ? 0.3253 0.3833 0.3934 0.0094  0.0805  0.0891  158 GLN A O   
136  C CB  . GLN A 22  ? 0.2272 0.3197 0.2957 0.0076  0.0730  0.0956  158 GLN A CB  
137  C CG  . GLN A 22  ? 0.2689 0.3888 0.3392 0.0098  0.0678  0.1026  158 GLN A CG  
138  C CD  . GLN A 22  ? 0.3554 0.4724 0.4121 0.0183  0.0702  0.1093  158 GLN A CD  
139  O OE1 . GLN A 22  ? 0.3133 0.4106 0.3622 0.0285  0.0764  0.1144  158 GLN A OE1 
140  N NE2 . GLN A 22  ? 0.4096 0.5449 0.4623 0.0138  0.0645  0.1095  158 GLN A NE2 
141  N N   . PRO A 23  ? 0.2792 0.3130 0.3296 0.0153  0.0844  0.0911  159 PRO A N   
142  C CA  . PRO A 23  ? 0.3040 0.3176 0.3529 0.0074  0.0851  0.0845  159 PRO A CA  
143  C C   . PRO A 23  ? 0.3395 0.3636 0.3999 -0.0036 0.0820  0.0785  159 PRO A C   
144  O O   . PRO A 23  ? 0.3908 0.4271 0.4532 -0.0063 0.0805  0.0776  159 PRO A O   
145  C CB  . PRO A 23  ? 0.3496 0.3465 0.3894 0.0067  0.0874  0.0882  159 PRO A CB  
146  C CG  . PRO A 23  ? 0.3661 0.3628 0.3983 0.0195  0.0888  0.0970  159 PRO A CG  
147  C CD  . PRO A 23  ? 0.2839 0.3110 0.3244 0.0237  0.0865  0.0989  159 PRO A CD  
148  N N   . GLY A 24  ? 0.3205 0.3397 0.3871 -0.0088 0.0806  0.0742  160 GLY A N   
149  C CA  . GLY A 24  ? 0.2831 0.3089 0.3620 -0.0163 0.0775  0.0692  160 GLY A CA  
150  C C   . GLY A 24  ? 0.2945 0.3117 0.3755 -0.0210 0.0777  0.0645  160 GLY A C   
151  O O   . GLY A 24  ? 0.2906 0.2965 0.3648 -0.0218 0.0787  0.0656  160 GLY A O   
152  N N   . LYS A 25  ? 0.2970 0.3204 0.3893 -0.0242 0.0772  0.0598  161 LYS A N   
153  C CA  . LYS A 25  ? 0.2549 0.2777 0.3536 -0.0268 0.0778  0.0566  161 LYS A CA  
154  C C   . LYS A 25  ? 0.2871 0.3096 0.3985 -0.0279 0.0730  0.0559  161 LYS A C   
155  O O   . LYS A 25  ? 0.2505 0.2741 0.3712 -0.0277 0.0707  0.0551  161 LYS A O   
156  C CB  . LYS A 25  ? 0.2775 0.3099 0.3796 -0.0256 0.0824  0.0514  161 LYS A CB  
157  C CG  . LYS A 25  ? 0.4177 0.4551 0.5058 -0.0243 0.0866  0.0539  161 LYS A CG  
158  C CD  . LYS A 25  ? 0.4659 0.4989 0.5474 -0.0275 0.0892  0.0611  161 LYS A CD  
159  C CE  . LYS A 25  ? 0.5700 0.6172 0.6557 -0.0294 0.0944  0.0608  161 LYS A CE  
160  N NZ  . LYS A 25  ? 0.5836 0.6264 0.6609 -0.0351 0.0936  0.0689  161 LYS A NZ  
161  N N   . LEU A 26  ? 0.2525 0.2734 0.3650 -0.0301 0.0701  0.0573  162 LEU A N   
162  C CA  . LEU A 26  ? 0.2817 0.3052 0.4069 -0.0306 0.0653  0.0595  162 LEU A CA  
163  C C   . LEU A 26  ? 0.3148 0.3461 0.4597 -0.0290 0.0683  0.0578  162 LEU A C   
164  O O   . LEU A 26  ? 0.2743 0.3133 0.4205 -0.0296 0.0725  0.0563  162 LEU A O   
165  C CB  . LEU A 26  ? 0.3115 0.3340 0.4310 -0.0344 0.0617  0.0629  162 LEU A CB  
166  C CG  . LEU A 26  ? 0.2722 0.3022 0.4052 -0.0356 0.0564  0.0681  162 LEU A CG  
167  C CD1 . LEU A 26  ? 0.2341 0.2639 0.3716 -0.0327 0.0532  0.0728  162 LEU A CD1 
168  C CD2 . LEU A 26  ? 0.2458 0.2768 0.3719 -0.0418 0.0536  0.0716  162 LEU A CD2 
169  N N   . ARG A 27  ? 0.2669 0.2959 0.4255 -0.0257 0.0652  0.0575  163 ARG A N   
170  C CA  . ARG A 27  ? 0.2869 0.3200 0.4612 -0.0189 0.0663  0.0527  163 ARG A CA  
171  C C   . ARG A 27  ? 0.3091 0.3418 0.5000 -0.0169 0.0596  0.0603  163 ARG A C   
172  O O   . ARG A 27  ? 0.3247 0.3515 0.5141 -0.0210 0.0538  0.0683  163 ARG A O   
173  C CB  . ARG A 27  ? 0.3676 0.3915 0.5407 -0.0136 0.0672  0.0416  163 ARG A CB  
174  C CG  . ARG A 27  ? 0.4490 0.4764 0.6050 -0.0145 0.0726  0.0348  163 ARG A CG  
175  C CD  . ARG A 27  ? 0.4689 0.5119 0.6214 -0.0149 0.0803  0.0371  163 ARG A CD  
176  N NE  . ARG A 27  ? 0.4167 0.4661 0.5543 -0.0138 0.0863  0.0321  163 ARG A NE  
177  C CZ  . ARG A 27  ? 0.3536 0.4144 0.4846 -0.0174 0.0924  0.0383  163 ARG A CZ  
178  N NH1 . ARG A 27  ? 0.3524 0.4164 0.4906 -0.0235 0.0921  0.0474  163 ARG A NH1 
179  N NH2 . ARG A 27  ? 0.3236 0.3925 0.4407 -0.0161 0.0977  0.0363  163 ARG A NH2 
180  N N   . VAL A 28  ? 0.2582 0.3003 0.4655 -0.0095 0.0608  0.0596  164 VAL A N   
181  C CA  . VAL A 28  ? 0.2386 0.2804 0.4645 -0.0045 0.0541  0.0678  164 VAL A CA  
182  C C   . VAL A 28  ? 0.2725 0.3069 0.5134 0.0094  0.0557  0.0597  164 VAL A C   
183  O O   . VAL A 28  ? 0.2843 0.3270 0.5245 0.0167  0.0638  0.0486  164 VAL A O   
184  C CB  . VAL A 28  ? 0.4028 0.4679 0.6400 -0.0053 0.0524  0.0766  164 VAL A CB  
185  C CG1 . VAL A 28  ? 0.3592 0.4256 0.5993 -0.0097 0.0428  0.0906  164 VAL A CG1 
186  C CG2 . VAL A 28  ? 0.5445 0.6229 0.7702 -0.0143 0.0573  0.0745  164 VAL A CG2 
187  N N   . GLN A 29  ? 0.2524 0.2722 0.5071 0.0143  0.0482  0.0663  165 GLN A N   
188  C CA  . GLN A 29  ? 0.2577 0.2669 0.5293 0.0306  0.0485  0.0595  165 GLN A CA  
189  C C   . GLN A 29  ? 0.2555 0.2633 0.5482 0.0360  0.0399  0.0761  165 GLN A C   
190  O O   . GLN A 29  ? 0.2162 0.2273 0.5069 0.0252  0.0329  0.0921  165 GLN A O   
191  C CB  . GLN A 29  ? 0.3330 0.3101 0.5966 0.0318  0.0466  0.0454  165 GLN A CB  
192  C CG  . GLN A 29  ? 0.3511 0.3054 0.6147 0.0200  0.0360  0.0563  165 GLN A CG  
193  C CD  . GLN A 29  ? 0.4678 0.3915 0.7244 0.0173  0.0321  0.0420  165 GLN A CD  
194  O OE1 . GLN A 29  ? 0.4632 0.3875 0.7056 0.0199  0.0378  0.0236  165 GLN A OE1 
195  N NE2 . GLN A 29  ? 0.4905 0.3885 0.7568 0.0108  0.0214  0.0513  165 GLN A NE2 
196  N N   . CYS A 30  ? 0.2311 0.2361 0.5433 0.0544  0.0408  0.0729  166 CYS A N   
197  C CA  . CYS A 30  ? 0.2613 0.2601 0.5952 0.0625  0.0318  0.0896  166 CYS A CA  
198  C C   . CYS A 30  ? 0.2743 0.2333 0.6059 0.0558  0.0226  0.0942  166 CYS A C   
199  O O   . CYS A 30  ? 0.3564 0.2850 0.6817 0.0579  0.0231  0.0778  166 CYS A O   
200  C CB  . CYS A 30  ? 0.2673 0.2687 0.6230 0.0875  0.0359  0.0829  166 CYS A CB  
201  S SG  . CYS A 30  ? 0.3473 0.3302 0.7311 0.1019  0.0241  0.1027  166 CYS A SG  
202  N N   . SER A 31  ? 0.3273 0.2884 0.6635 0.0464  0.0135  0.1169  167 SER A N   
203  C CA  . SER A 31  ? 0.3090 0.2378 0.6453 0.0367  0.0047  0.1263  167 SER A CA  
204  C C   . SER A 31  ? 0.3683 0.2641 0.7146 0.0483  -0.0011 0.1201  167 SER A C   
205  O O   . SER A 31  ? 0.3696 0.2369 0.7082 0.0387  -0.0076 0.1168  167 SER A O   
206  C CB  . SER A 31  ? 0.2907 0.2396 0.6236 0.0237  -0.0022 0.1514  167 SER A CB  
207  O OG  . SER A 31  ? 0.4248 0.3875 0.7739 0.0342  -0.0071 0.1662  167 SER A OG  
208  N N   . THR A 32  ? 0.4215 0.3224 0.7828 0.0687  0.0008  0.1179  168 THR A N   
209  C CA  . THR A 32  ? 0.5359 0.4023 0.9028 0.0812  -0.0051 0.1125  168 THR A CA  
210  C C   . THR A 32  ? 0.4747 0.3123 0.8343 0.0950  0.0003  0.0823  168 THR A C   
211  O O   . THR A 32  ? 0.5128 0.3089 0.8658 0.0952  -0.0067 0.0732  168 THR A O   
212  C CB  . THR A 32  ? 0.7504 0.6329 1.1350 0.0978  -0.0076 0.1273  168 THR A CB  
213  O OG1 . THR A 32  ? 0.8378 0.7368 1.2299 0.1199  0.0021  0.1120  168 THR A OG1 
214  C CG2 . THR A 32  ? 0.3687 0.2906 0.7581 0.0861  -0.0108 0.1531  168 THR A CG2 
215  N N   . CYS A 33  ? 0.5223 0.3833 0.8814 0.1063  0.0125  0.0665  169 CYS A N   
216  C CA  . CYS A 33  ? 0.5608 0.4006 0.9091 0.1207  0.0190  0.0362  169 CYS A CA  
217  C C   . CYS A 33  ? 0.6106 0.4475 0.9421 0.1070  0.0239  0.0200  169 CYS A C   
218  O O   . CYS A 33  ? 0.6253 0.4463 0.9435 0.1162  0.0288  -0.0066 169 CYS A O   
219  C CB  . CYS A 33  ? 0.5566 0.4276 0.9135 0.1464  0.0309  0.0271  169 CYS A CB  
220  S SG  . CYS A 33  ? 0.3950 0.3307 0.7585 0.1416  0.0447  0.0337  169 CYS A SG  
221  N N   . ARG A 34  ? 0.5511 0.4049 0.8787 0.0850  0.0223  0.0355  170 ARG A N   
222  C CA  . ARG A 34  ? 0.4913 0.3513 0.7935 0.0676  0.0255  0.0236  170 ARG A CA  
223  C C   . ARG A 34  ? 0.4951 0.3820 0.7826 0.0772  0.0395  0.0036  170 ARG A C   
224  O O   . ARG A 34  ? 0.5784 0.4597 0.8450 0.0705  0.0416  -0.0133 170 ARG A O   
225  C CB  . ARG A 34  ? 0.4569 0.2728 0.7507 0.0573  0.0155  0.0121  170 ARG A CB  
226  C CG  . ARG A 34  ? 0.7338 0.5165 1.0384 0.0525  0.0013  0.0259  170 ARG A CG  
227  C CD  . ARG A 34  ? 0.9498 0.6914 1.2402 0.0426  -0.0088 0.0090  170 ARG A CD  
228  N NE  . ARG A 34  ? 1.0885 0.8150 1.3659 0.0567  -0.0032 -0.0242 170 ARG A NE  
229  C CZ  . ARG A 34  ? 1.1081 0.8253 1.3691 0.0452  -0.0052 -0.0431 170 ARG A CZ  
230  N NH1 . ARG A 34  ? 1.0839 0.8054 1.3419 0.0193  -0.0128 -0.0306 170 ARG A NH1 
231  N NH2 . ARG A 34  ? 1.1074 0.8156 1.3532 0.0602  0.0007  -0.0746 170 ARG A NH2 
232  N N   . GLN A 35  ? 0.5390 0.4587 0.8384 0.0917  0.0484  0.0075  171 GLN A N   
233  C CA  . GLN A 35  ? 0.5258 0.4773 0.8146 0.1002  0.0626  -0.0070 171 GLN A CA  
234  C C   . GLN A 35  ? 0.4199 0.4143 0.7070 0.0867  0.0678  0.0088  171 GLN A C   
235  O O   . GLN A 35  ? 0.3804 0.3852 0.6795 0.0786  0.0617  0.0290  171 GLN A O   
236  C CB  . GLN A 35  ? 0.6815 0.6412 0.9871 0.1289  0.0702  -0.0163 171 GLN A CB  
237  C CG  . GLN A 35  ? 0.8646 0.8124 1.1529 0.1448  0.0785  -0.0462 171 GLN A CG  
238  C CD  . GLN A 35  ? 0.9390 0.8299 1.2145 0.1417  0.0670  -0.0631 171 GLN A CD  
239  O OE1 . GLN A 35  ? 0.9677 0.8216 1.2585 0.1430  0.0551  -0.0558 171 GLN A OE1 
240  N NE2 . GLN A 35  ? 0.9561 0.8404 1.2036 0.1363  0.0695  -0.0844 171 GLN A NE2 
241  N N   . ALA A 36  ? 0.4217 0.4396 0.6925 0.0837  0.0782  -0.0002 172 ALA A N   
242  C CA  . ALA A 36  ? 0.4788 0.5305 0.7464 0.0692  0.0822  0.0135  172 ALA A CA  
243  C C   . ALA A 36  ? 0.5005 0.5912 0.7901 0.0791  0.0888  0.0224  172 ALA A C   
244  O O   . ALA A 36  ? 0.5159 0.6388 0.8027 0.0776  0.0989  0.0221  172 ALA A O   
245  C CB  . ALA A 36  ? 0.4678 0.5273 0.7104 0.0609  0.0898  0.0040  172 ALA A CB  
246  N N   . THR A 37  ? 0.4708 0.5610 0.7840 0.0884  0.0823  0.0327  173 THR A N   
247  C CA  . THR A 37  ? 0.4240 0.5535 0.7635 0.1010  0.0869  0.0418  173 THR A CA  
248  C C   . THR A 37  ? 0.3602 0.5047 0.7147 0.0894  0.0760  0.0641  173 THR A C   
249  O O   . THR A 37  ? 0.3739 0.5496 0.7544 0.0996  0.0755  0.0752  173 THR A O   
250  C CB  . THR A 37  ? 0.4588 0.5771 0.8160 0.1299  0.0893  0.0327  173 THR A CB  
251  O OG1 . THR A 37  ? 0.4176 0.4887 0.7748 0.1304  0.0767  0.0339  173 THR A OG1 
252  C CG2 . THR A 37  ? 0.4832 0.5979 0.8255 0.1450  0.1021  0.0084  173 THR A CG2 
253  N N   . LEU A 38  ? 0.3465 0.4718 0.6841 0.0693  0.0671  0.0705  174 LEU A N   
254  C CA  . LEU A 38  ? 0.3661 0.5025 0.7110 0.0579  0.0558  0.0895  174 LEU A CA  
255  C C   . LEU A 38  ? 0.3640 0.5302 0.7020 0.0393  0.0565  0.0951  174 LEU A C   
256  O O   . LEU A 38  ? 0.2175 0.3719 0.5319 0.0247  0.0586  0.0893  174 LEU A O   
257  C CB  . LEU A 38  ? 0.2782 0.3801 0.6081 0.0479  0.0463  0.0939  174 LEU A CB  
258  C CG  . LEU A 38  ? 0.3331 0.4394 0.6712 0.0430  0.0337  0.1139  174 LEU A CG  
259  C CD1 . LEU A 38  ? 0.4392 0.5669 0.7633 0.0239  0.0295  0.1211  174 LEU A CD1 
260  C CD2 . LEU A 38  ? 0.3816 0.5061 0.7503 0.0606  0.0301  0.1249  174 LEU A CD2 
261  N N   . THR A 39  ? 0.3243 0.5284 0.6844 0.0401  0.0539  0.1068  175 THR A N   
262  C CA  . THR A 39  ? 0.3401 0.5681 0.6924 0.0201  0.0509  0.1119  175 THR A CA  
263  C C   . THR A 39  ? 0.3144 0.5422 0.6630 0.0069  0.0363  0.1240  175 THR A C   
264  O O   . THR A 39  ? 0.3237 0.5642 0.6895 0.0148  0.0278  0.1359  175 THR A O   
265  C CB  . THR A 39  ? 0.3412 0.6063 0.7077 0.0251  0.0533  0.1149  175 THR A CB  
266  O OG1 . THR A 39  ? 0.3697 0.6389 0.7347 0.0366  0.0677  0.1029  175 THR A OG1 
267  C CG2 . THR A 39  ? 0.3079 0.5905 0.6644 0.0019  0.0461  0.1200  175 THR A CG2 
268  N N   . LEU A 40  ? 0.2433 0.4560 0.5666 -0.0117 0.0331  0.1208  176 LEU A N   
269  C CA  . LEU A 40  ? 0.3502 0.5597 0.6618 -0.0231 0.0201  0.1287  176 LEU A CA  
270  C C   . LEU A 40  ? 0.3953 0.6367 0.7145 -0.0333 0.0090  0.1374  176 LEU A C   
271  O O   . LEU A 40  ? 0.3169 0.5693 0.6319 -0.0434 0.0100  0.1326  176 LEU A O   
272  C CB  . LEU A 40  ? 0.2578 0.4379 0.5354 -0.0361 0.0208  0.1195  176 LEU A CB  
273  C CG  . LEU A 40  ? 0.2623 0.4107 0.5277 -0.0271 0.0258  0.1145  176 LEU A CG  
274  C CD1 . LEU A 40  ? 0.2883 0.4137 0.5234 -0.0370 0.0283  0.1061  176 LEU A CD1 
275  C CD2 . LEU A 40  ? 0.3308 0.4775 0.6026 -0.0207 0.0174  0.1266  176 LEU A CD2 
276  N N   . THR A 41  ? 0.4308 0.6863 0.7596 -0.0310 -0.0026 0.1508  177 THR A N   
277  C CA  . THR A 41  ? 0.5260 0.8108 0.8566 -0.0424 -0.0163 0.1588  177 THR A CA  
278  C C   . THR A 41  ? 0.5133 0.7892 0.8173 -0.0657 -0.0216 0.1495  177 THR A C   
279  O O   . THR A 41  ? 0.3397 0.6319 0.6437 -0.0790 -0.0275 0.1478  177 THR A O   
280  C CB  . THR A 41  ? 0.6104 0.9082 0.9476 -0.0373 -0.0290 0.1753  177 THR A CB  
281  O OG1 . THR A 41  ? 0.6793 0.9804 1.0419 -0.0147 -0.0253 0.1846  177 THR A OG1 
282  C CG2 . THR A 41  ? 0.6331 0.9621 0.9675 -0.0513 -0.0446 0.1819  177 THR A CG2 
283  N N   . GLN A 42  ? 0.5540 0.7992 0.8320 -0.0693 -0.0193 0.1423  178 GLN A N   
284  C CA  . GLN A 42  ? 0.5929 0.8167 0.8398 -0.0864 -0.0214 0.1296  178 GLN A CA  
285  C C   . GLN A 42  ? 0.4983 0.6841 0.7231 -0.0789 -0.0095 0.1196  178 GLN A C   
286  O O   . GLN A 42  ? 0.4937 0.6712 0.7215 -0.0651 -0.0050 0.1239  178 GLN A O   
287  C CB  . GLN A 42  ? 0.6702 0.8999 0.8957 -0.0975 -0.0371 0.1306  178 GLN A CB  
288  C CG  . GLN A 42  ? 0.6848 0.9036 0.8918 -0.0871 -0.0379 0.1347  178 GLN A CG  
289  C CD  . GLN A 42  ? 0.8337 1.0612 1.0139 -0.0974 -0.0525 0.1339  178 GLN A CD  
290  O OE1 . GLN A 42  ? 0.9288 1.1658 1.1025 -0.1136 -0.0635 0.1276  178 GLN A OE1 
291  N NE2 . GLN A 42  ? 0.8378 1.0632 1.0014 -0.0892 -0.0531 0.1404  178 GLN A NE2 
292  N N   . GLY A 43  ? 0.3084 0.4713 0.5131 -0.0883 -0.0052 0.1077  179 GLY A N   
293  C CA  . GLY A 43  ? 0.2678 0.3998 0.4542 -0.0809 0.0059  0.0994  179 GLY A CA  
294  C C   . GLY A 43  ? 0.2270 0.3429 0.3858 -0.0783 0.0032  0.0965  179 GLY A C   
295  O O   . GLY A 43  ? 0.3363 0.4608 0.4827 -0.0842 -0.0075 0.0979  179 GLY A O   
296  N N   . PRO A 44  ? 0.2118 0.3082 0.3607 -0.0694 0.0127  0.0931  180 PRO A N   
297  C CA  . PRO A 44  ? 0.1861 0.2726 0.3101 -0.0659 0.0124  0.0917  180 PRO A CA  
298  C C   . PRO A 44  ? 0.3135 0.3841 0.4083 -0.0733 0.0095  0.0792  180 PRO A C   
299  O O   . PRO A 44  ? 0.2735 0.3298 0.3671 -0.0796 0.0116  0.0716  180 PRO A O   
300  C CB  . PRO A 44  ? 0.2590 0.3312 0.3841 -0.0570 0.0234  0.0905  180 PRO A CB  
301  C CG  . PRO A 44  ? 0.2420 0.3079 0.3791 -0.0582 0.0295  0.0851  180 PRO A CG  
302  C CD  . PRO A 44  ? 0.2552 0.3414 0.4141 -0.0627 0.0240  0.0901  180 PRO A CD  
303  N N   . SER A 45  ? 0.3131 0.3853 0.3841 -0.0719 0.0051  0.0773  181 SER A N   
304  C CA  . SER A 45  ? 0.3655 0.4193 0.4055 -0.0771 0.0010  0.0624  181 SER A CA  
305  C C   . SER A 45  ? 0.4113 0.4538 0.4234 -0.0653 0.0085  0.0562  181 SER A C   
306  O O   . SER A 45  ? 0.5188 0.5433 0.5016 -0.0651 0.0063  0.0417  181 SER A O   
307  C CB  . SER A 45  ? 0.3298 0.3992 0.3617 -0.0878 -0.0141 0.0614  181 SER A CB  
308  O OG  . SER A 45  ? 0.3702 0.4631 0.3954 -0.0814 -0.0170 0.0712  181 SER A OG  
309  N N   . CYS A 46  ? 0.3601 0.4135 0.3826 -0.0552 0.0171  0.0671  182 CYS A N   
310  C CA  . CYS A 46  ? 0.3747 0.4287 0.3771 -0.0435 0.0252  0.0660  182 CYS A CA  
311  C C   . CYS A 46  ? 0.3851 0.4505 0.4095 -0.0377 0.0331  0.0803  182 CYS A C   
312  O O   . CYS A 46  ? 0.3633 0.4335 0.4149 -0.0419 0.0311  0.0893  182 CYS A O   
313  C CB  . CYS A 46  ? 0.3452 0.4183 0.3248 -0.0419 0.0197  0.0675  182 CYS A CB  
314  S SG  . CYS A 46  ? 0.4367 0.5444 0.4391 -0.0463 0.0122  0.0912  182 CYS A SG  
315  N N   . TRP A 47  ? 0.3642 0.4349 0.3776 -0.0282 0.0415  0.0822  183 TRP A N   
316  C CA  . TRP A 47  ? 0.3013 0.3829 0.3360 -0.0258 0.0472  0.0958  183 TRP A CA  
317  C C   . TRP A 47  ? 0.2866 0.3878 0.3406 -0.0309 0.0417  0.1145  183 TRP A C   
318  O O   . TRP A 47  ? 0.2800 0.3781 0.3595 -0.0340 0.0411  0.1225  183 TRP A O   
319  C CB  . TRP A 47  ? 0.2616 0.3520 0.2829 -0.0153 0.0570  0.0962  183 TRP A CB  
320  C CG  . TRP A 47  ? 0.3386 0.4077 0.3547 -0.0094 0.0627  0.0837  183 TRP A CG  
321  C CD1 . TRP A 47  ? 0.2400 0.2927 0.2307 -0.0005 0.0661  0.0690  183 TRP A CD1 
322  C CD2 . TRP A 47  ? 0.2752 0.3349 0.3112 -0.0119 0.0647  0.0848  183 TRP A CD2 
323  N NE1 . TRP A 47  ? 0.2872 0.3216 0.2830 0.0029  0.0702  0.0640  183 TRP A NE1 
324  C CE2 . TRP A 47  ? 0.2782 0.3192 0.3005 -0.0044 0.0695  0.0736  183 TRP A CE2 
325  C CE3 . TRP A 47  ? 0.2138 0.2777 0.2758 -0.0189 0.0625  0.0935  183 TRP A CE3 
326  C CZ2 . TRP A 47  ? 0.2887 0.3206 0.3227 -0.0044 0.0722  0.0731  183 TRP A CZ2 
327  C CZ3 . TRP A 47  ? 0.2116 0.2651 0.2827 -0.0188 0.0651  0.0896  183 TRP A CZ3 
328  C CH2 . TRP A 47  ? 0.2216 0.2619 0.2787 -0.0120 0.0699  0.0806  183 TRP A CH2 
329  N N   . ASP A 48  ? 0.3098 0.4293 0.3506 -0.0313 0.0371  0.1214  184 ASP A N   
330  C CA  . ASP A 48  ? 0.3684 0.5062 0.4271 -0.0356 0.0310  0.1425  184 ASP A CA  
331  C C   . ASP A 48  ? 0.3811 0.5081 0.4678 -0.0406 0.0237  0.1454  184 ASP A C   
332  O O   . ASP A 48  ? 0.3422 0.4713 0.4528 -0.0419 0.0212  0.1611  184 ASP A O   
333  C CB  . ASP A 48  ? 0.4302 0.5917 0.4664 -0.0352 0.0259  0.1488  184 ASP A CB  
334  C CG  . ASP A 48  ? 0.5284 0.7118 0.5440 -0.0284 0.0345  0.1550  184 ASP A CG  
335  O OD1 . ASP A 48  ? 0.4496 0.6358 0.4778 -0.0264 0.0426  0.1624  184 ASP A OD1 
336  O OD2 . ASP A 48  ? 0.6183 0.8194 0.6049 -0.0251 0.0330  0.1525  184 ASP A OD2 
337  N N   . ASP A 49  ? 0.3395 0.4545 0.4242 -0.0429 0.0207  0.1306  185 ASP A N   
338  C CA  . ASP A 49  ? 0.2672 0.3783 0.3784 -0.0455 0.0154  0.1326  185 ASP A CA  
339  C C   . ASP A 49  ? 0.3059 0.4016 0.4396 -0.0427 0.0211  0.1320  185 ASP A C   
340  O O   . ASP A 49  ? 0.3055 0.4003 0.4636 -0.0409 0.0177  0.1379  185 ASP A O   
341  C CB  . ASP A 49  ? 0.2452 0.3512 0.3503 -0.0506 0.0119  0.1180  185 ASP A CB  
342  C CG  . ASP A 49  ? 0.3566 0.4796 0.4474 -0.0559 0.0011  0.1194  185 ASP A CG  
343  O OD1 . ASP A 49  ? 0.3848 0.5266 0.4731 -0.0542 -0.0036 0.1338  185 ASP A OD1 
344  O OD2 . ASP A 49  ? 0.4255 0.5436 0.5075 -0.0632 -0.0035 0.1070  185 ASP A OD2 
345  N N   . VAL A 50  ? 0.1906 0.2749 0.3157 -0.0410 0.0293  0.1239  186 VAL A N   
346  C CA  . VAL A 50  ? 0.2253 0.2954 0.3661 -0.0388 0.0331  0.1199  186 VAL A CA  
347  C C   . VAL A 50  ? 0.2645 0.3337 0.4059 -0.0367 0.0322  0.1251  186 VAL A C   
348  O O   . VAL A 50  ? 0.3816 0.4386 0.5337 -0.0354 0.0316  0.1205  186 VAL A O   
349  C CB  . VAL A 50  ? 0.3103 0.3682 0.4413 -0.0382 0.0401  0.1048  186 VAL A CB  
350  C CG1 . VAL A 50  ? 0.2231 0.2789 0.3537 -0.0410 0.0388  0.0967  186 VAL A CG1 
351  C CG2 . VAL A 50  ? 0.2953 0.3546 0.4040 -0.0362 0.0454  0.1022  186 VAL A CG2 
352  N N   . LEU A 51  ? 0.2583 0.3432 0.3887 -0.0373 0.0321  0.1353  187 LEU A N   
353  C CA  . LEU A 51  ? 0.2693 0.3589 0.4017 -0.0370 0.0312  0.1418  187 LEU A CA  
354  C C   . LEU A 51  ? 0.3264 0.4236 0.4723 -0.0390 0.0231  0.1587  187 LEU A C   
355  O O   . LEU A 51  ? 0.3375 0.4299 0.4955 -0.0413 0.0194  0.1638  187 LEU A O   
356  C CB  . LEU A 51  ? 0.2965 0.4029 0.4092 -0.0344 0.0384  0.1424  187 LEU A CB  
357  C CG  . LEU A 51  ? 0.3431 0.4451 0.4512 -0.0314 0.0446  0.1325  187 LEU A CG  
358  C CD1 . LEU A 51  ? 0.2731 0.3535 0.3862 -0.0318 0.0452  0.1188  187 LEU A CD1 
359  C CD2 . LEU A 51  ? 0.3583 0.4751 0.4450 -0.0247 0.0542  0.1312  187 LEU A CD2 
360  N N   . ILE A 52  ? 0.3300 0.4396 0.4743 -0.0394 0.0197  0.1689  188 ILE A N   
361  C CA  . ILE A 52  ? 0.3233 0.4427 0.4802 -0.0406 0.0117  0.1877  188 ILE A CA  
362  C C   . ILE A 52  ? 0.2457 0.3488 0.4276 -0.0391 0.0053  0.1906  188 ILE A C   
363  O O   . ILE A 52  ? 0.2825 0.3846 0.4675 -0.0376 0.0052  0.1871  188 ILE A O   
364  C CB  . ILE A 52  ? 0.3350 0.4819 0.4754 -0.0413 0.0105  0.1998  188 ILE A CB  
365  C CG1 . ILE A 52  ? 0.3814 0.5462 0.4968 -0.0399 0.0186  0.1970  188 ILE A CG1 
366  C CG2 . ILE A 52  ? 0.2993 0.4584 0.4543 -0.0423 0.0016  0.2209  188 ILE A CG2 
367  C CD1 . ILE A 52  ? 0.3970 0.5892 0.4870 -0.0393 0.0191  0.2040  188 ILE A CD1 
368  N N   . PRO A 53  ? 0.2384 0.3292 0.4393 -0.0397 0.0002  0.1976  189 PRO A N   
369  C CA  . PRO A 53  ? 0.2464 0.3185 0.4726 -0.0360 -0.0050 0.2004  189 PRO A CA  
370  C C   . PRO A 53  ? 0.2887 0.3745 0.5233 -0.0320 -0.0094 0.2128  189 PRO A C   
371  O O   . PRO A 53  ? 0.3729 0.4823 0.5995 -0.0343 -0.0132 0.2279  189 PRO A O   
372  C CB  . PRO A 53  ? 0.2432 0.3078 0.4826 -0.0397 -0.0114 0.2126  189 PRO A CB  
373  C CG  . PRO A 53  ? 0.2402 0.3100 0.4650 -0.0459 -0.0077 0.2074  189 PRO A CG  
374  C CD  . PRO A 53  ? 0.2281 0.3203 0.4282 -0.0444 -0.0003 0.2018  189 PRO A CD  
375  N N   . ASN A 54  ? 0.2701 0.3445 0.5204 -0.0261 -0.0088 0.2073  190 ASN A N   
376  C CA  . ASN A 54  ? 0.3517 0.4390 0.6173 -0.0205 -0.0148 0.2219  190 ASN A CA  
377  C C   . ASN A 54  ? 0.3264 0.4442 0.5735 -0.0253 -0.0165 0.2273  190 ASN A C   
378  O O   . ASN A 54  ? 0.3850 0.5227 0.6395 -0.0219 -0.0248 0.2404  190 ASN A O   
379  C CB  . ASN A 54  ? 0.3696 0.4555 0.6514 -0.0176 -0.0231 0.2392  190 ASN A CB  
380  C CG  . ASN A 54  ? 0.3700 0.4222 0.6662 -0.0153 -0.0230 0.2316  190 ASN A CG  
381  O OD1 . ASN A 54  ? 0.5260 0.5563 0.8366 -0.0065 -0.0210 0.2203  190 ASN A OD1 
382  N ND2 . ASN A 54  ? 0.3757 0.4244 0.6673 -0.0230 -0.0258 0.2380  190 ASN A ND2 
383  N N   . ARG A 55  ? 0.2578 0.3802 0.4788 -0.0319 -0.0098 0.2118  191 ARG A N   
384  C CA  . ARG A 55  ? 0.3017 0.4477 0.4988 -0.0363 -0.0122 0.2063  191 ARG A CA  
385  C C   . ARG A 55  ? 0.3566 0.5114 0.5644 -0.0344 -0.0166 0.1973  191 ARG A C   
386  O O   . ARG A 55  ? 0.4354 0.6138 0.6346 -0.0380 -0.0248 0.2011  191 ARG A O   
387  C CB  . ARG A 55  ? 0.3843 0.5242 0.5539 -0.0408 -0.0034 0.1879  191 ARG A CB  
388  C CG  . ARG A 55  ? 0.5749 0.7316 0.7175 -0.0438 -0.0024 0.1952  191 ARG A CG  
389  C CD  . ARG A 55  ? 0.7145 0.8951 0.8381 -0.0461 -0.0110 0.1970  191 ARG A CD  
390  N NE  . ARG A 55  ? 0.8355 1.0274 0.9234 -0.0468 -0.0068 0.1908  191 ARG A NE  
391  C CZ  . ARG A 55  ? 0.9054 1.1178 0.9816 -0.0457 -0.0053 0.2082  191 ARG A CZ  
392  N NH1 . ARG A 55  ? 0.9049 1.1261 1.0035 -0.0462 -0.0091 0.2350  191 ARG A NH1 
393  N NH2 . ARG A 55  ? 0.9506 1.1749 0.9926 -0.0434 0.0002  0.1994  191 ARG A NH2 
394  N N   . MET A 56  ? 0.2832 0.4223 0.5095 -0.0293 -0.0112 0.1856  192 MET A N   
395  C CA  . MET A 56  ? 0.3116 0.4628 0.5479 -0.0289 -0.0122 0.1758  192 MET A CA  
396  C C   . MET A 56  ? 0.3171 0.4694 0.5875 -0.0163 -0.0128 0.1812  192 MET A C   
397  O O   . MET A 56  ? 0.2821 0.4116 0.5655 -0.0077 -0.0087 0.1820  192 MET A O   
398  C CB  . MET A 56  ? 0.2380 0.3762 0.4597 -0.0343 -0.0031 0.1544  192 MET A CB  
399  C CG  . MET A 56  ? 0.2749 0.4093 0.4629 -0.0432 -0.0021 0.1474  192 MET A CG  
400  S SD  . MET A 56  ? 0.5805 0.7152 0.7535 -0.0534 -0.0019 0.1295  192 MET A SD  
401  C CE  . MET A 56  ? 0.5279 0.6470 0.7185 -0.0480 0.0098  0.1200  192 MET A CE  
402  N N   . SER A 57  ? 0.1847 0.3639 0.4697 -0.0151 -0.0182 0.1842  193 SER A N   
403  C CA  . SER A 57  ? 0.2825 0.4704 0.6018 0.0001  -0.0186 0.1908  193 SER A CA  
404  C C   . SER A 57  ? 0.3614 0.5630 0.6922 0.0014  -0.0113 0.1770  193 SER A C   
405  O O   . SER A 57  ? 0.3761 0.5875 0.6917 -0.0128 -0.0105 0.1675  193 SER A O   
406  C CB  . SER A 57  ? 0.2571 0.4753 0.5915 0.0037  -0.0319 0.2127  193 SER A CB  
407  O OG  . SER A 57  ? 0.3188 0.5278 0.6428 0.0025  -0.0382 0.2292  193 SER A OG  
408  N N   . GLY A 58  ? 0.3257 0.5280 0.6837 0.0189  -0.0060 0.1766  194 GLY A N   
409  C CA  . GLY A 58  ? 0.3231 0.5455 0.6951 0.0226  0.0025  0.1663  194 GLY A CA  
410  C C   . GLY A 58  ? 0.3388 0.5684 0.7417 0.0467  0.0065  0.1694  194 GLY A C   
411  O O   . GLY A 58  ? 0.2992 0.5224 0.7128 0.0582  -0.0007 0.1822  194 GLY A O   
412  N N   . GLU A 59  ? 0.3109 0.5478 0.7177 0.0534  0.0185  0.1554  195 GLU A N   
413  C CA  . GLU A 59  ? 0.2950 0.5360 0.7196 0.0770  0.0245  0.1519  195 GLU A CA  
414  C C   . GLU A 59  ? 0.3344 0.5489 0.7538 0.0890  0.0380  0.1323  195 GLU A C   
415  O O   . GLU A 59  ? 0.3327 0.5521 0.7394 0.0794  0.0470  0.1208  195 GLU A O   
416  C CB  . GLU A 59  ? 0.2049 0.4909 0.6388 0.0757  0.0263  0.1539  195 GLU A CB  
417  N N   . CYS A 60  ? 0.3906 0.5743 0.8164 0.1089  0.0384  0.1276  196 CYS A N   
418  C CA  . CYS A 60  ? 0.4068 0.5647 0.8249 0.1220  0.0498  0.1058  196 CYS A CA  
419  C C   . CYS A 60  ? 0.4186 0.6073 0.8446 0.1396  0.0599  0.0964  196 CYS A C   
420  O O   . CYS A 60  ? 0.4799 0.6871 0.9225 0.1530  0.0561  0.1049  196 CYS A O   
421  C CB  . CYS A 60  ? 0.3826 0.4894 0.7999 0.1340  0.0440  0.1020  196 CYS A CB  
422  S SG  . CYS A 60  ? 0.4004 0.4677 0.8012 0.1455  0.0542  0.0719  196 CYS A SG  
423  N N   . GLN A 61  ? 0.4469 0.6441 0.8608 0.1399  0.0728  0.0798  197 GLN A N   
424  C CA  . GLN A 61  ? 0.5052 0.7354 0.9247 0.1570  0.0834  0.0704  197 GLN A CA  
425  C C   . GLN A 61  ? 0.5643 0.7647 0.9776 0.1840  0.0900  0.0482  197 GLN A C   
426  O O   . GLN A 61  ? 0.6027 0.8286 1.0182 0.2015  0.0998  0.0364  197 GLN A O   
427  C CB  . GLN A 61  ? 0.4123 0.6771 0.8208 0.1408  0.0932  0.0677  197 GLN A CB  
428  N N   . SER A 62  ? 0.5986 0.7445 1.0031 0.1862  0.0836  0.0416  198 SER A N   
429  C CA  . SER A 62  ? 0.6613 0.7693 1.0568 0.2105  0.0857  0.0193  198 SER A CA  
430  C C   . SER A 62  ? 0.7088 0.8241 1.1221 0.2363  0.0822  0.0222  198 SER A C   
431  O O   . SER A 62  ? 0.6659 0.7915 1.0975 0.2324  0.0725  0.0443  198 SER A O   
432  C CB  . SER A 62  ? 0.6505 0.6956 1.0336 0.2019  0.0758  0.0143  198 SER A CB  
433  O OG  . SER A 62  ? 0.5937 0.6294 0.9581 0.1853  0.0811  0.0032  198 SER A OG  
434  N N   . PRO A 63  ? 0.7929 0.9042 1.1999 0.2637  0.0897  -0.0008 199 PRO A N   
435  C CA  . PRO A 63  ? 0.8425 0.9633 1.2660 0.2939  0.0885  -0.0042 199 PRO A CA  
436  C C   . PRO A 63  ? 0.8130 0.9104 1.2533 0.2973  0.0735  0.0165  199 PRO A C   
437  O O   . PRO A 63  ? 0.7741 0.9130 1.2381 0.2965  0.0705  0.0369  199 PRO A O   
438  C CB  . PRO A 63  ? 0.9037 0.9827 1.3042 0.3180  0.0922  -0.0362 199 PRO A CB  
439  C CG  . PRO A 63  ? 0.8697 0.9595 1.2477 0.3035  0.1033  -0.0507 199 PRO A CG  
440  C CD  . PRO A 63  ? 0.8126 0.9087 1.1927 0.2679  0.0997  -0.0280 199 PRO A CD  
441  N N   . HIS A 64  ? 0.7941 0.8262 1.2212 0.2992  0.0638  0.0124  200 HIS A N   
442  C CA  . HIS A 64  ? 0.7911 0.7977 1.2320 0.3039  0.0499  0.0319  200 HIS A CA  
443  C C   . HIS A 64  ? 0.7151 0.6940 1.1528 0.2726  0.0384  0.0521  200 HIS A C   
444  O O   . HIS A 64  ? 0.7373 0.6784 1.1779 0.2730  0.0263  0.0644  200 HIS A O   
445  C CB  . HIS A 64  ? 0.9140 0.8667 1.3445 0.3337  0.0462  0.0140  200 HIS A CB  
446  C CG  . HIS A 64  ? 1.0396 1.0071 1.4611 0.3632  0.0585  -0.0157 200 HIS A CG  
447  N ND1 . HIS A 64  ? 1.0533 1.0822 1.4992 0.3827  0.0653  -0.0172 200 HIS A ND1 
448  C CD2 . HIS A 64  ? 1.1151 1.0467 1.5061 0.3756  0.0651  -0.0453 200 HIS A CD2 
449  C CE1 . HIS A 64  ? 1.0978 1.1315 1.5336 0.4056  0.0747  -0.0486 200 HIS A CE1 
450  N NE2 . HIS A 64  ? 1.1434 1.1174 1.5405 0.4040  0.0750  -0.0657 200 HIS A NE2 
451  N N   . CYS A 65  ? 0.5382 0.5379 0.9701 0.2459  0.0421  0.0561  201 CYS A N   
452  C CA  . CYS A 65  ? 0.4723 0.4534 0.9011 0.2173  0.0318  0.0742  201 CYS A CA  
453  C C   . CYS A 65  ? 0.4247 0.4493 0.8709 0.2054  0.0258  0.1033  201 CYS A C   
454  O O   . CYS A 65  ? 0.4139 0.4900 0.8675 0.2018  0.0322  0.1074  201 CYS A O   
455  C CB  . CYS A 65  ? 0.4225 0.3991 0.8341 0.1961  0.0374  0.0630  201 CYS A CB  
456  S SG  . CYS A 65  ? 0.4002 0.3534 0.8064 0.1642  0.0247  0.0830  201 CYS A SG  
457  N N   . PRO A 66  ? 0.4377 0.4422 0.8883 0.1980  0.0129  0.1239  202 PRO A N   
458  C CA  . PRO A 66  ? 0.4148 0.4568 0.8770 0.1855  0.0052  0.1517  202 PRO A CA  
459  C C   . PRO A 66  ? 0.3746 0.4228 0.8247 0.1559  0.0022  0.1611  202 PRO A C   
460  O O   . PRO A 66  ? 0.4359 0.5138 0.8896 0.1434  -0.0049 0.1821  202 PRO A O   
461  C CB  . PRO A 66  ? 0.4567 0.4685 0.9254 0.1933  -0.0065 0.1672  202 PRO A CB  
462  C CG  . PRO A 66  ? 0.5683 0.5188 1.0217 0.1914  -0.0080 0.1523  202 PRO A CG  
463  C CD  . PRO A 66  ? 0.4815 0.4261 0.9244 0.2004  0.0043  0.1219  202 PRO A CD  
464  N N   . GLY A 67  ? 0.3640 0.3857 0.7983 0.1459  0.0070  0.1451  203 GLY A N   
465  C CA  . GLY A 67  ? 0.3309 0.3549 0.7524 0.1207  0.0045  0.1523  203 GLY A CA  
466  C C   . GLY A 67  ? 0.3510 0.4255 0.7744 0.1089  0.0052  0.1631  203 GLY A C   
467  O O   . GLY A 67  ? 0.3896 0.4974 0.8193 0.1146  0.0130  0.1551  203 GLY A O   
468  N N   . THR A 68  ? 0.3231 0.4041 0.7384 0.0908  -0.0033 0.1807  204 THR A N   
469  C CA  . THR A 68  ? 0.2627 0.3882 0.6760 0.0782  -0.0068 0.1917  204 THR A CA  
470  C C   . THR A 68  ? 0.3376 0.4574 0.7266 0.0568  -0.0082 0.1916  204 THR A C   
471  O O   . THR A 68  ? 0.4180 0.5651 0.7923 0.0422  -0.0093 0.1912  204 THR A O   
472  C CB  . THR A 68  ? 0.3696 0.5162 0.7912 0.0801  -0.0177 0.2136  204 THR A CB  
473  O OG1 . THR A 68  ? 0.5675 0.7579 0.9997 0.0832  -0.0174 0.2144  204 THR A OG1 
474  C CG2 . THR A 68  ? 0.2972 0.4493 0.7028 0.0622  -0.0276 0.2314  204 THR A CG2 
475  N N   . SER A 69  ? 0.2398 0.3207 0.6173 0.0527  -0.0074 0.1881  205 SER A N   
476  C CA  . SER A 69  ? 0.2270 0.3020 0.5759 0.0326  -0.0071 0.1866  205 SER A CA  
477  C C   . SER A 69  ? 0.2969 0.3572 0.6282 0.0269  0.0035  0.1625  205 SER A C   
478  O O   . SER A 69  ? 0.2396 0.2770 0.5775 0.0366  0.0089  0.1482  205 SER A O   
479  C CB  . SER A 69  ? 0.2449 0.2959 0.5931 0.0279  -0.0143 0.2038  205 SER A CB  
480  O OG  . SER A 69  ? 0.3285 0.3978 0.6851 0.0296  -0.0235 0.2257  205 SER A OG  
481  N N   . ALA A 70  ? 0.1962 0.2694 0.5036 0.0120  0.0060  0.1579  206 ALA A N   
482  C CA  . ALA A 70  ? 0.2709 0.3335 0.5602 0.0059  0.0153  0.1385  206 ALA A CA  
483  C C   . ALA A 70  ? 0.3062 0.3452 0.5825 -0.0019 0.0150  0.1388  206 ALA A C   
484  O O   . ALA A 70  ? 0.2861 0.3279 0.5573 -0.0089 0.0093  0.1545  206 ALA A O   
485  C CB  . ALA A 70  ? 0.1683 0.2527 0.4399 -0.0049 0.0176  0.1337  206 ALA A CB  
486  N N   . GLU A 71  ? 0.2589 0.2798 0.5295 -0.0013 0.0212  0.1224  207 GLU A N   
487  C CA  . GLU A 71  ? 0.3116 0.3154 0.5710 -0.0103 0.0210  0.1212  207 GLU A CA  
488  C C   . GLU A 71  ? 0.2941 0.3028 0.5340 -0.0146 0.0293  0.1053  207 GLU A C   
489  O O   . GLU A 71  ? 0.2206 0.2261 0.4609 -0.0083 0.0350  0.0902  207 GLU A O   
490  C CB  . GLU A 71  ? 0.3700 0.3432 0.6433 -0.0051 0.0174  0.1165  207 GLU A CB  
491  C CG  . GLU A 71  ? 0.4676 0.4238 0.7331 -0.0164 0.0153  0.1143  207 GLU A CG  
492  C CD  . GLU A 71  ? 0.6129 0.5365 0.8919 -0.0138 0.0073  0.1116  207 GLU A CD  
493  O OE1 . GLU A 71  ? 0.6579 0.5600 0.9386 -0.0070 0.0092  0.0926  207 GLU A OE1 
494  O OE2 . GLU A 71  ? 0.6297 0.5521 0.9124 -0.0178 -0.0012 0.1254  207 GLU A OE2 
495  N N   . PHE A 72  ? 0.2511 0.2690 0.4736 -0.0237 0.0305  0.1094  208 PHE A N   
496  C CA  . PHE A 72  ? 0.3078 0.3290 0.5122 -0.0266 0.0377  0.0972  208 PHE A CA  
497  C C   . PHE A 72  ? 0.2566 0.2674 0.4537 -0.0301 0.0379  0.0924  208 PHE A C   
498  O O   . PHE A 72  ? 0.2267 0.2336 0.4252 -0.0330 0.0315  0.0996  208 PHE A O   
499  C CB  . PHE A 72  ? 0.2666 0.3018 0.4503 -0.0300 0.0377  0.0994  208 PHE A CB  
500  C CG  . PHE A 72  ? 0.2455 0.2938 0.4356 -0.0306 0.0369  0.1025  208 PHE A CG  
501  C CD1 . PHE A 72  ? 0.2043 0.2559 0.3906 -0.0312 0.0416  0.0926  208 PHE A CD1 
502  C CD2 . PHE A 72  ? 0.2455 0.3049 0.4426 -0.0309 0.0297  0.1154  208 PHE A CD2 
503  C CE1 . PHE A 72  ? 0.2456 0.3119 0.4372 -0.0335 0.0385  0.0948  208 PHE A CE1 
504  C CE2 . PHE A 72  ? 0.1735 0.2485 0.3744 -0.0318 0.0260  0.1167  208 PHE A CE2 
505  C CZ  . PHE A 72  ? 0.1714 0.2499 0.3706 -0.0339 0.0302  0.1060  208 PHE A CZ  
506  N N   . PHE A 73  ? 0.2629 0.2725 0.4509 -0.0299 0.0441  0.0805  209 PHE A N   
507  C CA  . PHE A 73  ? 0.3041 0.3103 0.4844 -0.0343 0.0440  0.0771  209 PHE A CA  
508  C C   . PHE A 73  ? 0.3188 0.3317 0.4826 -0.0329 0.0513  0.0688  209 PHE A C   
509  O O   . PHE A 73  ? 0.2640 0.2799 0.4241 -0.0293 0.0559  0.0636  209 PHE A O   
510  C CB  . PHE A 73  ? 0.2418 0.2305 0.4330 -0.0348 0.0391  0.0697  209 PHE A CB  
511  C CG  . PHE A 73  ? 0.3139 0.2961 0.5044 -0.0261 0.0431  0.0532  209 PHE A CG  
512  C CD1 . PHE A 73  ? 0.3367 0.3131 0.5406 -0.0171 0.0429  0.0514  209 PHE A CD1 
513  C CD2 . PHE A 73  ? 0.3348 0.3202 0.5111 -0.0254 0.0473  0.0407  209 PHE A CD2 
514  C CE1 . PHE A 73  ? 0.3671 0.3430 0.5706 -0.0066 0.0485  0.0362  209 PHE A CE1 
515  C CE2 . PHE A 73  ? 0.3558 0.3402 0.5292 -0.0165 0.0523  0.0262  209 PHE A CE2 
516  C CZ  . PHE A 73  ? 0.3615 0.3419 0.5486 -0.0066 0.0536  0.0233  209 PHE A CZ  
517  N N   . PHE A 74  ? 0.2892 0.3063 0.4436 -0.0358 0.0513  0.0692  210 PHE A N   
518  C CA  . PHE A 74  ? 0.2621 0.2849 0.4017 -0.0335 0.0576  0.0649  210 PHE A CA  
519  C C   . PHE A 74  ? 0.2642 0.2867 0.4010 -0.0343 0.0565  0.0567  210 PHE A C   
520  O O   . PHE A 74  ? 0.3007 0.3196 0.4458 -0.0392 0.0499  0.0558  210 PHE A O   
521  C CB  . PHE A 74  ? 0.2608 0.2917 0.3855 -0.0314 0.0570  0.0706  210 PHE A CB  
522  C CG  . PHE A 74  ? 0.2369 0.2677 0.3549 -0.0293 0.0565  0.0736  210 PHE A CG  
523  C CD1 . PHE A 74  ? 0.2374 0.2726 0.3611 -0.0310 0.0516  0.0808  210 PHE A CD1 
524  C CD2 . PHE A 74  ? 0.2080 0.2343 0.3151 -0.0272 0.0609  0.0705  210 PHE A CD2 
525  C CE1 . PHE A 74  ? 0.2767 0.3154 0.3945 -0.0303 0.0518  0.0848  210 PHE A CE1 
526  C CE2 . PHE A 74  ? 0.2930 0.3190 0.3954 -0.0280 0.0606  0.0734  210 PHE A CE2 
527  C CZ  . PHE A 74  ? 0.2026 0.2368 0.3100 -0.0293 0.0564  0.0805  210 PHE A CZ  
528  N N   . LYS A 75  ? 0.3051 0.3311 0.4293 -0.0307 0.0619  0.0513  211 LYS A N   
529  C CA  . LYS A 75  ? 0.3483 0.3786 0.4655 -0.0311 0.0604  0.0442  211 LYS A CA  
530  C C   . LYS A 75  ? 0.3724 0.4129 0.4754 -0.0282 0.0646  0.0496  211 LYS A C   
531  O O   . LYS A 75  ? 0.3424 0.3804 0.4391 -0.0248 0.0704  0.0541  211 LYS A O   
532  C CB  . LYS A 75  ? 0.2487 0.2746 0.3643 -0.0276 0.0624  0.0311  211 LYS A CB  
533  C CG  . LYS A 75  ? 0.3394 0.3516 0.4699 -0.0271 0.0578  0.0249  211 LYS A CG  
534  C CD  . LYS A 75  ? 0.3794 0.3836 0.5064 -0.0246 0.0548  0.0079  211 LYS A CD  
535  C CE  . LYS A 75  ? 0.5018 0.5140 0.6212 -0.0148 0.0641  -0.0016 211 LYS A CE  
536  N NZ  . LYS A 75  ? 0.4497 0.4549 0.5608 -0.0099 0.0618  -0.0213 211 LYS A NZ  
537  N N   . CYS A 76  ? 0.2697 0.3208 0.3687 -0.0298 0.0606  0.0497  212 CYS A N   
538  C CA  . CYS A 76  ? 0.3378 0.3995 0.4243 -0.0249 0.0640  0.0563  212 CYS A CA  
539  C C   . CYS A 76  ? 0.2901 0.3495 0.3649 -0.0216 0.0700  0.0522  212 CYS A C   
540  O O   . CYS A 76  ? 0.2720 0.3317 0.3455 -0.0229 0.0695  0.0415  212 CYS A O   
541  C CB  . CYS A 76  ? 0.3062 0.3852 0.3921 -0.0277 0.0569  0.0576  212 CYS A CB  
542  S SG  . CYS A 76  ? 0.2727 0.3669 0.3450 -0.0185 0.0607  0.0691  212 CYS A SG  
543  N N   . GLY A 77  ? 0.3501 0.4070 0.4164 -0.0171 0.0757  0.0611  213 GLY A N   
544  C CA  . GLY A 77  ? 0.2056 0.2625 0.2630 -0.0163 0.0818  0.0616  213 GLY A CA  
545  C C   . GLY A 77  ? 0.3134 0.3833 0.3568 -0.0131 0.0825  0.0678  213 GLY A C   
546  O O   . GLY A 77  ? 0.3406 0.4146 0.3756 -0.0130 0.0880  0.0713  213 GLY A O   
547  N N   . ALA A 78  ? 0.3297 0.4104 0.3713 -0.0107 0.0769  0.0712  214 ALA A N   
548  C CA  . ALA A 78  ? 0.3099 0.4052 0.3384 -0.0064 0.0766  0.0803  214 ALA A CA  
549  C C   . ALA A 78  ? 0.2665 0.3803 0.2840 -0.0095 0.0738  0.0712  214 ALA A C   
550  O O   . ALA A 78  ? 0.3841 0.5145 0.3886 -0.0064 0.0726  0.0791  214 ALA A O   
551  C CB  . ALA A 78  ? 0.3194 0.4245 0.3512 -0.0008 0.0717  0.0900  214 ALA A CB  
552  N N   . HIS A 79  ? 0.2472 0.3576 0.2684 -0.0141 0.0725  0.0544  215 HIS A N   
553  C CA  . HIS A 79  ? 0.3080 0.4325 0.3165 -0.0157 0.0686  0.0403  215 HIS A CA  
554  C C   . HIS A 79  ? 0.3104 0.4224 0.3250 -0.0169 0.0699  0.0218  215 HIS A C   
555  O O   . HIS A 79  ? 0.2856 0.3805 0.3169 -0.0181 0.0710  0.0218  215 HIS A O   
556  C CB  . HIS A 79  ? 0.3345 0.4719 0.3419 -0.0201 0.0559  0.0378  215 HIS A CB  
557  C CG  . HIS A 79  ? 0.2752 0.4021 0.3029 -0.0257 0.0491  0.0374  215 HIS A CG  
558  N ND1 . HIS A 79  ? 0.2202 0.3291 0.2591 -0.0309 0.0463  0.0239  215 HIS A ND1 
559  C CD2 . HIS A 79  ? 0.2635 0.3978 0.3030 -0.0259 0.0455  0.0509  215 HIS A CD2 
560  C CE1 . HIS A 79  ? 0.2482 0.3542 0.3044 -0.0361 0.0408  0.0307  215 HIS A CE1 
561  N NE2 . HIS A 79  ? 0.2809 0.4044 0.3376 -0.0329 0.0409  0.0464  215 HIS A NE2 
562  N N   . PRO A 80  ? 0.3422 0.4630 0.3421 -0.0149 0.0698  0.0057  216 PRO A N   
563  C CA  . PRO A 80  ? 0.3542 0.4603 0.3608 -0.0126 0.0709  -0.0131 216 PRO A CA  
564  C C   . PRO A 80  ? 0.4016 0.4863 0.4252 -0.0194 0.0594  -0.0196 216 PRO A C   
565  O O   . PRO A 80  ? 0.4108 0.4993 0.4344 -0.0270 0.0487  -0.0168 216 PRO A O   
566  C CB  . PRO A 80  ? 0.2974 0.4165 0.2805 -0.0084 0.0699  -0.0318 216 PRO A CB  
567  C CG  . PRO A 80  ? 0.3785 0.5250 0.3428 -0.0073 0.0742  -0.0171 216 PRO A CG  
568  C CD  . PRO A 80  ? 0.3554 0.5000 0.3308 -0.0129 0.0690  0.0037  216 PRO A CD  
569  N N   . THR A 81  ? 0.3230 0.3885 0.3625 -0.0173 0.0613  -0.0253 217 THR A N   
570  C CA  . THR A 81  ? 0.3935 0.4375 0.4487 -0.0243 0.0500  -0.0306 217 THR A CA  
571  C C   . THR A 81  ? 0.4617 0.4851 0.5192 -0.0185 0.0484  -0.0514 217 THR A C   
572  O O   . THR A 81  ? 0.4266 0.4525 0.4830 -0.0070 0.0589  -0.0570 217 THR A O   
573  C CB  . THR A 81  ? 0.3990 0.4356 0.4750 -0.0277 0.0508  -0.0132 217 THR A CB  
574  O OG1 . THR A 81  ? 0.4261 0.4645 0.5063 -0.0204 0.0621  -0.0073 217 THR A OG1 
575  C CG2 . THR A 81  ? 0.3983 0.4496 0.4741 -0.0334 0.0483  0.0037  217 THR A CG2 
576  N N   . SER A 82  ? 0.4885 0.4913 0.5507 -0.0264 0.0348  -0.0621 218 SER A N   
577  C CA  . SER A 82  ? 0.5604 0.5346 0.6267 -0.0202 0.0314  -0.0818 218 SER A CA  
578  C C   . SER A 82  ? 0.5237 0.4841 0.6144 -0.0153 0.0359  -0.0705 218 SER A C   
579  O O   . SER A 82  ? 0.3577 0.3300 0.4600 -0.0195 0.0397  -0.0492 218 SER A O   
580  C CB  . SER A 82  ? 0.5194 0.4702 0.5859 -0.0332 0.0134  -0.0942 218 SER A CB  
581  O OG  . SER A 82  ? 0.5403 0.5072 0.5831 -0.0381 0.0076  -0.1055 218 SER A OG  
582  N N   . ASP A 83  ? 0.5353 0.4705 0.6328 -0.0056 0.0348  -0.0852 219 ASP A N   
583  C CA  . ASP A 83  ? 0.6220 0.5485 0.7421 0.0021  0.0394  -0.0744 219 ASP A CA  
584  C C   . ASP A 83  ? 0.4986 0.4183 0.6386 -0.0117 0.0317  -0.0519 219 ASP A C   
585  O O   . ASP A 83  ? 0.3967 0.3288 0.5484 -0.0098 0.0378  -0.0346 219 ASP A O   
586  C CB  . ASP A 83  ? 0.7933 0.6895 0.9187 0.0161  0.0372  -0.0941 219 ASP A CB  
587  C CG  . ASP A 83  ? 0.9056 0.7998 1.0542 0.0280  0.0432  -0.0827 219 ASP A CG  
588  O OD1 . ASP A 83  ? 0.9111 0.8365 1.0625 0.0338  0.0553  -0.0714 219 ASP A OD1 
589  O OD2 . ASP A 83  ? 1.0139 0.8754 1.1788 0.0309  0.0347  -0.0839 219 ASP A OD2 
590  N N   . LYS A 84  ? 0.4845 0.3875 0.6274 -0.0264 0.0179  -0.0518 220 LYS A N   
591  C CA  . LYS A 84  ? 0.5240 0.4242 0.6860 -0.0397 0.0109  -0.0293 220 LYS A CA  
592  C C   . LYS A 84  ? 0.4120 0.3373 0.5694 -0.0541 0.0081  -0.0160 220 LYS A C   
593  O O   . LYS A 84  ? 0.4573 0.3833 0.6292 -0.0669 0.0010  0.0006  220 LYS A O   
594  C CB  . LYS A 84  ? 0.5917 0.4535 0.7687 -0.0467 -0.0031 -0.0329 220 LYS A CB  
595  C CG  . LYS A 84  ? 0.7130 0.5483 0.8997 -0.0298 -0.0007 -0.0414 220 LYS A CG  
596  C CD  . LYS A 84  ? 0.8287 0.6188 1.0300 -0.0367 -0.0161 -0.0445 220 LYS A CD  
597  C CE  . LYS A 84  ? 0.8840 0.6469 1.0961 -0.0159 -0.0133 -0.0520 220 LYS A CE  
598  N NZ  . LYS A 84  ? 0.9493 0.6601 1.1749 -0.0211 -0.0291 -0.0562 220 LYS A NZ  
599  N N   . GLU A 85  ? 0.3968 0.3451 0.5352 -0.0511 0.0141  -0.0218 221 GLU A N   
600  C CA  . GLU A 85  ? 0.3632 0.3390 0.4976 -0.0596 0.0137  -0.0079 221 GLU A CA  
601  C C   . GLU A 85  ? 0.2868 0.2779 0.4278 -0.0556 0.0232  0.0120  221 GLU A C   
602  O O   . GLU A 85  ? 0.2898 0.2964 0.4191 -0.0477 0.0331  0.0145  221 GLU A O   
603  C CB  . GLU A 85  ? 0.5016 0.4968 0.6132 -0.0542 0.0186  -0.0173 221 GLU A CB  
604  C CG  . GLU A 85  ? 0.6080 0.6070 0.7090 -0.0637 0.0066  -0.0288 221 GLU A CG  
605  C CD  . GLU A 85  ? 0.5309 0.5591 0.6117 -0.0595 0.0114  -0.0276 221 GLU A CD  
606  O OE1 . GLU A 85  ? 0.5223 0.5733 0.6070 -0.0633 0.0113  -0.0102 221 GLU A OE1 
607  O OE2 . GLU A 85  ? 0.5503 0.5802 0.6114 -0.0511 0.0158  -0.0430 221 GLU A OE2 
608  N N   . THR A 86  ? 0.2177 0.2037 0.3759 -0.0613 0.0199  0.0264  222 THR A N   
609  C CA  . THR A 86  ? 0.3158 0.3162 0.4763 -0.0570 0.0282  0.0426  222 THR A CA  
610  C C   . THR A 86  ? 0.3529 0.3774 0.5135 -0.0630 0.0278  0.0572  222 THR A C   
611  O O   . THR A 86  ? 0.3516 0.3830 0.5185 -0.0736 0.0192  0.0597  222 THR A O   
612  C CB  . THR A 86  ? 0.3038 0.2913 0.4803 -0.0576 0.0261  0.0522  222 THR A CB  
613  O OG1 . THR A 86  ? 0.3111 0.2955 0.5020 -0.0706 0.0162  0.0630  222 THR A OG1 
614  C CG2 . THR A 86  ? 0.2957 0.2601 0.4762 -0.0494 0.0259  0.0389  222 THR A CG2 
615  N N   . SER A 87  ? 0.2963 0.3345 0.4507 -0.0559 0.0366  0.0666  223 SER A N   
616  C CA  . SER A 87  ? 0.2845 0.3468 0.4394 -0.0570 0.0382  0.0805  223 SER A CA  
617  C C   . SER A 87  ? 0.2864 0.3506 0.4366 -0.0513 0.0408  0.0885  223 SER A C   
618  O O   . SER A 87  ? 0.2970 0.3481 0.4434 -0.0466 0.0433  0.0849  223 SER A O   
619  C CB  . SER A 87  ? 0.2571 0.3316 0.3962 -0.0481 0.0445  0.0780  223 SER A CB  
620  O OG  . SER A 87  ? 0.2836 0.3584 0.4175 -0.0510 0.0396  0.0679  223 SER A OG  
621  N N   . VAL A 88  ? 0.2547 0.3377 0.4038 -0.0509 0.0394  0.0980  224 VAL A N   
622  C CA  . VAL A 88  ? 0.2629 0.3517 0.4056 -0.0451 0.0414  0.1048  224 VAL A CA  
623  C C   . VAL A 88  ? 0.2558 0.3475 0.3824 -0.0328 0.0504  0.1020  224 VAL A C   
624  O O   . VAL A 88  ? 0.3292 0.4307 0.4504 -0.0267 0.0550  0.1019  224 VAL A O   
625  C CB  . VAL A 88  ? 0.3872 0.4990 0.5365 -0.0485 0.0379  0.1172  224 VAL A CB  
626  C CG1 . VAL A 88  ? 0.4098 0.5312 0.5527 -0.0425 0.0409  0.1250  224 VAL A CG1 
627  C CG2 . VAL A 88  ? 0.4342 0.5397 0.5999 -0.0628 0.0277  0.1208  224 VAL A CG2 
628  N N   . ALA A 89  ? 0.2178 0.3008 0.3375 -0.0295 0.0525  0.1007  225 ALA A N   
629  C CA  . ALA A 89  ? 0.2858 0.3674 0.3904 -0.0202 0.0605  0.0980  225 ALA A CA  
630  C C   . ALA A 89  ? 0.2696 0.3729 0.3675 -0.0122 0.0656  0.1058  225 ALA A C   
631  O O   . ALA A 89  ? 0.2710 0.3890 0.3730 -0.0146 0.0627  0.1141  225 ALA A O   
632  C CB  . ALA A 89  ? 0.2151 0.2842 0.3161 -0.0216 0.0602  0.0953  225 ALA A CB  
633  N N   . LEU A 90  ? 0.2552 0.3610 0.3428 -0.0012 0.0737  0.1040  226 LEU A N   
634  C CA  . LEU A 90  ? 0.2946 0.4213 0.3736 0.0111  0.0806  0.1095  226 LEU A CA  
635  C C   . LEU A 90  ? 0.3335 0.4480 0.3925 0.0204  0.0901  0.1045  226 LEU A C   
636  O O   . LEU A 90  ? 0.3528 0.4468 0.3976 0.0302  0.0936  0.0949  226 LEU A O   
637  C CB  . LEU A 90  ? 0.2651 0.4040 0.3457 0.0209  0.0839  0.1116  226 LEU A CB  
638  C CG  . LEU A 90  ? 0.3666 0.5204 0.4651 0.0109  0.0749  0.1172  226 LEU A CG  
639  C CD1 . LEU A 90  ? 0.3437 0.5136 0.4435 0.0217  0.0780  0.1210  226 LEU A CD1 
640  C CD2 . LEU A 90  ? 0.3035 0.4782 0.4128 0.0030  0.0690  0.1267  226 LEU A CD2 
641  N N   . HIS A 91  ? 0.2756 0.3956 0.3295 0.0167  0.0890  0.1070  227 HIS A N   
642  C CA  . HIS A 91  ? 0.3215 0.4197 0.3531 0.0202  0.0886  0.0948  227 HIS A CA  
643  C C   . HIS A 91  ? 0.4172 0.5127 0.4228 0.0387  0.0961  0.0854  227 HIS A C   
644  O O   . HIS A 91  ? 0.4428 0.5115 0.4272 0.0415  0.0940  0.0711  227 HIS A O   
645  C CB  . HIS A 91  ? 0.3083 0.4156 0.3416 0.0105  0.0832  0.1009  227 HIS A CB  
646  C CG  . HIS A 91  ? 0.4371 0.5804 0.4697 0.0140  0.0875  0.1151  227 HIS A CG  
647  N ND1 . HIS A 91  ? 0.4723 0.6283 0.4795 0.0279  0.0942  0.1105  227 HIS A ND1 
648  C CD2 . HIS A 91  ? 0.4570 0.6170 0.5086 0.0057  0.0798  0.1267  227 HIS A CD2 
649  C CE1 . HIS A 91  ? 0.4521 0.6400 0.4653 0.0274  0.0939  0.1236  227 HIS A CE1 
650  N NE2 . HIS A 91  ? 0.4667 0.6543 0.5075 0.0132  0.0837  0.1332  227 HIS A NE2 
651  N N   . LEU A 92  ? 0.2780 0.5136 0.4387 0.0093  0.0065  -0.0147 228 LEU A N   
652  C CA  . LEU A 92  ? 0.2798 0.5113 0.4316 -0.0007 0.0008  -0.0336 228 LEU A CA  
653  C C   . LEU A 92  ? 0.2821 0.4819 0.4470 -0.0145 0.0123  -0.0424 228 LEU A C   
654  O O   . LEU A 92  ? 0.2943 0.4887 0.4650 -0.0244 0.0097  -0.0606 228 LEU A O   
655  C CB  . LEU A 92  ? 0.2895 0.5045 0.4065 0.0066  -0.0004 -0.0285 228 LEU A CB  
656  C CG  . LEU A 92  ? 0.3303 0.5733 0.4294 0.0188  -0.0104 -0.0171 228 LEU A CG  
657  C CD1 . LEU A 92  ? 0.2999 0.5238 0.3687 0.0231  -0.0074 -0.0124 228 LEU A CD1 
658  C CD2 . LEU A 92  ? 0.2791 0.5703 0.3848 0.0158  -0.0265 -0.0313 228 LEU A CD2 
659  N N   . ILE A 93  ? 0.2188 0.3964 0.3879 -0.0151 0.0264  -0.0293 229 ILE A N   
660  C CA  . ILE A 93  ? 0.1953 0.3397 0.3697 -0.0271 0.0387  -0.0301 229 ILE A CA  
661  C C   . ILE A 93  ? 0.1753 0.3354 0.3880 -0.0403 0.0445  -0.0379 229 ILE A C   
662  O O   . ILE A 93  ? 0.2547 0.4389 0.4854 -0.0374 0.0481  -0.0330 229 ILE A O   
663  C CB  . ILE A 93  ? 0.2160 0.3282 0.3657 -0.0227 0.0512  -0.0115 229 ILE A CB  
664  C CG1 . ILE A 93  ? 0.2332 0.3310 0.3511 -0.0130 0.0447  -0.0059 229 ILE A CG1 
665  C CG2 . ILE A 93  ? 0.1874 0.2699 0.3400 -0.0350 0.0637  -0.0069 229 ILE A CG2 
666  C CD1 . ILE A 93  ? 0.2835 0.3527 0.3758 -0.0108 0.0535  0.0089  229 ILE A CD1 
667  N N   . ALA A 94  ? 0.2503 0.3966 0.4799 -0.0547 0.0465  -0.0500 230 ALA A N   
668  C CA  . ALA A 94  ? 0.2635 0.4255 0.5348 -0.0708 0.0519  -0.0596 230 ALA A CA  
669  C C   . ALA A 94  ? 0.3440 0.4666 0.6256 -0.0856 0.0661  -0.0565 230 ALA A C   
670  O O   . ALA A 94  ? 0.4014 0.4887 0.6639 -0.0836 0.0664  -0.0529 230 ALA A O   
671  C CB  . ALA A 94  ? 0.2442 0.4452 0.5393 -0.0772 0.0350  -0.0847 230 ALA A CB  
672  N N   . THR A 95  ? 0.3706 0.5010 0.6863 -0.1003 0.0781  -0.0560 231 THR A N   
673  C CA  . THR A 95  ? 0.4289 0.5242 0.7617 -0.1171 0.0917  -0.0523 231 THR A CA  
674  C C   . THR A 95  ? 0.3825 0.4703 0.7364 -0.1265 0.0815  -0.0766 231 THR A C   
675  O O   . THR A 95  ? 0.3508 0.4751 0.7248 -0.1305 0.0678  -0.1010 231 THR A O   
676  C CB  . THR A 95  ? 0.4895 0.5974 0.8475 -0.1286 0.1033  -0.0479 231 THR A CB  
677  O OG1 . THR A 95  ? 0.6379 0.7953 1.0242 -0.1295 0.0911  -0.0660 231 THR A OG1 
678  C CG2 . THR A 95  ? 0.3923 0.4947 0.7263 -0.1219 0.1188  -0.0246 231 THR A CG2 
679  N N   . ASN A 96  ? 0.3663 0.4075 0.7148 -0.1290 0.0875  -0.0702 232 ASN A N   
680  C CA  . ASN A 96  ? 0.4471 0.4740 0.8123 -0.1341 0.0800  -0.0945 232 ASN A CA  
681  C C   . ASN A 96  ? 0.4810 0.4976 0.8748 -0.1486 0.0866  -0.0996 232 ASN A C   
682  O O   . ASN A 96  ? 0.5321 0.5068 0.9298 -0.1511 0.0959  -0.0879 232 ASN A O   
683  C CB  . ASN A 96  ? 0.4378 0.4200 0.7864 -0.1249 0.0822  -0.0849 232 ASN A CB  
684  C CG  . ASN A 96  ? 0.4599 0.4317 0.8229 -0.1252 0.0749  -0.1146 232 ASN A CG  
685  O OD1 . ASN A 96  ? 0.4256 0.4232 0.8066 -0.1339 0.0679  -0.1434 232 ASN A OD1 
686  N ND2 . ASN A 96  ? 0.4774 0.4137 0.8309 -0.1142 0.0765  -0.1080 232 ASN A ND2 
687  N N   . SER A 97  ? 0.5213 0.5786 0.9367 -0.1577 0.0810  -0.1155 233 SER A N   
688  C CA  . SER A 97  ? 0.5561 0.6107 1.0027 -0.1738 0.0874  -0.1207 233 SER A CA  
689  C C   . SER A 97  ? 0.6818 0.7126 1.1464 -0.1812 0.0847  -0.1447 233 SER A C   
690  O O   . SER A 97  ? 0.7620 0.7641 1.2471 -0.1917 0.0957  -0.1393 233 SER A O   
691  C CB  . SER A 97  ? 0.5661 0.6759 1.0331 -0.1803 0.0788  -0.1336 233 SER A CB  
692  O OG  . SER A 97  ? 0.5626 0.6953 1.0187 -0.1719 0.0836  -0.1124 233 SER A OG  
693  N N   . ARG A 98  ? 0.6645 0.7087 1.1208 -0.1755 0.0709  -0.1715 234 ARG A N   
694  C CA  . ARG A 98  ? 0.6573 0.6871 1.1302 -0.1820 0.0684  -0.2010 234 ARG A CA  
695  C C   . ARG A 98  ? 0.6153 0.5921 1.0818 -0.1724 0.0777  -0.1919 234 ARG A C   
696  O O   . ARG A 98  ? 0.5906 0.5485 1.0722 -0.1748 0.0791  -0.2141 234 ARG A O   
697  C CB  . ARG A 98  ? 0.7600 0.8335 1.2213 -0.1797 0.0500  -0.2342 234 ARG A CB  
698  C CG  . ARG A 98  ? 0.8418 0.9737 1.3046 -0.1836 0.0369  -0.2363 234 ARG A CG  
699  C CD  . ARG A 98  ? 0.9440 1.1208 1.3807 -0.1751 0.0172  -0.2567 234 ARG A CD  
700  N NE  . ARG A 98  ? 1.0461 1.2798 1.4918 -0.1807 0.0021  -0.2625 234 ARG A NE  
701  C CZ  . ARG A 98  ? 1.0782 1.3599 1.5021 -0.1743 -0.0175 -0.2752 234 ARG A CZ  
702  N NH1 . ARG A 98  ? 1.0731 1.3538 1.4625 -0.1631 -0.0227 -0.2851 234 ARG A NH1 
703  N NH2 . ARG A 98  ? 1.0697 1.4017 1.5059 -0.1785 -0.0317 -0.2755 234 ARG A NH2 
704  N N   . ASN A 99  ? 0.6215 0.5764 1.0663 -0.1608 0.0840  -0.1588 235 ASN A N   
705  C CA  . ASN A 99  ? 0.6062 0.5149 1.0433 -0.1487 0.0906  -0.1432 235 ASN A CA  
706  C C   . ASN A 99  ? 0.5367 0.4467 0.9671 -0.1381 0.0828  -0.1702 235 ASN A C   
707  O O   . ASN A 99  ? 0.5393 0.4188 0.9845 -0.1342 0.0880  -0.1777 235 ASN A O   
708  C CB  . ASN A 99  ? 0.6327 0.5022 1.0961 -0.1564 0.1029  -0.1324 235 ASN A CB  
709  C CG  . ASN A 99  ? 0.6757 0.5453 1.1431 -0.1676 0.1123  -0.1058 235 ASN A CG  
710  O OD1 . ASN A 99  ? 0.6581 0.5175 1.1008 -0.1611 0.1174  -0.0716 235 ASN A OD1 
711  N ND2 . ASN A 99  ? 0.6650 0.5482 1.1622 -0.1852 0.1148  -0.1220 235 ASN A ND2 
712  N N   . ILE A 100 ? 0.4847 0.4324 0.8934 -0.1333 0.0710  -0.1846 236 ILE A N   
713  C CA  . ILE A 100 ? 0.5392 0.4931 0.9341 -0.1224 0.0643  -0.2086 236 ILE A CA  
714  C C   . ILE A 100 ? 0.5710 0.4877 0.9538 -0.1054 0.0700  -0.1841 236 ILE A C   
715  O O   . ILE A 100 ? 0.5590 0.4657 0.9269 -0.1007 0.0721  -0.1512 236 ILE A O   
716  C CB  . ILE A 100 ? 0.5033 0.5103 0.8724 -0.1206 0.0493  -0.2244 236 ILE A CB  
717  C CG1 . ILE A 100 ? 0.4420 0.4915 0.8216 -0.1346 0.0415  -0.2336 236 ILE A CG1 
718  C CG2 . ILE A 100 ? 0.4732 0.4947 0.8267 -0.1128 0.0434  -0.2557 236 ILE A CG2 
719  C CD1 . ILE A 100 ? 0.4789 0.5393 0.8773 -0.1463 0.0389  -0.2667 236 ILE A CD1 
720  N N   . THR A 101 ? 0.4895 0.3885 0.8788 -0.0960 0.0728  -0.1995 237 THR A N   
721  C CA  . THR A 101 ? 0.4350 0.3049 0.8165 -0.0778 0.0763  -0.1774 237 THR A CA  
722  C C   . THR A 101 ? 0.4716 0.3654 0.8204 -0.0666 0.0680  -0.1790 237 THR A C   
723  O O   . THR A 101 ? 0.5688 0.5026 0.9009 -0.0703 0.0598  -0.2054 237 THR A O   
724  C CB  . THR A 101 ? 0.4899 0.3379 0.8947 -0.0704 0.0831  -0.1939 237 THR A CB  
725  O OG1 . THR A 101 ? 0.4716 0.3502 0.8734 -0.0744 0.0798  -0.2374 237 THR A OG1 
726  C CG2 . THR A 101 ? 0.5070 0.3235 0.9453 -0.0798 0.0924  -0.1855 237 THR A CG2 
727  N N   . CYS A 102 ? 0.3801 0.2562 0.7138 -0.0516 0.0686  -0.1462 238 CYS A N   
728  C CA  . CYS A 102 ? 0.3854 0.2922 0.6785 -0.0361 0.0602  -0.1379 238 CYS A CA  
729  C C   . CYS A 102 ? 0.4329 0.3483 0.7293 -0.0258 0.0616  -0.1681 238 CYS A C   
730  O O   . CYS A 102 ? 0.4097 0.2933 0.7391 -0.0214 0.0702  -0.1791 238 CYS A O   
731  C CB  . CYS A 102 ? 0.3587 0.2478 0.6358 -0.0244 0.0595  -0.0950 238 CYS A CB  
732  S SG  . CYS A 102 ? 0.3073 0.2246 0.5463 -0.0061 0.0514  -0.0841 238 CYS A SG  
733  N N   . ILE A 103 ? 0.4510 0.4090 0.7148 -0.0217 0.0547  -0.1810 239 ILE A N   
734  C CA  . ILE A 103 ? 0.4466 0.4200 0.7080 -0.0138 0.0582  -0.2119 239 ILE A CA  
735  C C   . ILE A 103 ? 0.5009 0.4533 0.7729 0.0046  0.0648  -0.1969 239 ILE A C   
736  O O   . ILE A 103 ? 0.5489 0.4985 0.8372 0.0116  0.0732  -0.2217 239 ILE A O   
737  C CB  . ILE A 103 ? 0.3895 0.4159 0.6082 -0.0133 0.0495  -0.2202 239 ILE A CB  
738  C CG1 . ILE A 103 ? 0.4366 0.4834 0.6482 -0.0075 0.0555  -0.2541 239 ILE A CG1 
739  C CG2 . ILE A 103 ? 0.2857 0.3227 0.4748 -0.0033 0.0439  -0.1813 239 ILE A CG2 
740  C CD1 . ILE A 103 ? 0.4101 0.5102 0.5781 -0.0083 0.0475  -0.2609 239 ILE A CD1 
741  N N   . THR A 104 ? 0.4772 0.4178 0.7405 0.0119  0.0606  -0.1560 240 THR A N   
742  C CA  . THR A 104 ? 0.4439 0.3732 0.7167 0.0292  0.0629  -0.1374 240 THR A CA  
743  C C   . THR A 104 ? 0.4179 0.3006 0.7307 0.0336  0.0673  -0.1190 240 THR A C   
744  O O   . THR A 104 ? 0.4365 0.3072 0.7766 0.0443  0.0730  -0.1244 240 THR A O   
745  C CB  . THR A 104 ? 0.5099 0.4610 0.7467 0.0343  0.0536  -0.1052 240 THR A CB  
746  O OG1 . THR A 104 ? 0.4667 0.4580 0.6726 0.0336  0.0517  -0.1201 240 THR A OG1 
747  C CG2 . THR A 104 ? 0.4854 0.4278 0.7362 0.0499  0.0531  -0.0837 240 THR A CG2 
748  N N   . CYS A 105 ? 0.3807 0.2432 0.6914 0.0242  0.0640  -0.0924 241 CYS A N   
749  C CA  . CYS A 105 ? 0.4665 0.2902 0.8056 0.0278  0.0663  -0.0648 241 CYS A CA  
750  C C   . CYS A 105 ? 0.4867 0.2888 0.8517 0.0146  0.0738  -0.0764 241 CYS A C   
751  O O   . CYS A 105 ? 0.5753 0.3521 0.9588 0.0171  0.0758  -0.0529 241 CYS A O   
752  C CB  . CYS A 105 ? 0.4575 0.2746 0.7735 0.0268  0.0589  -0.0211 241 CYS A CB  
753  S SG  . CYS A 105 ? 0.4791 0.2962 0.7747 0.0043  0.0606  -0.0143 241 CYS A SG  
754  N N   . THR A 106 ? 0.5036 0.3192 0.8698 0.0007  0.0771  -0.1123 242 THR A N   
755  C CA  . THR A 106 ? 0.5444 0.3457 0.9365 -0.0142 0.0838  -0.1277 242 THR A CA  
756  C C   . THR A 106 ? 0.5489 0.3301 0.9445 -0.0257 0.0853  -0.0975 242 THR A C   
757  O O   . THR A 106 ? 0.5245 0.2945 0.9427 -0.0385 0.0915  -0.1084 242 THR A O   
758  C CB  . THR A 106 ? 0.5922 0.3742 1.0185 -0.0072 0.0918  -0.1410 242 THR A CB  
759  O OG1 . THR A 106 ? 0.6131 0.3663 1.0538 0.0039  0.0925  -0.1022 242 THR A OG1 
760  C CG2 . THR A 106 ? 0.6030 0.4071 1.0242 0.0042  0.0927  -0.1690 242 THR A CG2 
761  N N   . ASP A 107 ? 0.4359 0.2146 0.8074 -0.0218 0.0805  -0.0605 243 ASP A N   
762  C CA  . ASP A 107 ? 0.5351 0.3008 0.9017 -0.0332 0.0834  -0.0317 243 ASP A CA  
763  C C   . ASP A 107 ? 0.5024 0.2890 0.8624 -0.0518 0.0848  -0.0480 243 ASP A C   
764  O O   . ASP A 107 ? 0.4957 0.3096 0.8440 -0.0539 0.0800  -0.0714 243 ASP A O   
765  C CB  . ASP A 107 ? 0.6081 0.3712 0.9438 -0.0248 0.0776  0.0110  243 ASP A CB  
766  C CG  . ASP A 107 ? 0.7588 0.5055 1.1031 -0.0078 0.0739  0.0330  243 ASP A CG  
767  O OD1 . ASP A 107 ? 0.7515 0.4810 1.1298 -0.0039 0.0791  0.0212  243 ASP A OD1 
768  O OD2 . ASP A 107 ? 0.8655 0.6186 1.1831 0.0012  0.0655  0.0618  243 ASP A OD2 
769  N N   . VAL A 108 ? 0.5322 0.3087 0.9008 -0.0651 0.0913  -0.0353 244 VAL A N   
770  C CA  . VAL A 108 ? 0.5081 0.3082 0.8722 -0.0820 0.0930  -0.0440 244 VAL A CA  
771  C C   . VAL A 108 ? 0.5113 0.3173 0.8413 -0.0812 0.0931  -0.0092 244 VAL A C   
772  O O   . VAL A 108 ? 0.5459 0.3326 0.8653 -0.0804 0.0972  0.0229  244 VAL A O   
773  C CB  . VAL A 108 ? 0.5646 0.3546 0.9582 -0.0979 0.1014  -0.0508 244 VAL A CB  
774  C CG1 . VAL A 108 ? 0.4578 0.2749 0.8465 -0.1135 0.1035  -0.0513 244 VAL A CG1 
775  C CG2 . VAL A 108 ? 0.4942 0.2846 0.9191 -0.1013 0.1012  -0.0914 244 VAL A CG2 
776  N N   . ARG A 109 ? 0.5194 0.3536 0.8302 -0.0816 0.0887  -0.0163 245 ARG A N   
777  C CA  . ARG A 109 ? 0.5672 0.4098 0.8437 -0.0805 0.0904  0.0127  245 ARG A CA  
778  C C   . ARG A 109 ? 0.5045 0.3816 0.7822 -0.0925 0.0934  -0.0001 245 ARG A C   
779  O O   . ARG A 109 ? 0.4516 0.3521 0.7505 -0.0985 0.0888  -0.0312 245 ARG A O   
780  C CB  . ARG A 109 ? 0.6600 0.5080 0.9050 -0.0633 0.0806  0.0221  245 ARG A CB  
781  C CG  . ARG A 109 ? 0.7202 0.5452 0.9434 -0.0552 0.0800  0.0596  245 ARG A CG  
782  C CD  . ARG A 109 ? 0.6970 0.4982 0.9394 -0.0436 0.0755  0.0633  245 ARG A CD  
783  N NE  . ARG A 109 ? 0.9045 0.6886 1.1327 -0.0420 0.0753  0.0965  245 ARG A NE  
784  C CZ  . ARG A 109 ? 1.0247 0.7933 1.2592 -0.0291 0.0690  0.1120  245 ARG A CZ  
785  N NH1 . ARG A 109 ? 1.0465 0.8149 1.3024 -0.0158 0.0638  0.0969  245 ARG A NH1 
786  N NH2 . ARG A 109 ? 1.0543 0.8097 1.2740 -0.0295 0.0682  0.1422  245 ARG A NH2 
787  N N   . SER A 110 ? 0.4962 0.3821 0.7471 -0.0938 0.0994  0.0228  246 SER A N   
788  C CA  . SER A 110 ? 0.5077 0.4314 0.7557 -0.0988 0.1016  0.0132  246 SER A CA  
789  C C   . SER A 110 ? 0.5290 0.4592 0.7338 -0.0908 0.1047  0.0350  246 SER A C   
790  O O   . SER A 110 ? 0.5955 0.5029 0.7782 -0.0914 0.1110  0.0607  246 SER A O   
791  C CB  . SER A 110 ? 0.4828 0.4123 0.7591 -0.1149 0.1116  0.0097  246 SER A CB  
792  O OG  . SER A 110 ? 0.4522 0.4231 0.7502 -0.1207 0.1093  -0.0123 246 SER A OG  
793  N N   . PRO A 111 ? 0.4699 0.4320 0.6602 -0.0826 0.0988  0.0244  247 PRO A N   
794  C CA  . PRO A 111 ? 0.3993 0.3942 0.6080 -0.0795 0.0877  -0.0018 247 PRO A CA  
795  C C   . PRO A 111 ? 0.4053 0.3977 0.6033 -0.0678 0.0731  -0.0133 247 PRO A C   
796  O O   . PRO A 111 ? 0.4348 0.4012 0.6149 -0.0608 0.0716  -0.0007 247 PRO A O   
797  C CB  . PRO A 111 ? 0.4161 0.4384 0.6074 -0.0717 0.0890  0.0018  247 PRO A CB  
798  C CG  . PRO A 111 ? 0.4534 0.4528 0.6049 -0.0655 0.0942  0.0230  247 PRO A CG  
799  C CD  . PRO A 111 ? 0.4815 0.4492 0.6348 -0.0761 0.1036  0.0392  247 PRO A CD  
800  N N   . VAL A 112 ? 0.2789 0.3015 0.4885 -0.0659 0.0625  -0.0366 248 VAL A N   
801  C CA  . VAL A 112 ? 0.3239 0.3508 0.5212 -0.0555 0.0510  -0.0498 248 VAL A CA  
802  C C   . VAL A 112 ? 0.3193 0.3841 0.4993 -0.0457 0.0409  -0.0548 248 VAL A C   
803  O O   . VAL A 112 ? 0.3327 0.4245 0.5219 -0.0479 0.0403  -0.0546 248 VAL A O   
804  C CB  . VAL A 112 ? 0.3045 0.3295 0.5313 -0.0642 0.0481  -0.0773 248 VAL A CB  
805  C CG1 . VAL A 112 ? 0.3336 0.3140 0.5800 -0.0706 0.0581  -0.0700 248 VAL A CG1 
806  C CG2 . VAL A 112 ? 0.2501 0.3084 0.5045 -0.0776 0.0450  -0.0966 248 VAL A CG2 
807  N N   . LEU A 113 ? 0.3507 0.4184 0.5087 -0.0343 0.0337  -0.0571 249 LEU A N   
808  C CA  . LEU A 113 ? 0.3169 0.4201 0.4589 -0.0255 0.0240  -0.0606 249 LEU A CA  
809  C C   . LEU A 113 ? 0.2852 0.4135 0.4361 -0.0294 0.0151  -0.0882 249 LEU A C   
810  O O   . LEU A 113 ? 0.3360 0.4479 0.4915 -0.0312 0.0170  -0.1033 249 LEU A O   
811  C CB  . LEU A 113 ? 0.2670 0.3614 0.3787 -0.0128 0.0233  -0.0455 249 LEU A CB  
812  C CG  . LEU A 113 ? 0.3030 0.4276 0.3960 -0.0030 0.0159  -0.0413 249 LEU A CG  
813  C CD1 . LEU A 113 ? 0.3171 0.4255 0.3888 0.0050  0.0201  -0.0197 249 LEU A CD1 
814  C CD2 . LEU A 113 ? 0.3572 0.5014 0.4412 -0.0002 0.0093  -0.0578 249 LEU A CD2 
815  N N   . VAL A 114 ? 0.3053 0.4749 0.4598 -0.0304 0.0054  -0.0956 250 VAL A N   
816  C CA  . VAL A 114 ? 0.2912 0.4928 0.4489 -0.0360 -0.0052 -0.1236 250 VAL A CA  
817  C C   . VAL A 114 ? 0.3571 0.5910 0.4829 -0.0238 -0.0148 -0.1175 250 VAL A C   
818  O O   . VAL A 114 ? 0.3408 0.6000 0.4621 -0.0169 -0.0211 -0.0999 250 VAL A O   
819  C CB  . VAL A 114 ? 0.3071 0.5416 0.4950 -0.0487 -0.0128 -0.1373 250 VAL A CB  
820  C CG1 . VAL A 114 ? 0.3089 0.5680 0.5032 -0.0601 -0.0223 -0.1737 250 VAL A CG1 
821  C CG2 . VAL A 114 ? 0.3229 0.5291 0.5428 -0.0598 -0.0006 -0.1319 250 VAL A CG2 
822  N N   . PHE A 115 ? 0.3699 0.6035 0.4760 -0.0207 -0.0144 -0.1308 251 PHE A N   
823  C CA  . PHE A 115 ? 0.3794 0.6449 0.4528 -0.0107 -0.0213 -0.1236 251 PHE A CA  
824  C C   . PHE A 115 ? 0.4533 0.7726 0.5240 -0.0156 -0.0374 -0.1366 251 PHE A C   
825  O O   . PHE A 115 ? 0.4079 0.7397 0.5023 -0.0291 -0.0428 -0.1612 251 PHE A O   
826  C CB  . PHE A 115 ? 0.3709 0.6267 0.4259 -0.0072 -0.0140 -0.1366 251 PHE A CB  
827  C CG  . PHE A 115 ? 0.3853 0.6005 0.4387 0.0010  -0.0022 -0.1172 251 PHE A CG  
828  C CD1 . PHE A 115 ? 0.3196 0.5351 0.3532 0.0110  -0.0011 -0.0884 251 PHE A CD1 
829  C CD2 . PHE A 115 ? 0.4421 0.6203 0.5160 -0.0018 0.0069  -0.1274 251 PHE A CD2 
830  C CE1 . PHE A 115 ? 0.4054 0.5888 0.4385 0.0162  0.0076  -0.0730 251 PHE A CE1 
831  C CE2 . PHE A 115 ? 0.4415 0.5891 0.5146 0.0058  0.0146  -0.1081 251 PHE A CE2 
832  C CZ  . PHE A 115 ? 0.4390 0.5913 0.4910 0.0138  0.0142  -0.0825 251 PHE A CZ  
833  N N   . GLN A 116 ? 0.4714 0.8234 0.5149 -0.0055 -0.0456 -0.1184 252 GLN A N   
834  C CA  . GLN A 116 ? 0.5353 0.9445 0.5728 -0.0077 -0.0641 -0.1230 252 GLN A CA  
835  C C   . GLN A 116 ? 0.6000 1.0360 0.6062 -0.0120 -0.0674 -0.1470 252 GLN A C   
836  O O   . GLN A 116 ? 0.6376 1.1051 0.6236 -0.0084 -0.0750 -0.1360 252 GLN A O   
837  C CB  . GLN A 116 ? 0.5287 0.9575 0.5565 0.0074  -0.0708 -0.0838 252 GLN A CB  
838  C CG  . GLN A 116 ? 0.5250 0.9376 0.5870 0.0118  -0.0680 -0.0637 252 GLN A CG  
839  C CD  . GLN A 116 ? 0.6334 1.0812 0.7295 0.0025  -0.0808 -0.0778 252 GLN A CD  
840  O OE1 . GLN A 116 ? 0.6937 1.1692 0.7884 0.0080  -0.0918 -0.0639 252 GLN A OE1 
841  N NE2 . GLN A 116 ? 0.6519 1.0773 0.7756 -0.0120 -0.0734 -0.1010 252 GLN A NE2 
842  N N   . CYS A 117 ? 0.5091 0.9203 0.5143 -0.0182 -0.0559 -0.1751 253 CYS A N   
843  C CA  . CYS A 117 ? 0.4493 0.8738 0.4344 -0.0225 -0.0515 -0.1996 253 CYS A CA  
844  C C   . CYS A 117 ? 0.4637 0.9053 0.4681 -0.0372 -0.0596 -0.2280 253 CYS A C   
845  O O   . CYS A 117 ? 0.4262 0.8595 0.4643 -0.0451 -0.0645 -0.2324 253 CYS A O   
846  C CB  . CYS A 117 ? 0.4471 0.8358 0.4332 -0.0220 -0.0341 -0.2194 253 CYS A CB  
847  S SG  . CYS A 117 ? 0.6199 0.9572 0.6536 -0.0319 -0.0253 -0.2437 253 CYS A SG  
848  N N   . ASN A 118 ? 0.5275 0.9938 0.5121 -0.0417 -0.0603 -0.2466 254 ASN A N   
849  C CA  . ASN A 118 ? 0.6014 1.0870 0.6001 -0.0566 -0.0682 -0.2759 254 ASN A CA  
850  C C   . ASN A 118 ? 0.6112 1.0599 0.6520 -0.0694 -0.0601 -0.3059 254 ASN A C   
851  O O   . ASN A 118 ? 0.5577 1.0159 0.6228 -0.0820 -0.0681 -0.3204 254 ASN A O   
852  C CB  . ASN A 118 ? 0.6883 1.2017 0.6567 -0.0601 -0.0670 -0.2952 254 ASN A CB  
853  C CG  . ASN A 118 ? 0.8096 1.3701 0.7443 -0.0541 -0.0813 -0.2692 254 ASN A CG  
854  O OD1 . ASN A 118 ? 0.8721 1.4600 0.8140 -0.0578 -0.0979 -0.2620 254 ASN A OD1 
855  N ND2 . ASN A 118 ? 0.8518 1.4211 0.7522 -0.0451 -0.0746 -0.2537 254 ASN A ND2 
856  N N   . SER A 119 ? 0.5857 0.9909 0.6374 -0.0660 -0.0440 -0.3127 255 SER A N   
857  C CA  . SER A 119 ? 0.6400 1.0025 0.7336 -0.0766 -0.0335 -0.3366 255 SER A CA  
858  C C   . SER A 119 ? 0.6271 0.9640 0.7521 -0.0787 -0.0347 -0.3181 255 SER A C   
859  O O   . SER A 119 ? 0.7330 1.0365 0.8964 -0.0895 -0.0274 -0.3309 255 SER A O   
860  C CB  . SER A 119 ? 0.6396 0.9642 0.7355 -0.0703 -0.0151 -0.3486 255 SER A CB  
861  O OG  . SER A 119 ? 0.6939 1.0453 0.7570 -0.0659 -0.0125 -0.3583 255 SER A OG  
862  N N   . ARG A 120 ? 0.5387 0.8908 0.6483 -0.0686 -0.0426 -0.2858 256 ARG A N   
863  C CA  . ARG A 120 ? 0.4718 0.8044 0.6095 -0.0697 -0.0428 -0.2645 256 ARG A CA  
864  C C   . ARG A 120 ? 0.4485 0.7166 0.6069 -0.0678 -0.0235 -0.2600 256 ARG A C   
865  O O   . ARG A 120 ? 0.4740 0.7139 0.6674 -0.0767 -0.0176 -0.2563 256 ARG A O   
866  C CB  . ARG A 120 ? 0.4288 0.7775 0.5984 -0.0820 -0.0503 -0.2662 256 ARG A CB  
867  N N   . HIS A 121 ? 0.4431 0.6902 0.5809 -0.0558 -0.0136 -0.2578 257 HIS A N   
868  C CA  . HIS A 121 ? 0.4322 0.6226 0.5901 -0.0514 0.0024  -0.2508 257 HIS A CA  
869  C C   . HIS A 121 ? 0.3846 0.5476 0.5528 -0.0473 0.0058  -0.2120 257 HIS A C   
870  O O   . HIS A 121 ? 0.4065 0.5881 0.5547 -0.0397 0.0000  -0.1852 257 HIS A O   
871  C CB  . HIS A 121 ? 0.4585 0.6412 0.5932 -0.0365 0.0107  -0.2483 257 HIS A CB  
872  C CG  . HIS A 121 ? 0.5600 0.7658 0.6832 -0.0397 0.0126  -0.2887 257 HIS A CG  
873  N ND1 . HIS A 121 ? 0.5630 0.8108 0.6452 -0.0331 0.0086  -0.2897 257 HIS A ND1 
874  C CD2 . HIS A 121 ? 0.5892 0.7804 0.7361 -0.0477 0.0202  -0.3212 257 HIS A CD2 
875  C CE1 . HIS A 121 ? 0.6153 0.8733 0.6965 -0.0369 0.0137  -0.3150 257 HIS A CE1 
876  N NE2 . HIS A 121 ? 0.5977 0.8223 0.7178 -0.0454 0.0207  -0.3357 257 HIS A NE2 
877  N N   . VAL A 122 ? 0.3098 0.4280 0.5085 -0.0525 0.0161  -0.2089 258 VAL A N   
878  C CA  . VAL A 122 ? 0.4088 0.5016 0.6117 -0.0497 0.0209  -0.1730 258 VAL A CA  
879  C C   . VAL A 122 ? 0.3862 0.4404 0.5840 -0.0375 0.0295  -0.1534 258 VAL A C   
880  O O   . VAL A 122 ? 0.4287 0.4625 0.6398 -0.0344 0.0353  -0.1691 258 VAL A O   
881  C CB  . VAL A 122 ? 0.2844 0.3625 0.5235 -0.0665 0.0254  -0.1745 258 VAL A CB  
882  C CG1 . VAL A 122 ? 0.2867 0.4018 0.5438 -0.0821 0.0165  -0.2080 258 VAL A CG1 
883  C CG2 . VAL A 122 ? 0.3348 0.3613 0.6009 -0.0700 0.0379  -0.1733 258 VAL A CG2 
884  N N   . ILE A 123 ? 0.2912 0.3381 0.4712 -0.0301 0.0300  -0.1204 259 ILE A N   
885  C CA  . ILE A 123 ? 0.3041 0.3213 0.4776 -0.0196 0.0347  -0.0989 259 ILE A CA  
886  C C   . ILE A 123 ? 0.3605 0.3581 0.5313 -0.0231 0.0383  -0.0694 259 ILE A C   
887  O O   . ILE A 123 ? 0.3116 0.3272 0.4706 -0.0263 0.0367  -0.0609 259 ILE A O   
888  C CB  . ILE A 123 ? 0.2478 0.2851 0.3917 -0.0064 0.0306  -0.0924 259 ILE A CB  
889  C CG1 . ILE A 123 ? 0.2479 0.2603 0.3916 0.0036  0.0336  -0.0734 259 ILE A CG1 
890  C CG2 . ILE A 123 ? 0.2089 0.2708 0.3278 -0.0052 0.0253  -0.0768 259 ILE A CG2 
891  C CD1 . ILE A 123 ? 0.2129 0.2447 0.3403 0.0146  0.0323  -0.0749 259 ILE A CD1 
892  N N   . CYS A 124 ? 0.3220 0.2841 0.5048 -0.0222 0.0438  -0.0538 260 CYS A N   
893  C CA  . CYS A 124 ? 0.3386 0.2838 0.5123 -0.0264 0.0479  -0.0249 260 CYS A CA  
894  C C   . CYS A 124 ? 0.3735 0.3296 0.5118 -0.0173 0.0431  -0.0066 260 CYS A C   
895  O O   . CYS A 124 ? 0.3704 0.3391 0.4982 -0.0074 0.0375  -0.0118 260 CYS A O   
896  C CB  . CYS A 124 ? 0.3440 0.2500 0.5378 -0.0277 0.0537  -0.0090 260 CYS A CB  
897  S SG  . CYS A 124 ? 0.4086 0.2987 0.5956 -0.0108 0.0480  0.0106  260 CYS A SG  
898  N N   . LEU A 125 ? 0.3596 0.3118 0.4806 -0.0219 0.0468  0.0128  261 LEU A N   
899  C CA  . LEU A 125 ? 0.3463 0.3088 0.4354 -0.0160 0.0434  0.0248  261 LEU A CA  
900  C C   . LEU A 125 ? 0.3503 0.3012 0.4277 -0.0082 0.0373  0.0390  261 LEU A C   
901  O O   . LEU A 125 ? 0.3443 0.3083 0.4048 -0.0020 0.0319  0.0399  261 LEU A O   
902  C CB  . LEU A 125 ? 0.3413 0.3023 0.4154 -0.0237 0.0514  0.0371  261 LEU A CB  
903  C CG  . LEU A 125 ? 0.3942 0.3750 0.4834 -0.0294 0.0569  0.0242  261 LEU A CG  
904  C CD1 . LEU A 125 ? 0.3198 0.3029 0.3939 -0.0336 0.0670  0.0346  261 LEU A CD1 
905  C CD2 . LEU A 125 ? 0.3469 0.3553 0.4386 -0.0218 0.0484  0.0081  261 LEU A CD2 
906  N N   . ASP A 126 ? 0.3650 0.2927 0.4556 -0.0085 0.0379  0.0515  262 ASP A N   
907  C CA  . ASP A 126 ? 0.3524 0.2726 0.4396 0.0001  0.0301  0.0670  262 ASP A CA  
908  C C   . ASP A 126 ? 0.3802 0.3151 0.4813 0.0108  0.0255  0.0501  262 ASP A C   
909  O O   . ASP A 126 ? 0.4484 0.3959 0.5382 0.0171  0.0189  0.0557  262 ASP A O   
910  C CB  . ASP A 126 ? 0.3224 0.2147 0.4299 -0.0001 0.0316  0.0848  262 ASP A CB  
911  C CG  . ASP A 126 ? 0.5394 0.4194 0.6256 -0.0106 0.0363  0.1084  262 ASP A CG  
912  O OD1 . ASP A 126 ? 0.6597 0.5531 0.7120 -0.0155 0.0364  0.1121  262 ASP A OD1 
913  O OD2 . ASP A 126 ? 0.7298 0.5860 0.8334 -0.0143 0.0415  0.1234  262 ASP A OD2 
914  N N   . CYS A 127 ? 0.3640 0.2997 0.4896 0.0113  0.0301  0.0275  263 CYS A N   
915  C CA  . CYS A 127 ? 0.3889 0.3412 0.5247 0.0205  0.0289  0.0082  263 CYS A CA  
916  C C   . CYS A 127 ? 0.3828 0.3655 0.4933 0.0207  0.0267  0.0001  263 CYS A C   
917  O O   . CYS A 127 ? 0.3543 0.3525 0.4615 0.0283  0.0249  -0.0022 263 CYS A O   
918  C CB  . CYS A 127 ? 0.3070 0.2519 0.4733 0.0196  0.0352  -0.0176 263 CYS A CB  
919  S SG  . CYS A 127 ? 0.4190 0.3242 0.6265 0.0249  0.0393  -0.0084 263 CYS A SG  
920  N N   . PHE A 128 ? 0.2518 0.2433 0.3479 0.0129  0.0278  -0.0021 264 PHE A N   
921  C CA  . PHE A 128 ? 0.2318 0.2489 0.3067 0.0146  0.0257  -0.0047 264 PHE A CA  
922  C C   . PHE A 128 ? 0.2715 0.2872 0.3280 0.0175  0.0227  0.0139  264 PHE A C   
923  O O   . PHE A 128 ? 0.3198 0.3524 0.3673 0.0218  0.0215  0.0133  264 PHE A O   
924  C CB  . PHE A 128 ? 0.3001 0.3268 0.3692 0.0080  0.0270  -0.0069 264 PHE A CB  
925  C CG  . PHE A 128 ? 0.3047 0.3562 0.3568 0.0119  0.0246  -0.0060 264 PHE A CG  
926  C CD1 . PHE A 128 ? 0.3291 0.4060 0.3795 0.0159  0.0218  -0.0193 264 PHE A CD1 
927  C CD2 . PHE A 128 ? 0.3220 0.3707 0.3595 0.0115  0.0262  0.0086  264 PHE A CD2 
928  C CE1 . PHE A 128 ? 0.2961 0.3952 0.3305 0.0201  0.0195  -0.0128 264 PHE A CE1 
929  C CE2 . PHE A 128 ? 0.2475 0.3144 0.2742 0.0162  0.0250  0.0125  264 PHE A CE2 
930  C CZ  . PHE A 128 ? 0.2593 0.3513 0.2846 0.0208  0.0210  0.0045  264 PHE A CZ  
931  N N   . HIS A 129 ? 0.2434 0.2401 0.2940 0.0136  0.0220  0.0302  265 HIS A N   
932  C CA  . HIS A 129 ? 0.3087 0.3048 0.3407 0.0132  0.0177  0.0449  265 HIS A CA  
933  C C   . HIS A 129 ? 0.3297 0.3347 0.3729 0.0206  0.0124  0.0464  265 HIS A C   
934  O O   . HIS A 129 ? 0.3347 0.3530 0.3688 0.0210  0.0103  0.0485  265 HIS A O   
935  C CB  . HIS A 129 ? 0.3169 0.2942 0.3377 0.0067  0.0171  0.0610  265 HIS A CB  
936  C CG  . HIS A 129 ? 0.4509 0.4297 0.4529 0.0047  0.0099  0.0739  265 HIS A CG  
937  N ND1 . HIS A 129 ? 0.5879 0.5716 0.5676 -0.0007 0.0114  0.0724  265 HIS A ND1 
938  C CD2 . HIS A 129 ? 0.5682 0.5460 0.5731 0.0069  0.0004  0.0874  265 HIS A CD2 
939  C CE1 . HIS A 129 ? 0.5932 0.5791 0.5608 -0.0040 0.0030  0.0816  265 HIS A CE1 
940  N NE2 . HIS A 129 ? 0.5994 0.5846 0.5815 0.0008  -0.0051 0.0921  265 HIS A NE2 
941  N N   . LEU A 130 ? 0.3008 0.2980 0.3681 0.0264  0.0115  0.0453  266 LEU A N   
942  C CA  . LEU A 130 ? 0.3669 0.3744 0.4528 0.0354  0.0077  0.0468  266 LEU A CA  
943  C C   . LEU A 130 ? 0.3523 0.3832 0.4416 0.0396  0.0134  0.0292  266 LEU A C   
944  O O   . LEU A 130 ? 0.3732 0.4217 0.4665 0.0431  0.0122  0.0319  266 LEU A O   
945  C CB  . LEU A 130 ? 0.3345 0.3253 0.4517 0.0429  0.0076  0.0492  266 LEU A CB  
946  C CG  . LEU A 130 ? 0.4011 0.4026 0.5444 0.0545  0.0029  0.0554  266 LEU A CG  
947  C CD1 . LEU A 130 ? 0.4274 0.4387 0.5556 0.0512  -0.0096 0.0776  266 LEU A CD1 
948  C CD2 . LEU A 130 ? 0.3244 0.3050 0.5045 0.0642  0.0043  0.0586  266 LEU A CD2 
949  N N   . TYR A 131 ? 0.3107 0.3449 0.3979 0.0381  0.0196  0.0119  267 TYR A N   
950  C CA  . TYR A 131 ? 0.3131 0.3727 0.3951 0.0406  0.0248  -0.0036 267 TYR A CA  
951  C C   . TYR A 131 ? 0.3180 0.3919 0.3775 0.0374  0.0236  0.0085  267 TYR A C   
952  O O   . TYR A 131 ? 0.3158 0.4086 0.3765 0.0405  0.0268  0.0083  267 TYR A O   
953  C CB  . TYR A 131 ? 0.3289 0.3918 0.4078 0.0367  0.0276  -0.0218 267 TYR A CB  
954  C CG  . TYR A 131 ? 0.3332 0.4262 0.3982 0.0376  0.0309  -0.0361 267 TYR A CG  
955  C CD1 . TYR A 131 ? 0.3436 0.4548 0.4146 0.0436  0.0374  -0.0494 267 TYR A CD1 
956  C CD2 . TYR A 131 ? 0.3181 0.4241 0.3649 0.0328  0.0278  -0.0359 267 TYR A CD2 
957  C CE1 . TYR A 131 ? 0.3585 0.5002 0.4106 0.0433  0.0409  -0.0610 267 TYR A CE1 
958  C CE2 . TYR A 131 ? 0.2638 0.4008 0.2949 0.0339  0.0287  -0.0451 267 TYR A CE2 
959  C CZ  . TYR A 131 ? 0.3348 0.4895 0.3654 0.0383  0.0353  -0.0573 267 TYR A CZ  
960  O OH  . TYR A 131 ? 0.3663 0.5544 0.3751 0.0383  0.0367  -0.0646 267 TYR A OH  
961  N N   . CYS A 132 ? 0.2786 0.3424 0.3206 0.0309  0.0209  0.0186  268 CYS A N   
962  C CA  . CYS A 132 ? 0.2989 0.3703 0.3237 0.0278  0.0214  0.0289  268 CYS A CA  
963  C C   . CYS A 132 ? 0.3415 0.4133 0.3699 0.0261  0.0184  0.0397  268 CYS A C   
964  O O   . CYS A 132 ? 0.3451 0.4308 0.3713 0.0251  0.0214  0.0435  268 CYS A O   
965  C CB  . CYS A 132 ? 0.3193 0.3774 0.3301 0.0226  0.0213  0.0349  268 CYS A CB  
966  S SG  . CYS A 132 ? 0.3559 0.4232 0.3678 0.0238  0.0231  0.0237  268 CYS A SG  
967  N N   . VAL A 133 ? 0.3141 0.3726 0.3491 0.0248  0.0120  0.0459  269 VAL A N   
968  C CA  . VAL A 133 ? 0.3235 0.3866 0.3633 0.0219  0.0053  0.0561  269 VAL A CA  
969  C C   . VAL A 133 ? 0.3733 0.4591 0.4373 0.0286  0.0071  0.0530  269 VAL A C   
970  O O   . VAL A 133 ? 0.3369 0.4372 0.4049 0.0243  0.0062  0.0581  269 VAL A O   
971  C CB  . VAL A 133 ? 0.4447 0.4929 0.4842 0.0201  -0.0040 0.0662  269 VAL A CB  
972  C CG1 . VAL A 133 ? 0.5023 0.5639 0.5538 0.0194  -0.0144 0.0761  269 VAL A CG1 
973  C CG2 . VAL A 133 ? 0.5173 0.5481 0.5288 0.0106  -0.0036 0.0699  269 VAL A CG2 
974  N N   . THR A 134 ? 0.3412 0.4308 0.4242 0.0383  0.0115  0.0428  270 THR A N   
975  C CA  . THR A 134 ? 0.3740 0.4866 0.4832 0.0461  0.0164  0.0371  270 THR A CA  
976  C C   . THR A 134 ? 0.3655 0.4998 0.4641 0.0440  0.0273  0.0307  270 THR A C   
977  O O   . THR A 134 ? 0.2969 0.4533 0.4096 0.0441  0.0315  0.0336  270 THR A O   
978  C CB  . THR A 134 ? 0.4293 0.5372 0.5650 0.0578  0.0207  0.0244  270 THR A CB  
979  O OG1 . THR A 134 ? 0.4226 0.5234 0.5447 0.0570  0.0277  0.0078  270 THR A OG1 
980  C CG2 . THR A 134 ? 0.4106 0.4972 0.5612 0.0610  0.0100  0.0375  270 THR A CG2 
981  N N   . ARG A 135 ? 0.3313 0.4620 0.4067 0.0419  0.0318  0.0241  271 ARG A N   
982  C CA  . ARG A 135 ? 0.3417 0.4936 0.4019 0.0402  0.0410  0.0229  271 ARG A CA  
983  C C   . ARG A 135 ? 0.2967 0.4486 0.3480 0.0315  0.0403  0.0403  271 ARG A C   
984  O O   . ARG A 135 ? 0.3505 0.5223 0.4018 0.0296  0.0489  0.0452  271 ARG A O   
985  C CB  . ARG A 135 ? 0.3628 0.5136 0.4013 0.0403  0.0419  0.0147  271 ARG A CB  
986  C CG  . ARG A 135 ? 0.3965 0.5661 0.4370 0.0460  0.0492  -0.0068 271 ARG A CG  
987  C CD  . ARG A 135 ? 0.4780 0.6405 0.5486 0.0525  0.0510  -0.0203 271 ARG A CD  
988  N NE  . ARG A 135 ? 0.5026 0.6762 0.5769 0.0568  0.0588  -0.0469 271 ARG A NE  
989  C CZ  . ARG A 135 ? 0.5922 0.7501 0.6930 0.0621  0.0603  -0.0631 271 ARG A CZ  
990  N NH1 . ARG A 135 ? 0.5151 0.6479 0.6391 0.0649  0.0534  -0.0503 271 ARG A NH1 
991  N NH2 . ARG A 135 ? 0.6726 0.8397 0.7765 0.0643  0.0687  -0.0920 271 ARG A NH2 
992  N N   . LEU A 136 ? 0.3195 0.4485 0.3634 0.0254  0.0318  0.0488  272 LEU A N   
993  C CA  . LEU A 136 ? 0.3502 0.4734 0.3885 0.0155  0.0313  0.0611  272 LEU A CA  
994  C C   . LEU A 136 ? 0.3385 0.4778 0.3995 0.0114  0.0299  0.0648  272 LEU A C   
995  O O   . LEU A 136 ? 0.3417 0.4945 0.4081 0.0057  0.0373  0.0710  272 LEU A O   
996  C CB  . LEU A 136 ? 0.2901 0.3862 0.3152 0.0096  0.0238  0.0639  272 LEU A CB  
997  C CG  . LEU A 136 ? 0.3287 0.4142 0.3491 -0.0022 0.0234  0.0710  272 LEU A CG  
998  C CD1 . LEU A 136 ? 0.3137 0.4011 0.3302 -0.0034 0.0340  0.0781  272 LEU A CD1 
999  C CD2 . LEU A 136 ? 0.3572 0.4174 0.3611 -0.0076 0.0188  0.0691  272 LEU A CD2 
1000 N N   . ASN A 137 ? 0.4052 0.5449 0.4823 0.0143  0.0203  0.0629  273 ASN A N   
1001 C CA  . ASN A 137 ? 0.3653 0.5259 0.4702 0.0116  0.0159  0.0670  273 ASN A CA  
1002 C C   . ASN A 137 ? 0.3211 0.5123 0.4485 0.0173  0.0289  0.0630  273 ASN A C   
1003 O O   . ASN A 137 ? 0.3332 0.5455 0.4802 0.0104  0.0315  0.0682  273 ASN A O   
1004 C CB  . ASN A 137 ? 0.3470 0.5049 0.4670 0.0172  0.0019  0.0691  273 ASN A CB  
1005 C CG  . ASN A 137 ? 0.5103 0.6935 0.6603 0.0136  -0.0076 0.0760  273 ASN A CG  
1006 O OD1 . ASN A 137 ? 0.5498 0.7586 0.7340 0.0227  -0.0033 0.0741  273 ASN A OD1 
1007 N ND2 . ASN A 137 ? 0.5243 0.7033 0.6635 -0.0001 -0.0202 0.0822  273 ASN A ND2 
1008 N N   . ASP A 138 ? 0.3454 0.5406 0.4703 0.0286  0.0382  0.0521  274 ASP A N   
1009 C CA  . ASP A 138 ? 0.3606 0.5865 0.5036 0.0347  0.0531  0.0446  274 ASP A CA  
1010 C C   . ASP A 138 ? 0.3288 0.5652 0.4472 0.0290  0.0670  0.0480  274 ASP A C   
1011 O O   . ASP A 138 ? 0.3419 0.6049 0.4644 0.0331  0.0821  0.0412  274 ASP A O   
1012 C CB  . ASP A 138 ? 0.4164 0.6432 0.5716 0.0492  0.0574  0.0270  274 ASP A CB  
1013 C CG  . ASP A 138 ? 0.5518 0.7669 0.7359 0.0568  0.0446  0.0289  274 ASP A CG  
1014 O OD1 . ASP A 138 ? 0.5987 0.8208 0.8011 0.0527  0.0338  0.0423  274 ASP A OD1 
1015 O OD2 . ASP A 138 ? 0.5851 0.7847 0.7747 0.0663  0.0448  0.0176  274 ASP A OD2 
1016 N N   . ARG A 139 ? 0.2573 0.4733 0.3504 0.0202  0.0626  0.0593  275 ARG A N   
1017 C CA  . ARG A 139 ? 0.2785 0.5004 0.3493 0.0155  0.0735  0.0693  275 ARG A CA  
1018 C C   . ARG A 139 ? 0.3595 0.5973 0.4101 0.0244  0.0820  0.0593  275 ARG A C   
1019 O O   . ARG A 139 ? 0.3433 0.5948 0.3852 0.0227  0.0912  0.0598  275 ARG A O   
1020 C CB  . ARG A 139 ? 0.3002 0.5432 0.3886 0.0063  0.0847  0.0808  275 ARG A CB  
1021 C CG  . ARG A 139 ? 0.2734 0.5102 0.3883 -0.0043 0.0752  0.0857  275 ARG A CG  
1022 C CD  . ARG A 139 ? 0.3516 0.5519 0.4493 -0.0109 0.0625  0.0896  275 ARG A CD  
1023 N NE  . ARG A 139 ? 0.3556 0.5403 0.4353 -0.0177 0.0704  0.1028  275 ARG A NE  
1024 C CZ  . ARG A 139 ? 0.3670 0.5196 0.4307 -0.0209 0.0645  0.1055  275 ARG A CZ  
1025 N NH1 . ARG A 139 ? 0.2626 0.3977 0.3210 -0.0195 0.0515  0.0955  275 ARG A NH1 
1026 N NH2 . ARG A 139 ? 0.3410 0.4774 0.3947 -0.0245 0.0721  0.1179  275 ARG A NH2 
1027 N N   . GLN A 140 ? 0.3748 0.5990 0.4147 0.0309  0.0739  0.0465  276 GLN A N   
1028 C CA  . GLN A 140 ? 0.3766 0.6178 0.3986 0.0374  0.0794  0.0314  276 GLN A CA  
1029 C C   . GLN A 140 ? 0.4458 0.6766 0.4405 0.0371  0.0714  0.0354  276 GLN A C   
1030 O O   . GLN A 140 ? 0.4287 0.6687 0.4114 0.0410  0.0698  0.0190  276 GLN A O   
1031 C CB  . GLN A 140 ? 0.3985 0.6390 0.4407 0.0453  0.0790  0.0070  276 GLN A CB  
1032 C CG  . GLN A 140 ? 0.4985 0.7595 0.5710 0.0497  0.0901  -0.0003 276 GLN A CG  
1033 C CD  . GLN A 140 ? 0.6652 0.9463 0.7222 0.0465  0.1034  -0.0039 276 GLN A CD  
1034 O OE1 . GLN A 140 ? 0.7577 1.0445 0.7911 0.0476  0.1065  -0.0183 276 GLN A OE1 
1035 N NE2 . GLN A 140 ? 0.7383 1.0298 0.8086 0.0411  0.1102  0.0093  276 GLN A NE2 
1036 N N   . PHE A 141 ? 0.4261 0.6387 0.4145 0.0322  0.0666  0.0555  277 PHE A N   
1037 C CA  . PHE A 141 ? 0.3437 0.5487 0.3126 0.0334  0.0593  0.0622  277 PHE A CA  
1038 C C   . PHE A 141 ? 0.4274 0.6499 0.3792 0.0338  0.0606  0.0679  277 PHE A C   
1039 O O   . PHE A 141 ? 0.3731 0.6042 0.3262 0.0305  0.0687  0.0735  277 PHE A O   
1040 C CB  . PHE A 141 ? 0.2812 0.4576 0.2541 0.0294  0.0553  0.0794  277 PHE A CB  
1041 C CG  . PHE A 141 ? 0.2905 0.4433 0.2703 0.0292  0.0473  0.0710  277 PHE A CG  
1042 C CD1 . PHE A 141 ? 0.2866 0.4290 0.2816 0.0270  0.0442  0.0608  277 PHE A CD1 
1043 C CD2 . PHE A 141 ? 0.3008 0.4424 0.2741 0.0316  0.0421  0.0741  277 PHE A CD2 
1044 C CE1 . PHE A 141 ? 0.2599 0.3797 0.2581 0.0259  0.0368  0.0554  277 PHE A CE1 
1045 C CE2 . PHE A 141 ? 0.3253 0.4454 0.3048 0.0302  0.0367  0.0659  277 PHE A CE2 
1046 C CZ  . PHE A 141 ? 0.2846 0.3931 0.2738 0.0267  0.0343  0.0573  277 PHE A CZ  
1047 N N   . VAL A 142 ? 0.4381 0.6691 0.3751 0.0374  0.0530  0.0673  278 VAL A N   
1048 C CA  . VAL A 142 ? 0.4349 0.6877 0.3545 0.0383  0.0521  0.0743  278 VAL A CA  
1049 C C   . VAL A 142 ? 0.4910 0.7303 0.4123 0.0394  0.0485  0.1003  278 VAL A C   
1050 O O   . VAL A 142 ? 0.4721 0.6963 0.4009 0.0424  0.0421  0.1050  278 VAL A O   
1051 C CB  . VAL A 142 ? 0.4275 0.7053 0.3330 0.0411  0.0443  0.0562  278 VAL A CB  
1052 C CG1 . VAL A 142 ? 0.4369 0.7386 0.3243 0.0421  0.0401  0.0683  278 VAL A CG1 
1053 C CG2 . VAL A 142 ? 0.3390 0.6291 0.2447 0.0399  0.0504  0.0261  278 VAL A CG2 
1054 N N   . HIS A 143 ? 0.5900 0.8340 0.5061 0.0374  0.0544  0.1168  279 HIS A N   
1055 C CA  . HIS A 143 ? 0.6326 0.8635 0.5527 0.0394  0.0530  0.1418  279 HIS A CA  
1056 C C   . HIS A 143 ? 0.7006 0.9561 0.6072 0.0460  0.0441  0.1491  279 HIS A C   
1057 O O   . HIS A 143 ? 0.7831 1.0691 0.6702 0.0456  0.0434  0.1438  279 HIS A O   
1058 C CB  . HIS A 143 ? 0.6662 0.8922 0.5872 0.0336  0.0641  0.1578  279 HIS A CB  
1059 C CG  . HIS A 143 ? 0.7166 0.9196 0.6484 0.0343  0.0656  0.1821  279 HIS A CG  
1060 N ND1 . HIS A 143 ? 0.7570 0.9474 0.6974 0.0414  0.0582  0.1897  279 HIS A ND1 
1061 C CD2 . HIS A 143 ? 0.7815 0.9713 0.7197 0.0287  0.0751  0.1998  279 HIS A CD2 
1062 C CE1 . HIS A 143 ? 0.7788 0.9478 0.7307 0.0412  0.0633  0.2104  279 HIS A CE1 
1063 N NE2 . HIS A 143 ? 0.8141 0.9814 0.7645 0.0329  0.0733  0.2170  279 HIS A NE2 
1064 N N   . ASP A 144 ? 0.6696 0.9139 0.5872 0.0518  0.0375  0.1603  280 ASP A N   
1065 C CA  . ASP A 144 ? 0.7324 1.0003 0.6427 0.0587  0.0290  0.1735  280 ASP A CA  
1066 C C   . ASP A 144 ? 0.7643 1.0091 0.6907 0.0633  0.0319  0.2008  280 ASP A C   
1067 O O   . ASP A 144 ? 0.7520 0.9702 0.6984 0.0662  0.0325  0.2021  280 ASP A O   
1068 C CB  . ASP A 144 ? 0.8290 1.1123 0.7412 0.0627  0.0175  0.1587  280 ASP A CB  
1069 C CG  . ASP A 144 ? 0.9123 1.2327 0.8121 0.0671  0.0065  0.1659  280 ASP A CG  
1070 O OD1 . ASP A 144 ? 0.9672 1.2933 0.8633 0.0706  0.0070  0.1905  280 ASP A OD1 
1071 O OD2 . ASP A 144 ? 0.8907 1.2354 0.7850 0.0664  -0.0031 0.1469  280 ASP A OD2 
1072 N N   . PRO A 145 ? 0.8255 1.0798 0.7430 0.0640  0.0350  0.2225  281 PRO A N   
1073 C CA  . PRO A 145 ? 0.8933 1.1248 0.8263 0.0678  0.0400  0.2505  281 PRO A CA  
1074 C C   . PRO A 145 ? 0.8725 1.0923 0.8273 0.0780  0.0342  0.2597  281 PRO A C   
1075 O O   . PRO A 145 ? 0.8547 1.0407 0.8315 0.0798  0.0414  0.2715  281 PRO A O   
1076 C CB  . PRO A 145 ? 0.9836 1.2437 0.8957 0.0691  0.0392  0.2712  281 PRO A CB  
1077 C CG  . PRO A 145 ? 0.9474 1.2487 0.8334 0.0675  0.0308  0.2517  281 PRO A CG  
1078 C CD  . PRO A 145 ? 0.8446 1.1350 0.7345 0.0613  0.0339  0.2214  281 PRO A CD  
1079 N N   . GLN A 146 ? 0.8793 1.1270 0.8297 0.0839  0.0221  0.2532  282 GLN A N   
1080 C CA  . GLN A 146 ? 0.9267 1.1677 0.9000 0.0940  0.0167  0.2610  282 GLN A CA  
1081 C C   . GLN A 146 ? 0.9136 1.1282 0.9034 0.0924  0.0202  0.2408  282 GLN A C   
1082 O O   . GLN A 146 ? 0.9308 1.1143 0.9446 0.0969  0.0267  0.2476  282 GLN A O   
1083 C CB  . GLN A 146 ? 0.9114 1.1959 0.8750 0.0997  0.0012  0.2617  282 GLN A CB  
1084 N N   . LEU A 147 ? 0.8504 1.0769 0.8268 0.0860  0.0168  0.2159  283 LEU A N   
1085 C CA  . LEU A 147 ? 0.7167 0.9220 0.7042 0.0840  0.0192  0.1978  283 LEU A CA  
1086 C C   . LEU A 147 ? 0.6621 0.8281 0.6550 0.0767  0.0314  0.1940  283 LEU A C   
1087 O O   . LEU A 147 ? 0.6511 0.7858 0.6620 0.0783  0.0379  0.1953  283 LEU A O   
1088 C CB  . LEU A 147 ? 0.6312 0.8616 0.6032 0.0792  0.0116  0.1736  283 LEU A CB  
1089 N N   . GLY A 148 ? 0.5918 0.7611 0.5698 0.0681  0.0348  0.1881  284 GLY A N   
1090 C CA  . GLY A 148 ? 0.5050 0.6445 0.4870 0.0588  0.0438  0.1806  284 GLY A CA  
1091 C C   . GLY A 148 ? 0.5625 0.7168 0.5301 0.0521  0.0423  0.1608  284 GLY A C   
1092 O O   . GLY A 148 ? 0.6695 0.8533 0.6221 0.0521  0.0396  0.1583  284 GLY A O   
1093 N N   . TYR A 149 ? 0.5151 0.6500 0.4875 0.0464  0.0444  0.1464  285 TYR A N   
1094 C CA  . TYR A 149 ? 0.4628 0.6107 0.4264 0.0415  0.0438  0.1288  285 TYR A CA  
1095 C C   . TYR A 149 ? 0.4393 0.5942 0.4003 0.0445  0.0378  0.1137  285 TYR A C   
1096 O O   . TYR A 149 ? 0.4288 0.5645 0.3975 0.0455  0.0373  0.1136  285 TYR A O   
1097 C CB  . TYR A 149 ? 0.3302 0.4582 0.3017 0.0321  0.0505  0.1255  285 TYR A CB  
1098 C CG  . TYR A 149 ? 0.4359 0.5652 0.4094 0.0274  0.0575  0.1383  285 TYR A CG  
1099 C CD1 . TYR A 149 ? 0.3859 0.4923 0.3689 0.0253  0.0621  0.1537  285 TYR A CD1 
1100 C CD2 . TYR A 149 ? 0.4592 0.6123 0.4260 0.0249  0.0615  0.1348  285 TYR A CD2 
1101 C CE1 . TYR A 149 ? 0.4169 0.5234 0.4025 0.0199  0.0696  0.1668  285 TYR A CE1 
1102 C CE2 . TYR A 149 ? 0.4692 0.6244 0.4377 0.0197  0.0698  0.1477  285 TYR A CE2 
1103 C CZ  . TYR A 149 ? 0.5060 0.6377 0.4837 0.0167  0.0734  0.1644  285 TYR A CZ  
1104 O OH  . TYR A 149 ? 0.5673 0.7002 0.5476 0.0103  0.0826  0.1782  285 TYR A OH  
1105 N N   . SER A 150 ? 0.4232 0.6058 0.3729 0.0453  0.0346  0.1000  286 SER A N   
1106 C CA  . SER A 150 ? 0.3939 0.5864 0.3412 0.0470  0.0293  0.0834  286 SER A CA  
1107 C C   . SER A 150 ? 0.4281 0.6345 0.3726 0.0439  0.0305  0.0594  286 SER A C   
1108 O O   . SER A 150 ? 0.4399 0.6556 0.3796 0.0425  0.0381  0.0594  286 SER A O   
1109 C CB  . SER A 150 ? 0.3306 0.5469 0.2737 0.0530  0.0198  0.0875  286 SER A CB  
1110 O OG  . SER A 150 ? 0.3652 0.5836 0.3183 0.0506  0.0129  0.0651  286 SER A OG  
1111 N N   . LEU A 151 ? 0.3609 0.5671 0.3132 0.0427  0.0245  0.0384  287 LEU A N   
1112 C CA  . LEU A 151 ? 0.3125 0.5277 0.2678 0.0407  0.0263  0.0126  287 LEU A CA  
1113 C C   . LEU A 151 ? 0.3953 0.6323 0.3475 0.0393  0.0181  -0.0063 287 LEU A C   
1114 O O   . LEU A 151 ? 0.4030 0.6380 0.3625 0.0388  0.0103  -0.0024 287 LEU A O   
1115 C CB  . LEU A 151 ? 0.2787 0.4622 0.2550 0.0382  0.0280  0.0038  287 LEU A CB  
1116 C CG  . LEU A 151 ? 0.3057 0.4723 0.2889 0.0377  0.0334  0.0160  287 LEU A CG  
1117 C CD1 . LEU A 151 ? 0.2495 0.3886 0.2508 0.0358  0.0311  0.0107  287 LEU A CD1 
1118 C CD2 . LEU A 151 ? 0.2584 0.4472 0.2393 0.0398  0.0418  0.0110  287 LEU A CD2 
1119 N N   . PRO A 152 ? 0.3885 0.6484 0.3325 0.0379  0.0205  -0.0293 288 PRO A N   
1120 C CA  . PRO A 152 ? 0.3893 0.6716 0.3314 0.0335  0.0123  -0.0540 288 PRO A CA  
1121 C C   . PRO A 152 ? 0.4444 0.6993 0.4144 0.0286  0.0139  -0.0781 288 PRO A C   
1122 O O   . PRO A 152 ? 0.4252 0.6454 0.4131 0.0299  0.0189  -0.0694 288 PRO A O   
1123 C CB  . PRO A 152 ? 0.3987 0.7148 0.3168 0.0334  0.0181  -0.0698 288 PRO A CB  
1124 C CG  . PRO A 152 ? 0.3309 0.6273 0.2586 0.0368  0.0329  -0.0685 288 PRO A CG  
1125 C CD  . PRO A 152 ? 0.3543 0.6220 0.2925 0.0395  0.0324  -0.0363 288 PRO A CD  
1126 N N   . CYS A 153 ? 0.4055 0.6764 0.3794 0.0220  0.0095  -0.1076 289 CYS A N   
1127 C CA  . CYS A 153 ? 0.4004 0.6437 0.4034 0.0166  0.0136  -0.1326 289 CYS A CA  
1128 C C   . CYS A 153 ? 0.3752 0.5988 0.3883 0.0221  0.0271  -0.1415 289 CYS A C   
1129 O O   . CYS A 153 ? 0.4000 0.6460 0.3956 0.0261  0.0343  -0.1485 289 CYS A O   
1130 C CB  . CYS A 153 ? 0.3434 0.6109 0.3482 0.0066  0.0076  -0.1676 289 CYS A CB  
1131 S SG  . CYS A 153 ? 0.5687 0.7982 0.6145 -0.0015 0.0151  -0.2006 289 CYS A SG  
1132 N N   . VAL A 154 ? 0.3193 0.5036 0.3622 0.0227  0.0311  -0.1401 290 VAL A N   
1133 C CA  . VAL A 154 ? 0.4305 0.5957 0.4922 0.0300  0.0422  -0.1458 290 VAL A CA  
1134 C C   . VAL A 154 ? 0.4159 0.5976 0.4803 0.0304  0.0517  -0.1830 290 VAL A C   
1135 O O   . VAL A 154 ? 0.4376 0.6187 0.5114 0.0389  0.0631  -0.1881 290 VAL A O   
1136 C CB  . VAL A 154 ? 0.5507 0.6726 0.6458 0.0301  0.0429  -0.1388 290 VAL A CB  
1137 C CG1 . VAL A 154 ? 0.6410 0.7482 0.7291 0.0296  0.0361  -0.1042 290 VAL A CG1 
1138 C CG2 . VAL A 154 ? 0.5109 0.6202 0.6260 0.0202  0.0418  -0.1634 290 VAL A CG2 
1139 N N   . ALA A 155 ? 0.4532 0.6522 0.5106 0.0207  0.0474  -0.2106 291 ALA A N   
1140 C CA  . ALA A 155 ? 0.5133 0.7290 0.5682 0.0176  0.0549  -0.2476 291 ALA A CA  
1141 C C   . ALA A 155 ? 0.5167 0.7736 0.5316 0.0183  0.0541  -0.2398 291 ALA A C   
1142 O O   . ALA A 155 ? 0.5278 0.7983 0.5362 0.0152  0.0598  -0.2604 291 ALA A O   
1143 C CB  . ALA A 155 ? 0.5316 0.7482 0.5972 0.0032  0.0473  -0.2753 291 ALA A CB  
1144 N N   . GLY A 156 ? 0.5073 0.7821 0.4969 0.0220  0.0482  -0.2086 292 GLY A N   
1145 C CA  . GLY A 156 ? 0.5155 0.8228 0.4713 0.0230  0.0483  -0.1928 292 GLY A CA  
1146 C C   . GLY A 156 ? 0.5642 0.9072 0.4956 0.0142  0.0367  -0.2024 292 GLY A C   
1147 O O   . GLY A 156 ? 0.5926 0.9617 0.4996 0.0133  0.0394  -0.2004 292 GLY A O   
1148 N N   . CYS A 157 ? 0.5787 0.9246 0.5185 0.0073  0.0242  -0.2121 293 CYS A N   
1149 C CA  . CYS A 157 ? 0.6025 0.9858 0.5250 -0.0011 0.0108  -0.2193 293 CYS A CA  
1150 C C   . CYS A 157 ? 0.6466 1.0580 0.5406 0.0043  0.0020  -0.1814 293 CYS A C   
1151 O O   . CYS A 157 ? 0.5991 0.9975 0.4940 0.0118  0.0012  -0.1507 293 CYS A O   
1152 C CB  . CYS A 157 ? 0.5008 0.8800 0.4466 -0.0101 -0.0007 -0.2357 293 CYS A CB  
1153 S SG  . CYS A 157 ? 0.5589 0.8934 0.5481 -0.0168 0.0105  -0.2736 293 CYS A SG  
1154 N N   . PRO A 158 ? 0.7485 1.1965 0.6185 0.0005  -0.0036 -0.1827 294 PRO A N   
1155 C CA  . PRO A 158 ? 0.7638 1.2366 0.6101 0.0059  -0.0115 -0.1452 294 PRO A CA  
1156 C C   . PRO A 158 ? 0.7181 1.1981 0.5752 0.0073  -0.0276 -0.1272 294 PRO A C   
1157 O O   . PRO A 158 ? 0.7355 1.2154 0.6120 0.0002  -0.0353 -0.1501 294 PRO A O   
1158 C CB  . PRO A 158 ? 0.8172 1.3276 0.6371 -0.0005 -0.0139 -0.1596 294 PRO A CB  
1159 C CG  . PRO A 158 ? 0.7951 1.3053 0.6298 -0.0113 -0.0141 -0.2054 294 PRO A CG  
1160 C CD  . PRO A 158 ? 0.7662 1.2323 0.6308 -0.0092 -0.0018 -0.2198 294 PRO A CD  
1161 N N   . ASN A 159 ? 0.7154 1.1994 0.5642 0.0160  -0.0315 -0.0870 295 ASN A N   
1162 C CA  . ASN A 159 ? 0.6528 1.1433 0.5142 0.0199  -0.0453 -0.0657 295 ASN A CA  
1163 C C   . ASN A 159 ? 0.5945 1.0584 0.4849 0.0192  -0.0466 -0.0742 295 ASN A C   
1164 O O   . ASN A 159 ? 0.5235 0.9984 0.4319 0.0158  -0.0588 -0.0795 295 ASN A O   
1165 C CB  . ASN A 159 ? 0.6806 1.2116 0.5349 0.0140  -0.0607 -0.0753 295 ASN A CB  
1166 N N   . SER A 160 ? 0.5317 0.9618 0.4275 0.0219  -0.0342 -0.0747 296 SER A N   
1167 C CA  . SER A 160 ? 0.4843 0.8887 0.4039 0.0206  -0.0348 -0.0828 296 SER A CA  
1168 C C   . SER A 160 ? 0.4957 0.8660 0.4216 0.0299  -0.0267 -0.0497 296 SER A C   
1169 O O   . SER A 160 ? 0.4650 0.7960 0.4171 0.0284  -0.0208 -0.0505 296 SER A O   
1170 C CB  . SER A 160 ? 0.5259 0.9083 0.4581 0.0125  -0.0253 -0.1209 296 SER A CB  
1171 O OG  . SER A 160 ? 0.5120 0.8818 0.4306 0.0170  -0.0099 -0.1223 296 SER A OG  
1172 N N   . LEU A 161 ? 0.5411 0.9185 0.4491 0.0377  -0.0241 -0.0195 297 LEU A N   
1173 C CA  . LEU A 161 ? 0.4856 0.8323 0.3987 0.0450  -0.0164 0.0107  297 LEU A CA  
1174 C C   . LEU A 161 ? 0.4212 0.7486 0.3625 0.0476  -0.0214 0.0221  297 LEU A C   
1175 O O   . LEU A 161 ? 0.4193 0.7732 0.3668 0.0509  -0.0335 0.0299  297 LEU A O   
1176 C CB  . LEU A 161 ? 0.5645 0.9136 0.4680 0.0499  -0.0121 0.0398  297 LEU A CB  
1177 C CG  . LEU A 161 ? 0.6339 0.9719 0.5272 0.0481  0.0011  0.0416  297 LEU A CG  
1178 C CD1 . LEU A 161 ? 0.6445 0.9808 0.5334 0.0517  0.0045  0.0725  297 LEU A CD1 
1179 C CD2 . LEU A 161 ? 0.6499 0.9539 0.5547 0.0472  0.0110  0.0378  297 LEU A CD2 
1180 N N   . ILE A 162 ? 0.4222 0.7065 0.3810 0.0460  -0.0117 0.0225  298 ILE A N   
1181 C CA  . ILE A 162 ? 0.3908 0.6545 0.3733 0.0479  -0.0118 0.0322  298 ILE A CA  
1182 C C   . ILE A 162 ? 0.4790 0.7457 0.4610 0.0585  -0.0123 0.0636  298 ILE A C   
1183 O O   . ILE A 162 ? 0.4440 0.6992 0.4126 0.0617  -0.0053 0.0807  298 ILE A O   
1184 C CB  . ILE A 162 ? 0.3029 0.5221 0.2957 0.0431  -0.0008 0.0271  298 ILE A CB  
1185 C CG1 . ILE A 162 ? 0.3770 0.5913 0.3791 0.0343  -0.0010 -0.0004 298 ILE A CG1 
1186 C CG2 . ILE A 162 ? 0.2144 0.4115 0.2241 0.0454  0.0031  0.0397  298 ILE A CG2 
1187 C CD1 . ILE A 162 ? 0.3600 0.5344 0.3720 0.0301  0.0073  -0.0023 298 ILE A CD1 
1188 N N   . LYS A 163 ? 0.4860 0.7684 0.4869 0.0639  -0.0199 0.0713  299 LYS A N   
1189 C CA  . LYS A 163 ? 0.4702 0.7580 0.4778 0.0768  -0.0212 0.1021  299 LYS A CA  
1190 C C   . LYS A 163 ? 0.3913 0.6408 0.4232 0.0810  -0.0096 0.1107  299 LYS A C   
1191 O O   . LYS A 163 ? 0.4014 0.6320 0.4358 0.0891  -0.0026 0.1333  299 LYS A O   
1192 C CB  . LYS A 163 ? 0.4895 0.8181 0.5057 0.0804  -0.0356 0.1049  299 LYS A CB  
1193 C CG  . LYS A 163 ? 0.6216 0.9707 0.6133 0.0808  -0.0396 0.1159  299 LYS A CG  
1194 C CD  . LYS A 163 ? 0.6937 1.0567 0.6567 0.0710  -0.0395 0.0950  299 LYS A CD  
1195 C CE  . LYS A 163 ? 0.7856 1.1670 0.7259 0.0715  -0.0396 0.1078  299 LYS A CE  
1196 N NZ  . LYS A 163 ? 0.8228 1.2204 0.7385 0.0623  -0.0379 0.0838  299 LYS A NZ  
1197 N N   . GLU A 164 ? 0.3014 0.5394 0.3515 0.0747  -0.0061 0.0921  300 GLU A N   
1198 C CA  . GLU A 164 ? 0.3720 0.5753 0.4400 0.0765  0.0073  0.0951  300 GLU A CA  
1199 C C   . GLU A 164 ? 0.3896 0.5532 0.4391 0.0671  0.0183  0.0874  300 GLU A C   
1200 O O   . GLU A 164 ? 0.3400 0.4945 0.3849 0.0566  0.0195  0.0695  300 GLU A O   
1201 C CB  . GLU A 164 ? 0.3280 0.5411 0.4228 0.0730  0.0079  0.0806  300 GLU A CB  
1202 C CG  . GLU A 164 ? 0.4353 0.6133 0.5422 0.0715  0.0249  0.0779  300 GLU A CG  
1203 C CD  . GLU A 164 ? 0.5633 0.7217 0.6778 0.0837  0.0341  0.0960  300 GLU A CD  
1204 O OE1 . GLU A 164 ? 0.6606 0.8391 0.8023 0.0972  0.0318  0.1090  300 GLU A OE1 
1205 O OE2 . GLU A 164 ? 0.5292 0.6523 0.6259 0.0798  0.0436  0.0970  300 GLU A OE2 
1206 N N   . LEU A 165 ? 0.3906 0.5314 0.4323 0.0705  0.0255  0.1023  301 LEU A N   
1207 C CA  . LEU A 165 ? 0.3800 0.4928 0.4041 0.0611  0.0322  0.0971  301 LEU A CA  
1208 C C   . LEU A 165 ? 0.3242 0.4064 0.3502 0.0530  0.0411  0.0842  301 LEU A C   
1209 O O   . LEU A 165 ? 0.2980 0.3632 0.3102 0.0441  0.0429  0.0777  301 LEU A O   
1210 C CB  . LEU A 165 ? 0.3657 0.4654 0.3845 0.0645  0.0373  0.1162  301 LEU A CB  
1211 C CG  . LEU A 165 ? 0.3917 0.5216 0.4019 0.0714  0.0302  0.1339  301 LEU A CG  
1212 C CD1 . LEU A 165 ? 0.3879 0.4983 0.3986 0.0712  0.0383  0.1510  301 LEU A CD1 
1213 C CD2 . LEU A 165 ? 0.3184 0.4734 0.3094 0.0651  0.0234  0.1204  301 LEU A CD2 
1214 N N   . HIS A 166 ? 0.2851 0.3639 0.3281 0.0560  0.0467  0.0812  302 HIS A N   
1215 C CA  . HIS A 166 ? 0.2727 0.3261 0.3124 0.0473  0.0569  0.0692  302 HIS A CA  
1216 C C   . HIS A 166 ? 0.2490 0.3059 0.2798 0.0372  0.0522  0.0568  302 HIS A C   
1217 O O   . HIS A 166 ? 0.2510 0.2882 0.2722 0.0286  0.0585  0.0504  302 HIS A O   
1218 C CB  . HIS A 166 ? 0.3568 0.4087 0.4186 0.0532  0.0675  0.0678  302 HIS A CB  
1219 C CG  . HIS A 166 ? 0.5530 0.5889 0.6266 0.0630  0.0765  0.0780  302 HIS A CG  
1220 N ND1 . HIS A 166 ? 0.6504 0.7043 0.7447 0.0777  0.0715  0.0950  302 HIS A ND1 
1221 C CD2 . HIS A 166 ? 0.5269 0.5295 0.5962 0.0599  0.0902  0.0733  302 HIS A CD2 
1222 C CE1 . HIS A 166 ? 0.6079 0.6364 0.7137 0.0845  0.0831  0.1024  302 HIS A CE1 
1223 N NE2 . HIS A 166 ? 0.5716 0.5679 0.6627 0.0730  0.0951  0.0868  302 HIS A NE2 
1224 N N   . HIS A 167 ? 0.2131 0.2945 0.2469 0.0378  0.0416  0.0536  303 HIS A N   
1225 C CA  . HIS A 167 ? 0.2934 0.3724 0.3227 0.0289  0.0382  0.0421  303 HIS A CA  
1226 C C   . HIS A 167 ? 0.3170 0.3759 0.3281 0.0242  0.0382  0.0433  303 HIS A C   
1227 O O   . HIS A 167 ? 0.2519 0.2993 0.2601 0.0176  0.0379  0.0383  303 HIS A O   
1228 C CB  . HIS A 167 ? 0.2672 0.3751 0.3037 0.0299  0.0279  0.0337  303 HIS A CB  
1229 C CG  . HIS A 167 ? 0.3081 0.4393 0.3667 0.0301  0.0253  0.0282  303 HIS A CG  
1230 N ND1 . HIS A 167 ? 0.3509 0.5088 0.4204 0.0394  0.0202  0.0365  303 HIS A ND1 
1231 C CD2 . HIS A 167 ? 0.2935 0.4273 0.3693 0.0218  0.0268  0.0166  303 HIS A CD2 
1232 C CE1 . HIS A 167 ? 0.3325 0.5124 0.4261 0.0368  0.0173  0.0287  303 HIS A CE1 
1233 N NE2 . HIS A 167 ? 0.2920 0.4569 0.3901 0.0251  0.0222  0.0157  303 HIS A NE2 
1234 N N   . PHE A 168 ? 0.2942 0.3500 0.2966 0.0274  0.0383  0.0519  304 PHE A N   
1235 C CA  . PHE A 168 ? 0.3771 0.4193 0.3674 0.0221  0.0374  0.0530  304 PHE A CA  
1236 C C   . PHE A 168 ? 0.3518 0.3693 0.3326 0.0146  0.0427  0.0528  304 PHE A C   
1237 O O   . PHE A 168 ? 0.3336 0.3429 0.3054 0.0087  0.0395  0.0534  304 PHE A O   
1238 C CB  . PHE A 168 ? 0.3001 0.3506 0.2871 0.0254  0.0366  0.0616  304 PHE A CB  
1239 C CG  . PHE A 168 ? 0.3217 0.3999 0.3103 0.0310  0.0317  0.0601  304 PHE A CG  
1240 C CD1 . PHE A 168 ? 0.3516 0.4385 0.3419 0.0294  0.0278  0.0481  304 PHE A CD1 
1241 C CD2 . PHE A 168 ? 0.2219 0.3178 0.2102 0.0380  0.0312  0.0704  304 PHE A CD2 
1242 C CE1 . PHE A 168 ? 0.3698 0.4832 0.3590 0.0331  0.0247  0.0412  304 PHE A CE1 
1243 C CE2 . PHE A 168 ? 0.3326 0.4586 0.3161 0.0416  0.0260  0.0674  304 PHE A CE2 
1244 C CZ  . PHE A 168 ? 0.4014 0.5363 0.3840 0.0384  0.0234  0.0503  304 PHE A CZ  
1245 N N   . ARG A 169 ? 0.3188 0.3282 0.3020 0.0144  0.0506  0.0509  305 ARG A N   
1246 C CA  . ARG A 169 ? 0.3874 0.3764 0.3565 0.0059  0.0574  0.0473  305 ARG A CA  
1247 C C   . ARG A 169 ? 0.3634 0.3492 0.3223 -0.0014 0.0521  0.0468  305 ARG A C   
1248 O O   . ARG A 169 ? 0.4316 0.4048 0.3718 -0.0097 0.0526  0.0470  305 ARG A O   
1249 C CB  . ARG A 169 ? 0.4429 0.4286 0.4201 0.0081  0.0697  0.0433  305 ARG A CB  
1250 C CG  . ARG A 169 ? 0.5591 0.5246 0.5269 0.0047  0.0812  0.0384  305 ARG A CG  
1251 C CD  . ARG A 169 ? 0.6815 0.6411 0.6585 0.0106  0.0818  0.0429  305 ARG A CD  
1252 N NE  . ARG A 169 ? 0.7972 0.7351 0.7752 0.0095  0.0965  0.0350  305 ARG A NE  
1253 C CZ  . ARG A 169 ? 0.8136 0.7320 0.7708 -0.0028 0.1011  0.0238  305 ARG A CZ  
1254 N NH1 . ARG A 169 ? 0.8134 0.7343 0.7477 -0.0144 0.0901  0.0228  305 ARG A NH1 
1255 N NH2 . ARG A 169 ? 0.8228 0.7205 0.7836 -0.0035 0.1166  0.0126  305 ARG A NH2 
1256 N N   . ILE A 170 ? 0.3538 0.3511 0.3253 0.0016  0.0466  0.0465  306 ILE A N   
1257 C CA  . ILE A 170 ? 0.4233 0.4150 0.3930 -0.0029 0.0419  0.0487  306 ILE A CA  
1258 C C   . ILE A 170 ? 0.4557 0.4449 0.4169 -0.0042 0.0328  0.0540  306 ILE A C   
1259 O O   . ILE A 170 ? 0.4857 0.4685 0.4438 -0.0071 0.0277  0.0603  306 ILE A O   
1260 C CB  . ILE A 170 ? 0.3161 0.3189 0.3075 0.0005  0.0394  0.0430  306 ILE A CB  
1261 C CG1 . ILE A 170 ? 0.3928 0.4007 0.3960 -0.0015 0.0473  0.0386  306 ILE A CG1 
1262 C CG2 . ILE A 170 ? 0.3923 0.3850 0.3892 -0.0021 0.0352  0.0462  306 ILE A CG2 
1263 C CD1 . ILE A 170 ? 0.4074 0.4324 0.4337 0.0002  0.0435  0.0286  306 ILE A CD1 
1264 N N   . LEU A 171 ? 0.4240 0.4195 0.3846 -0.0019 0.0308  0.0536  307 LEU A N   
1265 C CA  . LEU A 171 ? 0.4066 0.4046 0.3641 -0.0044 0.0227  0.0578  307 LEU A CA  
1266 C C   . LEU A 171 ? 0.4685 0.4555 0.4059 -0.0143 0.0198  0.0613  307 LEU A C   
1267 O O   . LEU A 171 ? 0.6172 0.6085 0.5538 -0.0164 0.0096  0.0678  307 LEU A O   
1268 C CB  . LEU A 171 ? 0.3280 0.3330 0.2889 -0.0034 0.0245  0.0574  307 LEU A CB  
1269 C CG  . LEU A 171 ? 0.2730 0.2964 0.2487 0.0049  0.0242  0.0570  307 LEU A CG  
1270 C CD1 . LEU A 171 ? 0.2366 0.2633 0.2124 0.0052  0.0294  0.0613  307 LEU A CD1 
1271 C CD2 . LEU A 171 ? 0.2970 0.3315 0.2837 0.0064  0.0174  0.0578  307 LEU A CD2 
1272 N N   . GLY A 172 ? 0.4895 0.4649 0.4111 -0.0198 0.0288  0.0567  308 GLY A N   
1273 C CA  . GLY A 172 ? 0.4992 0.4665 0.3953 -0.0312 0.0275  0.0558  308 GLY A CA  
1274 C C   . GLY A 172 ? 0.5917 0.5525 0.4833 -0.0367 0.0325  0.0460  308 GLY A C   
1275 O O   . GLY A 172 ? 0.6013 0.5663 0.5110 -0.0317 0.0329  0.0462  308 GLY A O   
1276 N N   . GLU A 173 ? 0.6378 0.5881 0.5051 -0.0476 0.0376  0.0373  309 GLU A N   
1277 C CA  . GLU A 173 ? 0.7027 0.6406 0.5676 -0.0543 0.0453  0.0240  309 GLU A CA  
1278 C C   . GLU A 173 ? 0.6746 0.6194 0.5527 -0.0587 0.0351  0.0253  309 GLU A C   
1279 O O   . GLU A 173 ? 0.6414 0.5788 0.5381 -0.0558 0.0422  0.0236  309 GLU A O   
1280 C CB  . GLU A 173 ? 0.8649 0.7934 0.6966 -0.0683 0.0506  0.0106  309 GLU A CB  
1281 C CG  . GLU A 173 ? 0.9980 0.9227 0.8147 -0.0661 0.0633  0.0101  309 GLU A CG  
1282 C CD  . GLU A 173 ? 1.0899 1.0207 0.8677 -0.0788 0.0577  0.0116  309 GLU A CD  
1283 O OE1 . GLU A 173 ? 1.1525 1.0776 0.9019 -0.0920 0.0628  -0.0049 309 GLU A OE1 
1284 O OE2 . GLU A 173 ? 1.0696 1.0105 0.8448 -0.0757 0.0485  0.0296  309 GLU A OE2 
1285 N N   . GLU A 174 ? 0.6551 0.6156 0.5266 -0.0654 0.0188  0.0305  310 GLU A N   
1286 C CA  . GLU A 174 ? 0.6286 0.6013 0.5163 -0.0714 0.0088  0.0313  310 GLU A CA  
1287 C C   . GLU A 174 ? 0.5844 0.5662 0.5024 -0.0590 0.0110  0.0413  310 GLU A C   
1288 O O   . GLU A 174 ? 0.5598 0.5382 0.4936 -0.0614 0.0170  0.0399  310 GLU A O   
1289 N N   . GLN A 175 ? 0.4570 0.4498 0.3827 -0.0465 0.0074  0.0511  311 GLN A N   
1290 C CA  . GLN A 175 ? 0.3540 0.3595 0.3038 -0.0352 0.0096  0.0576  311 GLN A CA  
1291 C C   . GLN A 175 ? 0.3651 0.3603 0.3193 -0.0289 0.0232  0.0569  311 GLN A C   
1292 O O   . GLN A 175 ? 0.3843 0.3890 0.3531 -0.0245 0.0267  0.0622  311 GLN A O   
1293 C CB  . GLN A 175 ? 0.3970 0.4129 0.3542 -0.0243 0.0043  0.0634  311 GLN A CB  
1294 C CG  . GLN A 175 ? 0.5059 0.5332 0.4654 -0.0266 -0.0101 0.0696  311 GLN A CG  
1295 C CD  . GLN A 175 ? 0.7212 0.7716 0.7064 -0.0250 -0.0165 0.0728  311 GLN A CD  
1296 O OE1 . GLN A 175 ? 0.8206 0.8835 0.8266 -0.0140 -0.0184 0.0765  311 GLN A OE1 
1297 N NE2 . GLN A 175 ? 0.7626 0.8190 0.7500 -0.0366 -0.0181 0.0698  311 GLN A NE2 
1298 N N   . TYR A 176 ? 0.3817 0.3602 0.3241 -0.0278 0.0311  0.0520  312 TYR A N   
1299 C CA  . TYR A 176 ? 0.3661 0.3378 0.3173 -0.0194 0.0423  0.0540  312 TYR A CA  
1300 C C   . TYR A 176 ? 0.3613 0.3209 0.3205 -0.0247 0.0491  0.0549  312 TYR A C   
1301 O O   . TYR A 176 ? 0.4824 0.4450 0.4547 -0.0170 0.0543  0.0649  312 TYR A O   
1302 C CB  . TYR A 176 ? 0.3666 0.3258 0.3100 -0.0167 0.0505  0.0480  312 TYR A CB  
1303 C CG  . TYR A 176 ? 0.3554 0.3129 0.3138 -0.0056 0.0598  0.0522  312 TYR A CG  
1304 C CD1 . TYR A 176 ? 0.3117 0.2892 0.2814 0.0054  0.0560  0.0599  312 TYR A CD1 
1305 C CD2 . TYR A 176 ? 0.3134 0.2506 0.2762 -0.0057 0.0720  0.0480  312 TYR A CD2 
1306 C CE1 . TYR A 176 ? 0.3543 0.3363 0.3382 0.0163  0.0613  0.0666  312 TYR A CE1 
1307 C CE2 . TYR A 176 ? 0.3738 0.3114 0.3557 0.0072  0.0793  0.0556  312 TYR A CE2 
1308 C CZ  . TYR A 176 ? 0.4356 0.3978 0.4273 0.0182  0.0725  0.0666  312 TYR A CZ  
1309 O OH  . TYR A 176 ? 0.5479 0.5162 0.5586 0.0314  0.0765  0.0768  312 TYR A OH  
1310 N N   . ASN A 177 ? 0.3967 0.3427 0.3474 -0.0387 0.0490  0.0450  313 ASN A N   
1311 C CA  . ASN A 177 ? 0.5035 0.4346 0.4656 -0.0474 0.0557  0.0433  313 ASN A CA  
1312 C C   . ASN A 177 ? 0.4778 0.4273 0.4572 -0.0480 0.0516  0.0558  313 ASN A C   
1313 O O   . ASN A 177 ? 0.5004 0.4427 0.4951 -0.0460 0.0606  0.0657  313 ASN A O   
1314 C CB  . ASN A 177 ? 0.5494 0.4680 0.4979 -0.0659 0.0534  0.0256  313 ASN A CB  
1315 N N   . ARG A 178 ? 0.4368 0.4106 0.4156 -0.0502 0.0393  0.0568  314 ARG A N   
1316 C CA  . ARG A 178 ? 0.3947 0.3912 0.3919 -0.0495 0.0376  0.0672  314 ARG A CA  
1317 C C   . ARG A 178 ? 0.3773 0.3817 0.3789 -0.0344 0.0454  0.0798  314 ARG A C   
1318 O O   . ARG A 178 ? 0.3124 0.3213 0.3258 -0.0349 0.0531  0.0911  314 ARG A O   
1319 C CB  . ARG A 178 ? 0.3681 0.3908 0.3686 -0.0493 0.0240  0.0661  314 ARG A CB  
1320 C CG  . ARG A 178 ? 0.3626 0.4121 0.3854 -0.0468 0.0256  0.0747  314 ARG A CG  
1321 C CD  . ARG A 178 ? 0.3204 0.3965 0.3557 -0.0449 0.0135  0.0737  314 ARG A CD  
1322 N NE  . ARG A 178 ? 0.4064 0.5091 0.4672 -0.0449 0.0186  0.0796  314 ARG A NE  
1323 C CZ  . ARG A 178 ? 0.3998 0.5308 0.4813 -0.0391 0.0132  0.0801  314 ARG A CZ  
1324 N NH1 . ARG A 178 ? 0.3874 0.5213 0.4681 -0.0320 0.0008  0.0776  314 ARG A NH1 
1325 N NH2 . ARG A 178 ? 0.3233 0.4797 0.4287 -0.0398 0.0218  0.0843  314 ARG A NH2 
1326 N N   . TYR A 179 ? 0.3544 0.3620 0.3459 -0.0224 0.0433  0.0783  315 TYR A N   
1327 C CA  . TYR A 179 ? 0.3164 0.3362 0.3091 -0.0093 0.0478  0.0876  315 TYR A CA  
1328 C C   . TYR A 179 ? 0.3464 0.3513 0.3436 -0.0065 0.0578  0.0994  315 TYR A C   
1329 O O   . TYR A 179 ? 0.3944 0.4133 0.3946 -0.0001 0.0612  0.1127  315 TYR A O   
1330 C CB  . TYR A 179 ? 0.2673 0.2905 0.2516 -0.0002 0.0434  0.0808  315 TYR A CB  
1331 C CG  . TYR A 179 ? 0.2887 0.3218 0.2733 0.0113  0.0467  0.0881  315 TYR A CG  
1332 C CD1 . TYR A 179 ? 0.3198 0.3797 0.3039 0.0175  0.0453  0.0921  315 TYR A CD1 
1333 C CD2 . TYR A 179 ? 0.2719 0.2910 0.2579 0.0161  0.0510  0.0905  315 TYR A CD2 
1334 C CE1 . TYR A 179 ? 0.3341 0.4088 0.3151 0.0270  0.0455  0.0992  315 TYR A CE1 
1335 C CE2 . TYR A 179 ? 0.3502 0.3840 0.3396 0.0273  0.0511  0.0995  315 TYR A CE2 
1336 C CZ  . TYR A 179 ? 0.3524 0.4151 0.3373 0.0321  0.0469  0.1043  315 TYR A CZ  
1337 O OH  . TYR A 179 ? 0.3756 0.4584 0.3606 0.0422  0.0441  0.1135  315 TYR A OH  
1338 N N   . GLN A 180 ? 0.3310 0.3075 0.3289 -0.0110 0.0627  0.0939  316 GLN A N   
1339 C CA  . GLN A 180 ? 0.4571 0.4139 0.4662 -0.0069 0.0736  0.1057  316 GLN A CA  
1340 C C   . GLN A 180 ? 0.4729 0.4254 0.4947 -0.0158 0.0795  0.1171  316 GLN A C   
1341 O O   . GLN A 180 ? 0.5146 0.4582 0.5463 -0.0102 0.0842  0.1282  316 GLN A O   
1342 C CB  . GLN A 180 ? 0.5260 0.4514 0.5361 -0.0097 0.0804  0.0923  316 GLN A CB  
1343 C CG  . GLN A 180 ? 0.6264 0.5562 0.6290 0.0002  0.0788  0.0843  316 GLN A CG  
1344 C CD  . GLN A 180 ? 0.6872 0.5878 0.6930 -0.0012 0.0902  0.0713  316 GLN A CD  
1345 O OE1 . GLN A 180 ? 0.6899 0.5765 0.6830 -0.0147 0.0915  0.0533  316 GLN A OE1 
1346 N NE2 . GLN A 180 ? 0.6322 0.5263 0.6554 0.0131  0.0985  0.0799  316 GLN A NE2 
1347 N N   . GLN A 181 ? 0.4968 0.4599 0.5200 -0.0292 0.0753  0.1106  317 GLN A N   
1348 C CA  . GLN A 181 ? 0.5277 0.4912 0.5666 -0.0406 0.0811  0.1197  317 GLN A CA  
1349 C C   . GLN A 181 ? 0.4216 0.4209 0.4588 -0.0352 0.0777  0.1277  317 GLN A C   
1350 O O   . GLN A 181 ? 0.4233 0.4324 0.4731 -0.0458 0.0811  0.1311  317 GLN A O   
1351 C CB  . GLN A 181 ? 0.5448 0.5019 0.5909 -0.0607 0.0771  0.1031  317 GLN A CB  
1352 C CG  . GLN A 181 ? 0.7587 0.6781 0.8058 -0.0708 0.0818  0.0878  317 GLN A CG  
1353 C CD  . GLN A 181 ? 0.9288 0.8504 0.9765 -0.0920 0.0730  0.0674  317 GLN A CD  
1354 O OE1 . GLN A 181 ? 0.9276 0.8807 0.9778 -0.0968 0.0616  0.0670  317 GLN A OE1 
1355 N NE2 . GLN A 181 ? 1.0065 0.8967 1.0536 -0.1046 0.0780  0.0494  317 GLN A NE2 
1356 N N   . TYR A 182 ? 0.4009 0.4200 0.4245 -0.0201 0.0725  0.1283  318 TYR A N   
1357 C CA  . TYR A 182 ? 0.3973 0.4502 0.4182 -0.0160 0.0708  0.1296  318 TYR A CA  
1358 C C   . TYR A 182 ? 0.3861 0.4464 0.4118 -0.0181 0.0783  0.1423  318 TYR A C   
1359 O O   . TYR A 182 ? 0.3682 0.4484 0.4023 -0.0247 0.0821  0.1424  318 TYR A O   
1360 C CB  . TYR A 182 ? 0.3076 0.3778 0.3137 -0.0015 0.0648  0.1252  318 TYR A CB  
1361 C CG  . TYR A 182 ? 0.2568 0.3594 0.2613 0.0013  0.0641  0.1193  318 TYR A CG  
1362 C CD1 . TYR A 182 ? 0.2854 0.4087 0.2865 0.0035  0.0693  0.1253  318 TYR A CD1 
1363 C CD2 . TYR A 182 ? 0.2599 0.3727 0.2671 0.0020  0.0600  0.1082  318 TYR A CD2 
1364 C CE1 . TYR A 182 ? 0.2664 0.4189 0.2668 0.0063  0.0716  0.1167  318 TYR A CE1 
1365 C CE2 . TYR A 182 ? 0.2198 0.3618 0.2309 0.0062  0.0619  0.1007  318 TYR A CE2 
1366 C CZ  . TYR A 182 ? 0.3160 0.4775 0.3235 0.0083  0.0685  0.1035  318 TYR A CZ  
1367 O OH  . TYR A 182 ? 0.3712 0.5607 0.3831 0.0127  0.0731  0.0924  318 TYR A OH  
1368 N N   . GLY A 183 ? 0.4037 0.4502 0.4264 -0.0123 0.0810  0.1545  319 GLY A N   
1369 C CA  . GLY A 183 ? 0.3397 0.3915 0.3649 -0.0139 0.0884  0.1705  319 GLY A CA  
1370 C C   . GLY A 183 ? 0.3830 0.4219 0.4265 -0.0310 0.0966  0.1724  319 GLY A C   
1371 O O   . GLY A 183 ? 0.4150 0.4718 0.4626 -0.0371 0.1032  0.1784  319 GLY A O   
1372 N N   . ALA A 184 ? 0.4487 0.4575 0.5042 -0.0402 0.0972  0.1659  320 ALA A N   
1373 C CA  . ALA A 184 ? 0.4485 0.4446 0.5244 -0.0597 0.1040  0.1646  320 ALA A CA  
1374 C C   . ALA A 184 ? 0.4150 0.4415 0.5003 -0.0699 0.1021  0.1553  320 ALA A C   
1375 O O   . ALA A 184 ? 0.4125 0.4517 0.5123 -0.0807 0.1091  0.1602  320 ALA A O   
1376 C CB  . ALA A 184 ? 0.4046 0.3637 0.4905 -0.0689 0.1042  0.1541  320 ALA A CB  
1377 N N   . GLU A 185 ? 0.3172 0.3573 0.3976 -0.0661 0.0930  0.1432  321 GLU A N   
1378 C CA  . GLU A 185 ? 0.3722 0.4444 0.4690 -0.0741 0.0893  0.1358  321 GLU A CA  
1379 C C   . GLU A 185 ? 0.3996 0.5056 0.4967 -0.0665 0.0952  0.1415  321 GLU A C   
1380 O O   . GLU A 185 ? 0.4610 0.5914 0.5806 -0.0758 0.0984  0.1396  321 GLU A O   
1381 C CB  . GLU A 185 ? 0.3587 0.4401 0.4509 -0.0701 0.0771  0.1254  321 GLU A CB  
1382 C CG  . GLU A 185 ? 0.3496 0.4630 0.4631 -0.0775 0.0679  0.1156  321 GLU A CG  
1383 C CD  . GLU A 185 ? 0.4427 0.5587 0.5442 -0.0689 0.0509  0.1011  321 GLU A CD  
1384 O OE1 . GLU A 185 ? 0.4414 0.5335 0.5185 -0.0609 0.0474  0.0970  321 GLU A OE1 
1385 O OE2 . GLU A 185 ? 0.4556 0.5990 0.5752 -0.0698 0.0416  0.0957  321 GLU A OE2 
1386 N N   . GLU A 186 ? 0.3853 0.4949 0.4588 -0.0504 0.0965  0.1468  322 GLU A N   
1387 C CA  . GLU A 186 ? 0.4347 0.5750 0.5035 -0.0442 0.1034  0.1498  322 GLU A CA  
1388 C C   . GLU A 186 ? 0.4822 0.6235 0.5629 -0.0560 0.1158  0.1617  322 GLU A C   
1389 O O   . GLU A 186 ? 0.5365 0.7061 0.6275 -0.0591 0.1240  0.1606  322 GLU A O   
1390 C CB  . GLU A 186 ? 0.4845 0.6280 0.5247 -0.0282 0.1007  0.1525  322 GLU A CB  
1391 C CG  . GLU A 186 ? 0.5312 0.7094 0.5625 -0.0200 0.1037  0.1444  322 GLU A CG  
1392 C CD  . GLU A 186 ? 0.5296 0.7210 0.5672 -0.0140 0.0968  0.1267  322 GLU A CD  
1393 O OE1 . GLU A 186 ? 0.4723 0.6537 0.5260 -0.0191 0.0905  0.1228  322 GLU A OE1 
1394 O OE2 . GLU A 186 ? 0.5703 0.7828 0.5970 -0.0049 0.0981  0.1165  322 GLU A OE2 
1395 N N   . CYS A 187 ? 0.3962 0.5060 0.4784 -0.0630 0.1185  0.1723  323 CYS A N   
1396 C CA  A CYS A 187 ? 0.4480 0.5538 0.5437 -0.0762 0.1308  0.1847  323 CYS A CA  
1397 C CA  B CYS A 187 ? 0.4511 0.5561 0.5471 -0.0765 0.1308  0.1848  323 CYS A CA  
1398 C C   . CYS A 187 ? 0.4508 0.5674 0.5791 -0.0952 0.1334  0.1750  323 CYS A C   
1399 O O   . CYS A 187 ? 0.4933 0.6339 0.6357 -0.1029 0.1436  0.1781  323 CYS A O   
1400 C CB  A CYS A 187 ? 0.4865 0.5531 0.5803 -0.0783 0.1326  0.1975  323 CYS A CB  
1401 C CB  B CYS A 187 ? 0.4883 0.5528 0.5838 -0.0795 0.1325  0.1968  323 CYS A CB  
1402 S SG  A CYS A 187 ? 0.4469 0.5069 0.5537 -0.0922 0.1485  0.2175  323 CYS A SG  
1403 S SG  B CYS A 187 ? 0.7439 0.8008 0.8129 -0.0602 0.1322  0.2171  323 CYS A SG  
1404 N N   . VAL A 188 ? 0.4452 0.5468 0.5863 -0.1035 0.1239  0.1626  324 VAL A N   
1405 C CA  . VAL A 188 ? 0.4813 0.5972 0.6555 -0.1226 0.1212  0.1509  324 VAL A CA  
1406 C C   . VAL A 188 ? 0.4739 0.6375 0.6642 -0.1181 0.1205  0.1451  324 VAL A C   
1407 O O   . VAL A 188 ? 0.4277 0.6140 0.6475 -0.1314 0.1255  0.1426  324 VAL A O   
1408 C CB  . VAL A 188 ? 0.4737 0.5706 0.6515 -0.1297 0.1076  0.1369  324 VAL A CB  
1409 C CG1 . VAL A 188 ? 0.4692 0.5934 0.6802 -0.1467 0.0980  0.1232  324 VAL A CG1 
1410 C CG2 . VAL A 188 ? 0.5239 0.5733 0.6960 -0.1386 0.1113  0.1384  324 VAL A CG2 
1411 N N   . LEU A 189 ? 0.4402 0.6187 0.6129 -0.0990 0.1149  0.1418  325 LEU A N   
1412 C CA  . LEU A 189 ? 0.3962 0.6169 0.5847 -0.0912 0.1144  0.1342  325 LEU A CA  
1413 C C   . LEU A 189 ? 0.4344 0.6775 0.6248 -0.0898 0.1317  0.1397  325 LEU A C   
1414 O O   . LEU A 189 ? 0.3794 0.6559 0.5994 -0.0929 0.1360  0.1331  325 LEU A O   
1415 C CB  . LEU A 189 ? 0.3351 0.5604 0.5032 -0.0719 0.1055  0.1277  325 LEU A CB  
1416 C CG  . LEU A 189 ? 0.3391 0.5591 0.5139 -0.0731 0.0879  0.1203  325 LEU A CG  
1417 C CD1 . LEU A 189 ? 0.3637 0.5746 0.5099 -0.0559 0.0827  0.1175  325 LEU A CD1 
1418 C CD2 . LEU A 189 ? 0.2242 0.4805 0.4368 -0.0760 0.0788  0.1121  325 LEU A CD2 
1419 N N   . GLN A 190 ? 0.5153 0.7420 0.6756 -0.0851 0.1412  0.1519  326 GLN A N   
1420 C CA  . GLN A 190 ? 0.5497 0.7980 0.7052 -0.0845 0.1581  0.1583  326 GLN A CA  
1421 C C   . GLN A 190 ? 0.6226 0.8757 0.8067 -0.1046 0.1701  0.1653  326 GLN A C   
1422 O O   . GLN A 190 ? 0.6563 0.9341 0.8466 -0.1077 0.1859  0.1683  326 GLN A O   
1423 C CB  . GLN A 190 ? 0.5772 0.8106 0.6914 -0.0742 0.1617  0.1713  326 GLN A CB  
1424 C CG  . GLN A 190 ? 0.7437 0.9433 0.8509 -0.0828 0.1643  0.1906  326 GLN A CG  
1425 C CD  . GLN A 190 ? 0.8587 1.0448 0.9293 -0.0690 0.1609  0.2032  326 GLN A CD  
1426 O OE1 . GLN A 190 ? 0.9259 1.1338 0.9734 -0.0572 0.1614  0.2002  326 GLN A OE1 
1427 N NE2 . GLN A 190 ? 0.8967 1.0485 0.9647 -0.0705 0.1570  0.2161  326 GLN A NE2 
1428 N N   . MET A 191 ? 0.6460 0.8757 0.8481 -0.1198 0.1637  0.1661  327 MET A N   
1429 C CA  . MET A 191 ? 0.7004 0.9354 0.9342 -0.1419 0.1734  0.1691  327 MET A CA  
1430 C C   . MET A 191 ? 0.6198 0.8871 0.8959 -0.1502 0.1652  0.1519  327 MET A C   
1431 O O   . MET A 191 ? 0.6404 0.9206 0.9500 -0.1698 0.1703  0.1498  327 MET A O   
1432 C CB  . MET A 191 ? 0.7950 0.9862 1.0268 -0.1564 0.1723  0.1777  327 MET A CB  
1433 C CG  . MET A 191 ? 0.8238 0.9992 1.0737 -0.1678 0.1566  0.1625  327 MET A CG  
1434 S SD  . MET A 191 ? 0.9989 1.1242 1.2531 -0.1888 0.1596  0.1687  327 MET A SD  
1435 C CE  . MET A 191 ? 0.7141 0.8031 0.9256 -0.1663 0.1627  0.1879  327 MET A CE  
1436 N N   . GLY A 192 ? 0.6881 0.6121 0.8057 -0.0074 0.2013  0.1130  328 GLY A N   
1437 C CA  . GLY A 192 ? 0.6439 0.5718 0.8242 -0.0211 0.1725  0.1320  328 GLY A CA  
1438 C C   . GLY A 192 ? 0.6975 0.5998 0.8483 -0.0477 0.1229  0.1308  328 GLY A C   
1439 O O   . GLY A 192 ? 0.7269 0.6267 0.9236 -0.0626 0.0895  0.1485  328 GLY A O   
1440 N N   . GLY A 193 ? 0.6960 0.5772 0.7692 -0.0539 0.1177  0.1098  329 GLY A N   
1441 C CA  . GLY A 193 ? 0.6448 0.4955 0.6765 -0.0803 0.0759  0.1042  329 GLY A CA  
1442 C C   . GLY A 193 ? 0.6501 0.4806 0.6205 -0.0870 0.0637  0.0841  329 GLY A C   
1443 O O   . GLY A 193 ? 0.6311 0.4732 0.5906 -0.0704 0.0880  0.0723  329 GLY A O   
1444 N N   . VAL A 194 ? 0.6833 0.4803 0.6104 -0.1129 0.0273  0.0792  330 VAL A N   
1445 C CA  . VAL A 194 ? 0.7663 0.5359 0.6277 -0.1236 0.0158  0.0599  330 VAL A CA  
1446 C C   . VAL A 194 ? 0.8397 0.5742 0.6205 -0.1416 0.0064  0.0355  330 VAL A C   
1447 O O   . VAL A 194 ? 0.8390 0.5614 0.6207 -0.1551 -0.0094 0.0414  330 VAL A O   
1448 C CB  . VAL A 194 ? 0.8870 0.6420 0.7751 -0.1404 -0.0225 0.0815  330 VAL A CB  
1449 C CG1 . VAL A 194 ? 1.0043 0.7231 0.8159 -0.1540 -0.0337 0.0626  330 VAL A CG1 
1450 C CG2 . VAL A 194 ? 0.9261 0.7163 0.8992 -0.1208 -0.0094 0.1031  330 VAL A CG2 
1451 N N   . LEU A 195 ? 0.8057 0.5235 0.5200 -0.1419 0.0190  0.0069  331 LEU A N   
1452 C CA  . LEU A 195 ? 0.8330 0.5153 0.4724 -0.1595 0.0142  -0.0193 331 LEU A CA  
1453 C C   . LEU A 195 ? 0.9462 0.5830 0.5354 -0.1886 -0.0165 -0.0212 331 LEU A C   
1454 O O   . LEU A 195 ? 0.8853 0.5173 0.4660 -0.1876 -0.0165 -0.0214 331 LEU A O   
1455 C CB  . LEU A 195 ? 0.8366 0.5297 0.4375 -0.1410 0.0510  -0.0527 331 LEU A CB  
1456 C CG  . LEU A 195 ? 0.9099 0.5822 0.4578 -0.1491 0.0566  -0.0807 331 LEU A CG  
1457 C CD1 . LEU A 195 ? 1.0957 0.7439 0.6373 -0.1679 0.0362  -0.0719 331 LEU A CD1 
1458 C CD2 . LEU A 195 ? 0.8843 0.6115 0.4802 -0.1126 0.0823  -0.0886 331 LEU A CD2 
1459 N N   . CYS A 196 ? 0.9497 0.5489 0.5019 -0.2154 -0.0425 -0.0224 332 CYS A N   
1460 C CA  . CYS A 196 ? 1.0533 0.5999 0.5402 -0.2454 -0.0697 -0.0275 332 CYS A CA  
1461 C C   . CYS A 196 ? 1.0945 0.6622 0.5636 -0.2240 -0.0326 -0.0452 332 CYS A C   
1462 O O   . CYS A 196 ? 1.0358 0.6356 0.5253 -0.2039 -0.0028 -0.0596 332 CYS A O   
1463 C CB  . CYS A 196 ? 1.0837 0.6158 0.5564 -0.2590 -0.0897 -0.0190 332 CYS A CB  
1464 S SG  . CYS A 196 ? 1.2262 0.7310 0.6486 -0.2684 -0.0984 -0.0130 332 CYS A SG  
1465 N N   . PRO A 197 ? 1.1548 0.7077 0.6061 -0.2287 -0.0386 -0.0398 333 PRO A N   
1466 C CA  . PRO A 197 ? 1.1719 0.7471 0.6321 -0.2116 -0.0074 -0.0522 333 PRO A CA  
1467 C C   . PRO A 197 ? 1.2279 0.7995 0.6803 -0.2150 -0.0001 -0.0547 333 PRO A C   
1468 O O   . PRO A 197 ? 1.2104 0.8153 0.6940 -0.1977 0.0244  -0.0678 333 PRO A O   
1469 C CB  . PRO A 197 ? 1.1730 0.7209 0.6096 -0.2214 -0.0217 -0.0430 333 PRO A CB  
1470 C CG  . PRO A 197 ? 1.2253 0.7302 0.6363 -0.2482 -0.0703 -0.0206 333 PRO A CG  
1471 C CD  . PRO A 197 ? 1.2055 0.7218 0.6439 -0.2510 -0.0812 -0.0188 333 PRO A CD  
1472 N N   . ARG A 198 ? 1.2600 0.7929 0.6747 -0.2370 -0.0242 -0.0419 334 ARG A N   
1473 C CA  . ARG A 198 ? 1.2914 0.8136 0.6906 -0.2432 -0.0151 -0.0451 334 ARG A CA  
1474 C C   . ARG A 198 ? 1.3423 0.9033 0.7806 -0.2257 0.0084  -0.0612 334 ARG A C   
1475 O O   . ARG A 198 ? 1.3426 0.9143 0.7946 -0.2217 0.0047  -0.0625 334 ARG A O   
1476 C CB  . ARG A 198 ? 1.2596 0.7349 0.6122 -0.2685 -0.0465 -0.0286 334 ARG A CB  
1477 N N   . PRO A 199 ? 1.3962 0.9553 0.8295 -0.2279 0.0332  -0.0696 335 PRO A N   
1478 C CA  . PRO A 199 ? 1.3687 0.9515 0.8275 -0.2189 0.0560  -0.0830 335 PRO A CA  
1479 C C   . PRO A 199 ? 1.3977 0.9734 0.8501 -0.2235 0.0513  -0.0841 335 PRO A C   
1480 O O   . PRO A 199 ? 1.4050 1.0105 0.8913 -0.2072 0.0569  -0.0918 335 PRO A O   
1481 C CB  . PRO A 199 ? 1.4123 0.9758 0.8504 -0.2330 0.0771  -0.0881 335 PRO A CB  
1482 C CG  . PRO A 199 ? 1.4256 0.9693 0.8419 -0.2401 0.0704  -0.0797 335 PRO A CG  
1483 C CD  . PRO A 199 ? 1.4547 0.9806 0.8513 -0.2441 0.0396  -0.0657 335 PRO A CD  
1484 N N   . GLY A 200 ? 1.4343 0.9689 0.8415 -0.2455 0.0409  -0.0764 336 GLY A N   
1485 C CA  . GLY A 200 ? 1.4554 0.9798 0.8533 -0.2516 0.0356  -0.0776 336 GLY A CA  
1486 C C   . GLY A 200 ? 1.3873 0.9341 0.8150 -0.2390 0.0156  -0.0744 336 GLY A C   
1487 O O   . GLY A 200 ? 1.3651 0.9337 0.8202 -0.2265 0.0231  -0.0827 336 GLY A O   
1488 N N   . CYS A 201 ? 1.3028 0.8342 0.7164 -0.2477 -0.0098 -0.0609 337 CYS A N   
1489 C CA  . CYS A 201 ? 1.2150 0.7456 0.6360 -0.2505 -0.0286 -0.0535 337 CYS A CA  
1490 C C   . CYS A 201 ? 1.2372 0.8004 0.6926 -0.2311 -0.0152 -0.0596 337 CYS A C   
1491 O O   . CYS A 201 ? 1.3459 0.9060 0.7985 -0.2326 -0.0235 -0.0531 337 CYS A O   
1492 C CB  . CYS A 201 ? 1.1609 0.6557 0.5518 -0.2733 -0.0673 -0.0331 337 CYS A CB  
1493 S SG  . CYS A 201 ? 1.2870 0.7873 0.7085 -0.2788 -0.0969 -0.0211 337 CYS A SG  
1494 N N   . GLY A 202 ? 1.1301 0.7220 0.6157 -0.2130 0.0047  -0.0719 338 GLY A N   
1495 C CA  . GLY A 202 ? 1.1060 0.7271 0.6199 -0.1934 0.0183  -0.0778 338 GLY A CA  
1496 C C   . GLY A 202 ? 1.1233 0.7276 0.6302 -0.2032 0.0052  -0.0710 338 GLY A C   
1497 O O   . GLY A 202 ? 1.1396 0.7623 0.6632 -0.1868 0.0223  -0.0781 338 GLY A O   
1498 N N   . ALA A 203 ? 1.1197 0.6906 0.6092 -0.2297 -0.0281 -0.0554 339 ALA A N   
1499 C CA  . ALA A 203 ? 1.0565 0.6122 0.5678 -0.2452 -0.0490 -0.0434 339 ALA A CA  
1500 C C   . ALA A 203 ? 0.9746 0.5683 0.5487 -0.2259 -0.0433 -0.0230 339 ALA A C   
1501 O O   . ALA A 203 ? 0.9420 0.5391 0.5220 -0.2262 -0.0523 -0.0147 339 ALA A O   
1502 C CB  . ALA A 203 ? 1.1141 0.6494 0.6292 -0.2689 -0.0883 -0.0227 339 ALA A CB  
1503 N N   . GLY A 204 ? 0.8809 0.5092 0.5086 -0.2042 -0.0247 -0.0118 340 GLY A N   
1504 C CA  . GLY A 204 ? 0.8715 0.5431 0.5719 -0.1820 -0.0142 0.0126  340 GLY A CA  
1505 C C   . GLY A 204 ? 0.9256 0.5980 0.6831 -0.1986 -0.0488 0.0447  340 GLY A C   
1506 O O   . GLY A 204 ? 0.9545 0.6023 0.7080 -0.2221 -0.0758 0.0510  340 GLY A O   
1507 N N   . LEU A 205 ? 0.9339 0.6342 0.7473 -0.1866 -0.0485 0.0641  341 LEU A N   
1508 C CA  . LEU A 205 ? 0.9253 0.6296 0.8026 -0.2007 -0.0839 0.0947  341 LEU A CA  
1509 C C   . LEU A 205 ? 0.8948 0.6455 0.8633 -0.1766 -0.0634 0.1172  341 LEU A C   
1510 O O   . LEU A 205 ? 0.8801 0.6510 0.8484 -0.1539 -0.0328 0.1095  341 LEU A O   
1511 C CB  . LEU A 205 ? 0.9315 0.6053 0.7713 -0.2205 -0.1186 0.0949  341 LEU A CB  
1512 C CG  . LEU A 205 ? 0.9573 0.5774 0.6988 -0.2477 -0.1375 0.0719  341 LEU A CG  
1513 C CD1 . LEU A 205 ? 0.9320 0.5273 0.6220 -0.2546 -0.1471 0.0638  341 LEU A CD1 
1514 C CD2 . LEU A 205 ? 0.9539 0.5454 0.6979 -0.2783 -0.1811 0.0855  341 LEU A CD2 
1515 N N   . LEU A 206 ? 0.9431 0.7094 0.9909 -0.1826 -0.0790 0.1437  342 LEU A N   
1516 C CA  . LEU A 206 ? 0.9769 0.7847 1.1206 -0.1631 -0.0602 0.1664  342 LEU A CA  
1517 C C   . LEU A 206 ? 1.0184 0.8300 1.2303 -0.1770 -0.1024 0.1921  342 LEU A C   
1518 O O   . LEU A 206 ? 1.1305 0.9310 1.3714 -0.1998 -0.1412 0.2065  342 LEU A O   
1519 C CB  . LEU A 206 ? 1.0544 0.8838 1.2502 -0.1532 -0.0326 0.1766  342 LEU A CB  
1520 C CG  . LEU A 206 ? 1.2158 1.0410 1.4641 -0.1745 -0.0600 0.1951  342 LEU A CG  
1521 C CD1 . LEU A 206 ? 1.2252 1.0750 1.5314 -0.1594 -0.0211 0.2064  342 LEU A CD1 
1522 C CD2 . LEU A 206 ? 1.3050 1.0882 1.4772 -0.2006 -0.0904 0.1798  342 LEU A CD2 
1523 N N   . PRO A 207 ? 0.9015 0.7266 1.1374 -0.1640 -0.0977 0.1973  343 PRO A N   
1524 C CA  . PRO A 207 ? 0.8721 0.7079 1.1918 -0.1709 -0.1332 0.2249  343 PRO A CA  
1525 C C   . PRO A 207 ? 0.8641 0.7464 1.2920 -0.1461 -0.0983 0.2423  343 PRO A C   
1526 O O   . PRO A 207 ? 0.8109 0.7123 1.2359 -0.1247 -0.0463 0.2320  343 PRO A O   
1527 C CB  . PRO A 207 ? 0.8684 0.6774 1.1266 -0.1752 -0.1528 0.2164  343 PRO A CB  
1528 C CG  . PRO A 207 ? 0.7904 0.6002 0.9769 -0.1556 -0.1032 0.1873  343 PRO A CG  
1529 C CD  . PRO A 207 ? 0.8041 0.6217 0.9704 -0.1498 -0.0723 0.1742  343 PRO A CD  
1530 N N   . GLU A 208 ? 0.9662 0.8642 1.4882 -0.1493 -0.1267 0.2681  344 GLU A N   
1531 C CA  . GLU A 208 ? 0.9722 0.9124 1.6036 -0.1265 -0.0924 0.2840  344 GLU A CA  
1532 C C   . GLU A 208 ? 1.0678 1.0113 1.6738 -0.1051 -0.0626 0.2729  344 GLU A C   
1533 O O   . GLU A 208 ? 1.1009 1.0186 1.6524 -0.1124 -0.0910 0.2676  344 GLU A O   
1534 C CB  . GLU A 208 ? 0.8977 0.8546 1.6473 -0.1370 -0.1350 0.3147  344 GLU A CB  
1535 N N   . PRO A 209 ? 1.1000 1.0719 1.7420 -0.0797 -0.0041 0.2691  345 PRO A N   
1536 C CA  . PRO A 209 ? 1.1161 1.0905 1.7255 -0.0587 0.0319  0.2539  345 PRO A CA  
1537 C C   . PRO A 209 ? 1.1490 1.1255 1.8135 -0.0560 0.0089  0.2685  345 PRO A C   
1538 O O   . PRO A 209 ? 1.1853 1.1559 1.8119 -0.0431 0.0293  0.2550  345 PRO A O   
1539 C CB  . PRO A 209 ? 1.0890 1.0931 1.7464 -0.0358 0.0947  0.2532  345 PRO A CB  
1540 C CG  . PRO A 209 ? 1.1103 1.1182 1.7831 -0.0455 0.0957  0.2599  345 PRO A CG  
1541 C CD  . PRO A 209 ? 1.1079 1.1072 1.8197 -0.0710 0.0330  0.2783  345 PRO A CD  
1542 N N   . ASP A 210 ? 1.0993 1.0839 1.8544 -0.0680 -0.0340 0.2958  346 ASP A N   
1543 C CA  . ASP A 210 ? 1.0316 1.0159 1.8460 -0.0663 -0.0646 0.3137  346 ASP A CA  
1544 C C   . ASP A 210 ? 1.0318 0.9717 1.7543 -0.0858 -0.1184 0.3096  346 ASP A C   
1545 O O   . ASP A 210 ? 1.0109 0.9363 1.7112 -0.0790 -0.1210 0.3074  346 ASP A O   
1546 C CB  . ASP A 210 ? 0.9642 0.9757 1.9192 -0.0711 -0.0928 0.3451  346 ASP A CB  
1547 N N   . GLN A 211 ? 1.0702 0.9849 1.7364 -0.1109 -0.1586 0.3081  347 GLN A N   
1548 C CA  . GLN A 211 ? 1.0968 0.9625 1.6685 -0.1336 -0.2097 0.3042  347 GLN A CA  
1549 C C   . GLN A 211 ? 1.0678 0.9062 1.5165 -0.1292 -0.1795 0.2729  347 GLN A C   
1550 O O   . GLN A 211 ? 1.0237 0.8743 1.4328 -0.1173 -0.1307 0.2500  347 GLN A O   
1551 C CB  . GLN A 211 ? 1.1563 1.0001 1.6930 -0.1621 -0.2521 0.3062  347 GLN A CB  
1552 C CG  . GLN A 211 ? 1.2558 1.0623 1.7782 -0.1883 -0.3268 0.3244  347 GLN A CG  
1553 C CD  . GLN A 211 ? 1.2938 1.1290 1.9548 -0.1888 -0.3650 0.3586  347 GLN A CD  
1554 O OE1 . GLN A 211 ? 1.2487 1.1322 2.0226 -0.1676 -0.3307 0.3687  347 GLN A OE1 
1555 N NE2 . GLN A 211 ? 1.3678 1.1717 2.0212 -0.2138 -0.4364 0.3761  347 GLN A NE2 
1556 N N   . ARG A 212 ? 1.0343 0.8342 1.4233 -0.1394 -0.2098 0.2724  348 ARG A N   
1557 C CA  . ARG A 212 ? 0.9328 0.7020 1.2043 -0.1399 -0.1862 0.2423  348 ARG A CA  
1558 C C   . ARG A 212 ? 0.9603 0.6785 1.1241 -0.1708 -0.2237 0.2313  348 ARG A C   
1559 O O   . ARG A 212 ? 0.9349 0.6324 1.0023 -0.1749 -0.1992 0.2014  348 ARG A O   
1560 C CB  . ARG A 212 ? 0.8891 0.6464 1.1617 -0.1293 -0.1837 0.2460  348 ARG A CB  
1561 C CG  . ARG A 212 ? 0.8711 0.6361 1.0956 -0.1100 -0.1245 0.2160  348 ARG A CG  
1562 C CD  . ARG A 212 ? 0.8953 0.6375 1.1032 -0.1049 -0.1261 0.2172  348 ARG A CD  
1563 N NE  . ARG A 212 ? 0.9852 0.6696 1.1072 -0.1315 -0.1728 0.2192  348 ARG A NE  
1564 C CZ  . ARG A 212 ? 1.0329 0.6918 1.1809 -0.1416 -0.2236 0.2479  348 ARG A CZ  
1565 N NH1 . ARG A 212 ? 1.0607 0.7513 1.3283 -0.1260 -0.2343 0.2766  348 ARG A NH1 
1566 N NH2 . ARG A 212 ? 1.0692 0.6686 1.1234 -0.1673 -0.2635 0.2480  348 ARG A NH2 
1567 N N   . LYS A 213 ? 1.0101 0.7074 1.1925 -0.1931 -0.2832 0.2547  349 LYS A N   
1568 C CA  . LYS A 213 ? 1.0456 0.6908 1.1275 -0.2251 -0.3205 0.2455  349 LYS A CA  
1569 C C   . LYS A 213 ? 1.0406 0.6995 1.1195 -0.2321 -0.3088 0.2345  349 LYS A C   
1570 O O   . LYS A 213 ? 1.0100 0.7072 1.1850 -0.2258 -0.3110 0.2518  349 LYS A O   
1571 C CB  . LYS A 213 ? 1.0645 0.6781 1.1625 -0.2477 -0.3926 0.2750  349 LYS A CB  
1572 C CG  . LYS A 213 ? 1.1741 0.7242 1.1565 -0.2836 -0.4328 0.2655  349 LYS A CG  
1573 C CD  . LYS A 213 ? 1.3240 0.8433 1.3263 -0.3057 -0.5090 0.2971  349 LYS A CD  
1574 C CE  . LYS A 213 ? 1.4016 0.8650 1.2858 -0.3385 -0.5459 0.2843  349 LYS A CE  
1575 N NZ  . LYS A 213 ? 1.4224 0.8665 1.3247 -0.3552 -0.6210 0.3129  349 LYS A NZ  
1576 N N   . VAL A 214 ? 1.0579 0.6846 1.0295 -0.2450 -0.2941 0.2053  350 VAL A N   
1577 C CA  . VAL A 214 ? 1.1038 0.7343 1.0608 -0.2538 -0.2857 0.1936  350 VAL A CA  
1578 C C   . VAL A 214 ? 1.1736 0.7424 1.0156 -0.2866 -0.3132 0.1765  350 VAL A C   
1579 O O   . VAL A 214 ? 1.1420 0.6711 0.8943 -0.2946 -0.3090 0.1590  350 VAL A O   
1580 C CB  . VAL A 214 ? 0.9953 0.6636 0.9581 -0.2270 -0.2210 0.1713  350 VAL A CB  
1581 C CG1 . VAL A 214 ? 0.7830 0.4658 0.7392 -0.2032 -0.1834 0.1601  350 VAL A CG1 
1582 C CG2 . VAL A 214 ? 0.9749 0.6168 0.8482 -0.2393 -0.2067 0.1421  350 VAL A CG2 
1583 N N   . THR A 215 ? 1.2102 0.7687 1.0563 -0.3066 -0.3395 0.1814  351 THR A N   
1584 C CA  . THR A 215 ? 1.2848 0.7933 1.0281 -0.3322 -0.3633 0.1653  351 THR A CA  
1585 C C   . THR A 215 ? 1.3438 0.8560 1.0517 -0.3310 -0.3289 0.1395  351 THR A C   
1586 O O   . THR A 215 ? 1.3040 0.8487 1.0817 -0.3232 -0.3118 0.1452  351 THR A O   
1587 C CB  . THR A 215 ? 1.3102 0.8099 1.0778 -0.3475 -0.4226 0.1908  351 THR A CB  
1588 O OG1 . THR A 215 ? 1.3034 0.8144 1.1439 -0.3442 -0.4558 0.2207  351 THR A OG1 
1589 C CG2 . THR A 215 ? 1.3769 0.8218 1.0251 -0.3642 -0.4412 0.1804  351 THR A CG2 
1590 N N   . CYS A 216 ? 1.4319 0.9109 1.0358 -0.3366 -0.3158 0.1141  352 CYS A N   
1591 C CA  . CYS A 216 ? 1.4662 0.9471 1.0365 -0.3330 -0.2823 0.0898  352 CYS A CA  
1592 C C   . CYS A 216 ? 1.5835 1.0278 1.0737 -0.3447 -0.2892 0.0824  352 CYS A C   
1593 O O   . CYS A 216 ? 1.7165 1.1285 1.1687 -0.3570 -0.3193 0.0966  352 CYS A O   
1594 C CB  . CYS A 216 ? 1.4341 0.9248 0.9787 -0.3164 -0.2312 0.0625  352 CYS A CB  
1595 S SG  . CYS A 216 ? 1.3256 0.7994 0.7819 -0.3097 -0.1908 0.0312  352 CYS A SG  
1596 N N   . GLU A 217 ? 1.4903 0.9364 0.9581 -0.3410 -0.2598 0.0629  353 GLU A N   
1597 C CA  . GLU A 217 ? 1.4738 0.8871 0.8795 -0.3517 -0.2592 0.0575  353 GLU A CA  
1598 C C   . GLU A 217 ? 1.4010 0.7878 0.7396 -0.3503 -0.2347 0.0477  353 GLU A C   
1599 O O   . GLU A 217 ? 1.3627 0.7173 0.6676 -0.3622 -0.2592 0.0629  353 GLU A O   
1600 C CB  . GLU A 217 ? 1.4000 0.8252 0.8123 -0.3471 -0.2331 0.0402  353 GLU A CB  
1601 N N   . PHE A 226 ? 1.7192 1.1136 1.0796 -0.3355 -0.2476 0.0647  362 PHE A N   
1602 C CA  . PHE A 226 ? 1.6803 1.0395 1.0196 -0.3501 -0.2906 0.0891  362 PHE A CA  
1603 C C   . PHE A 226 ? 1.4849 0.8654 0.8918 -0.3467 -0.3204 0.1065  362 PHE A C   
1604 O O   . PHE A 226 ? 1.3528 0.7744 0.8372 -0.3374 -0.3139 0.1066  362 PHE A O   
1605 C CB  . PHE A 226 ? 1.7648 1.0857 1.0316 -0.3531 -0.2669 0.0820  362 PHE A CB  
1606 C CG  . PHE A 226 ? 1.7408 1.0853 1.0122 -0.3347 -0.2189 0.0600  362 PHE A CG  
1607 C CD1 . PHE A 226 ? 1.7734 1.1258 1.0661 -0.3285 -0.2270 0.0642  362 PHE A CD1 
1608 C CD2 . PHE A 226 ? 1.7083 1.0692 0.9714 -0.3234 -0.1676 0.0357  362 PHE A CD2 
1609 C CE1 . PHE A 226 ? 1.7298 1.1032 1.0261 -0.3116 -0.1819 0.0429  362 PHE A CE1 
1610 C CE2 . PHE A 226 ? 1.6813 1.0699 0.9618 -0.3051 -0.1265 0.0170  362 PHE A CE2 
1611 C CZ  . PHE A 226 ? 1.6873 1.0811 0.9804 -0.2992 -0.1319 0.0198  362 PHE A CZ  
1612 N N   . ALA A 227 ? 1.4377 0.7879 0.8233 -0.3547 -0.3507 0.1242  363 ALA A N   
1613 C CA  . ALA A 227 ? 1.3631 0.7332 0.8248 -0.3504 -0.3769 0.1434  363 ALA A CA  
1614 C C   . ALA A 227 ? 1.3712 0.7492 0.8260 -0.3360 -0.3330 0.1241  363 ALA A C   
1615 O O   . ALA A 227 ? 1.4603 0.8050 0.8378 -0.3381 -0.3187 0.1130  363 ALA A O   
1616 C CB  . ALA A 227 ? 1.3907 0.7230 0.8372 -0.3651 -0.4347 0.1734  363 ALA A CB  
1617 N N   . PHE A 228 ? 1.2525 0.6714 0.7889 -0.3200 -0.3064 0.1239  364 PHE A N   
1618 C CA  . PHE A 228 ? 1.1907 0.6317 0.7289 -0.2954 -0.2582 0.1073  364 PHE A CA  
1619 C C   . PHE A 228 ? 1.1096 0.6123 0.7636 -0.2631 -0.2433 0.1279  364 PHE A C   
1620 O O   . PHE A 228 ? 0.9359 0.4733 0.6785 -0.2566 -0.2606 0.1518  364 PHE A O   
1621 C CB  . PHE A 228 ? 1.1661 0.6153 0.6550 -0.2885 -0.2067 0.0680  364 PHE A CB  
1622 C CG  . PHE A 228 ? 1.1345 0.6395 0.6924 -0.2676 -0.1813 0.0660  364 PHE A CG  
1623 C CD1 . PHE A 228 ? 1.1428 0.6406 0.6941 -0.2822 -0.1955 0.0650  364 PHE A CD1 
1624 C CD2 . PHE A 228 ? 1.1024 0.6621 0.7257 -0.2344 -0.1418 0.0644  364 PHE A CD2 
1625 C CE1 . PHE A 228 ? 1.1048 0.6491 0.7154 -0.2633 -0.1710 0.0643  364 PHE A CE1 
1626 C CE2 . PHE A 228 ? 1.0638 0.6682 0.7415 -0.2161 -0.1177 0.0636  364 PHE A CE2 
1627 C CZ  . PHE A 228 ? 1.0494 0.6458 0.7209 -0.2302 -0.1323 0.0642  364 PHE A CZ  
1628 N N   . CYS A 229 ? 0.9342 0.4480 0.5866 -0.2441 -0.2090 0.1170  365 CYS A N   
1629 C CA  . CYS A 229 ? 0.9050 0.4715 0.6572 -0.2134 -0.1875 0.1320  365 CYS A CA  
1630 C C   . CYS A 229 ? 0.8934 0.5101 0.6757 -0.1882 -0.1335 0.1115  365 CYS A C   
1631 O O   . CYS A 229 ? 0.8712 0.4810 0.5876 -0.1870 -0.1010 0.0790  365 CYS A O   
1632 C CB  . CYS A 229 ? 0.8969 0.4457 0.6309 -0.2065 -0.1787 0.1311  365 CYS A CB  
1633 S SG  . CYS A 229 ? 0.8658 0.4761 0.7096 -0.1679 -0.1388 0.1400  365 CYS A SG  
1634 N N   . ARG A 230 ? 0.9492 0.6149 0.8326 -0.1681 -0.1240 0.1308  366 ARG A N   
1635 C CA  . ARG A 230 ? 0.9329 0.6431 0.8469 -0.1449 -0.0765 0.1166  366 ARG A CA  
1636 C C   . ARG A 230 ? 0.9147 0.6379 0.8033 -0.1241 -0.0287 0.0911  366 ARG A C   
1637 O O   . ARG A 230 ? 0.8555 0.5860 0.6990 -0.1170 0.0032  0.0632  366 ARG A O   
1638 C CB  . ARG A 230 ? 0.9047 0.6580 0.9340 -0.1300 -0.0762 0.1455  366 ARG A CB  
1639 C CG  . ARG A 230 ? 0.9216 0.7129 0.9816 -0.1118 -0.0359 0.1376  366 ARG A CG  
1640 C CD  . ARG A 230 ? 0.8629 0.6921 1.0399 -0.0993 -0.0334 0.1670  366 ARG A CD  
1641 N NE  . ARG A 230 ? 0.8620 0.7259 1.0672 -0.0771 0.0162  0.1595  366 ARG A NE  
1642 C CZ  . ARG A 230 ? 0.8924 0.7748 1.1444 -0.0766 0.0214  0.1713  366 ARG A CZ  
1643 N NH1 . ARG A 230 ? 0.9539 0.8274 1.2363 -0.0973 -0.0207 0.1902  366 ARG A NH1 
1644 N NH2 . ARG A 230 ? 0.8957 0.8032 1.1622 -0.0562 0.0685  0.1643  366 ARG A NH2 
1645 N N   . GLU A 231 ? 0.8602 0.5852 0.7797 -0.1145 -0.0256 0.1008  367 GLU A N   
1646 C CA  . GLU A 231 ? 0.7876 0.5274 0.6963 -0.0940 0.0196  0.0791  367 GLU A CA  
1647 C C   . GLU A 231 ? 0.8735 0.5767 0.6813 -0.1064 0.0271  0.0477  367 GLU A C   
1648 O O   . GLU A 231 ? 0.8904 0.6066 0.6673 -0.0939 0.0660  0.0182  367 GLU A O   
1649 C CB  . GLU A 231 ? 0.7968 0.5466 0.7749 -0.0811 0.0199  0.1003  367 GLU A CB  
1650 C CG  . GLU A 231 ? 0.8463 0.6278 0.9345 -0.0720 0.0074  0.1341  367 GLU A CG  
1651 C CD  . GLU A 231 ? 0.9476 0.7752 1.0889 -0.0479 0.0544  0.1288  367 GLU A CD  
1652 O OE1 . GLU A 231 ? 0.9672 0.8021 1.0585 -0.0367 0.0937  0.0997  367 GLU A OE1 
1653 O OE2 . GLU A 231 ? 1.0133 0.8681 1.2462 -0.0407 0.0518  0.1537  367 GLU A OE2 
1654 N N   . CYS A 232 ? 0.8909 0.5465 0.6474 -0.1322 -0.0107 0.0539  368 CYS A N   
1655 C CA  . CYS A 232 ? 0.9582 0.5712 0.6212 -0.1473 -0.0041 0.0273  368 CYS A CA  
1656 C C   . CYS A 232 ? 0.9930 0.5830 0.5801 -0.1661 -0.0053 0.0028  368 CYS A C   
1657 O O   . CYS A 232 ? 0.9905 0.5598 0.5089 -0.1726 0.0172  -0.0292 368 CYS A O   
1658 C CB  . CYS A 232 ? 0.8308 0.3970 0.4742 -0.1648 -0.0414 0.0487  368 CYS A CB  
1659 S SG  . CYS A 232 ? 1.3833 0.8744 0.9010 -0.2012 -0.0625 0.0316  368 CYS A SG  
1660 N N   . LYS A 233 ? 0.9571 0.5510 0.5620 -0.1748 -0.0298 0.0171  369 LYS A N   
1661 C CA  . LYS A 233 ? 0.9284 0.4998 0.4701 -0.1928 -0.0328 -0.0033 369 LYS A CA  
1662 C C   . LYS A 233 ? 1.0797 0.5848 0.5279 -0.2252 -0.0552 -0.0131 369 LYS A C   
1663 O O   . LYS A 233 ? 1.1430 0.6388 0.5486 -0.2338 -0.0473 -0.0295 369 LYS A O   
1664 C CB  . LYS A 233 ? 0.8546 0.4549 0.3822 -0.1754 0.0126  -0.0373 369 LYS A CB  
1665 C CG  . LYS A 233 ? 0.8437 0.5024 0.4488 -0.1448 0.0369  -0.0294 369 LYS A CG  
1666 C CD  . LYS A 233 ? 0.8764 0.5496 0.5307 -0.1470 0.0151  -0.0041 369 LYS A CD  
1667 C CE  . LYS A 233 ? 0.9357 0.5806 0.5346 -0.1677 0.0017  -0.0177 369 LYS A CE  
1668 N NZ  . LYS A 233 ? 0.9158 0.5745 0.4833 -0.1554 0.0367  -0.0502 369 LYS A NZ  
1669 N N   . GLU A 234 ? 1.0973 0.5701 0.5321 -0.2351 -0.0779 0.0038  370 GLU A N   
1670 C CA  . GLU A 234 ? 1.1778 0.5860 0.5264 -0.2655 -0.1043 0.0036  370 GLU A CA  
1671 C C   . GLU A 234 ? 1.2570 0.6363 0.6175 -0.2865 -0.1642 0.0381  370 GLU A C   
1672 O O   . GLU A 234 ? 1.2674 0.6898 0.7173 -0.2722 -0.1795 0.0631  370 GLU A O   
1673 C CB  . GLU A 234 ? 1.2619 0.6460 0.5764 -0.2643 -0.0915 0.0010  370 GLU A CB  
1674 N N   . ALA A 235 ? 1.2558 0.5970 0.5519 -0.3014 -0.1857 0.0480  371 ALA A N   
1675 C CA  . ALA A 235 ? 1.3028 0.6157 0.5993 -0.3204 -0.2467 0.0795  371 ALA A CA  
1676 C C   . ALA A 235 ? 1.3172 0.6374 0.7004 -0.3167 -0.2808 0.1112  371 ALA A C   
1677 O O   . ALA A 235 ? 1.2850 0.6113 0.6870 -0.3012 -0.2617 0.1131  371 ALA A O   
1678 C CB  . ALA A 235 ? 1.3346 0.5911 0.5448 -0.3358 -0.2569 0.0893  371 ALA A CB  
1679 N N   . TYR A 236 ? 1.2858 0.6244 0.7384 -0.3197 -0.3215 0.1400  372 TYR A N   
1680 C CA  . TYR A 236 ? 1.2741 0.6529 0.8407 -0.2992 -0.3424 0.1749  372 TYR A CA  
1681 C C   . TYR A 236 ? 1.3288 0.6663 0.8722 -0.3034 -0.3686 0.1934  372 TYR A C   
1682 O O   . TYR A 236 ? 1.4053 0.6909 0.8584 -0.3258 -0.3976 0.1896  372 TYR A O   
1683 C CB  . TYR A 236 ? 1.2668 0.6624 0.9030 -0.3078 -0.3907 0.2031  372 TYR A CB  
1684 C CG  . TYR A 236 ? 1.2742 0.7144 1.0399 -0.2865 -0.4104 0.2381  372 TYR A CG  
1685 C CD1 . TYR A 236 ? 1.2163 0.7243 1.0809 -0.2532 -0.3642 0.2368  372 TYR A CD1 
1686 C CD2 . TYR A 236 ? 1.3610 0.7737 1.1501 -0.2996 -0.4746 0.2719  372 TYR A CD2 
1687 C CE1 . TYR A 236 ? 1.2223 0.7699 1.2089 -0.2339 -0.3767 0.2667  372 TYR A CE1 
1688 C CE2 . TYR A 236 ? 1.3537 0.8091 1.2713 -0.2791 -0.4916 0.3032  372 TYR A CE2 
1689 C CZ  . TYR A 236 ? 1.3068 0.8301 1.3246 -0.2463 -0.4399 0.2997  372 TYR A CZ  
1690 O OH  . TYR A 236 ? 1.3271 0.8924 1.4768 -0.2259 -0.4512 0.3288  372 TYR A OH  
1691 N N   . HIS A 237 ? 1.2738 0.6507 0.9026 -0.2751 -0.3516 0.2068  373 HIS A N   
1692 C CA  . HIS A 237 ? 1.2673 0.6089 0.8860 -0.2745 -0.3723 0.2254  373 HIS A CA  
1693 C C   . HIS A 237 ? 1.2769 0.6574 1.0270 -0.2552 -0.4025 0.2642  373 HIS A C   
1694 O O   . HIS A 237 ? 1.1214 0.5661 0.9768 -0.2355 -0.3864 0.2698  373 HIS A O   
1695 C CB  . HIS A 237 ? 1.2412 0.5833 0.8250 -0.2591 -0.3144 0.1985  373 HIS A CB  
1696 C CG  . HIS A 237 ? 1.1463 0.5618 0.8124 -0.2266 -0.2582 0.1830  373 HIS A CG  
1697 N ND1 . HIS A 237 ? 1.1163 0.5791 0.8961 -0.1987 -0.2491 0.2031  373 HIS A ND1 
1698 C CD2 . HIS A 237 ? 1.0855 0.5326 0.7352 -0.2182 -0.2093 0.1498  373 HIS A CD2 
1699 C CE1 . HIS A 237 ? 1.0863 0.6035 0.9087 -0.1757 -0.1956 0.1823  373 HIS A CE1 
1700 N NE2 . HIS A 237 ? 1.0958 0.6049 0.8407 -0.1865 -0.1730 0.1508  373 HIS A NE2 
1701 N N   . GLU A 238 ? 1.4460 0.7990 1.1941 -0.2576 -0.4397 0.2843  374 GLU A N   
1702 C CA  . GLU A 238 ? 1.5144 0.9002 1.3822 -0.2449 -0.4820 0.3203  374 GLU A CA  
1703 C C   . GLU A 238 ? 1.4731 0.9053 1.4592 -0.2104 -0.4483 0.3340  374 GLU A C   
1704 O O   . GLU A 238 ? 1.5204 0.9957 1.6296 -0.1963 -0.4715 0.3600  374 GLU A O   
1705 C CB  . GLU A 238 ? 1.5886 0.9290 1.4083 -0.2623 -0.5379 0.3336  374 GLU A CB  
1706 N N   . GLY A 239 ? 1.3684 0.7972 1.3217 -0.1967 -0.3911 0.3124  375 GLY A N   
1707 C CA  . GLY A 239 ? 1.3225 0.7940 1.3762 -0.1642 -0.3556 0.3187  375 GLY A CA  
1708 C C   . GLY A 239 ? 1.2425 0.7630 1.3106 -0.1424 -0.2792 0.2849  375 GLY A C   
1709 O O   . GLY A 239 ? 1.2411 0.8187 1.3908 -0.1275 -0.2566 0.2838  375 GLY A O   
1710 N N   . GLU A 240 ? 1.1454 0.6413 1.1333 -0.1412 -0.2396 0.2573  376 GLU A N   
1711 C CA  . GLU A 240 ? 1.0558 0.5938 1.0504 -0.1210 -0.1700 0.2239  376 GLU A CA  
1712 C C   . GLU A 240 ? 1.0320 0.5425 0.9027 -0.1369 -0.1428 0.1846  376 GLU A C   
1713 O O   . GLU A 240 ? 1.0796 0.5298 0.8539 -0.1600 -0.1637 0.1802  376 GLU A O   
1714 C CB  . GLU A 240 ? 1.0574 0.6067 1.1045 -0.0970 -0.1372 0.2253  376 GLU A CB  
1715 C CG  . GLU A 240 ? 1.0782 0.6947 1.2310 -0.0674 -0.0910 0.2215  376 GLU A CG  
1716 C CD  . GLU A 240 ? 1.2310 0.8573 1.4690 -0.0452 -0.0773 0.2376  376 GLU A CD  
1717 O OE1 . GLU A 240 ? 1.2490 0.8685 1.4573 -0.0351 -0.0345 0.2153  376 GLU A OE1 
1718 O OE2 . GLU A 240 ? 1.3195 0.9605 1.6581 -0.0379 -0.1093 0.2721  376 GLU A OE2 
1719 N N   . CYS A 241 ? 0.8885 0.4414 0.7628 -0.1247 -0.0959 0.1563  377 CYS A N   
1720 C CA  . CYS A 241 ? 0.8871 0.4227 0.6599 -0.1364 -0.0670 0.1170  377 CYS A CA  
1721 C C   . CYS A 241 ? 0.9045 0.4117 0.6236 -0.1349 -0.0369 0.0958  377 CYS A C   
1722 O O   . CYS A 241 ? 0.9103 0.4166 0.6757 -0.1218 -0.0338 0.1108  377 CYS A O   
1723 C CB  . CYS A 241 ? 0.8218 0.4120 0.6222 -0.1197 -0.0261 0.0948  377 CYS A CB  
1724 S SG  . CYS A 241 ? 0.7980 0.4250 0.6718 -0.1193 -0.0533 0.1195  377 CYS A SG  
1725 N N   . SER A 242 ? 0.9144 0.3976 0.5400 -0.1489 -0.0144 0.0606  378 SER A N   
1726 C CA  . SER A 242 ? 0.9314 0.3877 0.5035 -0.1501 0.0177  0.0360  378 SER A CA  
1727 C C   . SER A 242 ? 0.8871 0.3874 0.5277 -0.1206 0.0599  0.0280  378 SER A C   
1728 O O   . SER A 242 ? 0.8249 0.3797 0.5185 -0.1009 0.0854  0.0192  378 SER A O   
1729 C CB  . SER A 242 ? 0.9431 0.3830 0.4252 -0.1653 0.0443  -0.0057 378 SER A CB  
1730 O OG  . SER A 242 ? 1.0950 0.4681 0.4871 -0.1969 0.0160  -0.0041 378 SER A OG  
1731 N N   . ALA A 243 ? 0.9101 0.3825 0.5445 -0.1187 0.0681  0.0306  379 ALA A N   
1732 C CA  . ALA A 243 ? 0.8958 0.4021 0.5950 -0.0924 0.1064  0.0251  379 ALA A CA  
1733 C C   . ALA A 243 ? 0.9007 0.4468 0.5887 -0.0800 0.1578  -0.0167 379 ALA A C   
1734 O O   . ALA A 243 ? 0.8976 0.4864 0.6486 -0.0561 0.1887  -0.0211 379 ALA A O   
1735 C CB  . ALA A 243 ? 0.9205 0.3809 0.5985 -0.0963 0.1080  0.0303  379 ALA A CB  
1736 N N   . VAL A 244 ? 0.8973 0.4277 0.5052 -0.0968 0.1665  -0.0475 380 VAL A N   
1737 C CA  . VAL A 244 ? 0.8639 0.4303 0.4590 -0.0861 0.2096  -0.0879 380 VAL A CA  
1738 C C   . VAL A 244 ? 0.8616 0.4804 0.5027 -0.0706 0.2126  -0.0854 380 VAL A C   
1739 O O   . VAL A 244 ? 0.8652 0.5375 0.5397 -0.0540 0.2322  -0.1013 380 VAL A O   
1740 C CB  . VAL A 244 ? 0.8586 0.4301 0.4134 -0.1040 0.1997  -0.1031 380 VAL A CB  
1741 C CG1 . VAL A 244 ? 0.8199 0.3519 0.3429 -0.1168 0.2021  -0.1027 380 VAL A CG1 
1742 C CG2 . VAL A 244 ? 0.8053 0.3499 0.3129 -0.1239 0.1720  -0.0972 380 VAL A CG2 
1743 N N   . PHE A 245 ? 0.8833 0.5025 0.5507 -0.0760 0.1756  -0.0541 381 PHE A N   
1744 C CA  . PHE A 245 ? 0.9192 0.5815 0.6261 -0.0646 0.1762  -0.0492 381 PHE A CA  
1745 C C   . PHE A 245 ? 1.1125 0.8132 0.9163 -0.0419 0.1820  -0.0225 381 PHE A C   
1746 O O   . PHE A 245 ? 1.2058 0.9320 1.0502 -0.0372 0.1714  -0.0065 381 PHE A O   
1747 C CB  . PHE A 245 ? 0.8790 0.5205 0.5578 -0.0856 0.1357  -0.0347 381 PHE A CB  
1748 C CG  . PHE A 245 ? 0.8889 0.4982 0.4762 -0.1068 0.1367  -0.0645 381 PHE A CG  
1749 C CD1 . PHE A 245 ? 0.8340 0.4711 0.4098 -0.0981 0.1674  -0.0970 381 PHE A CD1 
1750 C CD2 . PHE A 245 ? 0.9176 0.4822 0.4548 -0.1337 0.0993  -0.0535 381 PHE A CD2 
1751 C CE1 . PHE A 245 ? 0.8214 0.4803 0.4036 -0.1061 0.1476  -0.0985 381 PHE A CE1 
1752 C CE2 . PHE A 245 ? 0.9857 0.5198 0.4421 -0.1537 0.1047  -0.0818 381 PHE A CE2 
1753 C CZ  . PHE A 245 ? 0.8359 0.4460 0.3625 -0.1315 0.1257  -0.0913 381 PHE A CZ  
1754 N N   . GLU A 246 ? 1.2760 0.9791 1.1186 -0.0285 0.2011  -0.0184 382 GLU A N   
1755 C CA  . GLU A 246 ? 1.4419 1.1803 1.3796 -0.0063 0.2144  0.0033  382 GLU A CA  
1756 C C   . GLU A 246 ? 1.5120 1.2944 1.4676 0.0104  0.2470  -0.0115 382 GLU A C   
1757 O O   . GLU A 246 ? 1.4711 1.2759 1.4731 0.0144  0.2366  0.0085  382 GLU A O   
1758 C CB  . GLU A 246 ? 1.5096 1.2415 1.4760 0.0060  0.2391  0.0014  382 GLU A CB  
1759 C CG  . GLU A 246 ? 1.5673 1.2709 1.4556 -0.0027 0.2583  -0.0324 382 GLU A CG  
1760 C CD  . GLU A 246 ? 1.5537 1.2857 1.4329 0.0134  0.3085  -0.0682 382 GLU A CD  
1761 O OE1 . GLU A 246 ? 1.5675 1.3272 1.5096 0.0334  0.3335  -0.0622 382 GLU A OE1 
1762 O OE2 . GLU A 246 ? 1.5168 1.2613 1.3471 0.0003  0.2890  -0.0885 382 GLU A OE2 
1768 N N   . TYR A 255 ? 0.7745 1.0415 1.3659 -0.0758 0.0214  -0.1317 391 TYR A N   
1769 C CA  . TYR A 255 ? 0.8456 1.0577 1.3817 -0.0774 0.0202  -0.1356 391 TYR A CA  
1770 C C   . TYR A 255 ? 0.8775 1.0768 1.4007 -0.0549 0.0329  -0.1491 391 TYR A C   
1771 O O   . TYR A 255 ? 0.8885 1.0494 1.3696 -0.0554 0.0319  -0.1537 391 TYR A O   
1772 C CB  . TYR A 255 ? 0.8696 1.0684 1.3698 -0.1041 0.0270  -0.1282 391 TYR A CB  
1773 N N   . ARG A 256 ? 0.8258 1.0537 1.3815 -0.0344 0.0424  -0.1556 392 ARG A N   
1774 C CA  . ARG A 256 ? 0.7815 0.9882 1.3175 -0.0130 0.0529  -0.1685 392 ARG A CA  
1775 C C   . ARG A 256 ? 0.7669 0.9337 1.2880 -0.0040 0.0344  -0.1740 392 ARG A C   
1776 O O   . ARG A 256 ? 0.7937 0.9617 1.3344 -0.0017 0.0200  -0.1704 392 ARG A O   
1777 C CB  . ARG A 256 ? 0.7730 1.0180 1.3419 0.0095  0.0703  -0.1737 392 ARG A CB  
1778 N N   . VAL A 257 ? 0.6968 0.8273 1.1811 -0.0013 0.0346  -0.1826 393 VAL A N   
1779 C CA  . VAL A 257 ? 0.5850 0.6831 1.0571 0.0011  0.0192  -0.1879 393 VAL A CA  
1780 C C   . VAL A 257 ? 0.5512 0.6265 1.0083 0.0173  0.0241  -0.1996 393 VAL A C   
1781 O O   . VAL A 257 ? 0.5859 0.6481 1.0167 0.0229  0.0354  -0.2065 393 VAL A O   
1782 C CB  . VAL A 257 ? 0.6208 0.6962 1.0650 -0.0114 0.0089  -0.1883 393 VAL A CB  
1783 C CG1 . VAL A 257 ? 0.5942 0.6489 1.0356 -0.0112 -0.0043 -0.1941 393 VAL A CG1 
1784 C CG2 . VAL A 257 ? 0.6321 0.7161 1.0787 -0.0248 0.0024  -0.1769 393 VAL A CG2 
1785 N N   . ASP A 258 ? 0.5748 0.6365 1.0395 0.0239  0.0155  -0.2016 394 ASP A N   
1786 C CA  . ASP A 258 ? 0.6540 0.6798 1.0935 0.0362  0.0169  -0.2123 394 ASP A CA  
1787 C C   . ASP A 258 ? 0.6830 0.6778 1.0876 0.0241  0.0124  -0.2199 394 ASP A C   
1788 O O   . ASP A 258 ? 0.7491 0.7404 1.1564 0.0079  0.0001  -0.2187 394 ASP A O   
1789 C CB  . ASP A 258 ? 0.6711 0.6775 1.1153 0.0382  0.0059  -0.2116 394 ASP A CB  
1790 C CG  . ASP A 258 ? 0.7504 0.7129 1.1622 0.0534  0.0075  -0.2215 394 ASP A CG  
1791 O OD1 . ASP A 258 ? 0.7566 0.6814 1.1342 0.0428  0.0048  -0.2292 394 ASP A OD1 
1792 O OD2 . ASP A 258 ? 0.7524 0.7159 1.1708 0.0759  0.0094  -0.2217 394 ASP A OD2 
1793 N N   . GLU A 259 ? 0.6846 0.6579 1.0565 0.0329  0.0219  -0.2279 395 GLU A N   
1794 C CA  . GLU A 259 ? 0.7343 0.6761 1.0684 0.0207  0.0145  -0.2351 395 GLU A CA  
1795 C C   . GLU A 259 ? 0.7798 0.6945 1.1042 0.0059  -0.0018 -0.2402 395 GLU A C   
1796 O O   . GLU A 259 ? 0.8009 0.7143 1.1208 -0.0113 -0.0155 -0.2421 395 GLU A O   
1797 C CB  . GLU A 259 ? 0.7904 0.7004 1.0799 0.0352  0.0284  -0.2434 395 GLU A CB  
1798 N N   . ARG A 260 ? 0.8029 0.6964 1.1236 0.0120  -0.0009 -0.2424 396 ARG A N   
1799 C CA  . ARG A 260 ? 0.7700 0.6343 1.0773 -0.0065 -0.0126 -0.2470 396 ARG A CA  
1800 C C   . ARG A 260 ? 0.6547 0.5533 1.0030 -0.0229 -0.0198 -0.2399 396 ARG A C   
1801 O O   . ARG A 260 ? 0.6095 0.5140 0.9633 -0.0433 -0.0297 -0.2424 396 ARG A O   
1802 C CB  . ARG A 260 ? 0.7201 0.5395 0.9993 0.0049  -0.0089 -0.2511 396 ARG A CB  
1803 N N   . ALA A 261 ? 0.5520 0.4739 0.9288 -0.0130 -0.0151 -0.2313 397 ALA A N   
1804 C CA  . ALA A 261 ? 0.5843 0.5295 0.9910 -0.0242 -0.0193 -0.2242 397 ALA A CA  
1805 C C   . ALA A 261 ? 0.5670 0.5444 0.9915 -0.0329 -0.0256 -0.2218 397 ALA A C   
1806 O O   . ALA A 261 ? 0.6347 0.6262 1.0766 -0.0443 -0.0301 -0.2205 397 ALA A O   
1807 C CB  . ALA A 261 ? 0.5467 0.5040 0.9717 -0.0113 -0.0162 -0.2150 397 ALA A CB  
1808 N N   . ALA A 262 ? 0.5135 0.5003 0.9304 -0.0258 -0.0249 -0.2215 398 ALA A N   
1809 C CA  . ALA A 262 ? 0.5046 0.5113 0.9269 -0.0306 -0.0335 -0.2193 398 ALA A CA  
1810 C C   . ALA A 262 ? 0.5154 0.5171 0.9300 -0.0428 -0.0466 -0.2279 398 ALA A C   
1811 O O   . ALA A 262 ? 0.4869 0.5109 0.9184 -0.0472 -0.0577 -0.2270 398 ALA A O   
1812 C CB  . ALA A 262 ? 0.5025 0.5107 0.9084 -0.0225 -0.0277 -0.2166 398 ALA A CB  
1813 N N   . GLU A 263 ? 0.5662 0.5378 0.9537 -0.0475 -0.0469 -0.2365 399 GLU A N   
1814 C CA  . GLU A 263 ? 0.5914 0.5562 0.9704 -0.0644 -0.0625 -0.2448 399 GLU A CA  
1815 C C   . GLU A 263 ? 0.5566 0.5406 0.9677 -0.0810 -0.0647 -0.2451 399 GLU A C   
1816 O O   . GLU A 263 ? 0.5747 0.5872 1.0093 -0.0937 -0.0780 -0.2478 399 GLU A O   
1817 C CB  . GLU A 263 ? 0.6029 0.5179 0.9329 -0.0669 -0.0623 -0.2535 399 GLU A CB  
1818 N N   . GLN A 264 ? 0.5688 0.5384 0.9808 -0.0801 -0.0513 -0.2423 400 GLN A N   
1819 C CA  . GLN A 264 ? 0.5782 0.5574 1.0119 -0.0971 -0.0477 -0.2420 400 GLN A CA  
1820 C C   . GLN A 264 ? 0.5256 0.5523 1.0024 -0.0935 -0.0467 -0.2356 400 GLN A C   
1821 O O   . GLN A 264 ? 0.4766 0.5271 0.9799 -0.1086 -0.0448 -0.2369 400 GLN A O   
1822 C CB  . GLN A 264 ? 0.5909 0.5310 1.0029 -0.0931 -0.0347 -0.2399 400 GLN A CB  
1823 C CG  . GLN A 264 ? 0.6728 0.5570 1.0358 -0.0974 -0.0354 -0.2476 400 GLN A CG  
1824 C CD  . GLN A 264 ? 0.7759 0.6490 1.1280 -0.1288 -0.0441 -0.2555 400 GLN A CD  
1825 O OE1 . GLN A 264 ? 0.7920 0.6745 1.1605 -0.1515 -0.0402 -0.2553 400 GLN A OE1 
1826 N NE2 . GLN A 264 ? 0.8416 0.6942 1.1644 -0.1323 -0.0556 -0.2624 400 GLN A NE2 
1827 N N   . ALA A 265 ? 0.4560 0.4942 0.9367 -0.0738 -0.0467 -0.2286 401 ALA A N   
1828 C CA  . ALA A 265 ? 0.4280 0.4952 0.9349 -0.0657 -0.0449 -0.2215 401 ALA A CA  
1829 C C   . ALA A 265 ? 0.4592 0.5593 0.9827 -0.0608 -0.0593 -0.2232 401 ALA A C   
1830 O O   . ALA A 265 ? 0.4933 0.6040 1.0209 -0.0462 -0.0609 -0.2168 401 ALA A O   
1831 C CB  . ALA A 265 ? 0.4135 0.4675 0.9091 -0.0505 -0.0388 -0.2121 401 ALA A CB  
1832 N N   . ARG A 266 ? 0.5442 0.6550 1.0720 -0.0725 -0.0725 -0.2317 402 ARG A N   
1833 C CA  . ARG A 266 ? 0.5773 0.7200 1.1217 -0.0662 -0.0916 -0.2344 402 ARG A CA  
1834 C C   . ARG A 266 ? 0.5420 0.7351 1.1365 -0.0710 -0.0912 -0.2364 402 ARG A C   
1835 O O   . ARG A 266 ? 0.5625 0.7635 1.1747 -0.0903 -0.0790 -0.2389 402 ARG A O   
1836 C CB  . ARG A 266 ? 0.6208 0.7493 1.1429 -0.0761 -0.1103 -0.2426 402 ARG A CB  
1837 N N   . TRP A 267 ? 0.5100 0.7356 1.1246 -0.0527 -0.1032 -0.2354 403 TRP A N   
1838 C CA  . TRP A 267 ? 0.5553 0.8371 1.2226 -0.0502 -0.0999 -0.2373 403 TRP A CA  
1839 C C   . TRP A 267 ? 0.6410 0.9722 1.3461 -0.0602 -0.1237 -0.2467 403 TRP A C   
1840 O O   . TRP A 267 ? 0.7065 1.0662 1.4263 -0.0391 -0.1446 -0.2484 403 TRP A O   
1841 C CB  . TRP A 267 ? 0.5235 0.8089 1.1881 -0.0184 -0.0976 -0.2305 403 TRP A CB  
1842 C CG  . TRP A 267 ? 0.5694 0.9111 1.2848 -0.0069 -0.0898 -0.2322 403 TRP A CG  
1843 C CD1 . TRP A 267 ? 0.6338 1.0281 1.3864 0.0112  -0.1084 -0.2374 403 TRP A CD1 
1844 C CD2 . TRP A 267 ? 0.5509 0.9012 1.2834 -0.0096 -0.0604 -0.2289 403 TRP A CD2 
1845 N NE1 . TRP A 267 ? 0.6119 1.0547 1.4101 0.0212  -0.0896 -0.2378 403 TRP A NE1 
1846 C CE2 . TRP A 267 ? 0.5838 0.9969 1.3669 0.0074  -0.0585 -0.2326 403 TRP A CE2 
1847 C CE3 . TRP A 267 ? 0.5042 0.8129 1.2113 -0.0232 -0.0361 -0.2236 403 TRP A CE3 
1848 C CZ2 . TRP A 267 ? 0.5623 0.9967 1.3691 0.0098  -0.0284 -0.2309 403 TRP A CZ2 
1849 C CZ3 . TRP A 267 ? 0.5371 0.8591 1.2614 -0.0222 -0.0099 -0.2216 403 TRP A CZ3 
1850 C CH2 . TRP A 267 ? 0.5692 0.9529 1.3418 -0.0065 -0.0039 -0.2253 403 TRP A CH2 
1851 N N   . GLU A 268 ? 0.7215 1.0588 1.4383 -0.0928 -0.1233 -0.2528 404 GLU A N   
1852 C CA  . GLU A 268 ? 0.8406 1.2259 1.5949 -0.1101 -0.1484 -0.2616 404 GLU A CA  
1853 C C   . GLU A 268 ? 0.9173 1.3266 1.7022 -0.1503 -0.1363 -0.2662 404 GLU A C   
1854 O O   . GLU A 268 ? 0.9421 1.3264 1.7151 -0.1624 -0.1073 -0.2627 404 GLU A O   
1855 C CB  . GLU A 268 ? 0.8897 1.2333 1.5969 -0.1124 -0.1779 -0.2657 404 GLU A CB  
1856 C CG  . GLU A 268 ? 0.9442 1.2069 1.5801 -0.1116 -0.1661 -0.2622 404 GLU A CG  
1857 C CD  . GLU A 268 ? 1.0252 1.2540 1.6415 -0.1416 -0.1506 -0.2646 404 GLU A CD  
1858 O OE1 . GLU A 268 ? 1.0280 1.2680 1.6658 -0.1511 -0.1267 -0.2619 404 GLU A OE1 
1859 O OE2 . GLU A 268 ? 1.0945 1.2764 1.6647 -0.1545 -0.1622 -0.2694 404 GLU A OE2 
1865 N N   . THR A 278 ? 1.3086 1.2463 0.8917 -0.2947 0.1127  -0.0096 414 THR A N   
1866 C CA  . THR A 278 ? 1.0985 1.0238 0.7350 -0.2590 0.1249  -0.0234 414 THR A CA  
1867 C C   . THR A 278 ? 0.9352 0.8551 0.6009 -0.2372 0.0943  -0.0001 414 THR A C   
1868 O O   . THR A 278 ? 0.8761 0.8000 0.5535 -0.2285 0.0704  0.0289  414 THR A O   
1869 C CB  . THR A 278 ? 1.0421 0.9680 0.7184 -0.2350 0.1441  -0.0277 414 THR A CB  
1870 O OG1 . THR A 278 ? 1.1085 1.0467 0.7551 -0.2565 0.1541  -0.0258 414 THR A OG1 
1871 C CG2 . THR A 278 ? 1.0123 0.9294 0.7219 -0.2202 0.1755  -0.0608 414 THR A CG2 
1872 N N   . THR A 279 ? 0.8535 0.7642 0.5328 -0.2293 0.0963  -0.0143 415 THR A N   
1873 C CA  . THR A 279 ? 0.7720 0.6796 0.4796 -0.2107 0.0710  0.0036  415 THR A CA  
1874 C C   . THR A 279 ? 0.6429 0.5393 0.3959 -0.1825 0.0842  -0.0104 415 THR A C   
1875 O O   . THR A 279 ? 0.6289 0.5178 0.3914 -0.1792 0.1110  -0.0346 415 THR A O   
1876 C CB  . THR A 279 ? 0.8277 0.7379 0.5058 -0.2329 0.0524  0.0067  415 THR A CB  
1877 O OG1 . THR A 279 ? 0.8760 0.7767 0.5440 -0.2414 0.0736  -0.0241 415 THR A OG1 
1878 C CG2 . THR A 279 ? 0.8616 0.7839 0.4899 -0.2669 0.0381  0.0217  415 THR A CG2 
1879 N N   . LYS A 280 ? 0.5816 0.4775 0.3649 -0.1636 0.0649  0.0054  416 LYS A N   
1880 C CA  . LYS A 280 ? 0.5903 0.4769 0.4116 -0.1419 0.0724  -0.0037 416 LYS A CA  
1881 C C   . LYS A 280 ? 0.5726 0.4623 0.4064 -0.1369 0.0488  0.0096  416 LYS A C   
1882 O O   . LYS A 280 ? 0.5294 0.4291 0.3641 -0.1376 0.0273  0.0303  416 LYS A O   
1883 C CB  . LYS A 280 ? 0.5536 0.4402 0.4105 -0.1190 0.0810  0.0013  416 LYS A CB  
1884 C CG  . LYS A 280 ? 0.5693 0.4469 0.4639 -0.1000 0.0887  -0.0059 416 LYS A CG  
1885 C CD  . LYS A 280 ? 0.5447 0.4253 0.4715 -0.0816 0.0947  0.0017  416 LYS A CD  
1886 C CE  . LYS A 280 ? 0.5552 0.4361 0.4810 -0.0844 0.1167  -0.0102 416 LYS A CE  
1887 N NZ  . LYS A 280 ? 0.5306 0.4160 0.4915 -0.0668 0.1208  -0.0014 416 LYS A NZ  
1888 N N   . PRO A 281 ? 0.5329 0.4142 0.3792 -0.1330 0.0529  -0.0024 417 PRO A N   
1889 C CA  . PRO A 281 ? 0.5057 0.3931 0.3648 -0.1301 0.0317  0.0092  417 PRO A CA  
1890 C C   . PRO A 281 ? 0.4440 0.3380 0.3402 -0.1087 0.0231  0.0242  417 PRO A C   
1891 O O   . PRO A 281 ? 0.4461 0.3358 0.3629 -0.0941 0.0353  0.0221  417 PRO A O   
1892 C CB  . PRO A 281 ? 0.5556 0.4310 0.4193 -0.1319 0.0412  -0.0086 417 PRO A CB  
1893 C CG  . PRO A 281 ? 0.5839 0.4454 0.4532 -0.1273 0.0672  -0.0268 417 PRO A CG  
1894 C CD  . PRO A 281 ? 0.5364 0.4032 0.3829 -0.1359 0.0752  -0.0273 417 PRO A CD  
1895 N N   . CYS A 282 ? 0.4839 0.3897 0.3903 -0.1085 0.0022  0.0390  418 CYS A N   
1896 C CA  . CYS A 282 ? 0.4508 0.3641 0.3935 -0.0913 -0.0045 0.0489  418 CYS A CA  
1897 C C   . CYS A 282 ? 0.3700 0.2780 0.3325 -0.0814 0.0064  0.0390  418 CYS A C   
1898 O O   . CYS A 282 ? 0.4176 0.3216 0.3761 -0.0878 0.0070  0.0305  418 CYS A O   
1899 C CB  . CYS A 282 ? 0.4582 0.3850 0.4149 -0.0944 -0.0268 0.0612  418 CYS A CB  
1900 S SG  . CYS A 282 ? 0.3927 0.3305 0.3972 -0.0764 -0.0310 0.0664  418 CYS A SG  
1901 N N   . PRO A 283 ? 0.3714 0.2795 0.3545 -0.0680 0.0140  0.0414  419 PRO A N   
1902 C CA  . PRO A 283 ? 0.4079 0.3127 0.4093 -0.0616 0.0213  0.0365  419 PRO A CA  
1903 C C   . PRO A 283 ? 0.3765 0.2907 0.3913 -0.0642 0.0114  0.0369  419 PRO A C   
1904 O O   . PRO A 283 ? 0.3532 0.2631 0.3745 -0.0655 0.0156  0.0321  419 PRO A O   
1905 C CB  . PRO A 283 ? 0.3889 0.2987 0.4082 -0.0508 0.0251  0.0436  419 PRO A CB  
1906 C CG  . PRO A 283 ? 0.3432 0.2533 0.3509 -0.0504 0.0253  0.0486  419 PRO A CG  
1907 C CD  . PRO A 283 ? 0.3371 0.2495 0.3268 -0.0608 0.0139  0.0506  419 PRO A CD  
1908 N N   . ARG A 284 ? 0.4190 0.3464 0.4419 -0.0654 -0.0017 0.0430  420 ARG A N   
1909 C CA  . ARG A 284 ? 0.4012 0.3412 0.4435 -0.0675 -0.0093 0.0418  420 ARG A CA  
1910 C C   . ARG A 284 ? 0.4292 0.3708 0.4598 -0.0794 -0.0192 0.0396  420 ARG A C   
1911 O O   . ARG A 284 ? 0.3628 0.3054 0.3970 -0.0847 -0.0183 0.0334  420 ARG A O   
1912 C CB  . ARG A 284 ? 0.3752 0.3313 0.4468 -0.0604 -0.0160 0.0474  420 ARG A CB  
1913 C CG  . ARG A 284 ? 0.3677 0.3399 0.4658 -0.0622 -0.0185 0.0423  420 ARG A CG  
1914 C CD  . ARG A 284 ? 0.3801 0.3664 0.5116 -0.0547 -0.0175 0.0417  420 ARG A CD  
1915 N NE  . ARG A 284 ? 0.3998 0.3889 0.5458 -0.0499 -0.0297 0.0509  420 ARG A NE  
1916 C CZ  . ARG A 284 ? 0.4055 0.4014 0.5818 -0.0421 -0.0294 0.0514  420 ARG A CZ  
1917 N NH1 . ARG A 284 ? 0.3339 0.3361 0.5249 -0.0399 -0.0158 0.0407  420 ARG A NH1 
1918 N NH2 . ARG A 284 ? 0.4080 0.4039 0.5999 -0.0385 -0.0432 0.0628  420 ARG A NH2 
1919 N N   . CYS A 285 ? 0.3857 0.3284 0.4010 -0.0862 -0.0297 0.0459  421 CYS A N   
1920 C CA  . CYS A 285 ? 0.4143 0.3611 0.4165 -0.1009 -0.0416 0.0454  421 CYS A CA  
1921 C C   . CYS A 285 ? 0.3907 0.3220 0.3517 -0.1153 -0.0351 0.0370  421 CYS A C   
1922 O O   . CYS A 285 ? 0.4302 0.3627 0.3753 -0.1306 -0.0423 0.0334  421 CYS A O   
1923 C CB  . CYS A 285 ? 0.3739 0.3372 0.3913 -0.1036 -0.0630 0.0605  421 CYS A CB  
1924 S SG  . CYS A 285 ? 0.4152 0.3733 0.4046 -0.1112 -0.0708 0.0735  421 CYS A SG  
1925 N N   . HIS A 286 ? 0.3895 0.3079 0.3350 -0.1118 -0.0207 0.0327  422 HIS A N   
1926 C CA  . HIS A 286 ? 0.4768 0.3803 0.3877 -0.1248 -0.0082 0.0195  422 HIS A CA  
1927 C C   . HIS A 286 ? 0.5338 0.4421 0.4095 -0.1454 -0.0181 0.0236  422 HIS A C   
1928 O O   . HIS A 286 ? 0.5999 0.4980 0.4435 -0.1610 -0.0064 0.0090  422 HIS A O   
1929 C CB  . HIS A 286 ? 0.5756 0.4669 0.4849 -0.1299 0.0012  0.0036  422 HIS A CB  
1930 C CG  . HIS A 286 ? 0.6294 0.5156 0.5694 -0.1141 0.0093  0.0025  422 HIS A CG  
1931 N ND1 . HIS A 286 ? 0.6542 0.5433 0.6098 -0.1152 0.0042  0.0018  422 HIS A ND1 
1932 C CD2 . HIS A 286 ? 0.5912 0.4715 0.5481 -0.0996 0.0207  0.0040  422 HIS A CD2 
1933 C CE1 . HIS A 286 ? 0.6312 0.5159 0.6091 -0.1036 0.0118  0.0034  422 HIS A CE1 
1934 N NE2 . HIS A 286 ? 0.6049 0.4844 0.5847 -0.0938 0.0210  0.0054  422 HIS A NE2 
1935 N N   . VAL A 287 ? 0.4722 0.3961 0.3548 -0.1474 -0.0396 0.0431  423 VAL A N   
1936 C CA  . VAL A 287 ? 0.5515 0.4810 0.4000 -0.1688 -0.0521 0.0529  423 VAL A CA  
1937 C C   . VAL A 287 ? 0.5868 0.5081 0.4152 -0.1690 -0.0364 0.0498  423 VAL A C   
1938 O O   . VAL A 287 ? 0.5463 0.4650 0.3991 -0.1492 -0.0282 0.0525  423 VAL A O   
1939 C CB  . VAL A 287 ? 0.6110 0.5584 0.4829 -0.1683 -0.0813 0.0790  423 VAL A CB  
1940 C CG1 . VAL A 287 ? 0.6389 0.5911 0.4798 -0.1881 -0.0956 0.0957  423 VAL A CG1 
1941 C CG2 . VAL A 287 ? 0.6241 0.5832 0.5105 -0.1749 -0.0979 0.0817  423 VAL A CG2 
1942 N N   . PRO A 288 ? 0.6234 0.5419 0.4061 -0.1935 -0.0304 0.0423  424 PRO A N   
1943 C CA  . PRO A 288 ? 0.5905 0.5046 0.3533 -0.1969 -0.0141 0.0381  424 PRO A CA  
1944 C C   . PRO A 288 ? 0.6922 0.6155 0.4662 -0.1913 -0.0313 0.0645  424 PRO A C   
1945 O O   . PRO A 288 ? 0.7139 0.6482 0.4856 -0.2023 -0.0582 0.0863  424 PRO A O   
1946 C CB  . PRO A 288 ? 0.6338 0.5486 0.3421 -0.2315 -0.0097 0.0273  424 PRO A CB  
1947 C CG  . PRO A 288 ? 0.6515 0.5640 0.3544 -0.2413 -0.0136 0.0156  424 PRO A CG  
1948 C CD  . PRO A 288 ? 0.6222 0.5423 0.3688 -0.2214 -0.0354 0.0337  424 PRO A CD  
1949 N N   . VAL A 289 ? 0.6544 0.5732 0.4435 -0.1751 -0.0172 0.0635  425 VAL A N   
1950 C CA  . VAL A 289 ? 0.6320 0.5567 0.4320 -0.1704 -0.0313 0.0867  425 VAL A CA  
1951 C C   . VAL A 289 ? 0.6769 0.6001 0.4450 -0.1836 -0.0159 0.0829  425 VAL A C   
1952 O O   . VAL A 289 ? 0.6795 0.5959 0.4454 -0.1783 0.0112  0.0614  425 VAL A O   
1953 C CB  . VAL A 289 ? 0.5292 0.4522 0.3785 -0.1404 -0.0298 0.0907  425 VAL A CB  
1954 C CG1 . VAL A 289 ? 0.5754 0.5036 0.4422 -0.1367 -0.0488 0.1153  425 VAL A CG1 
1955 C CG2 . VAL A 289 ? 0.5559 0.4808 0.4351 -0.1284 -0.0358 0.0863  425 VAL A CG2 
1956 N N   . GLU A 290 ? 0.6435 0.5737 0.3899 -0.2018 -0.0335 0.1045  426 GLU A N   
1957 C CA  . GLU A 290 ? 0.6843 0.6158 0.3975 -0.2182 -0.0201 0.1029  426 GLU A CA  
1958 C C   . GLU A 290 ? 0.6882 0.6167 0.4318 -0.1963 -0.0124 0.1089  426 GLU A C   
1959 O O   . GLU A 290 ? 0.6601 0.5882 0.4391 -0.1794 -0.0303 0.1278  426 GLU A O   
1960 C CB  . GLU A 290 ? 0.7076 0.6484 0.3812 -0.2510 -0.0438 0.1267  426 GLU A CB  
1961 N N   . LYS A 291 ? 0.6845 0.6115 0.4168 -0.1974 0.0152  0.0909  427 LYS A N   
1962 C CA  . LYS A 291 ? 0.6684 0.5946 0.4255 -0.1803 0.0243  0.0951  427 LYS A CA  
1963 C C   . LYS A 291 ? 0.6734 0.6055 0.4027 -0.2014 0.0147  0.1147  427 LYS A C   
1964 O O   . LYS A 291 ? 0.7074 0.6457 0.3919 -0.2309 0.0165  0.1123  427 LYS A O   
1965 C CB  . LYS A 291 ? 0.7086 0.6329 0.4719 -0.1725 0.0578  0.0674  427 LYS A CB  
1966 C CG  . LYS A 291 ? 0.6624 0.5877 0.4558 -0.1539 0.0689  0.0696  427 LYS A CG  
1967 C CD  . LYS A 291 ? 0.6741 0.6001 0.4740 -0.1511 0.1013  0.0427  427 LYS A CD  
1968 C CE  . LYS A 291 ? 0.6281 0.5548 0.4710 -0.1268 0.1105  0.0431  427 LYS A CE  
1969 N NZ  . LYS A 291 ? 0.7305 0.6648 0.5705 -0.1307 0.1095  0.0571  427 LYS A NZ  
1970 N N   . ASN A 292 ? 0.6013 0.5319 0.3566 -0.1883 0.0043  0.1334  428 ASN A N   
1971 C CA  . ASN A 292 ? 0.6581 0.5958 0.4010 -0.2004 -0.0058 0.1468  428 ASN A CA  
1972 C C   . ASN A 292 ? 0.6971 0.6377 0.4428 -0.1956 0.0189  0.1354  428 ASN A C   
1973 O O   . ASN A 292 ? 0.6623 0.5987 0.4418 -0.1748 0.0213  0.1399  428 ASN A O   
1974 C CB  . ASN A 292 ? 0.6615 0.5972 0.4384 -0.1885 -0.0362 0.1719  428 ASN A CB  
1975 C CG  . ASN A 292 ? 0.7395 0.6812 0.5093 -0.2000 -0.0476 0.1853  428 ASN A CG  
1976 O OD1 . ASN A 292 ? 0.7758 0.7141 0.5719 -0.1858 -0.0480 0.1913  428 ASN A OD1 
1977 N ND2 . ASN A 292 ? 0.7442 0.6951 0.4776 -0.2282 -0.0572 0.1893  428 ASN A ND2 
1978 N N   . GLY A 293 ? 0.6921 0.6413 0.4043 -0.2157 0.0374  0.1190  429 GLY A N   
1979 C CA  . GLY A 293 ? 0.6051 0.5603 0.3226 -0.2125 0.0624  0.1059  429 GLY A CA  
1980 C C   . GLY A 293 ? 0.6407 0.5905 0.3932 -0.1887 0.0831  0.0941  429 GLY A C   
1981 O O   . GLY A 293 ? 0.5999 0.5436 0.3593 -0.1821 0.0930  0.0797  429 GLY A O   
1982 N N   . GLY A 294 ? 0.5094 0.4619 0.2883 -0.1749 0.0874  0.1000  430 GLY A N   
1983 C CA  . GLY A 294 ? 0.4994 0.4492 0.3152 -0.1535 0.1038  0.0912  430 GLY A CA  
1984 C C   . GLY A 294 ? 0.5164 0.4570 0.3660 -0.1304 0.0836  0.1039  430 GLY A C   
1985 O O   . GLY A 294 ? 0.4803 0.4210 0.3650 -0.1100 0.0912  0.0974  430 GLY A O   
1986 N N   . CYS A 295 ? 0.5214 0.4555 0.3627 -0.1352 0.0581  0.1221  431 CYS A N   
1987 C CA  . CYS A 295 ? 0.4899 0.4169 0.3659 -0.1155 0.0408  0.1319  431 CYS A CA  
1988 C C   . CYS A 295 ? 0.4771 0.4017 0.3716 -0.1003 0.0453  0.1167  431 CYS A C   
1989 O O   . CYS A 295 ? 0.4552 0.3790 0.3315 -0.1082 0.0468  0.1075  431 CYS A O   
1990 C CB  . CYS A 295 ? 0.5072 0.4300 0.3803 -0.1216 0.0130  0.1515  431 CYS A CB  
1991 S SG  . CYS A 295 ? 0.5025 0.4184 0.4248 -0.0982 -0.0040 0.1585  431 CYS A SG  
1992 N N   . MET A 296 ? 0.4543 0.3780 0.3832 -0.0811 0.0465  0.1148  432 MET A N   
1993 C CA  . MET A 296 ? 0.3848 0.3070 0.3318 -0.0684 0.0506  0.1024  432 MET A CA  
1994 C C   . MET A 296 ? 0.4187 0.3375 0.3782 -0.0634 0.0323  0.1082  432 MET A C   
1995 O O   . MET A 296 ? 0.4328 0.3509 0.4024 -0.0567 0.0337  0.0990  432 MET A O   
1996 C CB  . MET A 296 ? 0.3994 0.3253 0.3744 -0.0546 0.0616  0.0979  432 MET A CB  
1997 C CG  . MET A 296 ? 0.4894 0.4211 0.4636 -0.0566 0.0814  0.0898  432 MET A CG  
1998 S SD  . MET A 296 ? 0.4641 0.3936 0.4375 -0.0566 0.0987  0.0695  432 MET A SD  
1999 C CE  . MET A 296 ? 0.7170 0.6473 0.6471 -0.0792 0.1045  0.0643  432 MET A CE  
2000 N N   . HIS A 297 ? 0.4219 0.3388 0.3846 -0.0670 0.0151  0.1236  433 HIS A N   
2001 C CA  . HIS A 297 ? 0.4118 0.3275 0.3952 -0.0619 -0.0022 0.1290  433 HIS A CA  
2002 C C   . HIS A 297 ? 0.4535 0.3699 0.4154 -0.0737 -0.0118 0.1304  433 HIS A C   
2003 O O   . HIS A 297 ? 0.4630 0.3794 0.3982 -0.0901 -0.0200 0.1413  433 HIS A O   
2004 C CB  . HIS A 297 ? 0.4072 0.3194 0.4093 -0.0614 -0.0176 0.1456  433 HIS A CB  
2005 C CG  . HIS A 297 ? 0.5203 0.4323 0.5571 -0.0533 -0.0326 0.1487  433 HIS A CG  
2006 N ND1 . HIS A 297 ? 0.5786 0.4893 0.6434 -0.0487 -0.0448 0.1560  433 HIS A ND1 
2007 C CD2 . HIS A 297 ? 0.5440 0.4606 0.5951 -0.0479 -0.0351 0.1400  433 HIS A CD2 
2008 C CE1 . HIS A 297 ? 0.5616 0.4746 0.6606 -0.0414 -0.0540 0.1544  433 HIS A CE1 
2009 N NE2 . HIS A 297 ? 0.5183 0.4350 0.6088 -0.0414 -0.0486 0.1459  433 HIS A NE2 
2010 N N   . MET A 298 ? 0.3852 0.3031 0.3563 -0.0681 -0.0111 0.1198  434 MET A N   
2011 C CA  . MET A 298 ? 0.4435 0.3630 0.3959 -0.0798 -0.0206 0.1199  434 MET A CA  
2012 C C   . MET A 298 ? 0.4414 0.3650 0.4244 -0.0746 -0.0407 0.1290  434 MET A C   
2013 O O   . MET A 298 ? 0.4107 0.3363 0.4279 -0.0599 -0.0383 0.1234  434 MET A O   
2014 C CB  . MET A 298 ? 0.4863 0.4041 0.4285 -0.0788 -0.0044 0.1002  434 MET A CB  
2015 C CG  . MET A 298 ? 0.5037 0.4180 0.4283 -0.0811 0.0180  0.0879  434 MET A CG  
2016 S SD  . MET A 298 ? 0.5024 0.4180 0.3823 -0.1052 0.0203  0.0917  434 MET A SD  
2017 C CE  . MET A 298 ? 0.6712 0.5871 0.5237 -0.1233 0.0106  0.0870  434 MET A CE  
2018 N N   . LYS A 299 ? 0.4200 0.3467 0.3925 -0.0881 -0.0604 0.1427  435 LYS A N   
2019 C CA  . LYS A 299 ? 0.4375 0.3705 0.4460 -0.0831 -0.0804 0.1518  435 LYS A CA  
2020 C C   . LYS A 299 ? 0.4268 0.3661 0.4186 -0.0957 -0.0899 0.1505  435 LYS A C   
2021 O O   . LYS A 299 ? 0.4789 0.4198 0.4382 -0.1160 -0.1023 0.1622  435 LYS A O   
2022 C CB  . LYS A 299 ? 0.4725 0.4049 0.5025 -0.0854 -0.1024 0.1761  435 LYS A CB  
2023 C CG  . LYS A 299 ? 0.6388 0.5642 0.6916 -0.0726 -0.0936 0.1761  435 LYS A CG  
2024 C CD  . LYS A 299 ? 0.7038 0.6296 0.7972 -0.0687 -0.1141 0.1933  435 LYS A CD  
2025 C CE  . LYS A 299 ? 0.7299 0.6593 0.7974 -0.0868 -0.1313 0.2111  435 LYS A CE  
2026 N NZ  . LYS A 299 ? 0.8291 0.7536 0.8477 -0.0974 -0.1157 0.2076  435 LYS A NZ  
2027 N N   . CYS A 300 ? 0.3568 0.3003 0.3682 -0.0864 -0.0840 0.1362  436 CYS A N   
2028 C CA  . CYS A 300 ? 0.4478 0.3975 0.4471 -0.0977 -0.0921 0.1332  436 CYS A CA  
2029 C C   . CYS A 300 ? 0.4689 0.4289 0.4867 -0.1062 -0.1220 0.1557  436 CYS A C   
2030 O O   . CYS A 300 ? 0.4944 0.4596 0.5614 -0.0935 -0.1332 0.1651  436 CYS A O   
2031 C CB  . CYS A 300 ? 0.3436 0.2969 0.3671 -0.0856 -0.0812 0.1160  436 CYS A CB  
2032 S SG  . CYS A 300 ? 0.4405 0.4019 0.4534 -0.0996 -0.0917 0.1120  436 CYS A SG  
2033 N N   . PRO A 301 ? 0.4983 0.4617 0.4790 -0.1293 -0.1351 0.1642  437 PRO A N   
2034 C CA  . PRO A 301 ? 0.5231 0.4982 0.5162 -0.1428 -0.1678 0.1900  437 PRO A CA  
2035 C C   . PRO A 301 ? 0.5367 0.5254 0.5630 -0.1398 -0.1794 0.1879  437 PRO A C   
2036 O O   . PRO A 301 ? 0.5617 0.5628 0.6192 -0.1445 -0.2079 0.2103  437 PRO A O   
2037 C CB  . PRO A 301 ? 0.5770 0.5509 0.5047 -0.1738 -0.1719 0.1949  437 PRO A CB  
2038 C CG  . PRO A 301 ? 0.5514 0.5165 0.4448 -0.1743 -0.1410 0.1635  437 PRO A CG  
2039 C CD  . PRO A 301 ? 0.4833 0.4395 0.4064 -0.1464 -0.1183 0.1490  437 PRO A CD  
2040 N N   . GLN A 302 ? 0.5336 0.5207 0.5557 -0.1329 -0.1588 0.1629  438 GLN A N   
2041 C CA  . GLN A 302 ? 0.5490 0.5496 0.5989 -0.1315 -0.1661 0.1578  438 GLN A CA  
2042 C C   . GLN A 302 ? 0.4701 0.4830 0.5925 -0.1112 -0.1745 0.1633  438 GLN A C   
2043 O O   . GLN A 302 ? 0.5279 0.5365 0.6754 -0.0925 -0.1559 0.1496  438 GLN A O   
2044 C CB  . GLN A 302 ? 0.6259 0.6187 0.6535 -0.1293 -0.1402 0.1303  438 GLN A CB  
2045 C CG  . GLN A 302 ? 0.7518 0.7570 0.8151 -0.1225 -0.1403 0.1208  438 GLN A CG  
2046 C CD  . GLN A 302 ? 0.8841 0.9049 0.9502 -0.1395 -0.1645 0.1326  438 GLN A CD  
2047 O OE1 . GLN A 302 ? 0.9327 0.9718 1.0502 -0.1330 -0.1801 0.1416  438 GLN A OE1 
2048 N NE2 . GLN A 302 ? 0.9635 0.9787 0.9762 -0.1626 -0.1673 0.1313  438 GLN A NE2 
2049 N N   . PRO A 303 ? 0.5356 0.5651 0.6939 -0.1165 -0.2026 0.1828  439 PRO A N   
2050 C CA  . PRO A 303 ? 0.5471 0.5887 0.7830 -0.0982 -0.2127 0.1901  439 PRO A CA  
2051 C C   . PRO A 303 ? 0.4927 0.5434 0.7695 -0.0813 -0.1919 0.1648  439 PRO A C   
2052 O O   . PRO A 303 ? 0.4991 0.5550 0.8345 -0.0643 -0.1888 0.1619  439 PRO A O   
2053 C CB  . PRO A 303 ? 0.5754 0.6349 0.8366 -0.1117 -0.2488 0.2170  439 PRO A CB  
2054 C CG  . PRO A 303 ? 0.6529 0.7133 0.8501 -0.1365 -0.2518 0.2148  439 PRO A CG  
2055 C CD  . PRO A 303 ? 0.6095 0.6479 0.7390 -0.1421 -0.2275 0.2003  439 PRO A CD  
2056 N N   . GLN A 304 ? 0.4576 0.5098 0.7050 -0.0875 -0.1775 0.1464  440 GLN A N   
2057 C CA  . GLN A 304 ? 0.4450 0.5057 0.7234 -0.0756 -0.1568 0.1232  440 GLN A CA  
2058 C C   . GLN A 304 ? 0.4627 0.5070 0.7146 -0.0674 -0.1283 0.1049  440 GLN A C   
2059 O O   . GLN A 304 ? 0.4750 0.5258 0.7480 -0.0600 -0.1104 0.0869  440 GLN A O   
2060 C CB  . GLN A 304 ? 0.5281 0.6002 0.7957 -0.0873 -0.1574 0.1145  440 GLN A CB  
2061 C CG  . GLN A 304 ? 0.6547 0.7522 0.9735 -0.0909 -0.1817 0.1273  440 GLN A CG  
2062 C CD  . GLN A 304 ? 0.8215 0.9199 1.1292 -0.1041 -0.2131 0.1562  440 GLN A CD  
2063 O OE1 . GLN A 304 ? 0.9167 1.0025 1.1606 -0.1218 -0.2169 0.1613  440 GLN A OE1 
2064 N NE2 . GLN A 304 ? 0.8408 0.9542 1.2121 -0.0970 -0.2355 0.1753  440 GLN A NE2 
2065 N N   . CYS A 305 ? 0.4285 0.4537 0.6347 -0.0709 -0.1245 0.1102  441 CYS A N   
2066 C CA  . CYS A 305 ? 0.3981 0.4085 0.5805 -0.0639 -0.1002 0.0963  441 CYS A CA  
2067 C C   . CYS A 305 ? 0.3765 0.3797 0.5736 -0.0538 -0.0993 0.1037  441 CYS A C   
2068 O O   . CYS A 305 ? 0.3908 0.3976 0.6214 -0.0422 -0.0879 0.0940  441 CYS A O   
2069 C CB  . CYS A 305 ? 0.3155 0.3099 0.4378 -0.0752 -0.0916 0.0920  441 CYS A CB  
2070 S SG  . CYS A 305 ? 0.3206 0.2976 0.4188 -0.0669 -0.0658 0.0803  441 CYS A SG  
2071 N N   . ARG A 306 ? 0.4247 0.4180 0.5947 -0.0609 -0.1105 0.1199  442 ARG A N   
2072 C CA  . ARG A 306 ? 0.4527 0.4380 0.6343 -0.0541 -0.1127 0.1303  442 ARG A CA  
2073 C C   . ARG A 306 ? 0.3834 0.3583 0.5523 -0.0454 -0.0885 0.1161  442 ARG A C   
2074 O O   . ARG A 306 ? 0.3641 0.3349 0.5549 -0.0371 -0.0864 0.1189  442 ARG A O   
2075 C CB  . ARG A 306 ? 0.4764 0.4721 0.7242 -0.0439 -0.1269 0.1387  442 ARG A CB  
2076 C CG  . ARG A 306 ? 0.6096 0.6153 0.8758 -0.0529 -0.1570 0.1612  442 ARG A CG  
2077 C CD  . ARG A 306 ? 0.8155 0.8105 1.0366 -0.0682 -0.1720 0.1833  442 ARG A CD  
2078 N NE  . ARG A 306 ? 0.9808 0.9861 1.2053 -0.0836 -0.2030 0.2076  442 ARG A NE  
2079 C CZ  . ARG A 306 ? 1.0502 1.0505 1.2430 -0.1010 -0.2225 0.2323  442 ARG A CZ  
2080 N NH1 . ARG A 306 ? 1.0462 1.0314 1.2042 -0.1036 -0.2120 0.2338  442 ARG A NH1 
2081 N NH2 . ARG A 306 ? 1.0523 1.0643 1.2472 -0.1182 -0.2512 0.2546  442 ARG A NH2 
2082 N N   . LEU A 307 ? 0.3860 0.3564 0.5222 -0.0482 -0.0716 0.1019  443 LEU A N   
2083 C CA  . LEU A 307 ? 0.4066 0.3692 0.5325 -0.0416 -0.0513 0.0913  443 LEU A CA  
2084 C C   . LEU A 307 ? 0.4042 0.3559 0.5109 -0.0423 -0.0509 0.1014  443 LEU A C   
2085 O O   . LEU A 307 ? 0.3500 0.2965 0.4253 -0.0529 -0.0577 0.1105  443 LEU A O   
2086 C CB  . LEU A 307 ? 0.4196 0.3772 0.5152 -0.0461 -0.0375 0.0794  443 LEU A CB  
2087 C CG  . LEU A 307 ? 0.3821 0.3395 0.4825 -0.0405 -0.0200 0.0674  443 LEU A CG  
2088 C CD1 . LEU A 307 ? 0.2639 0.2086 0.3323 -0.0433 -0.0086 0.0642  443 LEU A CD1 
2089 C CD2 . LEU A 307 ? 0.2791 0.2399 0.4032 -0.0327 -0.0148 0.0667  443 LEU A CD2 
2090 N N   . GLU A 308 ? 0.3853 0.3350 0.5096 -0.0337 -0.0426 0.0991  444 GLU A N   
2091 C CA  . GLU A 308 ? 0.3763 0.3163 0.4810 -0.0346 -0.0381 0.1061  444 GLU A CA  
2092 C C   . GLU A 308 ? 0.3298 0.2669 0.4167 -0.0324 -0.0186 0.0942  444 GLU A C   
2093 O O   . GLU A 308 ? 0.2591 0.2014 0.3629 -0.0273 -0.0096 0.0840  444 GLU A O   
2094 C CB  . GLU A 308 ? 0.4077 0.3463 0.5449 -0.0279 -0.0429 0.1124  444 GLU A CB  
2095 C CG  . GLU A 308 ? 0.5120 0.4521 0.6762 -0.0292 -0.0653 0.1282  444 GLU A CG  
2096 C CD  . GLU A 308 ? 0.6205 0.5548 0.8188 -0.0231 -0.0700 0.1354  444 GLU A CD  
2097 O OE1 . GLU A 308 ? 0.6190 0.5456 0.8026 -0.0228 -0.0597 0.1346  444 GLU A OE1 
2098 O OE2 . GLU A 308 ? 0.6907 0.6281 0.9342 -0.0186 -0.0844 0.1419  444 GLU A OE2 
2099 N N   . TRP A 309 ? 0.2951 0.2254 0.3496 -0.0379 -0.0120 0.0957  445 TRP A N   
2100 C CA  . TRP A 309 ? 0.2985 0.2265 0.3432 -0.0354 0.0046  0.0859  445 TRP A CA  
2101 C C   . TRP A 309 ? 0.3208 0.2437 0.3461 -0.0377 0.0143  0.0883  445 TRP A C   
2102 O O   . TRP A 309 ? 0.3582 0.2788 0.3678 -0.0447 0.0091  0.0966  445 TRP A O   
2103 C CB  . TRP A 309 ? 0.3231 0.2501 0.3579 -0.0389 0.0076  0.0768  445 TRP A CB  
2104 C CG  . TRP A 309 ? 0.4509 0.3738 0.4593 -0.0499 0.0025  0.0776  445 TRP A CG  
2105 C CD1 . TRP A 309 ? 0.4396 0.3666 0.4458 -0.0573 -0.0140 0.0849  445 TRP A CD1 
2106 C CD2 . TRP A 309 ? 0.3940 0.3093 0.3755 -0.0571 0.0143  0.0698  445 TRP A CD2 
2107 N NE1 . TRP A 309 ? 0.3898 0.3127 0.3629 -0.0712 -0.0140 0.0828  445 TRP A NE1 
2108 C CE2 . TRP A 309 ? 0.4212 0.3363 0.3786 -0.0713 0.0052  0.0713  445 TRP A CE2 
2109 C CE3 . TRP A 309 ? 0.4028 0.3124 0.3820 -0.0536 0.0319  0.0612  445 TRP A CE3 
2110 C CZ2 . TRP A 309 ? 0.4239 0.3329 0.3502 -0.0841 0.0160  0.0610  445 TRP A CZ2 
2111 C CZ3 . TRP A 309 ? 0.4448 0.3478 0.4009 -0.0631 0.0432  0.0507  445 TRP A CZ3 
2112 C CH2 . TRP A 309 ? 0.4720 0.3744 0.3997 -0.0790 0.0366  0.0489  445 TRP A CH2 
2113 N N   . CYS A 310 ? 0.2938 0.2164 0.3224 -0.0332 0.0277  0.0822  446 CYS A N   
2114 C CA  . CYS A 310 ? 0.3729 0.2935 0.3911 -0.0342 0.0393  0.0823  446 CYS A CA  
2115 C C   . CYS A 310 ? 0.4244 0.3397 0.4262 -0.0391 0.0497  0.0724  446 CYS A C   
2116 O O   . CYS A 310 ? 0.3857 0.2981 0.3954 -0.0361 0.0540  0.0649  446 CYS A O   
2117 C CB  . CYS A 310 ? 0.3594 0.2845 0.3969 -0.0272 0.0466  0.0829  446 CYS A CB  
2118 S SG  . CYS A 310 ? 0.3020 0.2286 0.3383 -0.0267 0.0611  0.0833  446 CYS A SG  
2119 N N   . TRP A 311 ? 0.4715 0.3854 0.4506 -0.0484 0.0544  0.0717  447 TRP A N   
2120 C CA  . TRP A 311 ? 0.4403 0.3498 0.4038 -0.0555 0.0691  0.0578  447 TRP A CA  
2121 C C   . TRP A 311 ? 0.4718 0.3795 0.4602 -0.0453 0.0843  0.0492  447 TRP A C   
2122 O O   . TRP A 311 ? 0.4055 0.3062 0.3969 -0.0459 0.0931  0.0365  447 TRP A O   
2123 C CB  . TRP A 311 ? 0.4366 0.3489 0.3737 -0.0689 0.0756  0.0581  447 TRP A CB  
2124 C CG  . TRP A 311 ? 0.5126 0.4226 0.4365 -0.0778 0.0970  0.0390  447 TRP A CG  
2125 C CD1 . TRP A 311 ? 0.5546 0.4664 0.4979 -0.0717 0.1173  0.0283  447 TRP A CD1 
2126 C CD2 . TRP A 311 ? 0.5512 0.4580 0.4425 -0.0960 0.1010  0.0270  447 TRP A CD2 
2127 N NE1 . TRP A 311 ? 0.5718 0.4808 0.5003 -0.0835 0.1360  0.0077  447 TRP A NE1 
2128 C CE2 . TRP A 311 ? 0.6138 0.5194 0.5067 -0.1000 0.1269  0.0057  447 TRP A CE2 
2129 C CE3 . TRP A 311 ? 0.5526 0.4586 0.4157 -0.1106 0.0850  0.0318  447 TRP A CE3 
2130 C CZ2 . TRP A 311 ? 0.6789 0.5813 0.5421 -0.1195 0.1397  -0.0140 447 TRP A CZ2 
2131 C CZ3 . TRP A 311 ? 0.6734 0.5773 0.5039 -0.1310 0.0947  0.0156  447 TRP A CZ3 
2132 C CH2 . TRP A 311 ? 0.7122 0.6138 0.5410 -0.1361 0.1230  -0.0086 447 TRP A CH2 
2133 N N   . ASN A 312 ? 0.5040 0.4178 0.5128 -0.0369 0.0863  0.0569  448 ASN A N   
2134 C CA  . ASN A 312 ? 0.4894 0.4038 0.5262 -0.0284 0.0983  0.0528  448 ASN A CA  
2135 C C   . ASN A 312 ? 0.4555 0.3676 0.5139 -0.0212 0.0908  0.0566  448 ASN A C   
2136 O O   . ASN A 312 ? 0.4638 0.3698 0.5402 -0.0177 0.0976  0.0505  448 ASN A O   
2137 C CB  . ASN A 312 ? 0.5098 0.4342 0.5603 -0.0249 0.1022  0.0612  448 ASN A CB  
2138 C CG  . ASN A 312 ? 0.5153 0.4432 0.6022 -0.0159 0.1102  0.0616  448 ASN A CG  
2139 O OD1 . ASN A 312 ? 0.5067 0.4389 0.6124 -0.0108 0.1008  0.0728  448 ASN A OD1 
2140 N ND2 . ASN A 312 ? 0.4690 0.3962 0.5681 -0.0154 0.1276  0.0495  448 ASN A ND2 
2141 N N   . CYS A 313 ? 0.4506 0.3676 0.5087 -0.0205 0.0772  0.0662  449 CYS A N   
2142 C CA  . CYS A 313 ? 0.3795 0.2987 0.4555 -0.0175 0.0705  0.0715  449 CYS A CA  
2143 C C   . CYS A 313 ? 0.4020 0.3155 0.4709 -0.0208 0.0642  0.0663  449 CYS A C   
2144 O O   . CYS A 313 ? 0.3529 0.2662 0.4348 -0.0209 0.0609  0.0689  449 CYS A O   
2145 C CB  . CYS A 313 ? 0.2768 0.2065 0.3572 -0.0180 0.0628  0.0810  449 CYS A CB  
2146 S SG  . CYS A 313 ? 0.3647 0.3035 0.4571 -0.0155 0.0681  0.0886  449 CYS A SG  
2147 N N   . GLY A 314 ? 0.4265 0.3368 0.4749 -0.0255 0.0610  0.0607  450 GLY A N   
2148 C CA  . GLY A 314 ? 0.3861 0.2930 0.4285 -0.0297 0.0545  0.0558  450 GLY A CA  
2149 C C   . GLY A 314 ? 0.4181 0.3344 0.4692 -0.0300 0.0439  0.0604  450 GLY A C   
2150 O O   . GLY A 314 ? 0.4390 0.3556 0.4888 -0.0339 0.0383  0.0566  450 GLY A O   
2151 N N   . CYS A 315 ? 0.4294 0.3541 0.4905 -0.0273 0.0425  0.0667  451 CYS A N   
2152 C CA  . CYS A 315 ? 0.4001 0.3352 0.4722 -0.0292 0.0364  0.0669  451 CYS A CA  
2153 C C   . CYS A 315 ? 0.3424 0.2806 0.4161 -0.0280 0.0299  0.0677  451 CYS A C   
2154 O O   . CYS A 315 ? 0.4093 0.3421 0.4723 -0.0272 0.0287  0.0716  451 CYS A O   
2155 C CB  . CYS A 315 ? 0.3584 0.3012 0.4409 -0.0302 0.0396  0.0716  451 CYS A CB  
2156 S SG  . CYS A 315 ? 0.4830 0.4259 0.5648 -0.0262 0.0427  0.0775  451 CYS A SG  
2157 N N   . GLU A 316 ? 0.3150 0.2623 0.4046 -0.0290 0.0258  0.0641  452 GLU A N   
2158 C CA  . GLU A 316 ? 0.3667 0.3155 0.4679 -0.0265 0.0185  0.0661  452 GLU A CA  
2159 C C   . GLU A 316 ? 0.3500 0.2963 0.4534 -0.0240 0.0209  0.0715  452 GLU A C   
2160 O O   . GLU A 316 ? 0.3143 0.2630 0.4168 -0.0250 0.0286  0.0710  452 GLU A O   
2161 C CB  . GLU A 316 ? 0.4850 0.4449 0.6120 -0.0271 0.0153  0.0584  452 GLU A CB  
2162 C CG  . GLU A 316 ? 0.6651 0.6356 0.8024 -0.0318 0.0248  0.0489  452 GLU A CG  
2163 C CD  . GLU A 316 ? 0.7235 0.7070 0.8867 -0.0343 0.0246  0.0375  452 GLU A CD  
2164 O OE1 . GLU A 316 ? 0.7142 0.7018 0.9051 -0.0307 0.0238  0.0326  452 GLU A OE1 
2165 O OE2 . GLU A 316 ? 0.7121 0.7019 0.8717 -0.0399 0.0256  0.0331  452 GLU A OE2 
2166 N N   . TRP A 317 ? 0.2893 0.2309 0.3955 -0.0224 0.0125  0.0786  453 TRP A N   
2167 C CA  . TRP A 317 ? 0.3114 0.2486 0.4178 -0.0215 0.0134  0.0854  453 TRP A CA  
2168 C C   . TRP A 317 ? 0.3720 0.3144 0.5014 -0.0205 0.0186  0.0785  453 TRP A C   
2169 O O   . TRP A 317 ? 0.3856 0.3341 0.5387 -0.0199 0.0180  0.0694  453 TRP A O   
2170 C CB  . TRP A 317 ? 0.3190 0.2500 0.4266 -0.0225 0.0000  0.0970  453 TRP A CB  
2171 C CG  . TRP A 317 ? 0.3636 0.2882 0.4622 -0.0246 0.0002  0.1068  453 TRP A CG  
2172 C CD1 . TRP A 317 ? 0.3060 0.2258 0.4241 -0.0236 -0.0072 0.1142  453 TRP A CD1 
2173 C CD2 . TRP A 317 ? 0.3062 0.2289 0.3774 -0.0286 0.0089  0.1098  453 TRP A CD2 
2174 N NE1 . TRP A 317 ? 0.3498 0.2663 0.4481 -0.0276 -0.0044 0.1208  453 TRP A NE1 
2175 C CE2 . TRP A 317 ? 0.3281 0.2464 0.3998 -0.0311 0.0061  0.1196  453 TRP A CE2 
2176 C CE3 . TRP A 317 ? 0.3100 0.2341 0.3609 -0.0302 0.0195  0.1040  453 TRP A CE3 
2177 C CZ2 . TRP A 317 ? 0.3442 0.2630 0.3933 -0.0358 0.0142  0.1219  453 TRP A CZ2 
2178 C CZ3 . TRP A 317 ? 0.3475 0.2711 0.3822 -0.0337 0.0285  0.1066  453 TRP A CZ3 
2179 C CH2 . TRP A 317 ? 0.3541 0.2759 0.3873 -0.0372 0.0263  0.1163  453 TRP A CH2 
2180 N N   . ASN A 318 ? 0.3390 0.2802 0.4623 -0.0220 0.0250  0.0812  454 ASN A N   
2181 C CA  . ASN A 318 ? 0.2891 0.2361 0.4272 -0.0252 0.0319  0.0731  454 ASN A CA  
2182 C C   . ASN A 318 ? 0.3720 0.3149 0.5041 -0.0269 0.0343  0.0802  454 ASN A C   
2183 O O   . ASN A 318 ? 0.4417 0.3798 0.5570 -0.0253 0.0316  0.0899  454 ASN A O   
2184 C CB  . ASN A 318 ? 0.2251 0.1830 0.3566 -0.0311 0.0394  0.0660  454 ASN A CB  
2185 C CG  . ASN A 318 ? 0.2705 0.2282 0.3824 -0.0316 0.0418  0.0751  454 ASN A CG  
2186 O OD1 . ASN A 318 ? 0.2578 0.2194 0.3642 -0.0340 0.0443  0.0780  454 ASN A OD1 
2187 N ND2 . ASN A 318 ? 0.3299 0.2843 0.4323 -0.0288 0.0402  0.0770  454 ASN A ND2 
2188 N N   . ARG A 319 ? 0.3768 0.3239 0.5200 -0.0322 0.0402  0.0729  455 ARG A N   
2189 C CA  . ARG A 319 ? 0.3420 0.2865 0.4807 -0.0345 0.0411  0.0774  455 ARG A CA  
2190 C C   . ARG A 319 ? 0.3007 0.2534 0.4148 -0.0357 0.0430  0.0824  455 ARG A C   
2191 O O   . ARG A 319 ? 0.2858 0.2375 0.3916 -0.0358 0.0420  0.0874  455 ARG A O   
2192 C CB  . ARG A 319 ? 0.3446 0.2916 0.5015 -0.0425 0.0481  0.0651  455 ARG A CB  
2193 C CG  . ARG A 319 ? 0.4403 0.4030 0.5845 -0.0533 0.0551  0.0576  455 ARG A CG  
2194 C CD  . ARG A 319 ? 0.5211 0.4892 0.6783 -0.0652 0.0638  0.0400  455 ARG A CD  
2195 N NE  . ARG A 319 ? 0.5682 0.5355 0.7516 -0.0633 0.0679  0.0241  455 ARG A NE  
2196 C CZ  . ARG A 319 ? 0.6922 0.6524 0.9051 -0.0627 0.0724  0.0101  455 ARG A CZ  
2197 N NH1 . ARG A 319 ? 0.7864 0.7376 1.0036 -0.0654 0.0733  0.0109  455 ARG A NH1 
2198 N NH2 . ARG A 319 ? 0.7600 0.7222 1.0016 -0.0592 0.0759  -0.0052 455 ARG A NH2 
2199 N N   . VAL A 320 ? 0.2786 0.2398 0.3849 -0.0369 0.0450  0.0809  456 VAL A N   
2200 C CA  . VAL A 320 ? 0.2780 0.2468 0.3713 -0.0367 0.0452  0.0851  456 VAL A CA  
2201 C C   . VAL A 320 ? 0.3222 0.2857 0.4077 -0.0297 0.0452  0.0906  456 VAL A C   
2202 O O   . VAL A 320 ? 0.4004 0.3667 0.4821 -0.0295 0.0468  0.0942  456 VAL A O   
2203 C CB  . VAL A 320 ? 0.3827 0.3602 0.4739 -0.0405 0.0448  0.0836  456 VAL A CB  
2204 C CG1 . VAL A 320 ? 0.3801 0.3643 0.4685 -0.0388 0.0434  0.0898  456 VAL A CG1 
2205 C CG2 . VAL A 320 ? 0.3608 0.3460 0.4538 -0.0529 0.0465  0.0766  456 VAL A CG2 
2206 N N   . CYS A 321 ? 0.2832 0.2395 0.3665 -0.0263 0.0445  0.0908  457 CYS A N   
2207 C CA  . CYS A 321 ? 0.2617 0.2117 0.3340 -0.0242 0.0467  0.0950  457 CYS A CA  
2208 C C   . CYS A 321 ? 0.2893 0.2346 0.3547 -0.0267 0.0443  0.1002  457 CYS A C   
2209 O O   . CYS A 321 ? 0.3601 0.3060 0.4156 -0.0289 0.0493  0.1036  457 CYS A O   
2210 C CB  . CYS A 321 ? 0.2190 0.1609 0.2878 -0.0234 0.0451  0.0947  457 CYS A CB  
2211 S SG  . CYS A 321 ? 0.3234 0.2684 0.3981 -0.0219 0.0484  0.0897  457 CYS A SG  
2212 N N   . MET A 322 ? 0.2594 0.2000 0.3331 -0.0275 0.0374  0.1011  458 MET A N   
2213 C CA  . MET A 322 ? 0.2274 0.1621 0.2975 -0.0306 0.0325  0.1075  458 MET A CA  
2214 C C   . MET A 322 ? 0.2492 0.1900 0.3156 -0.0334 0.0376  0.1074  458 MET A C   
2215 O O   . MET A 322 ? 0.3106 0.2499 0.3644 -0.0375 0.0387  0.1130  458 MET A O   
2216 C CB  . MET A 322 ? 0.2854 0.2137 0.3763 -0.0295 0.0248  0.1071  458 MET A CB  
2217 C CG  . MET A 322 ? 0.4120 0.3346 0.5124 -0.0270 0.0158  0.1097  458 MET A CG  
2218 S SD  . MET A 322 ? 0.4631 0.3816 0.6040 -0.0235 0.0106  0.1039  458 MET A SD  
2219 C CE  . MET A 322 ? 0.3360 0.2466 0.4811 -0.0257 0.0037  0.1114  458 MET A CE  
2220 N N   . GLY A 323 ? 0.2562 0.2048 0.3329 -0.0335 0.0406  0.1018  459 GLY A N   
2221 C CA  . GLY A 323 ? 0.2622 0.2177 0.3371 -0.0373 0.0435  0.1026  459 GLY A CA  
2222 C C   . GLY A 323 ? 0.2874 0.2520 0.3565 -0.0361 0.0493  0.1047  459 GLY A C   
2223 O O   . GLY A 323 ? 0.3132 0.2808 0.3783 -0.0393 0.0521  0.1082  459 GLY A O   
2224 N N   . ASP A 324 ? 0.2319 0.2004 0.3045 -0.0318 0.0520  0.1026  460 ASP A N   
2225 C CA  . ASP A 324 ? 0.3306 0.3079 0.4095 -0.0292 0.0590  0.1045  460 ASP A CA  
2226 C C   . ASP A 324 ? 0.3439 0.3165 0.4147 -0.0298 0.0678  0.1061  460 ASP A C   
2227 O O   . ASP A 324 ? 0.2838 0.2635 0.3598 -0.0309 0.0770  0.1077  460 ASP A O   
2228 C CB  . ASP A 324 ? 0.3406 0.3223 0.4309 -0.0252 0.0585  0.1031  460 ASP A CB  
2229 C CG  . ASP A 324 ? 0.3763 0.3674 0.4730 -0.0289 0.0519  0.1037  460 ASP A CG  
2230 O OD1 . ASP A 324 ? 0.4028 0.3977 0.4970 -0.0341 0.0499  0.1043  460 ASP A OD1 
2231 O OD2 . ASP A 324 ? 0.3981 0.3925 0.5005 -0.0287 0.0488  0.1040  460 ASP A OD2 
2232 N N   . HIS A 325 ? 0.3148 0.2763 0.3732 -0.0307 0.0662  0.1055  461 HIS A N   
2233 C CA  . HIS A 325 ? 0.2900 0.2471 0.3351 -0.0354 0.0762  0.1065  461 HIS A CA  
2234 C C   . HIS A 325 ? 0.3360 0.2813 0.3612 -0.0414 0.0685  0.1108  461 HIS A C   
2235 O O   . HIS A 325 ? 0.2990 0.2386 0.3156 -0.0432 0.0721  0.1092  461 HIS A O   
2236 C CB  . HIS A 325 ? 0.2430 0.2006 0.3000 -0.0306 0.0886  0.1011  461 HIS A CB  
2237 C CG  . HIS A 325 ? 0.2706 0.2238 0.3357 -0.0248 0.0808  0.0987  461 HIS A CG  
2238 N ND1 . HIS A 325 ? 0.3315 0.2923 0.4172 -0.0190 0.0778  0.0984  461 HIS A ND1 
2239 C CD2 . HIS A 325 ? 0.3174 0.2609 0.3726 -0.0257 0.0749  0.0977  461 HIS A CD2 
2240 C CE1 . HIS A 325 ? 0.3181 0.2742 0.4037 -0.0175 0.0713  0.0960  461 HIS A CE1 
2241 N NE2 . HIS A 325 ? 0.4065 0.3523 0.4755 -0.0207 0.0701  0.0948  461 HIS A NE2 
2242 N N   . TRP A 326 ? 0.3637 0.3046 0.3832 -0.0451 0.0571  0.1165  462 TRP A N   
2243 C CA  . TRP A 326 ? 0.3219 0.2525 0.3289 -0.0505 0.0456  0.1240  462 TRP A CA  
2244 C C   . TRP A 326 ? 0.3803 0.3103 0.3610 -0.0632 0.0517  0.1289  462 TRP A C   
2245 O O   . TRP A 326 ? 0.3480 0.2733 0.3165 -0.0680 0.0436  0.1314  462 TRP A O   
2246 C CB  . TRP A 326 ? 0.2879 0.2136 0.2973 -0.0525 0.0347  0.1300  462 TRP A CB  
2247 C CG  . TRP A 326 ? 0.3552 0.2726 0.3720 -0.0514 0.0188  0.1360  462 TRP A CG  
2248 C CD1 . TRP A 326 ? 0.3629 0.2775 0.3721 -0.0546 0.0111  0.1408  462 TRP A CD1 
2249 C CD2 . TRP A 326 ? 0.3735 0.2863 0.4124 -0.0471 0.0082  0.1379  462 TRP A CD2 
2250 N NE1 . TRP A 326 ? 0.3783 0.2882 0.4063 -0.0516 -0.0053 0.1464  462 TRP A NE1 
2251 C CE2 . TRP A 326 ? 0.3908 0.2990 0.4393 -0.0465 -0.0061 0.1441  462 TRP A CE2 
2252 C CE3 . TRP A 326 ? 0.3906 0.3031 0.4440 -0.0450 0.0098  0.1349  462 TRP A CE3 
2253 C CZ2 . TRP A 326 ? 0.4505 0.3542 0.5284 -0.0421 -0.0178 0.1467  462 TRP A CZ2 
2254 C CZ3 . TRP A 326 ? 0.5122 0.4180 0.5906 -0.0420 -0.0004 0.1367  462 TRP A CZ3 
2255 C CH2 . TRP A 326 ? 0.4858 0.3875 0.5789 -0.0397 -0.0137 0.1422  462 TRP A CH2 
2256 N N   . PHE A 327 ? 0.3890 0.3264 0.3598 -0.0704 0.0658  0.1274  463 PHE A N   
2257 C CA  . PHE A 327 ? 0.4378 0.3790 0.3813 -0.0839 0.0771  0.1218  463 PHE A CA  
2258 C C   . PHE A 327 ? 0.4563 0.4087 0.4117 -0.0808 0.1002  0.1084  463 PHE A C   
2259 O O   . PHE A 327 ? 0.4251 0.3837 0.4060 -0.0719 0.1037  0.1110  463 PHE A O   
2260 C CB  . PHE A 327 ? 0.3747 0.3153 0.2912 -0.1006 0.0691  0.1332  463 PHE A CB  
2261 C CG  . PHE A 327 ? 0.3850 0.3313 0.3081 -0.1006 0.0752  0.1353  463 PHE A CG  
2262 C CD1 . PHE A 327 ? 0.3642 0.3026 0.3031 -0.0923 0.0618  0.1417  463 PHE A CD1 
2263 C CD2 . PHE A 327 ? 0.4063 0.3671 0.3204 -0.1102 0.0947  0.1279  463 PHE A CD2 
2264 C CE1 . PHE A 327 ? 0.3853 0.3274 0.3272 -0.0946 0.0666  0.1429  463 PHE A CE1 
2265 C CE2 . PHE A 327 ? 0.3912 0.3588 0.3137 -0.1105 0.0997  0.1310  463 PHE A CE2 
2266 C CZ  . PHE A 327 ? 0.3810 0.3367 0.3144 -0.1035 0.0854  0.1388  463 PHE A CZ  
2267 N N   . ASP A 328 ? 0.5024 0.4585 0.4422 -0.0893 0.1159  0.0936  464 ASP A N   
2268 C CA  . ASP A 328 ? 0.5796 0.5477 0.5362 -0.0877 0.1401  0.0793  464 ASP A CA  
2269 C C   . ASP A 328 ? 0.6304 0.6044 0.5551 -0.1087 0.1572  0.0663  464 ASP A C   
2270 O O   . ASP A 328 ? 0.7191 0.6868 0.6164 -0.1193 0.1561  0.0587  464 ASP A O   
2271 C CB  . ASP A 328 ? 0.6913 0.6578 0.6820 -0.0705 0.1477  0.0670  464 ASP A CB  
2272 C CG  . ASP A 328 ? 0.8549 0.8343 0.8772 -0.0658 0.1707  0.0546  464 ASP A CG  
2273 O OD1 . ASP A 328 ? 0.8656 0.8574 0.8958 -0.0692 0.1764  0.0603  464 ASP A OD1 
2274 O OD2 . ASP A 328 ? 0.9131 0.8903 0.9566 -0.0586 0.1829  0.0392  464 ASP A OD2 
2275 N N   . VAL A 329 ? 0.6928 0.6814 0.6208 -0.1158 0.1717  0.0629  465 VAL A N   
2276 C CA  . VAL A 329 ? 0.9164 0.9157 0.8190 -0.1342 0.1871  0.0466  465 VAL A CA  
2277 C C   . VAL A 329 ? 1.0670 1.0832 1.0050 -0.1273 0.2103  0.0308  465 VAL A C   
2278 O O   . VAL A 329 ? 1.0503 1.0743 1.0194 -0.1153 0.2067  0.0415  465 VAL A O   
2279 C CB  . VAL A 329 ? 0.8888 0.8911 0.7537 -0.1524 0.1707  0.0625  465 VAL A CB  
2280 C CG1 . VAL A 329 ? 0.9121 0.9269 0.7513 -0.1730 0.1879  0.0443  465 VAL A CG1 
2281 C CG2 . VAL A 329 ? 0.8441 0.8311 0.6814 -0.1584 0.1446  0.0788  465 VAL A CG2 
2282 O OXT . VAL A 329 ? 1.1766 1.1993 1.1155 -0.1338 0.2319  0.0064  465 VAL A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   137 ?   ?   ?   A . n 
A 1 2   ALA 2   138 ?   ?   ?   A . n 
A 1 3   GLY 3   139 ?   ?   ?   A . n 
A 1 4   ARG 4   140 ?   ?   ?   A . n 
A 1 5   SER 5   141 ?   ?   ?   A . n 
A 1 6   ILE 6   142 142 ILE ILE A . n 
A 1 7   TYR 7   143 143 TYR TYR A . n 
A 1 8   ASN 8   144 144 ASN ASN A . n 
A 1 9   SER 9   145 145 SER SER A . n 
A 1 10  PHE 10  146 146 PHE PHE A . n 
A 1 11  TYR 11  147 147 TYR TYR A . n 
A 1 12  VAL 12  148 148 VAL VAL A . n 
A 1 13  TYR 13  149 149 TYR TYR A . n 
A 1 14  CYS 14  150 150 CYS CYS A . n 
A 1 15  LYS 15  151 151 LYS LYS A . n 
A 1 16  GLY 16  152 152 GLY GLY A . n 
A 1 17  PRO 17  153 153 PRO PRO A . n 
A 1 18  CYS 18  154 154 CYS CYS A . n 
A 1 19  GLN 19  155 155 GLN GLN A . n 
A 1 20  ARG 20  156 156 ARG ARG A . n 
A 1 21  VAL 21  157 157 VAL VAL A . n 
A 1 22  GLN 22  158 158 GLN GLN A . n 
A 1 23  PRO 23  159 159 PRO PRO A . n 
A 1 24  GLY 24  160 160 GLY GLY A . n 
A 1 25  LYS 25  161 161 LYS LYS A . n 
A 1 26  LEU 26  162 162 LEU LEU A . n 
A 1 27  ARG 27  163 163 ARG ARG A . n 
A 1 28  VAL 28  164 164 VAL VAL A . n 
A 1 29  GLN 29  165 165 GLN GLN A . n 
A 1 30  CYS 30  166 166 CYS CYS A . n 
A 1 31  SER 31  167 167 SER SER A . n 
A 1 32  THR 32  168 168 THR THR A . n 
A 1 33  CYS 33  169 169 CYS CYS A . n 
A 1 34  ARG 34  170 170 ARG ARG A . n 
A 1 35  GLN 35  171 171 GLN GLN A . n 
A 1 36  ALA 36  172 172 ALA ALA A . n 
A 1 37  THR 37  173 173 THR THR A . n 
A 1 38  LEU 38  174 174 LEU LEU A . n 
A 1 39  THR 39  175 175 THR THR A . n 
A 1 40  LEU 40  176 176 LEU LEU A . n 
A 1 41  THR 41  177 177 THR THR A . n 
A 1 42  GLN 42  178 178 GLN GLN A . n 
A 1 43  GLY 43  179 179 GLY GLY A . n 
A 1 44  PRO 44  180 180 PRO PRO A . n 
A 1 45  SER 45  181 181 SER SER A . n 
A 1 46  CYS 46  182 182 CYS CYS A . n 
A 1 47  TRP 47  183 183 TRP TRP A . n 
A 1 48  ASP 48  184 184 ASP ASP A . n 
A 1 49  ASP 49  185 185 ASP ASP A . n 
A 1 50  VAL 50  186 186 VAL VAL A . n 
A 1 51  LEU 51  187 187 LEU LEU A . n 
A 1 52  ILE 52  188 188 ILE ILE A . n 
A 1 53  PRO 53  189 189 PRO PRO A . n 
A 1 54  ASN 54  190 190 ASN ASN A . n 
A 1 55  ARG 55  191 191 ARG ARG A . n 
A 1 56  MET 56  192 192 MET MET A . n 
A 1 57  SER 57  193 193 SER SER A . n 
A 1 58  GLY 58  194 194 GLY GLY A . n 
A 1 59  GLU 59  195 195 GLU GLU A . n 
A 1 60  CYS 60  196 196 CYS CYS A . n 
A 1 61  GLN 61  197 197 GLN GLN A . n 
A 1 62  SER 62  198 198 SER SER A . n 
A 1 63  PRO 63  199 199 PRO PRO A . n 
A 1 64  HIS 64  200 200 HIS HIS A . n 
A 1 65  CYS 65  201 201 CYS CYS A . n 
A 1 66  PRO 66  202 202 PRO PRO A . n 
A 1 67  GLY 67  203 203 GLY GLY A . n 
A 1 68  THR 68  204 204 THR THR A . n 
A 1 69  SER 69  205 205 SER SER A . n 
A 1 70  ALA 70  206 206 ALA ALA A . n 
A 1 71  GLU 71  207 207 GLU GLU A . n 
A 1 72  PHE 72  208 208 PHE PHE A . n 
A 1 73  PHE 73  209 209 PHE PHE A . n 
A 1 74  PHE 74  210 210 PHE PHE A . n 
A 1 75  LYS 75  211 211 LYS LYS A . n 
A 1 76  CYS 76  212 212 CYS CYS A . n 
A 1 77  GLY 77  213 213 GLY GLY A . n 
A 1 78  ALA 78  214 214 ALA ALA A . n 
A 1 79  HIS 79  215 215 HIS HIS A . n 
A 1 80  PRO 80  216 216 PRO PRO A . n 
A 1 81  THR 81  217 217 THR THR A . n 
A 1 82  SER 82  218 218 SER SER A . n 
A 1 83  ASP 83  219 219 ASP ASP A . n 
A 1 84  LYS 84  220 220 LYS LYS A . n 
A 1 85  GLU 85  221 221 GLU GLU A . n 
A 1 86  THR 86  222 222 THR THR A . n 
A 1 87  SER 87  223 223 SER SER A . n 
A 1 88  VAL 88  224 224 VAL VAL A . n 
A 1 89  ALA 89  225 225 ALA ALA A . n 
A 1 90  LEU 90  226 226 LEU LEU A . n 
A 1 91  HIS 91  227 227 HIS HIS A . n 
A 1 92  LEU 92  228 228 LEU LEU A . n 
A 1 93  ILE 93  229 229 ILE ILE A . n 
A 1 94  ALA 94  230 230 ALA ALA A . n 
A 1 95  THR 95  231 231 THR THR A . n 
A 1 96  ASN 96  232 232 ASN ASN A . n 
A 1 97  SER 97  233 233 SER SER A . n 
A 1 98  ARG 98  234 234 ARG ARG A . n 
A 1 99  ASN 99  235 235 ASN ASN A . n 
A 1 100 ILE 100 236 236 ILE ILE A . n 
A 1 101 THR 101 237 237 THR THR A . n 
A 1 102 CYS 102 238 238 CYS CYS A . n 
A 1 103 ILE 103 239 239 ILE ILE A . n 
A 1 104 THR 104 240 240 THR THR A . n 
A 1 105 CYS 105 241 241 CYS CYS A . n 
A 1 106 THR 106 242 242 THR THR A . n 
A 1 107 ASP 107 243 243 ASP ASP A . n 
A 1 108 VAL 108 244 244 VAL VAL A . n 
A 1 109 ARG 109 245 245 ARG ARG A . n 
A 1 110 SER 110 246 246 SER SER A . n 
A 1 111 PRO 111 247 247 PRO PRO A . n 
A 1 112 VAL 112 248 248 VAL VAL A . n 
A 1 113 LEU 113 249 249 LEU LEU A . n 
A 1 114 VAL 114 250 250 VAL VAL A . n 
A 1 115 PHE 115 251 251 PHE PHE A . n 
A 1 116 GLN 116 252 252 GLN GLN A . n 
A 1 117 CYS 117 253 253 CYS CYS A . n 
A 1 118 ASN 118 254 254 ASN ASN A . n 
A 1 119 SER 119 255 255 SER SER A . n 
A 1 120 ARG 120 256 256 ARG ARG A . n 
A 1 121 HIS 121 257 257 HIS HIS A . n 
A 1 122 VAL 122 258 258 VAL VAL A . n 
A 1 123 ILE 123 259 259 ILE ILE A . n 
A 1 124 CYS 124 260 260 CYS CYS A . n 
A 1 125 LEU 125 261 261 LEU LEU A . n 
A 1 126 ASP 126 262 262 ASP ASP A . n 
A 1 127 CYS 127 263 263 CYS CYS A . n 
A 1 128 PHE 128 264 264 PHE PHE A . n 
A 1 129 HIS 129 265 265 HIS HIS A . n 
A 1 130 LEU 130 266 266 LEU LEU A . n 
A 1 131 TYR 131 267 267 TYR TYR A . n 
A 1 132 CYS 132 268 268 CYS CYS A . n 
A 1 133 VAL 133 269 269 VAL VAL A . n 
A 1 134 THR 134 270 270 THR THR A . n 
A 1 135 ARG 135 271 271 ARG ARG A . n 
A 1 136 LEU 136 272 272 LEU LEU A . n 
A 1 137 ASN 137 273 273 ASN ASN A . n 
A 1 138 ASP 138 274 274 ASP ASP A . n 
A 1 139 ARG 139 275 275 ARG ARG A . n 
A 1 140 GLN 140 276 276 GLN GLN A . n 
A 1 141 PHE 141 277 277 PHE PHE A . n 
A 1 142 VAL 142 278 278 VAL VAL A . n 
A 1 143 HIS 143 279 279 HIS HIS A . n 
A 1 144 ASP 144 280 280 ASP ASP A . n 
A 1 145 PRO 145 281 281 PRO PRO A . n 
A 1 146 GLN 146 282 282 GLN GLN A . n 
A 1 147 LEU 147 283 283 LEU LEU A . n 
A 1 148 GLY 148 284 284 GLY GLY A . n 
A 1 149 TYR 149 285 285 TYR TYR A . n 
A 1 150 SER 150 286 286 SER SER A . n 
A 1 151 LEU 151 287 287 LEU LEU A . n 
A 1 152 PRO 152 288 288 PRO PRO A . n 
A 1 153 CYS 153 289 289 CYS CYS A . n 
A 1 154 VAL 154 290 290 VAL VAL A . n 
A 1 155 ALA 155 291 291 ALA ALA A . n 
A 1 156 GLY 156 292 292 GLY GLY A . n 
A 1 157 CYS 157 293 293 CYS CYS A . n 
A 1 158 PRO 158 294 294 PRO PRO A . n 
A 1 159 ASN 159 295 295 ASN ASN A . n 
A 1 160 SER 160 296 296 SER SER A . n 
A 1 161 LEU 161 297 297 LEU LEU A . n 
A 1 162 ILE 162 298 298 ILE ILE A . n 
A 1 163 LYS 163 299 299 LYS LYS A . n 
A 1 164 GLU 164 300 300 GLU GLU A . n 
A 1 165 LEU 165 301 301 LEU LEU A . n 
A 1 166 HIS 166 302 302 HIS HIS A . n 
A 1 167 HIS 167 303 303 HIS HIS A . n 
A 1 168 PHE 168 304 304 PHE PHE A . n 
A 1 169 ARG 169 305 305 ARG ARG A . n 
A 1 170 ILE 170 306 306 ILE ILE A . n 
A 1 171 LEU 171 307 307 LEU LEU A . n 
A 1 172 GLY 172 308 308 GLY GLY A . n 
A 1 173 GLU 173 309 309 GLU GLU A . n 
A 1 174 GLU 174 310 310 GLU GLU A . n 
A 1 175 GLN 175 311 311 GLN GLN A . n 
A 1 176 TYR 176 312 312 TYR TYR A . n 
A 1 177 ASN 177 313 313 ASN ASN A . n 
A 1 178 ARG 178 314 314 ARG ARG A . n 
A 1 179 TYR 179 315 315 TYR TYR A . n 
A 1 180 GLN 180 316 316 GLN GLN A . n 
A 1 181 GLN 181 317 317 GLN GLN A . n 
A 1 182 TYR 182 318 318 TYR TYR A . n 
A 1 183 GLY 183 319 319 GLY GLY A . n 
A 1 184 ALA 184 320 320 ALA ALA A . n 
A 1 185 GLU 185 321 321 GLU GLU A . n 
A 1 186 GLU 186 322 322 GLU GLU A . n 
A 1 187 CYS 187 323 323 CYS CYS A . n 
A 1 188 VAL 188 324 324 VAL VAL A . n 
A 1 189 LEU 189 325 325 LEU LEU A . n 
A 1 190 GLN 190 326 326 GLN GLN A . n 
A 1 191 MET 191 327 327 MET MET A . n 
A 1 192 GLY 192 328 328 GLY GLY A . n 
A 1 193 GLY 193 329 329 GLY GLY A . n 
A 1 194 VAL 194 330 330 VAL VAL A . n 
A 1 195 LEU 195 331 331 LEU LEU A . n 
A 1 196 CYS 196 332 332 CYS CYS A . n 
A 1 197 PRO 197 333 333 PRO PRO A . n 
A 1 198 ARG 198 334 334 ARG ARG A . n 
A 1 199 PRO 199 335 335 PRO PRO A . n 
A 1 200 GLY 200 336 336 GLY GLY A . n 
A 1 201 CYS 201 337 337 CYS CYS A . n 
A 1 202 GLY 202 338 338 GLY GLY A . n 
A 1 203 ALA 203 339 339 ALA ALA A . n 
A 1 204 GLY 204 340 340 GLY GLY A . n 
A 1 205 LEU 205 341 341 LEU LEU A . n 
A 1 206 LEU 206 342 342 LEU LEU A . n 
A 1 207 PRO 207 343 343 PRO PRO A . n 
A 1 208 GLU 208 344 344 GLU GLU A . n 
A 1 209 PRO 209 345 345 PRO PRO A . n 
A 1 210 ASP 210 346 346 ASP ASP A . n 
A 1 211 GLN 211 347 347 GLN GLN A . n 
A 1 212 ARG 212 348 348 ARG ARG A . n 
A 1 213 LYS 213 349 349 LYS LYS A . n 
A 1 214 VAL 214 350 350 VAL VAL A . n 
A 1 215 THR 215 351 351 THR THR A . n 
A 1 216 CYS 216 352 352 CYS CYS A . n 
A 1 217 GLU 217 353 353 GLU GLU A . n 
A 1 218 GLY 218 354 ?   ?   ?   A . n 
A 1 219 GLY 219 355 ?   ?   ?   A . n 
A 1 220 ASN 220 356 ?   ?   ?   A . n 
A 1 221 GLY 221 357 ?   ?   ?   A . n 
A 1 222 LEU 222 358 ?   ?   ?   A . n 
A 1 223 GLY 223 359 ?   ?   ?   A . n 
A 1 224 CYS 224 360 ?   ?   ?   A . n 
A 1 225 GLY 225 361 ?   ?   ?   A . n 
A 1 226 PHE 226 362 362 PHE PHE A . n 
A 1 227 ALA 227 363 363 ALA ALA A . n 
A 1 228 PHE 228 364 364 PHE PHE A . n 
A 1 229 CYS 229 365 365 CYS CYS A . n 
A 1 230 ARG 230 366 366 ARG ARG A . n 
A 1 231 GLU 231 367 367 GLU GLU A . n 
A 1 232 CYS 232 368 368 CYS CYS A . n 
A 1 233 LYS 233 369 369 LYS LYS A . n 
A 1 234 GLU 234 370 370 GLU GLU A . n 
A 1 235 ALA 235 371 371 ALA ALA A . n 
A 1 236 TYR 236 372 372 TYR TYR A . n 
A 1 237 HIS 237 373 373 HIS HIS A . n 
A 1 238 GLU 238 374 374 GLU GLU A . n 
A 1 239 GLY 239 375 375 GLY GLY A . n 
A 1 240 GLU 240 376 376 GLU GLU A . n 
A 1 241 CYS 241 377 377 CYS CYS A . n 
A 1 242 SER 242 378 378 SER SER A . n 
A 1 243 ALA 243 379 379 ALA ALA A . n 
A 1 244 VAL 244 380 380 VAL VAL A . n 
A 1 245 PHE 245 381 381 PHE PHE A . n 
A 1 246 GLU 246 382 382 GLU GLU A . n 
A 1 247 ALA 247 383 383 ALA ALA A . n 
A 1 248 SER 248 384 ?   ?   ?   A . n 
A 1 249 GLY 249 385 ?   ?   ?   A . n 
A 1 250 THR 250 386 ?   ?   ?   A . n 
A 1 251 THR 251 387 ?   ?   ?   A . n 
A 1 252 THR 252 388 ?   ?   ?   A . n 
A 1 253 GLN 253 389 ?   ?   ?   A . n 
A 1 254 ALA 254 390 ?   ?   ?   A . n 
A 1 255 TYR 255 391 391 TYR TYR A . n 
A 1 256 ARG 256 392 392 ARG ARG A . n 
A 1 257 VAL 257 393 393 VAL VAL A . n 
A 1 258 ASP 258 394 394 ASP ASP A . n 
A 1 259 GLU 259 395 395 GLU GLU A . n 
A 1 260 ARG 260 396 396 ARG ARG A . n 
A 1 261 ALA 261 397 397 ALA ALA A . n 
A 1 262 ALA 262 398 398 ALA ALA A . n 
A 1 263 GLU 263 399 399 GLU GLU A . n 
A 1 264 GLN 264 400 400 GLN GLN A . n 
A 1 265 ALA 265 401 401 ALA ALA A . n 
A 1 266 ARG 266 402 402 ARG ARG A . n 
A 1 267 TRP 267 403 403 TRP TRP A . n 
A 1 268 GLU 268 404 404 GLU GLU A . n 
A 1 269 ALA 269 405 ?   ?   ?   A . n 
A 1 270 ALA 270 406 ?   ?   ?   A . n 
A 1 271 SER 271 407 ?   ?   ?   A . n 
A 1 272 LYS 272 408 ?   ?   ?   A . n 
A 1 273 GLU 273 409 ?   ?   ?   A . n 
A 1 274 THR 274 410 ?   ?   ?   A . n 
A 1 275 ILE 275 411 ?   ?   ?   A . n 
A 1 276 LYS 276 412 ?   ?   ?   A . n 
A 1 277 LYS 277 413 413 LYS LYS A . n 
A 1 278 THR 278 414 414 THR THR A . n 
A 1 279 THR 279 415 415 THR THR A . n 
A 1 280 LYS 280 416 416 LYS LYS A . n 
A 1 281 PRO 281 417 417 PRO PRO A . n 
A 1 282 CYS 282 418 418 CYS CYS A . n 
A 1 283 PRO 283 419 419 PRO PRO A . n 
A 1 284 ARG 284 420 420 ARG ARG A . n 
A 1 285 CYS 285 421 421 CYS CYS A . n 
A 1 286 HIS 286 422 422 HIS HIS A . n 
A 1 287 VAL 287 423 423 VAL VAL A . n 
A 1 288 PRO 288 424 424 PRO PRO A . n 
A 1 289 VAL 289 425 425 VAL VAL A . n 
A 1 290 GLU 290 426 426 GLU GLU A . n 
A 1 291 LYS 291 427 427 LYS LYS A . n 
A 1 292 ASN 292 428 428 ASN ASN A . n 
A 1 293 GLY 293 429 429 GLY GLY A . n 
A 1 294 GLY 294 430 430 GLY GLY A . n 
A 1 295 CYS 295 431 431 CYS CYS A . n 
A 1 296 MET 296 432 432 MET MET A . n 
A 1 297 HIS 297 433 433 HIS HIS A . n 
A 1 298 MET 298 434 434 MET MET A . n 
A 1 299 LYS 299 435 435 LYS LYS A . n 
A 1 300 CYS 300 436 436 CYS CYS A . n 
A 1 301 PRO 301 437 437 PRO PRO A . n 
A 1 302 GLN 302 438 438 GLN GLN A . n 
A 1 303 PRO 303 439 439 PRO PRO A . n 
A 1 304 GLN 304 440 440 GLN GLN A . n 
A 1 305 CYS 305 441 441 CYS CYS A . n 
A 1 306 ARG 306 442 442 ARG ARG A . n 
A 1 307 LEU 307 443 443 LEU LEU A . n 
A 1 308 GLU 308 444 444 GLU GLU A . n 
A 1 309 TRP 309 445 445 TRP TRP A . n 
A 1 310 CYS 310 446 446 CYS CYS A . n 
A 1 311 TRP 311 447 447 TRP TRP A . n 
A 1 312 ASN 312 448 448 ASN ASN A . n 
A 1 313 CYS 313 449 449 CYS CYS A . n 
A 1 314 GLY 314 450 450 GLY GLY A . n 
A 1 315 CYS 315 451 451 CYS CYS A . n 
A 1 316 GLU 316 452 452 GLU GLU A . n 
A 1 317 TRP 317 453 453 TRP TRP A . n 
A 1 318 ASN 318 454 454 ASN ASN A . n 
A 1 319 ARG 319 455 455 ARG ARG A . n 
A 1 320 VAL 320 456 456 VAL VAL A . n 
A 1 321 CYS 321 457 457 CYS CYS A . n 
A 1 322 MET 322 458 458 MET MET A . n 
A 1 323 GLY 323 459 459 GLY GLY A . n 
A 1 324 ASP 324 460 460 ASP ASP A . n 
A 1 325 HIS 325 461 461 HIS HIS A . n 
A 1 326 TRP 326 462 462 TRP TRP A . n 
A 1 327 PHE 327 463 463 PHE PHE A . n 
A 1 328 ASP 328 464 464 ASP ASP A . n 
A 1 329 VAL 329 465 465 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  1466 1466 ZN  ZN  A . 
C 2 ZN  1  1467 1467 ZN  ZN  A . 
D 2 ZN  1  1468 1468 ZN  ZN  A . 
E 2 ZN  1  1469 1469 ZN  ZN  A . 
F 2 ZN  1  1470 1470 ZN  ZN  A . 
G 2 ZN  1  1471 1471 ZN  ZN  A . 
H 2 ZN  1  1472 1472 ZN  ZN  A . 
I 2 ZN  1  1473 1473 ZN  ZN  A . 
J 3 SO4 1  1474 1474 SO4 SO4 A . 
K 3 SO4 1  1475 1475 SO4 SO4 A . 
L 3 SO4 1  1476 1476 SO4 SO4 A . 
M 4 GOL 1  1477 1477 GOL GOL A . 
N 5 HOH 1  2001 2001 HOH HOH A . 
N 5 HOH 2  2002 2002 HOH HOH A . 
N 5 HOH 3  2003 2003 HOH HOH A . 
N 5 HOH 4  2004 2004 HOH HOH A . 
N 5 HOH 5  2005 2005 HOH HOH A . 
N 5 HOH 6  2006 2006 HOH HOH A . 
N 5 HOH 7  2007 2007 HOH HOH A . 
N 5 HOH 8  2008 2008 HOH HOH A . 
N 5 HOH 9  2009 2009 HOH HOH A . 
N 5 HOH 10 2010 2010 HOH HOH A . 
N 5 HOH 11 2011 2011 HOH HOH A . 
N 5 HOH 12 2012 2012 HOH HOH A . 
N 5 HOH 13 2013 2013 HOH HOH A . 
N 5 HOH 14 2014 2014 HOH HOH A . 
N 5 HOH 15 2015 2015 HOH HOH A . 
N 5 HOH 16 2016 2016 HOH HOH A . 
N 5 HOH 17 2017 2017 HOH HOH A . 
N 5 HOH 18 2018 2018 HOH HOH A . 
N 5 HOH 19 2019 2019 HOH HOH A . 
N 5 HOH 20 2020 2020 HOH HOH A . 
N 5 HOH 21 2021 2021 HOH HOH A . 
N 5 HOH 22 2022 2022 HOH HOH A . 
N 5 HOH 23 2023 2023 HOH HOH A . 
N 5 HOH 24 2024 2024 HOH HOH A . 
N 5 HOH 25 2025 2025 HOH HOH A . 
N 5 HOH 26 2026 2026 HOH HOH A . 
N 5 HOH 27 2027 2027 HOH HOH A . 
N 5 HOH 28 2028 2028 HOH HOH A . 
N 5 HOH 29 2029 2029 HOH HOH A . 
N 5 HOH 30 2030 2030 HOH HOH A . 
N 5 HOH 31 2031 2031 HOH HOH A . 
N 5 HOH 32 2032 2032 HOH HOH A . 
N 5 HOH 33 2033 2033 HOH HOH A . 
N 5 HOH 34 2034 2034 HOH HOH A . 
N 5 HOH 35 2035 2035 HOH HOH A . 
N 5 HOH 36 2036 2036 HOH HOH A . 
N 5 HOH 37 2037 2037 HOH HOH A . 
N 5 HOH 38 2038 2038 HOH HOH A . 
N 5 HOH 39 2039 2039 HOH HOH A . 
N 5 HOH 40 2040 2040 HOH HOH A . 
N 5 HOH 41 2041 2041 HOH HOH A . 
N 5 HOH 42 2042 2042 HOH HOH A . 
N 5 HOH 43 2043 2043 HOH HOH A . 
N 5 HOH 44 2044 2044 HOH HOH A . 
N 5 HOH 45 2045 2045 HOH HOH A . 
N 5 HOH 46 2046 2046 HOH HOH A . 
N 5 HOH 47 2047 2047 HOH HOH A . 
N 5 HOH 48 2048 2048 HOH HOH A . 
N 5 HOH 49 2049 2049 HOH HOH A . 
N 5 HOH 50 2050 2050 HOH HOH A . 
N 5 HOH 51 2051 2051 HOH HOH A . 
N 5 HOH 52 2052 2052 HOH HOH A . 
N 5 HOH 53 2053 2053 HOH HOH A . 
N 5 HOH 54 2054 2054 HOH HOH A . 
N 5 HOH 55 2055 2055 HOH HOH A . 
N 5 HOH 56 2056 2056 HOH HOH A . 
N 5 HOH 57 2057 2057 HOH HOH A . 
N 5 HOH 58 2058 2058 HOH HOH A . 
N 5 HOH 59 2059 2059 HOH HOH A . 
N 5 HOH 60 2060 2060 HOH HOH A . 
N 5 HOH 61 2061 2061 HOH HOH A . 
N 5 HOH 62 2062 2062 HOH HOH A . 
N 5 HOH 63 2063 2063 HOH HOH A . 
N 5 HOH 64 2064 2064 HOH HOH A . 
N 5 HOH 65 2065 2065 HOH HOH A . 
N 5 HOH 66 2066 2066 HOH HOH A . 
N 5 HOH 67 2067 2067 HOH HOH A . 
N 5 HOH 68 2068 2068 HOH HOH A . 
N 5 HOH 69 2069 2069 HOH HOH A . 
N 5 HOH 70 2070 2070 HOH HOH A . 
N 5 HOH 71 2071 2071 HOH HOH A . 
N 5 HOH 72 2072 2072 HOH HOH A . 
N 5 HOH 73 2073 2073 HOH HOH A . 
N 5 HOH 74 2074 2074 HOH HOH A . 
N 5 HOH 75 2075 2075 HOH HOH A . 
N 5 HOH 76 2076 2076 HOH HOH A . 
N 5 HOH 77 2077 2077 HOH HOH A . 
N 5 HOH 78 2078 2078 HOH HOH A . 
N 5 HOH 79 2079 2079 HOH HOH A . 
N 5 HOH 80 2080 2080 HOH HOH A . 
N 5 HOH 81 2081 2081 HOH HOH A . 
N 5 HOH 82 2082 2082 HOH HOH A . 
N 5 HOH 83 2083 2083 HOH HOH A . 
N 5 HOH 84 2084 2084 HOH HOH A . 
N 5 HOH 85 2085 2085 HOH HOH A . 
N 5 HOH 86 2086 2086 HOH HOH A . 
N 5 HOH 87 2087 2087 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 18930  ? 
1 MORE         -586.4 ? 
1 'SSA (A^2)'  83320  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_555 -x+y,-x,z    -0.5000000000 0.8660254038  0.0000000000 0.0000000000 -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
3 'crystal symmetry operation' 4_556 y,x,-z+1     -0.5000000000 0.8660254038  0.0000000000 0.0000000000 0.8660254038  0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 97.1810000000 
4 'crystal symmetry operation' 6_556 -x,-x+y,-z+1 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 97.1810000000 
5 'crystal symmetry operation' 2_555 -y,x-y,z     -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
6 'crystal symmetry operation' 5_556 x-y,-y,-z+1  1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
-1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 97.1810000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A SO4 1475 ? K SO4 . 
2 1 A HOH 2039 ? N HOH . 
3 1 A HOH 2082 ? N HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 14  ? A CYS 150 ? 1_555 ZN ? B ZN . ? A ZN 1466 ? 1_555 SG  ? A CYS 18  ? A CYS 154 ? 1_555 114.1 ? 
2  SG  ? A CYS 14  ? A CYS 150 ? 1_555 ZN ? B ZN . ? A ZN 1466 ? 1_555 SG  ? A CYS 76  ? A CYS 212 ? 1_555 113.3 ? 
3  SG  ? A CYS 18  ? A CYS 154 ? 1_555 ZN ? B ZN . ? A ZN 1466 ? 1_555 SG  ? A CYS 76  ? A CYS 212 ? 1_555 112.4 ? 
4  SG  ? A CYS 14  ? A CYS 150 ? 1_555 ZN ? B ZN . ? A ZN 1466 ? 1_555 NE2 ? A HIS 79  ? A HIS 215 ? 1_555 108.0 ? 
5  SG  ? A CYS 18  ? A CYS 154 ? 1_555 ZN ? B ZN . ? A ZN 1466 ? 1_555 NE2 ? A HIS 79  ? A HIS 215 ? 1_555 99.2  ? 
6  SG  ? A CYS 76  ? A CYS 212 ? 1_555 ZN ? B ZN . ? A ZN 1466 ? 1_555 NE2 ? A HIS 79  ? A HIS 215 ? 1_555 108.8 ? 
7  SG  ? A CYS 117 ? A CYS 253 ? 1_555 ZN ? C ZN . ? A ZN 1467 ? 1_555 ND1 ? A HIS 121 ? A HIS 257 ? 1_555 93.0  ? 
8  SG  ? A CYS 117 ? A CYS 253 ? 1_555 ZN ? C ZN . ? A ZN 1467 ? 1_555 SG  ? A CYS 157 ? A CYS 293 ? 1_555 116.4 ? 
9  ND1 ? A HIS 121 ? A HIS 257 ? 1_555 ZN ? C ZN . ? A ZN 1467 ? 1_555 SG  ? A CYS 157 ? A CYS 293 ? 1_555 114.8 ? 
10 SG  ? A CYS 117 ? A CYS 253 ? 1_555 ZN ? C ZN . ? A ZN 1467 ? 1_555 SG  ? A CYS 153 ? A CYS 289 ? 1_555 113.6 ? 
11 ND1 ? A HIS 121 ? A HIS 257 ? 1_555 ZN ? C ZN . ? A ZN 1467 ? 1_555 SG  ? A CYS 153 ? A CYS 289 ? 1_555 97.9  ? 
12 SG  ? A CYS 157 ? A CYS 293 ? 1_555 ZN ? C ZN . ? A ZN 1467 ? 1_555 SG  ? A CYS 153 ? A CYS 289 ? 1_555 117.0 ? 
13 SG  ? A CYS 310 ? A CYS 446 ? 1_555 ZN ? D ZN . ? A ZN 1468 ? 1_555 SG  ? A CYS 313 ? A CYS 449 ? 1_555 112.9 ? 
14 SG  ? A CYS 310 ? A CYS 446 ? 1_555 ZN ? D ZN . ? A ZN 1468 ? 1_555 SG  ? A CYS 321 ? A CYS 457 ? 1_555 113.1 ? 
15 SG  ? A CYS 313 ? A CYS 449 ? 1_555 ZN ? D ZN . ? A ZN 1468 ? 1_555 SG  ? A CYS 321 ? A CYS 457 ? 1_555 115.1 ? 
16 SG  ? A CYS 310 ? A CYS 446 ? 1_555 ZN ? D ZN . ? A ZN 1468 ? 1_555 NE2 ? A HIS 325 ? A HIS 461 ? 1_555 103.2 ? 
17 SG  ? A CYS 313 ? A CYS 449 ? 1_555 ZN ? D ZN . ? A ZN 1468 ? 1_555 NE2 ? A HIS 325 ? A HIS 461 ? 1_555 103.9 ? 
18 SG  ? A CYS 321 ? A CYS 457 ? 1_555 ZN ? D ZN . ? A ZN 1468 ? 1_555 NE2 ? A HIS 325 ? A HIS 461 ? 1_555 107.3 ? 
19 SG  ? A CYS 60  ? A CYS 196 ? 1_555 ZN ? E ZN . ? A ZN 1469 ? 1_555 SG  ? A CYS 65  ? A CYS 201 ? 1_555 115.0 ? 
20 SG  ? A CYS 60  ? A CYS 196 ? 1_555 ZN ? E ZN . ? A ZN 1469 ? 1_555 SG  ? A CYS 30  ? A CYS 166 ? 1_555 110.7 ? 
21 SG  ? A CYS 65  ? A CYS 201 ? 1_555 ZN ? E ZN . ? A ZN 1469 ? 1_555 SG  ? A CYS 30  ? A CYS 166 ? 1_555 107.9 ? 
22 SG  ? A CYS 60  ? A CYS 196 ? 1_555 ZN ? E ZN . ? A ZN 1469 ? 1_555 SG  ? A CYS 33  ? A CYS 169 ? 1_555 107.6 ? 
23 SG  ? A CYS 65  ? A CYS 201 ? 1_555 ZN ? E ZN . ? A ZN 1469 ? 1_555 SG  ? A CYS 33  ? A CYS 169 ? 1_555 110.1 ? 
24 SG  ? A CYS 30  ? A CYS 166 ? 1_555 ZN ? E ZN . ? A ZN 1469 ? 1_555 SG  ? A CYS 33  ? A CYS 169 ? 1_555 105.1 ? 
25 SG  ? A CYS 105 ? A CYS 241 ? 1_555 ZN ? F ZN . ? A ZN 1470 ? 1_555 SG  ? A CYS 124 ? A CYS 260 ? 1_555 115.0 ? 
26 SG  ? A CYS 105 ? A CYS 241 ? 1_555 ZN ? F ZN . ? A ZN 1470 ? 1_555 SG  ? A CYS 127 ? A CYS 263 ? 1_555 109.8 ? 
27 SG  ? A CYS 124 ? A CYS 260 ? 1_555 ZN ? F ZN . ? A ZN 1470 ? 1_555 SG  ? A CYS 127 ? A CYS 263 ? 1_555 102.2 ? 
28 SG  ? A CYS 105 ? A CYS 241 ? 1_555 ZN ? F ZN . ? A ZN 1470 ? 1_555 SG  ? A CYS 102 ? A CYS 238 ? 1_555 105.7 ? 
29 SG  ? A CYS 124 ? A CYS 260 ? 1_555 ZN ? F ZN . ? A ZN 1470 ? 1_555 SG  ? A CYS 102 ? A CYS 238 ? 1_555 115.6 ? 
30 SG  ? A CYS 127 ? A CYS 263 ? 1_555 ZN ? F ZN . ? A ZN 1470 ? 1_555 SG  ? A CYS 102 ? A CYS 238 ? 1_555 108.3 ? 
31 SG  ? A CYS 201 ? A CYS 337 ? 1_555 ZN ? G ZN . ? A ZN 1471 ? 1_555 SG  ? A CYS 216 ? A CYS 352 ? 1_555 102.8 ? 
32 SG  ? A CYS 201 ? A CYS 337 ? 1_555 ZN ? G ZN . ? A ZN 1471 ? 1_555 SG  ? A CYS 196 ? A CYS 332 ? 1_555 107.8 ? 
33 SG  ? A CYS 216 ? A CYS 352 ? 1_555 ZN ? G ZN . ? A ZN 1471 ? 1_555 SG  ? A CYS 196 ? A CYS 332 ? 1_555 91.9  ? 
34 NE2 ? A HIS 237 ? A HIS 373 ? 1_555 ZN ? H ZN . ? A ZN 1472 ? 1_555 SG  ? A CYS 229 ? A CYS 365 ? 1_555 98.8  ? 
35 NE2 ? A HIS 237 ? A HIS 373 ? 1_555 ZN ? H ZN . ? A ZN 1472 ? 1_555 SG  ? A CYS 241 ? A CYS 377 ? 1_555 99.7  ? 
36 SG  ? A CYS 229 ? A CYS 365 ? 1_555 ZN ? H ZN . ? A ZN 1472 ? 1_555 SG  ? A CYS 241 ? A CYS 377 ? 1_555 111.7 ? 
37 SG  ? A CYS 285 ? A CYS 421 ? 1_555 ZN ? I ZN . ? A ZN 1473 ? 1_555 SG  ? A CYS 300 ? A CYS 436 ? 1_555 101.5 ? 
38 SG  ? A CYS 285 ? A CYS 421 ? 1_555 ZN ? I ZN . ? A ZN 1473 ? 1_555 SG  ? A CYS 305 ? A CYS 441 ? 1_555 116.5 ? 
39 SG  ? A CYS 300 ? A CYS 436 ? 1_555 ZN ? I ZN . ? A ZN 1473 ? 1_555 SG  ? A CYS 305 ? A CYS 441 ? 1_555 109.0 ? 
40 SG  ? A CYS 285 ? A CYS 421 ? 1_555 ZN ? I ZN . ? A ZN 1473 ? 1_555 SG  ? A CYS 282 ? A CYS 418 ? 1_555 110.7 ? 
41 SG  ? A CYS 300 ? A CYS 436 ? 1_555 ZN ? I ZN . ? A ZN 1473 ? 1_555 SG  ? A CYS 282 ? A CYS 418 ? 1_555 114.7 ? 
42 SG  ? A CYS 305 ? A CYS 441 ? 1_555 ZN ? I ZN . ? A ZN 1473 ? 1_555 SG  ? A CYS 282 ? A CYS 418 ? 1_555 104.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-06-12 
2 'Structure model' 1 1 2013-08-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -4.6852  37.8283 40.8627 0.1429 0.1607 0.3154 -0.0274 0.0532  0.0689  3.6699 1.8064 3.5802 -0.2365 
0.6200  -1.0270 -0.1087 0.0374  0.4823  0.0519  0.0142  0.1748  -0.1695 -0.0859 0.0990  
'X-RAY DIFFRACTION' 2 ? refined 17.5073  29.4903 32.7026 0.1446 0.2570 0.1531 0.0293  0.0220  0.0067  5.3074 3.2795 2.7110 0.5771  
-0.8566 -0.0369 0.0540  0.6927  -0.3486 -0.1163 -0.0830 0.0320  0.0795  -0.0718 -0.0099 
'X-RAY DIFFRACTION' 3 ? refined 37.2630  37.5980 41.5675 0.8087 0.4265 0.5610 -0.1976 -0.1288 0.0965  1.7533 5.1590 1.3574 0.8209  
-0.6055 0.5430  0.3375  -0.1642 -0.1934 1.2760  -0.9036 -1.7778 0.0628  0.3815  0.1883  
'X-RAY DIFFRACTION' 4 ? refined 13.6201  14.2401 27.2699 0.4545 0.4780 0.9018 -0.0458 -0.0453 -0.2219 0.1097 5.3914 6.5200 0.0739  
0.6231  0.1201  -0.0301 0.2973  -0.2044 -0.4234 -0.0775 0.2869  0.4769  -0.2901 0.3001  
'X-RAY DIFFRACTION' 5 ? refined -17.2654 22.9616 36.8067 0.3042 0.2224 0.2854 -0.0568 0.0075  0.0941  3.9238 2.8388 1.4560 2.6615  
0.1217  -0.0545 -0.3499 0.5719  0.1755  -0.6103 0.2344  0.1779  0.0441  -0.0514 0.1077  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 142 THROUGH 227 )' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 228 THROUGH 327 )' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 328 THROUGH 382 )' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 391 THROUGH 404 )' 
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 414 THROUGH 465 )' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
MOSFLM 'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
SHELX  phasing          .                 ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    143 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OD2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASP 
_pdbx_validate_close_contact.auth_seq_id_2    464 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.08 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 199 ? ? -34.78  -73.47 
2 1 THR A 242 ? ? 61.25   -1.50  
3 1 CYS A 441 ? ? -110.79 -71.84 
4 1 HIS A 461 ? ? -153.39 55.87  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 155 ? CG  ? A GLN 19  CG  
2   1 Y 1 A GLN 155 ? CD  ? A GLN 19  CD  
3   1 Y 1 A GLN 155 ? OE1 ? A GLN 19  OE1 
4   1 Y 1 A GLN 155 ? NE2 ? A GLN 19  NE2 
5   1 Y 1 A GLU 195 ? CG  ? A GLU 59  CG  
6   1 Y 1 A GLU 195 ? CD  ? A GLU 59  CD  
7   1 Y 1 A GLU 195 ? OE1 ? A GLU 59  OE1 
8   1 Y 1 A GLU 195 ? OE2 ? A GLU 59  OE2 
9   1 Y 1 A GLN 197 ? CG  ? A GLN 61  CG  
10  1 Y 1 A GLN 197 ? CD  ? A GLN 61  CD  
11  1 Y 1 A GLN 197 ? OE1 ? A GLN 61  OE1 
12  1 Y 1 A GLN 197 ? NE2 ? A GLN 61  NE2 
13  1 Y 1 A ARG 256 ? CG  ? A ARG 120 CG  
14  1 Y 1 A ARG 256 ? CD  ? A ARG 120 CD  
15  1 Y 1 A ARG 256 ? NE  ? A ARG 120 NE  
16  1 Y 1 A ARG 256 ? CZ  ? A ARG 120 CZ  
17  1 Y 1 A ARG 256 ? NH1 ? A ARG 120 NH1 
18  1 Y 1 A ARG 256 ? NH2 ? A ARG 120 NH2 
19  1 Y 1 A GLN 282 ? CG  ? A GLN 146 CG  
20  1 Y 1 A GLN 282 ? CD  ? A GLN 146 CD  
21  1 Y 1 A GLN 282 ? OE1 ? A GLN 146 OE1 
22  1 Y 1 A GLN 282 ? NE2 ? A GLN 146 NE2 
23  1 Y 1 A LEU 283 ? CG  ? A LEU 147 CG  
24  1 Y 1 A LEU 283 ? CD1 ? A LEU 147 CD1 
25  1 Y 1 A LEU 283 ? CD2 ? A LEU 147 CD2 
26  1 Y 1 A ASN 295 ? CG  ? A ASN 159 CG  
27  1 Y 1 A ASN 295 ? OD1 ? A ASN 159 OD1 
28  1 Y 1 A ASN 295 ? ND2 ? A ASN 159 ND2 
29  1 Y 1 A GLU 310 ? CB  ? A GLU 174 CB  
30  1 Y 1 A GLU 310 ? CG  ? A GLU 174 CG  
31  1 Y 1 A GLU 310 ? CD  ? A GLU 174 CD  
32  1 Y 1 A GLU 310 ? OE1 ? A GLU 174 OE1 
33  1 Y 1 A GLU 310 ? OE2 ? A GLU 174 OE2 
34  1 Y 1 A ASN 313 ? CG  ? A ASN 177 CG  
35  1 Y 1 A ASN 313 ? OD1 ? A ASN 177 OD1 
36  1 Y 1 A ASN 313 ? ND2 ? A ASN 177 ND2 
37  1 Y 1 A ARG 334 ? CG  ? A ARG 198 CG  
38  1 Y 1 A ARG 334 ? CD  ? A ARG 198 CD  
39  1 Y 1 A ARG 334 ? NE  ? A ARG 198 NE  
40  1 Y 1 A ARG 334 ? CZ  ? A ARG 198 CZ  
41  1 Y 1 A ARG 334 ? NH1 ? A ARG 198 NH1 
42  1 Y 1 A ARG 334 ? NH2 ? A ARG 198 NH2 
43  1 Y 1 A GLU 344 ? CG  ? A GLU 208 CG  
44  1 Y 1 A GLU 344 ? CD  ? A GLU 208 CD  
45  1 Y 1 A GLU 344 ? OE1 ? A GLU 208 OE1 
46  1 Y 1 A GLU 344 ? OE2 ? A GLU 208 OE2 
47  1 Y 1 A ASP 346 ? CG  ? A ASP 210 CG  
48  1 Y 1 A ASP 346 ? OD1 ? A ASP 210 OD1 
49  1 Y 1 A ASP 346 ? OD2 ? A ASP 210 OD2 
50  1 Y 1 A GLU 353 ? CG  ? A GLU 217 CG  
51  1 Y 1 A GLU 353 ? CD  ? A GLU 217 CD  
52  1 Y 1 A GLU 353 ? OE1 ? A GLU 217 OE1 
53  1 Y 1 A GLU 353 ? OE2 ? A GLU 217 OE2 
54  1 Y 1 A GLU 370 ? CG  ? A GLU 234 CG  
55  1 Y 1 A GLU 370 ? CD  ? A GLU 234 CD  
56  1 Y 1 A GLU 370 ? OE1 ? A GLU 234 OE1 
57  1 Y 1 A GLU 370 ? OE2 ? A GLU 234 OE2 
58  1 Y 1 A GLU 374 ? CG  ? A GLU 238 CG  
59  1 Y 1 A GLU 374 ? CD  ? A GLU 238 CD  
60  1 Y 1 A GLU 374 ? OE1 ? A GLU 238 OE1 
61  1 Y 1 A GLU 374 ? OE2 ? A GLU 238 OE2 
62  1 Y 1 A TYR 391 ? CG  ? A TYR 255 CG  
63  1 Y 1 A TYR 391 ? CD1 ? A TYR 255 CD1 
64  1 Y 1 A TYR 391 ? CD2 ? A TYR 255 CD2 
65  1 Y 1 A TYR 391 ? CE1 ? A TYR 255 CE1 
66  1 Y 1 A TYR 391 ? CE2 ? A TYR 255 CE2 
67  1 Y 1 A TYR 391 ? CZ  ? A TYR 255 CZ  
68  1 Y 1 A TYR 391 ? OH  ? A TYR 255 OH  
69  1 Y 1 A ARG 392 ? CG  ? A ARG 256 CG  
70  1 Y 1 A ARG 392 ? CD  ? A ARG 256 CD  
71  1 Y 1 A ARG 392 ? NE  ? A ARG 256 NE  
72  1 Y 1 A ARG 392 ? CZ  ? A ARG 256 CZ  
73  1 Y 1 A ARG 392 ? NH1 ? A ARG 256 NH1 
74  1 Y 1 A ARG 392 ? NH2 ? A ARG 256 NH2 
75  1 Y 1 A GLU 395 ? CG  ? A GLU 259 CG  
76  1 Y 1 A GLU 395 ? CD  ? A GLU 259 CD  
77  1 Y 1 A GLU 395 ? OE1 ? A GLU 259 OE1 
78  1 Y 1 A GLU 395 ? OE2 ? A GLU 259 OE2 
79  1 Y 1 A ARG 396 ? CG  ? A ARG 260 CG  
80  1 Y 1 A ARG 396 ? CD  ? A ARG 260 CD  
81  1 Y 1 A ARG 396 ? NE  ? A ARG 260 NE  
82  1 Y 1 A ARG 396 ? CZ  ? A ARG 260 CZ  
83  1 Y 1 A ARG 396 ? NH1 ? A ARG 260 NH1 
84  1 Y 1 A ARG 396 ? NH2 ? A ARG 260 NH2 
85  1 Y 1 A GLU 399 ? CG  ? A GLU 263 CG  
86  1 Y 1 A GLU 399 ? CD  ? A GLU 263 CD  
87  1 Y 1 A GLU 399 ? OE1 ? A GLU 263 OE1 
88  1 Y 1 A GLU 399 ? OE2 ? A GLU 263 OE2 
89  1 Y 1 A ARG 402 ? CG  ? A ARG 266 CG  
90  1 Y 1 A ARG 402 ? CD  ? A ARG 266 CD  
91  1 Y 1 A ARG 402 ? NE  ? A ARG 266 NE  
92  1 Y 1 A ARG 402 ? CZ  ? A ARG 266 CZ  
93  1 Y 1 A ARG 402 ? NH1 ? A ARG 266 NH1 
94  1 Y 1 A ARG 402 ? NH2 ? A ARG 266 NH2 
95  1 Y 1 A LYS 413 ? CG  ? A LYS 277 CG  
96  1 Y 1 A LYS 413 ? CD  ? A LYS 277 CD  
97  1 Y 1 A LYS 413 ? CE  ? A LYS 277 CE  
98  1 Y 1 A LYS 413 ? NZ  ? A LYS 277 NZ  
99  1 Y 1 A GLU 426 ? CG  ? A GLU 290 CG  
100 1 Y 1 A GLU 426 ? CD  ? A GLU 290 CD  
101 1 Y 1 A GLU 426 ? OE1 ? A GLU 290 OE1 
102 1 Y 1 A GLU 426 ? OE2 ? A GLU 290 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 137 ? A PRO 1   
2  1 Y 1 A ALA 138 ? A ALA 2   
3  1 Y 1 A GLY 139 ? A GLY 3   
4  1 Y 1 A ARG 140 ? A ARG 4   
5  1 Y 1 A SER 141 ? A SER 5   
6  1 Y 1 A GLY 354 ? A GLY 218 
7  1 Y 1 A GLY 355 ? A GLY 219 
8  1 Y 1 A ASN 356 ? A ASN 220 
9  1 Y 1 A GLY 357 ? A GLY 221 
10 1 Y 1 A LEU 358 ? A LEU 222 
11 1 Y 1 A GLY 359 ? A GLY 223 
12 1 Y 1 A CYS 360 ? A CYS 224 
13 1 Y 1 A GLY 361 ? A GLY 225 
14 1 Y 1 A SER 384 ? A SER 248 
15 1 Y 1 A GLY 385 ? A GLY 249 
16 1 Y 1 A THR 386 ? A THR 250 
17 1 Y 1 A THR 387 ? A THR 251 
18 1 Y 1 A THR 388 ? A THR 252 
19 1 Y 1 A GLN 389 ? A GLN 253 
20 1 Y 1 A ALA 390 ? A ALA 254 
21 1 Y 1 A ALA 405 ? A ALA 269 
22 1 Y 1 A ALA 406 ? A ALA 270 
23 1 Y 1 A SER 407 ? A SER 271 
24 1 Y 1 A LYS 408 ? A LYS 272 
25 1 Y 1 A GLU 409 ? A GLU 273 
26 1 Y 1 A THR 410 ? A THR 274 
27 1 Y 1 A ILE 411 ? A ILE 275 
28 1 Y 1 A LYS 412 ? A LYS 276 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'SULFATE ION' SO4 
4 GLYCEROL      GOL 
5 water         HOH 
#