data_4BPW
# 
_entry.id   4BPW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BPW         
PDBE  EBI-57043    
WWPDB D_1290057043 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4BPU unspecified 
'CRYSTAL STRUCTURE OF HUMAN PRIMASE IN HETERODIMERIC FORM, COMPRISING PRIS AND TRUNCATED PRIL LACKING THE C-TERMINAL FE-S DOMAIN.' 
PDB 4BPX unspecified 'CRYSTAL STRUCTURE OF HUMAN PRIMASE IN COMPLEX WITH THE PRIMASE-BINDING MOTIF OF DNA POLYMERASE ALPHA' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BPW 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kilkenny, M.L.' 1 
'Perera, R.L.'   2 
'Pellegrini, L.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structures of Human Primase Reveal Design of Nucleotide Elongation Site and Mode of Pol Alpha Tethering' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                15961 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24043831 
_citation.pdbx_database_id_DOI      10.1073/PNAS.1311185110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kilkenny, M.L.' 1 
primary 'Longo, M.A.'    2 
primary 'Perera, R.L.'   3 
primary 'Pellegrini, L.' 4 
# 
_cell.entry_id           4BPW 
_cell.length_a           116.394 
_cell.length_b           69.438 
_cell.length_c           127.087 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.90 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BPW 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA PRIMASE SMALL SUBUNIT' 50108.023 2 2.7.7.- YES PRIS                   ? 
2 polymer     man 'DNA PRIMASE LARGE SUBUNIT' 29782.174 2 2.7.7.- ?   'PRIL, RESIDUES 1-253' ? 
3 non-polymer syn 'ZINC ION'                  65.409    2 ?       ?   ?                      ? 
4 non-polymer syn 'MAGNESIUM ION'             24.305    4 ?       ?   ?                      ? 
5 non-polymer syn 
;URIDINE 5'-TRIPHOSPHATE
;
484.141   2 ?       ?   ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PRIMASE, DNA PRIMASE 49 KDA SUBUNIT, P49' 
2 'PRIMASE, DNA PRIMASE 58 KDA SUBUNIT, P58' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GTSMETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYK
IDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLW
VYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENK
ESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLL
KSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEH
FLENLDKSRKGELLKKSDLQKDF
;
;GTSMETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYK
IDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLW
VYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENK
ESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLL
KSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEH
FLENLDKSRKGELLKKSDLQKDF
;
A,C ? 
2 'polypeptide(L)' no no 
;MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRK
LKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKT
LREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHL
;
;MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRK
LKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKT
LREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHL
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   THR n 
1 3   SER n 
1 4   MET n 
1 5   GLU n 
1 6   THR n 
1 7   PHE n 
1 8   ASP n 
1 9   PRO n 
1 10  THR n 
1 11  GLU n 
1 12  LEU n 
1 13  PRO n 
1 14  GLU n 
1 15  LEU n 
1 16  LEU n 
1 17  LYS n 
1 18  LEU n 
1 19  TYR n 
1 20  TYR n 
1 21  ARG n 
1 22  ARG n 
1 23  LEU n 
1 24  PHE n 
1 25  PRO n 
1 26  TYR n 
1 27  SER n 
1 28  GLN n 
1 29  TYR n 
1 30  TYR n 
1 31  ARG n 
1 32  TRP n 
1 33  LEU n 
1 34  ASN n 
1 35  TYR n 
1 36  GLY n 
1 37  GLY n 
1 38  VAL n 
1 39  ILE n 
1 40  LYS n 
1 41  ASN n 
1 42  TYR n 
1 43  PHE n 
1 44  GLN n 
1 45  HIS n 
1 46  ARG n 
1 47  GLU n 
1 48  PHE n 
1 49  SER n 
1 50  PHE n 
1 51  THR n 
1 52  LEU n 
1 53  LYS n 
1 54  ASP n 
1 55  ASP n 
1 56  ILE n 
1 57  TYR n 
1 58  ILE n 
1 59  ARG n 
1 60  TYR n 
1 61  GLN n 
1 62  SER n 
1 63  PHE n 
1 64  ASN n 
1 65  ASN n 
1 66  GLN n 
1 67  SER n 
1 68  ASP n 
1 69  LEU n 
1 70  GLU n 
1 71  LYS n 
1 72  GLU n 
1 73  MET n 
1 74  GLN n 
1 75  ALA n 
1 76  ALA n 
1 77  ASN n 
1 78  PRO n 
1 79  TYR n 
1 80  LYS n 
1 81  ILE n 
1 82  ASP n 
1 83  ILE n 
1 84  GLY n 
1 85  ALA n 
1 86  VAL n 
1 87  TYR n 
1 88  SER n 
1 89  HIS n 
1 90  ARG n 
1 91  PRO n 
1 92  ASN n 
1 93  GLN n 
1 94  HIS n 
1 95  ASN n 
1 96  THR n 
1 97  VAL n 
1 98  LYS n 
1 99  LEU n 
1 100 GLY n 
1 101 ALA n 
1 102 PHE n 
1 103 GLN n 
1 104 ALA n 
1 105 GLN n 
1 106 GLU n 
1 107 LYS n 
1 108 GLU n 
1 109 LEU n 
1 110 VAL n 
1 111 PHE n 
1 112 ASP n 
1 113 ILE n 
1 114 ASP n 
1 115 MET n 
1 116 THR n 
1 117 ASP n 
1 118 TYR n 
1 119 ASP n 
1 120 ASP n 
1 121 VAL n 
1 122 ARG n 
1 123 ARG n 
1 124 CYS n 
1 125 CYS n 
1 126 SER n 
1 127 SER n 
1 128 ALA n 
1 129 ASP n 
1 130 ILE n 
1 131 CYS n 
1 132 PRO n 
1 133 LYS n 
1 134 CYS n 
1 135 TRP n 
1 136 THR n 
1 137 LEU n 
1 138 MET n 
1 139 THR n 
1 140 MET n 
1 141 ALA n 
1 142 ILE n 
1 143 ARG n 
1 144 ILE n 
1 145 ILE n 
1 146 ASP n 
1 147 ARG n 
1 148 ALA n 
1 149 LEU n 
1 150 LYS n 
1 151 GLU n 
1 152 ASP n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LYS n 
1 157 HIS n 
1 158 ARG n 
1 159 LEU n 
1 160 TRP n 
1 161 VAL n 
1 162 TYR n 
1 163 SER n 
1 164 GLY n 
1 165 ARG n 
1 166 ARG n 
1 167 GLY n 
1 168 VAL n 
1 169 HIS n 
1 170 CYS n 
1 171 TRP n 
1 172 VAL n 
1 173 CYS n 
1 174 ASP n 
1 175 GLU n 
1 176 SER n 
1 177 VAL n 
1 178 ARG n 
1 179 LYS n 
1 180 LEU n 
1 181 SER n 
1 182 SER n 
1 183 ALA n 
1 184 VAL n 
1 185 ARG n 
1 186 SER n 
1 187 GLY n 
1 188 ILE n 
1 189 VAL n 
1 190 GLU n 
1 191 TYR n 
1 192 LEU n 
1 193 SER n 
1 194 LEU n 
1 195 VAL n 
1 196 LYS n 
1 197 GLY n 
1 198 GLY n 
1 199 GLN n 
1 200 ASP n 
1 201 VAL n 
1 202 LYS n 
1 203 LYS n 
1 204 LYS n 
1 205 VAL n 
1 206 HIS n 
1 207 LEU n 
1 208 SER n 
1 209 GLU n 
1 210 LYS n 
1 211 ILE n 
1 212 HIS n 
1 213 PRO n 
1 214 PHE n 
1 215 ILE n 
1 216 ARG n 
1 217 LYS n 
1 218 SER n 
1 219 ILE n 
1 220 ASN n 
1 221 ILE n 
1 222 ILE n 
1 223 LYS n 
1 224 LYS n 
1 225 TYR n 
1 226 PHE n 
1 227 GLU n 
1 228 GLU n 
1 229 TYR n 
1 230 ALA n 
1 231 LEU n 
1 232 VAL n 
1 233 ASN n 
1 234 GLN n 
1 235 ASP n 
1 236 ILE n 
1 237 LEU n 
1 238 GLU n 
1 239 ASN n 
1 240 LYS n 
1 241 GLU n 
1 242 SER n 
1 243 TRP n 
1 244 ASP n 
1 245 LYS n 
1 246 ILE n 
1 247 LEU n 
1 248 ALA n 
1 249 LEU n 
1 250 VAL n 
1 251 PRO n 
1 252 GLU n 
1 253 THR n 
1 254 ILE n 
1 255 HIS n 
1 256 ASP n 
1 257 GLU n 
1 258 LEU n 
1 259 GLN n 
1 260 GLN n 
1 261 SER n 
1 262 PHE n 
1 263 GLN n 
1 264 LYS n 
1 265 SER n 
1 266 HIS n 
1 267 ASN n 
1 268 SER n 
1 269 LEU n 
1 270 GLN n 
1 271 ARG n 
1 272 TRP n 
1 273 GLU n 
1 274 HIS n 
1 275 LEU n 
1 276 LYS n 
1 277 LYS n 
1 278 VAL n 
1 279 ALA n 
1 280 SER n 
1 281 ARG n 
1 282 TYR n 
1 283 GLN n 
1 284 ASN n 
1 285 ASN n 
1 286 ILE n 
1 287 LYS n 
1 288 ASN n 
1 289 ASP n 
1 290 LYS n 
1 291 TYR n 
1 292 GLY n 
1 293 PRO n 
1 294 TRP n 
1 295 LEU n 
1 296 GLU n 
1 297 TRP n 
1 298 GLU n 
1 299 ILE n 
1 300 MET n 
1 301 LEU n 
1 302 GLN n 
1 303 TYR n 
1 304 CYS n 
1 305 PHE n 
1 306 PRO n 
1 307 ARG n 
1 308 LEU n 
1 309 ASP n 
1 310 ILE n 
1 311 ASN n 
1 312 VAL n 
1 313 SER n 
1 314 LYS n 
1 315 GLY n 
1 316 ILE n 
1 317 ASN n 
1 318 HIS n 
1 319 LEU n 
1 320 LEU n 
1 321 LYS n 
1 322 SER n 
1 323 PRO n 
1 324 PHE n 
1 325 SER n 
1 326 VAL n 
1 327 HIS n 
1 328 PRO n 
1 329 LYS n 
1 330 THR n 
1 331 GLY n 
1 332 ARG n 
1 333 ILE n 
1 334 SER n 
1 335 VAL n 
1 336 PRO n 
1 337 ILE n 
1 338 ASP n 
1 339 LEU n 
1 340 GLN n 
1 341 LYS n 
1 342 VAL n 
1 343 ASP n 
1 344 GLN n 
1 345 PHE n 
1 346 ASP n 
1 347 PRO n 
1 348 PHE n 
1 349 THR n 
1 350 VAL n 
1 351 PRO n 
1 352 THR n 
1 353 ILE n 
1 354 SER n 
1 355 PHE n 
1 356 ILE n 
1 357 CYS n 
1 358 ARG n 
1 359 GLU n 
1 360 LEU n 
1 361 ASP n 
1 362 ALA n 
1 363 ILE n 
1 364 SER n 
1 365 THR n 
1 366 ASN n 
1 367 GLU n 
1 368 GLU n 
1 369 GLU n 
1 370 LYS n 
1 371 GLU n 
1 372 GLU n 
1 373 ASN n 
1 374 GLU n 
1 375 ALA n 
1 376 GLU n 
1 377 SER n 
1 378 ASP n 
1 379 VAL n 
1 380 LYS n 
1 381 HIS n 
1 382 ARG n 
1 383 THR n 
1 384 ARG n 
1 385 ASP n 
1 386 TYR n 
1 387 LYS n 
1 388 LYS n 
1 389 THR n 
1 390 SER n 
1 391 LEU n 
1 392 ALA n 
1 393 PRO n 
1 394 TYR n 
1 395 VAL n 
1 396 LYS n 
1 397 VAL n 
1 398 PHE n 
1 399 GLU n 
1 400 HIS n 
1 401 PHE n 
1 402 LEU n 
1 403 GLU n 
1 404 ASN n 
1 405 LEU n 
1 406 ASP n 
1 407 LYS n 
1 408 SER n 
1 409 ARG n 
1 410 LYS n 
1 411 GLY n 
1 412 GLU n 
1 413 LEU n 
1 414 LEU n 
1 415 LYS n 
1 416 LYS n 
1 417 SER n 
1 418 ASP n 
1 419 LEU n 
1 420 GLN n 
1 421 LYS n 
1 422 ASP n 
1 423 PHE n 
2 1   MET n 
2 2   GLU n 
2 3   PHE n 
2 4   SER n 
2 5   GLY n 
2 6   ARG n 
2 7   LYS n 
2 8   TRP n 
2 9   ARG n 
2 10  LYS n 
2 11  LEU n 
2 12  ARG n 
2 13  LEU n 
2 14  ALA n 
2 15  GLY n 
2 16  ASP n 
2 17  GLN n 
2 18  ARG n 
2 19  ASN n 
2 20  ALA n 
2 21  SER n 
2 22  TYR n 
2 23  PRO n 
2 24  HIS n 
2 25  CYS n 
2 26  LEU n 
2 27  GLN n 
2 28  PHE n 
2 29  TYR n 
2 30  LEU n 
2 31  GLN n 
2 32  PRO n 
2 33  PRO n 
2 34  SER n 
2 35  GLU n 
2 36  ASN n 
2 37  ILE n 
2 38  SER n 
2 39  LEU n 
2 40  ILE n 
2 41  GLU n 
2 42  PHE n 
2 43  GLU n 
2 44  ASN n 
2 45  LEU n 
2 46  ALA n 
2 47  ILE n 
2 48  ASP n 
2 49  ARG n 
2 50  VAL n 
2 51  LYS n 
2 52  LEU n 
2 53  LEU n 
2 54  LYS n 
2 55  SER n 
2 56  VAL n 
2 57  GLU n 
2 58  ASN n 
2 59  LEU n 
2 60  GLY n 
2 61  VAL n 
2 62  SER n 
2 63  TYR n 
2 64  VAL n 
2 65  LYS n 
2 66  GLY n 
2 67  THR n 
2 68  GLU n 
2 69  GLN n 
2 70  TYR n 
2 71  GLN n 
2 72  SER n 
2 73  LYS n 
2 74  LEU n 
2 75  GLU n 
2 76  SER n 
2 77  GLU n 
2 78  LEU n 
2 79  ARG n 
2 80  LYS n 
2 81  LEU n 
2 82  LYS n 
2 83  PHE n 
2 84  SER n 
2 85  TYR n 
2 86  ARG n 
2 87  GLU n 
2 88  ASN n 
2 89  LEU n 
2 90  GLU n 
2 91  ASP n 
2 92  GLU n 
2 93  TYR n 
2 94  GLU n 
2 95  PRO n 
2 96  ARG n 
2 97  ARG n 
2 98  ARG n 
2 99  ASP n 
2 100 HIS n 
2 101 ILE n 
2 102 SER n 
2 103 HIS n 
2 104 PHE n 
2 105 ILE n 
2 106 LEU n 
2 107 ARG n 
2 108 LEU n 
2 109 ALA n 
2 110 TYR n 
2 111 CYS n 
2 112 GLN n 
2 113 SER n 
2 114 GLU n 
2 115 GLU n 
2 116 LEU n 
2 117 ARG n 
2 118 ARG n 
2 119 TRP n 
2 120 PHE n 
2 121 ILE n 
2 122 GLN n 
2 123 GLN n 
2 124 GLU n 
2 125 MET n 
2 126 ASP n 
2 127 LEU n 
2 128 LEU n 
2 129 ARG n 
2 130 PHE n 
2 131 ARG n 
2 132 PHE n 
2 133 SER n 
2 134 ILE n 
2 135 LEU n 
2 136 PRO n 
2 137 LYS n 
2 138 ASP n 
2 139 LYS n 
2 140 ILE n 
2 141 GLN n 
2 142 ASP n 
2 143 PHE n 
2 144 LEU n 
2 145 LYS n 
2 146 ASP n 
2 147 SER n 
2 148 GLN n 
2 149 LEU n 
2 150 GLN n 
2 151 PHE n 
2 152 GLU n 
2 153 ALA n 
2 154 ILE n 
2 155 SER n 
2 156 ASP n 
2 157 GLU n 
2 158 GLU n 
2 159 LYS n 
2 160 THR n 
2 161 LEU n 
2 162 ARG n 
2 163 GLU n 
2 164 GLN n 
2 165 GLU n 
2 166 ILE n 
2 167 VAL n 
2 168 ALA n 
2 169 SER n 
2 170 SER n 
2 171 PRO n 
2 172 SER n 
2 173 LEU n 
2 174 SER n 
2 175 GLY n 
2 176 LEU n 
2 177 LYS n 
2 178 LEU n 
2 179 GLY n 
2 180 PHE n 
2 181 GLU n 
2 182 SER n 
2 183 ILE n 
2 184 TYR n 
2 185 LYS n 
2 186 ILE n 
2 187 PRO n 
2 188 PHE n 
2 189 ALA n 
2 190 ASP n 
2 191 ALA n 
2 192 LEU n 
2 193 ASP n 
2 194 LEU n 
2 195 PHE n 
2 196 ARG n 
2 197 GLY n 
2 198 ARG n 
2 199 LYS n 
2 200 VAL n 
2 201 TYR n 
2 202 LEU n 
2 203 GLU n 
2 204 ASP n 
2 205 GLY n 
2 206 PHE n 
2 207 ALA n 
2 208 TYR n 
2 209 VAL n 
2 210 PRO n 
2 211 LEU n 
2 212 LYS n 
2 213 ASP n 
2 214 ILE n 
2 215 VAL n 
2 216 ALA n 
2 217 ILE n 
2 218 ILE n 
2 219 LEU n 
2 220 ASN n 
2 221 GLU n 
2 222 PHE n 
2 223 ARG n 
2 224 ALA n 
2 225 LYS n 
2 226 LEU n 
2 227 SER n 
2 228 LYS n 
2 229 ALA n 
2 230 LEU n 
2 231 ALA n 
2 232 LEU n 
2 233 THR n 
2 234 ALA n 
2 235 ARG n 
2 236 SER n 
2 237 LEU n 
2 238 PRO n 
2 239 ALA n 
2 240 VAL n 
2 241 GLN n 
2 242 SER n 
2 243 ASP n 
2 244 GLU n 
2 245 ARG n 
2 246 LEU n 
2 247 GLN n 
2 248 PRO n 
2 249 LEU n 
2 250 LEU n 
2 251 ASN n 
2 252 HIS n 
2 253 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' 
ROSETTA2 ? ? ? ? ? ? PLASMID PRSFDUET-1 ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' 
ROSETTA2 ? ? ? ? ? ? PLASMID PRSFDUET-1 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PRI1_HUMAN 1 ? ? P49642 ? 
2 UNP PRI2_HUMAN 2 ? ? P49643 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4BPW A 4 ? 423 ? P49642 1 ? 420 ? 1 420 
2 2 4BPW B 1 ? 253 ? P49643 1 ? 253 ? 1 253 
3 1 4BPW C 4 ? 423 ? P49642 1 ? 420 ? 1 420 
4 2 4BPW D 1 ? 253 ? P49643 1 ? 253 ? 1 253 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4BPW GLY A 1  ? UNP P49642 ?   ?  'expression tag'      -2 1  
1 4BPW THR A 2  ? UNP P49642 ?   ?  'expression tag'      -1 2  
1 4BPW SER A 3  ? UNP P49642 ?   ?  'expression tag'      0  3  
1 4BPW ALA A 75 ? UNP P49642 LYS 72 'engineered mutation' 72 4  
1 4BPW ALA A 76 ? UNP P49642 MET 73 'engineered mutation' 73 5  
3 4BPW GLY C 1  ? UNP P49642 ?   ?  'expression tag'      -2 6  
3 4BPW THR C 2  ? UNP P49642 ?   ?  'expression tag'      -1 7  
3 4BPW SER C 3  ? UNP P49642 ?   ?  'expression tag'      0  8  
3 4BPW ALA C 75 ? UNP P49642 LYS 72 'engineered mutation' 72 9  
3 4BPW ALA C 76 ? UNP P49642 MET 73 'engineered mutation' 73 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'           ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'      181.189 
UTP non-polymer         . 
;URIDINE 5'-TRIPHOSPHATE
;
? 'C9 H15 N2 O15 P3' 484.141 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'      117.146 
ZN  non-polymer         . 'ZINC ION'                ? 'Zn 2'             65.409  
# 
_exptl.entry_id          4BPW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.5 
_exptl_crystal.density_percent_sol   65 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100MM TRIS-HCL/BICINE PH 8.5, 20% GLYCEROL, 10% PEG4000 AND 20MM EACH OF AN ALCOHOL MIX COMPRISING 1,6-HEXANEDIOL, 1-BUTANOL, 1,2-PROPANEDIOL, 2-PROPANOL, 1,4-BUTANEDIOL AND 1,3-PROPANEDIOL.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2011-09-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             0.9795 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BPW 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.87 
_reflns.d_resolution_high            3.00 
_reflns.number_obs                   39304 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.50 
_reflns.B_iso_Wilson_estimate        105.46 
_reflns.pdbx_redundancy              4.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.13 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           1.50 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.20 
_reflns_shell.pdbx_redundancy        4.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BPW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     39252 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.27 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.784 
_refine.ls_d_res_high                            3.003 
_refine.ls_percent_reflns_obs                    98.28 
_refine.ls_R_factor_obs                          0.2172 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2152 
_refine.ls_R_factor_R_free                       0.2534 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3832 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               94.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.10 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'THE STRUCTURE WAS REFINED IN PHENIX WITH RIDING HYDROGENS. THE HYDROGENS HAVE BEEN INCLUDED IN THE ENTRY.' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.50 
_refine.pdbx_overall_phase_error                 32.12 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9784 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               9848 
_refine_hist.d_res_high                       3.003 
_refine_hist.d_res_low                        46.784 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 10087 'X-RAY DIFFRACTION' ? 
f_angle_d          0.924  ? ? 13608 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.629 ? ? 3848  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.037  ? ? 1460  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1719  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.0026 3.0406  2468 0.4547 92.00 0.4662 . . 125 . . 
'X-RAY DIFFRACTION' . 3.0406 3.0806  2731 0.4293 98.00 0.4371 . . 113 . . 
'X-RAY DIFFRACTION' . 3.0806 3.1228  2618 0.3830 99.00 0.4276 . . 146 . . 
'X-RAY DIFFRACTION' . 3.1228 3.1674  2692 0.3663 99.00 0.4157 . . 155 . . 
'X-RAY DIFFRACTION' . 3.1674 3.2147  2668 0.3492 99.00 0.4330 . . 126 . . 
'X-RAY DIFFRACTION' . 3.2147 3.2649  2662 0.3325 99.00 0.3775 . . 119 . . 
'X-RAY DIFFRACTION' . 3.2649 3.3184  2689 0.3208 99.00 0.3872 . . 157 . . 
'X-RAY DIFFRACTION' . 3.3184 3.3756  2638 0.2996 99.00 0.3572 . . 149 . . 
'X-RAY DIFFRACTION' . 3.3756 3.4370  2671 0.2907 99.00 0.3368 . . 140 . . 
'X-RAY DIFFRACTION' . 3.4370 3.5031  2683 0.2821 99.00 0.3204 . . 130 . . 
'X-RAY DIFFRACTION' . 3.5031 3.5746  2657 0.2574 99.00 0.3000 . . 131 . . 
'X-RAY DIFFRACTION' . 3.5746 3.6522  2747 0.2457 99.00 0.2869 . . 140 . . 
'X-RAY DIFFRACTION' . 3.6522 3.7372  2637 0.2249 99.00 0.2709 . . 151 . . 
'X-RAY DIFFRACTION' . 3.7372 3.8306  2652 0.2253 99.00 0.2745 . . 164 . . 
'X-RAY DIFFRACTION' . 3.8306 3.9341  2622 0.2183 99.00 0.2550 . . 173 . . 
'X-RAY DIFFRACTION' . 3.9341 4.0498  2679 0.2153 99.00 0.2844 . . 145 . . 
'X-RAY DIFFRACTION' . 4.0498 4.1805  2697 0.1989 99.00 0.2352 . . 141 . . 
'X-RAY DIFFRACTION' . 4.1805 4.3298  2689 0.1927 99.00 0.2350 . . 157 . . 
'X-RAY DIFFRACTION' . 4.3298 4.5030  2685 0.1794 99.00 0.2265 . . 139 . . 
'X-RAY DIFFRACTION' . 4.5030 4.7077  2695 0.1769 99.00 0.2116 . . 110 . . 
'X-RAY DIFFRACTION' . 4.7077 4.9557  2683 0.1803 99.00 0.2317 . . 138 . . 
'X-RAY DIFFRACTION' . 4.9557 5.2658  2651 0.1885 99.00 0.2386 . . 146 . . 
'X-RAY DIFFRACTION' . 5.2658 5.6717  2682 0.1982 99.00 0.2489 . . 151 . . 
'X-RAY DIFFRACTION' . 5.6717 6.2413  2641 0.2121 98.00 0.2514 . . 163 . . 
'X-RAY DIFFRACTION' . 6.2413 7.1417  2638 0.2139 98.00 0.2511 . . 128 . . 
'X-RAY DIFFRACTION' . 7.1417 8.9873  2614 0.1863 97.00 0.1901 . . 146 . . 
'X-RAY DIFFRACTION' . 8.9873 46.7895 2439 0.1804 91.00 0.2200 . . 149 . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 2 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  4BPW 
_struct.title                     'Crystal structure of human primase bound to UTP' 
_struct.pdbx_descriptor           'DNA PRIMASE SMALL SUBUNIT (E.C.2.7.7.-), DNA PRIMASE LARGE SUBUNIT (E.C.2.7.7.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BPW 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, DNA-DEPENDENT RNA POLYMERASE, DNA REPLICATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 11  ? LEU A 23  ? GLU A 8   LEU A 20  1 ? 13 
HELX_P HELX_P2  2  PRO A 25  ? TYR A 35  ? PRO A 22  TYR A 32  1 ? 11 
HELX_P HELX_P3  3  GLY A 36  ? VAL A 38  ? GLY A 33  VAL A 35  5 ? 3  
HELX_P HELX_P4  4  LYS A 53  ? ASP A 55  ? LYS A 50  ASP A 52  5 ? 3  
HELX_P HELX_P5  5  ASN A 65  ? ASN A 77  ? ASN A 62  ASN A 74  1 ? 13 
HELX_P HELX_P6  6  ARG A 90  ? VAL A 97  ? ARG A 87  VAL A 94  5 ? 8  
HELX_P HELX_P7  7  THR A 116 ? ASP A 119 ? THR A 113 ASP A 116 5 ? 4  
HELX_P HELX_P8  8  CYS A 131 ? ASP A 152 ? CYS A 128 ASP A 149 1 ? 22 
HELX_P HELX_P9  9  ASP A 174 ? LYS A 179 ? ASP A 171 LYS A 176 1 ? 6  
HELX_P HELX_P10 10 SER A 181 ? SER A 193 ? SER A 178 SER A 190 1 ? 13 
HELX_P HELX_P11 11 HIS A 212 ? LEU A 231 ? HIS A 209 LEU A 228 1 ? 20 
HELX_P HELX_P12 12 ASN A 239 ? ALA A 248 ? ASN A 236 ALA A 245 1 ? 10 
HELX_P HELX_P13 13 PRO A 251 ? THR A 253 ? PRO A 248 THR A 250 5 ? 3  
HELX_P HELX_P14 14 ILE A 254 ? SER A 265 ? ILE A 251 SER A 262 1 ? 12 
HELX_P HELX_P15 15 ASN A 267 ? ASN A 285 ? ASN A 264 ASN A 282 1 ? 19 
HELX_P HELX_P16 16 TRP A 294 ? PHE A 305 ? TRP A 291 PHE A 302 1 ? 12 
HELX_P HELX_P17 17 ASP A 309 ? GLY A 315 ? ASP A 306 GLY A 312 1 ? 7  
HELX_P HELX_P18 18 ASP A 338 ? PHE A 345 ? ASP A 335 PHE A 342 5 ? 8  
HELX_P HELX_P19 19 THR A 352 ? ASP A 361 ? THR A 349 ASP A 358 1 ? 10 
HELX_P HELX_P20 20 ASP A 385 ? THR A 389 ? ASP A 382 THR A 386 5 ? 5  
HELX_P HELX_P21 21 LEU A 391 ? GLY A 411 ? LEU A 388 GLY A 408 1 ? 21 
HELX_P HELX_P22 22 SER B 38  ? TYR B 63  ? SER B 38  TYR B 63  1 ? 26 
HELX_P HELX_P23 23 THR B 67  ? LEU B 81  ? THR B 67  LEU B 81  1 ? 15 
HELX_P HELX_P24 24 PRO B 95  ? TYR B 110 ? PRO B 95  TYR B 110 1 ? 16 
HELX_P HELX_P25 25 SER B 113 ? ILE B 134 ? SER B 113 ILE B 134 1 ? 22 
HELX_P HELX_P26 26 PRO B 136 ? ASP B 146 ? PRO B 136 ASP B 146 1 ? 11 
HELX_P HELX_P27 27 SER B 155 ? THR B 160 ? SER B 155 THR B 160 1 ? 6  
HELX_P HELX_P28 28 ARG B 162 ? SER B 170 ? ARG B 162 SER B 170 1 ? 9  
HELX_P HELX_P29 29 ALA B 191 ? ARG B 196 ? ALA B 191 ARG B 196 1 ? 6  
HELX_P HELX_P30 30 PRO B 210 ? LEU B 237 ? PRO B 210 LEU B 237 1 ? 28 
HELX_P HELX_P31 31 ALA B 239 ? ASP B 243 ? ALA B 239 ASP B 243 5 ? 5  
HELX_P HELX_P32 32 ASP B 243 ? ARG B 245 ? ASP B 243 ARG B 245 5 ? 3  
HELX_P HELX_P33 33 LEU B 246 ? HIS B 252 ? LEU B 246 HIS B 252 1 ? 7  
HELX_P HELX_P34 34 GLU C 11  ? LEU C 23  ? GLU C 8   LEU C 20  1 ? 13 
HELX_P HELX_P35 35 PRO C 25  ? TYR C 35  ? PRO C 22  TYR C 32  1 ? 11 
HELX_P HELX_P36 36 GLY C 36  ? VAL C 38  ? GLY C 33  VAL C 35  5 ? 3  
HELX_P HELX_P37 37 TYR C 42  ? GLN C 44  ? TYR C 39  GLN C 41  5 ? 3  
HELX_P HELX_P38 38 LYS C 53  ? ASP C 55  ? LYS C 50  ASP C 52  5 ? 3  
HELX_P HELX_P39 39 ASN C 65  ? ASN C 77  ? ASN C 62  ASN C 74  1 ? 13 
HELX_P HELX_P40 40 ARG C 90  ? VAL C 97  ? ARG C 87  VAL C 94  5 ? 8  
HELX_P HELX_P41 41 THR C 116 ? ASP C 119 ? THR C 113 ASP C 116 5 ? 4  
HELX_P HELX_P42 42 CYS C 131 ? ASP C 152 ? CYS C 128 ASP C 149 1 ? 22 
HELX_P HELX_P43 43 ASP C 174 ? LYS C 179 ? ASP C 171 LYS C 176 1 ? 6  
HELX_P HELX_P44 44 SER C 181 ? SER C 193 ? SER C 178 SER C 190 1 ? 13 
HELX_P HELX_P45 45 HIS C 212 ? LEU C 231 ? HIS C 209 LEU C 228 1 ? 20 
HELX_P HELX_P46 46 ASN C 239 ? ALA C 248 ? ASN C 236 ALA C 245 1 ? 10 
HELX_P HELX_P47 47 PRO C 251 ? THR C 253 ? PRO C 248 THR C 250 5 ? 3  
HELX_P HELX_P48 48 ILE C 254 ? SER C 265 ? ILE C 251 SER C 262 1 ? 12 
HELX_P HELX_P49 49 ASN C 267 ? TYR C 282 ? ASN C 264 TYR C 279 1 ? 16 
HELX_P HELX_P50 50 TRP C 294 ? PHE C 305 ? TRP C 291 PHE C 302 1 ? 12 
HELX_P HELX_P51 51 ASP C 309 ? GLY C 315 ? ASP C 306 GLY C 312 1 ? 7  
HELX_P HELX_P52 52 ASP C 338 ? PHE C 345 ? ASP C 335 PHE C 342 5 ? 8  
HELX_P HELX_P53 53 THR C 352 ? LEU C 360 ? THR C 349 LEU C 357 1 ? 9  
HELX_P HELX_P54 54 LEU C 391 ? GLY C 411 ? LEU C 388 GLY C 408 1 ? 21 
HELX_P HELX_P55 55 SER D 38  ? TYR D 63  ? SER D 38  TYR D 63  1 ? 26 
HELX_P HELX_P56 56 THR D 67  ? LEU D 81  ? THR D 67  LEU D 81  1 ? 15 
HELX_P HELX_P57 57 GLU D 94  ? TYR D 110 ? GLU D 94  TYR D 110 1 ? 17 
HELX_P HELX_P58 58 SER D 113 ? ILE D 134 ? SER D 113 ILE D 134 1 ? 22 
HELX_P HELX_P59 59 PRO D 136 ? ASP D 146 ? PRO D 136 ASP D 146 1 ? 11 
HELX_P HELX_P60 60 SER D 155 ? ARG D 162 ? SER D 155 ARG D 162 1 ? 8  
HELX_P HELX_P61 61 ARG D 162 ? SER D 170 ? ARG D 162 SER D 170 1 ? 9  
HELX_P HELX_P62 62 ALA D 191 ? ARG D 196 ? ALA D 191 ARG D 196 1 ? 6  
HELX_P HELX_P63 63 PRO D 210 ? LEU D 237 ? PRO D 210 LEU D 237 1 ? 28 
HELX_P HELX_P64 64 ALA D 239 ? ASP D 243 ? ALA D 239 ASP D 243 5 ? 5  
HELX_P HELX_P65 65 ASP D 243 ? ARG D 245 ? ASP D 243 ARG D 245 5 ? 3  
HELX_P HELX_P66 66 LEU D 246 ? ASN D 251 ? LEU D 246 ASN D 251 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 134 SG  ? ? A ZN 1411 A CYS 131  1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc2  metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 124 SG  ? ? A ZN 1411 A CYS 121  1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc3  metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 125 SG  ? ? A ZN 1411 A CYS 122  1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc4  metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 131 SG  ? ? A ZN 1411 A CYS 128  1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc5  metalc ? ? F MG . MG ? ? ? 1_555 A ASP 112 OD2 ? ? A MG 1412 A ASP 109  1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc6  metalc ? ? F MG . MG ? ? ? 1_555 A ASP 309 OD2 ? ? A MG 1412 A ASP 306  1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc7  metalc ? ? G MG . MG ? ? ? 1_555 H UTP .   O2G ? ? A MG 1413 A UTP 1414 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc8  metalc ? ? G MG . MG ? ? ? 1_555 A ASP 114 OD1 ? ? A MG 1413 A ASP 111  1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc9  metalc ? ? G MG . MG ? ? ? 1_555 A ASP 112 OD1 ? ? A MG 1413 A ASP 109  1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc10 metalc ? ? G MG . MG ? ? ? 1_555 H UTP .   O2B ? ? A MG 1413 A UTP 1414 1_555 ? ? ? ? ? ? ? 1.847 ? 
metalc11 metalc ? ? I ZN . ZN ? ? ? 1_555 C CYS 134 SG  ? ? C ZN 1409 C CYS 131  1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc12 metalc ? ? I ZN . ZN ? ? ? 1_555 C CYS 131 SG  ? ? C ZN 1409 C CYS 128  1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc13 metalc ? ? I ZN . ZN ? ? ? 1_555 C CYS 125 SG  ? ? C ZN 1409 C CYS 122  1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc14 metalc ? ? I ZN . ZN ? ? ? 1_555 C CYS 124 SG  ? ? C ZN 1409 C CYS 121  1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc15 metalc ? ? J MG . MG ? ? ? 1_555 C ASP 112 OD2 ? ? C MG 1410 C ASP 109  1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc16 metalc ? ? K MG . MG ? ? ? 1_555 L UTP .   O2G ? ? C MG 1411 C UTP 1412 1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc17 metalc ? ? K MG . MG ? ? ? 1_555 C ASP 114 OD2 ? ? C MG 1411 C ASP 111  1_555 ? ? ? ? ? ? ? 2.517 ? 
metalc18 metalc ? ? K MG . MG ? ? ? 1_555 L UTP .   O2B ? ? C MG 1411 C UTP 1412 1_555 ? ? ? ? ? ? ? 2.544 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 2 ? 
AD ? 3 ? 
BA ? 3 ? 
CA ? 4 ? 
CB ? 4 ? 
CC ? 2 ? 
CD ? 3 ? 
DA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 57  ? GLN A 61  ? TYR A 54  GLN A 58  
AA 2 ARG A 46  ? THR A 51  ? ARG A 43  THR A 48  
AA 3 LYS A 80  ? TYR A 87  ? LYS A 77  TYR A 84  
AA 4 ALA A 104 ? GLU A 106 ? ALA A 101 GLU A 103 
AB 1 TYR A 57  ? GLN A 61  ? TYR A 54  GLN A 58  
AB 2 ARG A 46  ? THR A 51  ? ARG A 43  THR A 48  
AB 3 LYS A 80  ? TYR A 87  ? LYS A 77  TYR A 84  
AB 4 LEU A 320 ? LYS A 321 ? LEU A 317 LYS A 318 
AC 1 ALA A 104 ? GLU A 106 ? ALA A 101 GLU A 103 
AC 2 LYS A 80  ? TYR A 87  ? LYS A 77  TYR A 84  
AD 1 LEU A 109 ? ASP A 114 ? LEU A 106 ASP A 111 
AD 2 GLY A 167 ? VAL A 172 ? GLY A 164 VAL A 169 
AD 3 ARG A 158 ? TYR A 162 ? ARG A 155 TYR A 159 
BA 1 TYR B 184 ? PRO B 187 ? TYR B 184 PRO B 187 
BA 2 PHE B 206 ? VAL B 209 ? PHE B 206 VAL B 209 
BA 3 TYR B 201 ? GLU B 203 ? TYR B 201 GLU B 203 
CA 1 TYR C 57  ? GLN C 61  ? TYR C 54  GLN C 58  
CA 2 ARG C 46  ? THR C 51  ? ARG C 43  THR C 48  
CA 3 LYS C 80  ? TYR C 87  ? LYS C 77  TYR C 84  
CA 4 ALA C 104 ? GLU C 106 ? ALA C 101 GLU C 103 
CB 1 TYR C 57  ? GLN C 61  ? TYR C 54  GLN C 58  
CB 2 ARG C 46  ? THR C 51  ? ARG C 43  THR C 48  
CB 3 LYS C 80  ? TYR C 87  ? LYS C 77  TYR C 84  
CB 4 LEU C 320 ? LYS C 321 ? LEU C 317 LYS C 318 
CC 1 ALA C 104 ? GLU C 106 ? ALA C 101 GLU C 103 
CC 2 LYS C 80  ? TYR C 87  ? LYS C 77  TYR C 84  
CD 1 LEU C 109 ? ASP C 114 ? LEU C 106 ASP C 111 
CD 2 GLY C 167 ? VAL C 172 ? GLY C 164 VAL C 169 
CD 3 ARG C 158 ? TYR C 162 ? ARG C 155 TYR C 159 
DA 1 TYR D 184 ? PRO D 187 ? TYR D 184 PRO D 187 
DA 2 PHE D 206 ? VAL D 209 ? PHE D 206 VAL D 209 
DA 3 TYR D 201 ? GLU D 203 ? TYR D 201 GLU D 203 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLN A 61  ? N GLN A 58  O PHE A 48  ? O PHE A 45  
AA 2 3 N THR A 51  ? N THR A 48  O LYS A 80  ? O LYS A 77  
AA 3 4 O VAL A 86  ? O VAL A 83  N GLN A 105 ? N GLN A 102 
AB 1 2 N GLN A 61  ? N GLN A 58  O PHE A 48  ? O PHE A 45  
AB 2 3 N THR A 51  ? N THR A 48  O LYS A 80  ? O LYS A 77  
AB 3 4 N ILE A 83  ? N ILE A 80  O LEU A 320 ? O LEU A 317 
AC 1 2 N GLN A 105 ? N GLN A 102 O VAL A 86  ? O VAL A 83  
AD 1 2 N ILE A 113 ? N ILE A 110 O VAL A 168 ? O VAL A 165 
AD 2 3 N TRP A 171 ? N TRP A 168 O LEU A 159 ? O LEU A 156 
BA 1 2 N ILE B 186 ? N ILE B 186 O ALA B 207 ? O ALA B 207 
BA 2 3 N TYR B 208 ? N TYR B 208 O TYR B 201 ? O TYR B 201 
CA 1 2 N GLN C 61  ? N GLN C 58  O PHE C 48  ? O PHE C 45  
CA 2 3 N THR C 51  ? N THR C 48  O LYS C 80  ? O LYS C 77  
CA 3 4 O VAL C 86  ? O VAL C 83  N GLN C 105 ? N GLN C 102 
CB 1 2 N GLN C 61  ? N GLN C 58  O PHE C 48  ? O PHE C 45  
CB 2 3 N THR C 51  ? N THR C 48  O LYS C 80  ? O LYS C 77  
CB 3 4 N ILE C 83  ? N ILE C 80  O LEU C 320 ? O LEU C 317 
CC 1 2 N GLN C 105 ? N GLN C 102 O VAL C 86  ? O VAL C 83  
CD 1 2 N ILE C 113 ? N ILE C 110 O VAL C 168 ? O VAL C 165 
CD 2 3 N TRP C 171 ? N TRP C 168 O LEU C 159 ? O LEU C 156 
DA 1 2 N ILE D 186 ? N ILE D 186 O ALA D 207 ? O ALA D 207 
DA 2 3 N TYR D 208 ? N TYR D 208 O TYR D 201 ? O TYR D 201 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1411'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 1412'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 1413'  
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE UTP A 1414' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 1409'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG C 1410'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG C 1411'  
AC8 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE UTP C 1412' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 124 ? CYS A 121  . ? 1_555 ? 
2  AC1 4  CYS A 125 ? CYS A 122  . ? 1_555 ? 
3  AC1 4  CYS A 131 ? CYS A 128  . ? 1_555 ? 
4  AC1 4  CYS A 134 ? CYS A 131  . ? 1_555 ? 
5  AC2 4  ASP A 112 ? ASP A 109  . ? 1_555 ? 
6  AC2 4  ASP A 114 ? ASP A 111  . ? 1_555 ? 
7  AC2 4  ASP A 309 ? ASP A 306  . ? 1_555 ? 
8  AC2 4  UTP H .   ? UTP A 1414 . ? 1_555 ? 
9  AC3 3  ASP A 112 ? ASP A 109  . ? 1_555 ? 
10 AC3 3  ASP A 114 ? ASP A 111  . ? 1_555 ? 
11 AC3 3  UTP H .   ? UTP A 1414 . ? 1_555 ? 
12 AC4 13 ASP A 82  ? ASP A 79   . ? 1_555 ? 
13 AC4 13 ASP A 112 ? ASP A 109  . ? 1_555 ? 
14 AC4 13 ASP A 114 ? ASP A 111  . ? 1_555 ? 
15 AC4 13 SER A 163 ? SER A 160  . ? 1_555 ? 
16 AC4 13 ARG A 166 ? ARG A 163  . ? 1_555 ? 
17 AC4 13 HIS A 169 ? HIS A 166  . ? 1_555 ? 
18 AC4 13 HIS A 318 ? HIS A 315  . ? 1_555 ? 
19 AC4 13 LEU A 319 ? LEU A 316  . ? 1_555 ? 
20 AC4 13 LEU A 320 ? LEU A 317  . ? 1_555 ? 
21 AC4 13 LYS A 321 ? LYS A 318  . ? 1_555 ? 
22 AC4 13 HIS A 327 ? HIS A 324  . ? 1_555 ? 
23 AC4 13 MG  F .   ? MG  A 1412 . ? 1_555 ? 
24 AC4 13 MG  G .   ? MG  A 1413 . ? 1_555 ? 
25 AC5 4  CYS C 124 ? CYS C 121  . ? 1_555 ? 
26 AC5 4  CYS C 125 ? CYS C 122  . ? 1_555 ? 
27 AC5 4  CYS C 131 ? CYS C 128  . ? 1_555 ? 
28 AC5 4  CYS C 134 ? CYS C 131  . ? 1_555 ? 
29 AC6 2  ASP C 112 ? ASP C 109  . ? 1_555 ? 
30 AC6 2  ASP C 309 ? ASP C 306  . ? 1_555 ? 
31 AC7 4  ASP C 112 ? ASP C 109  . ? 1_555 ? 
32 AC7 4  ASP C 114 ? ASP C 111  . ? 1_555 ? 
33 AC7 4  SER C 163 ? SER C 160  . ? 1_555 ? 
34 AC7 4  UTP L .   ? UTP C 1412 . ? 1_555 ? 
35 AC8 12 ASP C 112 ? ASP C 109  . ? 1_555 ? 
36 AC8 12 ASP C 114 ? ASP C 111  . ? 1_555 ? 
37 AC8 12 SER C 163 ? SER C 160  . ? 1_555 ? 
38 AC8 12 ARG C 165 ? ARG C 162  . ? 1_555 ? 
39 AC8 12 ARG C 166 ? ARG C 163  . ? 1_555 ? 
40 AC8 12 HIS C 169 ? HIS C 166  . ? 1_555 ? 
41 AC8 12 HIS C 318 ? HIS C 315  . ? 1_555 ? 
42 AC8 12 LEU C 319 ? LEU C 316  . ? 1_555 ? 
43 AC8 12 LEU C 320 ? LEU C 317  . ? 1_555 ? 
44 AC8 12 LYS C 321 ? LYS C 318  . ? 1_555 ? 
45 AC8 12 HIS C 327 ? HIS C 324  . ? 1_555 ? 
46 AC8 12 MG  K .   ? MG  C 1411 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BPW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BPW 
_atom_sites.fract_transf_matrix[1][1]   0.008592 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002286 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014401 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008142 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . PHE A 1 7   ? 60.517  72.085  -24.504 1.00 75.63  ? 4    PHE A N      1 
ATOM   2     C  CA     . PHE A 1 7   ? 59.269  72.832  -24.620 1.00 79.41  ? 4    PHE A CA     1 
ATOM   3     C  C      . PHE A 1 7   ? 59.253  74.036  -23.686 1.00 82.97  ? 4    PHE A C      1 
ATOM   4     O  O      . PHE A 1 7   ? 59.664  73.935  -22.532 1.00 97.27  ? 4    PHE A O      1 
ATOM   5     C  CB     . PHE A 1 7   ? 58.077  71.927  -24.315 1.00 74.14  ? 4    PHE A CB     1 
ATOM   6     C  CG     . PHE A 1 7   ? 56.767  72.653  -24.272 1.00 73.34  ? 4    PHE A CG     1 
ATOM   7     C  CD1    . PHE A 1 7   ? 56.137  73.045  -25.439 1.00 77.38  ? 4    PHE A CD1    1 
ATOM   8     C  CD2    . PHE A 1 7   ? 56.165  72.948  -23.062 1.00 70.15  ? 4    PHE A CD2    1 
ATOM   9     C  CE1    . PHE A 1 7   ? 54.930  73.717  -25.398 1.00 87.01  ? 4    PHE A CE1    1 
ATOM   10    C  CE2    . PHE A 1 7   ? 54.958  73.619  -23.014 1.00 71.47  ? 4    PHE A CE2    1 
ATOM   11    C  CZ     . PHE A 1 7   ? 54.340  74.004  -24.182 1.00 75.68  ? 4    PHE A CZ     1 
ATOM   12    H  HA     . PHE A 1 7   ? 59.177  73.156  -25.530 1.00 95.30  ? 4    PHE A HA     1 
ATOM   13    H  HB2    . PHE A 1 7   ? 58.017  71.246  -25.003 1.00 88.97  ? 4    PHE A HB2    1 
ATOM   14    H  HB3    . PHE A 1 7   ? 58.214  71.510  -23.450 1.00 88.97  ? 4    PHE A HB3    1 
ATOM   15    H  HD1    . PHE A 1 7   ? 56.530  72.854  -26.261 1.00 92.86  ? 4    PHE A HD1    1 
ATOM   16    H  HD2    . PHE A 1 7   ? 56.579  72.691  -22.269 1.00 84.18  ? 4    PHE A HD2    1 
ATOM   17    H  HE1    . PHE A 1 7   ? 54.515  73.975  -26.189 1.00 104.41 ? 4    PHE A HE1    1 
ATOM   18    H  HE2    . PHE A 1 7   ? 54.564  73.811  -22.194 1.00 85.76  ? 4    PHE A HE2    1 
ATOM   19    H  HZ     . PHE A 1 7   ? 53.528  74.456  -24.153 1.00 90.82  ? 4    PHE A HZ     1 
ATOM   20    N  N      . ASP A 1 8   ? 58.770  75.168  -24.190 1.00 82.94  ? 5    ASP A N      1 
ATOM   21    C  CA     . ASP A 1 8   ? 58.743  76.409  -23.421 1.00 74.31  ? 5    ASP A CA     1 
ATOM   22    C  C      . ASP A 1 8   ? 57.302  76.823  -23.089 1.00 83.20  ? 5    ASP A C      1 
ATOM   23    O  O      . ASP A 1 8   ? 56.526  77.124  -23.993 1.00 84.89  ? 5    ASP A O      1 
ATOM   24    C  CB     . ASP A 1 8   ? 59.445  77.519  -24.204 1.00 71.28  ? 5    ASP A CB     1 
ATOM   25    C  CG     . ASP A 1 8   ? 59.515  78.818  -23.435 1.00 95.17  ? 5    ASP A CG     1 
ATOM   26    O  OD1    . ASP A 1 8   ? 59.645  78.771  -22.194 1.00 113.80 ? 5    ASP A OD1    1 
ATOM   27    O  OD2    . ASP A 1 8   ? 59.437  79.890  -24.070 1.00 91.21  ? 5    ASP A OD2    1 
ATOM   28    H  H      . ASP A 1 8   ? 58.448  75.244  -24.984 1.00 99.53  ? 5    ASP A H      1 
ATOM   29    H  HA     . ASP A 1 8   ? 59.220  76.278  -22.587 1.00 89.17  ? 5    ASP A HA     1 
ATOM   30    H  HB2    . ASP A 1 8   ? 60.352  77.239  -24.405 1.00 85.54  ? 5    ASP A HB2    1 
ATOM   31    H  HB3    . ASP A 1 8   ? 58.958  77.683  -25.027 1.00 85.54  ? 5    ASP A HB3    1 
ATOM   32    N  N      . PRO A 1 9   ? 56.936  76.841  -21.794 1.00 84.04  ? 6    PRO A N      1 
ATOM   33    C  CA     . PRO A 1 9   ? 55.556  77.185  -21.414 1.00 84.35  ? 6    PRO A CA     1 
ATOM   34    C  C      . PRO A 1 9   ? 55.154  78.651  -21.618 1.00 82.94  ? 6    PRO A C      1 
ATOM   35    O  O      . PRO A 1 9   ? 54.021  78.998  -21.278 1.00 75.33  ? 6    PRO A O      1 
ATOM   36    C  CB     . PRO A 1 9   ? 55.509  76.840  -19.917 1.00 86.06  ? 6    PRO A CB     1 
ATOM   37    C  CG     . PRO A 1 9   ? 56.652  75.924  -19.686 1.00 86.41  ? 6    PRO A CG     1 
ATOM   38    C  CD     . PRO A 1 9   ? 57.710  76.366  -20.634 1.00 84.96  ? 6    PRO A CD     1 
ATOM   39    H  HA     . PRO A 1 9   ? 54.930  76.616  -21.889 1.00 101.23 ? 6    PRO A HA     1 
ATOM   40    H  HB2    . PRO A 1 9   ? 55.609  77.650  -19.393 1.00 103.27 ? 6    PRO A HB2    1 
ATOM   41    H  HB3    . PRO A 1 9   ? 54.670  76.399  -19.710 1.00 103.27 ? 6    PRO A HB3    1 
ATOM   42    H  HG2    . PRO A 1 9   ? 56.957  76.008  -18.769 1.00 103.69 ? 6    PRO A HG2    1 
ATOM   43    H  HG3    . PRO A 1 9   ? 56.383  75.011  -19.875 1.00 103.69 ? 6    PRO A HG3    1 
ATOM   44    H  HD2    . PRO A 1 9   ? 58.227  77.092  -20.251 1.00 101.95 ? 6    PRO A HD2    1 
ATOM   45    H  HD3    . PRO A 1 9   ? 58.275  75.619  -20.885 1.00 101.95 ? 6    PRO A HD3    1 
ATOM   46    N  N      . THR A 1 10  ? 56.041  79.488  -22.156 1.00 79.17  ? 7    THR A N      1 
ATOM   47    C  CA     . THR A 1 10  ? 55.716  80.899  -22.377 1.00 85.37  ? 7    THR A CA     1 
ATOM   48    C  C      . THR A 1 10  ? 55.173  81.150  -23.779 1.00 88.14  ? 7    THR A C      1 
ATOM   49    O  O      . THR A 1 10  ? 54.501  82.152  -24.017 1.00 93.70  ? 7    THR A O      1 
ATOM   50    C  CB     . THR A 1 10  ? 56.935  81.810  -22.145 1.00 75.57  ? 7    THR A CB     1 
ATOM   51    O  OG1    . THR A 1 10  ? 58.084  81.252  -22.790 1.00 67.78  ? 7    THR A OG1    1 
ATOM   52    C  CG2    . THR A 1 10  ? 57.216  81.959  -20.658 1.00 79.38  ? 7    THR A CG2    1 
ATOM   53    H  H      . THR A 1 10  ? 56.835  79.265  -22.401 1.00 95.00  ? 7    THR A H      1 
ATOM   54    H  HA     . THR A 1 10  ? 55.029  81.161  -21.744 1.00 102.45 ? 7    THR A HA     1 
ATOM   55    H  HB     . THR A 1 10  ? 56.755  82.690  -22.512 1.00 90.68  ? 7    THR A HB     1 
ATOM   56    H  HG1    . THR A 1 10  ? 57.946  81.183  -23.616 1.00 81.34  ? 7    THR A HG1    1 
ATOM   57    H  HG21   . THR A 1 10  ? 57.399  81.090  -20.267 1.00 95.26  ? 7    THR A HG21   1 
ATOM   58    H  HG22   . THR A 1 10  ? 57.985  82.534  -20.522 1.00 95.26  ? 7    THR A HG22   1 
ATOM   59    H  HG23   . THR A 1 10  ? 56.448  82.349  -20.213 1.00 95.26  ? 7    THR A HG23   1 
ATOM   60    N  N      . GLU A 1 11  ? 55.488  80.255  -24.710 1.00 81.40  ? 8    GLU A N      1 
ATOM   61    C  CA     . GLU A 1 11  ? 54.907  80.313  -26.047 1.00 76.47  ? 8    GLU A CA     1 
ATOM   62    C  C      . GLU A 1 11  ? 53.473  79.795  -26.022 1.00 72.44  ? 8    GLU A C      1 
ATOM   63    O  O      . GLU A 1 11  ? 52.758  79.863  -27.020 1.00 83.76  ? 8    GLU A O      1 
ATOM   64    C  CB     . GLU A 1 11  ? 55.725  79.481  -27.033 1.00 78.03  ? 8    GLU A CB     1 
ATOM   65    C  CG     . GLU A 1 11  ? 57.156  79.936  -27.210 1.00 81.71  ? 8    GLU A CG     1 
ATOM   66    C  CD     . GLU A 1 11  ? 57.919  79.058  -28.181 1.00 94.45  ? 8    GLU A CD     1 
ATOM   67    O  OE1    . GLU A 1 11  ? 57.451  77.933  -28.458 1.00 86.50  ? 8    GLU A OE1    1 
ATOM   68    O  OE2    . GLU A 1 11  ? 58.983  79.491  -28.669 1.00 109.17 ? 8    GLU A OE2    1 
ATOM   69    H  H      . GLU A 1 11  ? 56.036  79.604  -24.593 1.00 97.69  ? 8    GLU A H      1 
ATOM   70    H  HA     . GLU A 1 11  ? 54.896  81.232  -26.355 1.00 91.77  ? 8    GLU A HA     1 
ATOM   71    H  HB2    . GLU A 1 11  ? 55.745  78.563  -26.720 1.00 93.63  ? 8    GLU A HB2    1 
ATOM   72    H  HB3    . GLU A 1 11  ? 55.295  79.520  -27.901 1.00 93.63  ? 8    GLU A HB3    1 
ATOM   73    H  HG2    . GLU A 1 11  ? 57.162  80.843  -27.555 1.00 98.06  ? 8    GLU A HG2    1 
ATOM   74    H  HG3    . GLU A 1 11  ? 57.609  79.903  -26.353 1.00 98.06  ? 8    GLU A HG3    1 
ATOM   75    N  N      . LEU A 1 12  ? 53.067  79.269  -24.872 1.00 71.81  ? 9    LEU A N      1 
ATOM   76    C  CA     . LEU A 1 12  ? 51.799  78.564  -24.745 1.00 85.76  ? 9    LEU A CA     1 
ATOM   77    C  C      . LEU A 1 12  ? 50.572  79.393  -25.153 1.00 69.82  ? 9    LEU A C      1 
ATOM   78    O  O      . LEU A 1 12  ? 49.747  78.914  -25.933 1.00 66.20  ? 9    LEU A O      1 
ATOM   79    C  CB     . LEU A 1 12  ? 51.645  78.054  -23.306 1.00 73.27  ? 9    LEU A CB     1 
ATOM   80    C  CG     . LEU A 1 12  ? 50.598  76.965  -23.057 1.00 60.83  ? 9    LEU A CG     1 
ATOM   81    C  CD1    . LEU A 1 12  ? 50.707  75.810  -24.051 1.00 64.48  ? 9    LEU A CD1    1 
ATOM   82    C  CD2    . LEU A 1 12  ? 50.728  76.438  -21.645 1.00 60.39  ? 9    LEU A CD2    1 
ATOM   83    H  H      . LEU A 1 12  ? 53.516  79.309  -24.140 1.00 86.18  ? 9    LEU A H      1 
ATOM   84    H  HA     . LEU A 1 12  ? 51.825  77.787  -25.325 1.00 102.92 ? 9    LEU A HA     1 
ATOM   85    H  HB2    . LEU A 1 12  ? 52.500  77.696  -23.021 1.00 87.92  ? 9    LEU A HB2    1 
ATOM   86    H  HB3    . LEU A 1 12  ? 51.411  78.808  -22.743 1.00 87.92  ? 9    LEU A HB3    1 
ATOM   87    H  HG     . LEU A 1 12  ? 49.714  77.354  -23.149 1.00 72.99  ? 9    LEU A HG     1 
ATOM   88    H  HD11   . LEU A 1 12  ? 51.587  75.409  -23.972 1.00 77.37  ? 9    LEU A HD11   1 
ATOM   89    H  HD12   . LEU A 1 12  ? 50.023  75.153  -23.847 1.00 77.37  ? 9    LEU A HD12   1 
ATOM   90    H  HD13   . LEU A 1 12  ? 50.579  76.154  -24.949 1.00 77.37  ? 9    LEU A HD13   1 
ATOM   91    H  HD21   . LEU A 1 12  ? 50.590  77.168  -21.021 1.00 72.47  ? 9    LEU A HD21   1 
ATOM   92    H  HD22   . LEU A 1 12  ? 50.059  75.750  -21.502 1.00 72.47  ? 9    LEU A HD22   1 
ATOM   93    H  HD23   . LEU A 1 12  ? 51.616  76.065  -21.528 1.00 72.47  ? 9    LEU A HD23   1 
ATOM   94    N  N      . PRO A 1 13  ? 50.439  80.631  -24.637 1.00 68.25  ? 10   PRO A N      1 
ATOM   95    C  CA     . PRO A 1 13  ? 49.227  81.394  -24.968 1.00 79.61  ? 10   PRO A CA     1 
ATOM   96    C  C      . PRO A 1 13  ? 49.147  81.715  -26.457 1.00 91.23  ? 10   PRO A C      1 
ATOM   97    O  O      . PRO A 1 13  ? 48.062  81.910  -27.003 1.00 75.48  ? 10   PRO A O      1 
ATOM   98    C  CB     . PRO A 1 13  ? 49.370  82.674  -24.138 1.00 63.23  ? 10   PRO A CB     1 
ATOM   99    C  CG     . PRO A 1 13  ? 50.819  82.793  -23.867 1.00 77.60  ? 10   PRO A CG     1 
ATOM   100   C  CD     . PRO A 1 13  ? 51.332  81.393  -23.748 1.00 78.96  ? 10   PRO A CD     1 
ATOM   101   H  HA     . PRO A 1 13  ? 48.432  80.912  -24.692 1.00 95.54  ? 10   PRO A HA     1 
ATOM   102   H  HB2    . PRO A 1 13  ? 49.054  83.434  -24.652 1.00 75.87  ? 10   PRO A HB2    1 
ATOM   103   H  HB3    . PRO A 1 13  ? 48.872  82.586  -23.311 1.00 75.87  ? 10   PRO A HB3    1 
ATOM   104   H  HG2    . PRO A 1 13  ? 51.251  83.252  -24.604 1.00 93.12  ? 10   PRO A HG2    1 
ATOM   105   H  HG3    . PRO A 1 13  ? 50.955  83.277  -23.037 1.00 93.12  ? 10   PRO A HG3    1 
ATOM   106   H  HD2    . PRO A 1 13  ? 52.248  81.340  -24.062 1.00 94.75  ? 10   PRO A HD2    1 
ATOM   107   H  HD3    . PRO A 1 13  ? 51.249  81.078  -22.834 1.00 94.75  ? 10   PRO A HD3    1 
ATOM   108   N  N      . GLU A 1 14  ? 50.307  81.765  -27.098 1.00 89.30  ? 11   GLU A N      1 
ATOM   109   C  CA     . GLU A 1 14  ? 50.395  82.018  -28.525 1.00 81.12  ? 11   GLU A CA     1 
ATOM   110   C  C      . GLU A 1 14  ? 50.125  80.717  -29.281 1.00 73.28  ? 11   GLU A C      1 
ATOM   111   O  O      . GLU A 1 14  ? 49.399  80.708  -30.273 1.00 87.12  ? 11   GLU A O      1 
ATOM   112   C  CB     . GLU A 1 14  ? 51.769  82.598  -28.862 1.00 93.13  ? 11   GLU A CB     1 
ATOM   113   C  CG     . GLU A 1 14  ? 52.044  83.898  -28.106 1.00 119.73 ? 11   GLU A CG     1 
ATOM   114   C  CD     . GLU A 1 14  ? 53.392  84.512  -28.428 1.00 144.40 ? 11   GLU A CD     1 
ATOM   115   O  OE1    . GLU A 1 14  ? 54.351  83.753  -28.680 1.00 132.59 ? 11   GLU A OE1    1 
ATOM   116   O  OE2    . GLU A 1 14  ? 53.496  85.758  -28.414 1.00 150.16 ? 11   GLU A OE2    1 
ATOM   117   H  H      . GLU A 1 14  ? 51.071  81.653  -26.719 1.00 107.16 ? 11   GLU A H      1 
ATOM   118   H  HA     . GLU A 1 14  ? 49.719  82.665  -28.780 1.00 97.35  ? 11   GLU A HA     1 
ATOM   119   H  HB2    . GLU A 1 14  ? 52.454  81.956  -28.618 1.00 111.75 ? 11   GLU A HB2    1 
ATOM   120   H  HB3    . GLU A 1 14  ? 51.811  82.787  -29.812 1.00 111.75 ? 11   GLU A HB3    1 
ATOM   121   H  HG2    . GLU A 1 14  ? 51.360  84.546  -28.336 1.00 143.68 ? 11   GLU A HG2    1 
ATOM   122   H  HG3    . GLU A 1 14  ? 52.020  83.718  -27.153 1.00 143.68 ? 11   GLU A HG3    1 
ATOM   123   N  N      . LEU A 1 15  ? 50.713  79.623  -28.805 1.00 70.32  ? 12   LEU A N      1 
ATOM   124   C  CA     . LEU A 1 15  ? 50.526  78.308  -29.417 1.00 64.72  ? 12   LEU A CA     1 
ATOM   125   C  C      . LEU A 1 15  ? 49.076  77.826  -29.327 1.00 65.89  ? 12   LEU A C      1 
ATOM   126   O  O      . LEU A 1 15  ? 48.572  77.175  -30.243 1.00 59.59  ? 12   LEU A O      1 
ATOM   127   C  CB     . LEU A 1 15  ? 51.461  77.286  -28.773 1.00 61.60  ? 12   LEU A CB     1 
ATOM   128   C  CG     . LEU A 1 15  ? 52.932  77.466  -29.148 1.00 66.92  ? 12   LEU A CG     1 
ATOM   129   C  CD1    . LEU A 1 15  ? 53.852  76.724  -28.196 1.00 75.16  ? 12   LEU A CD1    1 
ATOM   130   C  CD2    . LEU A 1 15  ? 53.146  76.973  -30.569 1.00 72.09  ? 12   LEU A CD2    1 
ATOM   131   H  H      . LEU A 1 15  ? 51.233  79.615  -28.119 1.00 84.38  ? 12   LEU A H      1 
ATOM   132   H  HA     . LEU A 1 15  ? 50.758  78.368  -30.357 1.00 77.67  ? 12   LEU A HA     1 
ATOM   133   H  HB2    . LEU A 1 15  ? 51.390  77.363  -27.809 1.00 73.92  ? 12   LEU A HB2    1 
ATOM   134   H  HB3    . LEU A 1 15  ? 51.192  76.397  -29.052 1.00 73.92  ? 12   LEU A HB3    1 
ATOM   135   H  HG     . LEU A 1 15  ? 53.157  78.409  -29.116 1.00 80.31  ? 12   LEU A HG     1 
ATOM   136   H  HD11   . LEU A 1 15  ? 53.640  75.778  -28.226 1.00 90.19  ? 12   LEU A HD11   1 
ATOM   137   H  HD12   . LEU A 1 15  ? 54.771  76.866  -28.472 1.00 90.19  ? 12   LEU A HD12   1 
ATOM   138   H  HD13   . LEU A 1 15  ? 53.718  77.066  -27.298 1.00 90.19  ? 12   LEU A HD13   1 
ATOM   139   H  HD21   . LEU A 1 15  ? 52.586  77.489  -31.170 1.00 86.50  ? 12   LEU A HD21   1 
ATOM   140   H  HD22   . LEU A 1 15  ? 54.080  77.088  -30.805 1.00 86.50  ? 12   LEU A HD22   1 
ATOM   141   H  HD23   . LEU A 1 15  ? 52.905  76.034  -30.616 1.00 86.50  ? 12   LEU A HD23   1 
ATOM   142   N  N      . LEU A 1 16  ? 48.415  78.133  -28.216 1.00 69.34  ? 13   LEU A N      1 
ATOM   143   C  CA     . LEU A 1 16  ? 47.020  77.748  -28.022 1.00 76.05  ? 13   LEU A CA     1 
ATOM   144   C  C      . LEU A 1 16  ? 46.103  78.343  -29.079 1.00 68.03  ? 13   LEU A C      1 
ATOM   145   O  O      . LEU A 1 16  ? 45.247  77.645  -29.628 1.00 51.22  ? 13   LEU A O      1 
ATOM   146   C  CB     . LEU A 1 16  ? 46.532  78.180  -26.637 1.00 64.55  ? 13   LEU A CB     1 
ATOM   147   C  CG     . LEU A 1 16  ? 46.941  77.357  -25.420 1.00 42.42  ? 13   LEU A CG     1 
ATOM   148   C  CD1    . LEU A 1 16  ? 46.255  77.930  -24.199 1.00 55.38  ? 13   LEU A CD1    1 
ATOM   149   C  CD2    . LEU A 1 16  ? 46.568  75.892  -25.588 1.00 47.40  ? 13   LEU A CD2    1 
ATOM   150   H  H      . LEU A 1 16  ? 48.753  78.566  -27.554 1.00 83.21  ? 13   LEU A H      1 
ATOM   151   H  HA     . LEU A 1 16  ? 46.950  76.782  -28.076 1.00 91.26  ? 13   LEU A HA     1 
ATOM   152   H  HB2    . LEU A 1 16  ? 46.849  79.084  -26.481 1.00 77.46  ? 13   LEU A HB2    1 
ATOM   153   H  HB3    . LEU A 1 16  ? 45.562  78.188  -26.655 1.00 77.46  ? 13   LEU A HB3    1 
ATOM   154   H  HG     . LEU A 1 16  ? 47.900  77.419  -25.293 1.00 50.90  ? 13   LEU A HG     1 
ATOM   155   H  HD11   . LEU A 1 16  ? 45.294  77.885  -24.326 1.00 66.46  ? 13   LEU A HD11   1 
ATOM   156   H  HD12   . LEU A 1 16  ? 46.510  77.411  -23.420 1.00 66.46  ? 13   LEU A HD12   1 
ATOM   157   H  HD13   . LEU A 1 16  ? 46.531  78.853  -24.086 1.00 66.46  ? 13   LEU A HD13   1 
ATOM   158   H  HD21   . LEU A 1 16  ? 47.022  75.539  -26.369 1.00 56.87  ? 13   LEU A HD21   1 
ATOM   159   H  HD22   . LEU A 1 16  ? 46.844  75.403  -24.796 1.00 56.87  ? 13   LEU A HD22   1 
ATOM   160   H  HD23   . LEU A 1 16  ? 45.608  75.821  -25.703 1.00 56.87  ? 13   LEU A HD23   1 
ATOM   161   N  N      . LYS A 1 17  ? 46.285  79.635  -29.340 1.00 84.01  ? 14   LYS A N      1 
ATOM   162   C  CA     . LYS A 1 17  ? 45.514  80.364  -30.343 1.00 73.06  ? 14   LYS A CA     1 
ATOM   163   C  C      . LYS A 1 17  ? 45.562  79.628  -31.678 1.00 60.31  ? 14   LYS A C      1 
ATOM   164   O  O      . LYS A 1 17  ? 44.523  79.362  -32.282 1.00 51.06  ? 14   LYS A O      1 
ATOM   165   C  CB     . LYS A 1 17  ? 46.053  81.791  -30.470 1.00 85.66  ? 14   LYS A CB     1 
ATOM   166   C  CG     . LYS A 1 17  ? 45.810  82.627  -29.207 1.00 118.65 ? 14   LYS A CG     1 
ATOM   167   C  CD     . LYS A 1 17  ? 46.310  84.071  -29.324 1.00 141.06 ? 14   LYS A CD     1 
ATOM   168   C  CE     . LYS A 1 17  ? 46.154  84.829  -27.999 1.00 97.95  ? 14   LYS A CE     1 
ATOM   169   N  NZ     . LYS A 1 17  ? 46.733  86.204  -28.044 1.00 70.18  ? 14   LYS A NZ     1 
ATOM   170   H  H      . LYS A 1 17  ? 46.866  80.125  -28.936 1.00 100.82 ? 14   LYS A H      1 
ATOM   171   H  HA     . LYS A 1 17  ? 44.589  80.415  -30.059 1.00 87.67  ? 14   LYS A HA     1 
ATOM   172   H  HB2    . LYS A 1 17  ? 47.010  81.755  -30.627 1.00 102.79 ? 14   LYS A HB2    1 
ATOM   173   H  HB3    . LYS A 1 17  ? 45.610  82.231  -31.212 1.00 102.79 ? 14   LYS A HB3    1 
ATOM   174   H  HG2    . LYS A 1 17  ? 44.857  82.656  -29.029 1.00 142.38 ? 14   LYS A HG2    1 
ATOM   175   H  HG3    . LYS A 1 17  ? 46.272  82.212  -28.462 1.00 142.38 ? 14   LYS A HG3    1 
ATOM   176   H  HD2    . LYS A 1 17  ? 47.250  84.066  -29.563 1.00 169.27 ? 14   LYS A HD2    1 
ATOM   177   H  HD3    . LYS A 1 17  ? 45.794  84.535  -30.002 1.00 169.27 ? 14   LYS A HD3    1 
ATOM   178   H  HE2    . LYS A 1 17  ? 45.210  84.908  -27.791 1.00 117.54 ? 14   LYS A HE2    1 
ATOM   179   H  HE3    . LYS A 1 17  ? 46.608  84.335  -27.298 1.00 117.54 ? 14   LYS A HE3    1 
ATOM   180   H  HZ1    . LYS A 1 17  ? 46.329  86.684  -28.675 1.00 84.22  ? 14   LYS A HZ1    1 
ATOM   181   H  HZ2    . LYS A 1 17  ? 46.622  86.606  -27.258 1.00 84.22  ? 14   LYS A HZ2    1 
ATOM   182   H  HZ3    . LYS A 1 17  ? 47.604  86.161  -28.226 1.00 84.22  ? 14   LYS A HZ3    1 
ATOM   183   N  N      . LEU A 1 18  ? 46.765  79.294  -32.136 1.00 42.78  ? 15   LEU A N      1 
ATOM   184   C  CA     . LEU A 1 18  ? 46.911  78.575  -33.394 1.00 47.85  ? 15   LEU A CA     1 
ATOM   185   C  C      . LEU A 1 18  ? 46.280  77.187  -33.303 1.00 67.81  ? 15   LEU A C      1 
ATOM   186   O  O      . LEU A 1 18  ? 45.563  76.766  -34.210 1.00 67.61  ? 15   LEU A O      1 
ATOM   187   C  CB     . LEU A 1 18  ? 48.387  78.451  -33.778 1.00 42.66  ? 15   LEU A CB     1 
ATOM   188   C  CG     . LEU A 1 18  ? 48.665  77.769  -35.125 1.00 51.84  ? 15   LEU A CG     1 
ATOM   189   C  CD1    . LEU A 1 18  ? 47.983  78.496  -36.275 1.00 92.38  ? 15   LEU A CD1    1 
ATOM   190   C  CD2    . LEU A 1 18  ? 50.159  77.672  -35.383 1.00 60.74  ? 15   LEU A CD2    1 
ATOM   191   H  H      . LEU A 1 18  ? 47.507  79.471  -31.739 1.00 51.34  ? 15   LEU A H      1 
ATOM   192   H  HA     . LEU A 1 18  ? 46.457  79.067  -34.096 1.00 57.42  ? 15   LEU A HA     1 
ATOM   193   H  HB2    . LEU A 1 18  ? 48.769  79.342  -33.819 1.00 51.19  ? 15   LEU A HB2    1 
ATOM   194   H  HB3    . LEU A 1 18  ? 48.841  77.936  -33.092 1.00 51.19  ? 15   LEU A HB3    1 
ATOM   195   H  HG     . LEU A 1 18  ? 48.311  76.866  -35.096 1.00 62.21  ? 15   LEU A HG     1 
ATOM   196   H  HD11   . LEU A 1 18  ? 48.316  79.406  -36.314 1.00 110.86 ? 15   LEU A HD11   1 
ATOM   197   H  HD12   . LEU A 1 18  ? 48.183  78.034  -37.104 1.00 110.86 ? 15   LEU A HD12   1 
ATOM   198   H  HD13   . LEU A 1 18  ? 47.025  78.500  -36.121 1.00 110.86 ? 15   LEU A HD13   1 
ATOM   199   H  HD21   . LEU A 1 18  ? 50.568  77.152  -34.674 1.00 72.89  ? 15   LEU A HD21   1 
ATOM   200   H  HD22   . LEU A 1 18  ? 50.304  77.238  -36.238 1.00 72.89  ? 15   LEU A HD22   1 
ATOM   201   H  HD23   . LEU A 1 18  ? 50.535  78.566  -35.397 1.00 72.89  ? 15   LEU A HD23   1 
ATOM   202   N  N      . TYR A 1 19  ? 46.553  76.483  -32.205 1.00 80.42  ? 16   TYR A N      1 
ATOM   203   C  CA     . TYR A 1 19  ? 46.043  75.126  -32.004 1.00 72.68  ? 16   TYR A CA     1 
ATOM   204   C  C      . TYR A 1 19  ? 44.520  75.065  -32.029 1.00 68.57  ? 16   TYR A C      1 
ATOM   205   O  O      . TYR A 1 19  ? 43.929  74.253  -32.745 1.00 51.74  ? 16   TYR A O      1 
ATOM   206   C  CB     . TYR A 1 19  ? 46.539  74.560  -30.668 1.00 72.91  ? 16   TYR A CB     1 
ATOM   207   C  CG     . TYR A 1 19  ? 45.933  73.214  -30.308 1.00 71.15  ? 16   TYR A CG     1 
ATOM   208   C  CD1    . TYR A 1 19  ? 46.384  72.038  -30.903 1.00 53.25  ? 16   TYR A CD1    1 
ATOM   209   C  CD2    . TYR A 1 19  ? 44.896  73.127  -29.383 1.00 56.26  ? 16   TYR A CD2    1 
ATOM   210   C  CE1    . TYR A 1 19  ? 45.825  70.812  -30.578 1.00 40.10  ? 16   TYR A CE1    1 
ATOM   211   C  CE2    . TYR A 1 19  ? 44.331  71.909  -29.053 1.00 51.05  ? 16   TYR A CE2    1 
ATOM   212   C  CZ     . TYR A 1 19  ? 44.798  70.756  -29.653 1.00 56.07  ? 16   TYR A CZ     1 
ATOM   213   O  OH     . TYR A 1 19  ? 44.237  69.544  -29.324 1.00 63.28  ? 16   TYR A OH     1 
ATOM   214   H  H      . TYR A 1 19  ? 47.036  76.772  -31.555 1.00 96.51  ? 16   TYR A H      1 
ATOM   215   H  HA     . TYR A 1 19  ? 46.377  74.556  -32.714 1.00 87.22  ? 16   TYR A HA     1 
ATOM   216   H  HB2    . TYR A 1 19  ? 47.501  74.449  -30.714 1.00 87.50  ? 16   TYR A HB2    1 
ATOM   217   H  HB3    . TYR A 1 19  ? 46.313  75.185  -29.962 1.00 87.50  ? 16   TYR A HB3    1 
ATOM   218   H  HD1    . TYR A 1 19  ? 47.074  72.076  -31.525 1.00 63.90  ? 16   TYR A HD1    1 
ATOM   219   H  HD2    . TYR A 1 19  ? 44.579  73.902  -28.978 1.00 67.51  ? 16   TYR A HD2    1 
ATOM   220   H  HE1    . TYR A 1 19  ? 46.137  70.034  -30.980 1.00 48.12  ? 16   TYR A HE1    1 
ATOM   221   H  HE2    . TYR A 1 19  ? 43.641  71.867  -28.431 1.00 61.26  ? 16   TYR A HE2    1 
ATOM   222   H  HH     . TYR A 1 19  ? 43.630  69.654  -28.754 1.00 75.93  ? 16   TYR A HH     1 
ATOM   223   N  N      . TYR A 1 20  ? 43.897  75.938  -31.242 1.00 70.44  ? 17   TYR A N      1 
ATOM   224   C  CA     . TYR A 1 20  ? 42.448  75.960  -31.106 1.00 67.53  ? 17   TYR A CA     1 
ATOM   225   C  C      . TYR A 1 20  ? 41.729  76.402  -32.371 1.00 64.45  ? 17   TYR A C      1 
ATOM   226   O  O      . TYR A 1 20  ? 40.531  76.168  -32.509 1.00 63.84  ? 17   TYR A O      1 
ATOM   227   C  CB     . TYR A 1 20  ? 42.045  76.895  -29.962 1.00 74.32  ? 17   TYR A CB     1 
ATOM   228   C  CG     . TYR A 1 20  ? 42.247  76.350  -28.567 1.00 68.42  ? 17   TYR A CG     1 
ATOM   229   C  CD1    . TYR A 1 20  ? 41.941  75.030  -28.248 1.00 68.90  ? 17   TYR A CD1    1 
ATOM   230   C  CD2    . TYR A 1 20  ? 42.745  77.167  -27.561 1.00 77.59  ? 17   TYR A CD2    1 
ATOM   231   C  CE1    . TYR A 1 20  ? 42.126  74.543  -26.965 1.00 52.36  ? 17   TYR A CE1    1 
ATOM   232   C  CE2    . TYR A 1 20  ? 42.934  76.690  -26.278 1.00 80.35  ? 17   TYR A CE2    1 
ATOM   233   C  CZ     . TYR A 1 20  ? 42.622  75.379  -25.985 1.00 66.24  ? 17   TYR A CZ     1 
ATOM   234   O  OH     . TYR A 1 20  ? 42.811  74.903  -24.709 1.00 70.42  ? 17   TYR A OH     1 
ATOM   235   H  H      . TYR A 1 20  ? 44.299  76.535  -30.771 1.00 84.53  ? 17   TYR A H      1 
ATOM   236   H  HA     . TYR A 1 20  ? 42.139  75.068  -30.884 1.00 81.04  ? 17   TYR A HA     1 
ATOM   237   H  HB2    . TYR A 1 20  ? 42.568  77.709  -30.034 1.00 89.18  ? 17   TYR A HB2    1 
ATOM   238   H  HB3    . TYR A 1 20  ? 41.103  77.107  -30.057 1.00 89.18  ? 17   TYR A HB3    1 
ATOM   239   H  HD1    . TYR A 1 20  ? 41.605  74.466  -28.907 1.00 82.68  ? 17   TYR A HD1    1 
ATOM   240   H  HD2    . TYR A 1 20  ? 42.954  78.052  -27.754 1.00 93.11  ? 17   TYR A HD2    1 
ATOM   241   H  HE1    . TYR A 1 20  ? 41.918  73.659  -26.764 1.00 62.84  ? 17   TYR A HE1    1 
ATOM   242   H  HE2    . TYR A 1 20  ? 43.268  77.251  -25.615 1.00 96.42  ? 17   TYR A HE2    1 
ATOM   243   H  HH     . TYR A 1 20  ? 43.116  75.512  -24.217 1.00 84.50  ? 17   TYR A HH     1 
ATOM   244   N  N      . ARG A 1 21  ? 42.453  77.035  -33.291 1.00 69.20  ? 18   ARG A N      1 
ATOM   245   C  CA     . ARG A 1 21  ? 41.842  77.538  -34.522 1.00 80.57  ? 18   ARG A CA     1 
ATOM   246   C  C      . ARG A 1 21  ? 42.031  76.579  -35.687 1.00 74.94  ? 18   ARG A C      1 
ATOM   247   O  O      . ARG A 1 21  ? 41.114  76.396  -36.484 1.00 75.71  ? 18   ARG A O      1 
ATOM   248   C  CB     . ARG A 1 21  ? 42.385  78.921  -34.887 1.00 87.01  ? 18   ARG A CB     1 
ATOM   249   C  CG     . ARG A 1 21  ? 41.854  80.027  -33.982 1.00 115.93 ? 18   ARG A CG     1 
ATOM   250   C  CD     . ARG A 1 21  ? 42.433  81.396  -34.305 1.00 124.95 ? 18   ARG A CD     1 
ATOM   251   N  NE     . ARG A 1 21  ? 42.152  82.355  -33.237 1.00 127.34 ? 18   ARG A NE     1 
ATOM   252   C  CZ     . ARG A 1 21  ? 42.699  83.563  -33.144 1.00 137.57 ? 18   ARG A CZ     1 
ATOM   253   N  NH1    . ARG A 1 21  ? 43.559  83.984  -34.063 1.00 152.90 ? 18   ARG A NH1    1 
ATOM   254   N  NH2    . ARG A 1 21  ? 42.377  84.358  -32.133 1.00 124.22 ? 18   ARG A NH2    1 
ATOM   255   H  H      . ARG A 1 21  ? 43.297  77.187  -33.228 1.00 83.05  ? 18   ARG A H      1 
ATOM   256   H  HA     . ARG A 1 21  ? 40.888  77.631  -34.374 1.00 96.68  ? 18   ARG A HA     1 
ATOM   257   H  HB2    . ARG A 1 21  ? 43.352  78.911  -34.811 1.00 104.41 ? 18   ARG A HB2    1 
ATOM   258   H  HB3    . ARG A 1 21  ? 42.127  79.131  -35.798 1.00 104.41 ? 18   ARG A HB3    1 
ATOM   259   H  HG2    . ARG A 1 21  ? 40.891  80.079  -34.081 1.00 139.12 ? 18   ARG A HG2    1 
ATOM   260   H  HG3    . ARG A 1 21  ? 42.081  79.817  -33.062 1.00 139.12 ? 18   ARG A HG3    1 
ATOM   261   H  HD2    . ARG A 1 21  ? 43.395  81.323  -34.404 1.00 149.94 ? 18   ARG A HD2    1 
ATOM   262   H  HD3    . ARG A 1 21  ? 42.034  81.728  -35.125 1.00 149.94 ? 18   ARG A HD3    1 
ATOM   263   H  HE     . ARG A 1 21  ? 41.594  82.121  -32.626 1.00 152.81 ? 18   ARG A HE     1 
ATOM   264   H  HH11   . ARG A 1 21  ? 43.770  83.472  -34.721 1.00 183.48 ? 18   ARG A HH11   1 
ATOM   265   H  HH12   . ARG A 1 21  ? 43.909  84.767  -33.999 1.00 183.48 ? 18   ARG A HH12   1 
ATOM   266   H  HH21   . ARG A 1 21  ? 41.819  84.090  -31.536 1.00 149.06 ? 18   ARG A HH21   1 
ATOM   267   H  HH22   . ARG A 1 21  ? 42.728  85.141  -32.072 1.00 149.06 ? 18   ARG A HH22   1 
ATOM   268   N  N      . ARG A 1 22  ? 43.200  75.952  -35.771 1.00 66.51  ? 19   ARG A N      1 
ATOM   269   C  CA     . ARG A 1 22  ? 43.555  75.182  -36.956 1.00 60.08  ? 19   ARG A CA     1 
ATOM   270   C  C      . ARG A 1 22  ? 44.000  73.741  -36.689 1.00 69.89  ? 19   ARG A C      1 
ATOM   271   O  O      . ARG A 1 22  ? 44.455  73.061  -37.610 1.00 85.15  ? 19   ARG A O      1 
ATOM   272   C  CB     . ARG A 1 22  ? 44.652  75.921  -37.728 1.00 88.54  ? 19   ARG A CB     1 
ATOM   273   C  CG     . ARG A 1 22  ? 44.185  77.237  -38.338 1.00 108.16 ? 19   ARG A CG     1 
ATOM   274   C  CD     . ARG A 1 22  ? 45.274  77.878  -39.184 1.00 111.81 ? 19   ARG A CD     1 
ATOM   275   N  NE     . ARG A 1 22  ? 45.700  76.996  -40.268 1.00 93.50  ? 19   ARG A NE     1 
ATOM   276   C  CZ     . ARG A 1 22  ? 46.850  77.112  -40.928 1.00 96.10  ? 19   ARG A CZ     1 
ATOM   277   N  NH1    . ARG A 1 22  ? 47.712  78.074  -40.618 1.00 88.39  ? 19   ARG A NH1    1 
ATOM   278   N  NH2    . ARG A 1 22  ? 47.143  76.256  -41.897 1.00 86.99  ? 19   ARG A NH2    1 
ATOM   279   H  H      . ARG A 1 22  ? 43.803  75.957  -35.158 1.00 79.82  ? 19   ARG A H      1 
ATOM   280   H  HA     . ARG A 1 22  ? 42.776  75.139  -37.532 1.00 72.10  ? 19   ARG A HA     1 
ATOM   281   H  HB2    . ARG A 1 22  ? 45.384  76.117  -37.122 1.00 106.25 ? 19   ARG A HB2    1 
ATOM   282   H  HB3    . ARG A 1 22  ? 44.965  75.353  -38.450 1.00 106.25 ? 19   ARG A HB3    1 
ATOM   283   H  HG2    . ARG A 1 22  ? 43.416  77.071  -38.906 1.00 129.79 ? 19   ARG A HG2    1 
ATOM   284   H  HG3    . ARG A 1 22  ? 43.950  77.854  -37.627 1.00 129.79 ? 19   ARG A HG3    1 
ATOM   285   H  HD2    . ARG A 1 22  ? 44.935  78.699  -39.575 1.00 134.18 ? 19   ARG A HD2    1 
ATOM   286   H  HD3    . ARG A 1 22  ? 46.044  78.066  -38.625 1.00 134.18 ? 19   ARG A HD3    1 
ATOM   287   H  HE     . ARG A 1 22  ? 45.170  76.358  -40.496 1.00 112.20 ? 19   ARG A HE     1 
ATOM   288   H  HH11   . ARG A 1 22  ? 47.527  78.632  -39.990 1.00 106.07 ? 19   ARG A HH11   1 
ATOM   289   H  HH12   . ARG A 1 22  ? 48.453  78.142  -41.048 1.00 106.07 ? 19   ARG A HH12   1 
ATOM   290   H  HH21   . ARG A 1 22  ? 46.589  75.630  -42.101 1.00 104.39 ? 19   ARG A HH21   1 
ATOM   291   H  HH22   . ARG A 1 22  ? 47.886  76.328  -42.324 1.00 104.39 ? 19   ARG A HH22   1 
ATOM   292   N  N      . LEU A 1 23  ? 43.890  73.272  -35.448 1.00 86.27  ? 20   LEU A N      1 
ATOM   293   C  CA     . LEU A 1 23  ? 44.354  71.919  -35.119 1.00 61.23  ? 20   LEU A CA     1 
ATOM   294   C  C      . LEU A 1 23  ? 43.335  71.110  -34.296 1.00 55.20  ? 20   LEU A C      1 
ATOM   295   O  O      . LEU A 1 23  ? 43.127  69.929  -34.579 1.00 55.16  ? 20   LEU A O      1 
ATOM   296   C  CB     . LEU A 1 23  ? 45.714  71.996  -34.423 1.00 47.73  ? 20   LEU A CB     1 
ATOM   297   C  CG     . LEU A 1 23  ? 46.866  72.229  -35.417 1.00 56.98  ? 20   LEU A CG     1 
ATOM   298   C  CD1    . LEU A 1 23  ? 48.190  72.466  -34.717 1.00 64.23  ? 20   LEU A CD1    1 
ATOM   299   C  CD2    . LEU A 1 23  ? 47.028  71.050  -36.380 1.00 44.16  ? 20   LEU A CD2    1 
ATOM   300   H  H      . LEU A 1 23  ? 43.557  73.707  -34.785 1.00 103.53 ? 20   LEU A H      1 
ATOM   301   H  HA     . LEU A 1 23  ? 44.488  71.439  -35.951 1.00 73.47  ? 20   LEU A HA     1 
ATOM   302   H  HB2    . LEU A 1 23  ? 45.707  72.733  -33.792 1.00 57.28  ? 20   LEU A HB2    1 
ATOM   303   H  HB3    . LEU A 1 23  ? 45.881  71.161  -33.958 1.00 57.28  ? 20   LEU A HB3    1 
ATOM   304   H  HG     . LEU A 1 23  ? 46.666  73.017  -35.946 1.00 68.38  ? 20   LEU A HG     1 
ATOM   305   H  HD11   . LEU A 1 23  ? 48.405  71.689  -34.177 1.00 77.08  ? 20   LEU A HD11   1 
ATOM   306   H  HD12   . LEU A 1 23  ? 48.879  72.606  -35.384 1.00 77.08  ? 20   LEU A HD12   1 
ATOM   307   H  HD13   . LEU A 1 23  ? 48.112  73.250  -34.151 1.00 77.08  ? 20   LEU A HD13   1 
ATOM   308   H  HD21   . LEU A 1 23  ? 46.205  70.936  -36.880 1.00 53.00  ? 20   LEU A HD21   1 
ATOM   309   H  HD22   . LEU A 1 23  ? 47.761  71.236  -36.987 1.00 53.00  ? 20   LEU A HD22   1 
ATOM   310   H  HD23   . LEU A 1 23  ? 47.218  70.248  -35.868 1.00 53.00  ? 20   LEU A HD23   1 
ATOM   311   N  N      . PHE A 1 24  ? 42.711  71.719  -33.288 1.00 43.54  ? 21   PHE A N      1 
ATOM   312   C  CA     . PHE A 1 24  ? 41.717  71.010  -32.471 1.00 49.36  ? 21   PHE A CA     1 
ATOM   313   C  C      . PHE A 1 24  ? 40.596  70.409  -33.334 1.00 48.30  ? 21   PHE A C      1 
ATOM   314   O  O      . PHE A 1 24  ? 39.883  71.147  -34.007 1.00 58.86  ? 21   PHE A O      1 
ATOM   315   C  CB     . PHE A 1 24  ? 41.100  71.950  -31.433 1.00 58.52  ? 21   PHE A CB     1 
ATOM   316   C  CG     . PHE A 1 24  ? 40.226  71.252  -30.423 1.00 61.46  ? 21   PHE A CG     1 
ATOM   317   C  CD1    . PHE A 1 24  ? 38.883  71.026  -30.683 1.00 60.01  ? 21   PHE A CD1    1 
ATOM   318   C  CD2    . PHE A 1 24  ? 40.740  70.848  -29.201 1.00 65.82  ? 21   PHE A CD2    1 
ATOM   319   C  CE1    . PHE A 1 24  ? 38.073  70.391  -29.754 1.00 61.12  ? 21   PHE A CE1    1 
ATOM   320   C  CE2    . PHE A 1 24  ? 39.933  70.216  -28.269 1.00 69.40  ? 21   PHE A CE2    1 
ATOM   321   C  CZ     . PHE A 1 24  ? 38.597  69.988  -28.547 1.00 58.89  ? 21   PHE A CZ     1 
ATOM   322   H  H      . PHE A 1 24  ? 42.842  72.537  -33.056 1.00 52.24  ? 21   PHE A H      1 
ATOM   323   H  HA     . PHE A 1 24  ? 42.154  70.285  -31.999 1.00 59.23  ? 21   PHE A HA     1 
ATOM   324   H  HB2    . PHE A 1 24  ? 41.814  72.394  -30.950 1.00 70.22  ? 21   PHE A HB2    1 
ATOM   325   H  HB3    . PHE A 1 24  ? 40.554  72.608  -31.892 1.00 70.22  ? 21   PHE A HB3    1 
ATOM   326   H  HD1    . PHE A 1 24  ? 38.522  71.294  -31.497 1.00 72.02  ? 21   PHE A HD1    1 
ATOM   327   H  HD2    . PHE A 1 24  ? 41.637  70.996  -29.008 1.00 78.99  ? 21   PHE A HD2    1 
ATOM   328   H  HE1    . PHE A 1 24  ? 37.175  70.241  -29.944 1.00 73.35  ? 21   PHE A HE1    1 
ATOM   329   H  HE2    . PHE A 1 24  ? 40.290  69.944  -27.455 1.00 83.28  ? 21   PHE A HE2    1 
ATOM   330   H  HZ     . PHE A 1 24  ? 38.056  69.563  -27.921 1.00 70.66  ? 21   PHE A HZ     1 
ATOM   331   N  N      . PRO A 1 25  ? 40.426  69.075  -33.316 1.00 49.64  ? 22   PRO A N      1 
ATOM   332   C  CA     . PRO A 1 25  ? 39.427  68.423  -34.176 1.00 55.13  ? 22   PRO A CA     1 
ATOM   333   C  C      . PRO A 1 25  ? 37.978  68.584  -33.685 1.00 62.19  ? 22   PRO A C      1 
ATOM   334   O  O      . PRO A 1 25  ? 37.383  67.610  -33.216 1.00 52.71  ? 22   PRO A O      1 
ATOM   335   C  CB     . PRO A 1 25  ? 39.867  66.954  -34.163 1.00 53.01  ? 22   PRO A CB     1 
ATOM   336   C  CG     . PRO A 1 25  ? 40.529  66.771  -32.868 1.00 66.90  ? 22   PRO A CG     1 
ATOM   337   C  CD     . PRO A 1 25  ? 41.166  68.092  -32.507 1.00 68.51  ? 22   PRO A CD     1 
ATOM   338   H  HA     . PRO A 1 25  ? 39.494  68.765  -35.081 1.00 66.16  ? 22   PRO A HA     1 
ATOM   339   H  HB2    . PRO A 1 25  ? 39.090  66.379  -34.237 1.00 63.61  ? 22   PRO A HB2    1 
ATOM   340   H  HB3    . PRO A 1 25  ? 40.486  66.792  -34.892 1.00 63.61  ? 22   PRO A HB3    1 
ATOM   341   H  HG2    . PRO A 1 25  ? 39.869  66.522  -32.203 1.00 80.28  ? 22   PRO A HG2    1 
ATOM   342   H  HG3    . PRO A 1 25  ? 41.206  66.081  -32.948 1.00 80.28  ? 22   PRO A HG3    1 
ATOM   343   H  HD2    . PRO A 1 25  ? 41.046  68.276  -31.562 1.00 82.21  ? 22   PRO A HD2    1 
ATOM   344   H  HD3    . PRO A 1 25  ? 42.104  68.092  -32.752 1.00 82.21  ? 22   PRO A HD3    1 
ATOM   345   N  N      . TYR A 1 26  ? 37.433  69.798  -33.784 1.00 49.09  ? 23   TYR A N      1 
ATOM   346   C  CA     . TYR A 1 26  ? 36.056  70.081  -33.368 1.00 46.53  ? 23   TYR A CA     1 
ATOM   347   C  C      . TYR A 1 26  ? 35.008  69.165  -33.995 1.00 59.70  ? 23   TYR A C      1 
ATOM   348   O  O      . TYR A 1 26  ? 34.009  68.839  -33.355 1.00 53.88  ? 23   TYR A O      1 
ATOM   349   C  CB     . TYR A 1 26  ? 35.689  71.519  -33.721 1.00 41.34  ? 23   TYR A CB     1 
ATOM   350   C  CG     . TYR A 1 26  ? 36.457  72.586  -32.990 1.00 40.86  ? 23   TYR A CG     1 
ATOM   351   C  CD1    . TYR A 1 26  ? 36.030  73.053  -31.755 1.00 53.24  ? 23   TYR A CD1    1 
ATOM   352   C  CD2    . TYR A 1 26  ? 37.624  73.113  -33.524 1.00 45.66  ? 23   TYR A CD2    1 
ATOM   353   C  CE1    . TYR A 1 26  ? 36.731  74.037  -31.085 1.00 64.91  ? 23   TYR A CE1    1 
ATOM   354   C  CE2    . TYR A 1 26  ? 38.335  74.091  -32.861 1.00 49.85  ? 23   TYR A CE2    1 
ATOM   355   C  CZ     . TYR A 1 26  ? 37.886  74.550  -31.642 1.00 65.27  ? 23   TYR A CZ     1 
ATOM   356   O  OH     . TYR A 1 26  ? 38.595  75.523  -30.977 1.00 68.70  ? 23   TYR A OH     1 
ATOM   357   H  H      . TYR A 1 26  ? 37.847  70.485  -34.094 1.00 58.91  ? 23   TYR A H      1 
ATOM   358   H  HA     . TYR A 1 26  ? 35.995  69.986  -32.404 1.00 55.84  ? 23   TYR A HA     1 
ATOM   359   H  HB2    . TYR A 1 26  ? 35.842  71.650  -34.670 1.00 49.60  ? 23   TYR A HB2    1 
ATOM   360   H  HB3    . TYR A 1 26  ? 34.748  71.652  -33.524 1.00 49.60  ? 23   TYR A HB3    1 
ATOM   361   H  HD1    . TYR A 1 26  ? 35.250  72.712  -31.381 1.00 63.89  ? 23   TYR A HD1    1 
ATOM   362   H  HD2    . TYR A 1 26  ? 37.926  72.809  -34.349 1.00 54.79  ? 23   TYR A HD2    1 
ATOM   363   H  HE1    . TYR A 1 26  ? 36.433  74.346  -30.260 1.00 77.90  ? 23   TYR A HE1    1 
ATOM   364   H  HE2    . TYR A 1 26  ? 39.112  74.439  -33.235 1.00 59.82  ? 23   TYR A HE2    1 
ATOM   365   H  HH     . TYR A 1 26  ? 39.271  75.744  -31.424 1.00 82.44  ? 23   TYR A HH     1 
ATOM   366   N  N      . SER A 1 27  ? 35.226  68.770  -35.247 1.00 65.29  ? 24   SER A N      1 
ATOM   367   C  CA     . SER A 1 27  ? 34.261  67.940  -35.966 1.00 75.41  ? 24   SER A CA     1 
ATOM   368   C  C      . SER A 1 27  ? 34.048  66.623  -35.239 1.00 77.19  ? 24   SER A C      1 
ATOM   369   O  O      . SER A 1 27  ? 32.933  66.290  -34.834 1.00 73.02  ? 24   SER A O      1 
ATOM   370   C  CB     . SER A 1 27  ? 34.728  67.676  -37.396 1.00 72.36  ? 24   SER A CB     1 
ATOM   371   O  OG     . SER A 1 27  ? 34.752  68.873  -38.153 1.00 88.49  ? 24   SER A OG     1 
ATOM   372   H  H      . SER A 1 27  ? 35.927  68.970  -35.704 1.00 78.35  ? 24   SER A H      1 
ATOM   373   H  HA     . SER A 1 27  ? 33.411  68.404  -36.007 1.00 90.50  ? 24   SER A HA     1 
ATOM   374   H  HB2    . SER A 1 27  ? 35.623  67.301  -37.371 1.00 86.83  ? 24   SER A HB2    1 
ATOM   375   H  HB3    . SER A 1 27  ? 34.118  67.050  -37.816 1.00 86.83  ? 24   SER A HB3    1 
ATOM   376   H  HG     . SER A 1 27  ? 35.010  68.713  -38.936 1.00 106.19 ? 24   SER A HG     1 
ATOM   377   N  N      . GLN A 1 28  ? 35.135  65.881  -35.077 1.00 77.93  ? 25   GLN A N      1 
ATOM   378   C  CA     . GLN A 1 28  ? 35.090  64.600  -34.396 1.00 60.85  ? 25   GLN A CA     1 
ATOM   379   C  C      . GLN A 1 28  ? 34.690  64.852  -32.947 1.00 65.20  ? 25   GLN A C      1 
ATOM   380   O  O      . GLN A 1 28  ? 34.022  64.028  -32.323 1.00 70.07  ? 25   GLN A O      1 
ATOM   381   C  CB     . GLN A 1 28  ? 36.445  63.894  -34.486 1.00 55.74  ? 25   GLN A CB     1 
ATOM   382   C  CG     . GLN A 1 28  ? 36.953  63.641  -35.914 1.00 64.55  ? 25   GLN A CG     1 
ATOM   383   C  CD     . GLN A 1 28  ? 37.630  64.853  -36.546 1.00 68.37  ? 25   GLN A CD     1 
ATOM   384   O  OE1    . GLN A 1 28  ? 37.482  65.983  -36.080 1.00 65.17  ? 25   GLN A OE1    1 
ATOM   385   N  NE2    . GLN A 1 28  ? 38.396  64.614  -37.602 1.00 61.58  ? 25   GLN A NE2    1 
ATOM   386   H  H      . GLN A 1 28  ? 35.918  66.102  -35.355 1.00 93.51  ? 25   GLN A H      1 
ATOM   387   H  HA     . GLN A 1 28  ? 34.418  64.035  -34.809 1.00 73.02  ? 25   GLN A HA     1 
ATOM   388   H  HB2    . GLN A 1 28  ? 37.107  64.439  -34.033 1.00 66.89  ? 25   GLN A HB2    1 
ATOM   389   H  HB3    . GLN A 1 28  ? 36.375  63.034  -34.044 1.00 66.89  ? 25   GLN A HB3    1 
ATOM   390   H  HG2    . GLN A 1 28  ? 37.599  62.918  -35.893 1.00 77.46  ? 25   GLN A HG2    1 
ATOM   391   H  HG3    . GLN A 1 28  ? 36.201  63.395  -36.475 1.00 77.46  ? 25   GLN A HG3    1 
ATOM   392   H  HE21   . GLN A 1 28  ? 38.488  63.810  -37.893 1.00 73.89  ? 25   GLN A HE21   1 
ATOM   393   H  HE22   . GLN A 1 28  ? 38.800  65.263  -37.995 1.00 73.89  ? 25   GLN A HE22   1 
ATOM   394   N  N      . TYR A 1 29  ? 35.099  66.005  -32.424 1.00 58.08  ? 26   TYR A N      1 
ATOM   395   C  CA     . TYR A 1 29  ? 34.769  66.399  -31.059 1.00 50.10  ? 26   TYR A CA     1 
ATOM   396   C  C      . TYR A 1 29  ? 33.258  66.521  -30.873 1.00 62.70  ? 26   TYR A C      1 
ATOM   397   O  O      . TYR A 1 29  ? 32.697  65.989  -29.911 1.00 47.82  ? 26   TYR A O      1 
ATOM   398   C  CB     . TYR A 1 29  ? 35.441  67.722  -30.701 1.00 41.15  ? 26   TYR A CB     1 
ATOM   399   C  CG     . TYR A 1 29  ? 35.489  68.003  -29.222 1.00 58.82  ? 26   TYR A CG     1 
ATOM   400   C  CD1    . TYR A 1 29  ? 36.434  67.399  -28.403 1.00 62.74  ? 26   TYR A CD1    1 
ATOM   401   C  CD2    . TYR A 1 29  ? 34.568  68.860  -28.637 1.00 64.03  ? 26   TYR A CD2    1 
ATOM   402   C  CE1    . TYR A 1 29  ? 36.469  67.656  -27.050 1.00 44.97  ? 26   TYR A CE1    1 
ATOM   403   C  CE2    . TYR A 1 29  ? 34.596  69.119  -27.286 1.00 66.81  ? 26   TYR A CE2    1 
ATOM   404   C  CZ     . TYR A 1 29  ? 35.547  68.515  -26.498 1.00 45.40  ? 26   TYR A CZ     1 
ATOM   405   O  OH     . TYR A 1 29  ? 35.577  68.770  -25.152 1.00 49.94  ? 26   TYR A OH     1 
ATOM   406   H  H      . TYR A 1 29  ? 35.575  66.584  -32.846 1.00 69.70  ? 26   TYR A H      1 
ATOM   407   H  HA     . TYR A 1 29  ? 35.094  65.721  -30.446 1.00 60.13  ? 26   TYR A HA     1 
ATOM   408   H  HB2    . TYR A 1 29  ? 36.353  67.707  -31.029 1.00 49.38  ? 26   TYR A HB2    1 
ATOM   409   H  HB3    . TYR A 1 29  ? 34.951  68.445  -31.124 1.00 49.38  ? 26   TYR A HB3    1 
ATOM   410   H  HD1    . TYR A 1 29  ? 37.059  66.819  -28.776 1.00 75.29  ? 26   TYR A HD1    1 
ATOM   411   H  HD2    . TYR A 1 29  ? 33.924  69.271  -29.168 1.00 76.84  ? 26   TYR A HD2    1 
ATOM   412   H  HE1    . TYR A 1 29  ? 37.110  67.249  -26.513 1.00 53.96  ? 26   TYR A HE1    1 
ATOM   413   H  HE2    . TYR A 1 29  ? 33.975  69.699  -26.908 1.00 80.17  ? 26   TYR A HE2    1 
ATOM   414   H  HH     . TYR A 1 29  ? 34.964  69.308  -24.948 1.00 59.93  ? 26   TYR A HH     1 
ATOM   415   N  N      . TYR A 1 30  ? 32.600  67.230  -31.789 1.00 74.18  ? 27   TYR A N      1 
ATOM   416   C  CA     . TYR A 1 30  ? 31.149  67.400  -31.713 1.00 65.18  ? 27   TYR A CA     1 
ATOM   417   C  C      . TYR A 1 30  ? 30.436  66.088  -32.027 1.00 59.49  ? 27   TYR A C      1 
ATOM   418   O  O      . TYR A 1 30  ? 29.380  65.797  -31.458 1.00 52.66  ? 27   TYR A O      1 
ATOM   419   C  CB     . TYR A 1 30  ? 30.647  68.505  -32.647 1.00 59.25  ? 27   TYR A CB     1 
ATOM   420   C  CG     . TYR A 1 30  ? 29.157  68.744  -32.485 1.00 73.74  ? 27   TYR A CG     1 
ATOM   421   C  CD1    . TYR A 1 30  ? 28.677  69.504  -31.426 1.00 73.36  ? 27   TYR A CD1    1 
ATOM   422   C  CD2    . TYR A 1 30  ? 28.234  68.206  -33.374 1.00 66.18  ? 27   TYR A CD2    1 
ATOM   423   C  CE1    . TYR A 1 30  ? 27.324  69.721  -31.253 1.00 72.32  ? 27   TYR A CE1    1 
ATOM   424   C  CE2    . TYR A 1 30  ? 26.872  68.419  -33.207 1.00 62.76  ? 27   TYR A CE2    1 
ATOM   425   C  CZ     . TYR A 1 30  ? 26.425  69.180  -32.143 1.00 64.11  ? 27   TYR A CZ     1 
ATOM   426   O  OH     . TYR A 1 30  ? 25.078  69.406  -31.958 1.00 55.34  ? 27   TYR A OH     1 
ATOM   427   H  H      . TYR A 1 30  ? 32.968  67.621  -32.461 1.00 89.01  ? 27   TYR A H      1 
ATOM   428   H  HA     . TYR A 1 30  ? 30.914  67.653  -30.806 1.00 78.22  ? 27   TYR A HA     1 
ATOM   429   H  HB2    . TYR A 1 30  ? 31.110  69.332  -32.442 1.00 71.10  ? 27   TYR A HB2    1 
ATOM   430   H  HB3    . TYR A 1 30  ? 30.814  68.247  -33.567 1.00 71.10  ? 27   TYR A HB3    1 
ATOM   431   H  HD1    . TYR A 1 30  ? 29.278  69.870  -30.818 1.00 88.04  ? 27   TYR A HD1    1 
ATOM   432   H  HD2    . TYR A 1 30  ? 28.533  67.691  -34.089 1.00 79.42  ? 27   TYR A HD2    1 
ATOM   433   H  HE1    . TYR A 1 30  ? 27.022  70.233  -30.537 1.00 86.78  ? 27   TYR A HE1    1 
ATOM   434   H  HE2    . TYR A 1 30  ? 26.265  68.054  -33.809 1.00 75.31  ? 27   TYR A HE2    1 
ATOM   435   H  HH     . TYR A 1 30  ? 24.637  69.025  -32.563 1.00 66.41  ? 27   TYR A HH     1 
ATOM   436   N  N      . ARG A 1 31  ? 31.002  65.306  -32.943 1.00 52.49  ? 28   ARG A N      1 
ATOM   437   C  CA     . ARG A 1 31  ? 30.448  63.992  -33.251 1.00 62.66  ? 28   ARG A CA     1 
ATOM   438   C  C      . ARG A 1 31  ? 30.351  63.170  -31.983 1.00 68.61  ? 28   ARG A C      1 
ATOM   439   O  O      . ARG A 1 31  ? 29.344  62.505  -31.737 1.00 68.04  ? 28   ARG A O      1 
ATOM   440   C  CB     . ARG A 1 31  ? 31.310  63.242  -34.264 1.00 71.43  ? 28   ARG A CB     1 
ATOM   441   C  CG     . ARG A 1 31  ? 31.099  63.629  -35.713 1.00 83.18  ? 28   ARG A CG     1 
ATOM   442   C  CD     . ARG A 1 31  ? 31.956  62.755  -36.617 1.00 64.92  ? 28   ARG A CD     1 
ATOM   443   N  NE     . ARG A 1 31  ? 31.582  61.342  -36.527 1.00 43.89  ? 28   ARG A NE     1 
ATOM   444   C  CZ     . ARG A 1 31  ? 32.368  60.334  -36.898 1.00 53.21  ? 28   ARG A CZ     1 
ATOM   445   N  NH1    . ARG A 1 31  ? 33.589  60.573  -37.381 1.00 39.26  ? 28   ARG A NH1    1 
ATOM   446   N  NH2    . ARG A 1 31  ? 31.939  59.083  -36.780 1.00 44.47  ? 28   ARG A NH2    1 
ATOM   447   H  H      . ARG A 1 31  ? 31.702  65.512  -33.398 1.00 62.99  ? 28   ARG A H      1 
ATOM   448   H  HA     . ARG A 1 31  ? 29.557  64.094  -33.620 1.00 75.19  ? 28   ARG A HA     1 
ATOM   449   H  HB2    . ARG A 1 31  ? 32.242  63.404  -34.053 1.00 85.72  ? 28   ARG A HB2    1 
ATOM   450   H  HB3    . ARG A 1 31  ? 31.120  62.294  -34.186 1.00 85.72  ? 28   ARG A HB3    1 
ATOM   451   H  HG2    . ARG A 1 31  ? 30.168  63.500  -35.951 1.00 99.82  ? 28   ARG A HG2    1 
ATOM   452   H  HG3    . ARG A 1 31  ? 31.359  64.555  -35.843 1.00 99.82  ? 28   ARG A HG3    1 
ATOM   453   H  HD2    . ARG A 1 31  ? 31.842  63.040  -37.537 1.00 77.90  ? 28   ARG A HD2    1 
ATOM   454   H  HD3    . ARG A 1 31  ? 32.886  62.839  -36.353 1.00 77.90  ? 28   ARG A HD3    1 
ATOM   455   H  HE     . ARG A 1 31  ? 30.804  61.150  -36.214 1.00 52.67  ? 28   ARG A HE     1 
ATOM   456   H  HH11   . ARG A 1 31  ? 33.870  61.382  -37.459 1.00 47.11  ? 28   ARG A HH11   1 
ATOM   457   H  HH12   . ARG A 1 31  ? 34.093  59.918  -37.618 1.00 47.11  ? 28   ARG A HH12   1 
ATOM   458   H  HH21   . ARG A 1 31  ? 31.154  58.925  -36.467 1.00 53.36  ? 28   ARG A HH21   1 
ATOM   459   H  HH22   . ARG A 1 31  ? 32.447  58.430  -37.017 1.00 53.36  ? 28   ARG A HH22   1 
ATOM   460   N  N      . TRP A 1 32  ? 31.399  63.242  -31.171 1.00 67.57  ? 29   TRP A N      1 
ATOM   461   C  CA     . TRP A 1 32  ? 31.442  62.513  -29.918 1.00 49.12  ? 29   TRP A CA     1 
ATOM   462   C  C      . TRP A 1 32  ? 30.318  62.950  -28.990 1.00 56.59  ? 29   TRP A C      1 
ATOM   463   O  O      . TRP A 1 32  ? 29.415  62.169  -28.688 1.00 56.20  ? 29   TRP A O      1 
ATOM   464   C  CB     . TRP A 1 32  ? 32.794  62.706  -29.220 1.00 64.67  ? 29   TRP A CB     1 
ATOM   465   C  CG     . TRP A 1 32  ? 32.902  61.957  -27.913 1.00 72.02  ? 29   TRP A CG     1 
ATOM   466   C  CD1    . TRP A 1 32  ? 32.269  60.792  -27.580 1.00 59.77  ? 29   TRP A CD1    1 
ATOM   467   C  CD2    . TRP A 1 32  ? 33.684  62.326  -26.769 1.00 43.68  ? 29   TRP A CD2    1 
ATOM   468   N  NE1    . TRP A 1 32  ? 32.603  60.419  -26.306 1.00 55.42  ? 29   TRP A NE1    1 
ATOM   469   C  CE2    . TRP A 1 32  ? 33.473  61.341  -25.784 1.00 67.60  ? 29   TRP A CE2    1 
ATOM   470   C  CE3    . TRP A 1 32  ? 34.541  63.392  -26.483 1.00 48.28  ? 29   TRP A CE3    1 
ATOM   471   C  CZ2    . TRP A 1 32  ? 34.091  61.389  -24.532 1.00 61.33  ? 29   TRP A CZ2    1 
ATOM   472   C  CZ3    . TRP A 1 32  ? 35.153  63.438  -25.238 1.00 60.29  ? 29   TRP A CZ3    1 
ATOM   473   C  CH2    . TRP A 1 32  ? 34.925  62.443  -24.280 1.00 49.12  ? 29   TRP A CH2    1 
ATOM   474   H  H      . TRP A 1 32  ? 32.103  63.710  -31.328 1.00 81.09  ? 29   TRP A H      1 
ATOM   475   H  HA     . TRP A 1 32  ? 31.331  61.567  -30.099 1.00 58.94  ? 29   TRP A HA     1 
ATOM   476   H  HB2    . TRP A 1 32  ? 33.498  62.386  -29.805 1.00 77.60  ? 29   TRP A HB2    1 
ATOM   477   H  HB3    . TRP A 1 32  ? 32.920  63.649  -29.035 1.00 77.60  ? 29   TRP A HB3    1 
ATOM   478   H  HD1    . TRP A 1 32  ? 31.688  60.325  -28.136 1.00 71.73  ? 29   TRP A HD1    1 
ATOM   479   H  HE1    . TRP A 1 32  ? 32.318  59.716  -25.900 1.00 66.50  ? 29   TRP A HE1    1 
ATOM   480   H  HE3    . TRP A 1 32  ? 34.698  64.058  -27.113 1.00 57.93  ? 29   TRP A HE3    1 
ATOM   481   H  HZ2    . TRP A 1 32  ? 33.941  60.728  -23.894 1.00 73.59  ? 29   TRP A HZ2    1 
ATOM   482   H  HZ3    . TRP A 1 32  ? 35.725  64.143  -25.036 1.00 72.35  ? 29   TRP A HZ3    1 
ATOM   483   H  HH2    . TRP A 1 32  ? 35.349  62.501  -23.454 1.00 58.94  ? 29   TRP A HH2    1 
ATOM   484   N  N      . LEU A 1 33  ? 30.365  64.201  -28.548 1.00 43.00  ? 30   LEU A N      1 
ATOM   485   C  CA     . LEU A 1 33  ? 29.499  64.645  -27.464 1.00 54.17  ? 30   LEU A CA     1 
ATOM   486   C  C      . LEU A 1 33  ? 28.023  64.783  -27.844 1.00 68.01  ? 30   LEU A C      1 
ATOM   487   O  O      . LEU A 1 33  ? 27.173  64.851  -26.955 1.00 66.30  ? 30   LEU A O      1 
ATOM   488   C  CB     . LEU A 1 33  ? 30.032  65.965  -26.899 1.00 59.02  ? 30   LEU A CB     1 
ATOM   489   C  CG     . LEU A 1 33  ? 31.458  65.847  -26.334 1.00 67.53  ? 30   LEU A CG     1 
ATOM   490   C  CD1    . LEU A 1 33  ? 31.969  67.178  -25.786 1.00 54.82  ? 30   LEU A CD1    1 
ATOM   491   C  CD2    . LEU A 1 33  ? 31.556  64.752  -25.272 1.00 52.13  ? 30   LEU A CD2    1 
ATOM   492   H  H      . LEU A 1 33  ? 30.888  64.810  -28.856 1.00 51.60  ? 30   LEU A H      1 
ATOM   493   H  HA     . LEU A 1 33  ? 29.548  63.988  -26.752 1.00 65.00  ? 30   LEU A HA     1 
ATOM   494   H  HB2    . LEU A 1 33  ? 30.045  66.628  -27.607 1.00 70.83  ? 30   LEU A HB2    1 
ATOM   495   H  HB3    . LEU A 1 33  ? 29.450  66.258  -26.181 1.00 70.83  ? 30   LEU A HB3    1 
ATOM   496   H  HG     . LEU A 1 33  ? 32.049  65.592  -27.060 1.00 81.03  ? 30   LEU A HG     1 
ATOM   497   H  HD11   . LEU A 1 33  ? 31.380  67.473  -25.074 1.00 65.78  ? 30   LEU A HD11   1 
ATOM   498   H  HD12   . LEU A 1 33  ? 32.868  67.054  -25.443 1.00 65.78  ? 30   LEU A HD12   1 
ATOM   499   H  HD13   . LEU A 1 33  ? 31.975  67.832  -26.503 1.00 65.78  ? 30   LEU A HD13   1 
ATOM   500   H  HD21   . LEU A 1 33  ? 31.310  63.903  -25.672 1.00 62.56  ? 30   LEU A HD21   1 
ATOM   501   H  HD22   . LEU A 1 33  ? 32.468  64.711  -24.944 1.00 62.56  ? 30   LEU A HD22   1 
ATOM   502   H  HD23   . LEU A 1 33  ? 30.951  64.963  -24.544 1.00 62.56  ? 30   LEU A HD23   1 
ATOM   503   N  N      . ASN A 1 34  ? 27.711  64.822  -29.140 1.00 79.83  ? 31   ASN A N      1 
ATOM   504   C  CA     . ASN A 1 34  ? 26.313  64.894  -29.580 1.00 67.08  ? 31   ASN A CA     1 
ATOM   505   C  C      . ASN A 1 34  ? 25.643  63.527  -29.761 1.00 71.37  ? 31   ASN A C      1 
ATOM   506   O  O      . ASN A 1 34  ? 24.413  63.420  -29.706 1.00 70.84  ? 31   ASN A O      1 
ATOM   507   C  CB     . ASN A 1 34  ? 26.217  65.682  -30.884 1.00 76.08  ? 31   ASN A CB     1 
ATOM   508   C  CG     . ASN A 1 34  ? 24.783  65.906  -31.322 1.00 84.05  ? 31   ASN A CG     1 
ATOM   509   O  OD1    . ASN A 1 34  ? 23.917  66.228  -30.508 1.00 81.42  ? 31   ASN A OD1    1 
ATOM   510   N  ND2    . ASN A 1 34  ? 24.526  65.734  -32.614 1.00 74.72  ? 31   ASN A ND2    1 
ATOM   511   H  H      . ASN A 1 34  ? 28.284  64.807  -29.781 1.00 95.80  ? 31   ASN A H      1 
ATOM   512   H  HA     . ASN A 1 34  ? 25.807  65.379  -28.910 1.00 80.50  ? 31   ASN A HA     1 
ATOM   513   H  HB2    . ASN A 1 34  ? 26.633  66.550  -30.762 1.00 91.30  ? 31   ASN A HB2    1 
ATOM   514   H  HB3    . ASN A 1 34  ? 26.672  65.191  -31.586 1.00 91.30  ? 31   ASN A HB3    1 
ATOM   515   H  HD21   . ASN A 1 34  ? 25.157  65.507  -33.152 1.00 89.67  ? 31   ASN A HD21   1 
ATOM   516   H  HD22   . ASN A 1 34  ? 23.727  65.849  -32.913 1.00 89.67  ? 31   ASN A HD22   1 
ATOM   517   N  N      . TYR A 1 35  ? 26.453  62.491  -29.957 1.00 73.29  ? 32   TYR A N      1 
ATOM   518   C  CA     . TYR A 1 35  ? 25.968  61.110  -30.051 1.00 76.31  ? 32   TYR A CA     1 
ATOM   519   C  C      . TYR A 1 35  ? 24.870  60.896  -31.104 1.00 69.69  ? 32   TYR A C      1 
ATOM   520   O  O      . TYR A 1 35  ? 23.821  60.329  -30.808 1.00 65.20  ? 32   TYR A O      1 
ATOM   521   C  CB     . TYR A 1 35  ? 25.451  60.664  -28.679 1.00 85.06  ? 32   TYR A CB     1 
ATOM   522   C  CG     . TYR A 1 35  ? 26.552  60.450  -27.669 1.00 82.94  ? 32   TYR A CG     1 
ATOM   523   C  CD1    . TYR A 1 35  ? 27.307  59.283  -27.667 1.00 84.18  ? 32   TYR A CD1    1 
ATOM   524   C  CD2    . TYR A 1 35  ? 26.855  61.430  -26.734 1.00 68.55  ? 32   TYR A CD2    1 
ATOM   525   C  CE1    . TYR A 1 35  ? 28.324  59.091  -26.750 1.00 63.35  ? 32   TYR A CE1    1 
ATOM   526   C  CE2    . TYR A 1 35  ? 27.866  61.248  -25.813 1.00 76.66  ? 32   TYR A CE2    1 
ATOM   527   C  CZ     . TYR A 1 35  ? 28.598  60.077  -25.825 1.00 69.87  ? 32   TYR A CZ     1 
ATOM   528   O  OH     . TYR A 1 35  ? 29.608  59.897  -24.909 1.00 65.76  ? 32   TYR A OH     1 
ATOM   529   H  H      . TYR A 1 35  ? 27.306  62.560  -30.040 1.00 87.95  ? 32   TYR A H      1 
ATOM   530   H  HA     . TYR A 1 35  ? 26.714  60.536  -30.286 1.00 91.58  ? 32   TYR A HA     1 
ATOM   531   H  HB2    . TYR A 1 35  ? 24.855  61.346  -28.330 1.00 102.07 ? 32   TYR A HB2    1 
ATOM   532   H  HB3    . TYR A 1 35  ? 24.972  59.826  -28.780 1.00 102.07 ? 32   TYR A HB3    1 
ATOM   533   H  HD1    . TYR A 1 35  ? 26.363  62.219  -26.723 1.00 82.26  ? 32   TYR A HD1    1 
ATOM   534   H  HD2    . TYR A 1 35  ? 27.121  58.618  -28.289 1.00 101.02 ? 32   TYR A HD2    1 
ATOM   535   H  HE1    . TYR A 1 35  ? 28.055  61.911  -25.189 1.00 91.99  ? 32   TYR A HE1    1 
ATOM   536   H  HE2    . TYR A 1 35  ? 28.818  58.303  -26.755 1.00 76.02  ? 32   TYR A HE2    1 
ATOM   537   H  HH     . TYR A 1 35  ? 29.667  60.571  -24.411 1.00 78.91  ? 32   TYR A HH     1 
ATOM   538   N  N      . GLY A 1 36  ? 25.122  61.352  -32.329 1.00 82.30  ? 33   GLY A N      1 
ATOM   539   C  CA     . GLY A 1 36  ? 24.210  61.151  -33.446 1.00 84.46  ? 33   GLY A CA     1 
ATOM   540   C  C      . GLY A 1 36  ? 22.847  61.816  -33.318 1.00 66.22  ? 33   GLY A C      1 
ATOM   541   O  O      . GLY A 1 36  ? 21.863  61.342  -33.882 1.00 68.23  ? 33   GLY A O      1 
ATOM   542   H  H      . GLY A 1 36  ? 25.832  61.789  -32.540 1.00 98.76  ? 33   GLY A H      1 
ATOM   543   H  HA2    . GLY A 1 36  ? 24.628  61.488  -34.254 1.00 101.36 ? 33   GLY A HA2    1 
ATOM   544   H  HA3    . GLY A 1 36  ? 24.065  60.199  -33.562 1.00 101.36 ? 33   GLY A HA3    1 
ATOM   545   N  N      . GLY A 1 37  ? 22.782  62.901  -32.558 1.00 64.94  ? 34   GLY A N      1 
ATOM   546   C  CA     . GLY A 1 37  ? 21.577  63.705  -32.442 1.00 51.82  ? 34   GLY A CA     1 
ATOM   547   C  C      . GLY A 1 37  ? 20.316  63.007  -31.950 1.00 57.24  ? 34   GLY A C      1 
ATOM   548   O  O      . GLY A 1 37  ? 19.274  63.646  -31.817 1.00 68.84  ? 34   GLY A O      1 
ATOM   549   H  H      . GLY A 1 37  ? 23.440  63.198  -32.090 1.00 77.93  ? 34   GLY A H      1 
ATOM   550   H  HA2    . GLY A 1 37  ? 21.756  64.440  -31.835 1.00 62.18  ? 34   GLY A HA2    1 
ATOM   551   H  HA3    . GLY A 1 37  ? 21.377  64.085  -33.311 1.00 62.18  ? 34   GLY A HA3    1 
ATOM   552   N  N      . VAL A 1 38  ? 20.408  61.711  -31.671 1.00 54.78  ? 35   VAL A N      1 
ATOM   553   C  CA     . VAL A 1 38  ? 19.260  60.910  -31.237 1.00 73.63  ? 35   VAL A CA     1 
ATOM   554   C  C      . VAL A 1 38  ? 18.445  61.525  -30.095 1.00 83.97  ? 35   VAL A C      1 
ATOM   555   O  O      . VAL A 1 38  ? 17.218  61.432  -30.089 1.00 90.63  ? 35   VAL A O      1 
ATOM   556   C  CB     . VAL A 1 38  ? 19.705  59.495  -30.815 1.00 96.81  ? 35   VAL A CB     1 
ATOM   557   C  CG1    . VAL A 1 38  ? 20.256  58.739  -32.018 1.00 72.51  ? 35   VAL A CG1    1 
ATOM   558   C  CG2    . VAL A 1 38  ? 20.721  59.554  -29.676 1.00 102.71 ? 35   VAL A CG2    1 
ATOM   559   H  H      . VAL A 1 38  ? 21.139  61.261  -31.726 1.00 65.73  ? 35   VAL A H      1 
ATOM   560   H  HA     . VAL A 1 38  ? 18.661  60.809  -31.993 1.00 88.36  ? 35   VAL A HA     1 
ATOM   561   H  HB     . VAL A 1 38  ? 18.930  59.009  -30.493 1.00 116.17 ? 35   VAL A HB     1 
ATOM   562   H  HG11   . VAL A 1 38  ? 21.018  59.224  -32.373 1.00 87.01  ? 35   VAL A HG11   1 
ATOM   563   H  HG12   . VAL A 1 38  ? 20.531  57.853  -31.735 1.00 87.01  ? 35   VAL A HG12   1 
ATOM   564   H  HG13   . VAL A 1 38  ? 19.563  58.671  -32.693 1.00 87.01  ? 35   VAL A HG13   1 
ATOM   565   H  HG21   . VAL A 1 38  ? 20.316  59.996  -28.914 1.00 123.25 ? 35   VAL A HG21   1 
ATOM   566   H  HG22   . VAL A 1 38  ? 20.979  58.650  -29.436 1.00 123.25 ? 35   VAL A HG22   1 
ATOM   567   H  HG23   . VAL A 1 38  ? 21.499  60.052  -29.973 1.00 123.25 ? 35   VAL A HG23   1 
ATOM   568   N  N      . ILE A 1 39  ? 19.125  62.143  -29.130 1.00 84.42  ? 36   ILE A N      1 
ATOM   569   C  CA     . ILE A 1 39  ? 18.449  62.789  -28.006 1.00 87.94  ? 36   ILE A CA     1 
ATOM   570   C  C      . ILE A 1 39  ? 18.683  64.291  -28.019 1.00 92.31  ? 36   ILE A C      1 
ATOM   571   O  O      . ILE A 1 39  ? 19.814  64.763  -28.148 1.00 86.58  ? 36   ILE A O      1 
ATOM   572   C  CB     . ILE A 1 39  ? 18.908  62.207  -26.651 1.00 72.68  ? 36   ILE A CB     1 
ATOM   573   C  CG1    . ILE A 1 39  ? 18.245  60.844  -26.429 1.00 70.52  ? 36   ILE A CG1    1 
ATOM   574   C  CG2    . ILE A 1 39  ? 18.556  63.159  -25.500 1.00 78.31  ? 36   ILE A CG2    1 
ATOM   575   C  CD1    . ILE A 1 39  ? 18.556  60.183  -25.091 1.00 118.85 ? 36   ILE A CD1    1 
ATOM   576   H  H      . ILE A 1 39  ? 19.983  62.202  -29.104 1.00 101.30 ? 36   ILE A H      1 
ATOM   577   H  HA     . ILE A 1 39  ? 17.495  62.637  -28.086 1.00 105.52 ? 36   ILE A HA     1 
ATOM   578   H  HB     . ILE A 1 39  ? 19.870  62.086  -26.673 1.00 87.22  ? 36   ILE A HB     1 
ATOM   579   H  HG12   . ILE A 1 39  ? 17.283  60.957  -26.482 1.00 84.63  ? 36   ILE A HG12   1 
ATOM   580   H  HG13   . ILE A 1 39  ? 18.539  60.240  -27.128 1.00 84.63  ? 36   ILE A HG13   1 
ATOM   581   H  HG21   . ILE A 1 39  ? 17.595  63.288  -25.479 1.00 93.97  ? 36   ILE A HG21   1 
ATOM   582   H  HG22   . ILE A 1 39  ? 18.856  62.768  -24.664 1.00 93.97  ? 36   ILE A HG22   1 
ATOM   583   H  HG23   . ILE A 1 39  ? 19.001  64.008  -25.646 1.00 93.97  ? 36   ILE A HG23   1 
ATOM   584   H  HD11   . ILE A 1 39  ? 18.253  60.764  -24.375 1.00 142.62 ? 36   ILE A HD11   1 
ATOM   585   H  HD12   . ILE A 1 39  ? 18.093  59.332  -25.045 1.00 142.62 ? 36   ILE A HD12   1 
ATOM   586   H  HD13   . ILE A 1 39  ? 19.513  60.045  -25.023 1.00 142.62 ? 36   ILE A HD13   1 
ATOM   587   N  N      . LYS A 1 40  ? 17.587  65.029  -27.885 1.00 103.94 ? 37   LYS A N      1 
ATOM   588   C  CA     . LYS A 1 40  ? 17.604  66.481  -27.966 1.00 110.40 ? 37   LYS A CA     1 
ATOM   589   C  C      . LYS A 1 40  ? 18.143  67.114  -26.686 1.00 85.57  ? 37   LYS A C      1 
ATOM   590   O  O      . LYS A 1 40  ? 17.959  66.585  -25.592 1.00 61.03  ? 37   LYS A O      1 
ATOM   591   C  CB     . LYS A 1 40  ? 16.197  67.009  -28.259 1.00 113.52 ? 37   LYS A CB     1 
ATOM   592   C  CG     . LYS A 1 40  ? 15.499  66.303  -29.417 1.00 114.08 ? 37   LYS A CG     1 
ATOM   593   C  CD     . LYS A 1 40  ? 14.059  66.761  -29.567 1.00 116.43 ? 37   LYS A CD     1 
ATOM   594   C  CE     . LYS A 1 40  ? 13.342  65.974  -30.653 1.00 114.50 ? 37   LYS A CE     1 
ATOM   595   N  NZ     . LYS A 1 40  ? 11.906  66.351  -30.763 1.00 104.11 ? 37   LYS A NZ     1 
ATOM   596   H  H      . LYS A 1 40  ? 16.804  64.702  -27.742 1.00 124.73 ? 37   LYS A H      1 
ATOM   597   H  HA     . LYS A 1 40  ? 18.182  66.748  -28.697 1.00 132.48 ? 37   LYS A HA     1 
ATOM   598   H  HB2    . LYS A 1 40  ? 15.648  66.893  -27.468 1.00 136.23 ? 37   LYS A HB2    1 
ATOM   599   H  HB3    . LYS A 1 40  ? 16.257  67.952  -28.481 1.00 136.23 ? 37   LYS A HB3    1 
ATOM   600   H  HG2    . LYS A 1 40  ? 15.968  66.502  -30.242 1.00 136.90 ? 37   LYS A HG2    1 
ATOM   601   H  HG3    . LYS A 1 40  ? 15.498  65.347  -29.254 1.00 136.90 ? 37   LYS A HG3    1 
ATOM   602   H  HD2    . LYS A 1 40  ? 13.589  66.623  -28.730 1.00 139.72 ? 37   LYS A HD2    1 
ATOM   603   H  HD3    . LYS A 1 40  ? 14.044  67.699  -29.811 1.00 139.72 ? 37   LYS A HD3    1 
ATOM   604   H  HE2    . LYS A 1 40  ? 13.767  66.150  -31.507 1.00 137.39 ? 37   LYS A HE2    1 
ATOM   605   H  HE3    . LYS A 1 40  ? 13.391  65.027  -30.444 1.00 137.39 ? 37   LYS A HE3    1 
ATOM   606   H  HZ1    . LYS A 1 40  ? 11.833  67.216  -30.959 1.00 124.93 ? 37   LYS A HZ1    1 
ATOM   607   H  HZ2    . LYS A 1 40  ? 11.515  65.874  -31.405 1.00 124.93 ? 37   LYS A HZ2    1 
ATOM   608   H  HZ3    . LYS A 1 40  ? 11.490  66.194  -29.992 1.00 124.93 ? 37   LYS A HZ3    1 
ATOM   609   N  N      . ASN A 1 41  ? 18.831  68.238  -26.867 1.00 84.52  ? 38   ASN A N      1 
ATOM   610   C  CA     . ASN A 1 41  ? 19.446  69.023  -25.796 1.00 97.81  ? 38   ASN A CA     1 
ATOM   611   C  C      . ASN A 1 41  ? 20.622  68.327  -25.103 1.00 101.85 ? 38   ASN A C      1 
ATOM   612   O  O      . ASN A 1 41  ? 21.098  68.792  -24.064 1.00 86.92  ? 38   ASN A O      1 
ATOM   613   C  CB     . ASN A 1 41  ? 18.394  69.406  -24.745 1.00 99.88  ? 38   ASN A CB     1 
ATOM   614   C  CG     . ASN A 1 41  ? 17.462  70.495  -25.223 1.00 106.19 ? 38   ASN A CG     1 
ATOM   615   O  OD1    . ASN A 1 41  ? 17.847  71.354  -26.017 1.00 106.37 ? 38   ASN A OD1    1 
ATOM   616   N  ND2    . ASN A 1 41  ? 16.219  70.457  -24.753 1.00 114.56 ? 38   ASN A ND2    1 
ATOM   617   H  H      . ASN A 1 41  ? 18.962  68.583  -27.644 1.00 101.43 ? 38   ASN A H      1 
ATOM   618   H  HA     . ASN A 1 41  ? 19.785  69.847  -26.180 1.00 117.37 ? 38   ASN A HA     1 
ATOM   619   H  HB2    . ASN A 1 41  ? 17.859  68.625  -24.534 1.00 119.86 ? 38   ASN A HB2    1 
ATOM   620   H  HB3    . ASN A 1 41  ? 18.845  69.725  -23.948 1.00 119.86 ? 38   ASN A HB3    1 
ATOM   621   H  HD21   . ASN A 1 41  ? 15.985  69.834  -24.207 1.00 137.47 ? 38   ASN A HD21   1 
ATOM   622   H  HD22   . ASN A 1 41  ? 15.650  71.054  -24.994 1.00 137.47 ? 38   ASN A HD22   1 
ATOM   623   N  N      . TYR A 1 42  ? 21.098  67.227  -25.678 1.00 97.50  ? 39   TYR A N      1 
ATOM   624   C  CA     . TYR A 1 42  ? 22.188  66.472  -25.067 1.00 84.52  ? 39   TYR A CA     1 
ATOM   625   C  C      . TYR A 1 42  ? 23.488  67.275  -25.082 1.00 87.20  ? 39   TYR A C      1 
ATOM   626   O  O      . TYR A 1 42  ? 24.114  67.467  -24.039 1.00 93.50  ? 39   TYR A O      1 
ATOM   627   C  CB     . TYR A 1 42  ? 22.371  65.132  -25.774 1.00 86.27  ? 39   TYR A CB     1 
ATOM   628   C  CG     . TYR A 1 42  ? 22.897  64.040  -24.871 1.00 80.49  ? 39   TYR A CG     1 
ATOM   629   C  CD1    . TYR A 1 42  ? 22.067  63.442  -23.932 1.00 79.89  ? 39   TYR A CD1    1 
ATOM   630   C  CD2    . TYR A 1 42  ? 24.209  63.592  -24.965 1.00 79.32  ? 39   TYR A CD2    1 
ATOM   631   C  CE1    . TYR A 1 42  ? 22.528  62.443  -23.102 1.00 80.07  ? 39   TYR A CE1    1 
ATOM   632   C  CE2    . TYR A 1 42  ? 24.680  62.584  -24.139 1.00 68.09  ? 39   TYR A CE2    1 
ATOM   633   C  CZ     . TYR A 1 42  ? 23.832  62.016  -23.211 1.00 73.33  ? 39   TYR A CZ     1 
ATOM   634   O  OH     . TYR A 1 42  ? 24.281  61.016  -22.381 1.00 77.49  ? 39   TYR A OH     1 
ATOM   635   H  H      . TYR A 1 42  ? 20.809  66.898  -26.418 1.00 117.00 ? 39   TYR A H      1 
ATOM   636   H  HA     . TYR A 1 42  ? 21.962  66.291  -24.141 1.00 101.42 ? 39   TYR A HA     1 
ATOM   637   H  HB2    . TYR A 1 42  ? 21.514  64.842  -26.123 1.00 103.52 ? 39   TYR A HB2    1 
ATOM   638   H  HB3    . TYR A 1 42  ? 23.002  65.246  -26.502 1.00 103.52 ? 39   TYR A HB3    1 
ATOM   639   H  HD1    . TYR A 1 42  ? 24.781  63.976  -25.591 1.00 95.19  ? 39   TYR A HD1    1 
ATOM   640   H  HD2    . TYR A 1 42  ? 21.186  63.728  -23.855 1.00 95.86  ? 39   TYR A HD2    1 
ATOM   641   H  HE1    . TYR A 1 42  ? 25.561  62.295  -24.208 1.00 81.71  ? 39   TYR A HE1    1 
ATOM   642   H  HE2    . TYR A 1 42  ? 21.959  62.055  -22.477 1.00 96.09  ? 39   TYR A HE2    1 
ATOM   643   H  HH     . TYR A 1 42  ? 23.661  60.767  -21.871 1.00 92.98  ? 39   TYR A HH     1 
ATOM   644   N  N      . PHE A 1 43  ? 23.898  67.746  -26.258 1.00 76.92  ? 40   PHE A N      1 
ATOM   645   C  CA     . PHE A 1 43  ? 25.099  68.569  -26.342 1.00 73.22  ? 40   PHE A CA     1 
ATOM   646   C  C      . PHE A 1 43  ? 24.813  69.928  -25.734 1.00 63.52  ? 40   PHE A C      1 
ATOM   647   O  O      . PHE A 1 43  ? 25.711  70.600  -25.233 1.00 68.11  ? 40   PHE A O      1 
ATOM   648   C  CB     . PHE A 1 43  ? 25.566  68.759  -27.786 1.00 58.80  ? 40   PHE A CB     1 
ATOM   649   C  CG     . PHE A 1 43  ? 26.732  69.704  -27.917 1.00 60.05  ? 40   PHE A CG     1 
ATOM   650   C  CD1    . PHE A 1 43  ? 28.031  69.235  -27.825 1.00 78.74  ? 40   PHE A CD1    1 
ATOM   651   C  CD2    . PHE A 1 43  ? 26.531  71.065  -28.077 1.00 64.58  ? 40   PHE A CD2    1 
ATOM   652   C  CE1    . PHE A 1 43  ? 29.110  70.100  -27.929 1.00 79.75  ? 40   PHE A CE1    1 
ATOM   653   C  CE2    . PHE A 1 43  ? 27.606  71.933  -28.176 1.00 77.26  ? 40   PHE A CE2    1 
ATOM   654   C  CZ     . PHE A 1 43  ? 28.897  71.449  -28.101 1.00 70.55  ? 40   PHE A CZ     1 
ATOM   655   H  H      . PHE A 1 43  ? 23.505  67.605  -27.010 1.00 92.30  ? 40   PHE A H      1 
ATOM   656   H  HA     . PHE A 1 43  ? 25.815  68.150  -25.839 1.00 87.86  ? 40   PHE A HA     1 
ATOM   657   H  HB2    . PHE A 1 43  ? 25.837  67.900  -28.145 1.00 70.56  ? 40   PHE A HB2    1 
ATOM   658   H  HB3    . PHE A 1 43  ? 24.832  69.118  -28.309 1.00 70.56  ? 40   PHE A HB3    1 
ATOM   659   H  HD1    . PHE A 1 43  ? 28.182  68.325  -27.711 1.00 94.48  ? 40   PHE A HD1    1 
ATOM   660   H  HD2    . PHE A 1 43  ? 25.665  71.399  -28.131 1.00 77.50  ? 40   PHE A HD2    1 
ATOM   661   H  HE1    . PHE A 1 43  ? 29.977  69.769  -27.875 1.00 95.70  ? 40   PHE A HE1    1 
ATOM   662   H  HE2    . PHE A 1 43  ? 27.458  72.844  -28.295 1.00 92.71  ? 40   PHE A HE2    1 
ATOM   663   H  HZ     . PHE A 1 43  ? 29.619  72.032  -28.169 1.00 84.65  ? 40   PHE A HZ     1 
ATOM   664   N  N      . GLN A 1 44  ? 23.546  70.323  -25.766 1.00 73.77  ? 41   GLN A N      1 
ATOM   665   C  CA     . GLN A 1 44  ? 23.164  71.654  -25.320 1.00 91.78  ? 41   GLN A CA     1 
ATOM   666   C  C      . GLN A 1 44  ? 23.134  71.753  -23.794 1.00 91.28  ? 41   GLN A C      1 
ATOM   667   O  O      . GLN A 1 44  ? 23.157  72.853  -23.239 1.00 85.26  ? 41   GLN A O      1 
ATOM   668   C  CB     . GLN A 1 44  ? 21.798  72.043  -25.907 1.00 92.89  ? 41   GLN A CB     1 
ATOM   669   C  CG     . GLN A 1 44  ? 21.802  72.375  -27.408 1.00 89.40  ? 41   GLN A CG     1 
ATOM   670   C  CD     . GLN A 1 44  ? 21.889  71.151  -28.312 1.00 87.08  ? 41   GLN A CD     1 
ATOM   671   O  OE1    . GLN A 1 44  ? 21.374  70.083  -27.988 1.00 97.54  ? 41   GLN A OE1    1 
ATOM   672   N  NE2    . GLN A 1 44  ? 22.529  71.315  -29.467 1.00 55.88  ? 41   GLN A NE2    1 
ATOM   673   H  H      . GLN A 1 44  ? 22.891  69.840  -26.042 1.00 88.52  ? 41   GLN A H      1 
ATOM   674   H  HA     . GLN A 1 44  ? 23.818  72.292  -25.646 1.00 110.14 ? 41   GLN A HA     1 
ATOM   675   H  HB2    . GLN A 1 44  ? 21.184  71.304  -25.773 1.00 111.46 ? 41   GLN A HB2    1 
ATOM   676   H  HB3    . GLN A 1 44  ? 21.472  72.826  -25.435 1.00 111.46 ? 41   GLN A HB3    1 
ATOM   677   H  HG2    . GLN A 1 44  ? 20.982  72.846  -27.626 1.00 107.28 ? 41   GLN A HG2    1 
ATOM   678   H  HG3    . GLN A 1 44  ? 22.566  72.941  -27.601 1.00 107.28 ? 41   GLN A HG3    1 
ATOM   679   H  HE21   . GLN A 1 44  ? 22.865  72.081  -29.668 1.00 67.06  ? 41   GLN A HE21   1 
ATOM   680   H  HE22   . GLN A 1 44  ? 22.606  70.655  -30.013 1.00 67.06  ? 41   GLN A HE22   1 
ATOM   681   N  N      . HIS A 1 45  ? 23.081  70.605  -23.120 1.00 79.17  ? 42   HIS A N      1 
ATOM   682   C  CA     . HIS A 1 45  ? 23.063  70.573  -21.657 1.00 95.55  ? 42   HIS A CA     1 
ATOM   683   C  C      . HIS A 1 45  ? 24.392  70.142  -21.035 1.00 85.17  ? 42   HIS A C      1 
ATOM   684   O  O      . HIS A 1 45  ? 24.509  70.039  -19.812 1.00 72.79  ? 42   HIS A O      1 
ATOM   685   C  CB     . HIS A 1 45  ? 21.951  69.640  -21.183 1.00 89.74  ? 42   HIS A CB     1 
ATOM   686   C  CG     . HIS A 1 45  ? 20.584  70.229  -21.318 1.00 95.31  ? 42   HIS A CG     1 
ATOM   687   N  ND1    . HIS A 1 45  ? 19.450  69.608  -20.840 1.00 105.97 ? 42   HIS A ND1    1 
ATOM   688   C  CD2    . HIS A 1 45  ? 20.171  71.395  -21.868 1.00 96.63  ? 42   HIS A CD2    1 
ATOM   689   C  CE1    . HIS A 1 45  ? 18.397  70.363  -21.098 1.00 110.42 ? 42   HIS A CE1    1 
ATOM   690   N  NE2    . HIS A 1 45  ? 18.808  71.453  -21.720 1.00 108.53 ? 42   HIS A NE2    1 
ATOM   691   H  H      . HIS A 1 45  ? 23.056  69.828  -23.488 1.00 95.00  ? 42   HIS A H      1 
ATOM   692   H  HA     . HIS A 1 45  ? 22.860  71.463  -21.330 1.00 114.66 ? 42   HIS A HA     1 
ATOM   693   H  HB2    . HIS A 1 45  ? 21.978  68.826  -21.710 1.00 107.69 ? 42   HIS A HB2    1 
ATOM   694   H  HB3    . HIS A 1 45  ? 22.094  69.431  -20.246 1.00 107.69 ? 42   HIS A HB3    1 
ATOM   695   H  HD1    . HIS A 1 45  ? 19.431  68.847  -20.441 1.00 127.17 ? 42   HIS A HD1    1 
ATOM   696   H  HD2    . HIS A 1 45  ? 20.711  72.035  -22.274 1.00 115.95 ? 42   HIS A HD2    1 
ATOM   697   H  HE1    . HIS A 1 45  ? 17.516  70.162  -20.877 1.00 132.50 ? 42   HIS A HE1    1 
ATOM   698   H  HE2    . HIS A 1 45  ? 18.303  72.095  -21.990 1.00 130.23 ? 42   HIS A HE2    1 
ATOM   699   N  N      . ARG A 1 46  ? 25.394  69.910  -21.875 1.00 72.05  ? 43   ARG A N      1 
ATOM   700   C  CA     . ARG A 1 46  ? 26.696  69.466  -21.397 1.00 62.16  ? 43   ARG A CA     1 
ATOM   701   C  C      . ARG A 1 46  ? 27.467  70.589  -20.727 1.00 73.77  ? 43   ARG A C      1 
ATOM   702   O  O      . ARG A 1 46  ? 27.538  71.698  -21.253 1.00 70.61  ? 43   ARG A O      1 
ATOM   703   C  CB     . ARG A 1 46  ? 27.521  68.889  -22.545 1.00 62.82  ? 43   ARG A CB     1 
ATOM   704   C  CG     . ARG A 1 46  ? 28.913  68.413  -22.141 1.00 61.78  ? 43   ARG A CG     1 
ATOM   705   C  CD     . ARG A 1 46  ? 28.844  67.151  -21.290 1.00 62.32  ? 43   ARG A CD     1 
ATOM   706   N  NE     . ARG A 1 46  ? 28.497  65.984  -22.095 1.00 77.08  ? 43   ARG A NE     1 
ATOM   707   C  CZ     . ARG A 1 46  ? 28.743  64.725  -21.746 1.00 65.58  ? 43   ARG A CZ     1 
ATOM   708   N  NH1    . ARG A 1 46  ? 29.345  64.448  -20.596 1.00 68.53  ? 43   ARG A NH1    1 
ATOM   709   N  NH2    . ARG A 1 46  ? 28.385  63.736  -22.554 1.00 61.67  ? 43   ARG A NH2    1 
ATOM   710   H  H      . ARG A 1 46  ? 25.345  70.002  -22.729 1.00 86.46  ? 43   ARG A H      1 
ATOM   711   H  HA     . ARG A 1 46  ? 26.565  68.763  -20.741 1.00 74.59  ? 43   ARG A HA     1 
ATOM   712   H  HB2    . ARG A 1 46  ? 27.046  68.130  -22.918 1.00 75.38  ? 43   ARG A HB2    1 
ATOM   713   H  HB3    . ARG A 1 46  ? 27.630  69.574  -23.224 1.00 75.38  ? 43   ARG A HB3    1 
ATOM   714   H  HG2    . ARG A 1 46  ? 29.428  68.214  -22.939 1.00 74.14  ? 43   ARG A HG2    1 
ATOM   715   H  HG3    . ARG A 1 46  ? 29.351  69.106  -21.622 1.00 74.14  ? 43   ARG A HG3    1 
ATOM   716   H  HD2    . ARG A 1 46  ? 29.710  66.993  -20.882 1.00 74.78  ? 43   ARG A HD2    1 
ATOM   717   H  HD3    . ARG A 1 46  ? 28.165  67.262  -20.607 1.00 74.78  ? 43   ARG A HD3    1 
ATOM   718   H  HE     . ARG A 1 46  ? 28.106  66.120  -22.849 1.00 92.50  ? 43   ARG A HE     1 
ATOM   719   H  HH11   . ARG A 1 46  ? 29.580  65.086  -20.069 1.00 82.23  ? 43   ARG A HH11   1 
ATOM   720   H  HH12   . ARG A 1 46  ? 29.501  63.631  -20.378 1.00 82.23  ? 43   ARG A HH12   1 
ATOM   721   H  HH21   . ARG A 1 46  ? 27.995  63.911  -23.300 1.00 74.00  ? 43   ARG A HH21   1 
ATOM   722   H  HH22   . ARG A 1 46  ? 28.543  62.921  -22.331 1.00 74.00  ? 43   ARG A HH22   1 
ATOM   723   N  N      . GLU A 1 47  ? 28.038  70.288  -19.562 1.00 65.33  ? 44   GLU A N      1 
ATOM   724   C  CA     . GLU A 1 47  ? 28.886  71.237  -18.853 1.00 46.08  ? 44   GLU A CA     1 
ATOM   725   C  C      . GLU A 1 47  ? 30.318  71.143  -19.342 1.00 51.45  ? 44   GLU A C      1 
ATOM   726   O  O      . GLU A 1 47  ? 30.828  70.056  -19.599 1.00 61.55  ? 44   GLU A O      1 
ATOM   727   C  CB     . GLU A 1 47  ? 28.863  70.991  -17.353 1.00 48.00  ? 44   GLU A CB     1 
ATOM   728   C  CG     . GLU A 1 47  ? 29.743  71.960  -16.581 1.00 54.08  ? 44   GLU A CG     1 
ATOM   729   C  CD     . GLU A 1 47  ? 29.757  71.682  -15.098 1.00 58.56  ? 44   GLU A CD     1 
ATOM   730   O  OE1    . GLU A 1 47  ? 29.252  70.618  -14.678 1.00 63.15  ? 44   GLU A OE1    1 
ATOM   731   O  OE2    . GLU A 1 47  ? 30.276  72.529  -14.346 1.00 57.50  ? 44   GLU A OE2    1 
ATOM   732   H  H      . GLU A 1 47  ? 27.949  69.533  -19.160 1.00 78.39  ? 44   GLU A H      1 
ATOM   733   H  HA     . GLU A 1 47  ? 28.566  72.138  -19.019 1.00 55.29  ? 44   GLU A HA     1 
ATOM   734   H  HB2    . GLU A 1 47  ? 27.953  71.090  -17.031 1.00 57.61  ? 44   GLU A HB2    1 
ATOM   735   H  HB3    . GLU A 1 47  ? 29.181  70.091  -17.176 1.00 57.61  ? 44   GLU A HB3    1 
ATOM   736   H  HG2    . GLU A 1 47  ? 30.653  71.890  -16.908 1.00 64.90  ? 44   GLU A HG2    1 
ATOM   737   H  HG3    . GLU A 1 47  ? 29.411  72.862  -16.714 1.00 64.90  ? 44   GLU A HG3    1 
ATOM   738   N  N      . PHE A 1 48  ? 30.952  72.299  -19.475 1.00 51.49  ? 45   PHE A N      1 
ATOM   739   C  CA     . PHE A 1 48  ? 32.381  72.384  -19.732 1.00 57.05  ? 45   PHE A CA     1 
ATOM   740   C  C      . PHE A 1 48  ? 32.976  73.315  -18.678 1.00 62.72  ? 45   PHE A C      1 
ATOM   741   O  O      . PHE A 1 48  ? 32.236  74.040  -18.016 1.00 65.71  ? 45   PHE A O      1 
ATOM   742   C  CB     . PHE A 1 48  ? 32.643  72.922  -21.142 1.00 55.24  ? 45   PHE A CB     1 
ATOM   743   C  CG     . PHE A 1 48  ? 32.252  71.976  -22.245 1.00 52.54  ? 45   PHE A CG     1 
ATOM   744   C  CD1    . PHE A 1 48  ? 30.927  71.859  -22.640 1.00 60.05  ? 45   PHE A CD1    1 
ATOM   745   C  CD2    . PHE A 1 48  ? 33.212  71.242  -22.925 1.00 61.81  ? 45   PHE A CD2    1 
ATOM   746   C  CE1    . PHE A 1 48  ? 30.566  70.997  -23.666 1.00 64.54  ? 45   PHE A CE1    1 
ATOM   747   C  CE2    . PHE A 1 48  ? 32.852  70.384  -23.955 1.00 56.64  ? 45   PHE A CE2    1 
ATOM   748   C  CZ     . PHE A 1 48  ? 31.532  70.264  -24.324 1.00 58.97  ? 45   PHE A CZ     1 
ATOM   749   H  H      . PHE A 1 48  ? 30.567  73.066  -19.420 1.00 61.79  ? 45   PHE A H      1 
ATOM   750   H  HA     . PHE A 1 48  ? 32.787  71.507  -19.647 1.00 68.46  ? 45   PHE A HA     1 
ATOM   751   H  HB2    . PHE A 1 48  ? 32.136  73.740  -21.261 1.00 66.29  ? 45   PHE A HB2    1 
ATOM   752   H  HB3    . PHE A 1 48  ? 33.591  73.107  -21.233 1.00 66.29  ? 45   PHE A HB3    1 
ATOM   753   H  HD1    . PHE A 1 48  ? 34.106  71.315  -22.679 1.00 74.18  ? 45   PHE A HD1    1 
ATOM   754   H  HD2    . PHE A 1 48  ? 30.271  72.348  -22.199 1.00 72.06  ? 45   PHE A HD2    1 
ATOM   755   H  HE1    . PHE A 1 48  ? 33.504  69.888  -24.396 1.00 67.97  ? 45   PHE A HE1    1 
ATOM   756   H  HE2    . PHE A 1 48  ? 29.674  70.920  -23.916 1.00 77.44  ? 45   PHE A HE2    1 
ATOM   757   H  HZ     . PHE A 1 48  ? 31.291  69.689  -25.014 1.00 70.77  ? 45   PHE A HZ     1 
ATOM   758   N  N      . SER A 1 49  ? 34.295  73.284  -18.501 1.00 48.59  ? 46   SER A N      1 
ATOM   759   C  CA     . SER A 1 49  ? 34.956  74.267  -17.651 1.00 56.13  ? 46   SER A CA     1 
ATOM   760   C  C      . SER A 1 49  ? 36.270  74.672  -18.303 1.00 61.06  ? 46   SER A C      1 
ATOM   761   O  O      . SER A 1 49  ? 36.953  73.849  -18.914 1.00 53.14  ? 46   SER A O      1 
ATOM   762   C  CB     . SER A 1 49  ? 35.202  73.739  -16.235 1.00 55.75  ? 46   SER A CB     1 
ATOM   763   O  OG     . SER A 1 49  ? 36.439  73.062  -16.144 1.00 75.34  ? 46   SER A OG     1 
ATOM   764   H  H      . SER A 1 49  ? 34.824  72.708  -18.859 1.00 58.31  ? 46   SER A H      1 
ATOM   765   H  HA     . SER A 1 49  ? 34.396  75.056  -17.585 1.00 67.36  ? 46   SER A HA     1 
ATOM   766   H  HB2    . SER A 1 49  ? 35.206  74.487  -15.618 1.00 66.90  ? 46   SER A HB2    1 
ATOM   767   H  HB3    . SER A 1 49  ? 34.489  73.123  -16.002 1.00 66.90  ? 46   SER A HB3    1 
ATOM   768   H  HG     . SER A 1 49  ? 36.556  72.781  -15.361 1.00 90.41  ? 46   SER A HG     1 
ATOM   769   N  N      . PHE A 1 50  ? 36.604  75.949  -18.165 1.00 60.06  ? 47   PHE A N      1 
ATOM   770   C  CA     . PHE A 1 50  ? 37.807  76.520  -18.752 1.00 56.06  ? 47   PHE A CA     1 
ATOM   771   C  C      . PHE A 1 50  ? 38.713  77.089  -17.673 1.00 68.93  ? 47   PHE A C      1 
ATOM   772   O  O      . PHE A 1 50  ? 38.243  77.649  -16.677 1.00 67.43  ? 47   PHE A O      1 
ATOM   773   C  CB     . PHE A 1 50  ? 37.451  77.631  -19.750 1.00 66.30  ? 47   PHE A CB     1 
ATOM   774   C  CG     . PHE A 1 50  ? 36.782  77.150  -21.013 1.00 54.09  ? 47   PHE A CG     1 
ATOM   775   C  CD1    . PHE A 1 50  ? 37.131  75.943  -21.596 1.00 67.02  ? 47   PHE A CD1    1 
ATOM   776   C  CD2    . PHE A 1 50  ? 35.779  77.904  -21.600 1.00 58.95  ? 47   PHE A CD2    1 
ATOM   777   C  CE1    . PHE A 1 50  ? 36.511  75.511  -22.756 1.00 67.42  ? 47   PHE A CE1    1 
ATOM   778   C  CE2    . PHE A 1 50  ? 35.153  77.475  -22.754 1.00 73.15  ? 47   PHE A CE2    1 
ATOM   779   C  CZ     . PHE A 1 50  ? 35.518  76.277  -23.331 1.00 69.93  ? 47   PHE A CZ     1 
ATOM   780   H  H      . PHE A 1 50  ? 36.135  76.519  -17.724 1.00 72.07  ? 47   PHE A H      1 
ATOM   781   H  HA     . PHE A 1 50  ? 38.293  75.828  -19.226 1.00 67.27  ? 47   PHE A HA     1 
ATOM   782   H  HB2    . PHE A 1 50  ? 36.848  78.255  -19.318 1.00 79.56  ? 47   PHE A HB2    1 
ATOM   783   H  HB3    . PHE A 1 50  ? 38.267  78.090  -20.007 1.00 79.56  ? 47   PHE A HB3    1 
ATOM   784   H  HD1    . PHE A 1 50  ? 37.802  75.425  -21.213 1.00 80.43  ? 47   PHE A HD1    1 
ATOM   785   H  HD2    . PHE A 1 50  ? 35.531  78.714  -21.218 1.00 70.74  ? 47   PHE A HD2    1 
ATOM   786   H  HE1    . PHE A 1 50  ? 36.756  74.701  -23.141 1.00 80.90  ? 47   PHE A HE1    1 
ATOM   787   H  HE2    . PHE A 1 50  ? 34.485  77.994  -23.141 1.00 87.77  ? 47   PHE A HE2    1 
ATOM   788   H  HZ     . PHE A 1 50  ? 35.096  75.987  -24.108 1.00 83.91  ? 47   PHE A HZ     1 
ATOM   789   N  N      . THR A 1 51  ? 40.017  76.931  -17.874 1.00 60.98  ? 48   THR A N      1 
ATOM   790   C  CA     . THR A 1 51  ? 41.001  77.517  -16.976 1.00 78.89  ? 48   THR A CA     1 
ATOM   791   C  C      . THR A 1 51  ? 41.891  78.416  -17.808 1.00 73.95  ? 48   THR A C      1 
ATOM   792   O  O      . THR A 1 51  ? 42.756  77.967  -18.552 1.00 55.17  ? 48   THR A O      1 
ATOM   793   C  CB     . THR A 1 51  ? 41.840  76.470  -16.227 1.00 71.31  ? 48   THR A CB     1 
ATOM   794   O  OG1    . THR A 1 51  ? 40.980  75.676  -15.401 1.00 56.16  ? 48   THR A OG1    1 
ATOM   795   C  CG2    . THR A 1 51  ? 42.878  77.152  -15.343 1.00 59.40  ? 48   THR A CG2    1 
ATOM   796   H  H      . THR A 1 51  ? 40.358  76.487  -18.527 1.00 73.17  ? 48   THR A H      1 
ATOM   797   H  HA     . THR A 1 51  ? 40.546  78.065  -16.318 1.00 94.66  ? 48   THR A HA     1 
ATOM   798   H  HB     . THR A 1 51  ? 42.299  75.901  -16.865 1.00 85.57  ? 48   THR A HB     1 
ATOM   799   H  HG1    . THR A 1 51  ? 41.430  75.101  -14.987 1.00 67.40  ? 48   THR A HG1    1 
ATOM   800   H  HG21   . THR A 1 51  ? 42.437  77.721  -14.692 1.00 71.28  ? 48   THR A HG21   1 
ATOM   801   H  HG22   . THR A 1 51  ? 43.403  76.485  -14.874 1.00 71.28  ? 48   THR A HG22   1 
ATOM   802   H  HG23   . THR A 1 51  ? 43.470  77.695  -15.886 1.00 71.28  ? 48   THR A HG23   1 
ATOM   803   N  N      . LEU A 1 52  ? 41.589  79.700  -17.712 1.00 78.44  ? 49   LEU A N      1 
ATOM   804   C  CA     . LEU A 1 52  ? 42.285  80.757  -18.419 1.00 82.13  ? 49   LEU A CA     1 
ATOM   805   C  C      . LEU A 1 52  ? 43.588  81.134  -17.719 1.00 87.41  ? 49   LEU A C      1 
ATOM   806   O  O      . LEU A 1 52  ? 43.979  80.511  -16.733 1.00 90.31  ? 49   LEU A O      1 
ATOM   807   C  CB     . LEU A 1 52  ? 41.355  81.960  -18.541 1.00 85.38  ? 49   LEU A CB     1 
ATOM   808   C  CG     . LEU A 1 52  ? 39.942  81.570  -19.009 1.00 75.11  ? 49   LEU A CG     1 
ATOM   809   C  CD1    . LEU A 1 52  ? 38.911  82.627  -18.666 1.00 79.13  ? 49   LEU A CD1    1 
ATOM   810   C  CD2    . LEU A 1 52  ? 39.974  81.308  -20.504 1.00 87.34  ? 49   LEU A CD2    1 
ATOM   811   H  H      . LEU A 1 52  ? 40.951  79.996  -17.217 1.00 94.13  ? 49   LEU A H      1 
ATOM   812   H  HA     . LEU A 1 52  ? 42.502  80.451  -19.314 1.00 98.55  ? 49   LEU A HA     1 
ATOM   813   H  HB2    . LEU A 1 52  ? 41.276  82.388  -17.675 1.00 102.45 ? 49   LEU A HB2    1 
ATOM   814   H  HB3    . LEU A 1 52  ? 41.724  82.582  -19.187 1.00 102.45 ? 49   LEU A HB3    1 
ATOM   815   H  HG     . LEU A 1 52  ? 39.682  80.746  -18.568 1.00 90.13  ? 49   LEU A HG     1 
ATOM   816   H  HD11   . LEU A 1 52  ? 39.157  83.459  -19.099 1.00 94.96  ? 49   LEU A HD11   1 
ATOM   817   H  HD12   . LEU A 1 52  ? 38.042  82.333  -18.981 1.00 94.96  ? 49   LEU A HD12   1 
ATOM   818   H  HD13   . LEU A 1 52  ? 38.891  82.747  -17.704 1.00 94.96  ? 49   LEU A HD13   1 
ATOM   819   H  HD21   . LEU A 1 52  ? 40.595  80.585  -20.684 1.00 104.80 ? 49   LEU A HD21   1 
ATOM   820   H  HD22   . LEU A 1 52  ? 39.084  81.062  -20.800 1.00 104.80 ? 49   LEU A HD22   1 
ATOM   821   H  HD23   . LEU A 1 52  ? 40.264  82.114  -20.959 1.00 104.80 ? 49   LEU A HD23   1 
ATOM   822   N  N      . LYS A 1 53  ? 44.259  82.150  -18.253 1.00 97.12  ? 50   LYS A N      1 
ATOM   823   C  CA     . LYS A 1 53  ? 45.469  82.706  -17.643 1.00 102.94 ? 50   LYS A CA     1 
ATOM   824   C  C      . LYS A 1 53  ? 45.083  83.263  -16.276 1.00 107.23 ? 50   LYS A C      1 
ATOM   825   O  O      . LYS A 1 53  ? 43.901  83.489  -16.020 1.00 104.27 ? 50   LYS A O      1 
ATOM   826   C  CB     . LYS A 1 53  ? 46.101  83.826  -18.480 1.00 89.31  ? 50   LYS A CB     1 
ATOM   827   C  CG     . LYS A 1 53  ? 45.872  83.789  -19.990 1.00 101.32 ? 50   LYS A CG     1 
ATOM   828   C  CD     . LYS A 1 53  ? 46.208  85.112  -20.628 1.00 135.44 ? 50   LYS A CD     1 
ATOM   829   C  CE     . LYS A 1 53  ? 45.480  85.259  -21.947 1.00 129.43 ? 50   LYS A CE     1 
ATOM   830   N  NZ     . LYS A 1 53  ? 45.801  86.545  -22.612 1.00 89.53  ? 50   LYS A NZ     1 
ATOM   831   H  H      . LYS A 1 53  ? 44.031  82.544  -18.983 1.00 116.54 ? 50   LYS A H      1 
ATOM   832   H  HA     . LYS A 1 53  ? 46.125  82.003  -17.519 1.00 123.53 ? 50   LYS A HA     1 
ATOM   833   H  HB2    . LYS A 1 53  ? 45.752  84.673  -18.160 1.00 107.18 ? 50   LYS A HB2    1 
ATOM   834   H  HB3    . LYS A 1 53  ? 47.060  83.803  -18.338 1.00 107.18 ? 50   LYS A HB3    1 
ATOM   835   H  HG2    . LYS A 1 53  ? 46.439  83.109  -20.384 1.00 121.59 ? 50   LYS A HG2    1 
ATOM   836   H  HG3    . LYS A 1 53  ? 44.939  83.594  -20.168 1.00 121.59 ? 50   LYS A HG3    1 
ATOM   837   H  HD2    . LYS A 1 53  ? 45.932  85.834  -20.041 1.00 162.53 ? 50   LYS A HD2    1 
ATOM   838   H  HD3    . LYS A 1 53  ? 47.162  85.157  -20.796 1.00 162.53 ? 50   LYS A HD3    1 
ATOM   839   H  HE2    . LYS A 1 53  ? 45.743  84.537  -22.539 1.00 155.31 ? 50   LYS A HE2    1 
ATOM   840   H  HE3    . LYS A 1 53  ? 44.523  85.230  -21.788 1.00 155.31 ? 50   LYS A HE3    1 
ATOM   841   H  HZ1    . LYS A 1 53  ? 46.675  86.594  -22.773 1.00 107.44 ? 50   LYS A HZ1    1 
ATOM   842   H  HZ2    . LYS A 1 53  ? 45.361  86.606  -23.383 1.00 107.44 ? 50   LYS A HZ2    1 
ATOM   843   H  HZ3    . LYS A 1 53  ? 45.564  87.225  -22.089 1.00 107.44 ? 50   LYS A HZ3    1 
ATOM   844   N  N      . ASP A 1 54  ? 46.061  83.406  -15.384 1.00 93.46  ? 51   ASP A N      1 
ATOM   845   C  CA     . ASP A 1 54  ? 45.832  83.934  -14.036 1.00 102.87 ? 51   ASP A CA     1 
ATOM   846   C  C      . ASP A 1 54  ? 45.077  82.933  -13.166 1.00 104.75 ? 51   ASP A C      1 
ATOM   847   O  O      . ASP A 1 54  ? 44.635  83.271  -12.068 1.00 117.44 ? 51   ASP A O      1 
ATOM   848   C  CB     . ASP A 1 54  ? 45.060  85.271  -14.083 1.00 122.99 ? 51   ASP A CB     1 
ATOM   849   C  CG     . ASP A 1 54  ? 45.947  86.456  -14.404 1.00 130.05 ? 51   ASP A CG     1 
ATOM   850   O  OD1    . ASP A 1 54  ? 47.174  86.271  -14.533 1.00 129.73 ? 51   ASP A OD1    1 
ATOM   851   O  OD2    . ASP A 1 54  ? 45.409  87.577  -14.547 1.00 123.98 ? 51   ASP A OD2    1 
ATOM   852   H  H      . ASP A 1 54  ? 46.882  83.201  -15.537 1.00 112.15 ? 51   ASP A H      1 
ATOM   853   H  HA     . ASP A 1 54  ? 46.690  84.102  -13.617 1.00 123.44 ? 51   ASP A HA     1 
ATOM   854   H  HB2    . ASP A 1 54  ? 44.375  85.216  -14.768 1.00 147.58 ? 51   ASP A HB2    1 
ATOM   855   H  HB3    . ASP A 1 54  ? 44.650  85.430  -13.218 1.00 147.58 ? 51   ASP A HB3    1 
ATOM   856   N  N      . ASP A 1 55  ? 44.902  81.719  -13.682 1.00 93.71  ? 52   ASP A N      1 
ATOM   857   C  CA     . ASP A 1 55  ? 44.291  80.620  -12.938 1.00 83.36  ? 52   ASP A CA     1 
ATOM   858   C  C      . ASP A 1 55  ? 42.815  80.929  -12.724 1.00 88.10  ? 52   ASP A C      1 
ATOM   859   O  O      . ASP A 1 55  ? 42.215  80.495  -11.739 1.00 73.71  ? 52   ASP A O      1 
ATOM   860   C  CB     . ASP A 1 55  ? 44.997  80.373  -11.595 1.00 100.72 ? 52   ASP A CB     1 
ATOM   861   C  CG     . ASP A 1 55  ? 46.345  79.701  -11.756 1.00 113.92 ? 52   ASP A CG     1 
ATOM   862   O  OD1    . ASP A 1 55  ? 46.729  79.400  -12.905 1.00 105.25 ? 52   ASP A OD1    1 
ATOM   863   O  OD2    . ASP A 1 55  ? 47.017  79.458  -10.729 1.00 117.74 ? 52   ASP A OD2    1 
ATOM   864   H  H      . ASP A 1 55  ? 45.135  81.502  -14.481 1.00 112.45 ? 52   ASP A H      1 
ATOM   865   H  HA     . ASP A 1 55  ? 44.355  79.807  -13.465 1.00 100.04 ? 52   ASP A HA     1 
ATOM   866   H  HB2    . ASP A 1 55  ? 45.137  81.224  -11.150 1.00 120.86 ? 52   ASP A HB2    1 
ATOM   867   H  HB3    . ASP A 1 55  ? 44.440  79.800  -11.045 1.00 120.86 ? 52   ASP A HB3    1 
ATOM   868   N  N      . ILE A 1 56  ? 42.232  81.674  -13.661 1.00 91.35  ? 53   ILE A N      1 
ATOM   869   C  CA     . ILE A 1 56  ? 40.805  81.956  -13.622 1.00 81.94  ? 53   ILE A CA     1 
ATOM   870   C  C      . ILE A 1 56  ? 40.079  80.677  -13.992 1.00 78.82  ? 53   ILE A C      1 
ATOM   871   O  O      . ILE A 1 56  ? 40.330  80.102  -15.051 1.00 82.66  ? 53   ILE A O      1 
ATOM   872   C  CB     . ILE A 1 56  ? 40.399  83.072  -14.599 1.00 93.01  ? 53   ILE A CB     1 
ATOM   873   C  CG1    . ILE A 1 56  ? 41.171  84.361  -14.296 1.00 78.19  ? 53   ILE A CG1    1 
ATOM   874   C  CG2    . ILE A 1 56  ? 38.883  83.292  -14.534 1.00 85.18  ? 53   ILE A CG2    1 
ATOM   875   C  CD1    . ILE A 1 56  ? 40.748  85.553  -15.144 1.00 101.46 ? 53   ILE A CD1    1 
ATOM   876   H  H      . ILE A 1 56  ? 42.643  82.026  -14.329 1.00 109.62 ? 53   ILE A H      1 
ATOM   877   H  HA     . ILE A 1 56  ? 40.545  82.216  -12.724 1.00 98.32  ? 53   ILE A HA     1 
ATOM   878   H  HB     . ILE A 1 56  ? 40.626  82.786  -15.498 1.00 111.62 ? 53   ILE A HB     1 
ATOM   879   H  HG12   . ILE A 1 56  ? 41.031  84.596  -13.365 1.00 93.83  ? 53   ILE A HG12   1 
ATOM   880   H  HG13   . ILE A 1 56  ? 42.114  84.204  -14.456 1.00 93.83  ? 53   ILE A HG13   1 
ATOM   881   H  HG21   . ILE A 1 56  ? 38.640  83.548  -13.630 1.00 102.22 ? 53   ILE A HG21   1 
ATOM   882   H  HG22   . ILE A 1 56  ? 38.640  83.997  -15.154 1.00 102.22 ? 53   ILE A HG22   1 
ATOM   883   H  HG23   . ILE A 1 56  ? 38.433  82.468  -14.777 1.00 102.22 ? 53   ILE A HG23   1 
ATOM   884   H  HD11   . ILE A 1 56  ? 39.808  85.734  -14.988 1.00 121.75 ? 53   ILE A HD11   1 
ATOM   885   H  HD12   . ILE A 1 56  ? 41.280  86.323  -14.893 1.00 121.75 ? 53   ILE A HD12   1 
ATOM   886   H  HD13   . ILE A 1 56  ? 40.893  85.341  -16.080 1.00 121.75 ? 53   ILE A HD13   1 
ATOM   887   N  N      . TYR A 1 57  ? 39.177  80.234  -13.126 1.00 74.25  ? 54   TYR A N      1 
ATOM   888   C  CA     . TYR A 1 57  ? 38.486  78.975  -13.341 1.00 71.01  ? 54   TYR A CA     1 
ATOM   889   C  C      . TYR A 1 57  ? 36.999  79.251  -13.484 1.00 64.36  ? 54   TYR A C      1 
ATOM   890   O  O      . TYR A 1 57  ? 36.417  79.951  -12.656 1.00 75.87  ? 54   TYR A O      1 
ATOM   891   C  CB     . TYR A 1 57  ? 38.740  78.021  -12.172 1.00 56.99  ? 54   TYR A CB     1 
ATOM   892   C  CG     . TYR A 1 57  ? 37.990  76.715  -12.264 1.00 47.09  ? 54   TYR A CG     1 
ATOM   893   C  CD1    . TYR A 1 57  ? 38.500  75.672  -13.025 1.00 69.86  ? 54   TYR A CD1    1 
ATOM   894   C  CD2    . TYR A 1 57  ? 36.775  76.526  -11.621 1.00 44.60  ? 54   TYR A CD2    1 
ATOM   895   C  CE1    . TYR A 1 57  ? 37.837  74.467  -13.132 1.00 84.82  ? 54   TYR A CE1    1 
ATOM   896   C  CE2    . TYR A 1 57  ? 36.096  75.320  -11.726 1.00 64.03  ? 54   TYR A CE2    1 
ATOM   897   C  CZ     . TYR A 1 57  ? 36.635  74.293  -12.485 1.00 77.13  ? 54   TYR A CZ     1 
ATOM   898   O  OH     . TYR A 1 57  ? 35.982  73.085  -12.604 1.00 58.32  ? 54   TYR A OH     1 
ATOM   899   H  H      . TYR A 1 57  ? 38.948  80.645  -12.405 1.00 89.10  ? 54   TYR A H      1 
ATOM   900   H  HA     . TYR A 1 57  ? 38.806  78.561  -14.158 1.00 85.21  ? 54   TYR A HA     1 
ATOM   901   H  HB2    . TYR A 1 57  ? 39.688  77.816  -12.139 1.00 68.39  ? 54   TYR A HB2    1 
ATOM   902   H  HB3    . TYR A 1 57  ? 38.471  78.459  -11.350 1.00 68.39  ? 54   TYR A HB3    1 
ATOM   903   H  HD1    . TYR A 1 57  ? 39.313  75.784  -13.463 1.00 83.84  ? 54   TYR A HD1    1 
ATOM   904   H  HD2    . TYR A 1 57  ? 36.413  77.214  -11.110 1.00 53.52  ? 54   TYR A HD2    1 
ATOM   905   H  HE1    . TYR A 1 57  ? 38.198  73.779  -13.643 1.00 101.78 ? 54   TYR A HE1    1 
ATOM   906   H  HE2    . TYR A 1 57  ? 35.284  75.200  -11.287 1.00 76.83  ? 54   TYR A HE2    1 
ATOM   907   H  HH     . TYR A 1 57  ? 35.265  73.102  -12.167 1.00 69.98  ? 54   TYR A HH     1 
ATOM   908   N  N      . ILE A 1 58  ? 36.385  78.712  -14.532 1.00 56.13  ? 55   ILE A N      1 
ATOM   909   C  CA     . ILE A 1 58  ? 34.954  78.894  -14.744 1.00 76.01  ? 55   ILE A CA     1 
ATOM   910   C  C      . ILE A 1 58  ? 34.329  77.605  -15.270 1.00 78.89  ? 55   ILE A C      1 
ATOM   911   O  O      . ILE A 1 58  ? 34.869  76.968  -16.179 1.00 58.11  ? 55   ILE A O      1 
ATOM   912   C  CB     . ILE A 1 58  ? 34.650  80.053  -15.732 1.00 85.32  ? 55   ILE A CB     1 
ATOM   913   C  CG1    . ILE A 1 58  ? 35.370  79.861  -17.070 1.00 64.41  ? 55   ILE A CG1    1 
ATOM   914   C  CG2    . ILE A 1 58  ? 35.046  81.388  -15.116 1.00 79.50  ? 55   ILE A CG2    1 
ATOM   915   C  CD1    . ILE A 1 58  ? 34.826  80.744  -18.170 1.00 58.52  ? 55   ILE A CD1    1 
ATOM   916   H  H      . ILE A 1 58  ? 36.774  78.238  -15.134 1.00 67.36  ? 55   ILE A H      1 
ATOM   917   H  HA     . ILE A 1 58  ? 34.534  79.106  -13.896 1.00 91.21  ? 55   ILE A HA     1 
ATOM   918   H  HB     . ILE A 1 58  ? 33.695  80.067  -15.899 1.00 102.38 ? 55   ILE A HB     1 
ATOM   919   H  HG12   . ILE A 1 58  ? 36.310  80.071  -16.956 1.00 77.29  ? 55   ILE A HG12   1 
ATOM   920   H  HG13   . ILE A 1 58  ? 35.270  78.938  -17.352 1.00 77.29  ? 55   ILE A HG13   1 
ATOM   921   H  HG21   . ILE A 1 58  ? 35.995  81.376  -14.919 1.00 95.40  ? 55   ILE A HG21   1 
ATOM   922   H  HG22   . ILE A 1 58  ? 34.848  82.097  -15.748 1.00 95.40  ? 55   ILE A HG22   1 
ATOM   923   H  HG23   . ILE A 1 58  ? 34.539  81.521  -14.300 1.00 95.40  ? 55   ILE A HG23   1 
ATOM   924   H  HD11   . ILE A 1 58  ? 34.928  81.673  -17.909 1.00 70.22  ? 55   ILE A HD11   1 
ATOM   925   H  HD12   . ILE A 1 58  ? 35.323  80.574  -18.986 1.00 70.22  ? 55   ILE A HD12   1 
ATOM   926   H  HD13   . ILE A 1 58  ? 33.888  80.539  -18.305 1.00 70.22  ? 55   ILE A HD13   1 
ATOM   927   N  N      . ARG A 1 59  ? 33.208  77.207  -14.672 1.00 76.43  ? 56   ARG A N      1 
ATOM   928   C  CA     . ARG A 1 59  ? 32.490  76.015  -15.104 1.00 78.30  ? 56   ARG A CA     1 
ATOM   929   C  C      . ARG A 1 59  ? 31.060  76.404  -15.482 1.00 73.88  ? 56   ARG A C      1 
ATOM   930   O  O      . ARG A 1 59  ? 30.745  77.587  -15.583 1.00 80.95  ? 56   ARG A O      1 
ATOM   931   C  CB     . ARG A 1 59  ? 32.502  74.942  -14.014 1.00 76.47  ? 56   ARG A CB     1 
ATOM   932   C  CG     . ARG A 1 59  ? 31.950  75.404  -12.682 1.00 72.32  ? 56   ARG A CG     1 
ATOM   933   C  CD     . ARG A 1 59  ? 31.906  74.288  -11.647 1.00 67.53  ? 56   ARG A CD     1 
ATOM   934   N  NE     . ARG A 1 59  ? 31.141  73.129  -12.103 1.00 53.54  ? 56   ARG A NE     1 
ATOM   935   C  CZ     . ARG A 1 59  ? 30.647  72.190  -11.301 1.00 50.32  ? 56   ARG A CZ     1 
ATOM   936   N  NH1    . ARG A 1 59  ? 30.793  72.283  -9.987  1.00 44.21  ? 56   ARG A NH1    1 
ATOM   937   N  NH2    . ARG A 1 59  ? 29.970  71.170  -11.812 1.00 49.38  ? 56   ARG A NH2    1 
ATOM   938   H  H      . ARG A 1 59  ? 32.843  77.614  -14.008 1.00 91.72  ? 56   ARG A H      1 
ATOM   939   H  HA     . ARG A 1 59  ? 32.923  75.651  -15.892 1.00 93.96  ? 56   ARG A HA     1 
ATOM   940   H  HB2    . ARG A 1 59  ? 31.966  74.191  -14.311 1.00 91.77  ? 56   ARG A HB2    1 
ATOM   941   H  HB3    . ARG A 1 59  ? 33.418  74.655  -13.870 1.00 91.77  ? 56   ARG A HB3    1 
ATOM   942   H  HG2    . ARG A 1 59  ? 32.513  76.114  -12.335 1.00 86.78  ? 56   ARG A HG2    1 
ATOM   943   H  HG3    . ARG A 1 59  ? 31.046  75.731  -12.811 1.00 86.78  ? 56   ARG A HG3    1 
ATOM   944   H  HD2    . ARG A 1 59  ? 32.811  73.995  -11.459 1.00 81.03  ? 56   ARG A HD2    1 
ATOM   945   H  HD3    . ARG A 1 59  ? 31.490  74.623  -10.838 1.00 81.03  ? 56   ARG A HD3    1 
ATOM   946   H  HE     . ARG A 1 59  ? 31.001  73.049  -12.948 1.00 64.25  ? 56   ARG A HE     1 
ATOM   947   H  HH11   . ARG A 1 59  ? 31.230  72.942  -9.649  1.00 53.05  ? 56   ARG A HH11   1 
ATOM   948   H  HH12   . ARG A 1 59  ? 30.465  71.676  -9.473  1.00 53.05  ? 56   ARG A HH12   1 
ATOM   949   H  HH21   . ARG A 1 59  ? 29.863  71.107  -12.663 1.00 59.25  ? 56   ARG A HH21   1 
ATOM   950   H  HH22   . ARG A 1 59  ? 29.640  70.569  -11.292 1.00 59.25  ? 56   ARG A HH22   1 
ATOM   951   N  N      . TYR A 1 60  ? 30.206  75.405  -15.695 1.00 77.87  ? 57   TYR A N      1 
ATOM   952   C  CA     . TYR A 1 60  ? 28.835  75.625  -16.161 1.00 71.65  ? 57   TYR A CA     1 
ATOM   953   C  C      . TYR A 1 60  ? 28.813  76.336  -17.515 1.00 80.21  ? 57   TYR A C      1 
ATOM   954   O  O      . TYR A 1 60  ? 27.950  77.175  -17.778 1.00 86.74  ? 57   TYR A O      1 
ATOM   955   C  CB     . TYR A 1 60  ? 28.017  76.410  -15.133 1.00 62.82  ? 57   TYR A CB     1 
ATOM   956   C  CG     . TYR A 1 60  ? 27.931  75.740  -13.782 1.00 73.57  ? 57   TYR A CG     1 
ATOM   957   C  CD1    . TYR A 1 60  ? 27.265  74.532  -13.632 1.00 72.51  ? 57   TYR A CD1    1 
ATOM   958   C  CD2    . TYR A 1 60  ? 28.496  76.318  -12.656 1.00 70.99  ? 57   TYR A CD2    1 
ATOM   959   C  CE1    . TYR A 1 60  ? 27.175  73.912  -12.400 1.00 64.36  ? 57   TYR A CE1    1 
ATOM   960   C  CE2    . TYR A 1 60  ? 28.411  75.703  -11.419 1.00 63.30  ? 57   TYR A CE2    1 
ATOM   961   C  CZ     . TYR A 1 60  ? 27.748  74.502  -11.298 1.00 60.00  ? 57   TYR A CZ     1 
ATOM   962   O  OH     . TYR A 1 60  ? 27.659  73.887  -10.069 1.00 85.06  ? 57   TYR A OH     1 
ATOM   963   H  H      . TYR A 1 60  ? 30.400  74.576  -15.576 1.00 93.45  ? 57   TYR A H      1 
ATOM   964   H  HA     . TYR A 1 60  ? 28.407  74.762  -16.277 1.00 85.98  ? 57   TYR A HA     1 
ATOM   965   H  HB2    . TYR A 1 60  ? 28.427  77.280  -15.007 1.00 75.39  ? 57   TYR A HB2    1 
ATOM   966   H  HB3    . TYR A 1 60  ? 27.114  76.518  -15.469 1.00 75.39  ? 57   TYR A HB3    1 
ATOM   967   H  HD1    . TYR A 1 60  ? 26.877  74.129  -14.375 1.00 87.01  ? 57   TYR A HD1    1 
ATOM   968   H  HD2    . TYR A 1 60  ? 28.945  77.128  -12.734 1.00 85.19  ? 57   TYR A HD2    1 
ATOM   969   H  HE1    . TYR A 1 60  ? 26.728  73.101  -12.317 1.00 77.23  ? 57   TYR A HE1    1 
ATOM   970   H  HE2    . TYR A 1 60  ? 28.797  76.100  -10.672 1.00 75.97  ? 57   TYR A HE2    1 
ATOM   971   H  HH     . TYR A 1 60  ? 27.233  73.167  -10.139 1.00 102.07 ? 57   TYR A HH     1 
ATOM   972   N  N      . GLN A 1 61  ? 29.775  75.998  -18.364 1.00 62.76  ? 58   GLN A N      1 
ATOM   973   C  CA     . GLN A 1 61  ? 29.802  76.491  -19.733 1.00 66.58  ? 58   GLN A CA     1 
ATOM   974   C  C      . GLN A 1 61  ? 29.009  75.551  -20.622 1.00 87.47  ? 58   GLN A C      1 
ATOM   975   O  O      . GLN A 1 61  ? 29.249  74.345  -20.621 1.00 95.33  ? 58   GLN A O      1 
ATOM   976   C  CB     . GLN A 1 61  ? 31.231  76.636  -20.244 1.00 67.92  ? 58   GLN A CB     1 
ATOM   977   C  CG     . GLN A 1 61  ? 32.084  77.494  -19.343 1.00 85.14  ? 58   GLN A CG     1 
ATOM   978   C  CD     . GLN A 1 61  ? 31.667  78.946  -19.384 1.00 95.62  ? 58   GLN A CD     1 
ATOM   979   O  OE1    . GLN A 1 61  ? 31.214  79.497  -18.380 1.00 85.61  ? 58   GLN A OE1    1 
ATOM   980   N  NE2    . GLN A 1 61  ? 31.780  79.567  -20.555 1.00 109.86 ? 58   GLN A NE2    1 
ATOM   981   H  H      . GLN A 1 61  ? 30.432  75.478  -18.169 1.00 75.31  ? 58   GLN A H      1 
ATOM   982   H  HA     . GLN A 1 61  ? 29.380  77.364  -19.764 1.00 79.89  ? 58   GLN A HA     1 
ATOM   983   H  HB2    . GLN A 1 61  ? 31.639  75.757  -20.297 1.00 81.50  ? 58   GLN A HB2    1 
ATOM   984   H  HB3    . GLN A 1 61  ? 31.213  77.047  -21.122 1.00 81.50  ? 58   GLN A HB3    1 
ATOM   985   H  HG2    . GLN A 1 61  ? 31.998  77.181  -18.429 1.00 102.17 ? 58   GLN A HG2    1 
ATOM   986   H  HG3    . GLN A 1 61  ? 33.009  77.437  -19.630 1.00 102.17 ? 58   GLN A HG3    1 
ATOM   987   H  HE21   . GLN A 1 61  ? 32.079  79.142  -21.240 1.00 131.83 ? 58   GLN A HE21   1 
ATOM   988   H  HE22   . GLN A 1 61  ? 31.555  80.394  -20.627 1.00 131.83 ? 58   GLN A HE22   1 
ATOM   989   N  N      . SER A 1 62  ? 28.062  76.104  -21.372 1.00 90.16  ? 59   SER A N      1 
ATOM   990   C  CA     . SER A 1 62  ? 27.255  75.307  -22.281 1.00 85.82  ? 59   SER A CA     1 
ATOM   991   C  C      . SER A 1 62  ? 27.252  75.950  -23.664 1.00 80.29  ? 59   SER A C      1 
ATOM   992   O  O      . SER A 1 62  ? 27.553  77.133  -23.804 1.00 81.61  ? 59   SER A O      1 
ATOM   993   C  CB     . SER A 1 62  ? 25.837  75.186  -21.721 1.00 85.14  ? 59   SER A CB     1 
ATOM   994   O  OG     . SER A 1 62  ? 24.993  74.437  -22.576 1.00 110.81 ? 59   SER A OG     1 
ATOM   995   H  H      . SER A 1 62  ? 27.868  76.942  -21.371 1.00 108.20 ? 59   SER A H      1 
ATOM   996   H  HA     . SER A 1 62  ? 27.634  74.418  -22.356 1.00 102.98 ? 59   SER A HA     1 
ATOM   997   H  HB2    . SER A 1 62  ? 25.878  74.745  -20.859 1.00 102.16 ? 59   SER A HB2    1 
ATOM   998   H  HB3    . SER A 1 62  ? 25.465  76.076  -21.617 1.00 102.16 ? 59   SER A HB3    1 
ATOM   999   H  HG     . SER A 1 62  ? 24.222  74.386  -22.247 1.00 132.97 ? 59   SER A HG     1 
ATOM   1000  N  N      . PHE A 1 63  ? 26.912  75.164  -24.682 1.00 84.49  ? 60   PHE A N      1 
ATOM   1001  C  CA     . PHE A 1 63  ? 26.942  75.644  -26.062 1.00 91.90  ? 60   PHE A CA     1 
ATOM   1002  C  C      . PHE A 1 63  ? 25.764  75.123  -26.878 1.00 99.81  ? 60   PHE A C      1 
ATOM   1003  O  O      . PHE A 1 63  ? 25.208  74.066  -26.580 1.00 94.26  ? 60   PHE A O      1 
ATOM   1004  C  CB     . PHE A 1 63  ? 28.258  75.247  -26.731 1.00 88.32  ? 60   PHE A CB     1 
ATOM   1005  C  CG     . PHE A 1 63  ? 29.473  75.629  -25.937 1.00 83.80  ? 60   PHE A CG     1 
ATOM   1006  C  CD1    . PHE A 1 63  ? 29.863  76.952  -25.840 1.00 84.92  ? 60   PHE A CD1    1 
ATOM   1007  C  CD2    . PHE A 1 63  ? 30.227  74.666  -25.295 1.00 91.78  ? 60   PHE A CD2    1 
ATOM   1008  C  CE1    . PHE A 1 63  ? 30.977  77.310  -25.110 1.00 91.91  ? 60   PHE A CE1    1 
ATOM   1009  C  CE2    . PHE A 1 63  ? 31.345  75.017  -24.564 1.00 99.29  ? 60   PHE A CE2    1 
ATOM   1010  C  CZ     . PHE A 1 63  ? 31.721  76.341  -24.472 1.00 102.49 ? 60   PHE A CZ     1 
ATOM   1011  H  H      . PHE A 1 63  ? 26.660  74.346  -24.600 1.00 101.39 ? 60   PHE A H      1 
ATOM   1012  H  HA     . PHE A 1 63  ? 26.893  76.613  -26.056 1.00 110.28 ? 60   PHE A HA     1 
ATOM   1013  H  HB2    . PHE A 1 63  ? 28.272  74.285  -26.850 1.00 105.98 ? 60   PHE A HB2    1 
ATOM   1014  H  HB3    . PHE A 1 63  ? 28.317  75.687  -27.593 1.00 105.98 ? 60   PHE A HB3    1 
ATOM   1015  H  HD1    . PHE A 1 63  ? 29.364  77.610  -26.267 1.00 101.90 ? 60   PHE A HD1    1 
ATOM   1016  H  HD2    . PHE A 1 63  ? 29.977  73.772  -25.353 1.00 110.14 ? 60   PHE A HD2    1 
ATOM   1017  H  HE1    . PHE A 1 63  ? 31.228  78.203  -25.051 1.00 110.29 ? 60   PHE A HE1    1 
ATOM   1018  H  HE2    . PHE A 1 63  ? 31.844  74.360  -24.135 1.00 119.15 ? 60   PHE A HE2    1 
ATOM   1019  H  HZ     . PHE A 1 63  ? 32.474  76.579  -23.981 1.00 122.99 ? 60   PHE A HZ     1 
ATOM   1020  N  N      . ASN A 1 64  ? 25.390  75.875  -27.909 1.00 93.52  ? 61   ASN A N      1 
ATOM   1021  C  CA     . ASN A 1 64  ? 24.247  75.527  -28.745 1.00 82.15  ? 61   ASN A CA     1 
ATOM   1022  C  C      . ASN A 1 64  ? 24.601  74.497  -29.817 1.00 76.14  ? 61   ASN A C      1 
ATOM   1023  O  O      . ASN A 1 64  ? 23.808  73.607  -30.122 1.00 71.39  ? 61   ASN A O      1 
ATOM   1024  C  CB     . ASN A 1 64  ? 23.677  76.783  -29.402 1.00 95.77  ? 61   ASN A CB     1 
ATOM   1025  C  CG     . ASN A 1 64  ? 23.016  77.713  -28.403 1.00 100.04 ? 61   ASN A CG     1 
ATOM   1026  O  OD1    . ASN A 1 64  ? 22.484  77.271  -27.383 1.00 102.44 ? 61   ASN A OD1    1 
ATOM   1027  N  ND2    . ASN A 1 64  ? 23.046  79.010  -28.690 1.00 97.74  ? 61   ASN A ND2    1 
ATOM   1028  H  H      . ASN A 1 64  ? 25.787  76.600  -28.146 1.00 112.22 ? 61   ASN A H      1 
ATOM   1029  H  HA     . ASN A 1 64  ? 23.555  75.145  -28.184 1.00 98.59  ? 61   ASN A HA     1 
ATOM   1030  H  HB2    . ASN A 1 64  ? 24.397  77.269  -29.834 1.00 114.93 ? 61   ASN A HB2    1 
ATOM   1031  H  HB3    . ASN A 1 64  ? 23.011  76.523  -30.057 1.00 114.93 ? 61   ASN A HB3    1 
ATOM   1032  H  HD21   . ASN A 1 64  ? 23.427  79.281  -29.412 1.00 117.29 ? 61   ASN A HD21   1 
ATOM   1033  H  HD22   . ASN A 1 64  ? 22.685  79.578  -28.155 1.00 117.29 ? 61   ASN A HD22   1 
ATOM   1034  N  N      . ASN A 1 65  ? 25.798  74.622  -30.381 1.00 71.43  ? 62   ASN A N      1 
ATOM   1035  C  CA     . ASN A 1 65  ? 26.269  73.693  -31.402 1.00 64.61  ? 62   ASN A CA     1 
ATOM   1036  C  C      . ASN A 1 65  ? 27.779  73.784  -31.616 1.00 69.71  ? 62   ASN A C      1 
ATOM   1037  O  O      . ASN A 1 65  ? 28.471  74.519  -30.911 1.00 81.05  ? 62   ASN A O      1 
ATOM   1038  C  CB     . ASN A 1 65  ? 25.534  73.949  -32.722 1.00 81.59  ? 62   ASN A CB     1 
ATOM   1039  C  CG     . ASN A 1 65  ? 25.764  75.354  -33.266 1.00 91.49  ? 62   ASN A CG     1 
ATOM   1040  O  OD1    . ASN A 1 65  ? 26.723  76.032  -32.899 1.00 91.14  ? 62   ASN A OD1    1 
ATOM   1041  N  ND2    . ASN A 1 65  ? 24.869  75.798  -34.143 1.00 105.44 ? 62   ASN A ND2    1 
ATOM   1042  H  H      . ASN A 1 65  ? 26.361  75.243  -30.188 1.00 85.72  ? 62   ASN A H      1 
ATOM   1043  H  HA     . ASN A 1 65  ? 26.065  72.788  -31.119 1.00 77.53  ? 62   ASN A HA     1 
ATOM   1044  H  HB2    . ASN A 1 65  ? 25.848  73.316  -33.387 1.00 97.91  ? 62   ASN A HB2    1 
ATOM   1045  H  HB3    . ASN A 1 65  ? 24.581  73.835  -32.580 1.00 97.91  ? 62   ASN A HB3    1 
ATOM   1046  H  HD21   . ASN A 1 65  ? 24.208  75.299  -34.372 1.00 126.52 ? 62   ASN A HD21   1 
ATOM   1047  H  HD22   . ASN A 1 65  ? 24.952  76.585  -34.480 1.00 126.52 ? 62   ASN A HD22   1 
ATOM   1048  N  N      . GLN A 1 66  ? 28.278  73.037  -32.596 1.00 55.73  ? 63   GLN A N      1 
ATOM   1049  C  CA     . GLN A 1 66  ? 29.705  72.985  -32.890 1.00 47.27  ? 63   GLN A CA     1 
ATOM   1050  C  C      . GLN A 1 66  ? 30.288  74.356  -33.215 1.00 62.80  ? 63   GLN A C      1 
ATOM   1051  O  O      . GLN A 1 66  ? 31.417  74.660  -32.841 1.00 79.61  ? 63   GLN A O      1 
ATOM   1052  C  CB     . GLN A 1 66  ? 29.961  72.030  -34.056 1.00 47.36  ? 63   GLN A CB     1 
ATOM   1053  C  CG     . GLN A 1 66  ? 31.369  72.095  -34.620 1.00 27.62  ? 63   GLN A CG     1 
ATOM   1054  C  CD     . GLN A 1 66  ? 31.668  70.951  -35.573 1.00 60.38  ? 63   GLN A CD     1 
ATOM   1055  O  OE1    . GLN A 1 66  ? 30.839  70.060  -35.775 1.00 58.78  ? 63   GLN A OE1    1 
ATOM   1056  N  NE2    . GLN A 1 66  ? 32.858  70.973  -36.169 1.00 49.28  ? 63   GLN A NE2    1 
ATOM   1057  H  H      . GLN A 1 66  ? 27.800  72.542  -33.113 1.00 66.88  ? 63   GLN A H      1 
ATOM   1058  H  HA     . GLN A 1 66  ? 30.173  72.639  -32.114 1.00 56.73  ? 63   GLN A HA     1 
ATOM   1059  H  HB2    . GLN A 1 66  ? 29.806  71.122  -33.753 1.00 56.84  ? 63   GLN A HB2    1 
ATOM   1060  H  HB3    . GLN A 1 66  ? 29.345  72.245  -34.774 1.00 56.84  ? 63   GLN A HB3    1 
ATOM   1061  H  HG2    . GLN A 1 66  ? 31.477  72.927  -35.106 1.00 33.14  ? 63   GLN A HG2    1 
ATOM   1062  H  HG3    . GLN A 1 66  ? 32.005  72.052  -33.889 1.00 33.14  ? 63   GLN A HG3    1 
ATOM   1063  H  HE21   . GLN A 1 66  ? 33.409  71.612  -36.005 1.00 59.14  ? 63   GLN A HE21   1 
ATOM   1064  H  HE22   . GLN A 1 66  ? 33.076  70.348  -36.718 1.00 59.14  ? 63   GLN A HE22   1 
ATOM   1065  N  N      . SER A 1 67  ? 29.520  75.182  -33.910 1.00 87.05  ? 64   SER A N      1 
ATOM   1066  C  CA     . SER A 1 67  ? 29.970  76.527  -34.238 1.00 90.16  ? 64   SER A CA     1 
ATOM   1067  C  C      . SER A 1 67  ? 30.128  77.336  -32.955 1.00 78.04  ? 64   SER A C      1 
ATOM   1068  O  O      . SER A 1 67  ? 31.169  77.943  -32.718 1.00 66.67  ? 64   SER A O      1 
ATOM   1069  C  CB     . SER A 1 67  ? 28.990  77.209  -35.193 1.00 89.18  ? 64   SER A CB     1 
ATOM   1070  O  OG     . SER A 1 67  ? 28.818  76.440  -36.372 1.00 97.67  ? 64   SER A OG     1 
ATOM   1071  H  H      . SER A 1 67  ? 28.735  74.989  -34.203 1.00 104.46 ? 64   SER A H      1 
ATOM   1072  H  HA     . SER A 1 67  ? 30.835  76.477  -34.675 1.00 108.20 ? 64   SER A HA     1 
ATOM   1073  H  HB2    . SER A 1 67  ? 28.132  77.304  -34.751 1.00 107.01 ? 64   SER A HB2    1 
ATOM   1074  H  HB3    . SER A 1 67  ? 29.338  78.082  -35.434 1.00 107.01 ? 64   SER A HB3    1 
ATOM   1075  H  HG     . SER A 1 67  ? 28.278  76.824  -36.889 1.00 117.20 ? 64   SER A HG     1 
ATOM   1076  N  N      . ASP A 1 68  ? 29.098  77.301  -32.116 1.00 74.24  ? 65   ASP A N      1 
ATOM   1077  C  CA     . ASP A 1 68  ? 29.082  78.045  -30.863 1.00 73.13  ? 65   ASP A CA     1 
ATOM   1078  C  C      . ASP A 1 68  ? 30.264  77.648  -29.988 1.00 86.92  ? 65   ASP A C      1 
ATOM   1079  O  O      . ASP A 1 68  ? 30.837  78.474  -29.276 1.00 84.89  ? 65   ASP A O      1 
ATOM   1080  C  CB     . ASP A 1 68  ? 27.768  77.771  -30.124 1.00 75.44  ? 65   ASP A CB     1 
ATOM   1081  C  CG     . ASP A 1 68  ? 27.535  78.707  -28.954 1.00 81.21  ? 65   ASP A CG     1 
ATOM   1082  O  OD1    . ASP A 1 68  ? 28.412  79.544  -28.659 1.00 85.76  ? 65   ASP A OD1    1 
ATOM   1083  O  OD2    . ASP A 1 68  ? 26.474  78.581  -28.305 1.00 85.34  ? 65   ASP A OD2    1 
ATOM   1084  H  H      . ASP A 1 68  ? 28.383  76.844  -32.254 1.00 89.09  ? 65   ASP A H      1 
ATOM   1085  H  HA     . ASP A 1 68  ? 29.140  78.995  -31.048 1.00 87.76  ? 65   ASP A HA     1 
ATOM   1086  H  HB2    . ASP A 1 68  ? 27.030  77.879  -30.744 1.00 90.53  ? 65   ASP A HB2    1 
ATOM   1087  H  HB3    . ASP A 1 68  ? 27.783  76.863  -29.782 1.00 90.53  ? 65   ASP A HB3    1 
ATOM   1088  N  N      . LEU A 1 69  ? 30.632  76.375  -30.067 1.00 85.79  ? 66   LEU A N      1 
ATOM   1089  C  CA     . LEU A 1 69  ? 31.753  75.836  -29.311 1.00 82.68  ? 66   LEU A CA     1 
ATOM   1090  C  C      . LEU A 1 69  ? 33.068  76.403  -29.852 1.00 75.02  ? 66   LEU A C      1 
ATOM   1091  O  O      . LEU A 1 69  ? 33.911  76.875  -29.089 1.00 75.95  ? 66   LEU A O      1 
ATOM   1092  C  CB     . LEU A 1 69  ? 31.731  74.307  -29.368 1.00 80.23  ? 66   LEU A CB     1 
ATOM   1093  C  CG     . LEU A 1 69  ? 32.907  73.507  -28.809 1.00 85.06  ? 66   LEU A CG     1 
ATOM   1094  C  CD1    . LEU A 1 69  ? 32.997  73.630  -27.290 1.00 66.58  ? 66   LEU A CD1    1 
ATOM   1095  C  CD2    . LEU A 1 69  ? 32.746  72.056  -29.226 1.00 55.55  ? 66   LEU A CD2    1 
ATOM   1096  H  H      . LEU A 1 69  ? 30.239  75.792  -30.563 1.00 102.95 ? 66   LEU A H      1 
ATOM   1097  H  HA     . LEU A 1 69  ? 31.669  76.104  -28.383 1.00 99.22  ? 66   LEU A HA     1 
ATOM   1098  H  HB2    . LEU A 1 69  ? 30.942  74.010  -28.889 1.00 96.28  ? 66   LEU A HB2    1 
ATOM   1099  H  HB3    . LEU A 1 69  ? 31.643  74.052  -30.300 1.00 96.28  ? 66   LEU A HB3    1 
ATOM   1100  H  HG     . LEU A 1 69  ? 33.733  73.844  -29.190 1.00 102.07 ? 66   LEU A HG     1 
ATOM   1101  H  HD11   . LEU A 1 69  ? 32.177  73.293  -26.898 1.00 79.90  ? 66   LEU A HD11   1 
ATOM   1102  H  HD12   . LEU A 1 69  ? 33.753  73.110  -26.976 1.00 79.90  ? 66   LEU A HD12   1 
ATOM   1103  H  HD13   . LEU A 1 69  ? 33.117  74.564  -27.056 1.00 79.90  ? 66   LEU A HD13   1 
ATOM   1104  H  HD21   . LEU A 1 69  ? 32.738  72.006  -30.195 1.00 66.66  ? 66   LEU A HD21   1 
ATOM   1105  H  HD22   . LEU A 1 69  ? 33.490  71.543  -28.874 1.00 66.66  ? 66   LEU A HD22   1 
ATOM   1106  H  HD23   . LEU A 1 69  ? 31.910  71.717  -28.869 1.00 66.66  ? 66   LEU A HD23   1 
ATOM   1107  N  N      . GLU A 1 70  ? 33.231  76.350  -31.172 1.00 71.38  ? 67   GLU A N      1 
ATOM   1108  C  CA     . GLU A 1 70  ? 34.441  76.843  -31.830 1.00 75.39  ? 67   GLU A CA     1 
ATOM   1109  C  C      . GLU A 1 70  ? 34.716  78.302  -31.490 1.00 72.65  ? 67   GLU A C      1 
ATOM   1110  O  O      . GLU A 1 70  ? 35.856  78.685  -31.235 1.00 57.77  ? 67   GLU A O      1 
ATOM   1111  C  CB     . GLU A 1 70  ? 34.331  76.684  -33.347 1.00 60.56  ? 67   GLU A CB     1 
ATOM   1112  C  CG     . GLU A 1 70  ? 34.416  75.247  -33.819 1.00 72.98  ? 67   GLU A CG     1 
ATOM   1113  C  CD     . GLU A 1 70  ? 34.009  75.077  -35.269 1.00 84.22  ? 67   GLU A CD     1 
ATOM   1114  O  OE1    . GLU A 1 70  ? 34.079  76.064  -36.031 1.00 108.85 ? 67   GLU A OE1    1 
ATOM   1115  O  OE2    . GLU A 1 70  ? 33.616  73.953  -35.647 1.00 67.27  ? 67   GLU A OE2    1 
ATOM   1116  H  H      . GLU A 1 70  ? 32.648  76.029  -31.717 1.00 85.66  ? 67   GLU A H      1 
ATOM   1117  H  HA     . GLU A 1 70  ? 35.199  76.318  -31.528 1.00 90.47  ? 67   GLU A HA     1 
ATOM   1118  H  HB2    . GLU A 1 70  ? 33.478  77.041  -33.638 1.00 72.67  ? 67   GLU A HB2    1 
ATOM   1119  H  HB3    . GLU A 1 70  ? 35.054  77.177  -33.766 1.00 72.67  ? 67   GLU A HB3    1 
ATOM   1120  H  HG2    . GLU A 1 70  ? 35.331  74.939  -33.727 1.00 87.57  ? 67   GLU A HG2    1 
ATOM   1121  H  HG3    . GLU A 1 70  ? 33.827  74.702  -33.276 1.00 87.57  ? 67   GLU A HG3    1 
ATOM   1122  N  N      . LYS A 1 71  ? 33.660  79.103  -31.442 1.00 83.70  ? 68   LYS A N      1 
ATOM   1123  C  CA     . LYS A 1 71  ? 33.804  80.530  -31.198 1.00 88.31  ? 68   LYS A CA     1 
ATOM   1124  C  C      . LYS A 1 71  ? 34.318  80.699  -29.783 1.00 75.99  ? 68   LYS A C      1 
ATOM   1125  O  O      . LYS A 1 71  ? 35.408  81.226  -29.565 1.00 70.37  ? 68   LYS A O      1 
ATOM   1126  C  CB     . LYS A 1 71  ? 32.466  81.248  -31.386 1.00 85.06  ? 68   LYS A CB     1 
ATOM   1127  C  CG     . LYS A 1 71  ? 31.892  81.106  -32.785 1.00 115.17 ? 68   LYS A CG     1 
ATOM   1128  C  CD     . LYS A 1 71  ? 30.580  81.852  -32.952 1.00 123.68 ? 68   LYS A CD     1 
ATOM   1129  C  CE     . LYS A 1 71  ? 30.043  81.701  -34.366 1.00 82.83  ? 68   LYS A CE     1 
ATOM   1130  N  NZ     . LYS A 1 71  ? 28.780  82.458  -34.559 1.00 87.97  ? 68   LYS A NZ     1 
ATOM   1131  H  H      . LYS A 1 71  ? 32.847  78.843  -31.547 1.00 100.44 ? 68   LYS A H      1 
ATOM   1132  H  HA     . LYS A 1 71  ? 34.451  80.906  -31.815 1.00 105.97 ? 68   LYS A HA     1 
ATOM   1133  H  HB2    . LYS A 1 71  ? 31.822  80.879  -30.761 1.00 102.07 ? 68   LYS A HB2    1 
ATOM   1134  H  HB3    . LYS A 1 71  ? 32.591  82.194  -31.210 1.00 102.07 ? 68   LYS A HB3    1 
ATOM   1135  H  HG2    . LYS A 1 71  ? 32.526  81.465  -33.426 1.00 138.21 ? 68   LYS A HG2    1 
ATOM   1136  H  HG3    . LYS A 1 71  ? 31.730  80.168  -32.968 1.00 138.21 ? 68   LYS A HG3    1 
ATOM   1137  H  HD2    . LYS A 1 71  ? 29.924  81.491  -32.335 1.00 148.41 ? 68   LYS A HD2    1 
ATOM   1138  H  HD3    . LYS A 1 71  ? 30.722  82.796  -32.778 1.00 148.41 ? 68   LYS A HD3    1 
ATOM   1139  H  HE2    . LYS A 1 71  ? 30.700  82.040  -34.994 1.00 99.39  ? 68   LYS A HE2    1 
ATOM   1140  H  HE3    . LYS A 1 71  ? 29.865  80.764  -34.541 1.00 99.39  ? 68   LYS A HE3    1 
ATOM   1141  H  HZ1    . LYS A 1 71  ? 28.919  83.324  -34.408 1.00 105.56 ? 68   LYS A HZ1    1 
ATOM   1142  H  HZ2    . LYS A 1 71  ? 28.487  82.353  -35.393 1.00 105.56 ? 68   LYS A HZ2    1 
ATOM   1143  H  HZ3    . LYS A 1 71  ? 28.159  82.162  -33.995 1.00 105.56 ? 68   LYS A HZ3    1 
ATOM   1144  N  N      . GLU A 1 72  ? 33.522  80.238  -28.827 1.00 70.34  ? 69   GLU A N      1 
ATOM   1145  C  CA     . GLU A 1 72  ? 33.751  80.522  -27.422 1.00 77.55  ? 69   GLU A CA     1 
ATOM   1146  C  C      . GLU A 1 72  ? 35.123  80.013  -26.968 1.00 82.46  ? 69   GLU A C      1 
ATOM   1147  O  O      . GLU A 1 72  ? 35.751  80.621  -26.099 1.00 81.83  ? 69   GLU A O      1 
ATOM   1148  C  CB     . GLU A 1 72  ? 32.636  79.919  -26.565 1.00 82.44  ? 69   GLU A CB     1 
ATOM   1149  C  CG     . GLU A 1 72  ? 31.442  80.851  -26.376 1.00 74.45  ? 69   GLU A CG     1 
ATOM   1150  C  CD     . GLU A 1 72  ? 31.760  82.056  -25.500 1.00 96.47  ? 69   GLU A CD     1 
ATOM   1151  O  OE1    . GLU A 1 72  ? 32.775  82.025  -24.769 1.00 87.65  ? 69   GLU A OE1    1 
ATOM   1152  O  OE2    . GLU A 1 72  ? 30.988  83.037  -25.538 1.00 105.58 ? 69   GLU A OE2    1 
ATOM   1153  H  H      . GLU A 1 72  ? 32.830  79.748  -28.973 1.00 84.41  ? 69   GLU A H      1 
ATOM   1154  H  HA     . GLU A 1 72  ? 33.736  81.483  -27.293 1.00 93.06  ? 69   GLU A HA     1 
ATOM   1155  H  HB2    . GLU A 1 72  ? 32.317  79.108  -26.991 1.00 98.93  ? 69   GLU A HB2    1 
ATOM   1156  H  HB3    . GLU A 1 72  ? 32.993  79.711  -25.687 1.00 98.93  ? 69   GLU A HB3    1 
ATOM   1157  H  HG2    . GLU A 1 72  ? 31.158  81.179  -27.244 1.00 89.35  ? 69   GLU A HG2    1 
ATOM   1158  H  HG3    . GLU A 1 72  ? 30.720  80.358  -25.956 1.00 89.35  ? 69   GLU A HG3    1 
ATOM   1159  N  N      . MET A 1 73  ? 35.597  78.911  -27.551 1.00 69.47  ? 70   MET A N      1 
ATOM   1160  C  CA     . MET A 1 73  ? 36.919  78.404  -27.188 1.00 76.10  ? 70   MET A CA     1 
ATOM   1161  C  C      . MET A 1 73  ? 38.056  79.250  -27.760 1.00 73.82  ? 70   MET A C      1 
ATOM   1162  O  O      . MET A 1 73  ? 39.006  79.567  -27.044 1.00 79.96  ? 70   MET A O      1 
ATOM   1163  C  CB     . MET A 1 73  ? 37.091  76.958  -27.675 1.00 71.72  ? 70   MET A CB     1 
ATOM   1164  C  CG     . MET A 1 73  ? 36.516  75.894  -26.748 1.00 65.14  ? 70   MET A CG     1 
ATOM   1165  S  SD     . MET A 1 73  ? 36.656  74.216  -27.411 1.00 59.55  ? 70   MET A SD     1 
ATOM   1166  C  CE     . MET A 1 73  ? 38.398  74.124  -27.838 1.00 43.80  ? 70   MET A CE     1 
ATOM   1167  H  H      . MET A 1 73  ? 35.182  78.449  -28.146 1.00 83.36  ? 70   MET A H      1 
ATOM   1168  H  HA     . MET A 1 73  ? 36.993  78.399  -26.221 1.00 91.32  ? 70   MET A HA     1 
ATOM   1169  H  HB2    . MET A 1 73  ? 36.650  76.868  -28.534 1.00 86.07  ? 70   MET A HB2    1 
ATOM   1170  H  HB3    . MET A 1 73  ? 38.039  76.778  -27.776 1.00 86.07  ? 70   MET A HB3    1 
ATOM   1171  H  HG2    . MET A 1 73  ? 36.993  75.921  -25.904 1.00 78.17  ? 70   MET A HG2    1 
ATOM   1172  H  HG3    . MET A 1 73  ? 35.576  76.079  -26.603 1.00 78.17  ? 70   MET A HG3    1 
ATOM   1173  H  HE1    . MET A 1 73  ? 38.927  74.264  -27.037 1.00 52.56  ? 70   MET A HE1    1 
ATOM   1174  H  HE2    . MET A 1 73  ? 38.586  73.248  -28.210 1.00 52.56  ? 70   MET A HE2    1 
ATOM   1175  H  HE3    . MET A 1 73  ? 38.599  74.812  -28.492 1.00 52.56  ? 70   MET A HE3    1 
ATOM   1176  N  N      . GLN A 1 74  ? 37.980  79.609  -29.037 1.00 76.74  ? 71   GLN A N      1 
ATOM   1177  C  CA     . GLN A 1 74  ? 39.004  80.468  -29.630 1.00 71.34  ? 71   GLN A CA     1 
ATOM   1178  C  C      . GLN A 1 74  ? 39.010  81.834  -28.936 1.00 71.46  ? 71   GLN A C      1 
ATOM   1179  O  O      . GLN A 1 74  ? 40.058  82.461  -28.757 1.00 64.01  ? 71   GLN A O      1 
ATOM   1180  C  CB     . GLN A 1 74  ? 38.782  80.614  -31.136 1.00 52.67  ? 71   GLN A CB     1 
ATOM   1181  C  CG     . GLN A 1 74  ? 39.030  79.320  -31.910 1.00 59.46  ? 71   GLN A CG     1 
ATOM   1182  C  CD     . GLN A 1 74  ? 38.088  79.118  -33.090 1.00 63.06  ? 71   GLN A CD     1 
ATOM   1183  O  OE1    . GLN A 1 74  ? 37.121  79.856  -33.265 1.00 72.15  ? 71   GLN A OE1    1 
ATOM   1184  N  NE2    . GLN A 1 74  ? 38.368  78.101  -33.901 1.00 51.22  ? 71   GLN A NE2    1 
ATOM   1185  H  H      . GLN A 1 74  ? 37.354  79.373  -29.577 1.00 92.08  ? 71   GLN A H      1 
ATOM   1186  H  HA     . GLN A 1 74  ? 39.874  80.061  -29.495 1.00 85.61  ? 71   GLN A HA     1 
ATOM   1187  H  HB2    . GLN A 1 74  ? 37.864  80.884  -31.294 1.00 63.20  ? 71   GLN A HB2    1 
ATOM   1188  H  HB3    . GLN A 1 74  ? 39.388  81.289  -31.479 1.00 63.20  ? 71   GLN A HB3    1 
ATOM   1189  H  HG2    . GLN A 1 74  ? 39.937  79.330  -32.254 1.00 71.35  ? 71   GLN A HG2    1 
ATOM   1190  H  HG3    . GLN A 1 74  ? 38.916  78.568  -31.308 1.00 71.35  ? 71   GLN A HG3    1 
ATOM   1191  H  HE21   . GLN A 1 74  ? 39.051  77.601  -33.745 1.00 61.47  ? 71   GLN A HE21   1 
ATOM   1192  H  HE22   . GLN A 1 74  ? 37.867  77.944  -34.582 1.00 61.47  ? 71   GLN A HE22   1 
ATOM   1193  N  N      . ALA A 1 75  ? 37.821  82.279  -28.538 1.00 60.47  ? 72   ALA A N      1 
ATOM   1194  C  CA     . ALA A 1 75  ? 37.657  83.536  -27.817 1.00 60.29  ? 72   ALA A CA     1 
ATOM   1195  C  C      . ALA A 1 75  ? 38.235  83.458  -26.412 1.00 82.66  ? 72   ALA A C      1 
ATOM   1196  O  O      . ALA A 1 75  ? 38.958  84.356  -25.978 1.00 86.10  ? 72   ALA A O      1 
ATOM   1197  C  CB     . ALA A 1 75  ? 36.186  83.917  -27.754 1.00 71.63  ? 72   ALA A CB     1 
ATOM   1198  H  H      . ALA A 1 75  ? 37.082  81.863  -28.678 1.00 72.57  ? 72   ALA A H      1 
ATOM   1199  H  HA     . ALA A 1 75  ? 38.127  84.237  -28.295 1.00 72.35  ? 72   ALA A HA     1 
ATOM   1200  H  HB1    . ALA A 1 75  ? 35.698  83.216  -27.294 1.00 85.96  ? 72   ALA A HB1    1 
ATOM   1201  H  HB2    . ALA A 1 75  ? 36.097  84.754  -27.271 1.00 85.96  ? 72   ALA A HB2    1 
ATOM   1202  H  HB3    . ALA A 1 75  ? 35.847  84.018  -28.657 1.00 85.96  ? 72   ALA A HB3    1 
ATOM   1203  N  N      . ALA A 1 76  ? 37.917  82.382  -25.701 1.00 83.33  ? 73   ALA A N      1 
ATOM   1204  C  CA     . ALA A 1 76  ? 38.386  82.225  -24.332 1.00 85.47  ? 73   ALA A CA     1 
ATOM   1205  C  C      . ALA A 1 76  ? 39.848  81.796  -24.330 1.00 81.52  ? 73   ALA A C      1 
ATOM   1206  O  O      . ALA A 1 76  ? 40.627  82.224  -23.476 1.00 77.68  ? 73   ALA A O      1 
ATOM   1207  C  CB     . ALA A 1 76  ? 37.526  81.209  -23.591 1.00 73.63  ? 73   ALA A CB     1 
ATOM   1208  H  H      . ALA A 1 76  ? 37.432  81.731  -25.988 1.00 100.00 ? 73   ALA A H      1 
ATOM   1209  H  HA     . ALA A 1 76  ? 38.317  83.075  -23.871 1.00 102.57 ? 73   ALA A HA     1 
ATOM   1210  H  HB1    . ALA A 1 76  ? 37.582  80.355  -24.049 1.00 88.36  ? 73   ALA A HB1    1 
ATOM   1211  H  HB2    . ALA A 1 76  ? 37.856  81.120  -22.683 1.00 88.36  ? 73   ALA A HB2    1 
ATOM   1212  H  HB3    . ALA A 1 76  ? 36.608  81.520  -23.582 1.00 88.36  ? 73   ALA A HB3    1 
ATOM   1213  N  N      . ASN A 1 77  ? 40.212  80.966  -25.305 1.00 67.23  ? 74   ASN A N      1 
ATOM   1214  C  CA     . ASN A 1 77  ? 41.566  80.444  -25.419 1.00 64.84  ? 74   ASN A CA     1 
ATOM   1215  C  C      . ASN A 1 77  ? 42.001  79.851  -24.083 1.00 83.73  ? 74   ASN A C      1 
ATOM   1216  O  O      . ASN A 1 77  ? 42.897  80.376  -23.420 1.00 90.46  ? 74   ASN A O      1 
ATOM   1217  C  CB     . ASN A 1 77  ? 42.516  81.555  -25.879 1.00 81.05  ? 74   ASN A CB     1 
ATOM   1218  C  CG     . ASN A 1 77  ? 43.484  81.089  -26.941 1.00 98.10  ? 74   ASN A CG     1 
ATOM   1219  O  OD1    . ASN A 1 77  ? 43.105  80.905  -28.100 1.00 85.74  ? 74   ASN A OD1    1 
ATOM   1220  N  ND2    . ASN A 1 77  ? 44.747  80.908  -26.557 1.00 86.44  ? 74   ASN A ND2    1 
ATOM   1221  H  H      . ASN A 1 77  ? 39.681  80.688  -25.922 1.00 80.68  ? 74   ASN A H      1 
ATOM   1222  H  HA     . ASN A 1 77  ? 41.581  79.738  -26.084 1.00 77.80  ? 74   ASN A HA     1 
ATOM   1223  H  HB2    . ASN A 1 77  ? 41.995  82.285  -26.248 1.00 97.26  ? 74   ASN A HB2    1 
ATOM   1224  H  HB3    . ASN A 1 77  ? 43.032  81.866  -25.118 1.00 97.26  ? 74   ASN A HB3    1 
ATOM   1225  H  HD21   . ASN A 1 77  ? 44.974  81.056  -25.741 1.00 103.73 ? 74   ASN A HD21   1 
ATOM   1226  H  HD22   . ASN A 1 77  ? 45.335  80.643  -27.126 1.00 103.73 ? 74   ASN A HD22   1 
ATOM   1227  N  N      . PRO A 1 78  ? 41.362  78.743  -23.678 1.00 82.07  ? 75   PRO A N      1 
ATOM   1228  C  CA     . PRO A 1 78  ? 41.657  78.204  -22.348 1.00 62.86  ? 75   PRO A CA     1 
ATOM   1229  C  C      . PRO A 1 78  ? 42.950  77.399  -22.264 1.00 64.37  ? 75   PRO A C      1 
ATOM   1230  O  O      . PRO A 1 78  ? 43.391  76.836  -23.264 1.00 52.81  ? 75   PRO A O      1 
ATOM   1231  C  CB     . PRO A 1 78  ? 40.443  77.314  -22.075 1.00 50.59  ? 75   PRO A CB     1 
ATOM   1232  C  CG     . PRO A 1 78  ? 40.045  76.824  -23.424 1.00 47.58  ? 75   PRO A CG     1 
ATOM   1233  C  CD     . PRO A 1 78  ? 40.288  77.990  -24.351 1.00 62.58  ? 75   PRO A CD     1 
ATOM   1234  H  HA     . PRO A 1 78  ? 41.682  78.920  -21.694 1.00 75.43  ? 75   PRO A HA     1 
ATOM   1235  H  HB2    . PRO A 1 78  ? 40.698  76.575  -21.500 1.00 60.71  ? 75   PRO A HB2    1 
ATOM   1236  H  HB3    . PRO A 1 78  ? 39.733  77.838  -21.673 1.00 60.71  ? 75   PRO A HB3    1 
ATOM   1237  H  HG2    . PRO A 1 78  ? 40.597  76.066  -23.674 1.00 57.09  ? 75   PRO A HG2    1 
ATOM   1238  H  HG3    . PRO A 1 78  ? 39.106  76.579  -23.419 1.00 57.09  ? 75   PRO A HG3    1 
ATOM   1239  H  HD2    . PRO A 1 78  ? 40.587  77.675  -25.218 1.00 75.09  ? 75   PRO A HD2    1 
ATOM   1240  H  HD3    . PRO A 1 78  ? 39.489  78.534  -24.426 1.00 75.09  ? 75   PRO A HD3    1 
ATOM   1241  N  N      . TYR A 1 79  ? 43.542  77.354  -21.071 1.00 68.97  ? 76   TYR A N      1 
ATOM   1242  C  CA     . TYR A 1 79  ? 44.702  76.510  -20.811 1.00 50.37  ? 76   TYR A CA     1 
ATOM   1243  C  C      . TYR A 1 79  ? 44.250  75.074  -20.560 1.00 49.60  ? 76   TYR A C      1 
ATOM   1244  O  O      . TYR A 1 79  ? 44.938  74.126  -20.932 1.00 52.29  ? 76   TYR A O      1 
ATOM   1245  C  CB     . TYR A 1 79  ? 45.503  77.014  -19.613 1.00 51.64  ? 76   TYR A CB     1 
ATOM   1246  C  CG     . TYR A 1 79  ? 46.429  78.171  -19.898 1.00 65.93  ? 76   TYR A CG     1 
ATOM   1247  C  CD1    . TYR A 1 79  ? 47.744  77.951  -20.292 1.00 69.25  ? 76   TYR A CD1    1 
ATOM   1248  C  CD2    . TYR A 1 79  ? 46.001  79.481  -19.746 1.00 59.82  ? 76   TYR A CD2    1 
ATOM   1249  C  CE1    . TYR A 1 79  ? 48.600  79.005  -20.543 1.00 58.81  ? 76   TYR A CE1    1 
ATOM   1250  C  CE2    . TYR A 1 79  ? 46.848  80.535  -19.994 1.00 63.31  ? 76   TYR A CE2    1 
ATOM   1251  C  CZ     . TYR A 1 79  ? 48.148  80.295  -20.393 1.00 62.89  ? 76   TYR A CZ     1 
ATOM   1252  O  OH     . TYR A 1 79  ? 49.003  81.343  -20.643 1.00 69.70  ? 76   TYR A OH     1 
ATOM   1253  H  H      . TYR A 1 79  ? 43.285  77.809  -20.389 1.00 82.76  ? 76   TYR A H      1 
ATOM   1254  H  HA     . TYR A 1 79  ? 45.281  76.514  -21.588 1.00 60.44  ? 76   TYR A HA     1 
ATOM   1255  H  HB2    . TYR A 1 79  ? 44.882  77.301  -18.926 1.00 61.97  ? 76   TYR A HB2    1 
ATOM   1256  H  HB3    . TYR A 1 79  ? 46.045  76.284  -19.275 1.00 61.97  ? 76   TYR A HB3    1 
ATOM   1257  H  HD1    . TYR A 1 79  ? 48.050  77.079  -20.394 1.00 83.10  ? 76   TYR A HD1    1 
ATOM   1258  H  HD2    . TYR A 1 79  ? 45.126  79.648  -19.479 1.00 71.78  ? 76   TYR A HD2    1 
ATOM   1259  H  HE1    . TYR A 1 79  ? 49.475  78.843  -20.811 1.00 70.57  ? 76   TYR A HE1    1 
ATOM   1260  H  HE2    . TYR A 1 79  ? 46.545  81.409  -19.893 1.00 75.97  ? 76   TYR A HE2    1 
ATOM   1261  H  HH     . TYR A 1 79  ? 48.608  82.074  -20.516 1.00 83.64  ? 76   TYR A HH     1 
ATOM   1262  N  N      . LYS A 1 80  ? 43.093  74.933  -19.914 1.00 43.45  ? 77   LYS A N      1 
ATOM   1263  C  CA     . LYS A 1 80  ? 42.530  73.628  -19.574 1.00 49.96  ? 77   LYS A CA     1 
ATOM   1264  C  C      . LYS A 1 80  ? 41.069  73.551  -20.002 1.00 61.29  ? 77   LYS A C      1 
ATOM   1265  O  O      . LYS A 1 80  ? 40.340  74.532  -19.870 1.00 66.10  ? 77   LYS A O      1 
ATOM   1266  C  CB     . LYS A 1 80  ? 42.613  73.376  -18.067 1.00 64.76  ? 77   LYS A CB     1 
ATOM   1267  C  CG     . LYS A 1 80  ? 44.007  73.439  -17.458 1.00 56.35  ? 77   LYS A CG     1 
ATOM   1268  C  CD     . LYS A 1 80  ? 43.938  73.128  -15.969 1.00 59.79  ? 77   LYS A CD     1 
ATOM   1269  C  CE     . LYS A 1 80  ? 45.235  73.451  -15.254 1.00 89.75  ? 77   LYS A CE     1 
ATOM   1270  N  NZ     . LYS A 1 80  ? 45.142  73.179  -13.792 1.00 89.39  ? 77   LYS A NZ     1 
ATOM   1271  H  H      . LYS A 1 80  ? 42.606  75.594  -19.658 1.00 52.14  ? 77   LYS A H      1 
ATOM   1272  H  HA     . LYS A 1 80  ? 43.024  72.930  -20.032 1.00 59.96  ? 77   LYS A HA     1 
ATOM   1273  H  HB2    . LYS A 1 80  ? 42.070  74.041  -17.615 1.00 77.71  ? 77   LYS A HB2    1 
ATOM   1274  H  HB3    . LYS A 1 80  ? 42.258  72.492  -17.885 1.00 77.71  ? 77   LYS A HB3    1 
ATOM   1275  H  HG2    . LYS A 1 80  ? 44.578  72.782  -17.885 1.00 67.61  ? 77   LYS A HG2    1 
ATOM   1276  H  HG3    . LYS A 1 80  ? 44.370  74.332  -17.570 1.00 67.61  ? 77   LYS A HG3    1 
ATOM   1277  H  HD2    . LYS A 1 80  ? 43.231  73.657  -15.566 1.00 71.75  ? 77   LYS A HD2    1 
ATOM   1278  H  HD3    . LYS A 1 80  ? 43.756  72.182  -15.850 1.00 71.75  ? 77   LYS A HD3    1 
ATOM   1279  H  HE2    . LYS A 1 80  ? 45.947  72.903  -15.620 1.00 107.70 ? 77   LYS A HE2    1 
ATOM   1280  H  HE3    . LYS A 1 80  ? 45.441  74.392  -15.375 1.00 107.70 ? 77   LYS A HE3    1 
ATOM   1281  H  HZ1    . LYS A 1 80  ? 44.957  72.319  -13.654 1.00 107.27 ? 77   LYS A HZ1    1 
ATOM   1282  H  HZ2    . LYS A 1 80  ? 45.914  73.377  -13.396 1.00 107.27 ? 77   LYS A HZ2    1 
ATOM   1283  H  HZ3    . LYS A 1 80  ? 44.497  73.675  -13.431 1.00 107.27 ? 77   LYS A HZ3    1 
ATOM   1284  N  N      . ILE A 1 81  ? 40.647  72.393  -20.509 1.00 51.02  ? 78   ILE A N      1 
ATOM   1285  C  CA     . ILE A 1 81  ? 39.252  72.175  -20.904 1.00 46.48  ? 78   ILE A CA     1 
ATOM   1286  C  C      . ILE A 1 81  ? 38.706  70.901  -20.246 1.00 37.38  ? 78   ILE A C      1 
ATOM   1287  O  O      . ILE A 1 81  ? 39.071  69.796  -20.644 1.00 37.82  ? 78   ILE A O      1 
ATOM   1288  C  CB     . ILE A 1 81  ? 39.111  72.053  -22.446 1.00 62.92  ? 78   ILE A CB     1 
ATOM   1289  C  CG1    . ILE A 1 81  ? 39.718  73.272  -23.146 1.00 51.69  ? 78   ILE A CG1    1 
ATOM   1290  C  CG2    . ILE A 1 81  ? 37.641  71.851  -22.844 1.00 46.86  ? 78   ILE A CG2    1 
ATOM   1291  C  CD1    . ILE A 1 81  ? 39.698  73.191  -24.662 1.00 42.55  ? 78   ILE A CD1    1 
ATOM   1292  H  H      . ILE A 1 81  ? 41.154  71.710  -20.636 1.00 61.23  ? 78   ILE A H      1 
ATOM   1293  H  HA     . ILE A 1 81  ? 38.714  72.926  -20.607 1.00 55.78  ? 78   ILE A HA     1 
ATOM   1294  H  HB     . ILE A 1 81  ? 39.607  71.269  -22.730 1.00 75.50  ? 78   ILE A HB     1 
ATOM   1295  H  HG12   . ILE A 1 81  ? 39.219  74.061  -22.886 1.00 62.03  ? 78   ILE A HG12   1 
ATOM   1296  H  HG13   . ILE A 1 81  ? 40.643  73.362  -22.867 1.00 62.03  ? 78   ILE A HG13   1 
ATOM   1297  H  HG21   . ILE A 1 81  ? 37.124  72.613  -22.538 1.00 56.24  ? 78   ILE A HG21   1 
ATOM   1298  H  HG22   . ILE A 1 81  ? 37.583  71.778  -23.810 1.00 56.24  ? 78   ILE A HG22   1 
ATOM   1299  H  HG23   . ILE A 1 81  ? 37.311  71.038  -22.430 1.00 56.24  ? 78   ILE A HG23   1 
ATOM   1300  H  HD11   . ILE A 1 81  ? 38.779  73.114  -24.961 1.00 51.06  ? 78   ILE A HD11   1 
ATOM   1301  H  HD12   . ILE A 1 81  ? 40.099  73.997  -25.026 1.00 51.06  ? 78   ILE A HD12   1 
ATOM   1302  H  HD13   . ILE A 1 81  ? 40.205  72.414  -24.943 1.00 51.06  ? 78   ILE A HD13   1 
ATOM   1303  N  N      . ASP A 1 82  ? 37.864  71.050  -19.227 1.00 33.83  ? 79   ASP A N      1 
ATOM   1304  C  CA     . ASP A 1 82  ? 37.290  69.890  -18.533 1.00 49.98  ? 79   ASP A CA     1 
ATOM   1305  C  C      . ASP A 1 82  ? 35.847  69.630  -18.976 1.00 44.15  ? 79   ASP A C      1 
ATOM   1306  O  O      . ASP A 1 82  ? 35.068  70.563  -19.142 1.00 60.37  ? 79   ASP A O      1 
ATOM   1307  C  CB     . ASP A 1 82  ? 37.332  70.081  -17.010 1.00 50.70  ? 79   ASP A CB     1 
ATOM   1308  C  CG     . ASP A 1 82  ? 38.742  70.326  -16.477 1.00 61.95  ? 79   ASP A CG     1 
ATOM   1309  O  OD1    . ASP A 1 82  ? 39.709  69.781  -17.055 1.00 48.30  ? 79   ASP A OD1    1 
ATOM   1310  O  OD2    . ASP A 1 82  ? 38.886  71.058  -15.471 1.00 67.71  ? 79   ASP A OD2    1 
ATOM   1311  H  H      . ASP A 1 82  ? 37.606  71.809  -18.916 1.00 40.60  ? 79   ASP A H      1 
ATOM   1312  H  HA     . ASP A 1 82  ? 37.815  69.103  -18.749 1.00 59.97  ? 79   ASP A HA     1 
ATOM   1313  H  HB2    . ASP A 1 82  ? 36.785  70.846  -16.773 1.00 60.84  ? 79   ASP A HB2    1 
ATOM   1314  H  HB3    . ASP A 1 82  ? 36.985  69.282  -16.583 1.00 60.84  ? 79   ASP A HB3    1 
ATOM   1315  N  N      . ILE A 1 83  ? 35.502  68.358  -19.158 1.00 34.10  ? 80   ILE A N      1 
ATOM   1316  C  CA     . ILE A 1 83  ? 34.141  67.949  -19.517 1.00 34.01  ? 80   ILE A CA     1 
ATOM   1317  C  C      . ILE A 1 83  ? 33.361  67.463  -18.308 1.00 29.67  ? 80   ILE A C      1 
ATOM   1318  O  O      . ILE A 1 83  ? 33.831  66.609  -17.570 1.00 46.86  ? 80   ILE A O      1 
ATOM   1319  C  CB     . ILE A 1 83  ? 34.142  66.820  -20.568 1.00 40.47  ? 80   ILE A CB     1 
ATOM   1320  C  CG1    . ILE A 1 83  ? 34.855  67.289  -21.838 1.00 35.75  ? 80   ILE A CG1    1 
ATOM   1321  C  CG2    . ILE A 1 83  ? 32.707  66.382  -20.890 1.00 27.54  ? 80   ILE A CG2    1 
ATOM   1322  C  CD1    . ILE A 1 83  ? 34.968  66.235  -22.926 1.00 24.75  ? 80   ILE A CD1    1 
ATOM   1323  H  H      . ILE A 1 83  ? 36.048  67.698  -19.079 1.00 40.92  ? 80   ILE A H      1 
ATOM   1324  H  HA     . ILE A 1 83  ? 33.671  68.710  -19.893 1.00 40.82  ? 80   ILE A HA     1 
ATOM   1325  H  HB     . ILE A 1 83  ? 34.624  66.060  -20.205 1.00 48.57  ? 80   ILE A HB     1 
ATOM   1326  H  HG12   . ILE A 1 83  ? 34.367  68.042  -22.208 1.00 42.90  ? 80   ILE A HG12   1 
ATOM   1327  H  HG13   . ILE A 1 83  ? 35.754  67.568  -21.604 1.00 42.90  ? 80   ILE A HG13   1 
ATOM   1328  H  HG21   . ILE A 1 83  ? 32.216  67.142  -21.240 1.00 33.05  ? 80   ILE A HG21   1 
ATOM   1329  H  HG22   . ILE A 1 83  ? 32.735  65.673  -21.552 1.00 33.05  ? 80   ILE A HG22   1 
ATOM   1330  H  HG23   . ILE A 1 83  ? 32.286  66.060  -20.078 1.00 33.05  ? 80   ILE A HG23   1 
ATOM   1331  H  HD11   . ILE A 1 83  ? 34.077  65.953  -23.186 1.00 29.70  ? 80   ILE A HD11   1 
ATOM   1332  H  HD12   . ILE A 1 83  ? 35.431  66.617  -23.688 1.00 29.70  ? 80   ILE A HD12   1 
ATOM   1333  H  HD13   . ILE A 1 83  ? 35.468  65.478  -22.581 1.00 29.70  ? 80   ILE A HD13   1 
ATOM   1334  N  N      . GLY A 1 84  ? 32.156  67.991  -18.132 1.00 37.28  ? 81   GLY A N      1 
ATOM   1335  C  CA     . GLY A 1 84  ? 31.304  67.626  -17.012 1.00 35.89  ? 81   GLY A CA     1 
ATOM   1336  C  C      . GLY A 1 84  ? 30.142  66.741  -17.418 1.00 40.04  ? 81   GLY A C      1 
ATOM   1337  O  O      . GLY A 1 84  ? 30.239  65.961  -18.364 1.00 37.81  ? 81   GLY A O      1 
ATOM   1338  H  H      . GLY A 1 84  ? 31.804  68.572  -18.659 1.00 44.73  ? 81   GLY A H      1 
ATOM   1339  H  HA2    . GLY A 1 84  ? 31.831  67.154  -16.348 1.00 43.07  ? 81   GLY A HA2    1 
ATOM   1340  H  HA3    . GLY A 1 84  ? 30.948  68.431  -16.604 1.00 43.07  ? 81   GLY A HA3    1 
ATOM   1341  N  N      . ALA A 1 85  ? 29.039  66.870  -16.687 1.00 45.96  ? 82   ALA A N      1 
ATOM   1342  C  CA     . ALA A 1 85  ? 27.841  66.067  -16.917 1.00 51.68  ? 82   ALA A CA     1 
ATOM   1343  C  C      . ALA A 1 85  ? 26.865  66.708  -17.907 1.00 60.92  ? 82   ALA A C      1 
ATOM   1344  O  O      . ALA A 1 85  ? 27.007  67.874  -18.284 1.00 62.38  ? 82   ALA A O      1 
ATOM   1345  C  CB     . ALA A 1 85  ? 27.133  65.818  -15.598 1.00 45.52  ? 82   ALA A CB     1 
ATOM   1346  H  H      . ALA A 1 85  ? 28.958  67.429  -16.038 1.00 55.16  ? 82   ALA A H      1 
ATOM   1347  H  HA     . ALA A 1 85  ? 28.107  65.207  -17.278 1.00 62.02  ? 82   ALA A HA     1 
ATOM   1348  H  HB1    . ALA A 1 85  ? 26.884  66.670  -15.208 1.00 54.62  ? 82   ALA A HB1    1 
ATOM   1349  H  HB2    . ALA A 1 85  ? 26.340  65.284  -15.761 1.00 54.62  ? 82   ALA A HB2    1 
ATOM   1350  H  HB3    . ALA A 1 85  ? 27.735  65.344  -15.002 1.00 54.62  ? 82   ALA A HB3    1 
ATOM   1351  N  N      . VAL A 1 86  ? 25.878  65.921  -18.326 1.00 52.04  ? 83   VAL A N      1 
ATOM   1352  C  CA     . VAL A 1 86  ? 24.744  66.419  -19.093 1.00 55.37  ? 83   VAL A CA     1 
ATOM   1353  C  C      . VAL A 1 86  ? 23.633  66.717  -18.090 1.00 60.29  ? 83   VAL A C      1 
ATOM   1354  O  O      . VAL A 1 86  ? 23.117  65.801  -17.451 1.00 62.82  ? 83   VAL A O      1 
ATOM   1355  C  CB     . VAL A 1 86  ? 24.258  65.389  -20.134 1.00 60.60  ? 83   VAL A CB     1 
ATOM   1356  C  CG1    . VAL A 1 86  ? 23.098  65.948  -20.949 1.00 58.44  ? 83   VAL A CG1    1 
ATOM   1357  C  CG2    . VAL A 1 86  ? 25.401  64.961  -21.045 1.00 64.44  ? 83   VAL A CG2    1 
ATOM   1358  H  H      . VAL A 1 86  ? 25.843  65.076  -18.173 1.00 62.44  ? 83   VAL A H      1 
ATOM   1359  H  HA     . VAL A 1 86  ? 24.987  67.240  -19.550 1.00 66.45  ? 83   VAL A HA     1 
ATOM   1360  H  HB     . VAL A 1 86  ? 23.940  64.600  -19.667 1.00 72.71  ? 83   VAL A HB     1 
ATOM   1361  H  HG11   . VAL A 1 86  ? 23.394  66.748  -21.411 1.00 70.13  ? 83   VAL A HG11   1 
ATOM   1362  H  HG12   . VAL A 1 86  ? 22.814  65.280  -21.593 1.00 70.13  ? 83   VAL A HG12   1 
ATOM   1363  H  HG13   . VAL A 1 86  ? 22.366  66.162  -20.350 1.00 70.13  ? 83   VAL A HG13   1 
ATOM   1364  H  HG21   . VAL A 1 86  ? 26.101  64.561  -20.507 1.00 77.33  ? 83   VAL A HG21   1 
ATOM   1365  H  HG22   . VAL A 1 86  ? 25.067  64.315  -21.688 1.00 77.33  ? 83   VAL A HG22   1 
ATOM   1366  H  HG23   . VAL A 1 86  ? 25.744  65.742  -21.508 1.00 77.33  ? 83   VAL A HG23   1 
ATOM   1367  N  N      . TYR A 1 87  ? 23.256  67.986  -17.954 1.00 66.74  ? 84   TYR A N      1 
ATOM   1368  C  CA     . TYR A 1 87  ? 22.334  68.377  -16.886 1.00 76.88  ? 84   TYR A CA     1 
ATOM   1369  C  C      . TYR A 1 87  ? 20.860  68.407  -17.297 1.00 77.94  ? 84   TYR A C      1 
ATOM   1370  O  O      . TYR A 1 87  ? 20.513  68.187  -18.458 1.00 79.92  ? 84   TYR A O      1 
ATOM   1371  C  CB     . TYR A 1 87  ? 22.740  69.747  -16.337 1.00 73.34  ? 84   TYR A CB     1 
ATOM   1372  C  CG     . TYR A 1 87  ? 23.967  69.685  -15.458 1.00 69.99  ? 84   TYR A CG     1 
ATOM   1373  C  CD1    . TYR A 1 87  ? 25.236  69.578  -16.014 1.00 66.14  ? 84   TYR A CD1    1 
ATOM   1374  C  CD2    . TYR A 1 87  ? 23.857  69.695  -14.075 1.00 68.37  ? 84   TYR A CD2    1 
ATOM   1375  C  CE1    . TYR A 1 87  ? 26.362  69.510  -15.217 1.00 70.63  ? 84   TYR A CE1    1 
ATOM   1376  C  CE2    . TYR A 1 87  ? 24.978  69.626  -13.269 1.00 73.17  ? 84   TYR A CE2    1 
ATOM   1377  C  CZ     . TYR A 1 87  ? 26.229  69.531  -13.845 1.00 71.76  ? 84   TYR A CZ     1 
ATOM   1378  O  OH     . TYR A 1 87  ? 27.351  69.461  -13.049 1.00 56.39  ? 84   TYR A OH     1 
ATOM   1379  H  H      . TYR A 1 87  ? 23.514  68.633  -18.458 1.00 80.09  ? 84   TYR A H      1 
ATOM   1380  H  HA     . TYR A 1 87  ? 22.418  67.737  -16.162 1.00 92.26  ? 84   TYR A HA     1 
ATOM   1381  H  HB2    . TYR A 1 87  ? 22.933  70.340  -17.080 1.00 88.01  ? 84   TYR A HB2    1 
ATOM   1382  H  HB3    . TYR A 1 87  ? 22.010  70.104  -15.808 1.00 88.01  ? 84   TYR A HB3    1 
ATOM   1383  H  HD1    . TYR A 1 87  ? 23.016  69.760  -13.683 1.00 82.04  ? 84   TYR A HD1    1 
ATOM   1384  H  HD2    . TYR A 1 87  ? 25.329  69.565  -16.939 1.00 79.37  ? 84   TYR A HD2    1 
ATOM   1385  H  HE1    . TYR A 1 87  ? 24.890  69.640  -12.343 1.00 87.80  ? 84   TYR A HE1    1 
ATOM   1386  H  HE2    . TYR A 1 87  ? 27.205  69.446  -15.604 1.00 84.75  ? 84   TYR A HE2    1 
ATOM   1387  H  HH     . TYR A 1 87  ? 28.040  69.407  -13.527 1.00 67.66  ? 84   TYR A HH     1 
ATOM   1388  N  N      . SER A 1 88  ? 20.006  68.692  -16.317 1.00 77.78  ? 85   SER A N      1 
ATOM   1389  C  CA     . SER A 1 88  ? 18.561  68.758  -16.511 1.00 77.09  ? 85   SER A CA     1 
ATOM   1390  C  C      . SER A 1 88  ? 18.187  69.987  -17.327 1.00 85.21  ? 85   SER A C      1 
ATOM   1391  O  O      . SER A 1 88  ? 17.186  69.996  -18.042 1.00 87.64  ? 85   SER A O      1 
ATOM   1392  C  CB     . SER A 1 88  ? 17.846  68.789  -15.160 1.00 83.31  ? 85   SER A CB     1 
ATOM   1393  O  OG     . SER A 1 88  ? 18.393  69.794  -14.321 1.00 87.81  ? 85   SER A OG     1 
ATOM   1394  H  H      . SER A 1 88  ? 20.248  68.856  -15.509 1.00 93.34  ? 85   SER A H      1 
ATOM   1395  H  HA     . SER A 1 88  ? 18.266  67.970  -16.994 1.00 92.50  ? 85   SER A HA     1 
ATOM   1396  H  HB2    . SER A 1 88  ? 16.906  68.976  -15.305 1.00 99.98  ? 85   SER A HB2    1 
ATOM   1397  H  HB3    . SER A 1 88  ? 17.950  67.926  -14.728 1.00 99.98  ? 85   SER A HB3    1 
ATOM   1398  H  HG     . SER A 1 88  ? 17.992  69.801  -13.583 1.00 105.37 ? 85   SER A HG     1 
ATOM   1399  N  N      . HIS A 1 89  ? 19.003  71.026  -17.198 1.00 85.17  ? 86   HIS A N      1 
ATOM   1400  C  CA     . HIS A 1 89  ? 18.827  72.259  -17.950 1.00 83.88  ? 86   HIS A CA     1 
ATOM   1401  C  C      . HIS A 1 89  ? 20.137  72.652  -18.605 1.00 88.68  ? 86   HIS A C      1 
ATOM   1402  O  O      . HIS A 1 89  ? 21.133  71.938  -18.504 1.00 93.50  ? 86   HIS A O      1 
ATOM   1403  C  CB     . HIS A 1 89  ? 18.338  73.397  -17.051 1.00 90.21  ? 86   HIS A CB     1 
ATOM   1404  C  CG     . HIS A 1 89  ? 17.121  73.058  -16.249 1.00 94.98  ? 86   HIS A CG     1 
ATOM   1405  N  ND1    . HIS A 1 89  ? 17.180  72.394  -15.043 1.00 94.89  ? 86   HIS A ND1    1 
ATOM   1406  C  CD2    . HIS A 1 89  ? 15.808  73.289  -16.488 1.00 112.72 ? 86   HIS A CD2    1 
ATOM   1407  C  CE1    . HIS A 1 89  ? 15.956  72.236  -14.571 1.00 103.41 ? 86   HIS A CE1    1 
ATOM   1408  N  NE2    . HIS A 1 89  ? 15.105  72.769  -15.430 1.00 112.25 ? 86   HIS A NE2    1 
ATOM   1409  H  H      . HIS A 1 89  ? 19.680  71.040  -16.669 1.00 102.21 ? 86   HIS A H      1 
ATOM   1410  H  HA     . HIS A 1 89  ? 18.169  72.118  -18.648 1.00 100.66 ? 86   HIS A HA     1 
ATOM   1411  H  HB2    . HIS A 1 89  ? 19.045  73.631  -16.430 1.00 108.25 ? 86   HIS A HB2    1 
ATOM   1412  H  HB3    . HIS A 1 89  ? 18.122  74.163  -17.606 1.00 108.25 ? 86   HIS A HB3    1 
ATOM   1413  H  HD1    . HIS A 1 89  ? 17.901  72.129  -14.656 1.00 113.87 ? 86   HIS A HD1    1 
ATOM   1414  H  HD2    . HIS A 1 89  ? 15.450  73.721  -17.230 1.00 135.27 ? 86   HIS A HD2    1 
ATOM   1415  H  HE1    . HIS A 1 89  ? 15.732  71.818  -13.771 1.00 124.09 ? 86   HIS A HE1    1 
ATOM   1416  H  HE2    . HIS A 1 89  ? 14.250  72.787  -15.340 1.00 134.70 ? 86   HIS A HE2    1 
ATOM   1417  N  N      . ARG A 1 90  ? 20.128  73.795  -19.277 1.00 106.29 ? 87   ARG A N      1 
ATOM   1418  C  CA     . ARG A 1 90  ? 21.350  74.351  -19.829 1.00 107.25 ? 87   ARG A CA     1 
ATOM   1419  C  C      . ARG A 1 90  ? 22.210  74.887  -18.687 1.00 100.10 ? 87   ARG A C      1 
ATOM   1420  O  O      . ARG A 1 90  ? 21.735  75.693  -17.890 1.00 103.36 ? 87   ARG A O      1 
ATOM   1421  C  CB     . ARG A 1 90  ? 21.014  75.460  -20.824 1.00 109.49 ? 87   ARG A CB     1 
ATOM   1422  C  CG     . ARG A 1 90  ? 20.271  74.954  -22.047 1.00 113.08 ? 87   ARG A CG     1 
ATOM   1423  C  CD     . ARG A 1 90  ? 19.937  76.055  -23.036 1.00 112.80 ? 87   ARG A CD     1 
ATOM   1424  N  NE     . ARG A 1 90  ? 19.279  75.497  -24.215 1.00 112.77 ? 87   ARG A NE     1 
ATOM   1425  C  CZ     . ARG A 1 90  ? 19.841  75.354  -25.414 1.00 114.58 ? 87   ARG A CZ     1 
ATOM   1426  N  NH1    . ARG A 1 90  ? 21.089  75.751  -25.640 1.00 100.46 ? 87   ARG A NH1    1 
ATOM   1427  N  NH2    . ARG A 1 90  ? 19.140  74.819  -26.404 1.00 113.02 ? 87   ARG A NH2    1 
ATOM   1428  H  H      . ARG A 1 90  ? 19.426  74.267  -19.427 1.00 127.55 ? 87   ARG A H      1 
ATOM   1429  H  HA     . ARG A 1 90  ? 21.846  73.657  -20.292 1.00 128.69 ? 87   ARG A HA     1 
ATOM   1430  H  HB2    . ARG A 1 90  ? 20.452  76.118  -20.384 1.00 131.39 ? 87   ARG A HB2    1 
ATOM   1431  H  HB3    . ARG A 1 90  ? 21.837  75.875  -21.124 1.00 131.39 ? 87   ARG A HB3    1 
ATOM   1432  H  HG2    . ARG A 1 90  ? 20.824  74.300  -22.503 1.00 135.70 ? 87   ARG A HG2    1 
ATOM   1433  H  HG3    . ARG A 1 90  ? 19.440  74.543  -21.763 1.00 135.70 ? 87   ARG A HG3    1 
ATOM   1434  H  HD2    . ARG A 1 90  ? 19.334  76.692  -22.620 1.00 135.37 ? 87   ARG A HD2    1 
ATOM   1435  H  HD3    . ARG A 1 90  ? 20.753  76.496  -23.319 1.00 135.37 ? 87   ARG A HD3    1 
ATOM   1436  H  HE     . ARG A 1 90  ? 18.463  75.240  -24.128 1.00 135.32 ? 87   ARG A HE     1 
ATOM   1437  H  HH11   . ARG A 1 90  ? 21.552  76.097  -25.003 1.00 120.55 ? 87   ARG A HH11   1 
ATOM   1438  H  HH12   . ARG A 1 90  ? 21.435  75.655  -26.421 1.00 120.55 ? 87   ARG A HH12   1 
ATOM   1439  H  HH21   . ARG A 1 90  ? 18.330  74.564  -26.268 1.00 135.62 ? 87   ARG A HH21   1 
ATOM   1440  H  HH22   . ARG A 1 90  ? 19.493  74.731  -27.183 1.00 135.62 ? 87   ARG A HH22   1 
ATOM   1441  N  N      . PRO A 1 91  ? 23.468  74.428  -18.585 1.00 92.30  ? 88   PRO A N      1 
ATOM   1442  C  CA     . PRO A 1 91  ? 24.364  74.946  -17.545 1.00 86.01  ? 88   PRO A CA     1 
ATOM   1443  C  C      . PRO A 1 91  ? 24.473  76.473  -17.510 1.00 105.27 ? 88   PRO A C      1 
ATOM   1444  O  O      . PRO A 1 91  ? 24.542  77.066  -16.432 1.00 87.43  ? 88   PRO A O      1 
ATOM   1445  C  CB     . PRO A 1 91  ? 25.713  74.329  -17.923 1.00 78.44  ? 88   PRO A CB     1 
ATOM   1446  C  CG     . PRO A 1 91  ? 25.358  73.047  -18.578 1.00 76.21  ? 88   PRO A CG     1 
ATOM   1447  C  CD     . PRO A 1 91  ? 24.079  73.306  -19.323 1.00 91.82  ? 88   PRO A CD     1 
ATOM   1448  H  HA     . PRO A 1 91  ? 24.094  74.621  -16.672 1.00 103.21 ? 88   PRO A HA     1 
ATOM   1449  H  HB2    . PRO A 1 91  ? 26.182  74.914  -18.539 1.00 94.13  ? 88   PRO A HB2    1 
ATOM   1450  H  HB3    . PRO A 1 91  ? 26.240  74.174  -17.123 1.00 94.13  ? 88   PRO A HB3    1 
ATOM   1451  H  HG2    . PRO A 1 91  ? 26.063  72.790  -19.192 1.00 91.45  ? 88   PRO A HG2    1 
ATOM   1452  H  HG3    . PRO A 1 91  ? 25.226  72.363  -17.903 1.00 91.45  ? 88   PRO A HG3    1 
ATOM   1453  H  HD2    . PRO A 1 91  ? 24.268  73.568  -20.238 1.00 110.18 ? 88   PRO A HD2    1 
ATOM   1454  H  HD3    . PRO A 1 91  ? 23.503  72.526  -19.288 1.00 110.18 ? 88   PRO A HD3    1 
ATOM   1455  N  N      . ASN A 1 92  ? 24.491  77.089  -18.690 1.00 112.57 ? 89   ASN A N      1 
ATOM   1456  C  CA     . ASN A 1 92  ? 24.525  78.545  -18.825 1.00 89.01  ? 89   ASN A CA     1 
ATOM   1457  C  C      . ASN A 1 92  ? 23.434  79.286  -18.073 1.00 101.95 ? 89   ASN A C      1 
ATOM   1458  O  O      . ASN A 1 92  ? 23.636  80.413  -17.621 1.00 105.58 ? 89   ASN A O      1 
ATOM   1459  C  CB     . ASN A 1 92  ? 24.435  78.935  -20.301 1.00 69.45  ? 89   ASN A CB     1 
ATOM   1460  C  CG     . ASN A 1 92  ? 25.778  78.901  -21.002 1.00 90.12  ? 89   ASN A CG     1 
ATOM   1461  O  OD1    . ASN A 1 92  ? 26.826  79.078  -20.381 1.00 102.97 ? 89   ASN A OD1    1 
ATOM   1462  N  ND2    . ASN A 1 92  ? 25.752  78.684  -22.309 1.00 89.25  ? 89   ASN A ND2    1 
ATOM   1463  H  H      . ASN A 1 92  ? 24.484  76.676  -19.444 1.00 135.08 ? 89   ASN A H      1 
ATOM   1464  H  HA     . ASN A 1 92  ? 25.377  78.864  -18.490 1.00 106.82 ? 89   ASN A HA     1 
ATOM   1465  H  HB2    . ASN A 1 92  ? 23.844  78.314  -20.756 1.00 83.34  ? 89   ASN A HB2    1 
ATOM   1466  H  HB3    . ASN A 1 92  ? 24.084  79.837  -20.368 1.00 83.34  ? 89   ASN A HB3    1 
ATOM   1467  H  HD21   . ASN A 1 92  ? 25.000  78.572  -22.711 1.00 107.10 ? 89   ASN A HD21   1 
ATOM   1468  H  HD22   . ASN A 1 92  ? 26.487  78.655  -22.755 1.00 107.10 ? 89   ASN A HD22   1 
ATOM   1469  N  N      . GLN A 1 93  ? 22.286  78.638  -17.929 1.00 105.59 ? 90   GLN A N      1 
ATOM   1470  C  CA     . GLN A 1 93  ? 21.117  79.276  -17.350 1.00 109.99 ? 90   GLN A CA     1 
ATOM   1471  C  C      . GLN A 1 93  ? 20.815  78.700  -15.973 1.00 109.33 ? 90   GLN A C      1 
ATOM   1472  O  O      . GLN A 1 93  ? 19.673  78.733  -15.519 1.00 115.75 ? 90   GLN A O      1 
ATOM   1473  C  CB     . GLN A 1 93  ? 19.927  79.062  -18.288 1.00 101.65 ? 90   GLN A CB     1 
ATOM   1474  C  CG     . GLN A 1 93  ? 20.251  79.387  -19.748 1.00 119.48 ? 90   GLN A CG     1 
ATOM   1475  C  CD     . GLN A 1 93  ? 19.020  79.512  -20.623 1.00 135.17 ? 90   GLN A CD     1 
ATOM   1476  O  OE1    . GLN A 1 93  ? 18.022  78.824  -20.413 1.00 147.42 ? 90   GLN A OE1    1 
ATOM   1477  N  NE2    . GLN A 1 93  ? 19.106  80.354  -21.647 1.00 127.40 ? 90   GLN A NE2    1 
ATOM   1478  H  H      . GLN A 1 93  ? 22.158  77.820  -18.161 1.00 126.71 ? 90   GLN A H      1 
ATOM   1479  H  HA     . GLN A 1 93  ? 21.275  80.229  -17.261 1.00 131.98 ? 90   GLN A HA     1 
ATOM   1480  H  HB2    . GLN A 1 93  ? 19.652  78.133  -18.242 1.00 121.98 ? 90   GLN A HB2    1 
ATOM   1481  H  HB3    . GLN A 1 93  ? 19.198  79.637  -18.009 1.00 121.98 ? 90   GLN A HB3    1 
ATOM   1482  H  HG2    . GLN A 1 93  ? 20.729  80.230  -19.783 1.00 143.38 ? 90   GLN A HG2    1 
ATOM   1483  H  HG3    . GLN A 1 93  ? 20.805  78.678  -20.111 1.00 143.38 ? 90   GLN A HG3    1 
ATOM   1484  H  HE21   . GLN A 1 93  ? 19.833  80.793  -21.783 1.00 152.88 ? 90   GLN A HE21   1 
ATOM   1485  H  HE22   . GLN A 1 93  ? 18.434  80.460  -22.173 1.00 152.88 ? 90   GLN A HE22   1 
ATOM   1486  N  N      . HIS A 1 94  ? 21.848  78.187  -15.307 1.00 101.68 ? 91   HIS A N      1 
ATOM   1487  C  CA     . HIS A 1 94  ? 21.676  77.554  -14.003 1.00 92.87  ? 91   HIS A CA     1 
ATOM   1488  C  C      . HIS A 1 94  ? 21.220  78.554  -12.947 1.00 96.84  ? 91   HIS A C      1 
ATOM   1489  O  O      . HIS A 1 94  ? 20.556  78.177  -11.982 1.00 105.34 ? 91   HIS A O      1 
ATOM   1490  C  CB     . HIS A 1 94  ? 22.969  76.857  -13.563 1.00 83.00  ? 91   HIS A CB     1 
ATOM   1491  C  CG     . HIS A 1 94  ? 24.013  77.783  -13.021 1.00 74.96  ? 91   HIS A CG     1 
ATOM   1492  N  ND1    . HIS A 1 94  ? 24.092  78.109  -11.684 1.00 86.02  ? 91   HIS A ND1    1 
ATOM   1493  C  CD2    . HIS A 1 94  ? 25.036  78.431  -13.627 1.00 74.82  ? 91   HIS A CD2    1 
ATOM   1494  C  CE1    . HIS A 1 94  ? 25.111  78.927  -11.491 1.00 83.06  ? 91   HIS A CE1    1 
ATOM   1495  N  NE2    . HIS A 1 94  ? 25.701  79.138  -12.654 1.00 76.52  ? 91   HIS A NE2    1 
ATOM   1496  H  H      . HIS A 1 94  ? 22.660  78.193  -15.590 1.00 122.01 ? 91   HIS A H      1 
ATOM   1497  H  HA     . HIS A 1 94  ? 20.988  76.874  -14.078 1.00 111.45 ? 91   HIS A HA     1 
ATOM   1498  H  HB2    . HIS A 1 94  ? 22.756  76.214  -12.870 1.00 99.60  ? 91   HIS A HB2    1 
ATOM   1499  H  HB3    . HIS A 1 94  ? 23.351  76.399  -14.329 1.00 99.60  ? 91   HIS A HB3    1 
ATOM   1500  H  HD1    . HIS A 1 94  ? 23.558  77.827  -11.071 1.00 103.22 ? 91   HIS A HD1    1 
ATOM   1501  H  HD2    . HIS A 1 94  ? 25.246  78.406  -14.532 1.00 89.78  ? 91   HIS A HD2    1 
ATOM   1502  H  HE1    . HIS A 1 94  ? 25.369  79.292  -10.676 1.00 99.67  ? 91   HIS A HE1    1 
ATOM   1503  H  HE2    . HIS A 1 94  ? 26.388  79.639  -12.782 1.00 91.83  ? 91   HIS A HE2    1 
ATOM   1504  N  N      . ASN A 1 95  ? 21.580  79.824  -13.122 1.00 100.06 ? 92   ASN A N      1 
ATOM   1505  C  CA     . ASN A 1 95  ? 21.160  80.868  -12.190 1.00 98.90  ? 92   ASN A CA     1 
ATOM   1506  C  C      . ASN A 1 95  ? 19.641  80.996  -12.196 1.00 102.02 ? 92   ASN A C      1 
ATOM   1507  O  O      . ASN A 1 95  ? 19.028  81.364  -11.194 1.00 96.89  ? 92   ASN A O      1 
ATOM   1508  C  CB     . ASN A 1 95  ? 21.795  82.217  -12.535 1.00 90.44  ? 92   ASN A CB     1 
ATOM   1509  C  CG     . ASN A 1 95  ? 23.307  82.200  -12.424 1.00 103.98 ? 92   ASN A CG     1 
ATOM   1510  O  OD1    . ASN A 1 95  ? 23.860  82.200  -11.323 1.00 110.83 ? 92   ASN A OD1    1 
ATOM   1511  N  ND2    . ASN A 1 95  ? 23.985  82.220  -13.568 1.00 89.75  ? 92   ASN A ND2    1 
ATOM   1512  H  H      . ASN A 1 95  ? 22.067  80.106  -13.772 1.00 120.07 ? 92   ASN A H      1 
ATOM   1513  H  HA     . ASN A 1 95  ? 21.438  80.624  -11.293 1.00 118.68 ? 92   ASN A HA     1 
ATOM   1514  H  HB2    . ASN A 1 95  ? 21.564  82.451  -13.447 1.00 108.53 ? 92   ASN A HB2    1 
ATOM   1515  H  HB3    . ASN A 1 95  ? 21.457  82.891  -11.924 1.00 108.53 ? 92   ASN A HB3    1 
ATOM   1516  H  HD21   . ASN A 1 95  ? 23.564  82.242  -14.318 1.00 107.70 ? 92   ASN A HD21   1 
ATOM   1517  H  HD22   . ASN A 1 95  ? 24.845  82.212  -13.558 1.00 107.70 ? 92   ASN A HD22   1 
ATOM   1518  N  N      . THR A 1 96  ? 19.049  80.678  -13.343 1.00 103.96 ? 93   THR A N      1 
ATOM   1519  C  CA     . THR A 1 96  ? 17.616  80.824  -13.560 1.00 92.55  ? 93   THR A CA     1 
ATOM   1520  C  C      . THR A 1 96  ? 16.830  79.626  -13.038 1.00 105.00 ? 93   THR A C      1 
ATOM   1521  O  O      . THR A 1 96  ? 15.606  79.685  -12.920 1.00 109.93 ? 93   THR A O      1 
ATOM   1522  C  CB     . THR A 1 96  ? 17.294  80.994  -15.059 1.00 85.75  ? 93   THR A CB     1 
ATOM   1523  O  OG1    . THR A 1 96  ? 17.230  79.706  -15.686 1.00 96.86  ? 93   THR A OG1    1 
ATOM   1524  C  CG2    . THR A 1 96  ? 18.347  81.850  -15.760 1.00 91.03  ? 93   THR A CG2    1 
ATOM   1525  H  H      . THR A 1 96  ? 19.468  80.368  -14.027 1.00 124.75 ? 93   THR A H      1 
ATOM   1526  H  HA     . THR A 1 96  ? 17.304  81.615  -13.094 1.00 111.06 ? 93   THR A HA     1 
ATOM   1527  H  HB     . THR A 1 96  ? 16.435  81.435  -15.152 1.00 102.90 ? 93   THR A HB     1 
ATOM   1528  H  HG1    . THR A 1 96  ? 17.967  79.310  -15.605 1.00 116.23 ? 93   THR A HG1    1 
ATOM   1529  H  HG21   . THR A 1 96  ? 19.219  81.432  -15.682 1.00 109.24 ? 93   THR A HG21   1 
ATOM   1530  H  HG22   . THR A 1 96  ? 18.126  81.943  -16.700 1.00 109.24 ? 93   THR A HG22   1 
ATOM   1531  H  HG23   . THR A 1 96  ? 18.382  82.730  -15.355 1.00 109.24 ? 93   THR A HG23   1 
ATOM   1532  N  N      . VAL A 1 97  ? 17.540  78.547  -12.720 1.00 103.16 ? 94   VAL A N      1 
ATOM   1533  C  CA     . VAL A 1 97  ? 16.909  77.303  -12.287 1.00 83.10  ? 94   VAL A CA     1 
ATOM   1534  C  C      . VAL A 1 97  ? 16.757  77.285  -10.771 1.00 85.05  ? 94   VAL A C      1 
ATOM   1535  O  O      . VAL A 1 97  ? 17.673  77.663  -10.039 1.00 84.18  ? 94   VAL A O      1 
ATOM   1536  C  CB     . VAL A 1 97  ? 17.717  76.070  -12.728 1.00 75.50  ? 94   VAL A CB     1 
ATOM   1537  C  CG1    . VAL A 1 97  ? 16.940  74.797  -12.422 1.00 81.37  ? 94   VAL A CG1    1 
ATOM   1538  C  CG2    . VAL A 1 97  ? 18.028  76.135  -14.210 1.00 68.77  ? 94   VAL A CG2    1 
ATOM   1539  H  H      . VAL A 1 97  ? 18.398  78.509  -12.747 1.00 123.79 ? 94   VAL A H      1 
ATOM   1540  H  HA     . VAL A 1 97  ? 16.025  77.241  -12.681 1.00 99.72  ? 94   VAL A HA     1 
ATOM   1541  H  HB     . VAL A 1 97  ? 18.554  76.042  -12.239 1.00 90.60  ? 94   VAL A HB     1 
ATOM   1542  H  HG11   . VAL A 1 97  ? 16.098  74.818  -12.903 1.00 97.65  ? 94   VAL A HG11   1 
ATOM   1543  H  HG12   . VAL A 1 97  ? 17.465  74.032  -12.707 1.00 97.65  ? 94   VAL A HG12   1 
ATOM   1544  H  HG13   . VAL A 1 97  ? 16.776  74.749  -11.468 1.00 97.65  ? 94   VAL A HG13   1 
ATOM   1545  H  HG21   . VAL A 1 97  ? 18.547  76.935  -14.388 1.00 82.53  ? 94   VAL A HG21   1 
ATOM   1546  H  HG22   . VAL A 1 97  ? 18.536  75.348  -14.460 1.00 82.53  ? 94   VAL A HG22   1 
ATOM   1547  H  HG23   . VAL A 1 97  ? 17.195  76.164  -14.706 1.00 82.53  ? 94   VAL A HG23   1 
ATOM   1548  N  N      . LYS A 1 98  ? 15.592  76.848  -10.307 1.00 85.82  ? 95   LYS A N      1 
ATOM   1549  C  CA     . LYS A 1 98  ? 15.311  76.799  -8.878  1.00 94.92  ? 95   LYS A CA     1 
ATOM   1550  C  C      . LYS A 1 98  ? 16.149  75.747  -8.175  1.00 102.92 ? 95   LYS A C      1 
ATOM   1551  O  O      . LYS A 1 98  ? 16.456  74.696  -8.737  1.00 101.49 ? 95   LYS A O      1 
ATOM   1552  C  CB     . LYS A 1 98  ? 13.832  76.505  -8.627  1.00 89.89  ? 95   LYS A CB     1 
ATOM   1553  C  CG     . LYS A 1 98  ? 12.926  77.704  -8.784  1.00 119.43 ? 95   LYS A CG     1 
ATOM   1554  C  CD     . LYS A 1 98  ? 11.499  77.370  -8.389  1.00 131.63 ? 95   LYS A CD     1 
ATOM   1555  C  CE     . LYS A 1 98  ? 10.647  78.621  -8.313  1.00 152.09 ? 95   LYS A CE     1 
ATOM   1556  N  NZ     . LYS A 1 98  ? 9.219   78.312  -8.033  1.00 159.68 ? 95   LYS A NZ     1 
ATOM   1557  H  H      . LYS A 1 98  ? 14.944  76.572  -10.801 1.00 102.98 ? 95   LYS A H      1 
ATOM   1558  H  HA     . LYS A 1 98  ? 15.518  77.661  -8.485  1.00 113.90 ? 95   LYS A HA     1 
ATOM   1559  H  HB2    . LYS A 1 98  ? 13.538  75.829  -9.258  1.00 107.87 ? 95   LYS A HB2    1 
ATOM   1560  H  HB3    . LYS A 1 98  ? 13.730  76.174  -7.721  1.00 107.87 ? 95   LYS A HB3    1 
ATOM   1561  H  HG2    . LYS A 1 98  ? 13.241  78.421  -8.211  1.00 143.32 ? 95   LYS A HG2    1 
ATOM   1562  H  HG3    . LYS A 1 98  ? 12.927  77.989  -9.711  1.00 143.32 ? 95   LYS A HG3    1 
ATOM   1563  H  HD2    . LYS A 1 98  ? 11.113  76.777  -9.052  1.00 157.95 ? 95   LYS A HD2    1 
ATOM   1564  H  HD3    . LYS A 1 98  ? 11.498  76.946  -7.516  1.00 157.95 ? 95   LYS A HD3    1 
ATOM   1565  H  HE2    . LYS A 1 98  ? 10.979  79.189  -7.600  1.00 182.51 ? 95   LYS A HE2    1 
ATOM   1566  H  HE3    . LYS A 1 98  ? 10.694  79.089  -9.161  1.00 182.51 ? 95   LYS A HE3    1 
ATOM   1567  H  HZ1    . LYS A 1 98  ? 9.147   77.886  -7.255  1.00 191.62 ? 95   LYS A HZ1    1 
ATOM   1568  H  HZ2    . LYS A 1 98  ? 8.746   79.066  -7.995  1.00 191.62 ? 95   LYS A HZ2    1 
ATOM   1569  H  HZ3    . LYS A 1 98  ? 8.887   77.795  -8.677  1.00 191.62 ? 95   LYS A HZ3    1 
ATOM   1570  N  N      . LEU A 1 99  ? 16.525  76.054  -6.939  1.00 97.06  ? 96   LEU A N      1 
ATOM   1571  C  CA     . LEU A 1 99  ? 17.307  75.139  -6.126  1.00 103.66 ? 96   LEU A CA     1 
ATOM   1572  C  C      . LEU A 1 99  ? 16.571  73.816  -5.947  1.00 100.87 ? 96   LEU A C      1 
ATOM   1573  O  O      . LEU A 1 99  ? 15.508  73.771  -5.329  1.00 103.67 ? 96   LEU A O      1 
ATOM   1574  C  CB     . LEU A 1 99  ? 17.596  75.769  -4.764  1.00 100.37 ? 96   LEU A CB     1 
ATOM   1575  C  CG     . LEU A 1 99  ? 18.644  75.069  -3.907  1.00 75.37  ? 96   LEU A CG     1 
ATOM   1576  C  CD1    . LEU A 1 99  ? 20.017  75.248  -4.527  1.00 89.09  ? 96   LEU A CD1    1 
ATOM   1577  C  CD2    . LEU A 1 99  ? 18.606  75.618  -2.495  1.00 80.37  ? 96   LEU A CD2    1 
ATOM   1578  H  H      . LEU A 1 99  ? 16.336  76.795  -6.546  1.00 116.48 ? 96   LEU A H      1 
ATOM   1579  H  HA     . LEU A 1 99  ? 18.153  74.961  -6.566  1.00 124.39 ? 96   LEU A HA     1 
ATOM   1580  H  HB2    . LEU A 1 99  ? 17.902  76.678  -4.907  1.00 120.44 ? 96   LEU A HB2    1 
ATOM   1581  H  HB3    . LEU A 1 99  ? 16.771  75.783  -4.255  1.00 120.44 ? 96   LEU A HB3    1 
ATOM   1582  H  HG     . LEU A 1 99  ? 18.448  74.119  -3.871  1.00 90.45  ? 96   LEU A HG     1 
ATOM   1583  H  HD11   . LEU A 1 99  ? 20.219  76.196  -4.578  1.00 106.91 ? 96   LEU A HD11   1 
ATOM   1584  H  HD12   . LEU A 1 99  ? 20.675  74.799  -3.973  1.00 106.91 ? 96   LEU A HD12   1 
ATOM   1585  H  HD13   . LEU A 1 99  ? 20.014  74.862  -5.417  1.00 106.91 ? 96   LEU A HD13   1 
ATOM   1586  H  HD21   . LEU A 1 99  ? 17.725  75.463  -2.120  1.00 96.44  ? 96   LEU A HD21   1 
ATOM   1587  H  HD22   . LEU A 1 99  ? 19.277  75.164  -1.962  1.00 96.44  ? 96   LEU A HD22   1 
ATOM   1588  H  HD23   . LEU A 1 99  ? 18.792  76.569  -2.521  1.00 96.44  ? 96   LEU A HD23   1 
ATOM   1589  N  N      . GLY A 1 100 ? 17.136  72.748  -6.502  1.00 94.49  ? 97   GLY A N      1 
ATOM   1590  C  CA     . GLY A 1 100 ? 16.567  71.417  -6.373  1.00 95.57  ? 97   GLY A CA     1 
ATOM   1591  C  C      . GLY A 1 100 ? 16.254  70.804  -7.726  1.00 107.78 ? 97   GLY A C      1 
ATOM   1592  O  O      . GLY A 1 100 ? 15.974  69.608  -7.824  1.00 107.22 ? 97   GLY A O      1 
ATOM   1593  H  H      . GLY A 1 100 ? 17.860  72.772  -6.965  1.00 113.39 ? 97   GLY A H      1 
ATOM   1594  H  HA2    . GLY A 1 100 ? 17.193  70.840  -5.910  1.00 114.68 ? 97   GLY A HA2    1 
ATOM   1595  H  HA3    . GLY A 1 100 ? 15.747  71.463  -5.857  1.00 114.68 ? 97   GLY A HA3    1 
ATOM   1596  N  N      . ALA A 1 101 ? 16.308  71.630  -8.768  1.00 93.94  ? 98   ALA A N      1 
ATOM   1597  C  CA     . ALA A 1 101 ? 15.945  71.212  -10.118 1.00 86.66  ? 98   ALA A CA     1 
ATOM   1598  C  C      . ALA A 1 101 ? 17.141  71.201  -11.064 1.00 92.96  ? 98   ALA A C      1 
ATOM   1599  O  O      . ALA A 1 101 ? 17.049  70.689  -12.178 1.00 92.89  ? 98   ALA A O      1 
ATOM   1600  C  CB     . ALA A 1 101 ? 14.858  72.120  -10.663 1.00 102.59 ? 98   ALA A CB     1 
ATOM   1601  H  H      . ALA A 1 101 ? 16.557  72.452  -8.717  1.00 112.73 ? 98   ALA A H      1 
ATOM   1602  H  HA     . ALA A 1 101 ? 15.588  70.311  -10.081 1.00 103.99 ? 98   ALA A HA     1 
ATOM   1603  H  HB1    . ALA A 1 101 ? 15.190  73.031  -10.684 1.00 123.11 ? 98   ALA A HB1    1 
ATOM   1604  H  HB2    . ALA A 1 101 ? 14.627  71.831  -11.560 1.00 123.11 ? 98   ALA A HB2    1 
ATOM   1605  H  HB3    . ALA A 1 101 ? 14.081  72.064  -10.086 1.00 123.11 ? 98   ALA A HB3    1 
ATOM   1606  N  N      . PHE A 1 102 ? 18.266  71.747  -10.612 1.00 90.16  ? 99   PHE A N      1 
ATOM   1607  C  CA     . PHE A 1 102 ? 19.490  71.740  -11.406 1.00 93.72  ? 99   PHE A CA     1 
ATOM   1608  C  C      . PHE A 1 102 ? 20.278  70.493  -11.062 1.00 94.23  ? 99   PHE A C      1 
ATOM   1609  O  O      . PHE A 1 102 ? 20.952  70.439  -10.034 1.00 99.13  ? 99   PHE A O      1 
ATOM   1610  C  CB     . PHE A 1 102 ? 20.321  72.998  -11.149 1.00 90.17  ? 99   PHE A CB     1 
ATOM   1611  C  CG     . PHE A 1 102 ? 21.464  73.166  -12.103 1.00 84.30  ? 99   PHE A CG     1 
ATOM   1612  C  CD1    . PHE A 1 102 ? 21.237  73.297  -13.461 1.00 74.89  ? 99   PHE A CD1    1 
ATOM   1613  C  CD2    . PHE A 1 102 ? 22.765  73.200  -11.642 1.00 83.34  ? 99   PHE A CD2    1 
ATOM   1614  C  CE1    . PHE A 1 102 ? 22.288  73.449  -14.341 1.00 77.92  ? 99   PHE A CE1    1 
ATOM   1615  C  CE2    . PHE A 1 102 ? 23.819  73.354  -12.516 1.00 77.52  ? 99   PHE A CE2    1 
ATOM   1616  C  CZ     . PHE A 1 102 ? 23.580  73.479  -13.868 1.00 64.81  ? 99   PHE A CZ     1 
ATOM   1617  H  H      . PHE A 1 102 ? 18.346  72.129  -9.846  1.00 108.20 ? 99   PHE A H      1 
ATOM   1618  H  HA     . PHE A 1 102 ? 19.264  71.709  -12.349 1.00 112.46 ? 99   PHE A HA     1 
ATOM   1619  H  HB2    . PHE A 1 102 ? 19.747  73.775  -11.233 1.00 108.21 ? 99   PHE A HB2    1 
ATOM   1620  H  HB3    . PHE A 1 102 ? 20.687  72.953  -10.252 1.00 108.21 ? 99   PHE A HB3    1 
ATOM   1621  H  HD1    . PHE A 1 102 ? 20.366  73.275  -13.785 1.00 89.86  ? 99   PHE A HD1    1 
ATOM   1622  H  HD2    . PHE A 1 102 ? 22.933  73.114  -10.731 1.00 100.01 ? 99   PHE A HD2    1 
ATOM   1623  H  HE1    . PHE A 1 102 ? 22.123  73.535  -15.253 1.00 93.51  ? 99   PHE A HE1    1 
ATOM   1624  H  HE2    . PHE A 1 102 ? 24.691  73.374  -12.194 1.00 93.03  ? 99   PHE A HE2    1 
ATOM   1625  H  HZ     . PHE A 1 102 ? 24.291  73.585  -14.459 1.00 77.77  ? 99   PHE A HZ     1 
ATOM   1626  N  N      . GLN A 1 103 ? 20.194  69.496  -11.939 1.00 91.08  ? 100  GLN A N      1 
ATOM   1627  C  CA     . GLN A 1 103 ? 20.731  68.177  -11.639 1.00 85.27  ? 100  GLN A CA     1 
ATOM   1628  C  C      . GLN A 1 103 ? 21.605  67.595  -12.745 1.00 74.97  ? 100  GLN A C      1 
ATOM   1629  O  O      . GLN A 1 103 ? 21.249  67.658  -13.918 1.00 74.46  ? 100  GLN A O      1 
ATOM   1630  C  CB     . GLN A 1 103 ? 19.547  67.244  -11.399 1.00 67.86  ? 100  GLN A CB     1 
ATOM   1631  C  CG     . GLN A 1 103 ? 18.730  67.616  -10.178 1.00 71.20  ? 100  GLN A CG     1 
ATOM   1632  C  CD     . GLN A 1 103 ? 17.505  66.751  -9.999  1.00 90.04  ? 100  GLN A CD     1 
ATOM   1633  O  OE1    . GLN A 1 103 ? 17.391  65.682  -10.598 1.00 103.05 ? 100  GLN A OE1    1 
ATOM   1634  N  NE2    . GLN A 1 103 ? 16.576  67.210  -9.167  1.00 97.15  ? 100  GLN A NE2    1 
ATOM   1635  H  H      . GLN A 1 103 ? 19.830  69.560  -12.716 1.00 109.29 ? 100  GLN A H      1 
ATOM   1636  H  HA     . GLN A 1 103 ? 21.257  68.221  -10.826 1.00 102.33 ? 100  GLN A HA     1 
ATOM   1637  H  HB2    . GLN A 1 103 ? 18.961  67.274  -12.171 1.00 81.43  ? 100  GLN A HB2    1 
ATOM   1638  H  HB3    . GLN A 1 103 ? 19.879  66.341  -11.272 1.00 81.43  ? 100  GLN A HB3    1 
ATOM   1639  H  HG2    . GLN A 1 103 ? 19.283  67.519  -9.387  1.00 85.44  ? 100  GLN A HG2    1 
ATOM   1640  H  HG3    . GLN A 1 103 ? 18.436  68.536  -10.265 1.00 85.44  ? 100  GLN A HG3    1 
ATOM   1641  H  HE21   . GLN A 1 103 ? 16.692  67.962  -8.765  1.00 116.58 ? 100  GLN A HE21   1 
ATOM   1642  H  HE22   . GLN A 1 103 ? 15.859  66.756  -9.029  1.00 116.58 ? 100  GLN A HE22   1 
ATOM   1643  N  N      . ALA A 1 104 ? 22.752  67.033  -12.365 1.00 76.80  ? 101  ALA A N      1 
ATOM   1644  C  CA     . ALA A 1 104 ? 23.575  66.265  -13.297 1.00 71.39  ? 101  ALA A CA     1 
ATOM   1645  C  C      . ALA A 1 104 ? 22.911  64.911  -13.527 1.00 66.01  ? 101  ALA A C      1 
ATOM   1646  O  O      . ALA A 1 104 ? 22.692  64.163  -12.572 1.00 65.42  ? 101  ALA A O      1 
ATOM   1647  C  CB     . ALA A 1 104 ? 24.984  66.094  -12.768 1.00 62.79  ? 101  ALA A CB     1 
ATOM   1648  H  H      . ALA A 1 104 ? 23.077  67.082  -11.570 1.00 92.16  ? 101  ALA A H      1 
ATOM   1649  H  HA     . ALA A 1 104 ? 23.621  66.732  -14.146 1.00 85.67  ? 101  ALA A HA     1 
ATOM   1650  H  HB1    . ALA A 1 104 ? 24.948  65.625  -11.920 1.00 75.35  ? 101  ALA A HB1    1 
ATOM   1651  H  HB2    . ALA A 1 104 ? 25.501  65.582  -13.409 1.00 75.35  ? 101  ALA A HB2    1 
ATOM   1652  H  HB3    . ALA A 1 104 ? 25.383  66.970  -12.644 1.00 75.35  ? 101  ALA A HB3    1 
ATOM   1653  N  N      . GLN A 1 105 ? 22.607  64.589  -14.780 1.00 50.11  ? 102  GLN A N      1 
ATOM   1654  C  CA     . GLN A 1 105 ? 21.742  63.451  -15.077 1.00 63.49  ? 102  GLN A CA     1 
ATOM   1655  C  C      . GLN A 1 105 ? 22.447  62.304  -15.788 1.00 55.94  ? 102  GLN A C      1 
ATOM   1656  O  O      . GLN A 1 105 ? 22.169  61.137  -15.515 1.00 55.51  ? 102  GLN A O      1 
ATOM   1657  C  CB     . GLN A 1 105 ? 20.547  63.915  -15.908 1.00 75.88  ? 102  GLN A CB     1 
ATOM   1658  C  CG     . GLN A 1 105 ? 19.547  64.713  -15.091 1.00 85.43  ? 102  GLN A CG     1 
ATOM   1659  C  CD     . GLN A 1 105 ? 18.320  65.110  -15.878 1.00 93.97  ? 102  GLN A CD     1 
ATOM   1660  O  OE1    . GLN A 1 105 ? 18.301  65.036  -17.107 1.00 102.10 ? 102  GLN A OE1    1 
ATOM   1661  N  NE2    . GLN A 1 105 ? 17.279  65.533  -15.169 1.00 96.99  ? 102  GLN A NE2    1 
ATOM   1662  H  H      . GLN A 1 105 ? 22.887  65.012  -15.474 1.00 60.14  ? 102  GLN A H      1 
ATOM   1663  H  HA     . GLN A 1 105 ? 21.396  63.103  -14.240 1.00 76.18  ? 102  GLN A HA     1 
ATOM   1664  H  HB2    . GLN A 1 105 ? 20.863  64.480  -16.630 1.00 91.05  ? 102  GLN A HB2    1 
ATOM   1665  H  HB3    . GLN A 1 105 ? 20.090  63.139  -16.267 1.00 91.05  ? 102  GLN A HB3    1 
ATOM   1666  H  HG2    . GLN A 1 105 ? 19.257  64.177  -14.336 1.00 102.52 ? 102  GLN A HG2    1 
ATOM   1667  H  HG3    . GLN A 1 105 ? 19.974  65.525  -14.775 1.00 102.52 ? 102  GLN A HG3    1 
ATOM   1668  H  HE21   . GLN A 1 105 ? 17.330  65.568  -14.311 1.00 116.39 ? 102  GLN A HE21   1 
ATOM   1669  H  HE22   . GLN A 1 105 ? 16.556  65.771  -15.567 1.00 116.39 ? 102  GLN A HE22   1 
ATOM   1670  N  N      . GLU A 1 106 ? 23.353  62.637  -16.700 1.00 44.45  ? 103  GLU A N      1 
ATOM   1671  C  CA     . GLU A 1 106 ? 24.087  61.618  -17.431 1.00 40.43  ? 103  GLU A CA     1 
ATOM   1672  C  C      . GLU A 1 106 ? 25.525  62.045  -17.670 1.00 49.17  ? 103  GLU A C      1 
ATOM   1673  O  O      . GLU A 1 106 ? 25.803  63.227  -17.860 1.00 62.80  ? 103  GLU A O      1 
ATOM   1674  C  CB     . GLU A 1 106 ? 23.380  61.350  -18.756 1.00 61.79  ? 103  GLU A CB     1 
ATOM   1675  C  CG     . GLU A 1 106 ? 22.079  60.583  -18.586 1.00 64.30  ? 103  GLU A CG     1 
ATOM   1676  C  CD     . GLU A 1 106 ? 21.515  60.072  -19.894 1.00 72.61  ? 103  GLU A CD     1 
ATOM   1677  O  OE1    . GLU A 1 106 ? 22.285  59.905  -20.865 1.00 65.41  ? 103  GLU A OE1    1 
ATOM   1678  O  OE2    . GLU A 1 106 ? 20.287  59.852  -19.952 1.00 84.78  ? 103  GLU A OE2    1 
ATOM   1679  H  H      . GLU A 1 106 ? 23.559  63.444  -16.912 1.00 53.34  ? 103  GLU A H      1 
ATOM   1680  H  HA     . GLU A 1 106 ? 24.094  60.796  -16.917 1.00 48.52  ? 103  GLU A HA     1 
ATOM   1681  H  HB2    . GLU A 1 106 ? 23.175  62.198  -19.181 1.00 74.15  ? 103  GLU A HB2    1 
ATOM   1682  H  HB3    . GLU A 1 106 ? 23.964  60.826  -19.326 1.00 74.15  ? 103  GLU A HB3    1 
ATOM   1683  H  HG2    . GLU A 1 106 ? 22.238  59.819  -18.010 1.00 77.16  ? 103  GLU A HG2    1 
ATOM   1684  H  HG3    . GLU A 1 106 ? 21.419  61.169  -18.184 1.00 77.16  ? 103  GLU A HG3    1 
ATOM   1685  N  N      . LYS A 1 107 ? 26.435  61.078  -17.664 1.00 43.88  ? 104  LYS A N      1 
ATOM   1686  C  CA     . LYS A 1 107 ? 27.832  61.325  -18.011 1.00 47.93  ? 104  LYS A CA     1 
ATOM   1687  C  C      . LYS A 1 107 ? 28.543  60.007  -18.258 1.00 52.88  ? 104  LYS A C      1 
ATOM   1688  O  O      . LYS A 1 107 ? 28.187  58.985  -17.674 1.00 57.39  ? 104  LYS A O      1 
ATOM   1689  C  CB     . LYS A 1 107 ? 28.542  62.126  -16.919 1.00 53.86  ? 104  LYS A CB     1 
ATOM   1690  C  CG     . LYS A 1 107 ? 29.924  62.648  -17.323 1.00 59.39  ? 104  LYS A CG     1 
ATOM   1691  C  CD     . LYS A 1 107 ? 30.607  63.342  -16.151 1.00 61.26  ? 104  LYS A CD     1 
ATOM   1692  C  CE     . LYS A 1 107 ? 31.635  62.480  -15.431 1.00 45.60  ? 104  LYS A CE     1 
ATOM   1693  N  NZ     . LYS A 1 107 ? 33.012  62.759  -15.927 1.00 45.95  ? 104  LYS A NZ     1 
ATOM   1694  H  H      . LYS A 1 107 ? 26.268  60.260  -17.460 1.00 52.66  ? 104  LYS A H      1 
ATOM   1695  H  HA     . LYS A 1 107 ? 27.867  61.842  -18.831 1.00 57.52  ? 104  LYS A HA     1 
ATOM   1696  H  HB2    . LYS A 1 107 ? 27.992  62.891  -16.687 1.00 64.64  ? 104  LYS A HB2    1 
ATOM   1697  H  HB3    . LYS A 1 107 ? 28.657  61.558  -16.141 1.00 64.64  ? 104  LYS A HB3    1 
ATOM   1698  H  HG2    . LYS A 1 107 ? 30.480  61.905  -17.605 1.00 71.27  ? 104  LYS A HG2    1 
ATOM   1699  H  HG3    . LYS A 1 107 ? 29.827  63.290  -18.044 1.00 71.27  ? 104  LYS A HG3    1 
ATOM   1700  H  HD2    . LYS A 1 107 ? 31.062  64.133  -16.480 1.00 73.51  ? 104  LYS A HD2    1 
ATOM   1701  H  HD3    . LYS A 1 107 ? 29.931  63.599  -15.504 1.00 73.51  ? 104  LYS A HD3    1 
ATOM   1702  H  HE2    . LYS A 1 107 ? 31.607  62.674  -14.481 1.00 54.73  ? 104  LYS A HE2    1 
ATOM   1703  H  HE3    . LYS A 1 107 ? 31.437  61.544  -15.590 1.00 54.73  ? 104  LYS A HE3    1 
ATOM   1704  H  HZ1    . LYS A 1 107 ? 33.217  63.614  -15.789 1.00 55.14  ? 104  LYS A HZ1    1 
ATOM   1705  H  HZ2    . LYS A 1 107 ? 33.599  62.248  -15.496 1.00 55.14  ? 104  LYS A HZ2    1 
ATOM   1706  H  HZ3    . LYS A 1 107 ? 33.062  62.586  -16.798 1.00 55.14  ? 104  LYS A HZ3    1 
ATOM   1707  N  N      . GLU A 1 108 ? 29.545  60.035  -19.129 1.00 48.32  ? 105  GLU A N      1 
ATOM   1708  C  CA     . GLU A 1 108 ? 30.348  58.851  -19.402 1.00 41.48  ? 105  GLU A CA     1 
ATOM   1709  C  C      . GLU A 1 108 ? 30.933  58.361  -18.086 1.00 57.64  ? 105  GLU A C      1 
ATOM   1710  O  O      . GLU A 1 108 ? 31.151  59.151  -17.168 1.00 60.62  ? 105  GLU A O      1 
ATOM   1711  C  CB     . GLU A 1 108 ? 31.480  59.165  -20.381 1.00 47.99  ? 105  GLU A CB     1 
ATOM   1712  C  CG     . GLU A 1 108 ? 31.039  59.658  -21.755 1.00 45.40  ? 105  GLU A CG     1 
ATOM   1713  C  CD     . GLU A 1 108 ? 30.659  61.124  -21.754 1.00 47.19  ? 105  GLU A CD     1 
ATOM   1714  O  OE1    . GLU A 1 108 ? 30.692  61.751  -20.673 1.00 48.28  ? 105  GLU A OE1    1 
ATOM   1715  O  OE2    . GLU A 1 108 ? 30.329  61.653  -22.835 1.00 69.92  ? 105  GLU A OE2    1 
ATOM   1716  H  H      . GLU A 1 108 ? 29.782  60.730  -19.577 1.00 57.99  ? 105  GLU A H      1 
ATOM   1717  H  HA     . GLU A 1 108 ? 29.790  58.152  -19.778 1.00 49.78  ? 105  GLU A HA     1 
ATOM   1718  H  HB2    . GLU A 1 108 ? 32.041  59.853  -19.991 1.00 57.59  ? 105  GLU A HB2    1 
ATOM   1719  H  HB3    . GLU A 1 108 ? 32.002  58.359  -20.515 1.00 57.59  ? 105  GLU A HB3    1 
ATOM   1720  H  HG2    . GLU A 1 108 ? 31.768  59.537  -22.383 1.00 54.48  ? 105  GLU A HG2    1 
ATOM   1721  H  HG3    . GLU A 1 108 ? 30.265  59.147  -22.041 1.00 54.48  ? 105  GLU A HG3    1 
ATOM   1722  N  N      . LEU A 1 109 ? 31.192  57.060  -17.996 1.00 61.23  ? 106  LEU A N      1 
ATOM   1723  C  CA     . LEU A 1 109 ? 31.848  56.488  -16.827 1.00 45.98  ? 106  LEU A CA     1 
ATOM   1724  C  C      . LEU A 1 109 ? 33.341  56.719  -17.003 1.00 42.82  ? 106  LEU A C      1 
ATOM   1725  O  O      . LEU A 1 109 ? 33.912  56.309  -18.010 1.00 46.29  ? 106  LEU A O      1 
ATOM   1726  C  CB     . LEU A 1 109 ? 31.524  54.999  -16.695 1.00 36.71  ? 106  LEU A CB     1 
ATOM   1727  C  CG     . LEU A 1 109 ? 32.304  54.167  -15.680 1.00 40.16  ? 106  LEU A CG     1 
ATOM   1728  C  CD1    . LEU A 1 109 ? 31.982  54.649  -14.276 1.00 46.87  ? 106  LEU A CD1    1 
ATOM   1729  C  CD2    . LEU A 1 109 ? 31.994  52.685  -15.828 1.00 33.32  ? 106  LEU A CD2    1 
ATOM   1730  H  H      . LEU A 1 109 ? 30.996  56.484  -18.604 1.00 73.48  ? 106  LEU A H      1 
ATOM   1731  H  HA     . LEU A 1 109 ? 31.551  56.947  -16.025 1.00 55.18  ? 106  LEU A HA     1 
ATOM   1732  H  HB2    . LEU A 1 109 ? 30.586  54.920  -16.460 1.00 44.05  ? 106  LEU A HB2    1 
ATOM   1733  H  HB3    . LEU A 1 109 ? 31.666  54.588  -17.562 1.00 44.05  ? 106  LEU A HB3    1 
ATOM   1734  H  HG     . LEU A 1 109 ? 33.254  54.293  -15.830 1.00 48.19  ? 106  LEU A HG     1 
ATOM   1735  H  HD11   . LEU A 1 109 ? 31.030  54.548  -14.119 1.00 56.25  ? 106  LEU A HD11   1 
ATOM   1736  H  HD12   . LEU A 1 109 ? 32.481  54.116  -13.638 1.00 56.25  ? 106  LEU A HD12   1 
ATOM   1737  H  HD13   . LEU A 1 109 ? 32.233  55.583  -14.198 1.00 56.25  ? 106  LEU A HD13   1 
ATOM   1738  H  HD21   . LEU A 1 109 ? 32.239  52.400  -16.722 1.00 39.98  ? 106  LEU A HD21   1 
ATOM   1739  H  HD22   . LEU A 1 109 ? 32.505  52.189  -15.170 1.00 39.98  ? 106  LEU A HD22   1 
ATOM   1740  H  HD23   . LEU A 1 109 ? 31.045  52.546  -15.684 1.00 39.98  ? 106  LEU A HD23   1 
ATOM   1741  N  N      . VAL A 1 110 ? 33.977  57.358  -16.024 1.00 38.30  ? 107  VAL A N      1 
ATOM   1742  C  CA     . VAL A 1 110 ? 35.349  57.823  -16.212 1.00 41.47  ? 107  VAL A CA     1 
ATOM   1743  C  C      . VAL A 1 110 ? 36.309  57.275  -15.173 1.00 44.94  ? 107  VAL A C      1 
ATOM   1744  O  O      . VAL A 1 110 ? 35.963  57.109  -14.005 1.00 42.99  ? 107  VAL A O      1 
ATOM   1745  C  CB     . VAL A 1 110 ? 35.435  59.362  -16.169 1.00 37.64  ? 107  VAL A CB     1 
ATOM   1746  C  CG1    . VAL A 1 110 ? 34.680  59.963  -17.337 1.00 50.24  ? 107  VAL A CG1    1 
ATOM   1747  C  CG2    . VAL A 1 110 ? 34.911  59.905  -14.838 1.00 49.38  ? 107  VAL A CG2    1 
ATOM   1748  H  H      . VAL A 1 110 ? 33.643  57.532  -15.251 1.00 45.96  ? 107  VAL A H      1 
ATOM   1749  H  HA     . VAL A 1 110 ? 35.659  57.533  -17.084 1.00 49.77  ? 107  VAL A HA     1 
ATOM   1750  H  HB     . VAL A 1 110 ? 36.365  59.625  -16.250 1.00 45.17  ? 107  VAL A HB     1 
ATOM   1751  H  HG11   . VAL A 1 110 ? 33.750  59.692  -17.285 1.00 60.29  ? 107  VAL A HG11   1 
ATOM   1752  H  HG12   . VAL A 1 110 ? 34.746  60.930  -17.291 1.00 60.29  ? 107  VAL A HG12   1 
ATOM   1753  H  HG13   . VAL A 1 110 ? 35.072  59.643  -18.165 1.00 60.29  ? 107  VAL A HG13   1 
ATOM   1754  H  HG21   . VAL A 1 110 ? 35.445  59.540  -14.116 1.00 59.26  ? 107  VAL A HG21   1 
ATOM   1755  H  HG22   . VAL A 1 110 ? 34.978  60.873  -14.844 1.00 59.26  ? 107  VAL A HG22   1 
ATOM   1756  H  HG23   . VAL A 1 110 ? 33.984  59.638  -14.731 1.00 59.26  ? 107  VAL A HG23   1 
ATOM   1757  N  N      . PHE A 1 111 ? 37.523  56.989  -15.633 1.00 30.46  ? 108  PHE A N      1 
ATOM   1758  C  CA     . PHE A 1 111 ? 38.589  56.537  -14.768 1.00 25.87  ? 108  PHE A CA     1 
ATOM   1759  C  C      . PHE A 1 111 ? 39.825  57.392  -14.943 1.00 36.26  ? 108  PHE A C      1 
ATOM   1760  O  O      . PHE A 1 111 ? 40.224  57.695  -16.065 1.00 26.29  ? 108  PHE A O      1 
ATOM   1761  C  CB     . PHE A 1 111 ? 38.933  55.077  -15.059 1.00 23.34  ? 108  PHE A CB     1 
ATOM   1762  C  CG     . PHE A 1 111 ? 37.792  54.133  -14.833 1.00 28.27  ? 108  PHE A CG     1 
ATOM   1763  C  CD1    . PHE A 1 111 ? 37.526  53.641  -13.570 1.00 26.32  ? 108  PHE A CD1    1 
ATOM   1764  C  CD2    . PHE A 1 111 ? 37.003  53.712  -15.887 1.00 34.05  ? 108  PHE A CD2    1 
ATOM   1765  C  CE1    . PHE A 1 111 ? 36.481  52.768  -13.355 1.00 25.33  ? 108  PHE A CE1    1 
ATOM   1766  C  CE2    . PHE A 1 111 ? 35.957  52.835  -15.679 1.00 36.38  ? 108  PHE A CE2    1 
ATOM   1767  C  CZ     . PHE A 1 111 ? 35.697  52.362  -14.409 1.00 38.21  ? 108  PHE A CZ     1 
ATOM   1768  H  H      . PHE A 1 111 ? 37.751  57.052  -16.460 1.00 36.55  ? 108  PHE A H      1 
ATOM   1769  H  HA     . PHE A 1 111 ? 38.302  56.603  -13.844 1.00 31.04  ? 108  PHE A HA     1 
ATOM   1770  H  HB2    . PHE A 1 111 ? 39.204  54.998  -15.986 1.00 28.00  ? 108  PHE A HB2    1 
ATOM   1771  H  HB3    . PHE A 1 111 ? 39.661  54.805  -14.478 1.00 28.00  ? 108  PHE A HB3    1 
ATOM   1772  H  HD1    . PHE A 1 111 ? 38.051  53.914  -12.852 1.00 31.59  ? 108  PHE A HD1    1 
ATOM   1773  H  HD2    . PHE A 1 111 ? 37.173  54.030  -16.745 1.00 40.87  ? 108  PHE A HD2    1 
ATOM   1774  H  HE1    . PHE A 1 111 ? 36.309  52.450  -12.498 1.00 30.40  ? 108  PHE A HE1    1 
ATOM   1775  H  HE2    . PHE A 1 111 ? 35.428  52.563  -16.395 1.00 43.66  ? 108  PHE A HE2    1 
ATOM   1776  H  HZ     . PHE A 1 111 ? 34.993  51.771  -14.267 1.00 45.86  ? 108  PHE A HZ     1 
ATOM   1777  N  N      . ASP A 1 112 ? 40.411  57.784  -13.815 1.00 36.40  ? 109  ASP A N      1 
ATOM   1778  C  CA     . ASP A 1 112 ? 41.686  58.480  -13.784 1.00 25.75  ? 109  ASP A CA     1 
ATOM   1779  C  C      . ASP A 1 112 ? 42.696  57.599  -13.057 1.00 26.66  ? 109  ASP A C      1 
ATOM   1780  O  O      . ASP A 1 112 ? 42.418  57.101  -11.970 1.00 43.57  ? 109  ASP A O      1 
ATOM   1781  C  CB     . ASP A 1 112 ? 41.546  59.852  -13.126 1.00 22.33  ? 109  ASP A CB     1 
ATOM   1782  C  CG     . ASP A 1 112 ? 42.869  60.599  -13.051 1.00 43.70  ? 109  ASP A CG     1 
ATOM   1783  O  OD1    . ASP A 1 112 ? 43.433  60.920  -14.110 1.00 38.73  ? 109  ASP A OD1    1 
ATOM   1784  O  OD2    . ASP A 1 112 ? 43.331  60.896  -11.930 1.00 55.71  ? 109  ASP A OD2    1 
ATOM   1785  H  H      . ASP A 1 112 ? 40.076  57.651  -13.034 1.00 43.68  ? 109  ASP A H      1 
ATOM   1786  H  HA     . ASP A 1 112 ? 41.999  58.612  -14.692 1.00 30.90  ? 109  ASP A HA     1 
ATOM   1787  H  HB2    . ASP A 1 112 ? 40.927  60.390  -13.644 1.00 26.79  ? 109  ASP A HB2    1 
ATOM   1788  H  HB3    . ASP A 1 112 ? 41.213  59.738  -12.223 1.00 26.79  ? 109  ASP A HB3    1 
ATOM   1789  N  N      . ILE A 1 113 ? 43.842  57.379  -13.693 1.00 17.49  ? 110  ILE A N      1 
ATOM   1790  C  CA     . ILE A 1 113 ? 44.926  56.564  -13.146 1.00 21.93  ? 110  ILE A CA     1 
ATOM   1791  C  C      . ILE A 1 113 ? 46.225  57.367  -13.082 1.00 35.92  ? 110  ILE A C      1 
ATOM   1792  O  O      . ILE A 1 113 ? 46.723  57.801  -14.116 1.00 35.31  ? 110  ILE A O      1 
ATOM   1793  C  CB     . ILE A 1 113 ? 45.132  55.276  -13.986 1.00 24.00  ? 110  ILE A CB     1 
ATOM   1794  C  CG1    . ILE A 1 113 ? 43.824  54.480  -14.047 1.00 22.85  ? 110  ILE A CG1    1 
ATOM   1795  C  CG2    . ILE A 1 113 ? 46.164  54.365  -13.349 1.00 27.31  ? 110  ILE A CG2    1 
ATOM   1796  C  CD1    . ILE A 1 113 ? 43.847  53.290  -14.991 1.00 19.78  ? 110  ILE A CD1    1 
ATOM   1797  H  H      . ILE A 1 113 ? 44.022  57.701  -14.470 1.00 20.99  ? 110  ILE A H      1 
ATOM   1798  H  HA     . ILE A 1 113 ? 44.695  56.298  -12.242 1.00 26.31  ? 110  ILE A HA     1 
ATOM   1799  H  HB     . ILE A 1 113 ? 45.413  55.512  -14.884 1.00 28.80  ? 110  ILE A HB     1 
ATOM   1800  H  HG12   . ILE A 1 113 ? 43.624  54.146  -13.158 1.00 27.42  ? 110  ILE A HG12   1 
ATOM   1801  H  HG13   . ILE A 1 113 ? 43.114  55.073  -14.340 1.00 27.42  ? 110  ILE A HG13   1 
ATOM   1802  H  HG21   . ILE A 1 113 ? 45.860  54.116  -12.462 1.00 32.78  ? 110  ILE A HG21   1 
ATOM   1803  H  HG22   . ILE A 1 113 ? 46.267  53.572  -13.899 1.00 32.78  ? 110  ILE A HG22   1 
ATOM   1804  H  HG23   . ILE A 1 113 ? 47.009  54.839  -13.289 1.00 32.78  ? 110  ILE A HG23   1 
ATOM   1805  H  HD11   . ILE A 1 113 ? 44.541  52.675  -14.706 1.00 23.74  ? 110  ILE A HD11   1 
ATOM   1806  H  HD12   . ILE A 1 113 ? 42.983  52.849  -14.964 1.00 23.74  ? 110  ILE A HD12   1 
ATOM   1807  H  HD13   . ILE A 1 113 ? 44.031  53.604  -15.890 1.00 23.74  ? 110  ILE A HD13   1 
ATOM   1808  N  N      . ASP A 1 114 ? 46.772  57.556  -11.875 1.00 41.03  ? 111  ASP A N      1 
ATOM   1809  C  CA     . ASP A 1 114 ? 47.933  58.435  -11.683 1.00 34.03  ? 111  ASP A CA     1 
ATOM   1810  C  C      . ASP A 1 114 ? 49.164  57.644  -11.280 1.00 33.99  ? 111  ASP A C      1 
ATOM   1811  O  O      . ASP A 1 114 ? 49.125  56.873  -10.324 1.00 39.31  ? 111  ASP A O      1 
ATOM   1812  C  CB     . ASP A 1 114 ? 47.681  59.479  -10.589 1.00 43.23  ? 111  ASP A CB     1 
ATOM   1813  C  CG     . ASP A 1 114 ? 46.419  60.292  -10.812 1.00 67.53  ? 111  ASP A CG     1 
ATOM   1814  O  OD1    . ASP A 1 114 ? 46.179  60.743  -11.952 1.00 74.11  ? 111  ASP A OD1    1 
ATOM   1815  O  OD2    . ASP A 1 114 ? 45.666  60.487  -9.831  1.00 78.01  ? 111  ASP A OD2    1 
ATOM   1816  H  H      . ASP A 1 114 ? 46.489  57.187  -11.152 1.00 49.24  ? 111  ASP A H      1 
ATOM   1817  H  HA     . ASP A 1 114 ? 48.125  58.900  -12.512 1.00 40.84  ? 111  ASP A HA     1 
ATOM   1818  H  HB2    . ASP A 1 114 ? 47.596  59.026  -9.736  1.00 51.88  ? 111  ASP A HB2    1 
ATOM   1819  H  HB3    . ASP A 1 114 ? 48.431  60.094  -10.564 1.00 51.88  ? 111  ASP A HB3    1 
ATOM   1820  N  N      . MET A 1 115 ? 50.255  57.841  -12.016 1.00 25.84  ? 112  MET A N      1 
ATOM   1821  C  CA     . MET A 1 115 ? 51.528  57.214  -11.688 1.00 27.52  ? 112  MET A CA     1 
ATOM   1822  C  C      . MET A 1 115 ? 51.935  57.527  -10.253 1.00 37.69  ? 112  MET A C      1 
ATOM   1823  O  O      . MET A 1 115 ? 52.566  56.709  -9.590  1.00 40.28  ? 112  MET A O      1 
ATOM   1824  C  CB     . MET A 1 115 ? 52.636  57.656  -12.643 1.00 31.97  ? 112  MET A CB     1 
ATOM   1825  C  CG     . MET A 1 115 ? 52.697  56.848  -13.937 1.00 53.95  ? 112  MET A CG     1 
ATOM   1826  S  SD     . MET A 1 115 ? 53.102  55.103  -13.711 1.00 43.56  ? 112  MET A SD     1 
ATOM   1827  C  CE     . MET A 1 115 ? 54.700  55.229  -12.948 1.00 38.98  ? 112  MET A CE     1 
ATOM   1828  H  H      . MET A 1 115 ? 50.282  58.340  -12.716 1.00 31.01  ? 112  MET A H      1 
ATOM   1829  H  HA     . MET A 1 115 ? 51.430  56.253  -11.778 1.00 33.03  ? 112  MET A HA     1 
ATOM   1830  H  HB2    . MET A 1 115 ? 52.490  58.585  -12.881 1.00 38.37  ? 112  MET A HB2    1 
ATOM   1831  H  HB3    . MET A 1 115 ? 53.490  57.562  -12.194 1.00 38.37  ? 112  MET A HB3    1 
ATOM   1832  H  HG2    . MET A 1 115 ? 51.832  56.895  -14.373 1.00 64.73  ? 112  MET A HG2    1 
ATOM   1833  H  HG3    . MET A 1 115 ? 53.375  57.235  -14.512 1.00 64.73  ? 112  MET A HG3    1 
ATOM   1834  H  HE1    . MET A 1 115 ? 54.614  55.722  -12.117 1.00 46.78  ? 112  MET A HE1    1 
ATOM   1835  H  HE2    . MET A 1 115 ? 55.036  54.336  -12.771 1.00 46.78  ? 112  MET A HE2    1 
ATOM   1836  H  HE3    . MET A 1 115 ? 55.301  55.696  -13.550 1.00 46.78  ? 112  MET A HE3    1 
ATOM   1837  N  N      . THR A 1 116 ? 51.600  58.729  -9.792  1.00 43.24  ? 113  THR A N      1 
ATOM   1838  C  CA     . THR A 1 116 ? 52.012  59.185  -8.465  1.00 36.28  ? 113  THR A CA     1 
ATOM   1839  C  C      . THR A 1 116 ? 51.539  58.220  -7.381  1.00 31.75  ? 113  THR A C      1 
ATOM   1840  O  O      . THR A 1 116 ? 52.207  58.052  -6.365  1.00 41.46  ? 113  THR A O      1 
ATOM   1841  C  CB     . THR A 1 116 ? 51.468  60.606  -8.162  1.00 35.26  ? 113  THR A CB     1 
ATOM   1842  O  OG1    . THR A 1 116 ? 52.038  61.548  -9.076  1.00 45.10  ? 113  THR A OG1    1 
ATOM   1843  C  CG2    . THR A 1 116 ? 51.820  61.046  -6.754  1.00 28.91  ? 113  THR A CG2    1 
ATOM   1844  H  H      . THR A 1 116 ? 51.133  59.303  -10.229 1.00 51.88  ? 113  THR A H      1 
ATOM   1845  H  HA     . THR A 1 116 ? 52.980  59.222  -8.432  1.00 43.54  ? 113  THR A HA     1 
ATOM   1846  H  HB     . THR A 1 116 ? 50.502  60.610  -8.254  1.00 42.31  ? 113  THR A HB     1 
ATOM   1847  H  HG1    . THR A 1 116 ? 52.874  61.553  -8.999  1.00 54.12  ? 113  THR A HG1    1 
ATOM   1848  H  HG21   . THR A 1 116 ? 52.784  61.059  -6.642  1.00 34.69  ? 113  THR A HG21   1 
ATOM   1849  H  HG22   . THR A 1 116 ? 51.471  61.935  -6.587  1.00 34.69  ? 113  THR A HG22   1 
ATOM   1850  H  HG23   . THR A 1 116 ? 51.437  60.430  -6.109  1.00 34.69  ? 113  THR A HG23   1 
ATOM   1851  N  N      . ASP A 1 117 ? 50.403  57.571  -7.614  1.00 22.53  ? 114  ASP A N      1 
ATOM   1852  C  CA     . ASP A 1 117 ? 49.821  56.663  -6.630  1.00 20.58  ? 114  ASP A CA     1 
ATOM   1853  C  C      . ASP A 1 117 ? 50.610  55.355  -6.524  1.00 23.64  ? 114  ASP A C      1 
ATOM   1854  O  O      . ASP A 1 117 ? 50.271  54.486  -5.727  1.00 33.43  ? 114  ASP A O      1 
ATOM   1855  C  CB     . ASP A 1 117 ? 48.356  56.370  -6.944  1.00 23.36  ? 114  ASP A CB     1 
ATOM   1856  C  CG     . ASP A 1 117 ? 47.502  57.621  -6.948  1.00 32.32  ? 114  ASP A CG     1 
ATOM   1857  O  OD1    . ASP A 1 117 ? 48.034  58.698  -6.609  1.00 51.79  ? 114  ASP A OD1    1 
ATOM   1858  O  OD2    . ASP A 1 117 ? 46.291  57.523  -7.235  1.00 32.07  ? 114  ASP A OD2    1 
ATOM   1859  H  H      . ASP A 1 117 ? 49.947  57.639  -8.340  1.00 27.03  ? 114  ASP A H      1 
ATOM   1860  H  HA     . ASP A 1 117 ? 49.852  57.093  -5.760  1.00 24.70  ? 114  ASP A HA     1 
ATOM   1861  H  HB2    . ASP A 1 117 ? 48.296  55.962  -7.822  1.00 28.03  ? 114  ASP A HB2    1 
ATOM   1862  H  HB3    . ASP A 1 117 ? 48.002  55.766  -6.272  1.00 28.03  ? 114  ASP A HB3    1 
ATOM   1863  N  N      . TYR A 1 118 ? 51.638  55.208  -7.351  1.00 24.09  ? 115  TYR A N      1 
ATOM   1864  C  CA     . TYR A 1 118 ? 52.475  54.016  -7.334  1.00 22.01  ? 115  TYR A CA     1 
ATOM   1865  C  C      . TYR A 1 118 ? 53.794  54.265  -6.642  1.00 23.74  ? 115  TYR A C      1 
ATOM   1866  O  O      . TYR A 1 118 ? 54.670  53.403  -6.651  1.00 30.41  ? 115  TYR A O      1 
ATOM   1867  C  CB     . TYR A 1 118 ? 52.762  53.558  -8.761  1.00 33.95  ? 115  TYR A CB     1 
ATOM   1868  C  CG     . TYR A 1 118 ? 51.565  53.020  -9.468  1.00 31.10  ? 115  TYR A CG     1 
ATOM   1869  C  CD1    . TYR A 1 118 ? 51.204  51.697  -9.339  1.00 39.93  ? 115  TYR A CD1    1 
ATOM   1870  C  CD2    . TYR A 1 118 ? 50.770  53.846  -10.239 1.00 42.33  ? 115  TYR A CD2    1 
ATOM   1871  C  CE1    . TYR A 1 118 ? 50.116  51.213  -9.978  1.00 42.84  ? 115  TYR A CE1    1 
ATOM   1872  C  CE2    . TYR A 1 118 ? 49.677  53.362  -10.874 1.00 45.98  ? 115  TYR A CE2    1 
ATOM   1873  C  CZ     . TYR A 1 118 ? 49.356  52.050  -10.736 1.00 39.95  ? 115  TYR A CZ     1 
ATOM   1874  O  OH     . TYR A 1 118 ? 48.272  51.544  -11.370 1.00 44.74  ? 115  TYR A OH     1 
ATOM   1875  H  H      . TYR A 1 118 ? 51.873  55.791  -7.938  1.00 28.91  ? 115  TYR A H      1 
ATOM   1876  H  HA     . TYR A 1 118 ? 52.013  53.302  -6.868  1.00 26.42  ? 115  TYR A HA     1 
ATOM   1877  H  HB2    . TYR A 1 118 ? 53.095  54.312  -9.271  1.00 40.75  ? 115  TYR A HB2    1 
ATOM   1878  H  HB3    . TYR A 1 118 ? 53.432  52.856  -8.735  1.00 40.75  ? 115  TYR A HB3    1 
ATOM   1879  H  HD1    . TYR A 1 118 ? 51.725  51.127  -8.822  1.00 47.91  ? 115  TYR A HD1    1 
ATOM   1880  H  HD2    . TYR A 1 118 ? 50.995  54.743  -10.332 1.00 50.80  ? 115  TYR A HD2    1 
ATOM   1881  H  HE1    . TYR A 1 118 ? 49.883  50.317  -9.893  1.00 51.41  ? 115  TYR A HE1    1 
ATOM   1882  H  HE2    . TYR A 1 118 ? 49.152  53.922  -11.399 1.00 55.17  ? 115  TYR A HE2    1 
ATOM   1883  H  HH     . TYR A 1 118 ? 48.199  50.724  -11.205 1.00 53.69  ? 115  TYR A HH     1 
ATOM   1884  N  N      . ASP A 1 119 ? 53.939  55.437  -6.032  1.00 34.01  ? 116  ASP A N      1 
ATOM   1885  C  CA     . ASP A 1 119 ? 55.243  55.878  -5.542  1.00 36.32  ? 116  ASP A CA     1 
ATOM   1886  C  C      . ASP A 1 119 ? 55.840  54.932  -4.504  1.00 32.08  ? 116  ASP A C      1 
ATOM   1887  O  O      . ASP A 1 119 ? 57.058  54.907  -4.325  1.00 40.89  ? 116  ASP A O      1 
ATOM   1888  C  CB     . ASP A 1 119 ? 55.121  57.270  -4.915  1.00 24.44  ? 116  ASP A CB     1 
ATOM   1889  C  CG     . ASP A 1 119 ? 55.357  58.389  -5.903  1.00 25.99  ? 116  ASP A CG     1 
ATOM   1890  O  OD1    . ASP A 1 119 ? 55.452  58.121  -7.113  1.00 37.04  ? 116  ASP A OD1    1 
ATOM   1891  O  OD2    . ASP A 1 119 ? 55.441  59.554  -5.460  1.00 39.41  ? 116  ASP A OD2    1 
ATOM   1892  H  H      . ASP A 1 119 ? 53.300  55.994  -5.888  1.00 40.82  ? 116  ASP A H      1 
ATOM   1893  H  HA     . ASP A 1 119 ? 55.860  55.935  -6.289  1.00 43.59  ? 116  ASP A HA     1 
ATOM   1894  H  HB2    . ASP A 1 119 ? 54.227  57.375  -4.553  1.00 29.33  ? 116  ASP A HB2    1 
ATOM   1895  H  HB3    . ASP A 1 119 ? 55.777  57.355  -4.206  1.00 29.33  ? 116  ASP A HB3    1 
ATOM   1896  N  N      . ASP A 1 120 ? 55.000  54.127  -3.858  1.00 18.32  ? 117  ASP A N      1 
ATOM   1897  C  CA     . ASP A 1 120 ? 55.481  53.188  -2.852  1.00 12.88  ? 117  ASP A CA     1 
ATOM   1898  C  C      . ASP A 1 120 ? 55.936  51.858  -3.430  1.00 20.87  ? 117  ASP A C      1 
ATOM   1899  O  O      . ASP A 1 120 ? 56.413  51.009  -2.686  1.00 31.74  ? 117  ASP A O      1 
ATOM   1900  C  CB     . ASP A 1 120 ? 54.409  52.942  -1.784  1.00 22.81  ? 117  ASP A CB     1 
ATOM   1901  C  CG     . ASP A 1 120 ? 53.112  52.417  -2.356  1.00 43.33  ? 117  ASP A CG     1 
ATOM   1902  O  OD1    . ASP A 1 120 ? 52.625  52.990  -3.353  1.00 54.91  ? 117  ASP A OD1    1 
ATOM   1903  O  OD2    . ASP A 1 120 ? 52.569  51.436  -1.793  1.00 37.99  ? 117  ASP A OD2    1 
ATOM   1904  H  H      . ASP A 1 120 ? 54.149  54.107  -3.984  1.00 21.98  ? 117  ASP A H      1 
ATOM   1905  H  HA     . ASP A 1 120 ? 56.246  53.585  -2.407  1.00 15.46  ? 117  ASP A HA     1 
ATOM   1906  H  HB2    . ASP A 1 120 ? 54.741  52.288  -1.149  1.00 27.37  ? 117  ASP A HB2    1 
ATOM   1907  H  HB3    . ASP A 1 120 ? 54.219  53.778  -1.331  1.00 27.37  ? 117  ASP A HB3    1 
ATOM   1908  N  N      . VAL A 1 121 ? 55.783  51.667  -4.739  1.00 32.31  ? 118  VAL A N      1 
ATOM   1909  C  CA     . VAL A 1 121 ? 56.161  50.405  -5.383  1.00 15.59  ? 118  VAL A CA     1 
ATOM   1910  C  C      . VAL A 1 121 ? 56.964  50.599  -6.670  1.00 27.29  ? 118  VAL A C      1 
ATOM   1911  O  O      . VAL A 1 121 ? 57.265  49.632  -7.371  1.00 53.67  ? 118  VAL A O      1 
ATOM   1912  C  CB     . VAL A 1 121 ? 54.919  49.566  -5.702  1.00 20.95  ? 118  VAL A CB     1 
ATOM   1913  C  CG1    . VAL A 1 121 ? 54.240  49.130  -4.433  1.00 23.58  ? 118  VAL A CG1    1 
ATOM   1914  C  CG2    . VAL A 1 121 ? 53.943  50.351  -6.573  1.00 31.82  ? 118  VAL A CG2    1 
ATOM   1915  H  H      . VAL A 1 121 ? 55.461  52.253  -5.280  1.00 38.77  ? 118  VAL A H      1 
ATOM   1916  H  HA     . VAL A 1 121 ? 56.711  49.895  -4.767  1.00 18.70  ? 118  VAL A HA     1 
ATOM   1917  H  HB     . VAL A 1 121 ? 55.188  48.772  -6.189  1.00 25.15  ? 118  VAL A HB     1 
ATOM   1918  H  HG11   . VAL A 1 121 ? 53.974  49.917  -3.932  1.00 28.30  ? 118  VAL A HG11   1 
ATOM   1919  H  HG12   . VAL A 1 121 ? 53.458  48.602  -4.660  1.00 28.30  ? 118  VAL A HG12   1 
ATOM   1920  H  HG13   . VAL A 1 121 ? 54.860  48.598  -3.910  1.00 28.30  ? 118  VAL A HG13   1 
ATOM   1921  H  HG21   . VAL A 1 121 ? 54.385  50.592  -7.403  1.00 38.19  ? 118  VAL A HG21   1 
ATOM   1922  H  HG22   . VAL A 1 121 ? 53.170  49.796  -6.758  1.00 38.19  ? 118  VAL A HG22   1 
ATOM   1923  H  HG23   . VAL A 1 121 ? 53.671  51.151  -6.098  1.00 38.19  ? 118  VAL A HG23   1 
ATOM   1924  N  N      . ARG A 1 122 ? 57.312  51.844  -6.978  1.00 18.47  ? 119  ARG A N      1 
ATOM   1925  C  CA     . ARG A 1 122 ? 58.270  52.121  -8.040  1.00 23.28  ? 119  ARG A CA     1 
ATOM   1926  C  C      . ARG A 1 122 ? 59.492  52.787  -7.440  1.00 29.91  ? 119  ARG A C      1 
ATOM   1927  O  O      . ARG A 1 122 ? 59.391  53.503  -6.442  1.00 41.25  ? 119  ARG A O      1 
ATOM   1928  C  CB     . ARG A 1 122 ? 57.656  52.990  -9.137  1.00 37.06  ? 119  ARG A CB     1 
ATOM   1929  C  CG     . ARG A 1 122 ? 57.117  54.322  -8.680  1.00 26.77  ? 119  ARG A CG     1 
ATOM   1930  C  CD     . ARG A 1 122 ? 56.725  55.134  -9.886  1.00 34.79  ? 119  ARG A CD     1 
ATOM   1931  N  NE     . ARG A 1 122 ? 56.342  56.500  -9.553  1.00 39.79  ? 119  ARG A NE     1 
ATOM   1932  C  CZ     . ARG A 1 122 ? 56.272  57.489  -10.439 1.00 37.00  ? 119  ARG A CZ     1 
ATOM   1933  N  NH1    . ARG A 1 122 ? 56.592  57.274  -11.709 1.00 45.06  ? 119  ARG A NH1    1 
ATOM   1934  N  NH2    . ARG A 1 122 ? 55.903  58.698  -10.051 1.00 36.60  ? 119  ARG A NH2    1 
ATOM   1935  H  H      . ARG A 1 122 ? 57.008  52.546  -6.586  1.00 22.17  ? 119  ARG A H      1 
ATOM   1936  H  HA     . ARG A 1 122 ? 58.549  51.283  -8.441  1.00 27.93  ? 119  ARG A HA     1 
ATOM   1937  H  HB2    . ARG A 1 122 ? 58.336  53.165  -9.806  1.00 44.47  ? 119  ARG A HB2    1 
ATOM   1938  H  HB3    . ARG A 1 122 ? 56.922  52.502  -9.541  1.00 44.47  ? 119  ARG A HB3    1 
ATOM   1939  H  HG2    . ARG A 1 122 ? 56.331  54.186  -8.128  1.00 32.12  ? 119  ARG A HG2    1 
ATOM   1940  H  HG3    . ARG A 1 122 ? 57.802  54.803  -8.190  1.00 32.12  ? 119  ARG A HG3    1 
ATOM   1941  H  HD2    . ARG A 1 122 ? 57.478  55.175  -10.496 1.00 41.74  ? 119  ARG A HD2    1 
ATOM   1942  H  HD3    . ARG A 1 122 ? 55.969  54.709  -10.320 1.00 41.74  ? 119  ARG A HD3    1 
ATOM   1943  H  HE     . ARG A 1 122 ? 56.219  56.693  -8.724  1.00 47.74  ? 119  ARG A HE     1 
ATOM   1944  H  HH11   . ARG A 1 122 ? 56.831  56.489  -11.966 1.00 54.07  ? 119  ARG A HH11   1 
ATOM   1945  H  HH12   . ARG A 1 122 ? 56.550  57.918  -12.278 1.00 54.07  ? 119  ARG A HH12   1 
ATOM   1946  H  HH21   . ARG A 1 122 ? 55.701  58.844  -9.228  1.00 43.91  ? 119  ARG A HH21   1 
ATOM   1947  H  HH22   . ARG A 1 122 ? 55.867  59.341  -10.622 1.00 43.91  ? 119  ARG A HH22   1 
ATOM   1948  N  N      . ARG A 1 123 ? 60.636  52.575  -8.083  1.00 26.03  ? 120  ARG A N      1 
ATOM   1949  C  CA     . ARG A 1 123 ? 61.928  52.951  -7.525  1.00 38.12  ? 120  ARG A CA     1 
ATOM   1950  C  C      . ARG A 1 123 ? 62.674  53.995  -8.340  1.00 44.87  ? 120  ARG A C      1 
ATOM   1951  O  O      . ARG A 1 123 ? 63.660  54.568  -7.875  1.00 56.52  ? 120  ARG A O      1 
ATOM   1952  C  CB     . ARG A 1 123 ? 62.777  51.684  -7.432  1.00 41.56  ? 120  ARG A CB     1 
ATOM   1953  C  CG     . ARG A 1 123 ? 62.386  50.747  -6.303  1.00 34.45  ? 120  ARG A CG     1 
ATOM   1954  C  CD     . ARG A 1 123 ? 63.321  49.554  -6.249  1.00 27.87  ? 120  ARG A CD     1 
ATOM   1955  N  NE     . ARG A 1 123 ? 64.676  49.887  -5.818  1.00 38.95  ? 120  ARG A NE     1 
ATOM   1956  C  CZ     . ARG A 1 123 ? 65.764  49.220  -6.201  1.00 41.95  ? 120  ARG A CZ     1 
ATOM   1957  N  NH1    . ARG A 1 123 ? 65.667  48.186  -7.022  1.00 60.79  ? 120  ARG A NH1    1 
ATOM   1958  N  NH2    . ARG A 1 123 ? 66.957  49.586  -5.768  1.00 45.32  ? 120  ARG A NH2    1 
ATOM   1959  H  H      . ARG A 1 123 ? 60.689  52.208  -8.859  1.00 31.24  ? 120  ARG A H      1 
ATOM   1960  H  HA     . ARG A 1 123 ? 61.800  53.299  -6.629  1.00 45.74  ? 120  ARG A HA     1 
ATOM   1961  H  HB2    . ARG A 1 123 ? 62.694  51.192  -8.264  1.00 49.88  ? 120  ARG A HB2    1 
ATOM   1962  H  HB3    . ARG A 1 123 ? 63.703  51.940  -7.295  1.00 49.88  ? 120  ARG A HB3    1 
ATOM   1963  H  HG2    . ARG A 1 123 ? 62.442  51.219  -5.457  1.00 41.34  ? 120  ARG A HG2    1 
ATOM   1964  H  HG3    . ARG A 1 123 ? 61.484  50.423  -6.450  1.00 41.34  ? 120  ARG A HG3    1 
ATOM   1965  H  HD2    . ARG A 1 123 ? 62.963  48.904  -5.625  1.00 33.44  ? 120  ARG A HD2    1 
ATOM   1966  H  HD3    . ARG A 1 123 ? 63.379  49.163  -7.134  1.00 33.44  ? 120  ARG A HD3    1 
ATOM   1967  H  HE     . ARG A 1 123 ? 64.785  50.594  -5.341  1.00 46.73  ? 120  ARG A HE     1 
ATOM   1968  H  HH11   . ARG A 1 123 ? 64.896  47.938  -7.313  1.00 72.95  ? 120  ARG A HH11   1 
ATOM   1969  H  HH12   . ARG A 1 123 ? 66.374  47.762  -7.265  1.00 72.95  ? 120  ARG A HH12   1 
ATOM   1970  H  HH21   . ARG A 1 123 ? 67.034  50.256  -5.234  1.00 54.38  ? 120  ARG A HH21   1 
ATOM   1971  H  HH22   . ARG A 1 123 ? 67.657  49.152  -6.018  1.00 54.38  ? 120  ARG A HH22   1 
ATOM   1972  N  N      . CYS A 1 124 ? 62.192  54.248  -9.550  1.00 45.71  ? 121  CYS A N      1 
ATOM   1973  C  CA     . CYS A 1 124 ? 62.871  55.141  -10.481 1.00 39.50  ? 121  CYS A CA     1 
ATOM   1974  C  C      . CYS A 1 124 ? 62.450  56.603  -10.344 1.00 36.85  ? 121  CYS A C      1 
ATOM   1975  O  O      . CYS A 1 124 ? 63.272  57.511  -10.465 1.00 53.12  ? 121  CYS A O      1 
ATOM   1976  C  CB     . CYS A 1 124 ? 62.589  54.673  -11.900 1.00 57.83  ? 121  CYS A CB     1 
ATOM   1977  S  SG     . CYS A 1 124 ? 60.848  54.252  -12.133 1.00 53.24  ? 121  CYS A SG     1 
ATOM   1978  H  H      . CYS A 1 124 ? 61.464  53.911  -9.859  1.00 54.86  ? 121  CYS A H      1 
ATOM   1979  H  HA     . CYS A 1 124 ? 63.827  55.088  -10.330 1.00 47.40  ? 121  CYS A HA     1 
ATOM   1980  H  HB2    . CYS A 1 124 ? 62.815  55.383  -12.521 1.00 69.40  ? 121  CYS A HB2    1 
ATOM   1981  H  HB3    . CYS A 1 124 ? 63.120  53.883  -12.087 1.00 69.40  ? 121  CYS A HB3    1 
ATOM   1982  N  N      . CYS A 1 125 ? 61.160  56.817  -10.102 1.00 32.69  ? 122  CYS A N      1 
ATOM   1983  C  CA     . CYS A 1 125 ? 60.586  58.156  -10.047 1.00 35.90  ? 122  CYS A CA     1 
ATOM   1984  C  C      . CYS A 1 125 ? 59.766  58.373  -8.787  1.00 38.24  ? 122  CYS A C      1 
ATOM   1985  O  O      . CYS A 1 125 ? 59.553  57.445  -8.009  1.00 61.62  ? 122  CYS A O      1 
ATOM   1986  C  CB     . CYS A 1 125 ? 59.677  58.366  -11.263 1.00 57.21  ? 122  CYS A CB     1 
ATOM   1987  S  SG     . CYS A 1 125 ? 60.466  58.167  -12.883 1.00 39.76  ? 122  CYS A SG     1 
ATOM   1988  H  H      . CYS A 1 125 ? 60.587  56.190  -9.964  1.00 39.23  ? 122  CYS A H      1 
ATOM   1989  H  HA     . CYS A 1 125 ? 61.296  58.816  -10.073 1.00 43.08  ? 122  CYS A HA     1 
ATOM   1990  H  HB2    . CYS A 1 125 ? 58.949  57.726  -11.214 1.00 68.65  ? 122  CYS A HB2    1 
ATOM   1991  H  HB3    . CYS A 1 125 ? 59.318  59.266  -11.224 1.00 68.65  ? 122  CYS A HB3    1 
ATOM   1992  N  N      . SER A 1 126 ? 59.309  59.603  -8.580  1.00 31.73  ? 123  SER A N      1 
ATOM   1993  C  CA     . SER A 1 126 ? 58.317  59.877  -7.544  1.00 32.54  ? 123  SER A CA     1 
ATOM   1994  C  C      . SER A 1 126 ? 57.512  61.097  -7.960  1.00 26.93  ? 123  SER A C      1 
ATOM   1995  O  O      . SER A 1 126 ? 57.947  61.896  -8.792  1.00 22.92  ? 123  SER A O      1 
ATOM   1996  C  CB     . SER A 1 126 ? 58.949  60.077  -6.156  1.00 34.56  ? 123  SER A CB     1 
ATOM   1997  O  OG     . SER A 1 126 ? 59.897  61.128  -6.112  1.00 29.55  ? 123  SER A OG     1 
ATOM   1998  H  H      . SER A 1 126 ? 59.555  60.297  -9.025  1.00 38.07  ? 123  SER A H      1 
ATOM   1999  H  HA     . SER A 1 126 ? 57.708  59.124  -7.486  1.00 39.05  ? 123  SER A HA     1 
ATOM   2000  H  HB2    . SER A 1 126 ? 58.242  60.275  -5.522  1.00 41.48  ? 123  SER A HB2    1 
ATOM   2001  H  HB3    . SER A 1 126 ? 59.392  59.253  -5.899  1.00 41.48  ? 123  SER A HB3    1 
ATOM   2002  H  HG     . SER A 1 126 ? 60.212  61.197  -5.336  1.00 35.47  ? 123  SER A HG     1 
ATOM   2003  N  N      . SER A 1 127 ? 56.347  61.248  -7.347  1.00 26.27  ? 124  SER A N      1 
ATOM   2004  C  CA     . SER A 1 127 ? 55.442  62.347  -7.646  1.00 28.37  ? 124  SER A CA     1 
ATOM   2005  C  C      . SER A 1 127 ? 55.054  62.391  -9.134  1.00 34.95  ? 124  SER A C      1 
ATOM   2006  O  O      . SER A 1 127 ? 54.483  61.425  -9.639  1.00 33.56  ? 124  SER A O      1 
ATOM   2007  C  CB     . SER A 1 127 ? 56.069  63.663  -7.184  1.00 27.92  ? 124  SER A CB     1 
ATOM   2008  O  OG     . SER A 1 127 ? 55.051  64.599  -6.880  1.00 35.39  ? 124  SER A OG     1 
ATOM   2009  H  H      . SER A 1 127 ? 56.051  60.715  -6.741  1.00 31.52  ? 124  SER A H      1 
ATOM   2010  H  HA     . SER A 1 127 ? 54.626  62.220  -7.137  1.00 34.04  ? 124  SER A HA     1 
ATOM   2011  H  HB2    . SER A 1 127 ? 56.601  63.502  -6.389  1.00 33.50  ? 124  SER A HB2    1 
ATOM   2012  H  HB3    . SER A 1 127 ? 56.626  64.018  -7.894  1.00 33.50  ? 124  SER A HB3    1 
ATOM   2013  H  HG     . SER A 1 127 ? 55.393  65.323  -6.626  1.00 42.47  ? 124  SER A HG     1 
ATOM   2014  N  N      . ALA A 1 128 ? 55.354  63.481  -9.837  1.00 36.99  ? 125  ALA A N      1 
ATOM   2015  C  CA     . ALA A 1 128 ? 54.851  63.662  -11.196 1.00 28.45  ? 125  ALA A CA     1 
ATOM   2016  C  C      . ALA A 1 128 ? 55.835  63.210  -12.266 1.00 42.05  ? 125  ALA A C      1 
ATOM   2017  O  O      . ALA A 1 128 ? 55.568  63.365  -13.457 1.00 64.77  ? 125  ALA A O      1 
ATOM   2018  C  CB     . ALA A 1 128 ? 54.486  65.119  -11.424 1.00 24.17  ? 125  ALA A CB     1 
ATOM   2019  H  H      . ALA A 1 128 ? 55.844  64.127  -9.551  1.00 44.38  ? 125  ALA A H      1 
ATOM   2020  H  HA     . ALA A 1 128 ? 54.042  63.137  -11.300 1.00 34.15  ? 125  ALA A HA     1 
ATOM   2021  H  HB1    . ALA A 1 128 ? 55.277  65.665  -11.296 1.00 29.01  ? 125  ALA A HB1    1 
ATOM   2022  H  HB2    . ALA A 1 128 ? 54.154  65.223  -12.329 1.00 29.01  ? 125  ALA A HB2    1 
ATOM   2023  H  HB3    . ALA A 1 128 ? 53.800  65.375  -10.788 1.00 29.01  ? 125  ALA A HB3    1 
ATOM   2024  N  N      . ASP A 1 129 ? 56.960  62.639  -11.853 1.00 18.02  ? 126  ASP A N      1 
ATOM   2025  C  CA     . ASP A 1 129 ? 57.948  62.150  -12.811 1.00 32.27  ? 126  ASP A CA     1 
ATOM   2026  C  C      . ASP A 1 129 ? 57.523  60.805  -13.382 1.00 40.93  ? 126  ASP A C      1 
ATOM   2027  O  O      . ASP A 1 129 ? 57.001  59.959  -12.654 1.00 48.55  ? 126  ASP A O      1 
ATOM   2028  C  CB     . ASP A 1 129 ? 59.330  61.991  -12.173 1.00 25.59  ? 126  ASP A CB     1 
ATOM   2029  C  CG     . ASP A 1 129 ? 60.178  63.239  -12.269 1.00 27.72  ? 126  ASP A CG     1 
ATOM   2030  O  OD1    . ASP A 1 129 ? 60.025  64.000  -13.241 1.00 41.01  ? 126  ASP A OD1    1 
ATOM   2031  O  OD2    . ASP A 1 129 ? 61.028  63.444  -11.376 1.00 55.46  ? 126  ASP A OD2    1 
ATOM   2032  H  H      . ASP A 1 129 ? 57.176  62.522  -11.029 1.00 21.63  ? 126  ASP A H      1 
ATOM   2033  H  HA     . ASP A 1 129 ? 58.023  62.781  -13.544 1.00 38.72  ? 126  ASP A HA     1 
ATOM   2034  H  HB2    . ASP A 1 129 ? 59.220  61.776  -11.234 1.00 30.70  ? 126  ASP A HB2    1 
ATOM   2035  H  HB3    . ASP A 1 129 ? 59.804  61.273  -12.623 1.00 30.70  ? 126  ASP A HB3    1 
ATOM   2036  N  N      . ILE A 1 130 ? 57.735  60.613  -14.682 1.00 24.52  ? 127  ILE A N      1 
ATOM   2037  C  CA     . ILE A 1 130 ? 57.589  59.287  -15.266 1.00 30.48  ? 127  ILE A CA     1 
ATOM   2038  C  C      . ILE A 1 130 ? 58.808  58.976  -16.136 1.00 32.77  ? 127  ILE A C      1 
ATOM   2039  O  O      . ILE A 1 130 ? 59.456  59.883  -16.659 1.00 32.11  ? 127  ILE A O      1 
ATOM   2040  C  CB     . ILE A 1 130 ? 56.301  59.158  -16.098 1.00 24.67  ? 127  ILE A CB     1 
ATOM   2041  C  CG1    . ILE A 1 130 ? 56.293  60.126  -17.287 1.00 31.12  ? 127  ILE A CG1    1 
ATOM   2042  C  CG2    . ILE A 1 130 ? 55.086  59.380  -15.207 1.00 32.21  ? 127  ILE A CG2    1 
ATOM   2043  C  CD1    . ILE A 1 130 ? 55.326  59.712  -18.378 1.00 33.59  ? 127  ILE A CD1    1 
ATOM   2044  H  H      . ILE A 1 130 ? 57.961  61.227  -15.240 1.00 29.43  ? 127  ILE A H      1 
ATOM   2045  H  HA     . ILE A 1 130 ? 57.553  58.630  -14.553 1.00 36.58  ? 127  ILE A HA     1 
ATOM   2046  H  HB     . ILE A 1 130 ? 56.258  58.254  -16.446 1.00 29.60  ? 127  ILE A HB     1 
ATOM   2047  H  HG12   . ILE A 1 130 ? 56.034  61.007  -16.975 1.00 37.34  ? 127  ILE A HG12   1 
ATOM   2048  H  HG13   . ILE A 1 130 ? 57.183  60.159  -17.672 1.00 37.34  ? 127  ILE A HG13   1 
ATOM   2049  H  HG21   . ILE A 1 130 ? 55.136  60.268  -14.821 1.00 38.66  ? 127  ILE A HG21   1 
ATOM   2050  H  HG22   . ILE A 1 130 ? 54.282  59.295  -15.743 1.00 38.66  ? 127  ILE A HG22   1 
ATOM   2051  H  HG23   . ILE A 1 130 ? 55.086  58.713  -14.502 1.00 38.66  ? 127  ILE A HG23   1 
ATOM   2052  H  HD11   . ILE A 1 130 ? 54.429  59.683  -18.009 1.00 40.30  ? 127  ILE A HD11   1 
ATOM   2053  H  HD12   . ILE A 1 130 ? 55.367  60.360  -19.098 1.00 40.30  ? 127  ILE A HD12   1 
ATOM   2054  H  HD13   . ILE A 1 130 ? 55.577  58.835  -18.707 1.00 40.30  ? 127  ILE A HD13   1 
ATOM   2055  N  N      . CYS A 1 131 ? 59.129  57.691  -16.256 1.00 26.16  ? 128  CYS A N      1 
ATOM   2056  C  CA     . CYS A 1 131 ? 60.173  57.234  -17.165 1.00 33.76  ? 128  CYS A CA     1 
ATOM   2057  C  C      . CYS A 1 131 ? 59.694  55.944  -17.821 1.00 36.96  ? 128  CYS A C      1 
ATOM   2058  O  O      . CYS A 1 131 ? 58.646  55.415  -17.461 1.00 41.24  ? 128  CYS A O      1 
ATOM   2059  C  CB     . CYS A 1 131 ? 61.508  57.018  -16.435 1.00 47.93  ? 128  CYS A CB     1 
ATOM   2060  S  SG     . CYS A 1 131 ? 61.542  55.730  -15.155 1.00 36.25  ? 128  CYS A SG     1 
ATOM   2061  H  H      . CYS A 1 131 ? 58.752  57.057  -15.815 1.00 31.39  ? 128  CYS A H      1 
ATOM   2062  H  HA     . CYS A 1 131 ? 60.309  57.898  -17.858 1.00 40.52  ? 128  CYS A HA     1 
ATOM   2063  H  HB2    . CYS A 1 131 ? 62.179  56.784  -17.095 1.00 57.52  ? 128  CYS A HB2    1 
ATOM   2064  H  HB3    . CYS A 1 131 ? 61.758  57.853  -16.008 1.00 57.52  ? 128  CYS A HB3    1 
ATOM   2065  N  N      . PRO A 1 132 ? 60.450  55.430  -18.796 1.00 31.90  ? 129  PRO A N      1 
ATOM   2066  C  CA     . PRO A 1 132 ? 60.038  54.153  -19.385 1.00 44.16  ? 129  PRO A CA     1 
ATOM   2067  C  C      . PRO A 1 132 ? 60.059  52.974  -18.415 1.00 55.94  ? 129  PRO A C      1 
ATOM   2068  O  O      . PRO A 1 132 ? 59.372  51.977  -18.653 1.00 47.19  ? 129  PRO A O      1 
ATOM   2069  C  CB     . PRO A 1 132 ? 61.086  53.929  -20.472 1.00 38.12  ? 129  PRO A CB     1 
ATOM   2070  C  CG     . PRO A 1 132 ? 61.533  55.288  -20.847 1.00 44.02  ? 129  PRO A CG     1 
ATOM   2071  C  CD     . PRO A 1 132 ? 61.522  56.073  -19.572 1.00 34.14  ? 129  PRO A CD     1 
ATOM   2072  H  HA     . PRO A 1 132 ? 59.159  54.229  -19.789 1.00 52.99  ? 129  PRO A HA     1 
ATOM   2073  H  HB2    . PRO A 1 132 ? 61.824  53.410  -20.114 1.00 45.75  ? 129  PRO A HB2    1 
ATOM   2074  H  HB3    . PRO A 1 132 ? 60.682  53.478  -21.229 1.00 45.75  ? 129  PRO A HB3    1 
ATOM   2075  H  HG2    . PRO A 1 132 ? 62.429  55.247  -21.216 1.00 52.82  ? 129  PRO A HG2    1 
ATOM   2076  H  HG3    . PRO A 1 132 ? 60.914  55.669  -21.489 1.00 52.82  ? 129  PRO A HG3    1 
ATOM   2077  H  HD2    . PRO A 1 132 ? 62.372  55.986  -19.113 1.00 40.96  ? 129  PRO A HD2    1 
ATOM   2078  H  HD3    . PRO A 1 132 ? 61.303  57.001  -19.747 1.00 40.96  ? 129  PRO A HD3    1 
ATOM   2079  N  N      . LYS A 1 133 ? 60.827  53.085  -17.336 1.00 47.11  ? 130  LYS A N      1 
ATOM   2080  C  CA     . LYS A 1 133 ? 60.979  51.959  -16.426 1.00 43.52  ? 130  LYS A CA     1 
ATOM   2081  C  C      . LYS A 1 133 ? 59.715  51.740  -15.609 1.00 42.64  ? 130  LYS A C      1 
ATOM   2082  O  O      . LYS A 1 133 ? 59.409  50.610  -15.229 1.00 60.37  ? 130  LYS A O      1 
ATOM   2083  C  CB     . LYS A 1 133 ? 62.201  52.159  -15.527 1.00 41.80  ? 130  LYS A CB     1 
ATOM   2084  C  CG     . LYS A 1 133 ? 63.506  52.176  -16.321 1.00 52.44  ? 130  LYS A CG     1 
ATOM   2085  C  CD     . LYS A 1 133 ? 64.732  51.878  -15.469 1.00 62.74  ? 130  LYS A CD     1 
ATOM   2086  C  CE     . LYS A 1 133 ? 65.005  52.961  -14.447 1.00 62.85  ? 130  LYS A CE     1 
ATOM   2087  N  NZ     . LYS A 1 133 ? 66.027  52.517  -13.460 1.00 88.41  ? 130  LYS A NZ     1 
ATOM   2088  H  H      . LYS A 1 133 ? 61.264  53.790  -17.111 1.00 56.53  ? 130  LYS A H      1 
ATOM   2089  H  HA     . LYS A 1 133 ? 61.131  51.157  -16.950 1.00 52.22  ? 130  LYS A HA     1 
ATOM   2090  H  HB2    . LYS A 1 133 ? 62.118  53.008  -15.064 1.00 50.16  ? 130  LYS A HB2    1 
ATOM   2091  H  HB3    . LYS A 1 133 ? 62.246  51.433  -14.886 1.00 50.16  ? 130  LYS A HB3    1 
ATOM   2092  H  HG2    . LYS A 1 133 ? 63.458  51.504  -17.019 1.00 62.93  ? 130  LYS A HG2    1 
ATOM   2093  H  HG3    . LYS A 1 133 ? 63.623  53.054  -16.715 1.00 62.93  ? 130  LYS A HG3    1 
ATOM   2094  H  HD2    . LYS A 1 133 ? 64.592  51.044  -14.993 1.00 75.29  ? 130  LYS A HD2    1 
ATOM   2095  H  HD3    . LYS A 1 133 ? 65.508  51.805  -16.046 1.00 75.29  ? 130  LYS A HD3    1 
ATOM   2096  H  HE2    . LYS A 1 133 ? 65.339  53.752  -14.898 1.00 75.42  ? 130  LYS A HE2    1 
ATOM   2097  H  HE3    . LYS A 1 133 ? 64.187  53.166  -13.968 1.00 75.42  ? 130  LYS A HE3    1 
ATOM   2098  H  HZ1    . LYS A 1 133 ? 66.790  52.325  -13.878 1.00 106.10 ? 130  LYS A HZ1    1 
ATOM   2099  H  HZ2    . LYS A 1 133 ? 66.178  53.163  -12.867 1.00 106.10 ? 130  LYS A HZ2    1 
ATOM   2100  H  HZ3    . LYS A 1 133 ? 65.741  51.792  -13.032 1.00 106.10 ? 130  LYS A HZ3    1 
ATOM   2101  N  N      . CYS A 1 134 ? 58.976  52.816  -15.349 1.00 34.70  ? 131  CYS A N      1 
ATOM   2102  C  CA     . CYS A 1 134 ? 57.749  52.724  -14.562 1.00 34.19  ? 131  CYS A CA     1 
ATOM   2103  C  C      . CYS A 1 134 ? 56.464  52.811  -15.395 1.00 34.76  ? 131  CYS A C      1 
ATOM   2104  O  O      . CYS A 1 134 ? 55.389  52.483  -14.886 1.00 24.32  ? 131  CYS A O      1 
ATOM   2105  C  CB     . CYS A 1 134 ? 57.745  53.808  -13.478 1.00 47.03  ? 131  CYS A CB     1 
ATOM   2106  S  SG     . CYS A 1 134 ? 57.891  55.521  -14.027 1.00 33.92  ? 131  CYS A SG     1 
ATOM   2107  H  H      . CYS A 1 134 ? 59.164  53.611  -15.618 1.00 41.63  ? 131  CYS A H      1 
ATOM   2108  H  HA     . CYS A 1 134 ? 57.742  51.866  -14.111 1.00 41.02  ? 131  CYS A HA     1 
ATOM   2109  H  HB2    . CYS A 1 134 ? 56.912  53.737  -12.985 1.00 56.43  ? 131  CYS A HB2    1 
ATOM   2110  H  HB3    . CYS A 1 134 ? 58.487  53.636  -12.878 1.00 56.43  ? 131  CYS A HB3    1 
ATOM   2111  N  N      . TRP A 1 135 ? 56.553  53.282  -16.643 1.00 39.43  ? 132  TRP A N      1 
ATOM   2112  C  CA     . TRP A 1 135 ? 55.355  53.403  -17.482 1.00 34.30  ? 132  TRP A CA     1 
ATOM   2113  C  C      . TRP A 1 135 ? 54.622  52.079  -17.714 1.00 30.65  ? 132  TRP A C      1 
ATOM   2114  O  O      . TRP A 1 135 ? 53.406  52.064  -17.899 1.00 27.41  ? 132  TRP A O      1 
ATOM   2115  C  CB     . TRP A 1 135 ? 55.677  53.986  -18.857 1.00 31.76  ? 132  TRP A CB     1 
ATOM   2116  C  CG     . TRP A 1 135 ? 54.406  54.268  -19.606 1.00 30.84  ? 132  TRP A CG     1 
ATOM   2117  C  CD1    . TRP A 1 135 ? 53.914  53.586  -20.677 1.00 34.01  ? 132  TRP A CD1    1 
ATOM   2118  C  CD2    . TRP A 1 135 ? 53.465  55.312  -19.329 1.00 31.00  ? 132  TRP A CD2    1 
ATOM   2119  N  NE1    . TRP A 1 135 ? 52.716  54.129  -21.075 1.00 40.71  ? 132  TRP A NE1    1 
ATOM   2120  C  CE2    . TRP A 1 135 ? 52.423  55.195  -20.266 1.00 33.90  ? 132  TRP A CE2    1 
ATOM   2121  C  CE3    . TRP A 1 135 ? 53.403  56.333  -18.378 1.00 32.12  ? 132  TRP A CE3    1 
ATOM   2122  C  CZ2    . TRP A 1 135 ? 51.334  56.060  -20.280 1.00 40.15  ? 132  TRP A CZ2    1 
ATOM   2123  C  CZ3    . TRP A 1 135 ? 52.324  57.189  -18.392 1.00 32.99  ? 132  TRP A CZ3    1 
ATOM   2124  C  CH2    . TRP A 1 135 ? 51.303  57.049  -19.335 1.00 38.92  ? 132  TRP A CH2    1 
ATOM   2125  H  H      . TRP A 1 135 ? 57.283  53.534  -17.023 1.00 47.32  ? 132  TRP A H      1 
ATOM   2126  H  HA     . TRP A 1 135 ? 54.735  54.008  -17.045 1.00 41.16  ? 132  TRP A HA     1 
ATOM   2127  H  HB2    . TRP A 1 135 ? 56.164  54.819  -18.751 1.00 38.11  ? 132  TRP A HB2    1 
ATOM   2128  H  HB3    . TRP A 1 135 ? 56.200  53.348  -19.366 1.00 38.11  ? 132  TRP A HB3    1 
ATOM   2129  H  HD1    . TRP A 1 135 ? 54.320  52.846  -21.068 1.00 40.82  ? 132  TRP A HD1    1 
ATOM   2130  H  HE1    . TRP A 1 135 ? 52.236  53.853  -21.733 1.00 48.85  ? 132  TRP A HE1    1 
ATOM   2131  H  HE3    . TRP A 1 135 ? 54.076  56.430  -17.743 1.00 38.55  ? 132  TRP A HE3    1 
ATOM   2132  H  HZ2    . TRP A 1 135 ? 50.655  55.971  -20.909 1.00 48.18  ? 132  TRP A HZ2    1 
ATOM   2133  H  HZ3    . TRP A 1 135 ? 52.273  57.871  -17.761 1.00 39.59  ? 132  TRP A HZ3    1 
ATOM   2134  H  HH2    . TRP A 1 135 ? 50.587  57.643  -19.322 1.00 46.70  ? 132  TRP A HH2    1 
ATOM   2135  N  N      . THR A 1 136 ? 55.359  50.973  -17.667 1.00 26.75  ? 133  THR A N      1 
ATOM   2136  C  CA     . THR A 1 136 ? 54.777  49.641  -17.841 1.00 22.30  ? 133  THR A CA     1 
ATOM   2137  C  C      . THR A 1 136 ? 53.580  49.430  -16.924 1.00 27.97  ? 133  THR A C      1 
ATOM   2138  O  O      . THR A 1 136 ? 52.699  48.619  -17.210 1.00 30.19  ? 133  THR A O      1 
ATOM   2139  C  CB     . THR A 1 136 ? 55.804  48.527  -17.566 1.00 23.93  ? 133  THR A CB     1 
ATOM   2140  O  OG1    . THR A 1 136 ? 57.066  48.871  -18.152 1.00 24.79  ? 133  THR A OG1    1 
ATOM   2141  C  CG2    . THR A 1 136 ? 55.326  47.204  -18.139 1.00 22.62  ? 133  THR A CG2    1 
ATOM   2142  H  H      . THR A 1 136 ? 56.208  50.966  -17.535 1.00 32.10  ? 133  THR A H      1 
ATOM   2143  H  HA     . THR A 1 136 ? 54.473  49.548  -18.757 1.00 26.76  ? 133  THR A HA     1 
ATOM   2144  H  HB     . THR A 1 136 ? 55.914  48.422  -16.608 1.00 28.72  ? 133  THR A HB     1 
ATOM   2145  H  HG1    . THR A 1 136 ? 57.627  48.264  -18.003 1.00 29.75  ? 133  THR A HG1    1 
ATOM   2146  H  HG21   . THR A 1 136 ? 55.205  47.282  -19.098 1.00 27.15  ? 133  THR A HG21   1 
ATOM   2147  H  HG22   . THR A 1 136 ? 55.980  46.510  -17.960 1.00 27.15  ? 133  THR A HG22   1 
ATOM   2148  H  HG23   . THR A 1 136 ? 54.482  46.953  -17.734 1.00 27.15  ? 133  THR A HG23   1 
ATOM   2149  N  N      . LEU A 1 137 ? 53.572  50.143  -15.802 1.00 24.81  ? 134  LEU A N      1 
ATOM   2150  C  CA     . LEU A 1 137 ? 52.466  50.085  -14.863 1.00 28.67  ? 134  LEU A CA     1 
ATOM   2151  C  C      . LEU A 1 137 ? 51.172  50.521  -15.540 1.00 31.22  ? 134  LEU A C      1 
ATOM   2152  O  O      . LEU A 1 137 ? 50.124  49.915  -15.325 1.00 41.12  ? 134  LEU A O      1 
ATOM   2153  C  CB     . LEU A 1 137 ? 52.755  50.957  -13.637 1.00 35.25  ? 134  LEU A CB     1 
ATOM   2154  C  CG     . LEU A 1 137 ? 53.826  50.446  -12.662 1.00 28.28  ? 134  LEU A CG     1 
ATOM   2155  C  CD1    . LEU A 1 137 ? 53.998  51.445  -11.533 1.00 30.18  ? 134  LEU A CD1    1 
ATOM   2156  C  CD2    . LEU A 1 137 ? 53.517  49.060  -12.113 1.00 22.22  ? 134  LEU A CD2    1 
ATOM   2157  H  H      . LEU A 1 137 ? 54.205  50.674  -15.563 1.00 29.77  ? 134  LEU A H      1 
ATOM   2158  H  HA     . LEU A 1 137 ? 52.354  49.170  -14.562 1.00 34.40  ? 134  LEU A HA     1 
ATOM   2159  H  HB2    . LEU A 1 137 ? 53.043  51.829  -13.948 1.00 42.30  ? 134  LEU A HB2    1 
ATOM   2160  H  HB3    . LEU A 1 137 ? 51.932  51.053  -13.134 1.00 42.30  ? 134  LEU A HB3    1 
ATOM   2161  H  HG     . LEU A 1 137 ? 54.672  50.391  -13.134 1.00 33.94  ? 134  LEU A HG     1 
ATOM   2162  H  HD11   . LEU A 1 137 ? 53.153  51.544  -11.068 1.00 36.22  ? 134  LEU A HD11   1 
ATOM   2163  H  HD12   . LEU A 1 137 ? 54.676  51.116  -10.921 1.00 36.22  ? 134  LEU A HD12   1 
ATOM   2164  H  HD13   . LEU A 1 137 ? 54.274  52.297  -11.905 1.00 36.22  ? 134  LEU A HD13   1 
ATOM   2165  H  HD21   . LEU A 1 137 ? 53.461  48.433  -12.852 1.00 26.67  ? 134  LEU A HD21   1 
ATOM   2166  H  HD22   . LEU A 1 137 ? 54.227  48.795  -11.507 1.00 26.67  ? 134  LEU A HD22   1 
ATOM   2167  H  HD23   . LEU A 1 137 ? 52.671  49.089  -11.640 1.00 26.67  ? 134  LEU A HD23   1 
ATOM   2168  N  N      . MET A 1 138 ? 51.243  51.577  -16.345 1.00 29.53  ? 135  MET A N      1 
ATOM   2169  C  CA     . MET A 1 138 ? 50.071  52.068  -17.072 1.00 29.16  ? 135  MET A CA     1 
ATOM   2170  C  C      . MET A 1 138 ? 49.609  51.060  -18.118 1.00 35.72  ? 135  MET A C      1 
ATOM   2171  O  O      . MET A 1 138 ? 48.407  50.881  -18.331 1.00 28.99  ? 135  MET A O      1 
ATOM   2172  C  CB     . MET A 1 138 ? 50.364  53.425  -17.718 1.00 34.22  ? 135  MET A CB     1 
ATOM   2173  C  CG     . MET A 1 138 ? 50.445  54.569  -16.717 1.00 30.47  ? 135  MET A CG     1 
ATOM   2174  S  SD     . MET A 1 138 ? 48.977  54.629  -15.668 1.00 45.49  ? 135  MET A SD     1 
ATOM   2175  C  CE     . MET A 1 138 ? 49.519  55.714  -14.360 1.00 49.10  ? 135  MET A CE     1 
ATOM   2176  H  H      . MET A 1 138 ? 51.959  52.030  -16.489 1.00 35.44  ? 135  MET A H      1 
ATOM   2177  H  HA     . MET A 1 138 ? 49.350  52.199  -16.436 1.00 34.99  ? 135  MET A HA     1 
ATOM   2178  H  HB2    . MET A 1 138 ? 51.214  53.374  -18.182 1.00 41.06  ? 135  MET A HB2    1 
ATOM   2179  H  HB3    . MET A 1 138 ? 49.656  53.631  -18.349 1.00 41.06  ? 135  MET A HB3    1 
ATOM   2180  H  HG2    . MET A 1 138 ? 51.220  54.444  -16.149 1.00 36.56  ? 135  MET A HG2    1 
ATOM   2181  H  HG3    . MET A 1 138 ? 50.511  55.410  -17.196 1.00 36.56  ? 135  MET A HG3    1 
ATOM   2182  H  HE1    . MET A 1 138 ? 49.757  56.573  -14.742 1.00 58.92  ? 135  MET A HE1    1 
ATOM   2183  H  HE2    . MET A 1 138 ? 48.797  55.823  -13.722 1.00 58.92  ? 135  MET A HE2    1 
ATOM   2184  H  HE3    . MET A 1 138 ? 50.291  55.320  -13.924 1.00 58.92  ? 135  MET A HE3    1 
ATOM   2185  N  N      . THR A 1 139 ? 50.566  50.399  -18.762 1.00 35.53  ? 136  THR A N      1 
ATOM   2186  C  CA     . THR A 1 139 ? 50.245  49.375  -19.742 1.00 25.09  ? 136  THR A CA     1 
ATOM   2187  C  C      . THR A 1 139 ? 49.428  48.292  -19.054 1.00 30.94  ? 136  THR A C      1 
ATOM   2188  O  O      . THR A 1 139 ? 48.376  47.895  -19.552 1.00 37.40  ? 136  THR A O      1 
ATOM   2189  C  CB     . THR A 1 139 ? 51.521  48.760  -20.357 1.00 27.33  ? 136  THR A CB     1 
ATOM   2190  O  OG1    . THR A 1 139 ? 52.254  49.769  -21.065 1.00 33.73  ? 136  THR A OG1    1 
ATOM   2191  C  CG2    . THR A 1 139 ? 51.188  47.620  -21.314 1.00 31.64  ? 136  THR A CG2    1 
ATOM   2192  H  H      . THR A 1 139 ? 51.409  50.528  -18.648 1.00 42.64  ? 136  THR A H      1 
ATOM   2193  H  HA     . THR A 1 139 ? 49.712  49.761  -20.455 1.00 30.11  ? 136  THR A HA     1 
ATOM   2194  H  HB     . THR A 1 139 ? 52.077  48.405  -19.646 1.00 32.79  ? 136  THR A HB     1 
ATOM   2195  H  HG1    . THR A 1 139 ? 52.949  49.438  -21.401 1.00 40.47  ? 136  THR A HG1    1 
ATOM   2196  H  HG21   . THR A 1 139 ? 50.631  47.947  -22.037 1.00 37.97  ? 136  THR A HG21   1 
ATOM   2197  H  HG22   . THR A 1 139 ? 52.004  47.251  -21.686 1.00 37.97  ? 136  THR A HG22   1 
ATOM   2198  H  HG23   . THR A 1 139 ? 50.712  46.919  -20.841 1.00 37.97  ? 136  THR A HG23   1 
ATOM   2199  N  N      . MET A 1 140 ? 49.901  47.828  -17.903 1.00 25.31  ? 137  MET A N      1 
ATOM   2200  C  CA     . MET A 1 140 ? 49.202  46.786  -17.166 1.00 20.83  ? 137  MET A CA     1 
ATOM   2201  C  C      . MET A 1 140 ? 47.861  47.301  -16.645 1.00 23.18  ? 137  MET A C      1 
ATOM   2202  O  O      . MET A 1 140 ? 46.918  46.533  -16.474 1.00 22.55  ? 137  MET A O      1 
ATOM   2203  C  CB     . MET A 1 140 ? 50.052  46.274  -16.006 1.00 22.67  ? 137  MET A CB     1 
ATOM   2204  C  CG     . MET A 1 140 ? 51.241  45.423  -16.409 1.00 33.45  ? 137  MET A CG     1 
ATOM   2205  S  SD     . MET A 1 140 ? 52.151  44.813  -14.969 1.00 31.83  ? 137  MET A SD     1 
ATOM   2206  C  CE     . MET A 1 140 ? 52.924  46.329  -14.439 1.00 38.09  ? 137  MET A CE     1 
ATOM   2207  H  H      . MET A 1 140 ? 50.625  48.101  -17.527 1.00 30.37  ? 137  MET A H      1 
ATOM   2208  H  HA     . MET A 1 140 ? 49.038  46.040  -17.763 1.00 25.00  ? 137  MET A HA     1 
ATOM   2209  H  HB2    . MET A 1 140 ? 50.392  47.036  -15.513 1.00 27.21  ? 137  MET A HB2    1 
ATOM   2210  H  HB3    . MET A 1 140 ? 49.490  45.736  -15.426 1.00 27.21  ? 137  MET A HB3    1 
ATOM   2211  H  HG2    . MET A 1 140 ? 50.927  44.657  -16.916 1.00 40.13  ? 137  MET A HG2    1 
ATOM   2212  H  HG3    . MET A 1 140 ? 51.846  45.956  -16.948 1.00 40.13  ? 137  MET A HG3    1 
ATOM   2213  H  HE1    . MET A 1 140 ? 52.235  46.978  -14.230 1.00 45.71  ? 137  MET A HE1    1 
ATOM   2214  H  HE2    . MET A 1 140 ? 53.462  46.151  -13.652 1.00 45.71  ? 137  MET A HE2    1 
ATOM   2215  H  HE3    . MET A 1 140 ? 53.487  46.663  -15.156 1.00 45.71  ? 137  MET A HE3    1 
ATOM   2216  N  N      . ALA A 1 141 ? 47.790  48.595  -16.350 1.00 18.91  ? 138  ALA A N      1 
ATOM   2217  C  CA     . ALA A 1 141 ? 46.560  49.183  -15.828 1.00 21.53  ? 138  ALA A CA     1 
ATOM   2218  C  C      . ALA A 1 141 ? 45.482  49.173  -16.885 1.00 35.14  ? 138  ALA A C      1 
ATOM   2219  O  O      . ALA A 1 141 ? 44.352  48.749  -16.630 1.00 28.52  ? 138  ALA A O      1 
ATOM   2220  C  CB     . ALA A 1 141 ? 46.804  50.594  -15.350 1.00 25.91  ? 138  ALA A CB     1 
ATOM   2221  H  H      . ALA A 1 141 ? 48.437  49.154  -16.444 1.00 22.69  ? 138  ALA A H      1 
ATOM   2222  H  HA     . ALA A 1 141 ? 46.251  48.657  -15.074 1.00 25.84  ? 138  ALA A HA     1 
ATOM   2223  H  HB1    . ALA A 1 141 ? 47.120  51.129  -16.095 1.00 31.09  ? 138  ALA A HB1    1 
ATOM   2224  H  HB2    . ALA A 1 141 ? 45.973  50.959  -15.009 1.00 31.09  ? 138  ALA A HB2    1 
ATOM   2225  H  HB3    . ALA A 1 141 ? 47.472  50.578  -14.647 1.00 31.09  ? 138  ALA A HB3    1 
ATOM   2226  N  N      . ILE A 1 142 ? 45.851  49.659  -18.069 1.00 36.89  ? 139  ILE A N      1 
ATOM   2227  C  CA     . ILE A 1 142 ? 44.961  49.691  -19.226 1.00 34.22  ? 139  ILE A CA     1 
ATOM   2228  C  C      . ILE A 1 142 ? 44.516  48.276  -19.601 1.00 36.11  ? 139  ILE A C      1 
ATOM   2229  O  O      . ILE A 1 142 ? 43.323  48.013  -19.762 1.00 31.49  ? 139  ILE A O      1 
ATOM   2230  C  CB     . ILE A 1 142 ? 45.632  50.382  -20.437 1.00 31.92  ? 139  ILE A CB     1 
ATOM   2231  C  CG1    . ILE A 1 142 ? 45.838  51.873  -20.142 1.00 34.28  ? 139  ILE A CG1    1 
ATOM   2232  C  CG2    . ILE A 1 142 ? 44.760  50.245  -21.679 1.00 33.06  ? 139  ILE A CG2    1 
ATOM   2233  C  CD1    . ILE A 1 142 ? 46.481  52.675  -21.273 1.00 12.35  ? 139  ILE A CD1    1 
ATOM   2234  H  H      . ILE A 1 142 ? 46.631  49.983  -18.229 1.00 44.27  ? 139  ILE A H      1 
ATOM   2235  H  HA     . ILE A 1 142 ? 44.168  50.200  -18.996 1.00 41.06  ? 139  ILE A HA     1 
ATOM   2236  H  HB     . ILE A 1 142 ? 46.493  49.968  -20.605 1.00 38.30  ? 139  ILE A HB     1 
ATOM   2237  H  HG12   . ILE A 1 142 ? 44.974  52.272  -19.955 1.00 41.14  ? 139  ILE A HG12   1 
ATOM   2238  H  HG13   . ILE A 1 142 ? 46.410  51.956  -19.363 1.00 41.14  ? 139  ILE A HG13   1 
ATOM   2239  H  HG21   . ILE A 1 142 ? 43.901  50.663  -21.508 1.00 39.68  ? 139  ILE A HG21   1 
ATOM   2240  H  HG22   . ILE A 1 142 ? 45.200  50.685  -22.423 1.00 39.68  ? 139  ILE A HG22   1 
ATOM   2241  H  HG23   . ILE A 1 142 ? 44.637  49.304  -21.876 1.00 39.68  ? 139  ILE A HG23   1 
ATOM   2242  H  HD11   . ILE A 1 142 ? 45.916  52.619  -22.059 1.00 14.82  ? 139  ILE A HD11   1 
ATOM   2243  H  HD12   . ILE A 1 142 ? 46.569  53.599  -20.993 1.00 14.82  ? 139  ILE A HD12   1 
ATOM   2244  H  HD13   . ILE A 1 142 ? 47.355  52.302  -21.466 1.00 14.82  ? 139  ILE A HD13   1 
ATOM   2245  N  N      . ARG A 1 143 ? 45.477  47.368  -19.735 1.00 23.43  ? 140  ARG A N      1 
ATOM   2246  C  CA     . ARG A 1 143 ? 45.162  46.001  -20.114 1.00 20.31  ? 140  ARG A CA     1 
ATOM   2247  C  C      . ARG A 1 143 ? 44.206  45.352  -19.119 1.00 28.11  ? 140  ARG A C      1 
ATOM   2248  O  O      . ARG A 1 143 ? 43.205  44.761  -19.513 1.00 40.49  ? 140  ARG A O      1 
ATOM   2249  C  CB     . ARG A 1 143 ? 46.446  45.171  -20.201 1.00 24.70  ? 140  ARG A CB     1 
ATOM   2250  C  CG     . ARG A 1 143 ? 47.302  45.430  -21.438 1.00 39.16  ? 140  ARG A CG     1 
ATOM   2251  C  CD     . ARG A 1 143 ? 46.784  44.667  -22.647 1.00 57.69  ? 140  ARG A CD     1 
ATOM   2252  N  NE     . ARG A 1 143 ? 46.804  43.226  -22.411 1.00 67.72  ? 140  ARG A NE     1 
ATOM   2253  C  CZ     . ARG A 1 143 ? 47.886  42.461  -22.533 1.00 67.51  ? 140  ARG A CZ     1 
ATOM   2254  N  NH1    . ARG A 1 143 ? 49.049  42.991  -22.898 1.00 56.51  ? 140  ARG A NH1    1 
ATOM   2255  N  NH2    . ARG A 1 143 ? 47.805  41.158  -22.291 1.00 47.49  ? 140  ARG A NH2    1 
ATOM   2256  H  H      . ARG A 1 143 ? 46.315  47.520  -19.613 1.00 28.11  ? 140  ARG A H      1 
ATOM   2257  H  HA     . ARG A 1 143 ? 44.739  46.000  -20.987 1.00 24.38  ? 140  ARG A HA     1 
ATOM   2258  H  HB2    . ARG A 1 143 ? 46.991  45.365  -19.423 1.00 29.64  ? 140  ARG A HB2    1 
ATOM   2259  H  HB3    . ARG A 1 143 ? 46.206  44.231  -20.204 1.00 29.64  ? 140  ARG A HB3    1 
ATOM   2260  H  HG2    . ARG A 1 143 ? 47.284  46.378  -21.646 1.00 46.99  ? 140  ARG A HG2    1 
ATOM   2261  H  HG3    . ARG A 1 143 ? 48.211  45.142  -21.263 1.00 46.99  ? 140  ARG A HG3    1 
ATOM   2262  H  HD2    . ARG A 1 143 ? 45.869  44.934  -22.827 1.00 69.23  ? 140  ARG A HD2    1 
ATOM   2263  H  HD3    . ARG A 1 143 ? 47.348  44.859  -23.413 1.00 69.23  ? 140  ARG A HD3    1 
ATOM   2264  H  HE     . ARG A 1 143 ? 46.068  42.846  -22.178 1.00 81.26  ? 140  ARG A HE     1 
ATOM   2265  H  HH11   . ARG A 1 143 ? 49.107  43.835  -23.055 1.00 67.81  ? 140  ARG A HH11   1 
ATOM   2266  H  HH12   . ARG A 1 143 ? 49.744  42.491  -22.977 1.00 67.81  ? 140  ARG A HH12   1 
ATOM   2267  H  HH21   . ARG A 1 143 ? 47.054  40.810  -22.056 1.00 56.99  ? 140  ARG A HH21   1 
ATOM   2268  H  HH22   . ARG A 1 143 ? 48.502  40.661  -22.372 1.00 56.99  ? 140  ARG A HH22   1 
ATOM   2269  N  N      . ILE A 1 144 ? 44.509  45.492  -17.831 1.00 31.16  ? 141  ILE A N      1 
ATOM   2270  C  CA     . ILE A 1 144 ? 43.726  44.884  -16.751 1.00 27.10  ? 141  ILE A CA     1 
ATOM   2271  C  C      . ILE A 1 144 ? 42.303  45.420  -16.652 1.00 30.15  ? 141  ILE A C      1 
ATOM   2272  O  O      . ILE A 1 144 ? 41.349  44.656  -16.508 1.00 31.09  ? 141  ILE A O      1 
ATOM   2273  C  CB     . ILE A 1 144 ? 44.431  45.096  -15.389 1.00 22.70  ? 141  ILE A CB     1 
ATOM   2274  C  CG1    . ILE A 1 144 ? 45.633  44.165  -15.291 1.00 16.59  ? 141  ILE A CG1    1 
ATOM   2275  C  CG2    . ILE A 1 144 ? 43.479  44.825  -14.211 1.00 18.07  ? 141  ILE A CG2    1 
ATOM   2276  C  CD1    . ILE A 1 144 ? 46.497  44.408  -14.097 1.00 30.60  ? 141  ILE A CD1    1 
ATOM   2277  H  H      . ILE A 1 144 ? 45.182  45.946  -17.548 1.00 37.39  ? 141  ILE A H      1 
ATOM   2278  H  HA     . ILE A 1 144 ? 43.670  43.929  -16.909 1.00 32.52  ? 141  ILE A HA     1 
ATOM   2279  H  HB     . ILE A 1 144 ? 44.740  46.013  -15.336 1.00 27.24  ? 141  ILE A HB     1 
ATOM   2280  H  HG12   . ILE A 1 144 ? 45.316  43.250  -15.244 1.00 19.91  ? 141  ILE A HG12   1 
ATOM   2281  H  HG13   . ILE A 1 144 ? 46.182  44.282  -16.082 1.00 19.91  ? 141  ILE A HG13   1 
ATOM   2282  H  HG21   . ILE A 1 144 ? 43.168  43.907  -14.261 1.00 21.69  ? 141  ILE A HG21   1 
ATOM   2283  H  HG22   . ILE A 1 144 ? 43.957  44.968  -13.379 1.00 21.69  ? 141  ILE A HG22   1 
ATOM   2284  H  HG23   . ILE A 1 144 ? 42.725  45.433  -14.268 1.00 21.69  ? 141  ILE A HG23   1 
ATOM   2285  H  HD11   . ILE A 1 144 ? 45.968  44.283  -13.294 1.00 36.72  ? 141  ILE A HD11   1 
ATOM   2286  H  HD12   . ILE A 1 144 ? 47.235  43.779  -14.109 1.00 36.72  ? 141  ILE A HD12   1 
ATOM   2287  H  HD13   . ILE A 1 144 ? 46.835  45.317  -14.133 1.00 36.72  ? 141  ILE A HD13   1 
ATOM   2288  N  N      . ILE A 1 145 ? 42.178  46.741  -16.694 1.00 28.59  ? 142  ILE A N      1 
ATOM   2289  C  CA     . ILE A 1 145 ? 40.893  47.404  -16.515 1.00 42.51  ? 142  ILE A CA     1 
ATOM   2290  C  C      . ILE A 1 145 ? 40.032  47.338  -17.780 1.00 47.03  ? 142  ILE A C      1 
ATOM   2291  O  O      . ILE A 1 145 ? 38.829  47.074  -17.708 1.00 39.64  ? 142  ILE A O      1 
ATOM   2292  C  CB     . ILE A 1 145 ? 41.119  48.871  -16.081 1.00 31.21  ? 142  ILE A CB     1 
ATOM   2293  C  CG1    . ILE A 1 145 ? 41.482  48.901  -14.601 1.00 25.53  ? 142  ILE A CG1    1 
ATOM   2294  C  CG2    . ILE A 1 145 ? 39.882  49.736  -16.326 1.00 32.90  ? 142  ILE A CG2    1 
ATOM   2295  C  CD1    . ILE A 1 145 ? 42.052  50.205  -14.143 1.00 49.87  ? 142  ILE A CD1    1 
ATOM   2296  H  H      . ILE A 1 145 ? 42.832  47.283  -16.827 1.00 34.31  ? 142  ILE A H      1 
ATOM   2297  H  HA     . ILE A 1 145 ? 40.408  46.957  -15.804 1.00 51.02  ? 142  ILE A HA     1 
ATOM   2298  H  HB     . ILE A 1 145 ? 41.860  49.235  -16.590 1.00 37.45  ? 142  ILE A HB     1 
ATOM   2299  H  HG12   . ILE A 1 145 ? 40.682  48.728  -14.080 1.00 30.64  ? 142  ILE A HG12   1 
ATOM   2300  H  HG13   . ILE A 1 145 ? 42.142  48.212  -14.427 1.00 30.64  ? 142  ILE A HG13   1 
ATOM   2301  H  HG21   . ILE A 1 145 ? 39.139  49.376  -15.817 1.00 39.48  ? 142  ILE A HG21   1 
ATOM   2302  H  HG22   . ILE A 1 145 ? 40.071  50.644  -16.040 1.00 39.48  ? 142  ILE A HG22   1 
ATOM   2303  H  HG23   . ILE A 1 145 ? 39.672  49.724  -17.273 1.00 39.48  ? 142  ILE A HG23   1 
ATOM   2304  H  HD11   . ILE A 1 145 ? 41.399  50.906  -14.297 1.00 59.85  ? 142  ILE A HD11   1 
ATOM   2305  H  HD12   . ILE A 1 145 ? 42.255  50.145  -13.196 1.00 59.85  ? 142  ILE A HD12   1 
ATOM   2306  H  HD13   . ILE A 1 145 ? 42.861  50.389  -14.645 1.00 59.85  ? 142  ILE A HD13   1 
ATOM   2307  N  N      . ASP A 1 146 ? 40.642  47.587  -18.934 1.00 34.38  ? 143  ASP A N      1 
ATOM   2308  C  CA     . ASP A 1 146 ? 39.899  47.534  -20.182 1.00 39.91  ? 143  ASP A CA     1 
ATOM   2309  C  C      . ASP A 1 146 ? 39.336  46.138  -20.390 1.00 43.30  ? 143  ASP A C      1 
ATOM   2310  O  O      . ASP A 1 146 ? 38.235  45.987  -20.909 1.00 50.43  ? 143  ASP A O      1 
ATOM   2311  C  CB     . ASP A 1 146 ? 40.780  47.926  -21.369 1.00 43.67  ? 143  ASP A CB     1 
ATOM   2312  C  CG     . ASP A 1 146 ? 40.026  47.909  -22.687 1.00 50.95  ? 143  ASP A CG     1 
ATOM   2313  O  OD1    . ASP A 1 146 ? 39.348  48.912  -23.008 1.00 53.52  ? 143  ASP A OD1    1 
ATOM   2314  O  OD2    . ASP A 1 146 ? 40.108  46.888  -23.404 1.00 55.53  ? 143  ASP A OD2    1 
ATOM   2315  H  H      . ASP A 1 146 ? 41.474  47.787  -19.020 1.00 41.25  ? 143  ASP A H      1 
ATOM   2316  H  HA     . ASP A 1 146 ? 39.156  48.157  -20.138 1.00 47.89  ? 143  ASP A HA     1 
ATOM   2317  H  HB2    . ASP A 1 146 ? 41.119  48.824  -21.229 1.00 52.41  ? 143  ASP A HB2    1 
ATOM   2318  H  HB3    . ASP A 1 146 ? 41.517  47.299  -21.436 1.00 52.41  ? 143  ASP A HB3    1 
ATOM   2319  N  N      . ARG A 1 147 ? 40.091  45.124  -19.973 1.00 30.43  ? 144  ARG A N      1 
ATOM   2320  C  CA     . ARG A 1 147 ? 39.630  43.751  -20.097 1.00 26.46  ? 144  ARG A CA     1 
ATOM   2321  C  C      . ARG A 1 147 ? 38.382  43.553  -19.246 1.00 28.86  ? 144  ARG A C      1 
ATOM   2322  O  O      . ARG A 1 147 ? 37.470  42.832  -19.632 1.00 55.08  ? 144  ARG A O      1 
ATOM   2323  C  CB     . ARG A 1 147 ? 40.714  42.759  -19.673 1.00 23.67  ? 144  ARG A CB     1 
ATOM   2324  C  CG     . ARG A 1 147 ? 40.329  41.294  -19.873 1.00 20.72  ? 144  ARG A CG     1 
ATOM   2325  C  CD     . ARG A 1 147 ? 40.825  40.407  -18.753 1.00 25.82  ? 144  ARG A CD     1 
ATOM   2326  N  NE     . ARG A 1 147 ? 40.254  40.823  -17.475 1.00 49.09  ? 144  ARG A NE     1 
ATOM   2327  C  CZ     . ARG A 1 147 ? 39.031  40.505  -17.058 1.00 45.11  ? 144  ARG A CZ     1 
ATOM   2328  N  NH1    . ARG A 1 147 ? 38.240  39.754  -17.808 1.00 27.76  ? 144  ARG A NH1    1 
ATOM   2329  N  NH2    . ARG A 1 147 ? 38.598  40.940  -15.884 1.00 44.51  ? 144  ARG A NH2    1 
ATOM   2330  H  H      . ARG A 1 147 ? 40.870  45.207  -19.618 1.00 36.51  ? 144  ARG A H      1 
ATOM   2331  H  HA     . ARG A 1 147 ? 39.399  43.573  -21.022 1.00 31.76  ? 144  ARG A HA     1 
ATOM   2332  H  HB2    . ARG A 1 147 ? 41.513  42.929  -20.194 1.00 28.40  ? 144  ARG A HB2    1 
ATOM   2333  H  HB3    . ARG A 1 147 ? 40.903  42.889  -18.730 1.00 28.40  ? 144  ARG A HB3    1 
ATOM   2334  H  HG2    . ARG A 1 147 ? 39.362  41.222  -19.908 1.00 24.86  ? 144  ARG A HG2    1 
ATOM   2335  H  HG3    . ARG A 1 147 ? 40.716  40.976  -20.703 1.00 24.86  ? 144  ARG A HG3    1 
ATOM   2336  H  HD2    . ARG A 1 147 ? 40.558  39.491  -18.924 1.00 30.99  ? 144  ARG A HD2    1 
ATOM   2337  H  HD3    . ARG A 1 147 ? 41.791  40.473  -18.693 1.00 30.99  ? 144  ARG A HD3    1 
ATOM   2338  H  HE     . ARG A 1 147 ? 40.741  41.307  -16.957 1.00 58.91  ? 144  ARG A HE     1 
ATOM   2339  H  HH11   . ARG A 1 147 ? 38.514  39.471  -18.573 1.00 33.31  ? 144  ARG A HH11   1 
ATOM   2340  H  HH12   . ARG A 1 147 ? 37.451  39.552  -17.532 1.00 33.31  ? 144  ARG A HH12   1 
ATOM   2341  H  HH21   . ARG A 1 147 ? 39.107  41.426  -15.391 1.00 53.42  ? 144  ARG A HH21   1 
ATOM   2342  H  HH22   . ARG A 1 147 ? 37.809  40.730  -15.613 1.00 53.42  ? 144  ARG A HH22   1 
ATOM   2343  N  N      . ALA A 1 148 ? 38.339  44.189  -18.083 1.00 30.19  ? 145  ALA A N      1 
ATOM   2344  C  CA     . ALA A 1 148 ? 37.204  44.010  -17.190 1.00 42.49  ? 145  ALA A CA     1 
ATOM   2345  C  C      . ALA A 1 148 ? 36.009  44.770  -17.733 1.00 42.67  ? 145  ALA A C      1 
ATOM   2346  O  O      . ALA A 1 148 ? 34.885  44.275  -17.727 1.00 47.15  ? 145  ALA A O      1 
ATOM   2347  C  CB     . ALA A 1 148 ? 37.546  44.484  -15.781 1.00 58.15  ? 145  ALA A CB     1 
ATOM   2348  H  H      . ALA A 1 148 ? 38.946  44.723  -17.790 1.00 36.22  ? 145  ALA A H      1 
ATOM   2349  H  HA     . ALA A 1 148 ? 36.973  43.068  -17.148 1.00 50.99  ? 145  ALA A HA     1 
ATOM   2350  H  HB1    . ALA A 1 148 ? 37.780  45.425  -15.814 1.00 69.78  ? 145  ALA A HB1    1 
ATOM   2351  H  HB2    . ALA A 1 148 ? 36.775  44.354  -15.208 1.00 69.78  ? 145  ALA A HB2    1 
ATOM   2352  H  HB3    . ALA A 1 148 ? 38.297  43.967  -15.449 1.00 69.78  ? 145  ALA A HB3    1 
ATOM   2353  N  N      . LEU A 1 149 ? 36.261  45.982  -18.211 1.00 49.92  ? 146  LEU A N      1 
ATOM   2354  C  CA     . LEU A 1 149 ? 35.198  46.810  -18.763 1.00 54.63  ? 146  LEU A CA     1 
ATOM   2355  C  C      . LEU A 1 149 ? 34.581  46.151  -19.989 1.00 48.74  ? 146  LEU A C      1 
ATOM   2356  O  O      . LEU A 1 149 ? 33.369  46.215  -20.194 1.00 55.79  ? 146  LEU A O      1 
ATOM   2357  C  CB     . LEU A 1 149 ? 35.734  48.201  -19.116 1.00 47.05  ? 146  LEU A CB     1 
ATOM   2358  C  CG     . LEU A 1 149 ? 36.196  49.069  -17.945 1.00 28.73  ? 146  LEU A CG     1 
ATOM   2359  C  CD1    . LEU A 1 149 ? 36.731  50.398  -18.444 1.00 30.03  ? 146  LEU A CD1    1 
ATOM   2360  C  CD2    . LEU A 1 149 ? 35.046  49.304  -16.981 1.00 27.91  ? 146  LEU A CD2    1 
ATOM   2361  H  H      . LEU A 1 149 ? 37.039  46.348  -18.229 1.00 59.91  ? 146  LEU A H      1 
ATOM   2362  H  HA     . LEU A 1 149 ? 34.502  46.916  -18.096 1.00 65.55  ? 146  LEU A HA     1 
ATOM   2363  H  HB2    . LEU A 1 149 ? 36.492  48.092  -19.711 1.00 56.46  ? 146  LEU A HB2    1 
ATOM   2364  H  HB3    . LEU A 1 149 ? 35.033  48.688  -19.576 1.00 56.46  ? 146  LEU A HB3    1 
ATOM   2365  H  HG     . LEU A 1 149 ? 36.907  48.613  -17.468 1.00 34.48  ? 146  LEU A HG     1 
ATOM   2366  H  HD11   . LEU A 1 149 ? 36.026  50.860  -18.925 1.00 36.04  ? 146  LEU A HD11   1 
ATOM   2367  H  HD12   . LEU A 1 149 ? 37.017  50.928  -17.684 1.00 36.04  ? 146  LEU A HD12   1 
ATOM   2368  H  HD13   . LEU A 1 149 ? 37.482  50.234  -19.035 1.00 36.04  ? 146  LEU A HD13   1 
ATOM   2369  H  HD21   . LEU A 1 149 ? 34.736  48.449  -16.644 1.00 33.50  ? 146  LEU A HD21   1 
ATOM   2370  H  HD22   . LEU A 1 149 ? 35.359  49.856  -16.246 1.00 33.50  ? 146  LEU A HD22   1 
ATOM   2371  H  HD23   . LEU A 1 149 ? 34.328  49.755  -17.451 1.00 33.50  ? 146  LEU A HD23   1 
ATOM   2372  N  N      . LYS A 1 150 ? 35.422  45.509  -20.794 1.00 49.80  ? 147  LYS A N      1 
ATOM   2373  C  CA     . LYS A 1 150 ? 34.972  44.879  -22.031 1.00 46.22  ? 147  LYS A CA     1 
ATOM   2374  C  C      . LYS A 1 150 ? 34.319  43.534  -21.790 1.00 36.75  ? 147  LYS A C      1 
ATOM   2375  O  O      . LYS A 1 150 ? 33.194  43.298  -22.213 1.00 42.88  ? 147  LYS A O      1 
ATOM   2376  C  CB     . LYS A 1 150 ? 36.154  44.693  -22.986 1.00 40.27  ? 147  LYS A CB     1 
ATOM   2377  C  CG     . LYS A 1 150 ? 35.857  43.835  -24.212 1.00 47.62  ? 147  LYS A CG     1 
ATOM   2378  C  CD     . LYS A 1 150 ? 37.003  43.882  -25.217 1.00 56.19  ? 147  LYS A CD     1 
ATOM   2379  C  CE     . LYS A 1 150 ? 37.801  42.582  -25.241 1.00 70.34  ? 147  LYS A CE     1 
ATOM   2380  N  NZ     . LYS A 1 150 ? 37.105  41.486  -25.970 1.00 63.40  ? 147  LYS A NZ     1 
ATOM   2381  H  H      . LYS A 1 150 ? 36.265  45.424  -20.645 1.00 59.76  ? 147  LYS A H      1 
ATOM   2382  H  HA     . LYS A 1 150 ? 34.323  45.456  -22.463 1.00 55.46  ? 147  LYS A HA     1 
ATOM   2383  H  HB2    . LYS A 1 150 ? 36.437  45.566  -23.300 1.00 48.32  ? 147  LYS A HB2    1 
ATOM   2384  H  HB3    . LYS A 1 150 ? 36.880  44.271  -22.501 1.00 48.32  ? 147  LYS A HB3    1 
ATOM   2385  H  HG2    . LYS A 1 150 ? 35.733  42.914  -23.936 1.00 57.15  ? 147  LYS A HG2    1 
ATOM   2386  H  HG3    . LYS A 1 150 ? 35.057  44.166  -24.648 1.00 57.15  ? 147  LYS A HG3    1 
ATOM   2387  H  HD2    . LYS A 1 150 ? 36.642  44.031  -26.105 1.00 67.42  ? 147  LYS A HD2    1 
ATOM   2388  H  HD3    . LYS A 1 150 ? 37.607  44.603  -24.978 1.00 67.42  ? 147  LYS A HD3    1 
ATOM   2389  H  HE2    . LYS A 1 150 ? 38.651  42.742  -25.681 1.00 84.41  ? 147  LYS A HE2    1 
ATOM   2390  H  HE3    . LYS A 1 150 ? 37.951  42.288  -24.329 1.00 84.41  ? 147  LYS A HE3    1 
ATOM   2391  H  HZ1    . LYS A 1 150 ? 36.961  41.726  -26.815 1.00 76.08  ? 147  LYS A HZ1    1 
ATOM   2392  H  HZ2    . LYS A 1 150 ? 37.603  40.749  -25.960 1.00 76.08  ? 147  LYS A HZ2    1 
ATOM   2393  H  HZ3    . LYS A 1 150 ? 36.323  41.311  -25.582 1.00 76.08  ? 147  LYS A HZ3    1 
ATOM   2394  N  N      . GLU A 1 151 ? 35.027  42.669  -21.077 1.00 34.93  ? 148  GLU A N      1 
ATOM   2395  C  CA     . GLU A 1 151 ? 34.605  41.289  -20.911 1.00 29.03  ? 148  GLU A CA     1 
ATOM   2396  C  C      . GLU A 1 151 ? 33.646  41.080  -19.746 1.00 36.31  ? 148  GLU A C      1 
ATOM   2397  O  O      . GLU A 1 151 ? 32.624  40.415  -19.897 1.00 51.52  ? 148  GLU A O      1 
ATOM   2398  C  CB     . GLU A 1 151 ? 35.830  40.398  -20.727 1.00 22.86  ? 148  GLU A CB     1 
ATOM   2399  C  CG     . GLU A 1 151 ? 36.821  40.511  -21.872 1.00 29.33  ? 148  GLU A CG     1 
ATOM   2400  C  CD     . GLU A 1 151 ? 37.977  39.538  -21.742 1.00 47.29  ? 148  GLU A CD     1 
ATOM   2401  O  OE1    . GLU A 1 151 ? 37.938  38.684  -20.829 1.00 51.77  ? 148  GLU A OE1    1 
ATOM   2402  O  OE2    . GLU A 1 151 ? 38.927  39.629  -22.552 1.00 43.12  ? 148  GLU A OE2    1 
ATOM   2403  H  H      . GLU A 1 151 ? 35.763  42.860  -20.675 1.00 41.92  ? 148  GLU A H      1 
ATOM   2404  H  HA     . GLU A 1 151 ? 34.152  41.004  -21.720 1.00 34.84  ? 148  GLU A HA     1 
ATOM   2405  H  HB2    . GLU A 1 151 ? 36.286  40.654  -19.910 1.00 27.43  ? 148  GLU A HB2    1 
ATOM   2406  H  HB3    . GLU A 1 151 ? 35.542  39.473  -20.670 1.00 27.43  ? 148  GLU A HB3    1 
ATOM   2407  H  HG2    . GLU A 1 151 ? 36.363  40.323  -22.706 1.00 35.19  ? 148  GLU A HG2    1 
ATOM   2408  H  HG3    . GLU A 1 151 ? 37.185  41.410  -21.888 1.00 35.19  ? 148  GLU A HG3    1 
ATOM   2409  N  N      . ASP A 1 152 ? 33.961  41.647  -18.587 1.00 47.84  ? 149  ASP A N      1 
ATOM   2410  C  CA     . ASP A 1 152 ? 33.132  41.422  -17.408 1.00 48.49  ? 149  ASP A CA     1 
ATOM   2411  C  C      . ASP A 1 152 ? 31.867  42.284  -17.455 1.00 43.08  ? 149  ASP A C      1 
ATOM   2412  O  O      . ASP A 1 152 ? 30.792  41.828  -17.065 1.00 41.96  ? 149  ASP A O      1 
ATOM   2413  C  CB     . ASP A 1 152 ? 33.925  41.700  -16.120 1.00 50.27  ? 149  ASP A CB     1 
ATOM   2414  C  CG     . ASP A 1 152 ? 35.197  40.867  -16.021 1.00 51.96  ? 149  ASP A CG     1 
ATOM   2415  O  OD1    . ASP A 1 152 ? 35.404  39.989  -16.885 1.00 61.20  ? 149  ASP A OD1    1 
ATOM   2416  O  OD2    . ASP A 1 152 ? 35.989  41.084  -15.079 1.00 42.76  ? 149  ASP A OD2    1 
ATOM   2417  H  H      . ASP A 1 152 ? 34.640  42.159  -18.457 1.00 57.41  ? 149  ASP A H      1 
ATOM   2418  H  HA     . ASP A 1 152 ? 32.857  40.492  -17.392 1.00 58.19  ? 149  ASP A HA     1 
ATOM   2419  H  HB2    . ASP A 1 152 ? 34.177  42.636  -16.100 1.00 60.32  ? 149  ASP A HB2    1 
ATOM   2420  H  HB3    . ASP A 1 152 ? 33.369  41.489  -15.354 1.00 60.32  ? 149  ASP A HB3    1 
ATOM   2421  N  N      . PHE A 1 153 ? 31.989  43.522  -17.932 1.00 41.16  ? 150  PHE A N      1 
ATOM   2422  C  CA     . PHE A 1 153 ? 30.859  44.457  -17.931 1.00 45.51  ? 150  PHE A CA     1 
ATOM   2423  C  C      . PHE A 1 153 ? 30.191  44.673  -19.296 1.00 59.61  ? 150  PHE A C      1 
ATOM   2424  O  O      . PHE A 1 153 ? 29.080  45.201  -19.371 1.00 53.80  ? 150  PHE A O      1 
ATOM   2425  C  CB     . PHE A 1 153 ? 31.316  45.804  -17.381 1.00 38.21  ? 150  PHE A CB     1 
ATOM   2426  C  CG     . PHE A 1 153 ? 31.557  45.792  -15.908 1.00 43.08  ? 150  PHE A CG     1 
ATOM   2427  C  CD1    . PHE A 1 153 ? 30.497  45.884  -15.022 1.00 37.31  ? 150  PHE A CD1    1 
ATOM   2428  C  CD2    . PHE A 1 153 ? 32.838  45.658  -15.404 1.00 36.36  ? 150  PHE A CD2    1 
ATOM   2429  C  CE1    . PHE A 1 153 ? 30.711  45.856  -13.663 1.00 32.22  ? 150  PHE A CE1    1 
ATOM   2430  C  CE2    . PHE A 1 153 ? 33.057  45.632  -14.048 1.00 29.03  ? 150  PHE A CE2    1 
ATOM   2431  C  CZ     . PHE A 1 153 ? 31.991  45.730  -13.173 1.00 31.51  ? 150  PHE A CZ     1 
ATOM   2432  H  H      . PHE A 1 153 ? 32.714  43.847  -18.262 1.00 49.39  ? 150  PHE A H      1 
ATOM   2433  H  HA     . PHE A 1 153 ? 30.181  44.112  -17.329 1.00 54.61  ? 150  PHE A HA     1 
ATOM   2434  H  HB2    . PHE A 1 153 ? 32.145  46.056  -17.816 1.00 45.85  ? 150  PHE A HB2    1 
ATOM   2435  H  HB3    . PHE A 1 153 ? 30.631  46.466  -17.565 1.00 45.85  ? 150  PHE A HB3    1 
ATOM   2436  H  HD1    . PHE A 1 153 ? 29.630  45.968  -15.349 1.00 44.78  ? 150  PHE A HD1    1 
ATOM   2437  H  HD2    . PHE A 1 153 ? 33.559  45.591  -15.988 1.00 43.63  ? 150  PHE A HD2    1 
ATOM   2438  H  HE1    . PHE A 1 153 ? 29.992  45.924  -13.076 1.00 38.66  ? 150  PHE A HE1    1 
ATOM   2439  H  HE2    . PHE A 1 153 ? 33.923  45.547  -13.718 1.00 34.84  ? 150  PHE A HE2    1 
ATOM   2440  H  HZ     . PHE A 1 153 ? 32.139  45.715  -12.255 1.00 37.81  ? 150  PHE A HZ     1 
ATOM   2441  N  N      . GLY A 1 154 ? 30.852  44.260  -20.369 1.00 46.50  ? 151  GLY A N      1 
ATOM   2442  C  CA     . GLY A 1 154 ? 30.261  44.360  -21.688 1.00 50.05  ? 151  GLY A CA     1 
ATOM   2443  C  C      . GLY A 1 154 ? 30.147  45.781  -22.215 1.00 53.33  ? 151  GLY A C      1 
ATOM   2444  O  O      . GLY A 1 154 ? 29.333  46.058  -23.093 1.00 59.62  ? 151  GLY A O      1 
ATOM   2445  H  H      . GLY A 1 154 ? 31.642  43.920  -20.358 1.00 55.79  ? 151  GLY A H      1 
ATOM   2446  H  HA2    . GLY A 1 154 ? 30.797  43.848  -22.314 1.00 60.06  ? 151  GLY A HA2    1 
ATOM   2447  H  HA3    . GLY A 1 154 ? 29.371  43.974  -21.666 1.00 60.06  ? 151  GLY A HA3    1 
ATOM   2448  N  N      . PHE A 1 155 ? 30.959  46.687  -21.683 1.00 50.82  ? 152  PHE A N      1 
ATOM   2449  C  CA     . PHE A 1 155 ? 31.013  48.049  -22.197 1.00 47.96  ? 152  PHE A CA     1 
ATOM   2450  C  C      . PHE A 1 155 ? 31.758  48.001  -23.529 1.00 50.02  ? 152  PHE A C      1 
ATOM   2451  O  O      . PHE A 1 155 ? 32.861  47.453  -23.603 1.00 40.36  ? 152  PHE A O      1 
ATOM   2452  C  CB     . PHE A 1 155 ? 31.710  48.975  -21.196 1.00 38.40  ? 152  PHE A CB     1 
ATOM   2453  C  CG     . PHE A 1 155 ? 31.053  49.014  -19.841 1.00 35.71  ? 152  PHE A CG     1 
ATOM   2454  C  CD1    . PHE A 1 155 ? 29.729  48.640  -19.681 1.00 32.13  ? 152  PHE A CD1    1 
ATOM   2455  C  CD2    . PHE A 1 155 ? 31.782  49.366  -18.715 1.00 48.04  ? 152  PHE A CD2    1 
ATOM   2456  C  CE1    . PHE A 1 155 ? 29.132  48.669  -18.432 1.00 53.57  ? 152  PHE A CE1    1 
ATOM   2457  C  CE2    . PHE A 1 155 ? 31.191  49.387  -17.460 1.00 46.97  ? 152  PHE A CE2    1 
ATOM   2458  C  CZ     . PHE A 1 155 ? 29.865  49.036  -17.318 1.00 40.21  ? 152  PHE A CZ     1 
ATOM   2459  H  H      . PHE A 1 155 ? 31.490  46.538  -21.023 1.00 60.99  ? 152  PHE A H      1 
ATOM   2460  H  HA     . PHE A 1 155 ? 30.113  48.378  -22.353 1.00 57.56  ? 152  PHE A HA     1 
ATOM   2461  H  HB2    . PHE A 1 155 ? 32.623  48.671  -21.074 1.00 46.08  ? 152  PHE A HB2    1 
ATOM   2462  H  HB3    . PHE A 1 155 ? 31.709  49.877  -21.552 1.00 46.08  ? 152  PHE A HB3    1 
ATOM   2463  H  HD1    . PHE A 1 155 ? 32.676  49.608  -18.805 1.00 57.65  ? 152  PHE A HD1    1 
ATOM   2464  H  HD2    . PHE A 1 155 ? 29.227  48.397  -20.425 1.00 38.56  ? 152  PHE A HD2    1 
ATOM   2465  H  HE1    . PHE A 1 155 ? 31.688  49.638  -16.715 1.00 56.36  ? 152  PHE A HE1    1 
ATOM   2466  H  HE2    . PHE A 1 155 ? 28.239  48.427  -18.340 1.00 64.28  ? 152  PHE A HE2    1 
ATOM   2467  H  HZ     . PHE A 1 155 ? 29.465  49.049  -16.479 1.00 48.25  ? 152  PHE A HZ     1 
ATOM   2468  N  N      . LYS A 1 156 ? 31.163  48.578  -24.574 1.00 49.24  ? 153  LYS A N      1 
ATOM   2469  C  CA     . LYS A 1 156 ? 31.695  48.426  -25.927 1.00 43.23  ? 153  LYS A CA     1 
ATOM   2470  C  C      . LYS A 1 156 ? 32.441  49.637  -26.465 1.00 35.91  ? 153  LYS A C      1 
ATOM   2471  O  O      . LYS A 1 156 ? 33.296  49.496  -27.338 1.00 51.34  ? 153  LYS A O      1 
ATOM   2472  C  CB     . LYS A 1 156 ? 30.550  48.089  -26.881 1.00 33.33  ? 153  LYS A CB     1 
ATOM   2473  C  CG     . LYS A 1 156 ? 30.082  46.646  -26.785 1.00 51.64  ? 153  LYS A CG     1 
ATOM   2474  C  CD     . LYS A 1 156 ? 28.597  46.502  -27.089 1.00 74.46  ? 153  LYS A CD     1 
ATOM   2475  C  CE     . LYS A 1 156 ? 28.064  45.168  -26.591 1.00 106.47 ? 153  LYS A CE     1 
ATOM   2476  N  NZ     . LYS A 1 156 ? 26.662  44.913  -27.027 1.00 125.69 ? 153  LYS A NZ     1 
ATOM   2477  H  H      . LYS A 1 156 ? 30.453  49.061  -24.526 1.00 59.09  ? 153  LYS A H      1 
ATOM   2478  H  HA     . LYS A 1 156 ? 32.312  47.678  -25.933 1.00 51.88  ? 153  LYS A HA     1 
ATOM   2479  H  HB2    . LYS A 1 156 ? 29.793  48.661  -26.677 1.00 39.99  ? 153  LYS A HB2    1 
ATOM   2480  H  HB3    . LYS A 1 156 ? 30.844  48.245  -27.792 1.00 39.99  ? 153  LYS A HB3    1 
ATOM   2481  H  HG2    . LYS A 1 156 ? 30.575  46.108  -27.424 1.00 61.97  ? 153  LYS A HG2    1 
ATOM   2482  H  HG3    . LYS A 1 156 ? 30.239  46.320  -25.884 1.00 61.97  ? 153  LYS A HG3    1 
ATOM   2483  H  HD2    . LYS A 1 156 ? 28.108  47.212  -26.645 1.00 89.35  ? 153  LYS A HD2    1 
ATOM   2484  H  HD3    . LYS A 1 156 ? 28.460  46.547  -28.048 1.00 89.35  ? 153  LYS A HD3    1 
ATOM   2485  H  HE2    . LYS A 1 156 ? 28.621  44.454  -26.939 1.00 127.77 ? 153  LYS A HE2    1 
ATOM   2486  H  HE3    . LYS A 1 156 ? 28.083  45.162  -25.621 1.00 127.77 ? 153  LYS A HE3    1 
ATOM   2487  H  HZ1    . LYS A 1 156 ? 26.617  44.906  -27.915 1.00 150.83 ? 153  LYS A HZ1    1 
ATOM   2488  H  HZ2    . LYS A 1 156 ? 26.386  44.125  -26.717 1.00 150.83 ? 153  LYS A HZ2    1 
ATOM   2489  H  HZ3    . LYS A 1 156 ? 26.126  45.551  -26.714 1.00 150.83 ? 153  LYS A HZ3    1 
ATOM   2490  N  N      . HIS A 1 157 ? 32.160  50.813  -25.916 1.00 28.44  ? 154  HIS A N      1 
ATOM   2491  C  CA     . HIS A 1 157 ? 32.769  52.044  -26.417 1.00 48.39  ? 154  HIS A CA     1 
ATOM   2492  C  C      . HIS A 1 157 ? 33.584  52.694  -25.324 1.00 47.16  ? 154  HIS A C      1 
ATOM   2493  O  O      . HIS A 1 157 ? 33.063  53.400  -24.453 1.00 40.80  ? 154  HIS A O      1 
ATOM   2494  C  CB     . HIS A 1 157 ? 31.708  53.008  -26.952 1.00 61.33  ? 154  HIS A CB     1 
ATOM   2495  C  CG     . HIS A 1 157 ? 30.591  52.332  -27.681 1.00 59.78  ? 154  HIS A CG     1 
ATOM   2496  N  ND1    . HIS A 1 157 ? 30.767  51.732  -28.909 1.00 36.08  ? 154  HIS A ND1    1 
ATOM   2497  C  CD2    . HIS A 1 157 ? 29.282  52.181  -27.370 1.00 50.42  ? 154  HIS A CD2    1 
ATOM   2498  C  CE1    . HIS A 1 157 ? 29.616  51.224  -29.315 1.00 52.20  ? 154  HIS A CE1    1 
ATOM   2499  N  NE2    . HIS A 1 157 ? 28.699  51.485  -28.399 1.00 43.85  ? 154  HIS A NE2    1 
ATOM   2500  H  H      . HIS A 1 157 ? 31.623  50.927  -25.254 1.00 34.13  ? 154  HIS A H      1 
ATOM   2501  H  HA     . HIS A 1 157 ? 33.368  51.824  -27.147 1.00 58.06  ? 154  HIS A HA     1 
ATOM   2502  H  HB2    . HIS A 1 157 ? 31.324  53.495  -26.206 1.00 73.60  ? 154  HIS A HB2    1 
ATOM   2503  H  HB3    . HIS A 1 157 ? 32.131  53.628  -27.567 1.00 73.60  ? 154  HIS A HB3    1 
ATOM   2504  H  HD1    . HIS A 1 157 ? 31.510  51.686  -29.339 1.00 43.30  ? 154  HIS A HD1    1 
ATOM   2505  H  HD2    . HIS A 1 157 ? 28.859  52.483  -26.599 1.00 60.51  ? 154  HIS A HD2    1 
ATOM   2506  H  HE1    . HIS A 1 157 ? 29.475  50.767  -30.112 1.00 62.64  ? 154  HIS A HE1    1 
ATOM   2507  H  HE2    . HIS A 1 157 ? 27.872  51.256  -28.442 1.00 52.62  ? 154  HIS A HE2    1 
ATOM   2508  N  N      . ARG A 1 158 ? 34.884  52.442  -25.406 1.00 40.13  ? 155  ARG A N      1 
ATOM   2509  C  CA     . ARG A 1 158 ? 35.820  52.827  -24.373 1.00 37.55  ? 155  ARG A CA     1 
ATOM   2510  C  C      . ARG A 1 158 ? 36.953  53.607  -25.008 1.00 39.59  ? 155  ARG A C      1 
ATOM   2511  O  O      . ARG A 1 158 ? 37.668  53.093  -25.871 1.00 42.26  ? 155  ARG A O      1 
ATOM   2512  C  CB     . ARG A 1 158 ? 36.351  51.595  -23.644 1.00 24.64  ? 155  ARG A CB     1 
ATOM   2513  C  CG     . ARG A 1 158 ? 35.239  50.718  -23.074 1.00 29.13  ? 155  ARG A CG     1 
ATOM   2514  C  CD     . ARG A 1 158 ? 35.760  49.383  -22.577 1.00 37.49  ? 155  ARG A CD     1 
ATOM   2515  N  NE     . ARG A 1 158 ? 36.752  48.788  -23.468 1.00 35.67  ? 155  ARG A NE     1 
ATOM   2516  C  CZ     . ARG A 1 158 ? 36.472  48.004  -24.505 1.00 46.47  ? 155  ARG A CZ     1 
ATOM   2517  N  NH1    . ARG A 1 158 ? 35.214  47.691  -24.802 1.00 33.33  ? 155  ARG A NH1    1 
ATOM   2518  N  NH2    . ARG A 1 158 ? 37.464  47.520  -25.245 1.00 39.92  ? 155  ARG A NH2    1 
ATOM   2519  H  H      . ARG A 1 158 ? 35.253  52.038  -26.070 1.00 48.15  ? 155  ARG A H      1 
ATOM   2520  H  HA     . ARG A 1 158 ? 35.375  53.399  -23.728 1.00 45.06  ? 155  ARG A HA     1 
ATOM   2521  H  HB2    . ARG A 1 158 ? 36.868  51.059  -24.265 1.00 29.57  ? 155  ARG A HB2    1 
ATOM   2522  H  HB3    . ARG A 1 158 ? 36.913  51.883  -22.907 1.00 29.57  ? 155  ARG A HB3    1 
ATOM   2523  H  HG2    . ARG A 1 158 ? 34.823  51.177  -22.327 1.00 34.96  ? 155  ARG A HG2    1 
ATOM   2524  H  HG3    . ARG A 1 158 ? 34.582  50.547  -23.767 1.00 34.96  ? 155  ARG A HG3    1 
ATOM   2525  H  HD2    . ARG A 1 158 ? 36.176  49.510  -21.710 1.00 44.99  ? 155  ARG A HD2    1 
ATOM   2526  H  HD3    . ARG A 1 158 ? 35.018  48.763  -22.500 1.00 44.99  ? 155  ARG A HD3    1 
ATOM   2527  H  HE     . ARG A 1 158 ? 37.580  48.957  -23.310 1.00 42.81  ? 155  ARG A HE     1 
ATOM   2528  H  HH11   . ARG A 1 158 ? 34.569  48.001  -24.325 1.00 40.00  ? 155  ARG A HH11   1 
ATOM   2529  H  HH12   . ARG A 1 158 ? 35.045  47.182  -25.475 1.00 40.00  ? 155  ARG A HH12   1 
ATOM   2530  H  HH21   . ARG A 1 158 ? 38.279  47.718  -25.055 1.00 47.91  ? 155  ARG A HH21   1 
ATOM   2531  H  HH22   . ARG A 1 158 ? 37.291  47.011  -25.916 1.00 47.91  ? 155  ARG A HH22   1 
ATOM   2532  N  N      . LEU A 1 159 ? 37.115  54.849  -24.579 1.00 35.57  ? 156  LEU A N      1 
ATOM   2533  C  CA     . LEU A 1 159 ? 38.157  55.705  -25.115 1.00 43.14  ? 156  LEU A CA     1 
ATOM   2534  C  C      . LEU A 1 159 ? 39.233  55.922  -24.060 1.00 45.95  ? 156  LEU A C      1 
ATOM   2535  O  O      . LEU A 1 159 ? 38.990  56.545  -23.027 1.00 38.17  ? 156  LEU A O      1 
ATOM   2536  C  CB     . LEU A 1 159 ? 37.572  57.042  -25.569 1.00 31.88  ? 156  LEU A CB     1 
ATOM   2537  C  CG     . LEU A 1 159 ? 38.589  58.058  -26.096 1.00 37.07  ? 156  LEU A CG     1 
ATOM   2538  C  CD1    . LEU A 1 159 ? 39.144  57.611  -27.433 1.00 40.13  ? 156  LEU A CD1    1 
ATOM   2539  C  CD2    . LEU A 1 159 ? 37.968  59.441  -26.201 1.00 44.52  ? 156  LEU A CD2    1 
ATOM   2540  H  H      . LEU A 1 159 ? 36.630  55.221  -23.974 1.00 42.68  ? 156  LEU A H      1 
ATOM   2541  H  HA     . LEU A 1 159 ? 38.564  55.274  -25.883 1.00 51.77  ? 156  LEU A HA     1 
ATOM   2542  H  HB2    . LEU A 1 159 ? 36.934  56.873  -26.280 1.00 38.25  ? 156  LEU A HB2    1 
ATOM   2543  H  HB3    . LEU A 1 159 ? 37.116  57.450  -24.815 1.00 38.25  ? 156  LEU A HB3    1 
ATOM   2544  H  HG     . LEU A 1 159 ? 39.329  58.112  -25.471 1.00 44.48  ? 156  LEU A HG     1 
ATOM   2545  H  HD11   . LEU A 1 159 ? 38.414  57.533  -28.067 1.00 48.15  ? 156  LEU A HD11   1 
ATOM   2546  H  HD12   . LEU A 1 159 ? 39.785  58.269  -27.745 1.00 48.15  ? 156  LEU A HD12   1 
ATOM   2547  H  HD13   . LEU A 1 159 ? 39.580  56.751  -27.322 1.00 48.15  ? 156  LEU A HD13   1 
ATOM   2548  H  HD21   . LEU A 1 159 ? 37.669  59.720  -25.321 1.00 53.42  ? 156  LEU A HD21   1 
ATOM   2549  H  HD22   . LEU A 1 159 ? 38.634  60.061  -26.536 1.00 53.42  ? 156  LEU A HD22   1 
ATOM   2550  H  HD23   . LEU A 1 159 ? 37.214  59.403  -26.810 1.00 53.42  ? 156  LEU A HD23   1 
ATOM   2551  N  N      . TRP A 1 160 ? 40.424  55.395  -24.338 1.00 40.71  ? 157  TRP A N      1 
ATOM   2552  C  CA     . TRP A 1 160 ? 41.570  55.586  -23.465 1.00 42.39  ? 157  TRP A CA     1 
ATOM   2553  C  C      . TRP A 1 160 ? 42.393  56.761  -23.967 1.00 48.25  ? 157  TRP A C      1 
ATOM   2554  O  O      . TRP A 1 160 ? 42.675  56.884  -25.162 1.00 41.41  ? 157  TRP A O      1 
ATOM   2555  C  CB     . TRP A 1 160 ? 42.413  54.310  -23.383 1.00 36.24  ? 157  TRP A CB     1 
ATOM   2556  C  CG     . TRP A 1 160 ? 41.782  53.238  -22.535 1.00 33.28  ? 157  TRP A CG     1 
ATOM   2557  C  CD1    . TRP A 1 160 ? 40.918  52.271  -22.943 1.00 34.29  ? 157  TRP A CD1    1 
ATOM   2558  C  CD2    . TRP A 1 160 ? 41.976  53.035  -21.130 1.00 43.32  ? 157  TRP A CD2    1 
ATOM   2559  N  NE1    . TRP A 1 160 ? 40.557  51.478  -21.882 1.00 28.09  ? 157  TRP A NE1    1 
ATOM   2560  C  CE2    . TRP A 1 160 ? 41.195  51.926  -20.757 1.00 40.70  ? 157  TRP A CE2    1 
ATOM   2561  C  CE3    . TRP A 1 160 ? 42.736  53.686  -20.151 1.00 39.87  ? 157  TRP A CE3    1 
ATOM   2562  C  CZ2    . TRP A 1 160 ? 41.149  51.451  -19.446 1.00 46.24  ? 157  TRP A CZ2    1 
ATOM   2563  C  CZ3    . TRP A 1 160 ? 42.691  53.213  -18.852 1.00 36.03  ? 157  TRP A CZ3    1 
ATOM   2564  C  CH2    . TRP A 1 160 ? 41.902  52.106  -18.511 1.00 38.78  ? 157  TRP A CH2    1 
ATOM   2565  H  H      . TRP A 1 160 ? 40.591  54.920  -25.035 1.00 48.86  ? 157  TRP A H      1 
ATOM   2566  H  HA     . TRP A 1 160 ? 41.256  55.797  -22.571 1.00 50.87  ? 157  TRP A HA     1 
ATOM   2567  H  HB2    . TRP A 1 160 ? 42.531  53.953  -24.277 1.00 43.49  ? 157  TRP A HB2    1 
ATOM   2568  H  HB3    . TRP A 1 160 ? 43.276  54.528  -22.997 1.00 43.49  ? 157  TRP A HB3    1 
ATOM   2569  H  HD1    . TRP A 1 160 ? 40.612  52.164  -23.814 1.00 41.15  ? 157  TRP A HD1    1 
ATOM   2570  H  HE1    . TRP A 1 160 ? 40.019  50.808  -21.919 1.00 33.71  ? 157  TRP A HE1    1 
ATOM   2571  H  HE3    . TRP A 1 160 ? 43.262  54.421  -20.369 1.00 47.84  ? 157  TRP A HE3    1 
ATOM   2572  H  HZ2    . TRP A 1 160 ? 40.628  50.716  -19.217 1.00 55.48  ? 157  TRP A HZ2    1 
ATOM   2573  H  HZ3    . TRP A 1 160 ? 43.191  53.638  -18.193 1.00 43.24  ? 157  TRP A HZ3    1 
ATOM   2574  H  HH2    . TRP A 1 160 ? 41.891  51.810  -17.630 1.00 46.53  ? 157  TRP A HH2    1 
ATOM   2575  N  N      . VAL A 1 161 ? 42.759  57.625  -23.024 1.00 44.60  ? 158  VAL A N      1 
ATOM   2576  C  CA     . VAL A 1 161 ? 43.451  58.867  -23.319 1.00 41.55  ? 158  VAL A CA     1 
ATOM   2577  C  C      . VAL A 1 161 ? 44.646  59.105  -22.401 1.00 42.95  ? 158  VAL A C      1 
ATOM   2578  O  O      . VAL A 1 161 ? 44.544  58.927  -21.190 1.00 39.78  ? 158  VAL A O      1 
ATOM   2579  C  CB     . VAL A 1 161 ? 42.499  60.068  -23.168 1.00 30.32  ? 158  VAL A CB     1 
ATOM   2580  C  CG1    . VAL A 1 161 ? 43.124  61.308  -23.780 1.00 32.80  ? 158  VAL A CG1    1 
ATOM   2581  C  CG2    . VAL A 1 161 ? 41.153  59.779  -23.818 1.00 33.03  ? 158  VAL A CG2    1 
ATOM   2582  H  H      . VAL A 1 161 ? 42.612  57.506  -22.185 1.00 53.52  ? 158  VAL A H      1 
ATOM   2583  H  HA     . VAL A 1 161 ? 43.770  58.845  -24.235 1.00 49.86  ? 158  VAL A HA     1 
ATOM   2584  H  HB     . VAL A 1 161 ? 42.349  60.239  -22.225 1.00 36.39  ? 158  VAL A HB     1 
ATOM   2585  H  HG11   . VAL A 1 161 ? 43.292  61.145  -24.722 1.00 39.36  ? 158  VAL A HG11   1 
ATOM   2586  H  HG12   . VAL A 1 161 ? 42.512  62.054  -23.677 1.00 39.36  ? 158  VAL A HG12   1 
ATOM   2587  H  HG13   . VAL A 1 161 ? 43.959  61.499  -23.324 1.00 39.36  ? 158  VAL A HG13   1 
ATOM   2588  H  HG21   . VAL A 1 161 ? 40.755  59.005  -23.390 1.00 39.64  ? 158  VAL A HG21   1 
ATOM   2589  H  HG22   . VAL A 1 161 ? 40.577  60.552  -23.707 1.00 39.64  ? 158  VAL A HG22   1 
ATOM   2590  H  HG23   . VAL A 1 161 ? 41.290  59.601  -24.762 1.00 39.64  ? 158  VAL A HG23   1 
ATOM   2591  N  N      . TYR A 1 162 ? 45.769  59.514  -22.980 1.00 33.48  ? 159  TYR A N      1 
ATOM   2592  C  CA     . TYR A 1 162 ? 46.930  59.936  -22.205 1.00 32.13  ? 159  TYR A CA     1 
ATOM   2593  C  C      . TYR A 1 162 ? 46.617  61.272  -21.533 1.00 36.69  ? 159  TYR A C      1 
ATOM   2594  O  O      . TYR A 1 162 ? 46.100  62.179  -22.178 1.00 45.51  ? 159  TYR A O      1 
ATOM   2595  C  CB     . TYR A 1 162 ? 48.147  60.066  -23.113 1.00 33.96  ? 159  TYR A CB     1 
ATOM   2596  C  CG     . TYR A 1 162 ? 49.398  60.608  -22.453 1.00 35.60  ? 159  TYR A CG     1 
ATOM   2597  C  CD1    . TYR A 1 162 ? 49.984  59.976  -21.367 1.00 41.76  ? 159  TYR A CD1    1 
ATOM   2598  C  CD2    . TYR A 1 162 ? 49.986  61.768  -22.924 1.00 48.60  ? 159  TYR A CD2    1 
ATOM   2599  C  CE1    . TYR A 1 162 ? 51.136  60.484  -20.784 1.00 42.20  ? 159  TYR A CE1    1 
ATOM   2600  C  CE2    . TYR A 1 162 ? 51.127  62.282  -22.348 1.00 48.56  ? 159  TYR A CE2    1 
ATOM   2601  C  CZ     . TYR A 1 162 ? 51.698  61.642  -21.283 1.00 45.12  ? 159  TYR A CZ     1 
ATOM   2602  O  OH     . TYR A 1 162 ? 52.836  62.173  -20.727 1.00 45.91  ? 159  TYR A OH     1 
ATOM   2603  H  H      . TYR A 1 162 ? 45.886  59.556  -23.831 1.00 40.17  ? 159  TYR A H      1 
ATOM   2604  H  HA     . TYR A 1 162 ? 47.122  59.279  -21.518 1.00 38.56  ? 159  TYR A HA     1 
ATOM   2605  H  HB2    . TYR A 1 162 ? 48.361  59.189  -23.466 1.00 40.75  ? 159  TYR A HB2    1 
ATOM   2606  H  HB3    . TYR A 1 162 ? 47.922  60.663  -23.844 1.00 40.75  ? 159  TYR A HB3    1 
ATOM   2607  H  HD1    . TYR A 1 162 ? 49.608  59.193  -21.034 1.00 50.11  ? 159  TYR A HD1    1 
ATOM   2608  H  HD2    . TYR A 1 162 ? 49.608  62.207  -23.651 1.00 58.32  ? 159  TYR A HD2    1 
ATOM   2609  H  HE1    . TYR A 1 162 ? 51.523  60.051  -20.058 1.00 50.63  ? 159  TYR A HE1    1 
ATOM   2610  H  HE2    . TYR A 1 162 ? 51.509  63.061  -22.683 1.00 58.28  ? 159  TYR A HE2    1 
ATOM   2611  H  HH     . TYR A 1 162 ? 53.055  62.874  -21.136 1.00 55.09  ? 159  TYR A HH     1 
ATOM   2612  N  N      . SER A 1 163 ? 46.923  61.401  -20.246 1.00 48.43  ? 160  SER A N      1 
ATOM   2613  C  CA     . SER A 1 163 ? 46.485  62.570  -19.478 1.00 42.41  ? 160  SER A CA     1 
ATOM   2614  C  C      . SER A 1 163 ? 47.400  63.767  -19.706 1.00 41.66  ? 160  SER A C      1 
ATOM   2615  O  O      . SER A 1 163 ? 47.087  64.876  -19.283 1.00 51.68  ? 160  SER A O      1 
ATOM   2616  C  CB     . SER A 1 163 ? 46.411  62.249  -17.984 1.00 39.65  ? 160  SER A CB     1 
ATOM   2617  O  OG     . SER A 1 163 ? 47.703  62.201  -17.405 1.00 52.53  ? 160  SER A OG     1 
ATOM   2618  H  H      . SER A 1 163 ? 47.381  60.831  -19.794 1.00 58.11  ? 160  SER A H      1 
ATOM   2619  H  HA     . SER A 1 163 ? 45.595  62.819  -19.772 1.00 50.89  ? 160  SER A HA     1 
ATOM   2620  H  HB2    . SER A 1 163 ? 45.893  62.939  -17.540 1.00 47.58  ? 160  SER A HB2    1 
ATOM   2621  H  HB3    . SER A 1 163 ? 45.982  61.387  -17.869 1.00 47.58  ? 160  SER A HB3    1 
ATOM   2622  H  HG     . SER A 1 163 ? 48.087  62.942  -17.496 1.00 63.03  ? 160  SER A HG     1 
ATOM   2623  N  N      . GLY A 1 164 ? 48.536  63.534  -20.355 1.00 35.29  ? 161  GLY A N      1 
ATOM   2624  C  CA     . GLY A 1 164 ? 49.455  64.604  -20.693 1.00 37.67  ? 161  GLY A CA     1 
ATOM   2625  C  C      . GLY A 1 164 ? 50.754  64.584  -19.925 1.00 37.85  ? 161  GLY A C      1 
ATOM   2626  O  O      . GLY A 1 164 ? 51.708  65.245  -20.328 1.00 43.24  ? 161  GLY A O      1 
ATOM   2627  H  H      . GLY A 1 164 ? 48.796  62.755  -20.612 1.00 42.34  ? 161  GLY A H      1 
ATOM   2628  H  HA2    . GLY A 1 164 ? 49.666  64.552  -21.638 1.00 45.20  ? 161  GLY A HA2    1 
ATOM   2629  H  HA3    . GLY A 1 164 ? 49.022  65.456  -20.527 1.00 45.20  ? 161  GLY A HA3    1 
ATOM   2630  N  N      . ARG A 1 165 ? 50.803  63.840  -18.823 1.00 56.18  ? 162  ARG A N      1 
ATOM   2631  C  CA     . ARG A 1 165 ? 51.995  63.845  -17.979 1.00 38.66  ? 162  ARG A CA     1 
ATOM   2632  C  C      . ARG A 1 165 ? 52.116  62.561  -17.167 1.00 30.14  ? 162  ARG A C      1 
ATOM   2633  O  O      . ARG A 1 165 ? 53.060  61.792  -17.354 1.00 27.54  ? 162  ARG A O      1 
ATOM   2634  C  CB     . ARG A 1 165 ? 52.000  65.059  -17.050 1.00 42.60  ? 162  ARG A CB     1 
ATOM   2635  C  CG     . ARG A 1 165 ? 53.308  65.227  -16.294 1.00 47.05  ? 162  ARG A CG     1 
ATOM   2636  C  CD     . ARG A 1 165 ? 53.230  66.355  -15.303 1.00 49.61  ? 162  ARG A CD     1 
ATOM   2637  N  NE     . ARG A 1 165 ? 54.560  66.806  -14.912 1.00 40.19  ? 162  ARG A NE     1 
ATOM   2638  C  CZ     . ARG A 1 165 ? 54.789  67.909  -14.205 1.00 41.72  ? 162  ARG A CZ     1 
ATOM   2639  N  NH1    . ARG A 1 165 ? 53.775  68.679  -13.808 1.00 32.02  ? 162  ARG A NH1    1 
ATOM   2640  N  NH2    . ARG A 1 165 ? 56.032  68.254  -13.907 1.00 19.23  ? 162  ARG A NH2    1 
ATOM   2641  H  H      . ARG A 1 165 ? 50.169  63.330  -18.545 1.00 67.42  ? 162  ARG A H      1 
ATOM   2642  H  HA     . ARG A 1 165 ? 52.778  63.907  -18.549 1.00 46.39  ? 162  ARG A HA     1 
ATOM   2643  H  HB2    . ARG A 1 165 ? 51.855  65.860  -17.577 1.00 51.12  ? 162  ARG A HB2    1 
ATOM   2644  H  HB3    . ARG A 1 165 ? 51.289  64.959  -16.398 1.00 51.12  ? 162  ARG A HB3    1 
ATOM   2645  H  HG2    . ARG A 1 165 ? 53.505  64.410  -15.810 1.00 56.46  ? 162  ARG A HG2    1 
ATOM   2646  H  HG3    . ARG A 1 165 ? 54.018  65.424  -16.924 1.00 56.46  ? 162  ARG A HG3    1 
ATOM   2647  H  HD2    . ARG A 1 165 ? 52.759  67.102  -15.704 1.00 59.53  ? 162  ARG A HD2    1 
ATOM   2648  H  HD3    . ARG A 1 165 ? 52.765  66.051  -14.508 1.00 59.53  ? 162  ARG A HD3    1 
ATOM   2649  H  HE     . ARG A 1 165 ? 55.239  66.388  -15.236 1.00 48.23  ? 162  ARG A HE     1 
ATOM   2650  H  HH11   . ARG A 1 165 ? 52.967  68.461  -14.005 1.00 38.42  ? 162  ARG A HH11   1 
ATOM   2651  H  HH12   . ARG A 1 165 ? 53.930  69.391  -13.351 1.00 38.42  ? 162  ARG A HH12   1 
ATOM   2652  H  HH21   . ARG A 1 165 ? 56.688  67.759  -14.161 1.00 23.08  ? 162  ARG A HH21   1 
ATOM   2653  H  HH22   . ARG A 1 165 ? 56.182  68.964  -13.447 1.00 23.08  ? 162  ARG A HH22   1 
ATOM   2654  N  N      . ARG A 1 166 ? 51.161  62.326  -16.270 1.00 29.49  ? 163  ARG A N      1 
ATOM   2655  C  CA     . ARG A 1 166 ? 51.335  61.298  -15.246 1.00 39.15  ? 163  ARG A CA     1 
ATOM   2656  C  C      . ARG A 1 166 ? 50.523  60.028  -15.436 1.00 39.22  ? 163  ARG A C      1 
ATOM   2657  O  O      . ARG A 1 166 ? 50.714  59.075  -14.689 1.00 48.30  ? 163  ARG A O      1 
ATOM   2658  C  CB     . ARG A 1 166 ? 50.976  61.851  -13.870 1.00 43.85  ? 163  ARG A CB     1 
ATOM   2659  C  CG     . ARG A 1 166 ? 52.017  62.733  -13.219 1.00 37.56  ? 163  ARG A CG     1 
ATOM   2660  C  CD     . ARG A 1 166 ? 51.310  63.713  -12.314 1.00 45.78  ? 163  ARG A CD     1 
ATOM   2661  N  NE     . ARG A 1 166 ? 50.298  63.005  -11.531 1.00 46.18  ? 163  ARG A NE     1 
ATOM   2662  C  CZ     . ARG A 1 166 ? 49.250  63.578  -10.951 1.00 52.56  ? 163  ARG A CZ     1 
ATOM   2663  N  NH1    . ARG A 1 166 ? 49.054  64.887  -11.056 1.00 47.22  ? 163  ARG A NH1    1 
ATOM   2664  N  NH2    . ARG A 1 166 ? 48.390  62.833  -10.270 1.00 49.82  ? 163  ARG A NH2    1 
ATOM   2665  H  H      . ARG A 1 166 ? 50.410  62.744  -16.233 1.00 35.39  ? 163  ARG A H      1 
ATOM   2666  H  HA     . ARG A 1 166 ? 52.271  61.044  -15.224 1.00 46.98  ? 163  ARG A HA     1 
ATOM   2667  H  HB2    . ARG A 1 166 ? 50.165  62.376  -13.954 1.00 52.62  ? 163  ARG A HB2    1 
ATOM   2668  H  HB3    . ARG A 1 166 ? 50.816  61.104  -13.273 1.00 52.62  ? 163  ARG A HB3    1 
ATOM   2669  H  HG2    . ARG A 1 166 ? 52.621  62.192  -12.686 1.00 45.07  ? 163  ARG A HG2    1 
ATOM   2670  H  HG3    . ARG A 1 166 ? 52.503  63.226  -13.899 1.00 45.07  ? 163  ARG A HG3    1 
ATOM   2671  H  HD2    . ARG A 1 166 ? 51.949  64.115  -11.705 1.00 54.94  ? 163  ARG A HD2    1 
ATOM   2672  H  HD3    . ARG A 1 166 ? 50.871  64.393  -12.848 1.00 54.94  ? 163  ARG A HD3    1 
ATOM   2673  H  HE     . ARG A 1 166 ? 50.389  62.154  -11.440 1.00 55.41  ? 163  ARG A HE     1 
ATOM   2674  H  HH11   . ARG A 1 166 ? 49.610  65.371  -11.500 1.00 56.66  ? 163  ARG A HH11   1 
ATOM   2675  H  HH12   . ARG A 1 166 ? 48.373  65.252  -10.678 1.00 56.66  ? 163  ARG A HH12   1 
ATOM   2676  H  HH21   . ARG A 1 166 ? 48.515  61.985  -10.201 1.00 59.78  ? 163  ARG A HH21   1 
ATOM   2677  H  HH22   . ARG A 1 166 ? 47.710  63.200  -9.891  1.00 59.78  ? 163  ARG A HH22   1 
ATOM   2678  N  N      . GLY A 1 167 ? 49.616  59.986  -16.403 1.00 44.34  ? 164  GLY A N      1 
ATOM   2679  C  CA     . GLY A 1 167 ? 48.775  58.809  -16.518 1.00 44.51  ? 164  GLY A CA     1 
ATOM   2680  C  C      . GLY A 1 167 ? 47.825  58.761  -17.691 1.00 38.32  ? 164  GLY A C      1 
ATOM   2681  O  O      . GLY A 1 167 ? 48.050  59.407  -18.712 1.00 31.94  ? 164  GLY A O      1 
ATOM   2682  H  H      . GLY A 1 167 ? 49.471  60.603  -16.984 1.00 53.20  ? 164  GLY A H      1 
ATOM   2683  H  HA2    . GLY A 1 167 ? 49.347  58.027  -16.574 1.00 53.41  ? 164  GLY A HA2    1 
ATOM   2684  H  HA3    . GLY A 1 167 ? 48.245  58.729  -15.710 1.00 53.41  ? 164  GLY A HA3    1 
ATOM   2685  N  N      . VAL A 1 168 ? 46.769  57.967  -17.537 1.00 32.52  ? 165  VAL A N      1 
ATOM   2686  C  CA     . VAL A 1 168 ? 45.780  57.789  -18.585 1.00 29.85  ? 165  VAL A CA     1 
ATOM   2687  C  C      . VAL A 1 168 ? 44.358  57.916  -18.042 1.00 30.30  ? 165  VAL A C      1 
ATOM   2688  O  O      . VAL A 1 168 ? 44.114  57.658  -16.865 1.00 28.51  ? 165  VAL A O      1 
ATOM   2689  C  CB     . VAL A 1 168 ? 45.949  56.406  -19.251 1.00 29.62  ? 165  VAL A CB     1 
ATOM   2690  C  CG1    . VAL A 1 168 ? 47.379  56.242  -19.747 1.00 23.66  ? 165  VAL A CG1    1 
ATOM   2691  C  CG2    . VAL A 1 168 ? 45.622  55.285  -18.272 1.00 40.11  ? 165  VAL A CG2    1 
ATOM   2692  H  H      . VAL A 1 168 ? 46.604  57.516  -16.824 1.00 39.02  ? 165  VAL A H      1 
ATOM   2693  H  HA     . VAL A 1 168 ? 45.908  58.470  -19.263 1.00 35.83  ? 165  VAL A HA     1 
ATOM   2694  H  HB     . VAL A 1 168 ? 45.349  56.337  -20.011 1.00 35.55  ? 165  VAL A HB     1 
ATOM   2695  H  HG11   . VAL A 1 168 ? 47.985  56.314  -18.993 1.00 28.39  ? 165  VAL A HG11   1 
ATOM   2696  H  HG12   . VAL A 1 168 ? 47.470  55.370  -20.163 1.00 28.39  ? 165  VAL A HG12   1 
ATOM   2697  H  HG13   . VAL A 1 168 ? 47.571  56.939  -20.394 1.00 28.39  ? 165  VAL A HG13   1 
ATOM   2698  H  HG21   . VAL A 1 168 ? 44.704  55.383  -17.976 1.00 48.13  ? 165  VAL A HG21   1 
ATOM   2699  H  HG22   . VAL A 1 168 ? 45.737  54.432  -18.719 1.00 48.13  ? 165  VAL A HG22   1 
ATOM   2700  H  HG23   . VAL A 1 168 ? 46.223  55.345  -17.512 1.00 48.13  ? 165  VAL A HG23   1 
ATOM   2701  N  N      . HIS A 1 169 ? 43.428  58.328  -18.900 1.00 28.83  ? 166  HIS A N      1 
ATOM   2702  C  CA     . HIS A 1 169 ? 42.018  58.352  -18.529 1.00 27.09  ? 166  HIS A CA     1 
ATOM   2703  C  C      . HIS A 1 169 ? 41.305  57.319  -19.386 1.00 31.36  ? 166  HIS A C      1 
ATOM   2704  O  O      . HIS A 1 169 ? 41.810  56.952  -20.442 1.00 31.81  ? 166  HIS A O      1 
ATOM   2705  C  CB     . HIS A 1 169 ? 41.371  59.720  -18.725 1.00 31.71  ? 166  HIS A CB     1 
ATOM   2706  C  CG     . HIS A 1 169 ? 42.045  60.826  -17.978 1.00 28.11  ? 166  HIS A CG     1 
ATOM   2707  N  ND1    . HIS A 1 169 ? 41.780  62.155  -18.223 1.00 37.41  ? 166  HIS A ND1    1 
ATOM   2708  C  CD2    . HIS A 1 169 ? 43.041  60.804  -17.063 1.00 49.37  ? 166  HIS A CD2    1 
ATOM   2709  C  CE1    . HIS A 1 169 ? 42.544  62.904  -17.450 1.00 31.77  ? 166  HIS A CE1    1 
ATOM   2710  N  NE2    . HIS A 1 169 ? 43.321  62.109  -16.738 1.00 50.51  ? 166  HIS A NE2    1 
ATOM   2711  H  H      . HIS A 1 169 ? 43.588  58.599  -19.701 1.00 34.60  ? 166  HIS A H      1 
ATOM   2712  H  HA     . HIS A 1 169 ? 41.924  58.098  -17.598 1.00 32.51  ? 166  HIS A HA     1 
ATOM   2713  H  HB2    . HIS A 1 169 ? 41.394  59.943  -19.668 1.00 38.05  ? 166  HIS A HB2    1 
ATOM   2714  H  HB3    . HIS A 1 169 ? 40.451  59.675  -18.421 1.00 38.05  ? 166  HIS A HB3    1 
ATOM   2715  H  HD1    . HIS A 1 169 ? 41.189  62.451  -18.773 1.00 44.89  ? 166  HIS A HD1    1 
ATOM   2716  H  HD2    . HIS A 1 169 ? 43.442  60.047  -16.701 1.00 59.24  ? 166  HIS A HD2    1 
ATOM   2717  H  HE1    . HIS A 1 169 ? 42.542  63.834  -17.418 1.00 38.12  ? 166  HIS A HE1    1 
ATOM   2718  H  HE2    . HIS A 1 169 ? 43.907  62.367  -16.164 1.00 60.61  ? 166  HIS A HE2    1 
ATOM   2719  N  N      . CYS A 1 170 ? 40.159  56.830  -18.923 1.00 31.44  ? 167  CYS A N      1 
ATOM   2720  C  CA     . CYS A 1 170 ? 39.303  55.991  -19.758 1.00 33.40  ? 167  CYS A CA     1 
ATOM   2721  C  C      . CYS A 1 170 ? 37.880  56.525  -19.718 1.00 41.06  ? 167  CYS A C      1 
ATOM   2722  O  O      . CYS A 1 170 ? 37.311  56.734  -18.648 1.00 38.08  ? 167  CYS A O      1 
ATOM   2723  C  CB     . CYS A 1 170 ? 39.322  54.532  -19.295 1.00 40.67  ? 167  CYS A CB     1 
ATOM   2724  S  SG     . CYS A 1 170 ? 38.286  53.411  -20.288 1.00 37.27  ? 167  CYS A SG     1 
ATOM   2725  H  H      . CYS A 1 170 ? 39.854  56.967  -18.131 1.00 37.73  ? 167  CYS A H      1 
ATOM   2726  H  HA     . CYS A 1 170 ? 39.617  56.025  -20.675 1.00 40.08  ? 167  CYS A HA     1 
ATOM   2727  H  HB2    . CYS A 1 170 ? 40.234  54.204  -19.338 1.00 48.81  ? 167  CYS A HB2    1 
ATOM   2728  H  HB3    . CYS A 1 170 ? 39.004  54.493  -18.379 1.00 48.81  ? 167  CYS A HB3    1 
ATOM   2729  H  HG     . CYS A 1 170 ? 38.671  53.427  -21.424 1.00 44.72  ? 167  CYS A HG     1 
ATOM   2730  N  N      . TRP A 1 171 ? 37.312  56.732  -20.901 1.00 40.31  ? 168  TRP A N      1 
ATOM   2731  C  CA     . TRP A 1 171 ? 35.931  57.172  -21.028 1.00 33.78  ? 168  TRP A CA     1 
ATOM   2732  C  C      . TRP A 1 171 ? 35.072  56.031  -21.564 1.00 40.85  ? 168  TRP A C      1 
ATOM   2733  O  O      . TRP A 1 171 ? 35.273  55.572  -22.689 1.00 45.92  ? 168  TRP A O      1 
ATOM   2734  C  CB     . TRP A 1 171 ? 35.817  58.368  -21.970 1.00 37.62  ? 168  TRP A CB     1 
ATOM   2735  C  CG     . TRP A 1 171 ? 36.584  59.597  -21.580 1.00 33.33  ? 168  TRP A CG     1 
ATOM   2736  C  CD1    . TRP A 1 171 ? 37.920  59.825  -21.750 1.00 36.01  ? 168  TRP A CD1    1 
ATOM   2737  C  CD2    . TRP A 1 171 ? 36.047  60.784  -20.986 1.00 24.76  ? 168  TRP A CD2    1 
ATOM   2738  N  NE1    . TRP A 1 171 ? 38.248  61.082  -21.290 1.00 34.72  ? 168  TRP A NE1    1 
ATOM   2739  C  CE2    . TRP A 1 171 ? 37.114  61.688  -20.816 1.00 21.94  ? 168  TRP A CE2    1 
ATOM   2740  C  CE3    . TRP A 1 171 ? 34.767  61.167  -20.578 1.00 20.40  ? 168  TRP A CE3    1 
ATOM   2741  C  CZ2    . TRP A 1 171 ? 36.939  62.945  -20.255 1.00 28.29  ? 168  TRP A CZ2    1 
ATOM   2742  C  CZ3    . TRP A 1 171 ? 34.596  62.413  -20.022 1.00 20.17  ? 168  TRP A CZ3    1 
ATOM   2743  C  CH2    . TRP A 1 171 ? 35.675  63.288  -19.863 1.00 30.44  ? 168  TRP A CH2    1 
ATOM   2744  H  H      . TRP A 1 171 ? 37.712  56.622  -21.654 1.00 48.37  ? 168  TRP A H      1 
ATOM   2745  H  HA     . TRP A 1 171 ? 35.592  57.432  -20.157 1.00 40.54  ? 168  TRP A HA     1 
ATOM   2746  H  HB2    . TRP A 1 171 ? 36.134  58.097  -22.845 1.00 45.15  ? 168  TRP A HB2    1 
ATOM   2747  H  HB3    . TRP A 1 171 ? 34.882  58.619  -22.030 1.00 45.15  ? 168  TRP A HB3    1 
ATOM   2748  H  HD1    . TRP A 1 171 ? 38.520  59.222  -22.125 1.00 43.21  ? 168  TRP A HD1    1 
ATOM   2749  H  HE1    . TRP A 1 171 ? 39.035  61.428  -21.296 1.00 41.66  ? 168  TRP A HE1    1 
ATOM   2750  H  HE3    . TRP A 1 171 ? 34.044  60.591  -20.681 1.00 24.48  ? 168  TRP A HE3    1 
ATOM   2751  H  HZ2    . TRP A 1 171 ? 37.654  63.530  -20.145 1.00 33.94  ? 168  TRP A HZ2    1 
ATOM   2752  H  HZ3    . TRP A 1 171 ? 33.748  62.677  -19.747 1.00 24.20  ? 168  TRP A HZ3    1 
ATOM   2753  H  HH2    . TRP A 1 171 ? 35.529  64.125  -19.483 1.00 36.53  ? 168  TRP A HH2    1 
ATOM   2754  N  N      . VAL A 1 172 ? 34.121  55.574  -20.758 1.00 42.80  ? 169  VAL A N      1 
ATOM   2755  C  CA     . VAL A 1 172 ? 33.185  54.541  -21.184 1.00 41.58  ? 169  VAL A CA     1 
ATOM   2756  C  C      . VAL A 1 172 ? 31.872  55.205  -21.562 1.00 50.03  ? 169  VAL A C      1 
ATOM   2757  O  O      . VAL A 1 172 ? 31.168  55.730  -20.697 1.00 42.10  ? 169  VAL A O      1 
ATOM   2758  C  CB     . VAL A 1 172 ? 32.949  53.491  -20.089 1.00 44.94  ? 169  VAL A CB     1 
ATOM   2759  C  CG1    . VAL A 1 172 ? 31.962  52.435  -20.565 1.00 46.30  ? 169  VAL A CG1    1 
ATOM   2760  C  CG2    . VAL A 1 172 ? 34.270  52.856  -19.670 1.00 36.82  ? 169  VAL A CG2    1 
ATOM   2761  H  H      . VAL A 1 172 ? 33.996  55.847  -19.952 1.00 51.36  ? 169  VAL A H      1 
ATOM   2762  H  HA     . VAL A 1 172 ? 33.537  54.091  -21.968 1.00 49.90  ? 169  VAL A HA     1 
ATOM   2763  H  HB     . VAL A 1 172 ? 32.567  53.928  -19.312 1.00 53.93  ? 169  VAL A HB     1 
ATOM   2764  H  HG11   . VAL A 1 172 ? 32.323  51.998  -21.353 1.00 55.56  ? 169  VAL A HG11   1 
ATOM   2765  H  HG12   . VAL A 1 172 ? 31.830  51.785  -19.857 1.00 55.56  ? 169  VAL A HG12   1 
ATOM   2766  H  HG13   . VAL A 1 172 ? 31.120  52.865  -20.781 1.00 55.56  ? 169  VAL A HG13   1 
ATOM   2767  H  HG21   . VAL A 1 172 ? 34.859  53.548  -19.329 1.00 44.19  ? 169  VAL A HG21   1 
ATOM   2768  H  HG22   . VAL A 1 172 ? 34.098  52.197  -18.979 1.00 44.19  ? 169  VAL A HG22   1 
ATOM   2769  H  HG23   . VAL A 1 172 ? 34.674  52.429  -20.441 1.00 44.19  ? 169  VAL A HG23   1 
ATOM   2770  N  N      . CYS A 1 173 ? 31.545  55.158  -22.853 1.00 49.95  ? 170  CYS A N      1 
ATOM   2771  C  CA     . CYS A 1 173 ? 30.497  56.000  -23.420 1.00 33.75  ? 170  CYS A CA     1 
ATOM   2772  C  C      . CYS A 1 173 ? 29.274  55.241  -23.925 1.00 41.12  ? 170  CYS A C      1 
ATOM   2773  O  O      . CYS A 1 173 ? 28.444  55.819  -24.621 1.00 62.85  ? 170  CYS A O      1 
ATOM   2774  C  CB     . CYS A 1 173 ? 31.066  56.805  -24.578 1.00 48.99  ? 170  CYS A CB     1 
ATOM   2775  S  SG     . CYS A 1 173 ? 32.564  57.673  -24.187 1.00 51.13  ? 170  CYS A SG     1 
ATOM   2776  H  H      . CYS A 1 173 ? 31.922  54.640  -23.427 1.00 59.94  ? 170  CYS A H      1 
ATOM   2777  H  HA     . CYS A 1 173 ? 30.198  56.625  -22.742 1.00 40.50  ? 170  CYS A HA     1 
ATOM   2778  H  HB2    . CYS A 1 173 ? 31.257  56.202  -25.313 1.00 58.78  ? 170  CYS A HB2    1 
ATOM   2779  H  HB3    . CYS A 1 173 ? 30.408  57.462  -24.854 1.00 58.78  ? 170  CYS A HB3    1 
ATOM   2780  H  HG     . CYS A 1 173 ? 33.401  56.878  -23.856 1.00 61.35  ? 170  CYS A HG     1 
ATOM   2781  N  N      . ASP A 1 174 ? 29.152  53.964  -23.586 1.00 35.59  ? 171  ASP A N      1 
ATOM   2782  C  CA     . ASP A 1 174 ? 27.954  53.221  -23.947 1.00 38.86  ? 171  ASP A CA     1 
ATOM   2783  C  C      . ASP A 1 174 ? 26.705  53.938  -23.453 1.00 50.42  ? 171  ASP A C      1 
ATOM   2784  O  O      . ASP A 1 174 ? 26.705  54.534  -22.379 1.00 36.40  ? 171  ASP A O      1 
ATOM   2785  C  CB     . ASP A 1 174 ? 28.019  51.803  -23.386 1.00 32.27  ? 171  ASP A CB     1 
ATOM   2786  C  CG     . ASP A 1 174 ? 29.180  51.011  -23.950 1.00 42.45  ? 171  ASP A CG     1 
ATOM   2787  O  OD1    . ASP A 1 174 ? 30.232  51.621  -24.245 1.00 34.42  ? 171  ASP A OD1    1 
ATOM   2788  O  OD2    . ASP A 1 174 ? 29.040  49.780  -24.113 1.00 35.68  ? 171  ASP A OD2    1 
ATOM   2789  H  H      . ASP A 1 174 ? 29.740  53.511  -23.152 1.00 42.70  ? 171  ASP A H      1 
ATOM   2790  H  HA     . ASP A 1 174 ? 27.901  53.158  -24.913 1.00 46.63  ? 171  ASP A HA     1 
ATOM   2791  H  HB2    . ASP A 1 174 ? 28.125  51.847  -22.422 1.00 38.72  ? 171  ASP A HB2    1 
ATOM   2792  H  HB3    . ASP A 1 174 ? 27.199  51.335  -23.609 1.00 38.72  ? 171  ASP A HB3    1 
ATOM   2793  N  N      . GLU A 1 175 ? 25.650  53.886  -24.259 1.00 65.76  ? 172  GLU A N      1 
ATOM   2794  C  CA     . GLU A 1 175 ? 24.412  54.587  -23.947 1.00 64.75  ? 172  GLU A CA     1 
ATOM   2795  C  C      . GLU A 1 175 ? 23.893  54.165  -22.584 1.00 63.58  ? 172  GLU A C      1 
ATOM   2796  O  O      . GLU A 1 175 ? 23.529  55.003  -21.762 1.00 79.38  ? 172  GLU A O      1 
ATOM   2797  C  CB     . GLU A 1 175 ? 23.347  54.332  -25.012 1.00 85.88  ? 172  GLU A CB     1 
ATOM   2798  C  CG     . GLU A 1 175 ? 21.945  54.696  -24.548 1.00 93.12  ? 172  GLU A CG     1 
ATOM   2799  C  CD     . GLU A 1 175 ? 21.007  55.030  -25.691 1.00 111.15 ? 172  GLU A CD     1 
ATOM   2800  O  OE1    . GLU A 1 175 ? 21.126  54.412  -26.770 1.00 104.74 ? 172  GLU A OE1    1 
ATOM   2801  O  OE2    . GLU A 1 175 ? 20.145  55.916  -25.506 1.00 114.81 ? 172  GLU A OE2    1 
ATOM   2802  H  H      . GLU A 1 175 ? 25.626  53.448  -24.999 1.00 78.92  ? 172  GLU A H      1 
ATOM   2803  H  HA     . GLU A 1 175 ? 24.587  55.541  -23.919 1.00 77.69  ? 172  GLU A HA     1 
ATOM   2804  H  HB2    . GLU A 1 175 ? 23.551  54.865  -25.796 1.00 103.06 ? 172  GLU A HB2    1 
ATOM   2805  H  HB3    . GLU A 1 175 ? 23.350  53.389  -25.242 1.00 103.06 ? 172  GLU A HB3    1 
ATOM   2806  H  HG2    . GLU A 1 175 ? 21.569  53.945  -24.063 1.00 111.74 ? 172  GLU A HG2    1 
ATOM   2807  H  HG3    . GLU A 1 175 ? 21.998  55.472  -23.968 1.00 111.74 ? 172  GLU A HG3    1 
ATOM   2808  N  N      . SER A 1 176 ? 23.860  52.859  -22.351 1.00 58.88  ? 173  SER A N      1 
ATOM   2809  C  CA     . SER A 1 176 ? 23.360  52.332  -21.093 1.00 66.19  ? 173  SER A CA     1 
ATOM   2810  C  C      . SER A 1 176 ? 24.281  52.722  -19.940 1.00 65.83  ? 173  SER A C      1 
ATOM   2811  O  O      . SER A 1 176 ? 23.836  52.831  -18.798 1.00 71.08  ? 173  SER A O      1 
ATOM   2812  C  CB     . SER A 1 176 ? 23.222  50.810  -21.178 1.00 80.07  ? 173  SER A CB     1 
ATOM   2813  O  OG     . SER A 1 176 ? 24.439  50.208  -21.586 1.00 61.65  ? 173  SER A OG     1 
ATOM   2814  H  H      . SER A 1 176 ? 24.123  52.258  -22.907 1.00 70.66  ? 173  SER A H      1 
ATOM   2815  H  HA     . SER A 1 176 ? 22.483  52.706  -20.918 1.00 79.43  ? 173  SER A HA     1 
ATOM   2816  H  HB2    . SER A 1 176 ? 22.979  50.467  -20.303 1.00 96.08  ? 173  SER A HB2    1 
ATOM   2817  H  HB3    . SER A 1 176 ? 22.531  50.592  -21.822 1.00 96.08  ? 173  SER A HB3    1 
ATOM   2818  H  HG     . SER A 1 176 ? 24.347  49.374  -21.628 1.00 73.98  ? 173  SER A HG     1 
ATOM   2819  N  N      . VAL A 1 177 ? 25.558  52.945  -20.246 1.00 64.48  ? 174  VAL A N      1 
ATOM   2820  C  CA     . VAL A 1 177 ? 26.546  53.300  -19.228 1.00 48.13  ? 174  VAL A CA     1 
ATOM   2821  C  C      . VAL A 1 177 ? 26.380  54.722  -18.732 1.00 49.18  ? 174  VAL A C      1 
ATOM   2822  O  O      . VAL A 1 177 ? 26.476  54.973  -17.533 1.00 54.82  ? 174  VAL A O      1 
ATOM   2823  C  CB     . VAL A 1 177 ? 27.998  53.129  -19.755 1.00 42.14  ? 174  VAL A CB     1 
ATOM   2824  C  CG1    . VAL A 1 177 ? 29.009  53.951  -18.939 1.00 29.67  ? 174  VAL A CG1    1 
ATOM   2825  C  CG2    . VAL A 1 177 ? 28.379  51.654  -19.797 1.00 39.05  ? 174  VAL A CG2    1 
ATOM   2826  H  H      . VAL A 1 177 ? 25.880  52.897  -21.042 1.00 77.38  ? 174  VAL A H      1 
ATOM   2827  H  HA     . VAL A 1 177 ? 26.435  52.707  -18.468 1.00 57.76  ? 174  VAL A HA     1 
ATOM   2828  H  HB     . VAL A 1 177 ? 28.030  53.459  -20.667 1.00 50.56  ? 174  VAL A HB     1 
ATOM   2829  H  HG11   . VAL A 1 177 ? 28.982  53.658  -18.015 1.00 35.60  ? 174  VAL A HG11   1 
ATOM   2830  H  HG12   . VAL A 1 177 ? 29.897  53.812  -19.305 1.00 35.60  ? 174  VAL A HG12   1 
ATOM   2831  H  HG13   . VAL A 1 177 ? 28.771  54.890  -18.996 1.00 35.60  ? 174  VAL A HG13   1 
ATOM   2832  H  HG21   . VAL A 1 177 ? 27.768  51.187  -20.388 1.00 46.86  ? 174  VAL A HG21   1 
ATOM   2833  H  HG22   . VAL A 1 177 ? 29.287  51.572  -20.129 1.00 46.86  ? 174  VAL A HG22   1 
ATOM   2834  H  HG23   . VAL A 1 177 ? 28.319  51.287  -18.901 1.00 46.86  ? 174  VAL A HG23   1 
ATOM   2835  N  N      . ARG A 1 178 ? 26.124  55.650  -19.648 1.00 49.15  ? 175  ARG A N      1 
ATOM   2836  C  CA     . ARG A 1 178 ? 26.033  57.059  -19.280 1.00 49.58  ? 175  ARG A CA     1 
ATOM   2837  C  C      . ARG A 1 178 ? 24.883  57.345  -18.312 1.00 51.93  ? 175  ARG A C      1 
ATOM   2838  O  O      . ARG A 1 178 ? 24.845  58.414  -17.701 1.00 59.45  ? 175  ARG A O      1 
ATOM   2839  C  CB     . ARG A 1 178 ? 25.894  57.947  -20.524 1.00 51.65  ? 175  ARG A CB     1 
ATOM   2840  C  CG     . ARG A 1 178 ? 26.994  57.768  -21.572 1.00 48.90  ? 175  ARG A CG     1 
ATOM   2841  C  CD     . ARG A 1 178 ? 26.963  58.894  -22.606 1.00 61.96  ? 175  ARG A CD     1 
ATOM   2842  N  NE     . ARG A 1 178 ? 25.800  58.851  -23.493 1.00 65.76  ? 175  ARG A NE     1 
ATOM   2843  C  CZ     . ARG A 1 178 ? 25.714  58.114  -24.597 1.00 62.39  ? 175  ARG A CZ     1 
ATOM   2844  N  NH1    . ARG A 1 178 ? 26.725  57.345  -24.973 1.00 63.85  ? 175  ARG A NH1    1 
ATOM   2845  N  NH2    . ARG A 1 178 ? 24.612  58.151  -25.331 1.00 68.20  ? 175  ARG A NH2    1 
ATOM   2846  H  H      . ARG A 1 178 ? 26.000  55.493  -20.484 1.00 58.98  ? 175  ARG A H      1 
ATOM   2847  H  HA     . ARG A 1 178 ? 26.857  57.311  -18.834 1.00 59.49  ? 175  ARG A HA     1 
ATOM   2848  H  HB2    . ARG A 1 178 ? 25.047  57.748  -20.952 1.00 61.98  ? 175  ARG A HB2    1 
ATOM   2849  H  HB3    . ARG A 1 178 ? 25.906  58.875  -20.243 1.00 61.98  ? 175  ARG A HB3    1 
ATOM   2850  H  HG2    . ARG A 1 178 ? 27.859  57.780  -21.135 1.00 58.68  ? 175  ARG A HG2    1 
ATOM   2851  H  HG3    . ARG A 1 178 ? 26.862  56.926  -22.035 1.00 58.68  ? 175  ARG A HG3    1 
ATOM   2852  H  HD2    . ARG A 1 178 ? 26.949  59.745  -22.141 1.00 74.35  ? 175  ARG A HD2    1 
ATOM   2853  H  HD3    . ARG A 1 178 ? 27.758  58.833  -23.157 1.00 74.35  ? 175  ARG A HD3    1 
ATOM   2854  H  HE     . ARG A 1 178 ? 25.122  59.338  -23.286 1.00 78.92  ? 175  ARG A HE     1 
ATOM   2855  H  HH11   . ARG A 1 178 ? 27.443  57.318  -24.501 1.00 76.62  ? 175  ARG A HH11   1 
ATOM   2856  H  HH12   . ARG A 1 178 ? 26.662  56.872  -25.689 1.00 76.62  ? 175  ARG A HH12   1 
ATOM   2857  H  HH21   . ARG A 1 178 ? 23.952  58.649  -25.092 1.00 81.84  ? 175  ARG A HH21   1 
ATOM   2858  H  HH22   . ARG A 1 178 ? 24.555  57.676  -26.045 1.00 81.84  ? 175  ARG A HH22   1 
ATOM   2859  N  N      . LYS A 1 179 ? 23.958  56.398  -18.163 1.00 42.04  ? 176  LYS A N      1 
ATOM   2860  C  CA     . LYS A 1 179 ? 22.796  56.589  -17.290 1.00 51.35  ? 176  LYS A CA     1 
ATOM   2861  C  C      . LYS A 1 179 ? 22.949  55.913  -15.929 1.00 54.50  ? 176  LYS A C      1 
ATOM   2862  O  O      . LYS A 1 179 ? 22.001  55.870  -15.142 1.00 49.98  ? 176  LYS A O      1 
ATOM   2863  C  CB     . LYS A 1 179 ? 21.523  56.070  -17.967 1.00 73.53  ? 176  LYS A CB     1 
ATOM   2864  C  CG     . LYS A 1 179 ? 21.179  56.767  -19.268 1.00 73.46  ? 176  LYS A CG     1 
ATOM   2865  C  CD     . LYS A 1 179 ? 19.961  56.148  -19.944 1.00 82.56  ? 176  LYS A CD     1 
ATOM   2866  C  CE     . LYS A 1 179 ? 19.647  56.821  -21.277 1.00 110.38 ? 176  LYS A CE     1 
ATOM   2867  N  NZ     . LYS A 1 179 ? 20.825  56.906  -22.178 1.00 95.22  ? 176  LYS A NZ     1 
ATOM   2868  H  H      . LYS A 1 179 ? 23.979  55.634  -18.557 1.00 50.45  ? 176  LYS A H      1 
ATOM   2869  H  HA     . LYS A 1 179 ? 22.679  57.539  -17.135 1.00 61.62  ? 176  LYS A HA     1 
ATOM   2870  H  HB2    . LYS A 1 179 ? 21.635  55.126  -18.159 1.00 88.24  ? 176  LYS A HB2    1 
ATOM   2871  H  HB3    . LYS A 1 179 ? 20.776  56.194  -17.360 1.00 88.24  ? 176  LYS A HB3    1 
ATOM   2872  H  HG2    . LYS A 1 179 ? 20.984  57.700  -19.087 1.00 88.15  ? 176  LYS A HG2    1 
ATOM   2873  H  HG3    . LYS A 1 179 ? 21.932  56.695  -19.876 1.00 88.15  ? 176  LYS A HG3    1 
ATOM   2874  H  HD2    . LYS A 1 179 ? 20.133  55.209  -20.112 1.00 99.07  ? 176  LYS A HD2    1 
ATOM   2875  H  HD3    . LYS A 1 179 ? 19.190  56.249  -19.365 1.00 99.07  ? 176  LYS A HD3    1 
ATOM   2876  H  HE2    . LYS A 1 179 ? 18.959  56.312  -21.732 1.00 132.46 ? 176  LYS A HE2    1 
ATOM   2877  H  HE3    . LYS A 1 179 ? 19.334  57.724  -21.108 1.00 132.46 ? 176  LYS A HE3    1 
ATOM   2878  H  HZ1    . LYS A 1 179 ? 21.130  56.089  -22.358 1.00 114.27 ? 176  LYS A HZ1    1 
ATOM   2879  H  HZ2    . LYS A 1 179 ? 20.596  57.304  -22.941 1.00 114.27 ? 176  LYS A HZ2    1 
ATOM   2880  H  HZ3    . LYS A 1 179 ? 21.472  57.377  -21.789 1.00 114.27 ? 176  LYS A HZ3    1 
ATOM   2881  N  N      . LEU A 1 180 ? 24.140  55.398  -15.646 1.00 49.34  ? 177  LEU A N      1 
ATOM   2882  C  CA     . LEU A 1 180 ? 24.385  54.671  -14.404 1.00 42.21  ? 177  LEU A CA     1 
ATOM   2883  C  C      . LEU A 1 180 ? 24.359  55.603  -13.198 1.00 46.23  ? 177  LEU A C      1 
ATOM   2884  O  O      . LEU A 1 180 ? 24.934  56.692  -13.227 1.00 49.27  ? 177  LEU A O      1 
ATOM   2885  C  CB     . LEU A 1 180 ? 25.726  53.941  -14.484 1.00 45.01  ? 177  LEU A CB     1 
ATOM   2886  C  CG     . LEU A 1 180 ? 25.762  52.732  -15.416 1.00 42.04  ? 177  LEU A CG     1 
ATOM   2887  C  CD1    . LEU A 1 180 ? 27.174  52.189  -15.545 1.00 43.26  ? 177  LEU A CD1    1 
ATOM   2888  C  CD2    . LEU A 1 180 ? 24.842  51.649  -14.881 1.00 47.71  ? 177  LEU A CD2    1 
ATOM   2889  H  H      . LEU A 1 180 ? 24.828  55.455  -16.160 1.00 59.21  ? 177  LEU A H      1 
ATOM   2890  H  HA     . LEU A 1 180 ? 23.688  54.007  -14.284 1.00 50.65  ? 177  LEU A HA     1 
ATOM   2891  H  HB2    . LEU A 1 180 ? 26.398  54.568  -14.795 1.00 54.01  ? 177  LEU A HB2    1 
ATOM   2892  H  HB3    . LEU A 1 180 ? 25.960  53.631  -13.596 1.00 54.01  ? 177  LEU A HB3    1 
ATOM   2893  H  HG     . LEU A 1 180 ? 25.450  52.993  -16.297 1.00 50.44  ? 177  LEU A HG     1 
ATOM   2894  H  HD11   . LEU A 1 180 ? 27.490  51.921  -14.668 1.00 51.91  ? 177  LEU A HD11   1 
ATOM   2895  H  HD12   . LEU A 1 180 ? 27.164  51.424  -16.141 1.00 51.91  ? 177  LEU A HD12   1 
ATOM   2896  H  HD13   . LEU A 1 180 ? 27.747  52.883  -15.906 1.00 51.91  ? 177  LEU A HD13   1 
ATOM   2897  H  HD21   . LEU A 1 180 ? 23.938  51.998  -14.834 1.00 57.25  ? 177  LEU A HD21   1 
ATOM   2898  H  HD22   . LEU A 1 180 ? 24.872  50.887  -15.480 1.00 57.25  ? 177  LEU A HD22   1 
ATOM   2899  H  HD23   . LEU A 1 180 ? 25.143  51.388  -13.997 1.00 57.25  ? 177  LEU A HD23   1 
ATOM   2900  N  N      . SER A 1 181 ? 23.693  55.166  -12.133 1.00 45.85  ? 178  SER A N      1 
ATOM   2901  C  CA     . SER A 1 181 ? 23.601  55.967  -10.917 1.00 44.41  ? 178  SER A CA     1 
ATOM   2902  C  C      . SER A 1 181 ? 24.975  56.063  -10.294 1.00 41.17  ? 178  SER A C      1 
ATOM   2903  O  O      . SER A 1 181 ? 25.877  55.315  -10.658 1.00 45.90  ? 178  SER A O      1 
ATOM   2904  C  CB     . SER A 1 181 ? 22.614  55.361  -9.911  1.00 56.87  ? 178  SER A CB     1 
ATOM   2905  O  OG     . SER A 1 181 ? 23.096  54.132  -9.388  1.00 42.51  ? 178  SER A OG     1 
ATOM   2906  H  H      . SER A 1 181 ? 23.286  54.410  -12.089 1.00 55.02  ? 178  SER A H      1 
ATOM   2907  H  HA     . SER A 1 181 ? 23.302  56.862  -11.140 1.00 53.29  ? 178  SER A HA     1 
ATOM   2908  H  HB2    . SER A 1 181 ? 22.488  55.985  -9.179  1.00 68.25  ? 178  SER A HB2    1 
ATOM   2909  H  HB3    . SER A 1 181 ? 21.768  55.202  -10.358 1.00 68.25  ? 178  SER A HB3    1 
ATOM   2910  H  HG     . SER A 1 181 ? 22.543  53.816  -8.841  1.00 51.02  ? 178  SER A HG     1 
ATOM   2911  N  N      . SER A 1 182 ? 25.137  56.989  -9.358  1.00 53.27  ? 179  SER A N      1 
ATOM   2912  C  CA     . SER A 1 182 ? 26.413  57.147  -8.683  1.00 47.54  ? 179  SER A CA     1 
ATOM   2913  C  C      . SER A 1 182 ? 26.742  55.898  -7.880  1.00 44.21  ? 179  SER A C      1 
ATOM   2914  O  O      . SER A 1 182 ? 27.908  55.562  -7.691  1.00 62.56  ? 179  SER A O      1 
ATOM   2915  C  CB     . SER A 1 182 ? 26.391  58.369  -7.770  1.00 35.08  ? 179  SER A CB     1 
ATOM   2916  O  OG     . SER A 1 182 ? 27.676  58.605  -7.230  1.00 67.55  ? 179  SER A OG     1 
ATOM   2917  H  H      . SER A 1 182 ? 24.526  57.535  -9.097  1.00 63.92  ? 179  SER A H      1 
ATOM   2918  H  HA     . SER A 1 182 ? 27.111  57.275  -9.345  1.00 57.05  ? 179  SER A HA     1 
ATOM   2919  H  HB2    . SER A 1 182 ? 26.116  59.144  -8.284  1.00 42.10  ? 179  SER A HB2    1 
ATOM   2920  H  HB3    . SER A 1 182 ? 25.767  58.211  -7.045  1.00 42.10  ? 179  SER A HB3    1 
ATOM   2921  H  HG     . SER A 1 182 ? 28.227  58.741  -7.850  1.00 81.06  ? 179  SER A HG     1 
ATOM   2922  N  N      . ALA A 1 183 ? 25.705  55.200  -7.430  1.00 38.70  ? 180  ALA A N      1 
ATOM   2923  C  CA     . ALA A 1 183 ? 25.886  54.003  -6.617  1.00 34.73  ? 180  ALA A CA     1 
ATOM   2924  C  C      . ALA A 1 183 ? 26.454  52.852  -7.433  1.00 41.61  ? 180  ALA A C      1 
ATOM   2925  O  O      . ALA A 1 183 ? 27.315  52.113  -6.963  1.00 55.99  ? 180  ALA A O      1 
ATOM   2926  C  CB     . ALA A 1 183 ? 24.568  53.589  -5.988  1.00 29.89  ? 180  ALA A CB     1 
ATOM   2927  H  H      . ALA A 1 183 ? 24.882  55.400  -7.581  1.00 46.44  ? 180  ALA A H      1 
ATOM   2928  H  HA     . ALA A 1 183 ? 26.511  54.199  -5.902  1.00 41.68  ? 180  ALA A HA     1 
ATOM   2929  H  HB1    . ALA A 1 183 ? 23.927  53.405  -6.692  1.00 35.86  ? 180  ALA A HB1    1 
ATOM   2930  H  HB2    . ALA A 1 183 ? 24.711  52.792  -5.453  1.00 35.86  ? 180  ALA A HB2    1 
ATOM   2931  H  HB3    . ALA A 1 183 ? 24.246  54.311  -5.427  1.00 35.86  ? 180  ALA A HB3    1 
ATOM   2932  N  N      . VAL A 1 184 ? 25.975  52.696  -8.659  1.00 50.15  ? 181  VAL A N      1 
ATOM   2933  C  CA     . VAL A 1 184 ? 26.481  51.628  -9.502  1.00 49.28  ? 181  VAL A CA     1 
ATOM   2934  C  C      . VAL A 1 184 ? 27.888  51.988  -9.941  1.00 53.73  ? 181  VAL A C      1 
ATOM   2935  O  O      . VAL A 1 184 ? 28.749  51.120  -10.038 1.00 50.29  ? 181  VAL A O      1 
ATOM   2936  C  CB     . VAL A 1 184 ? 25.591  51.384  -10.722 1.00 33.04  ? 181  VAL A CB     1 
ATOM   2937  C  CG1    . VAL A 1 184 ? 26.252  50.379  -11.666 1.00 40.19  ? 181  VAL A CG1    1 
ATOM   2938  C  CG2    . VAL A 1 184 ? 24.239  50.868  -10.267 1.00 31.14  ? 181  VAL A CG2    1 
ATOM   2939  H  H      . VAL A 1 184 ? 25.368  53.186  -9.020  1.00 60.18  ? 181  VAL A H      1 
ATOM   2940  H  HA     . VAL A 1 184 ? 26.524  50.807  -8.988  1.00 59.14  ? 181  VAL A HA     1 
ATOM   2941  H  HB     . VAL A 1 184 ? 25.459  52.218  -11.200 1.00 39.65  ? 181  VAL A HB     1 
ATOM   2942  H  HG11   . VAL A 1 184 ? 26.386  49.543  -11.192 1.00 48.23  ? 181  VAL A HG11   1 
ATOM   2943  H  HG12   . VAL A 1 184 ? 25.674  50.238  -12.431 1.00 48.23  ? 181  VAL A HG12   1 
ATOM   2944  H  HG13   . VAL A 1 184 ? 27.106  50.735  -11.957 1.00 48.23  ? 181  VAL A HG13   1 
ATOM   2945  H  HG21   . VAL A 1 184 ? 23.827  51.528  -9.688  1.00 37.37  ? 181  VAL A HG21   1 
ATOM   2946  H  HG22   . VAL A 1 184 ? 23.681  50.716  -11.046 1.00 37.37  ? 181  VAL A HG22   1 
ATOM   2947  H  HG23   . VAL A 1 184 ? 24.366  50.036  -9.783  1.00 37.37  ? 181  VAL A HG23   1 
ATOM   2948  N  N      . ARG A 1 185 ? 28.126  53.274  -10.176 1.00 58.41  ? 182  ARG A N      1 
ATOM   2949  C  CA     . ARG A 1 185 ? 29.452  53.730  -10.571 1.00 53.31  ? 182  ARG A CA     1 
ATOM   2950  C  C      . ARG A 1 185 ? 30.435  53.402  -9.463  1.00 46.24  ? 182  ARG A C      1 
ATOM   2951  O  O      . ARG A 1 185 ? 31.534  52.915  -9.726  1.00 52.71  ? 182  ARG A O      1 
ATOM   2952  C  CB     . ARG A 1 185 ? 29.469  55.228  -10.878 1.00 59.51  ? 182  ARG A CB     1 
ATOM   2953  C  CG     . ARG A 1 185 ? 28.775  55.604  -12.182 1.00 56.64  ? 182  ARG A CG     1 
ATOM   2954  C  CD     . ARG A 1 185 ? 28.537  57.105  -12.315 1.00 47.78  ? 182  ARG A CD     1 
ATOM   2955  N  NE     . ARG A 1 185 ? 27.436  57.376  -13.241 1.00 51.70  ? 182  ARG A NE     1 
ATOM   2956  C  CZ     . ARG A 1 185 ? 27.573  57.698  -14.526 1.00 44.66  ? 182  ARG A CZ     1 
ATOM   2957  N  NH1    . ARG A 1 185 ? 28.771  57.798  -15.091 1.00 45.61  ? 182  ARG A NH1    1 
ATOM   2958  N  NH2    . ARG A 1 185 ? 26.493  57.910  -15.256 1.00 43.17  ? 182  ARG A NH2    1 
ATOM   2959  H  H      . ARG A 1 185 ? 27.539  53.900  -10.115 1.00 70.09  ? 182  ARG A H      1 
ATOM   2960  H  HA     . ARG A 1 185 ? 29.727  53.255  -11.370 1.00 63.98  ? 182  ARG A HA     1 
ATOM   2961  H  HB2    . ARG A 1 185 ? 29.021  55.699  -10.159 1.00 71.41  ? 182  ARG A HB2    1 
ATOM   2962  H  HB3    . ARG A 1 185 ? 30.391  55.524  -10.939 1.00 71.41  ? 182  ARG A HB3    1 
ATOM   2963  H  HG2    . ARG A 1 185 ? 29.328  55.321  -12.927 1.00 67.97  ? 182  ARG A HG2    1 
ATOM   2964  H  HG3    . ARG A 1 185 ? 27.913  55.159  -12.220 1.00 67.97  ? 182  ARG A HG3    1 
ATOM   2965  H  HD2    . ARG A 1 185 ? 28.304  57.472  -11.448 1.00 57.34  ? 182  ARG A HD2    1 
ATOM   2966  H  HD3    . ARG A 1 185 ? 29.338  57.529  -12.658 1.00 57.34  ? 182  ARG A HD3    1 
ATOM   2967  H  HE     . ARG A 1 185 ? 26.636  57.324  -12.931 1.00 62.04  ? 182  ARG A HE     1 
ATOM   2968  H  HH11   . ARG A 1 185 ? 29.479  57.659  -14.624 1.00 54.73  ? 182  ARG A HH11   1 
ATOM   2969  H  HH12   . ARG A 1 185 ? 28.837  58.006  -15.923 1.00 54.73  ? 182  ARG A HH12   1 
ATOM   2970  H  HH21   . ARG A 1 185 ? 25.714  57.847  -14.898 1.00 51.81  ? 182  ARG A HH21   1 
ATOM   2971  H  HH22   . ARG A 1 185 ? 26.570  58.119  -16.087 1.00 51.81  ? 182  ARG A HH22   1 
ATOM   2972  N  N      . SER A 1 186 ? 30.045  53.671  -8.222  1.00 49.17  ? 183  SER A N      1 
ATOM   2973  C  CA     . SER A 1 186 ? 30.922  53.395  -7.096  1.00 46.66  ? 183  SER A CA     1 
ATOM   2974  C  C      . SER A 1 186 ? 31.147  51.895  -6.960  1.00 50.31  ? 183  SER A C      1 
ATOM   2975  O  O      . SER A 1 186 ? 32.220  51.460  -6.558  1.00 58.19  ? 183  SER A O      1 
ATOM   2976  C  CB     . SER A 1 186 ? 30.325  53.946  -5.798  1.00 41.55  ? 183  SER A CB     1 
ATOM   2977  O  OG     . SER A 1 186 ? 31.267  53.887  -4.739  1.00 79.15  ? 183  SER A OG     1 
ATOM   2978  H  H      . SER A 1 186 ? 29.284  54.010  -8.009  1.00 59.01  ? 183  SER A H      1 
ATOM   2979  H  HA     . SER A 1 186 ? 31.781  53.821  -7.243  1.00 55.99  ? 183  SER A HA     1 
ATOM   2980  H  HB2    . SER A 1 186 ? 30.065  54.870  -5.938  1.00 49.86  ? 183  SER A HB2    1 
ATOM   2981  H  HB3    . SER A 1 186 ? 29.548  53.416  -5.559  1.00 49.86  ? 183  SER A HB3    1 
ATOM   2982  H  HG     . SER A 1 186 ? 30.926  54.192  -4.034  1.00 94.97  ? 183  SER A HG     1 
ATOM   2983  N  N      . GLY A 1 187 ? 30.144  51.111  -7.345  1.00 48.56  ? 184  GLY A N      1 
ATOM   2984  C  CA     . GLY A 1 187 ? 30.216  49.666  -7.246  1.00 34.23  ? 184  GLY A CA     1 
ATOM   2985  C  C      . GLY A 1 187 ? 31.165  49.066  -8.258  1.00 37.93  ? 184  GLY A C      1 
ATOM   2986  O  O      . GLY A 1 187 ? 31.823  48.068  -7.985  1.00 50.98  ? 184  GLY A O      1 
ATOM   2987  H  H      . GLY A 1 187 ? 29.403  51.401  -7.672  1.00 58.27  ? 184  GLY A H      1 
ATOM   2988  H  HA2    . GLY A 1 187 ? 30.517  49.418  -6.358  1.00 41.07  ? 184  GLY A HA2    1 
ATOM   2989  H  HA3    . GLY A 1 187 ? 29.334  49.288  -7.389  1.00 41.07  ? 184  GLY A HA3    1 
ATOM   2990  N  N      . ILE A 1 188 ? 31.243  49.689  -9.429  1.00 44.17  ? 185  ILE A N      1 
ATOM   2991  C  CA     . ILE A 1 188 ? 32.175  49.260  -10.461 1.00 31.80  ? 185  ILE A CA     1 
ATOM   2992  C  C      . ILE A 1 188 ? 33.599  49.493  -9.984  1.00 33.57  ? 185  ILE A C      1 
ATOM   2993  O  O      . ILE A 1 188 ? 34.485  48.688  -10.251 1.00 32.73  ? 185  ILE A O      1 
ATOM   2994  C  CB     . ILE A 1 188 ? 31.921  50.005  -11.787 1.00 31.35  ? 185  ILE A CB     1 
ATOM   2995  C  CG1    . ILE A 1 188 ? 30.519  49.663  -12.300 1.00 33.62  ? 185  ILE A CG1    1 
ATOM   2996  C  CG2    . ILE A 1 188 ? 32.978  49.630  -12.829 1.00 31.64  ? 185  ILE A CG2    1 
ATOM   2997  C  CD1    . ILE A 1 188 ? 30.147  50.287  -13.629 1.00 49.56  ? 185  ILE A CD1    1 
ATOM   2998  H  H      . ILE A 1 188 ? 30.763  50.367  -9.650  1.00 53.00  ? 185  ILE A H      1 
ATOM   2999  H  HA     . ILE A 1 188 ? 32.060  48.310  -10.621 1.00 38.15  ? 185  ILE A HA     1 
ATOM   3000  H  HB     . ILE A 1 188 ? 31.969  50.960  -11.622 1.00 37.61  ? 185  ILE A HB     1 
ATOM   3001  H  HG12   . ILE A 1 188 ? 30.456  48.701  -12.402 1.00 40.35  ? 185  ILE A HG12   1 
ATOM   3002  H  HG13   . ILE A 1 188 ? 29.870  49.963  -11.645 1.00 40.35  ? 185  ILE A HG13   1 
ATOM   3003  H  HG21   . ILE A 1 188 ? 32.938  48.675  -12.989 1.00 37.97  ? 185  ILE A HG21   1 
ATOM   3004  H  HG22   . ILE A 1 188 ? 32.795  50.112  -13.651 1.00 37.97  ? 185  ILE A HG22   1 
ATOM   3005  H  HG23   . ILE A 1 188 ? 33.854  49.874  -12.491 1.00 37.97  ? 185  ILE A HG23   1 
ATOM   3006  H  HD11   . ILE A 1 188 ? 30.774  49.987  -14.306 1.00 59.48  ? 185  ILE A HD11   1 
ATOM   3007  H  HD12   . ILE A 1 188 ? 29.247  50.012  -13.866 1.00 59.48  ? 185  ILE A HD12   1 
ATOM   3008  H  HD13   . ILE A 1 188 ? 30.187  51.253  -13.546 1.00 59.48  ? 185  ILE A HD13   1 
ATOM   3009  N  N      . VAL A 1 189 ? 33.822  50.599  -9.287  1.00 38.41  ? 186  VAL A N      1 
ATOM   3010  C  CA     . VAL A 1 189 ? 35.148  50.894  -8.756  1.00 41.28  ? 186  VAL A CA     1 
ATOM   3011  C  C      . VAL A 1 189 ? 35.570  49.862  -7.698  1.00 40.67  ? 186  VAL A C      1 
ATOM   3012  O  O      . VAL A 1 189 ? 36.726  49.440  -7.665  1.00 44.97  ? 186  VAL A O      1 
ATOM   3013  C  CB     . VAL A 1 189 ? 35.197  52.311  -8.162  1.00 40.68  ? 186  VAL A CB     1 
ATOM   3014  C  CG1    . VAL A 1 189 ? 36.446  52.521  -7.312  1.00 47.99  ? 186  VAL A CG1    1 
ATOM   3015  C  CG2    . VAL A 1 189 ? 35.152  53.335  -9.275  1.00 26.99  ? 186  VAL A CG2    1 
ATOM   3016  H  H      . VAL A 1 189 ? 33.227  51.193  -9.106  1.00 46.09  ? 186  VAL A H      1 
ATOM   3017  H  HA     . VAL A 1 189 ? 35.790  50.854  -9.482  1.00 49.54  ? 186  VAL A HA     1 
ATOM   3018  H  HB     . VAL A 1 189 ? 34.420  52.446  -7.596  1.00 48.82  ? 186  VAL A HB     1 
ATOM   3019  H  HG11   . VAL A 1 189 ? 37.230  52.391  -7.868  1.00 57.59  ? 186  VAL A HG11   1 
ATOM   3020  H  HG12   . VAL A 1 189 ? 36.438  53.424  -6.958  1.00 57.59  ? 186  VAL A HG12   1 
ATOM   3021  H  HG13   . VAL A 1 189 ? 36.445  51.880  -6.585  1.00 57.59  ? 186  VAL A HG13   1 
ATOM   3022  H  HG21   . VAL A 1 189 ? 34.329  53.221  -9.775  1.00 32.39  ? 186  VAL A HG21   1 
ATOM   3023  H  HG22   . VAL A 1 189 ? 35.184  54.224  -8.887  1.00 32.39  ? 186  VAL A HG22   1 
ATOM   3024  H  HG23   . VAL A 1 189 ? 35.916  53.201  -9.857  1.00 32.39  ? 186  VAL A HG23   1 
ATOM   3025  N  N      . GLU A 1 190 ? 34.636  49.458  -6.840  1.00 35.04  ? 187  GLU A N      1 
ATOM   3026  C  CA     . GLU A 1 190 ? 34.928  48.476  -5.792  1.00 39.21  ? 187  GLU A CA     1 
ATOM   3027  C  C      . GLU A 1 190 ? 35.277  47.106  -6.361  1.00 38.12  ? 187  GLU A C      1 
ATOM   3028  O  O      . GLU A 1 190 ? 36.114  46.383  -5.821  1.00 55.32  ? 187  GLU A O      1 
ATOM   3029  C  CB     . GLU A 1 190 ? 33.733  48.318  -4.859  1.00 36.82  ? 187  GLU A CB     1 
ATOM   3030  C  CG     . GLU A 1 190 ? 33.319  49.576  -4.144  1.00 46.81  ? 187  GLU A CG     1 
ATOM   3031  C  CD     . GLU A 1 190 ? 32.083  49.371  -3.300  1.00 69.79  ? 187  GLU A CD     1 
ATOM   3032  O  OE1    . GLU A 1 190 ? 31.948  48.281  -2.700  1.00 58.17  ? 187  GLU A OE1    1 
ATOM   3033  O  OE2    . GLU A 1 190 ? 31.232  50.288  -3.258  1.00 70.86  ? 187  GLU A OE2    1 
ATOM   3034  H  H      . GLU A 1 190 ? 33.823  49.736  -6.842  1.00 42.05  ? 187  GLU A H      1 
ATOM   3035  H  HA     . GLU A 1 190 ? 35.683  48.787  -5.268  1.00 47.05  ? 187  GLU A HA     1 
ATOM   3036  H  HB2    . GLU A 1 190 ? 32.974  48.013  -5.379  1.00 44.19  ? 187  GLU A HB2    1 
ATOM   3037  H  HB3    . GLU A 1 190 ? 33.953  47.657  -4.185  1.00 44.19  ? 187  GLU A HB3    1 
ATOM   3038  H  HG2    . GLU A 1 190 ? 34.039  49.862  -3.561  1.00 56.17  ? 187  GLU A HG2    1 
ATOM   3039  H  HG3    . GLU A 1 190 ? 33.126  50.265  -4.799  1.00 56.17  ? 187  GLU A HG3    1 
ATOM   3040  N  N      . TYR A 1 191 ? 34.622  46.763  -7.461  1.00 33.97  ? 188  TYR A N      1 
ATOM   3041  C  CA     . TYR A 1 191 ? 34.877  45.512  -8.156  1.00 31.69  ? 188  TYR A CA     1 
ATOM   3042  C  C      . TYR A 1 191 ? 36.283  45.506  -8.744  1.00 36.89  ? 188  TYR A C      1 
ATOM   3043  O  O      . TYR A 1 191 ? 36.988  44.495  -8.697  1.00 38.87  ? 188  TYR A O      1 
ATOM   3044  C  CB     . TYR A 1 191 ? 33.827  45.333  -9.254  1.00 28.95  ? 188  TYR A CB     1 
ATOM   3045  C  CG     . TYR A 1 191 ? 34.028  44.156  -10.178 1.00 33.52  ? 188  TYR A CG     1 
ATOM   3046  C  CD1    . TYR A 1 191 ? 33.533  42.896  -9.874  1.00 33.09  ? 188  TYR A CD1    1 
ATOM   3047  C  CD2    . TYR A 1 191 ? 34.736  44.314  -11.364 1.00 32.91  ? 188  TYR A CD2    1 
ATOM   3048  C  CE1    . TYR A 1 191 ? 33.725  41.833  -10.744 1.00 36.30  ? 188  TYR A CE1    1 
ATOM   3049  C  CE2    . TYR A 1 191 ? 34.940  43.261  -12.228 1.00 26.73  ? 188  TYR A CE2    1 
ATOM   3050  C  CZ     . TYR A 1 191 ? 34.434  42.026  -11.918 1.00 32.38  ? 188  TYR A CZ     1 
ATOM   3051  O  OH     . TYR A 1 191 ? 34.640  40.984  -12.791 1.00 42.88  ? 188  TYR A OH     1 
ATOM   3052  H  H      . TYR A 1 191 ? 34.015  47.247  -7.830  1.00 40.76  ? 188  TYR A H      1 
ATOM   3053  H  HA     . TYR A 1 191 ? 34.801  44.773  -7.533  1.00 38.03  ? 188  TYR A HA     1 
ATOM   3054  H  HB2    . TYR A 1 191 ? 32.960  45.224  -8.832  1.00 34.74  ? 188  TYR A HB2    1 
ATOM   3055  H  HB3    . TYR A 1 191 ? 33.820  46.133  -9.803  1.00 34.74  ? 188  TYR A HB3    1 
ATOM   3056  H  HD1    . TYR A 1 191 ? 33.054  42.767  -9.088  1.00 39.70  ? 188  TYR A HD1    1 
ATOM   3057  H  HD2    . TYR A 1 191 ? 35.078  45.151  -11.580 1.00 39.50  ? 188  TYR A HD2    1 
ATOM   3058  H  HE1    . TYR A 1 191 ? 33.388  40.992  -10.535 1.00 43.56  ? 188  TYR A HE1    1 
ATOM   3059  H  HE2    . TYR A 1 191 ? 35.412  43.389  -13.019 1.00 32.07  ? 188  TYR A HE2    1 
ATOM   3060  H  HH     . TYR A 1 191 ? 35.083  41.249  -13.454 1.00 51.45  ? 188  TYR A HH     1 
ATOM   3061  N  N      . LEU A 1 192 ? 36.685  46.642  -9.301  1.00 34.90  ? 189  LEU A N      1 
ATOM   3062  C  CA     . LEU A 1 192 ? 37.976  46.758  -9.968  1.00 32.28  ? 189  LEU A CA     1 
ATOM   3063  C  C      . LEU A 1 192 ? 39.148  46.983  -9.029  1.00 30.54  ? 189  LEU A C      1 
ATOM   3064  O  O      . LEU A 1 192 ? 40.298  46.934  -9.463  1.00 29.00  ? 189  LEU A O      1 
ATOM   3065  C  CB     . LEU A 1 192 ? 37.934  47.907  -10.977 1.00 30.75  ? 189  LEU A CB     1 
ATOM   3066  C  CG     . LEU A 1 192 ? 36.918  47.829  -12.114 1.00 29.61  ? 189  LEU A CG     1 
ATOM   3067  C  CD1    . LEU A 1 192 ? 37.036  49.077  -12.978 1.00 30.86  ? 189  LEU A CD1    1 
ATOM   3068  C  CD2    . LEU A 1 192 ? 37.113  46.566  -12.931 1.00 26.35  ? 189  LEU A CD2    1 
ATOM   3069  H  H      . LEU A 1 192 ? 36.224  47.368  -9.305  1.00 41.89  ? 189  LEU A H      1 
ATOM   3070  H  HA     . LEU A 1 192 ? 38.145  45.939  -10.460 1.00 38.74  ? 189  LEU A HA     1 
ATOM   3071  H  HB2    . LEU A 1 192 ? 37.748  48.724  -10.489 1.00 36.91  ? 189  LEU A HB2    1 
ATOM   3072  H  HB3    . LEU A 1 192 ? 38.811  47.976  -11.386 1.00 36.91  ? 189  LEU A HB3    1 
ATOM   3073  H  HG     . LEU A 1 192 ? 36.024  47.807  -11.738 1.00 35.53  ? 189  LEU A HG     1 
ATOM   3074  H  HD11   . LEU A 1 192 ? 37.934  49.126  -13.341 1.00 37.04  ? 189  LEU A HD11   1 
ATOM   3075  H  HD12   . LEU A 1 192 ? 36.389  49.024  -13.699 1.00 37.04  ? 189  LEU A HD12   1 
ATOM   3076  H  HD13   . LEU A 1 192 ? 36.858  49.858  -12.430 1.00 37.04  ? 189  LEU A HD13   1 
ATOM   3077  H  HD21   . LEU A 1 192 ? 36.999  45.795  -12.353 1.00 31.62  ? 189  LEU A HD21   1 
ATOM   3078  H  HD22   . LEU A 1 192 ? 36.454  46.547  -13.643 1.00 31.62  ? 189  LEU A HD22   1 
ATOM   3079  H  HD23   . LEU A 1 192 ? 38.007  46.569  -13.307 1.00 31.62  ? 189  LEU A HD23   1 
ATOM   3080  N  N      . SER A 1 193 ? 38.861  47.212  -7.750  1.00 41.07  ? 190  SER A N      1 
ATOM   3081  C  CA     . SER A 1 193 ? 39.882  47.658  -6.794  1.00 35.51  ? 190  SER A CA     1 
ATOM   3082  C  C      . SER A 1 193 ? 40.417  46.582  -5.852  1.00 25.45  ? 190  SER A C      1 
ATOM   3083  O  O      . SER A 1 193 ? 39.640  45.899  -5.189  1.00 39.75  ? 190  SER A O      1 
ATOM   3084  C  CB     . SER A 1 193 ? 39.315  48.809  -5.968  1.00 28.46  ? 190  SER A CB     1 
ATOM   3085  O  OG     . SER A 1 193 ? 39.375  50.016  -6.707  1.00 44.22  ? 190  SER A OG     1 
ATOM   3086  H  H      . SER A 1 193 ? 38.078  47.116  -7.406  1.00 49.28  ? 190  SER A H      1 
ATOM   3087  H  HA     . SER A 1 193 ? 40.638  48.004  -7.294  1.00 42.62  ? 190  SER A HA     1 
ATOM   3088  H  HB2    . SER A 1 193 ? 38.390  48.617  -5.748  1.00 34.16  ? 190  SER A HB2    1 
ATOM   3089  H  HB3    . SER A 1 193 ? 39.838  48.907  -5.157  1.00 34.16  ? 190  SER A HB3    1 
ATOM   3090  H  HG     . SER A 1 193 ? 38.928  49.943  -7.414  1.00 53.07  ? 190  SER A HG     1 
ATOM   3091  N  N      . LEU A 1 194 ? 41.743  46.447  -5.791  1.00 24.40  ? 191  LEU A N      1 
ATOM   3092  C  CA     . LEU A 1 194 ? 42.383  45.474  -4.898  1.00 41.68  ? 191  LEU A CA     1 
ATOM   3093  C  C      . LEU A 1 194 ? 43.365  46.063  -3.883  1.00 39.14  ? 191  LEU A C      1 
ATOM   3094  O  O      . LEU A 1 194 ? 43.502  45.540  -2.782  1.00 50.38  ? 191  LEU A O      1 
ATOM   3095  C  CB     . LEU A 1 194 ? 43.140  44.434  -5.723  1.00 36.71  ? 191  LEU A CB     1 
ATOM   3096  C  CG     . LEU A 1 194 ? 42.328  43.321  -6.369  1.00 54.91  ? 191  LEU A CG     1 
ATOM   3097  C  CD1    . LEU A 1 194 ? 43.239  42.452  -7.209  1.00 59.88  ? 191  LEU A CD1    1 
ATOM   3098  C  CD2    . LEU A 1 194 ? 41.646  42.497  -5.301  1.00 41.09  ? 191  LEU A CD2    1 
ATOM   3099  H  H      . LEU A 1 194 ? 42.298  46.910  -6.258  1.00 29.28  ? 191  LEU A H      1 
ATOM   3100  H  HA     . LEU A 1 194 ? 41.692  45.010  -4.401  1.00 50.02  ? 191  LEU A HA     1 
ATOM   3101  H  HB2    . LEU A 1 194 ? 43.603  44.898  -6.437  1.00 44.05  ? 191  LEU A HB2    1 
ATOM   3102  H  HB3    . LEU A 1 194 ? 43.792  44.010  -5.144  1.00 44.05  ? 191  LEU A HB3    1 
ATOM   3103  H  HG     . LEU A 1 194 ? 41.649  43.706  -6.945  1.00 65.89  ? 191  LEU A HG     1 
ATOM   3104  H  HD11   . LEU A 1 194 ? 43.923  42.068  -6.638  1.00 71.86  ? 191  LEU A HD11   1 
ATOM   3105  H  HD12   . LEU A 1 194 ? 42.713  41.746  -7.616  1.00 71.86  ? 191  LEU A HD12   1 
ATOM   3106  H  HD13   . LEU A 1 194 ? 43.650  42.999  -7.897  1.00 71.86  ? 191  LEU A HD13   1 
ATOM   3107  H  HD21   . LEU A 1 194 ? 41.057  43.071  -4.787  1.00 49.31  ? 191  LEU A HD21   1 
ATOM   3108  H  HD22   . LEU A 1 194 ? 41.133  41.792  -5.727  1.00 49.31  ? 191  LEU A HD22   1 
ATOM   3109  H  HD23   . LEU A 1 194 ? 42.321  42.111  -4.721  1.00 49.31  ? 191  LEU A HD23   1 
ATOM   3110  N  N      . VAL A 1 195 ? 44.043  47.142  -4.253  1.00 39.81  ? 192  VAL A N      1 
ATOM   3111  C  CA     . VAL A 1 195 ? 45.065  47.731  -3.400  1.00 22.10  ? 192  VAL A CA     1 
ATOM   3112  C  C      . VAL A 1 195 ? 44.455  48.720  -2.419  1.00 35.39  ? 192  VAL A C      1 
ATOM   3113  O  O      . VAL A 1 195 ? 44.143  49.847  -2.793  1.00 49.89  ? 192  VAL A O      1 
ATOM   3114  C  CB     . VAL A 1 195 ? 46.150  48.431  -4.237  1.00 18.48  ? 192  VAL A CB     1 
ATOM   3115  C  CG1    . VAL A 1 195 ? 47.234  49.027  -3.350  1.00 20.89  ? 192  VAL A CG1    1 
ATOM   3116  C  CG2    . VAL A 1 195 ? 46.759  47.444  -5.225  1.00 19.55  ? 192  VAL A CG2    1 
ATOM   3117  H  H      . VAL A 1 195 ? 43.929  47.555  -4.999  1.00 47.77  ? 192  VAL A H      1 
ATOM   3118  H  HA     . VAL A 1 195 ? 45.491  47.026  -2.888  1.00 26.52  ? 192  VAL A HA     1 
ATOM   3119  H  HB     . VAL A 1 195 ? 45.744  49.152  -4.744  1.00 22.18  ? 192  VAL A HB     1 
ATOM   3120  H  HG11   . VAL A 1 195 ? 47.646  48.316  -2.835  1.00 25.07  ? 192  VAL A HG11   1 
ATOM   3121  H  HG12   . VAL A 1 195 ? 47.898  49.459  -3.909  1.00 25.07  ? 192  VAL A HG12   1 
ATOM   3122  H  HG13   . VAL A 1 195 ? 46.830  49.677  -2.753  1.00 25.07  ? 192  VAL A HG13   1 
ATOM   3123  H  HG21   . VAL A 1 195 ? 46.061  47.113  -5.810  1.00 23.46  ? 192  VAL A HG21   1 
ATOM   3124  H  HG22   . VAL A 1 195 ? 47.440  47.898  -5.745  1.00 23.46  ? 192  VAL A HG22   1 
ATOM   3125  H  HG23   . VAL A 1 195 ? 47.155  46.709  -4.731  1.00 23.46  ? 192  VAL A HG23   1 
ATOM   3126  N  N      . LYS A 1 196 ? 44.294  48.292  -1.167  1.00 46.76  ? 193  LYS A N      1 
ATOM   3127  C  CA     . LYS A 1 196 ? 43.669  49.120  -0.136  1.00 45.94  ? 193  LYS A CA     1 
ATOM   3128  C  C      . LYS A 1 196 ? 44.664  49.538  0.922   1.00 58.46  ? 193  LYS A C      1 
ATOM   3129  O  O      . LYS A 1 196 ? 45.533  48.758  1.312   1.00 77.96  ? 193  LYS A O      1 
ATOM   3130  C  CB     . LYS A 1 196 ? 42.501  48.398  0.548   1.00 59.52  ? 193  LYS A CB     1 
ATOM   3131  C  CG     . LYS A 1 196 ? 41.297  48.125  -0.342  1.00 99.23  ? 193  LYS A CG     1 
ATOM   3132  C  CD     . LYS A 1 196 ? 40.227  47.356  0.428   1.00 108.96 ? 193  LYS A CD     1 
ATOM   3133  C  CE     . LYS A 1 196 ? 38.984  47.115  -0.414  1.00 126.54 ? 193  LYS A CE     1 
ATOM   3134  N  NZ     . LYS A 1 196 ? 37.902  46.441  0.362   1.00 117.82 ? 193  LYS A NZ     1 
ATOM   3135  H  H      . LYS A 1 196 ? 44.540  47.517  -0.887  1.00 56.11  ? 193  LYS A H      1 
ATOM   3136  H  HA     . LYS A 1 196 ? 43.320  49.925  -0.550  1.00 55.12  ? 193  LYS A HA     1 
ATOM   3137  H  HB2    . LYS A 1 196 ? 42.819  47.543  0.879   1.00 71.42  ? 193  LYS A HB2    1 
ATOM   3138  H  HB3    . LYS A 1 196 ? 42.197  48.941  1.292   1.00 71.42  ? 193  LYS A HB3    1 
ATOM   3139  H  HG2    . LYS A 1 196 ? 40.917  48.967  -0.639  1.00 119.07 ? 193  LYS A HG2    1 
ATOM   3140  H  HG3    . LYS A 1 196 ? 41.572  47.590  -1.103  1.00 119.07 ? 193  LYS A HG3    1 
ATOM   3141  H  HD2    . LYS A 1 196 ? 40.583  46.494  0.695   1.00 130.75 ? 193  LYS A HD2    1 
ATOM   3142  H  HD3    . LYS A 1 196 ? 39.968  47.867  1.211   1.00 130.75 ? 193  LYS A HD3    1 
ATOM   3143  H  HE2    . LYS A 1 196 ? 38.644  47.967  -0.729  1.00 151.85 ? 193  LYS A HE2    1 
ATOM   3144  H  HE3    . LYS A 1 196 ? 39.214  46.549  -1.166  1.00 151.85 ? 193  LYS A HE3    1 
ATOM   3145  H  HZ1    . LYS A 1 196 ? 37.668  46.945  1.057   1.00 141.39 ? 193  LYS A HZ1    1 
ATOM   3146  H  HZ2    . LYS A 1 196 ? 37.190  46.315  -0.156  1.00 141.39 ? 193  LYS A HZ2    1 
ATOM   3147  H  HZ3    . LYS A 1 196 ? 38.188  45.653  0.659   1.00 141.39 ? 193  LYS A HZ3    1 
ATOM   3148  N  N      . GLY A 1 197 ? 44.530  50.783  1.376   1.00 86.30  ? 194  GLY A N      1 
ATOM   3149  C  CA     . GLY A 1 197 ? 45.354  51.312  2.448   1.00 94.24  ? 194  GLY A CA     1 
ATOM   3150  C  C      . GLY A 1 197 ? 46.143  52.534  2.031   1.00 97.97  ? 194  GLY A C      1 
ATOM   3151  O  O      . GLY A 1 197 ? 46.430  52.729  0.848   1.00 102.17 ? 194  GLY A O      1 
ATOM   3152  H  H      . GLY A 1 197 ? 43.956  51.346  1.071   1.00 103.56 ? 194  GLY A H      1 
ATOM   3153  H  HA2    . GLY A 1 197 ? 44.790  51.554  3.199   1.00 113.09 ? 194  GLY A HA2    1 
ATOM   3154  H  HA3    . GLY A 1 197 ? 45.979  50.630  2.741   1.00 113.09 ? 194  GLY A HA3    1 
ATOM   3155  N  N      . GLY A 1 198 ? 46.491  53.355  3.015   1.00 87.28  ? 195  GLY A N      1 
ATOM   3156  C  CA     . GLY A 1 198 ? 47.302  54.538  2.791   1.00 107.55 ? 195  GLY A CA     1 
ATOM   3157  C  C      . GLY A 1 198 ? 48.744  54.232  3.143   1.00 112.37 ? 195  GLY A C      1 
ATOM   3158  O  O      . GLY A 1 198 ? 49.132  53.066  3.195   1.00 116.33 ? 195  GLY A O      1 
ATOM   3159  H  H      . GLY A 1 198 ? 46.263  53.244  3.837   1.00 104.73 ? 195  GLY A H      1 
ATOM   3160  H  HA2    . GLY A 1 198 ? 47.252  54.804  1.859   1.00 129.06 ? 195  GLY A HA2    1 
ATOM   3161  H  HA3    . GLY A 1 198 ? 46.988  55.268  3.347   1.00 129.06 ? 195  GLY A HA3    1 
ATOM   3162  N  N      . GLN A 1 199 ? 49.540  55.269  3.386   1.00 109.25 ? 196  GLN A N      1 
ATOM   3163  C  CA     . GLN A 1 199 ? 50.930  55.078  3.794   1.00 104.65 ? 196  GLN A CA     1 
ATOM   3164  C  C      . GLN A 1 199 ? 51.040  54.398  5.150   1.00 99.10  ? 196  GLN A C      1 
ATOM   3165  O  O      . GLN A 1 199 ? 52.059  53.786  5.464   1.00 102.37 ? 196  GLN A O      1 
ATOM   3166  C  CB     . GLN A 1 199 ? 51.676  56.406  3.855   1.00 113.60 ? 196  GLN A CB     1 
ATOM   3167  C  CG     . GLN A 1 199 ? 52.152  56.936  2.525   1.00 131.81 ? 196  GLN A CG     1 
ATOM   3168  C  CD     . GLN A 1 199 ? 52.951  58.211  2.689   1.00 138.09 ? 196  GLN A CD     1 
ATOM   3169  O  OE1    . GLN A 1 199 ? 52.510  59.294  2.304   1.00 128.18 ? 196  GLN A OE1    1 
ATOM   3170  N  NE2    . GLN A 1 199 ? 54.144  58.085  3.260   1.00 131.23 ? 196  GLN A NE2    1 
ATOM   3171  H  H      . GLN A 1 199 ? 49.301  56.092  3.322   1.00 131.09 ? 196  GLN A H      1 
ATOM   3172  H  HA     . GLN A 1 199 ? 51.374  54.515  3.141   1.00 125.58 ? 196  GLN A HA     1 
ATOM   3173  H  HB2    . GLN A 1 199 ? 51.087  57.073  4.241   1.00 136.32 ? 196  GLN A HB2    1 
ATOM   3174  H  HB3    . GLN A 1 199 ? 52.456  56.296  4.421   1.00 136.32 ? 196  GLN A HB3    1 
ATOM   3175  H  HG2    . GLN A 1 199 ? 52.720  56.274  2.101   1.00 158.17 ? 196  GLN A HG2    1 
ATOM   3176  H  HG3    . GLN A 1 199 ? 51.384  57.129  1.964   1.00 158.17 ? 196  GLN A HG3    1 
ATOM   3177  H  HE21   . GLN A 1 199 ? 54.421  57.311  3.512   1.00 157.48 ? 196  GLN A HE21   1 
ATOM   3178  H  HE22   . GLN A 1 199 ? 54.639  58.779  3.377   1.00 157.48 ? 196  GLN A HE22   1 
ATOM   3179  N  N      . ASP A 1 200 ? 49.986  54.508  5.950   1.00 99.31  ? 197  ASP A N      1 
ATOM   3180  C  CA     . ASP A 1 200 ? 49.950  53.887  7.270   1.00 116.28 ? 197  ASP A CA     1 
ATOM   3181  C  C      . ASP A 1 200 ? 49.942  52.363  7.173   1.00 107.78 ? 197  ASP A C      1 
ATOM   3182  O  O      . ASP A 1 200 ? 50.338  51.673  8.117   1.00 75.25  ? 197  ASP A O      1 
ATOM   3183  C  CB     . ASP A 1 200 ? 48.719  54.371  8.041   1.00 129.27 ? 197  ASP A CB     1 
ATOM   3184  C  CG     . ASP A 1 200 ? 48.791  55.848  8.389   1.00 143.99 ? 197  ASP A CG     1 
ATOM   3185  O  OD1    . ASP A 1 200 ? 49.772  56.265  9.042   1.00 123.99 ? 197  ASP A OD1    1 
ATOM   3186  O  OD2    . ASP A 1 200 ? 47.866  56.594  8.002   1.00 157.62 ? 197  ASP A OD2    1 
ATOM   3187  H  H      . ASP A 1 200 ? 49.271  54.942  5.750   1.00 119.17 ? 197  ASP A H      1 
ATOM   3188  H  HA     . ASP A 1 200 ? 50.740  54.152  7.766   1.00 139.53 ? 197  ASP A HA     1 
ATOM   3189  H  HB2    . ASP A 1 200 ? 47.929  54.229  7.497   1.00 155.13 ? 197  ASP A HB2    1 
ATOM   3190  H  HB3    . ASP A 1 200 ? 48.647  53.871  8.869   1.00 155.13 ? 197  ASP A HB3    1 
ATOM   3191  N  N      . VAL A 1 201 ? 49.495  51.852  6.026   1.00 101.09 ? 198  VAL A N      1 
ATOM   3192  C  CA     . VAL A 1 201 ? 49.327  50.416  5.807   1.00 60.95  ? 198  VAL A CA     1 
ATOM   3193  C  C      . VAL A 1 201 ? 50.450  49.830  4.946   1.00 54.11  ? 198  VAL A C      1 
ATOM   3194  O  O      . VAL A 1 201 ? 50.640  50.248  3.806   1.00 63.76  ? 198  VAL A O      1 
ATOM   3195  C  CB     . VAL A 1 201 ? 47.989  50.118  5.107   1.00 71.92  ? 198  VAL A CB     1 
ATOM   3196  C  CG1    . VAL A 1 201 ? 47.616  48.654  5.286   1.00 72.59  ? 198  VAL A CG1    1 
ATOM   3197  C  CG2    . VAL A 1 201 ? 46.879  51.025  5.629   1.00 86.55  ? 198  VAL A CG2    1 
ATOM   3198  H  H      . VAL A 1 201 ? 49.277  52.329  5.344   1.00 121.31 ? 198  VAL A H      1 
ATOM   3199  H  HA     . VAL A 1 201 ? 49.330  49.960  6.663   1.00 73.13  ? 198  VAL A HA     1 
ATOM   3200  H  HB     . VAL A 1 201 ? 48.088  50.286  4.157   1.00 86.30  ? 198  VAL A HB     1 
ATOM   3201  H  HG11   . VAL A 1 201 ? 47.533  48.463  6.233   1.00 87.11  ? 198  VAL A HG11   1 
ATOM   3202  H  HG12   . VAL A 1 201 ? 46.772  48.487  4.838   1.00 87.11  ? 198  VAL A HG12   1 
ATOM   3203  H  HG13   . VAL A 1 201 ? 48.313  48.102  4.897   1.00 87.11  ? 198  VAL A HG13   1 
ATOM   3204  H  HG21   . VAL A 1 201 ? 47.121  51.949  5.461   1.00 103.86 ? 198  VAL A HG21   1 
ATOM   3205  H  HG22   . VAL A 1 201 ? 46.053  50.810  5.168   1.00 103.86 ? 198  VAL A HG22   1 
ATOM   3206  H  HG23   . VAL A 1 201 ? 46.774  50.878  6.582   1.00 103.86 ? 198  VAL A HG23   1 
ATOM   3207  N  N      . LYS A 1 202 ? 51.192  48.867  5.487   1.00 41.26  ? 199  LYS A N      1 
ATOM   3208  C  CA     . LYS A 1 202 ? 52.289  48.237  4.745   1.00 41.40  ? 199  LYS A CA     1 
ATOM   3209  C  C      . LYS A 1 202 ? 51.820  47.192  3.717   1.00 43.44  ? 199  LYS A C      1 
ATOM   3210  O  O      . LYS A 1 202 ? 52.169  47.283  2.541   1.00 34.17  ? 199  LYS A O      1 
ATOM   3211  C  CB     . LYS A 1 202 ? 53.287  47.605  5.715   1.00 30.77  ? 199  LYS A CB     1 
ATOM   3212  C  CG     . LYS A 1 202 ? 54.253  48.609  6.332   1.00 46.26  ? 199  LYS A CG     1 
ATOM   3213  C  CD     . LYS A 1 202 ? 55.575  47.967  6.753   1.00 70.86  ? 199  LYS A CD     1 
ATOM   3214  C  CE     . LYS A 1 202 ? 55.396  47.172  8.047   1.00 85.27  ? 199  LYS A CE     1 
ATOM   3215  N  NZ     . LYS A 1 202 ? 56.653  46.589  8.612   1.00 61.42  ? 199  LYS A NZ     1 
ATOM   3216  H  H      . LYS A 1 202 ? 51.084  48.559  6.283   1.00 49.51  ? 199  LYS A H      1 
ATOM   3217  H  HA     . LYS A 1 202 ? 52.760  48.929  4.255   1.00 49.68  ? 199  LYS A HA     1 
ATOM   3218  H  HB2    . LYS A 1 202 ? 52.798  47.181  6.436   1.00 36.92  ? 199  LYS A HB2    1 
ATOM   3219  H  HB3    . LYS A 1 202 ? 53.812  46.943  5.238   1.00 36.92  ? 199  LYS A HB3    1 
ATOM   3220  H  HG2    . LYS A 1 202 ? 54.449  49.302  5.682   1.00 55.51  ? 199  LYS A HG2    1 
ATOM   3221  H  HG3    . LYS A 1 202 ? 53.843  48.999  7.121   1.00 55.51  ? 199  LYS A HG3    1 
ATOM   3222  H  HD2    . LYS A 1 202 ? 55.874  47.359  6.059   1.00 85.03  ? 199  LYS A HD2    1 
ATOM   3223  H  HD3    . LYS A 1 202 ? 56.236  48.659  6.907   1.00 85.03  ? 199  LYS A HD3    1 
ATOM   3224  H  HE2    . LYS A 1 202 ? 55.018  47.759  8.720   1.00 102.32 ? 199  LYS A HE2    1 
ATOM   3225  H  HE3    . LYS A 1 202 ? 54.785  46.438  7.876   1.00 102.32 ? 199  LYS A HE3    1 
ATOM   3226  H  HZ1    . LYS A 1 202 ? 57.233  47.239  8.795   1.00 73.71  ? 199  LYS A HZ1    1 
ATOM   3227  H  HZ2    . LYS A 1 202 ? 56.471  46.143  9.360   1.00 73.71  ? 199  LYS A HZ2    1 
ATOM   3228  H  HZ3    . LYS A 1 202 ? 57.020  46.031  8.024   1.00 73.71  ? 199  LYS A HZ3    1 
ATOM   3229  N  N      . LYS A 1 203 ? 51.050  46.200  4.163   1.00 38.70  ? 200  LYS A N      1 
ATOM   3230  C  CA     . LYS A 1 203 ? 50.511  45.182  3.261   1.00 19.68  ? 200  LYS A CA     1 
ATOM   3231  C  C      . LYS A 1 203 ? 49.178  45.670  2.716   1.00 42.15  ? 200  LYS A C      1 
ATOM   3232  O  O      . LYS A 1 203 ? 48.197  45.762  3.456   1.00 36.97  ? 200  LYS A O      1 
ATOM   3233  C  CB     . LYS A 1 203 ? 50.313  43.844  3.976   1.00 26.88  ? 200  LYS A CB     1 
ATOM   3234  C  CG     . LYS A 1 203 ? 50.565  42.611  3.121   1.00 24.77  ? 200  LYS A CG     1 
ATOM   3235  C  CD     . LYS A 1 203 ? 49.633  41.471  3.494   1.00 21.04  ? 200  LYS A CD     1 
ATOM   3236  C  CE     . LYS A 1 203 ? 50.073  40.168  2.864   1.00 12.75  ? 200  LYS A CE     1 
ATOM   3237  N  NZ     . LYS A 1 203 ? 50.366  40.328  1.416   1.00 33.42  ? 200  LYS A NZ     1 
ATOM   3238  H  H      . LYS A 1 203 ? 50.824  46.093  4.986   1.00 46.44  ? 200  LYS A H      1 
ATOM   3239  H  HA     . LYS A 1 203 ? 51.120  45.049  2.517   1.00 23.62  ? 200  LYS A HA     1 
ATOM   3240  H  HB2    . LYS A 1 203 ? 50.921  43.805  4.730   1.00 32.25  ? 200  LYS A HB2    1 
ATOM   3241  H  HB3    . LYS A 1 203 ? 49.398  43.797  4.293   1.00 32.25  ? 200  LYS A HB3    1 
ATOM   3242  H  HG2    . LYS A 1 203 ? 50.416  42.833  2.189   1.00 29.73  ? 200  LYS A HG2    1 
ATOM   3243  H  HG3    . LYS A 1 203 ? 51.478  42.312  3.253   1.00 29.73  ? 200  LYS A HG3    1 
ATOM   3244  H  HD2    . LYS A 1 203 ? 49.634  41.359  4.457   1.00 25.25  ? 200  LYS A HD2    1 
ATOM   3245  H  HD3    . LYS A 1 203 ? 48.738  41.674  3.180   1.00 25.25  ? 200  LYS A HD3    1 
ATOM   3246  H  HE2    . LYS A 1 203 ? 50.880  39.857  3.304   1.00 15.30  ? 200  LYS A HE2    1 
ATOM   3247  H  HE3    . LYS A 1 203 ? 49.365  39.512  2.959   1.00 15.30  ? 200  LYS A HE3    1 
ATOM   3248  H  HZ1    . LYS A 1 203 ? 51.018  40.923  1.302   1.00 40.11  ? 200  LYS A HZ1    1 
ATOM   3249  H  HZ2    . LYS A 1 203 ? 50.623  39.549  1.070   1.00 40.11  ? 200  LYS A HZ2    1 
ATOM   3250  H  HZ3    . LYS A 1 203 ? 49.639  40.609  0.988   1.00 40.11  ? 200  LYS A HZ3    1 
ATOM   3251  N  N      . LYS A 1 204 ? 49.137  45.965  1.421   1.00 31.03  ? 201  LYS A N      1 
ATOM   3252  C  CA     . LYS A 1 204 ? 47.964  46.582  0.823   1.00 27.71  ? 201  LYS A CA     1 
ATOM   3253  C  C      . LYS A 1 204 ? 47.084  45.587  0.056   1.00 39.53  ? 201  LYS A C      1 
ATOM   3254  O  O      . LYS A 1 204 ? 45.998  45.951  -0.395  1.00 38.39  ? 201  LYS A O      1 
ATOM   3255  C  CB     . LYS A 1 204 ? 48.391  47.733  -0.086  1.00 35.52  ? 201  LYS A CB     1 
ATOM   3256  C  CG     . LYS A 1 204 ? 49.057  48.893  0.653   1.00 36.81  ? 201  LYS A CG     1 
ATOM   3257  C  CD     . LYS A 1 204 ? 49.700  49.869  -0.323  1.00 37.53  ? 201  LYS A CD     1 
ATOM   3258  C  CE     . LYS A 1 204 ? 50.046  51.206  0.319   1.00 44.52  ? 201  LYS A CE     1 
ATOM   3259  N  NZ     . LYS A 1 204 ? 51.161  51.114  1.303   1.00 77.27  ? 201  LYS A NZ     1 
ATOM   3260  H  H      . LYS A 1 204 ? 49.778  45.816  0.867   1.00 37.24  ? 201  LYS A H      1 
ATOM   3261  H  HA     . LYS A 1 204 ? 47.422  46.959  1.534   1.00 33.25  ? 201  LYS A HA     1 
ATOM   3262  H  HB2    . LYS A 1 204 ? 49.024  47.396  -0.740  1.00 42.62  ? 201  LYS A HB2    1 
ATOM   3263  H  HB3    . LYS A 1 204 ? 47.607  48.081  -0.538  1.00 42.62  ? 201  LYS A HB3    1 
ATOM   3264  H  HG2    . LYS A 1 204 ? 48.389  49.373  1.168   1.00 44.17  ? 201  LYS A HG2    1 
ATOM   3265  H  HG3    . LYS A 1 204 ? 49.749  48.547  1.239   1.00 44.17  ? 201  LYS A HG3    1 
ATOM   3266  H  HD2    . LYS A 1 204 ? 50.520  49.479  -0.665  1.00 45.03  ? 201  LYS A HD2    1 
ATOM   3267  H  HD3    . LYS A 1 204 ? 49.084  50.037  -1.053  1.00 45.03  ? 201  LYS A HD3    1 
ATOM   3268  H  HE2    . LYS A 1 204 ? 50.312  51.830  -0.375  1.00 53.42  ? 201  LYS A HE2    1 
ATOM   3269  H  HE3    . LYS A 1 204 ? 49.264  51.543  0.784   1.00 53.42  ? 201  LYS A HE3    1 
ATOM   3270  H  HZ1    . LYS A 1 204 ? 51.897  50.815  0.902   1.00 92.72  ? 201  LYS A HZ1    1 
ATOM   3271  H  HZ2    . LYS A 1 204 ? 51.326  51.917  1.651   1.00 92.72  ? 201  LYS A HZ2    1 
ATOM   3272  H  HZ3    . LYS A 1 204 ? 50.941  50.554  1.959   1.00 92.72  ? 201  LYS A HZ3    1 
ATOM   3273  N  N      . VAL A 1 205 ? 47.543  44.343  -0.090  1.00 37.57  ? 202  VAL A N      1 
ATOM   3274  C  CA     . VAL A 1 205 ? 46.766  43.308  -0.786  1.00 31.56  ? 202  VAL A CA     1 
ATOM   3275  C  C      . VAL A 1 205 ? 46.644  41.994  -0.009  1.00 33.36  ? 202  VAL A C      1 
ATOM   3276  O  O      . VAL A 1 205 ? 47.646  41.383  0.358   1.00 35.90  ? 202  VAL A O      1 
ATOM   3277  C  CB     . VAL A 1 205 ? 47.384  42.982  -2.155  1.00 30.53  ? 202  VAL A CB     1 
ATOM   3278  C  CG1    . VAL A 1 205 ? 46.605  41.864  -2.850  1.00 31.71  ? 202  VAL A CG1    1 
ATOM   3279  C  CG2    . VAL A 1 205 ? 47.439  44.229  -3.025  1.00 27.28  ? 202  VAL A CG2    1 
ATOM   3280  H  H      . VAL A 1 205 ? 48.303  44.070  0.206   1.00 45.09  ? 202  VAL A H      1 
ATOM   3281  H  HA     . VAL A 1 205 ? 45.869  43.644  -0.939  1.00 37.88  ? 202  VAL A HA     1 
ATOM   3282  H  HB     . VAL A 1 205 ? 48.294  42.672  -2.022  1.00 36.64  ? 202  VAL A HB     1 
ATOM   3283  H  HG11   . VAL A 1 205 ? 45.687  42.152  -2.976  1.00 38.06  ? 202  VAL A HG11   1 
ATOM   3284  H  HG12   . VAL A 1 205 ? 47.016  41.680  -3.709  1.00 38.06  ? 202  VAL A HG12   1 
ATOM   3285  H  HG13   . VAL A 1 205 ? 46.630  41.070  -2.293  1.00 38.06  ? 202  VAL A HG13   1 
ATOM   3286  H  HG21   . VAL A 1 205 ? 47.982  44.899  -2.582  1.00 32.73  ? 202  VAL A HG21   1 
ATOM   3287  H  HG22   . VAL A 1 205 ? 47.832  43.998  -3.882  1.00 32.73  ? 202  VAL A HG22   1 
ATOM   3288  H  HG23   . VAL A 1 205 ? 46.538  44.564  -3.154  1.00 32.73  ? 202  VAL A HG23   1 
ATOM   3289  N  N      . HIS A 1 206 ? 45.407  41.566  0.228   1.00 35.53  ? 203  HIS A N      1 
ATOM   3290  C  CA     . HIS A 1 206 ? 45.122  40.279  0.869   1.00 29.38  ? 203  HIS A CA     1 
ATOM   3291  C  C      . HIS A 1 206 ? 44.170  39.437  0.020   1.00 40.90  ? 203  HIS A C      1 
ATOM   3292  O  O      . HIS A 1 206 ? 43.066  39.880  -0.290  1.00 57.91  ? 203  HIS A O      1 
ATOM   3293  C  CB     . HIS A 1 206 ? 44.508  40.486  2.250   1.00 38.00  ? 203  HIS A CB     1 
ATOM   3294  C  CG     . HIS A 1 206 ? 45.418  41.168  3.219   1.00 41.18  ? 203  HIS A CG     1 
ATOM   3295  N  ND1    . HIS A 1 206 ? 45.639  42.528  3.196   1.00 48.13  ? 203  HIS A ND1    1 
ATOM   3296  C  CD2    . HIS A 1 206 ? 46.166  40.681  4.237   1.00 30.26  ? 203  HIS A CD2    1 
ATOM   3297  C  CE1    . HIS A 1 206 ? 46.481  42.850  4.161   1.00 51.47  ? 203  HIS A CE1    1 
ATOM   3298  N  NE2    . HIS A 1 206 ? 46.817  41.748  4.807   1.00 43.02  ? 203  HIS A NE2    1 
ATOM   3299  H  H      . HIS A 1 206 ? 44.700  42.010  0.022   1.00 42.64  ? 203  HIS A H      1 
ATOM   3300  H  HA     . HIS A 1 206 ? 45.950  39.786  0.976   1.00 35.25  ? 203  HIS A HA     1 
ATOM   3301  H  HB2    . HIS A 1 206 ? 43.710  41.030  2.159   1.00 45.60  ? 203  HIS A HB2    1 
ATOM   3302  H  HB3    . HIS A 1 206 ? 44.275  39.620  2.621   1.00 45.60  ? 203  HIS A HB3    1 
ATOM   3303  H  HD1    . HIS A 1 206 ? 45.282  43.081  2.642   1.00 57.76  ? 203  HIS A HD1    1 
ATOM   3304  H  HD2    . HIS A 1 206 ? 46.226  39.792  4.502   1.00 36.31  ? 203  HIS A HD2    1 
ATOM   3305  H  HE1    . HIS A 1 206 ? 46.788  43.707  4.352   1.00 61.77  ? 203  HIS A HE1    1 
ATOM   3306  H  HE2    . HIS A 1 206 ? 47.355  41.705  5.476   1.00 51.63  ? 203  HIS A HE2    1 
ATOM   3307  N  N      . LEU A 1 207 ? 44.584  38.222  -0.334  1.00 41.05  ? 204  LEU A N      1 
ATOM   3308  C  CA     . LEU A 1 207 ? 43.763  37.335  -1.159  1.00 39.34  ? 204  LEU A CA     1 
ATOM   3309  C  C      . LEU A 1 207 ? 43.143  36.204  -0.345  1.00 41.78  ? 204  LEU A C      1 
ATOM   3310  O  O      . LEU A 1 207 ? 43.783  35.627  0.533   1.00 37.33  ? 204  LEU A O      1 
ATOM   3311  C  CB     . LEU A 1 207 ? 44.599  36.748  -2.304  1.00 31.54  ? 204  LEU A CB     1 
ATOM   3312  C  CG     . LEU A 1 207 ? 45.121  37.720  -3.361  1.00 28.48  ? 204  LEU A CG     1 
ATOM   3313  C  CD1    . LEU A 1 207 ? 46.078  37.022  -4.311  1.00 25.03  ? 204  LEU A CD1    1 
ATOM   3314  C  CD2    . LEU A 1 207 ? 43.964  38.308  -4.151  1.00 28.63  ? 204  LEU A CD2    1 
ATOM   3315  H  H      . LEU A 1 207 ? 45.342  37.885  -0.107  1.00 49.26  ? 204  LEU A H      1 
ATOM   3316  H  HA     . LEU A 1 207 ? 43.041  37.851  -1.551  1.00 47.20  ? 204  LEU A HA     1 
ATOM   3317  H  HB2    . LEU A 1 207 ? 45.371  36.307  -1.916  1.00 37.85  ? 204  LEU A HB2    1 
ATOM   3318  H  HB3    . LEU A 1 207 ? 44.055  36.090  -2.766  1.00 37.85  ? 204  LEU A HB3    1 
ATOM   3319  H  HG     . LEU A 1 207 ? 45.595  38.445  -2.926  1.00 34.18  ? 204  LEU A HG     1 
ATOM   3320  H  HD11   . LEU A 1 207 ? 45.611  36.296  -4.753  1.00 30.04  ? 204  LEU A HD11   1 
ATOM   3321  H  HD12   . LEU A 1 207 ? 46.392  37.662  -4.969  1.00 30.04  ? 204  LEU A HD12   1 
ATOM   3322  H  HD13   . LEU A 1 207 ? 46.828  36.674  -3.804  1.00 30.04  ? 204  LEU A HD13   1 
ATOM   3323  H  HD21   . LEU A 1 207 ? 43.375  38.781  -3.542  1.00 34.36  ? 204  LEU A HD21   1 
ATOM   3324  H  HD22   . LEU A 1 207 ? 44.315  38.921  -4.815  1.00 34.36  ? 204  LEU A HD22   1 
ATOM   3325  H  HD23   . LEU A 1 207 ? 43.481  37.588  -4.586  1.00 34.36  ? 204  LEU A HD23   1 
ATOM   3326  N  N      . SER A 1 208 ? 41.890  35.887  -0.662  1.00 53.37  ? 205  SER A N      1 
ATOM   3327  C  CA     . SER A 1 208 ? 41.164  34.816  0.007   1.00 49.12  ? 205  SER A CA     1 
ATOM   3328  C  C      . SER A 1 208 ? 41.671  33.475  -0.496  1.00 55.36  ? 205  SER A C      1 
ATOM   3329  O  O      . SER A 1 208 ? 42.480  33.422  -1.423  1.00 55.39  ? 205  SER A O      1 
ATOM   3330  C  CB     . SER A 1 208 ? 39.665  34.934  -0.266  1.00 59.80  ? 205  SER A CB     1 
ATOM   3331  O  OG     . SER A 1 208 ? 39.195  36.248  -0.022  1.00 72.31  ? 205  SER A OG     1 
ATOM   3332  H  H      . SER A 1 208 ? 41.434  36.286  -1.272  1.00 64.04  ? 205  SER A H      1 
ATOM   3333  H  HA     . SER A 1 208 ? 41.313  34.867  0.964   1.00 58.94  ? 205  SER A HA     1 
ATOM   3334  H  HB2    . SER A 1 208 ? 39.496  34.708  -1.194  1.00 71.76  ? 205  SER A HB2    1 
ATOM   3335  H  HB3    . SER A 1 208 ? 39.191  34.319  0.315   1.00 71.76  ? 205  SER A HB3    1 
ATOM   3336  H  HG     . SER A 1 208 ? 38.370  36.291  -0.177  1.00 86.78  ? 205  SER A HG     1 
ATOM   3337  N  N      . GLU A 1 209 ? 41.217  32.386  0.112   1.00 62.73  ? 206  GLU A N      1 
ATOM   3338  C  CA     . GLU A 1 209 ? 41.623  31.076  -0.370  1.00 53.27  ? 206  GLU A CA     1 
ATOM   3339  C  C      . GLU A 1 209 ? 41.062  30.890  -1.767  1.00 57.11  ? 206  GLU A C      1 
ATOM   3340  O  O      . GLU A 1 209 ? 41.694  30.256  -2.610  1.00 65.31  ? 206  GLU A O      1 
ATOM   3341  C  CB     . GLU A 1 209 ? 41.173  29.953  0.567   1.00 80.69  ? 206  GLU A CB     1 
ATOM   3342  C  CG     . GLU A 1 209 ? 41.587  30.178  2.014   1.00 109.90 ? 206  GLU A CG     1 
ATOM   3343  C  CD     . GLU A 1 209 ? 41.345  28.969  2.895   1.00 114.92 ? 206  GLU A CD     1 
ATOM   3344  O  OE1    . GLU A 1 209 ? 40.237  28.397  2.841   1.00 116.19 ? 206  GLU A OE1    1 
ATOM   3345  O  OE2    . GLU A 1 209 ? 42.272  28.591  3.644   1.00 111.71 ? 206  GLU A OE2    1 
ATOM   3346  H  H      . GLU A 1 209 ? 40.687  32.378  0.789   1.00 75.28  ? 206  GLU A H      1 
ATOM   3347  H  HA     . GLU A 1 209 ? 42.590  31.047  -0.428  1.00 63.92  ? 206  GLU A HA     1 
ATOM   3348  H  HB2    . GLU A 1 209 ? 40.205  29.889  0.540   1.00 96.83  ? 206  GLU A HB2    1 
ATOM   3349  H  HB3    . GLU A 1 209 ? 41.568  29.118  0.270   1.00 96.83  ? 206  GLU A HB3    1 
ATOM   3350  H  HG2    . GLU A 1 209 ? 42.535  30.383  2.042   1.00 131.88 ? 206  GLU A HG2    1 
ATOM   3351  H  HG3    . GLU A 1 209 ? 41.077  30.919  2.376   1.00 131.88 ? 206  GLU A HG3    1 
ATOM   3352  N  N      . LYS A 1 210 ? 39.888  31.474  -2.013  1.00 53.69  ? 207  LYS A N      1 
ATOM   3353  C  CA     . LYS A 1 210 ? 39.241  31.369  -3.317  1.00 56.06  ? 207  LYS A CA     1 
ATOM   3354  C  C      . LYS A 1 210 ? 39.387  32.676  -4.088  1.00 55.80  ? 207  LYS A C      1 
ATOM   3355  O  O      . LYS A 1 210 ? 39.019  33.747  -3.606  1.00 81.18  ? 207  LYS A O      1 
ATOM   3356  C  CB     . LYS A 1 210 ? 37.761  31.023  -3.159  1.00 53.06  ? 207  LYS A CB     1 
ATOM   3357  C  CG     . LYS A 1 210 ? 37.238  30.084  -4.229  1.00 52.27  ? 207  LYS A CG     1 
ATOM   3358  C  CD     . LYS A 1 210 ? 36.108  29.207  -3.711  1.00 58.90  ? 207  LYS A CD     1 
ATOM   3359  C  CE     . LYS A 1 210 ? 34.961  30.044  -3.157  1.00 54.39  ? 207  LYS A CE     1 
ATOM   3360  N  NZ     . LYS A 1 210 ? 33.758  29.226  -2.836  1.00 77.37  ? 207  LYS A NZ     1 
ATOM   3361  H  H      . LYS A 1 210 ? 39.447  31.937  -1.439  1.00 64.43  ? 207  LYS A H      1 
ATOM   3362  H  HA     . LYS A 1 210 ? 39.665  30.663  -3.831  1.00 67.27  ? 207  LYS A HA     1 
ATOM   3363  H  HB2    . LYS A 1 210 ? 37.630  30.595  -2.298  1.00 63.67  ? 207  LYS A HB2    1 
ATOM   3364  H  HB3    . LYS A 1 210 ? 37.242  31.841  -3.202  1.00 63.67  ? 207  LYS A HB3    1 
ATOM   3365  H  HG2    . LYS A 1 210 ? 36.899  30.606  -4.973  1.00 62.72  ? 207  LYS A HG2    1 
ATOM   3366  H  HG3    . LYS A 1 210 ? 37.958  29.506  -4.526  1.00 62.72  ? 207  LYS A HG3    1 
ATOM   3367  H  HD2    . LYS A 1 210 ? 35.764  28.665  -4.439  1.00 70.68  ? 207  LYS A HD2    1 
ATOM   3368  H  HD3    . LYS A 1 210 ? 36.443  28.640  -2.999  1.00 70.68  ? 207  LYS A HD3    1 
ATOM   3369  H  HE2    . LYS A 1 210 ? 35.254  30.481  -2.341  1.00 65.26  ? 207  LYS A HE2    1 
ATOM   3370  H  HE3    . LYS A 1 210 ? 34.707  30.708  -3.816  1.00 65.26  ? 207  LYS A HE3    1 
ATOM   3371  H  HZ1    . LYS A 1 210 ? 33.962  28.611  -2.226  1.00 92.84  ? 207  LYS A HZ1    1 
ATOM   3372  H  HZ2    . LYS A 1 210 ? 33.112  29.748  -2.516  1.00 92.84  ? 207  LYS A HZ2    1 
ATOM   3373  H  HZ3    . LYS A 1 210 ? 33.463  28.819  -3.571  1.00 92.84  ? 207  LYS A HZ3    1 
ATOM   3374  N  N      . ILE A 1 211 ? 39.906  32.570  -5.301  1.00 36.15  ? 208  ILE A N      1 
ATOM   3375  C  CA     . ILE A 1 211 ? 40.214  33.736  -6.116  1.00 43.60  ? 208  ILE A CA     1 
ATOM   3376  C  C      . ILE A 1 211 ? 39.168  34.015  -7.194  1.00 44.03  ? 208  ILE A C      1 
ATOM   3377  O  O      . ILE A 1 211 ? 38.979  33.230  -8.120  1.00 43.91  ? 208  ILE A O      1 
ATOM   3378  C  CB     . ILE A 1 211 ? 41.602  33.568  -6.743  1.00 41.82  ? 208  ILE A CB     1 
ATOM   3379  C  CG1    . ILE A 1 211 ? 42.618  33.455  -5.603  1.00 31.52  ? 208  ILE A CG1    1 
ATOM   3380  C  CG2    . ILE A 1 211 ? 41.923  34.719  -7.702  1.00 31.79  ? 208  ILE A CG2    1 
ATOM   3381  C  CD1    . ILE A 1 211 ? 44.051  33.439  -6.028  1.00 54.76  ? 208  ILE A CD1    1 
ATOM   3382  H  H      . ILE A 1 211 ? 40.091  31.822  -5.682  1.00 43.39  ? 208  ILE A H      1 
ATOM   3383  H  HA     . ILE A 1 211 ? 40.249  34.514  -5.537  1.00 52.32  ? 208  ILE A HA     1 
ATOM   3384  H  HB     . ILE A 1 211 ? 41.612  32.738  -7.246  1.00 50.18  ? 208  ILE A HB     1 
ATOM   3385  H  HG12   . ILE A 1 211 ? 42.498  34.212  -5.008  1.00 37.82  ? 208  ILE A HG12   1 
ATOM   3386  H  HG13   . ILE A 1 211 ? 42.448  32.632  -5.119  1.00 37.82  ? 208  ILE A HG13   1 
ATOM   3387  H  HG21   . ILE A 1 211 ? 41.902  35.555  -7.210  1.00 38.15  ? 208  ILE A HG21   1 
ATOM   3388  H  HG22   . ILE A 1 211 ? 42.806  34.578  -8.079  1.00 38.15  ? 208  ILE A HG22   1 
ATOM   3389  H  HG23   . ILE A 1 211 ? 41.260  34.735  -8.410  1.00 38.15  ? 208  ILE A HG23   1 
ATOM   3390  H  HD11   . ILE A 1 211 ? 44.250  34.262  -6.500  1.00 65.71  ? 208  ILE A HD11   1 
ATOM   3391  H  HD12   . ILE A 1 211 ? 44.613  33.365  -5.240  1.00 65.71  ? 208  ILE A HD12   1 
ATOM   3392  H  HD13   . ILE A 1 211 ? 44.199  32.678  -6.612  1.00 65.71  ? 208  ILE A HD13   1 
ATOM   3393  N  N      . HIS A 1 212 ? 38.503  35.154  -7.056  1.00 49.21  ? 209  HIS A N      1 
ATOM   3394  C  CA     . HIS A 1 212 ? 37.515  35.614  -8.024  1.00 31.20  ? 209  HIS A CA     1 
ATOM   3395  C  C      . HIS A 1 212 ? 38.175  35.789  -9.395  1.00 47.15  ? 209  HIS A C      1 
ATOM   3396  O  O      . HIS A 1 212 ? 39.272  36.344  -9.477  1.00 43.32  ? 209  HIS A O      1 
ATOM   3397  C  CB     . HIS A 1 212 ? 36.886  36.924  -7.539  1.00 44.26  ? 209  HIS A CB     1 
ATOM   3398  C  CG     . HIS A 1 212 ? 35.724  37.387  -8.359  1.00 41.89  ? 209  HIS A CG     1 
ATOM   3399  N  ND1    . HIS A 1 212 ? 35.879  37.982  -9.592  1.00 40.96  ? 209  HIS A ND1    1 
ATOM   3400  C  CD2    . HIS A 1 212 ? 34.391  37.356  -8.121  1.00 45.26  ? 209  HIS A CD2    1 
ATOM   3401  C  CE1    . HIS A 1 212 ? 34.693  38.298  -10.079 1.00 36.47  ? 209  HIS A CE1    1 
ATOM   3402  N  NE2    . HIS A 1 212 ? 33.773  37.927  -9.207  1.00 50.06  ? 209  HIS A NE2    1 
ATOM   3403  H  H      . HIS A 1 212 ? 38.609  35.692  -6.393  1.00 59.05  ? 209  HIS A H      1 
ATOM   3404  H  HA     . HIS A 1 212 ? 36.813  34.950  -8.106  1.00 37.44  ? 209  HIS A HA     1 
ATOM   3405  H  HB2    . HIS A 1 212 ? 36.574  36.801  -6.628  1.00 53.11  ? 209  HIS A HB2    1 
ATOM   3406  H  HB3    . HIS A 1 212 ? 37.560  37.621  -7.563  1.00 53.11  ? 209  HIS A HB3    1 
ATOM   3407  H  HD1    . HIS A 1 212 ? 36.631  38.129  -9.982  1.00 49.16  ? 209  HIS A HD1    1 
ATOM   3408  H  HD2    . HIS A 1 212 ? 33.973  37.013  -7.364  1.00 54.31  ? 209  HIS A HD2    1 
ATOM   3409  H  HE1    . HIS A 1 212 ? 34.532  38.707  -10.899 1.00 43.76  ? 209  HIS A HE1    1 
ATOM   3410  H  HE2    . HIS A 1 212 ? 32.924  38.026  -9.304  1.00 60.07  ? 209  HIS A HE2    1 
ATOM   3411  N  N      . PRO A 1 213 ? 37.522  35.298  -10.469 1.00 49.65  ? 210  PRO A N      1 
ATOM   3412  C  CA     . PRO A 1 213 ? 38.050  35.315  -11.840 1.00 31.51  ? 210  PRO A CA     1 
ATOM   3413  C  C      . PRO A 1 213 ? 38.703  36.627  -12.261 1.00 48.16  ? 210  PRO A C      1 
ATOM   3414  O  O      . PRO A 1 213 ? 39.727  36.608  -12.940 1.00 41.52  ? 210  PRO A O      1 
ATOM   3415  C  CB     . PRO A 1 213 ? 36.806  35.060  -12.678 1.00 38.03  ? 210  PRO A CB     1 
ATOM   3416  C  CG     . PRO A 1 213 ? 35.978  34.182  -11.832 1.00 36.17  ? 210  PRO A CG     1 
ATOM   3417  C  CD     . PRO A 1 213 ? 36.205  34.638  -10.418 1.00 43.97  ? 210  PRO A CD     1 
ATOM   3418  H  HA     . PRO A 1 213 ? 38.678  34.588  -11.968 1.00 37.81  ? 210  PRO A HA     1 
ATOM   3419  H  HB2    . PRO A 1 213 ? 36.351  35.897  -12.858 1.00 45.64  ? 210  PRO A HB2    1 
ATOM   3420  H  HB3    . PRO A 1 213 ? 37.051  34.614  -13.504 1.00 45.64  ? 210  PRO A HB3    1 
ATOM   3421  H  HG2    . PRO A 1 213 ? 35.045  34.282  -12.076 1.00 43.40  ? 210  PRO A HG2    1 
ATOM   3422  H  HG3    . PRO A 1 213 ? 36.263  33.262  -11.943 1.00 43.40  ? 210  PRO A HG3    1 
ATOM   3423  H  HD2    . PRO A 1 213 ? 35.520  35.272  -10.154 1.00 52.76  ? 210  PRO A HD2    1 
ATOM   3424  H  HD3    . PRO A 1 213 ? 36.233  33.876  -9.819  1.00 52.76  ? 210  PRO A HD3    1 
ATOM   3425  N  N      . PHE A 1 214 ? 38.139  37.748  -11.832 1.00 41.83  ? 211  PHE A N      1 
ATOM   3426  C  CA     . PHE A 1 214 ? 38.705  39.049  -12.158 1.00 32.03  ? 211  PHE A CA     1 
ATOM   3427  C  C      . PHE A 1 214 ? 40.133  39.186  -11.674 1.00 39.30  ? 211  PHE A C      1 
ATOM   3428  O  O      . PHE A 1 214 ? 40.981  39.752  -12.367 1.00 31.21  ? 211  PHE A O      1 
ATOM   3429  C  CB     . PHE A 1 214 ? 37.858  40.163  -11.551 1.00 31.49  ? 211  PHE A CB     1 
ATOM   3430  C  CG     . PHE A 1 214 ? 38.549  41.493  -11.540 1.00 41.41  ? 211  PHE A CG     1 
ATOM   3431  C  CD1    . PHE A 1 214 ? 38.638  42.250  -12.688 1.00 42.06  ? 211  PHE A CD1    1 
ATOM   3432  C  CD2    . PHE A 1 214 ? 39.113  41.983  -10.377 1.00 40.18  ? 211  PHE A CD2    1 
ATOM   3433  C  CE1    . PHE A 1 214 ? 39.283  43.464  -12.679 1.00 36.55  ? 211  PHE A CE1    1 
ATOM   3434  C  CE2    . PHE A 1 214 ? 39.756  43.196  -10.363 1.00 35.57  ? 211  PHE A CE2    1 
ATOM   3435  C  CZ     . PHE A 1 214 ? 39.841  43.937  -11.516 1.00 31.75  ? 211  PHE A CZ     1 
ATOM   3436  H  H      . PHE A 1 214 ? 37.428  37.783  -11.350 1.00 50.20  ? 211  PHE A H      1 
ATOM   3437  H  HA     . PHE A 1 214 ? 38.703  39.161  -13.122 1.00 38.44  ? 211  PHE A HA     1 
ATOM   3438  H  HB2    . PHE A 1 214 ? 37.043  40.255  -12.068 1.00 37.78  ? 211  PHE A HB2    1 
ATOM   3439  H  HB3    . PHE A 1 214 ? 37.644  39.931  -10.634 1.00 37.78  ? 211  PHE A HB3    1 
ATOM   3440  H  HD1    . PHE A 1 214 ? 38.267  41.932  -13.479 1.00 50.48  ? 211  PHE A HD1    1 
ATOM   3441  H  HD2    . PHE A 1 214 ? 39.062  41.482  -9.595  1.00 48.21  ? 211  PHE A HD2    1 
ATOM   3442  H  HE1    . PHE A 1 214 ? 39.338  43.967  -13.460 1.00 43.86  ? 211  PHE A HE1    1 
ATOM   3443  H  HE2    . PHE A 1 214 ? 40.132  43.516  -9.575  1.00 42.68  ? 211  PHE A HE2    1 
ATOM   3444  H  HZ     . PHE A 1 214 ? 40.272  44.761  -11.508 1.00 38.10  ? 211  PHE A HZ     1 
ATOM   3445  N  N      . ILE A 1 215 ? 40.397  38.660  -10.486 1.00 35.26  ? 212  ILE A N      1 
ATOM   3446  C  CA     . ILE A 1 215 ? 41.733  38.689  -9.919  1.00 29.65  ? 212  ILE A CA     1 
ATOM   3447  C  C      . ILE A 1 215 ? 42.621  37.716  -10.676 1.00 33.48  ? 212  ILE A C      1 
ATOM   3448  O  O      . ILE A 1 215 ? 43.760  38.041  -11.019 1.00 29.87  ? 212  ILE A O      1 
ATOM   3449  C  CB     . ILE A 1 215 ? 41.705  38.347  -8.427  1.00 41.02  ? 212  ILE A CB     1 
ATOM   3450  C  CG1    . ILE A 1 215 ? 40.739  39.299  -7.710  1.00 37.61  ? 212  ILE A CG1    1 
ATOM   3451  C  CG2    . ILE A 1 215 ? 43.114  38.433  -7.837  1.00 31.00  ? 212  ILE A CG2    1 
ATOM   3452  C  CD1    . ILE A 1 215 ? 40.635  39.079  -6.226  1.00 38.47  ? 212  ILE A CD1    1 
ATOM   3453  H  H      . ILE A 1 215 ? 39.812  38.277  -9.985  1.00 42.32  ? 212  ILE A H      1 
ATOM   3454  H  HA     . ILE A 1 215 ? 42.103  39.580  -10.020 1.00 35.58  ? 212  ILE A HA     1 
ATOM   3455  H  HB     . ILE A 1 215 ? 41.380  37.439  -8.323  1.00 49.22  ? 212  ILE A HB     1 
ATOM   3456  H  HG12   . ILE A 1 215 ? 41.039  40.210  -7.852  1.00 45.14  ? 212  ILE A HG12   1 
ATOM   3457  H  HG13   . ILE A 1 215 ? 39.853  39.184  -8.087  1.00 45.14  ? 212  ILE A HG13   1 
ATOM   3458  H  HG21   . ILE A 1 215 ? 43.450  39.335  -7.953  1.00 37.20  ? 212  ILE A HG21   1 
ATOM   3459  H  HG22   . ILE A 1 215 ? 43.074  38.213  -6.893  1.00 37.20  ? 212  ILE A HG22   1 
ATOM   3460  H  HG23   . ILE A 1 215 ? 43.688  37.803  -8.300  1.00 37.20  ? 212  ILE A HG23   1 
ATOM   3461  H  HD11   . ILE A 1 215 ? 41.510  39.204  -5.826  1.00 46.17  ? 212  ILE A HD11   1 
ATOM   3462  H  HD12   . ILE A 1 215 ? 40.007  39.720  -5.855  1.00 46.17  ? 212  ILE A HD12   1 
ATOM   3463  H  HD13   . ILE A 1 215 ? 40.322  38.176  -6.062  1.00 46.17  ? 212  ILE A HD13   1 
ATOM   3464  N  N      . ARG A 1 216 ? 42.086  36.525  -10.941 1.00 28.48  ? 213  ARG A N      1 
ATOM   3465  C  CA     . ARG A 1 216 ? 42.805  35.499  -11.692 1.00 27.83  ? 213  ARG A CA     1 
ATOM   3466  C  C      . ARG A 1 216 ? 43.304  36.036  -13.026 1.00 40.35  ? 213  ARG A C      1 
ATOM   3467  O  O      . ARG A 1 216 ? 44.492  35.938  -13.350 1.00 31.84  ? 213  ARG A O      1 
ATOM   3468  C  CB     . ARG A 1 216 ? 41.892  34.291  -11.939 1.00 35.20  ? 213  ARG A CB     1 
ATOM   3469  C  CG     . ARG A 1 216 ? 42.604  33.083  -12.533 1.00 44.96  ? 213  ARG A CG     1 
ATOM   3470  C  CD     . ARG A 1 216 ? 41.646  31.955  -12.935 1.00 67.29  ? 213  ARG A CD     1 
ATOM   3471  N  NE     . ARG A 1 216 ? 40.916  32.229  -14.178 1.00 50.35  ? 213  ARG A NE     1 
ATOM   3472  C  CZ     . ARG A 1 216 ? 39.587  32.239  -14.310 1.00 61.55  ? 213  ARG A CZ     1 
ATOM   3473  N  NH1    . ARG A 1 216 ? 38.783  31.982  -13.280 1.00 47.20  ? 213  ARG A NH1    1 
ATOM   3474  N  NH2    . ARG A 1 216 ? 39.052  32.503  -15.495 1.00 53.91  ? 213  ARG A NH2    1 
ATOM   3475  H  H      . ARG A 1 216 ? 41.298  36.285  -10.692 1.00 34.17  ? 213  ARG A H      1 
ATOM   3476  H  HA     . ARG A 1 216 ? 43.571  35.202  -11.178 1.00 33.39  ? 213  ARG A HA     1 
ATOM   3477  H  HB2    . ARG A 1 216 ? 41.503  34.018  -11.094 1.00 42.24  ? 213  ARG A HB2    1 
ATOM   3478  H  HB3    . ARG A 1 216 ? 41.190  34.552  -12.555 1.00 42.24  ? 213  ARG A HB3    1 
ATOM   3479  H  HG2    . ARG A 1 216 ? 43.087  33.361  -13.327 1.00 53.95  ? 213  ARG A HG2    1 
ATOM   3480  H  HG3    . ARG A 1 216 ? 43.224  32.728  -11.877 1.00 53.95  ? 213  ARG A HG3    1 
ATOM   3481  H  HD2    . ARG A 1 216 ? 42.156  31.140  -13.061 1.00 80.75  ? 213  ARG A HD2    1 
ATOM   3482  H  HD3    . ARG A 1 216 ? 40.994  31.830  -12.227 1.00 80.75  ? 213  ARG A HD3    1 
ATOM   3483  H  HE     . ARG A 1 216 ? 41.383  32.396  -14.880 1.00 60.42  ? 213  ARG A HE     1 
ATOM   3484  H  HH11   . ARG A 1 216 ? 39.116  31.809  -12.506 1.00 56.64  ? 213  ARG A HH11   1 
ATOM   3485  H  HH12   . ARG A 1 216 ? 37.930  31.992  -13.387 1.00 56.64  ? 213  ARG A HH12   1 
ATOM   3486  H  HH21   . ARG A 1 216 ? 39.559  32.669  -16.169 1.00 64.70  ? 213  ARG A HH21   1 
ATOM   3487  H  HH22   . ARG A 1 216 ? 38.197  32.509  -15.588 1.00 64.70  ? 213  ARG A HH22   1 
ATOM   3488  N  N      . LYS A 1 217 ? 42.380  36.600  -13.798 1.00 34.25  ? 214  LYS A N      1 
ATOM   3489  C  CA     . LYS A 1 217 ? 42.693  37.123  -15.118 1.00 31.34  ? 214  LYS A CA     1 
ATOM   3490  C  C      . LYS A 1 217 ? 43.605  38.332  -15.007 1.00 42.26  ? 214  LYS A C      1 
ATOM   3491  O  O      . LYS A 1 217 ? 44.419  38.583  -15.892 1.00 44.26  ? 214  LYS A O      1 
ATOM   3492  C  CB     . LYS A 1 217 ? 41.404  37.489  -15.846 1.00 33.21  ? 214  LYS A CB     1 
ATOM   3493  C  CG     . LYS A 1 217 ? 40.423  36.331  -15.953 1.00 41.64  ? 214  LYS A CG     1 
ATOM   3494  C  CD     . LYS A 1 217 ? 39.127  36.737  -16.623 1.00 51.33  ? 214  LYS A CD     1 
ATOM   3495  C  CE     . LYS A 1 217 ? 38.088  35.635  -16.494 1.00 50.50  ? 214  LYS A CE     1 
ATOM   3496  N  NZ     . LYS A 1 217 ? 36.797  35.989  -17.143 1.00 68.74  ? 214  LYS A NZ     1 
ATOM   3497  H  H      . LYS A 1 217 ? 41.554  36.693  -13.574 1.00 41.10  ? 214  LYS A H      1 
ATOM   3498  H  HA     . LYS A 1 217 ? 43.151  36.441  -15.633 1.00 37.61  ? 214  LYS A HA     1 
ATOM   3499  H  HB2    . LYS A 1 217 ? 40.965  38.208  -15.365 1.00 39.85  ? 214  LYS A HB2    1 
ATOM   3500  H  HB3    . LYS A 1 217 ? 41.622  37.778  -16.746 1.00 39.85  ? 214  LYS A HB3    1 
ATOM   3501  H  HG2    . LYS A 1 217 ? 40.825  35.622  -16.479 1.00 49.97  ? 214  LYS A HG2    1 
ATOM   3502  H  HG3    . LYS A 1 217 ? 40.214  36.009  -15.062 1.00 49.97  ? 214  LYS A HG3    1 
ATOM   3503  H  HD2    . LYS A 1 217 ? 38.780  37.537  -16.196 1.00 61.59  ? 214  LYS A HD2    1 
ATOM   3504  H  HD3    . LYS A 1 217 ? 39.288  36.899  -17.565 1.00 61.59  ? 214  LYS A HD3    1 
ATOM   3505  H  HE2    . LYS A 1 217 ? 38.426  34.830  -16.917 1.00 60.60  ? 214  LYS A HE2    1 
ATOM   3506  H  HE3    . LYS A 1 217 ? 37.916  35.470  -15.554 1.00 60.60  ? 214  LYS A HE3    1 
ATOM   3507  H  HZ1    . LYS A 1 217 ? 36.925  36.140  -18.011 1.00 82.49  ? 214  LYS A HZ1    1 
ATOM   3508  H  HZ2    . LYS A 1 217 ? 36.216  35.322  -17.048 1.00 82.49  ? 214  LYS A HZ2    1 
ATOM   3509  H  HZ3    . LYS A 1 217 ? 36.460  36.723  -16.769 1.00 82.49  ? 214  LYS A HZ3    1 
ATOM   3510  N  N      . SER A 1 218 ? 43.482  39.069  -13.904 1.00 45.28  ? 215  SER A N      1 
ATOM   3511  C  CA     . SER A 1 218 ? 44.319  40.246  -13.679 1.00 33.97  ? 215  SER A CA     1 
ATOM   3512  C  C      . SER A 1 218 ? 45.751  39.835  -13.367 1.00 45.86  ? 215  SER A C      1 
ATOM   3513  O  O      . SER A 1 218 ? 46.705  40.422  -13.887 1.00 37.87  ? 215  SER A O      1 
ATOM   3514  C  CB     . SER A 1 218 ? 43.759  41.095  -12.538 1.00 25.31  ? 215  SER A CB     1 
ATOM   3515  O  OG     . SER A 1 218 ? 42.483  41.620  -12.850 1.00 31.37  ? 215  SER A OG     1 
ATOM   3516  H  H      . SER A 1 218 ? 42.923  38.909  -13.271 1.00 54.34  ? 215  SER A H      1 
ATOM   3517  H  HA     . SER A 1 218 ? 44.328  40.788  -14.483 1.00 40.77  ? 215  SER A HA     1 
ATOM   3518  H  HB2    . SER A 1 218 ? 43.683  40.541  -11.745 1.00 30.37  ? 215  SER A HB2    1 
ATOM   3519  H  HB3    . SER A 1 218 ? 44.367  41.831  -12.368 1.00 30.37  ? 215  SER A HB3    1 
ATOM   3520  H  HG     . SER A 1 218 ? 41.943  40.994  -12.997 1.00 37.64  ? 215  SER A HG     1 
ATOM   3521  N  N      . ILE A 1 219 ? 45.896  38.821  -12.516 1.00 27.68  ? 216  ILE A N      1 
ATOM   3522  C  CA     . ILE A 1 219 ? 47.207  38.265  -12.213 1.00 32.04  ? 216  ILE A CA     1 
ATOM   3523  C  C      . ILE A 1 219 ? 47.894  37.784  -13.490 1.00 44.37  ? 216  ILE A C      1 
ATOM   3524  O  O      . ILE A 1 219 ? 49.075  38.061  -13.708 1.00 34.57  ? 216  ILE A O      1 
ATOM   3525  C  CB     . ILE A 1 219 ? 47.118  37.104  -11.205 1.00 31.09  ? 216  ILE A CB     1 
ATOM   3526  C  CG1    . ILE A 1 219 ? 46.682  37.627  -9.834  1.00 33.02  ? 216  ILE A CG1    1 
ATOM   3527  C  CG2    . ILE A 1 219 ? 48.470  36.410  -11.063 1.00 32.75  ? 216  ILE A CG2    1 
ATOM   3528  C  CD1    . ILE A 1 219 ? 46.231  36.543  -8.873  1.00 35.26  ? 216  ILE A CD1    1 
ATOM   3529  H  H      . ILE A 1 219 ? 45.247  38.437  -12.102 1.00 33.21  ? 216  ILE A H      1 
ATOM   3530  H  HA     . ILE A 1 219 ? 47.760  38.960  -11.821 1.00 38.45  ? 216  ILE A HA     1 
ATOM   3531  H  HB     . ILE A 1 219 ? 46.465  36.461  -11.520 1.00 37.31  ? 216  ILE A HB     1 
ATOM   3532  H  HG12   . ILE A 1 219 ? 47.429  38.091  -9.425  1.00 39.63  ? 216  ILE A HG12   1 
ATOM   3533  H  HG13   . ILE A 1 219 ? 45.941  38.241  -9.956  1.00 39.63  ? 216  ILE A HG13   1 
ATOM   3534  H  HG21   . ILE A 1 219 ? 49.124  37.054  -10.749 1.00 39.30  ? 216  ILE A HG21   1 
ATOM   3535  H  HG22   . ILE A 1 219 ? 48.387  35.685  -10.424 1.00 39.30  ? 216  ILE A HG22   1 
ATOM   3536  H  HG23   . ILE A 1 219 ? 48.738  36.061  -11.927 1.00 39.30  ? 216  ILE A HG23   1 
ATOM   3537  H  HD11   . ILE A 1 219 ? 46.964  35.925  -8.727  1.00 42.31  ? 216  ILE A HD11   1 
ATOM   3538  H  HD12   . ILE A 1 219 ? 45.973  36.954  -8.033  1.00 42.31  ? 216  ILE A HD12   1 
ATOM   3539  H  HD13   . ILE A 1 219 ? 45.474  36.075  -9.259  1.00 42.31  ? 216  ILE A HD13   1 
ATOM   3540  N  N      . ASN A 1 220 ? 47.152  37.057  -14.324 1.00 43.44  ? 217  ASN A N      1 
ATOM   3541  C  CA     . ASN A 1 220 ? 47.710  36.489  -15.547 1.00 33.49  ? 217  ASN A CA     1 
ATOM   3542  C  C      . ASN A 1 220 ? 48.221  37.547  -16.521 1.00 25.74  ? 217  ASN A C      1 
ATOM   3543  O  O      . ASN A 1 220 ? 49.198  37.312  -17.232 1.00 17.78  ? 217  ASN A O      1 
ATOM   3544  C  CB     . ASN A 1 220 ? 46.681  35.580  -16.217 1.00 33.17  ? 217  ASN A CB     1 
ATOM   3545  C  CG     . ASN A 1 220 ? 46.422  34.305  -15.420 1.00 49.99  ? 217  ASN A CG     1 
ATOM   3546  O  OD1    . ASN A 1 220 ? 47.226  33.915  -14.574 1.00 68.18  ? 217  ASN A OD1    1 
ATOM   3547  N  ND2    . ASN A 1 220 ? 45.300  33.648  -15.690 1.00 65.56  ? 217  ASN A ND2    1 
ATOM   3548  H  H      . ASN A 1 220 ? 46.319  36.878  -14.202 1.00 52.13  ? 217  ASN A H      1 
ATOM   3549  H  HA     . ASN A 1 220 ? 48.468  35.934  -15.305 1.00 40.19  ? 217  ASN A HA     1 
ATOM   3550  H  HB2    . ASN A 1 220 ? 45.841  36.059  -16.300 1.00 39.80  ? 217  ASN A HB2    1 
ATOM   3551  H  HB3    . ASN A 1 220 ? 47.006  35.325  -17.095 1.00 39.80  ? 217  ASN A HB3    1 
ATOM   3552  H  HD21   . ASN A 1 220 ? 44.761  33.947  -16.290 1.00 78.68  ? 217  ASN A HD21   1 
ATOM   3553  H  HD22   . ASN A 1 220 ? 45.112  32.924  -15.266 1.00 78.68  ? 217  ASN A HD22   1 
ATOM   3554  N  N      . ILE A 1 221 ? 47.598  38.720  -16.546 1.00 32.98  ? 218  ILE A N      1 
ATOM   3555  C  CA     . ILE A 1 221 ? 48.123  39.804  -17.375 1.00 32.96  ? 218  ILE A CA     1 
ATOM   3556  C  C      . ILE A 1 221 ? 49.415  40.303  -16.744 1.00 47.54  ? 218  ILE A C      1 
ATOM   3557  O  O      . ILE A 1 221 ? 50.392  40.568  -17.440 1.00 40.31  ? 218  ILE A O      1 
ATOM   3558  C  CB     . ILE A 1 221 ? 47.165  41.004  -17.488 1.00 21.70  ? 218  ILE A CB     1 
ATOM   3559  C  CG1    . ILE A 1 221 ? 45.837  40.593  -18.112 1.00 11.68  ? 218  ILE A CG1    1 
ATOM   3560  C  CG2    . ILE A 1 221 ? 47.834  42.140  -18.284 1.00 21.33  ? 218  ILE A CG2    1 
ATOM   3561  C  CD1    . ILE A 1 221 ? 44.805  41.700  -18.111 1.00 17.03  ? 218  ILE A CD1    1 
ATOM   3562  H  H      . ILE A 1 221 ? 46.886  38.914  -16.104 1.00 39.57  ? 218  ILE A H      1 
ATOM   3563  H  HA     . ILE A 1 221 ? 48.317  39.473  -18.266 1.00 39.55  ? 218  ILE A HA     1 
ATOM   3564  H  HB     . ILE A 1 221 ? 46.987  41.330  -16.592 1.00 26.04  ? 218  ILE A HB     1 
ATOM   3565  H  HG12   . ILE A 1 221 ? 45.990  40.330  -19.033 1.00 14.01  ? 218  ILE A HG12   1 
ATOM   3566  H  HG13   . ILE A 1 221 ? 45.472  39.846  -17.612 1.00 14.01  ? 218  ILE A HG13   1 
ATOM   3567  H  HG21   . ILE A 1 221 ? 48.052  41.816  -19.172 1.00 25.60  ? 218  ILE A HG21   1 
ATOM   3568  H  HG22   . ILE A 1 221 ? 47.217  42.886  -18.346 1.00 25.60  ? 218  ILE A HG22   1 
ATOM   3569  H  HG23   . ILE A 1 221 ? 48.642  42.414  -17.823 1.00 25.60  ? 218  ILE A HG23   1 
ATOM   3570  H  HD11   . ILE A 1 221 ? 45.149  42.452  -18.617 1.00 20.43  ? 218  ILE A HD11   1 
ATOM   3571  H  HD12   . ILE A 1 221 ? 43.989  41.371  -18.520 1.00 20.43  ? 218  ILE A HD12   1 
ATOM   3572  H  HD13   . ILE A 1 221 ? 44.632  41.968  -17.195 1.00 20.43  ? 218  ILE A HD13   1 
ATOM   3573  N  N      . ILE A 1 222 ? 49.413  40.434  -15.419 1.00 38.46  ? 219  ILE A N      1 
ATOM   3574  C  CA     . ILE A 1 222 ? 50.583  40.931  -14.706 1.00 32.42  ? 219  ILE A CA     1 
ATOM   3575  C  C      . ILE A 1 222 ? 51.741  39.955  -14.868 1.00 33.85  ? 219  ILE A C      1 
ATOM   3576  O  O      . ILE A 1 222 ? 52.889  40.364  -15.051 1.00 34.63  ? 219  ILE A O      1 
ATOM   3577  C  CB     . ILE A 1 222 ? 50.283  41.139  -13.207 1.00 34.68  ? 219  ILE A CB     1 
ATOM   3578  C  CG1    . ILE A 1 222 ? 49.264  42.260  -13.020 1.00 26.52  ? 219  ILE A CG1    1 
ATOM   3579  C  CG2    . ILE A 1 222 ? 51.566  41.473  -12.441 1.00 34.66  ? 219  ILE A CG2    1 
ATOM   3580  C  CD1    . ILE A 1 222 ? 48.806  42.448  -11.586 1.00 23.58  ? 219  ILE A CD1    1 
ATOM   3581  H  H      . ILE A 1 222 ? 48.746  40.242  -14.911 1.00 46.15  ? 219  ILE A H      1 
ATOM   3582  H  HA     . ILE A 1 222 ? 50.849  41.784  -15.084 1.00 38.91  ? 219  ILE A HA     1 
ATOM   3583  H  HB     . ILE A 1 222 ? 49.912  40.318  -12.848 1.00 41.62  ? 219  ILE A HB     1 
ATOM   3584  H  HG12   . ILE A 1 222 ? 49.660  43.095  -13.316 1.00 31.82  ? 219  ILE A HG12   1 
ATOM   3585  H  HG13   . ILE A 1 222 ? 48.480  42.061  -13.557 1.00 31.82  ? 219  ILE A HG13   1 
ATOM   3586  H  HG21   . ILE A 1 222 ? 51.948  42.287  -12.805 1.00 41.60  ? 219  ILE A HG21   1 
ATOM   3587  H  HG22   . ILE A 1 222 ? 51.350  41.599  -11.504 1.00 41.60  ? 219  ILE A HG22   1 
ATOM   3588  H  HG23   . ILE A 1 222 ? 52.193  40.740  -12.541 1.00 41.60  ? 219  ILE A HG23   1 
ATOM   3589  H  HD11   . ILE A 1 222 ? 49.576  42.661  -11.035 1.00 28.30  ? 219  ILE A HD11   1 
ATOM   3590  H  HD12   . ILE A 1 222 ? 48.164  43.174  -11.552 1.00 28.30  ? 219  ILE A HD12   1 
ATOM   3591  H  HD13   . ILE A 1 222 ? 48.395  41.626  -11.276 1.00 28.30  ? 219  ILE A HD13   1 
ATOM   3592  N  N      . LYS A 1 223 ? 51.424  38.665  -14.801 1.00 30.77  ? 220  LYS A N      1 
ATOM   3593  C  CA     . LYS A 1 223 ? 52.421  37.613  -14.964 1.00 28.53  ? 220  LYS A CA     1 
ATOM   3594  C  C      . LYS A 1 223 ? 53.215  37.857  -16.241 1.00 36.96  ? 220  LYS A C      1 
ATOM   3595  O  O      . LYS A 1 223 ? 54.429  37.656  -16.277 1.00 32.78  ? 220  LYS A O      1 
ATOM   3596  C  CB     . LYS A 1 223 ? 51.761  36.235  -14.989 1.00 21.70  ? 220  LYS A CB     1 
ATOM   3597  C  CG     . LYS A 1 223 ? 51.571  35.600  -13.615 1.00 36.13  ? 220  LYS A CG     1 
ATOM   3598  C  CD     . LYS A 1 223 ? 50.994  34.187  -13.695 1.00 50.05  ? 220  LYS A CD     1 
ATOM   3599  C  CE     . LYS A 1 223 ? 51.976  33.195  -14.316 1.00 80.16  ? 220  LYS A CE     1 
ATOM   3600  N  NZ     . LYS A 1 223 ? 51.395  31.831  -14.469 1.00 74.14  ? 220  LYS A NZ     1 
ATOM   3601  H  H      . LYS A 1 223 ? 50.628  38.371  -14.661 1.00 36.92  ? 220  LYS A H      1 
ATOM   3602  H  HA     . LYS A 1 223 ? 53.037  37.639  -14.215 1.00 34.24  ? 220  LYS A HA     1 
ATOM   3603  H  HB2    . LYS A 1 223 ? 50.885  36.318  -15.398 1.00 26.04  ? 220  LYS A HB2    1 
ATOM   3604  H  HB3    . LYS A 1 223 ? 52.312  35.637  -15.516 1.00 26.04  ? 220  LYS A HB3    1 
ATOM   3605  H  HG2    . LYS A 1 223 ? 52.431  35.549  -13.169 1.00 43.36  ? 220  LYS A HG2    1 
ATOM   3606  H  HG3    . LYS A 1 223 ? 50.960  36.146  -13.096 1.00 43.36  ? 220  LYS A HG3    1 
ATOM   3607  H  HD2    . LYS A 1 223 ? 50.781  33.880  -12.799 1.00 60.06  ? 220  LYS A HD2    1 
ATOM   3608  H  HD3    . LYS A 1 223 ? 50.193  34.201  -14.241 1.00 60.06  ? 220  LYS A HD3    1 
ATOM   3609  H  HE2    . LYS A 1 223 ? 52.232  33.513  -15.196 1.00 96.19  ? 220  LYS A HE2    1 
ATOM   3610  H  HE3    . LYS A 1 223 ? 52.759  33.127  -13.747 1.00 96.19  ? 220  LYS A HE3    1 
ATOM   3611  H  HZ1    . LYS A 1 223 ? 50.677  31.863  -14.994 1.00 88.97  ? 220  LYS A HZ1    1 
ATOM   3612  H  HZ2    . LYS A 1 223 ? 51.996  31.284  -14.834 1.00 88.97  ? 220  LYS A HZ2    1 
ATOM   3613  H  HZ3    . LYS A 1 223 ? 51.157  31.510  -13.674 1.00 88.97  ? 220  LYS A HZ3    1 
ATOM   3614  N  N      . LYS A 1 224 ? 52.508  38.290  -17.284 1.00 31.76  ? 221  LYS A N      1 
ATOM   3615  C  CA     . LYS A 1 224 ? 53.100  38.499  -18.601 1.00 34.41  ? 221  LYS A CA     1 
ATOM   3616  C  C      . LYS A 1 224 ? 54.146  39.615  -18.618 1.00 38.07  ? 221  LYS A C      1 
ATOM   3617  O  O      . LYS A 1 224 ? 55.003  39.636  -19.498 1.00 48.36  ? 221  LYS A O      1 
ATOM   3618  C  CB     . LYS A 1 224 ? 51.990  38.800  -19.622 1.00 41.24  ? 221  LYS A CB     1 
ATOM   3619  C  CG     . LYS A 1 224 ? 52.472  39.091  -21.043 1.00 50.46  ? 221  LYS A CG     1 
ATOM   3620  C  CD     . LYS A 1 224 ? 51.313  39.443  -21.978 1.00 70.15  ? 221  LYS A CD     1 
ATOM   3621  C  CE     . LYS A 1 224 ? 51.803  39.791  -23.385 1.00 79.20  ? 221  LYS A CE     1 
ATOM   3622  N  NZ     . LYS A 1 224 ? 52.788  40.913  -23.411 1.00 64.30  ? 221  LYS A NZ     1 
ATOM   3623  H  H      . LYS A 1 224 ? 51.668  38.474  -17.251 1.00 38.11  ? 221  LYS A H      1 
ATOM   3624  H  HA     . LYS A 1 224 ? 53.540  37.680  -18.877 1.00 41.30  ? 221  LYS A HA     1 
ATOM   3625  H  HB2    . LYS A 1 224 ? 51.397  38.034  -19.667 1.00 49.49  ? 221  LYS A HB2    1 
ATOM   3626  H  HB3    . LYS A 1 224 ? 51.495  39.577  -19.318 1.00 49.49  ? 221  LYS A HB3    1 
ATOM   3627  H  HG2    . LYS A 1 224 ? 53.085  39.843  -21.025 1.00 60.55  ? 221  LYS A HG2    1 
ATOM   3628  H  HG3    . LYS A 1 224 ? 52.917  38.305  -21.396 1.00 60.55  ? 221  LYS A HG3    1 
ATOM   3629  H  HD2    . LYS A 1 224 ? 50.715  38.682  -22.045 1.00 84.18  ? 221  LYS A HD2    1 
ATOM   3630  H  HD3    . LYS A 1 224 ? 50.839  40.211  -21.624 1.00 84.18  ? 221  LYS A HD3    1 
ATOM   3631  H  HE2    . LYS A 1 224 ? 52.231  39.010  -23.770 1.00 95.04  ? 221  LYS A HE2    1 
ATOM   3632  H  HE3    . LYS A 1 224 ? 51.041  40.051  -23.926 1.00 95.04  ? 221  LYS A HE3    1 
ATOM   3633  H  HZ1    . LYS A 1 224 ? 53.505  40.700  -22.929 1.00 77.17  ? 221  LYS A HZ1    1 
ATOM   3634  H  HZ2    . LYS A 1 224 ? 53.041  41.076  -24.249 1.00 77.17  ? 221  LYS A HZ2    1 
ATOM   3635  H  HZ3    . LYS A 1 224 ? 52.420  41.649  -23.071 1.00 77.17  ? 221  LYS A HZ3    1 
ATOM   3636  N  N      . TYR A 1 225 ? 54.093  40.525  -17.645 1.00 41.24  ? 222  TYR A N      1 
ATOM   3637  C  CA     . TYR A 1 225 ? 54.977  41.702  -17.630 1.00 47.27  ? 222  TYR A CA     1 
ATOM   3638  C  C      . TYR A 1 225 ? 55.929  41.708  -16.433 1.00 52.81  ? 222  TYR A C      1 
ATOM   3639  O  O      . TYR A 1 225 ? 56.922  42.443  -16.421 1.00 49.67  ? 222  TYR A O      1 
ATOM   3640  C  CB     . TYR A 1 225 ? 54.179  43.008  -17.573 1.00 28.18  ? 222  TYR A CB     1 
ATOM   3641  C  CG     . TYR A 1 225 ? 53.300  43.296  -18.754 1.00 26.15  ? 222  TYR A CG     1 
ATOM   3642  C  CD1    . TYR A 1 225 ? 52.011  42.793  -18.805 1.00 33.33  ? 222  TYR A CD1    1 
ATOM   3643  C  CD2    . TYR A 1 225 ? 53.748  44.071  -19.819 1.00 36.94  ? 222  TYR A CD2    1 
ATOM   3644  C  CE1    . TYR A 1 225 ? 51.186  43.052  -19.878 1.00 40.72  ? 222  TYR A CE1    1 
ATOM   3645  C  CE2    . TYR A 1 225 ? 52.927  44.334  -20.907 1.00 28.95  ? 222  TYR A CE2    1 
ATOM   3646  C  CZ     . TYR A 1 225 ? 51.647  43.819  -20.927 1.00 36.94  ? 222  TYR A CZ     1 
ATOM   3647  O  OH     . TYR A 1 225 ? 50.813  44.067  -21.992 1.00 56.77  ? 222  TYR A OH     1 
ATOM   3648  H  H      . TYR A 1 225 ? 53.552  40.487  -16.977 1.00 49.48  ? 222  TYR A H      1 
ATOM   3649  H  HA     . TYR A 1 225 ? 55.510  41.708  -18.440 1.00 56.72  ? 222  TYR A HA     1 
ATOM   3650  H  HB2    . TYR A 1 225 ? 53.610  42.983  -16.788 1.00 33.82  ? 222  TYR A HB2    1 
ATOM   3651  H  HB3    . TYR A 1 225 ? 54.806  43.744  -17.492 1.00 33.82  ? 222  TYR A HB3    1 
ATOM   3652  H  HD1    . TYR A 1 225 ? 54.611  44.416  -19.802 1.00 44.33  ? 222  TYR A HD1    1 
ATOM   3653  H  HD2    . TYR A 1 225 ? 51.695  42.275  -18.101 1.00 39.99  ? 222  TYR A HD2    1 
ATOM   3654  H  HE1    . TYR A 1 225 ? 53.235  44.853  -21.614 1.00 34.74  ? 222  TYR A HE1    1 
ATOM   3655  H  HE2    . TYR A 1 225 ? 50.323  42.705  -19.897 1.00 48.86  ? 222  TYR A HE2    1 
ATOM   3656  H  HH     . TYR A 1 225 ? 51.207  44.544  -22.560 1.00 68.13  ? 222  TYR A HH     1 
ATOM   3657  N  N      . PHE A 1 226 ? 55.620  40.895  -15.428 1.00 34.17  ? 223  PHE A N      1 
ATOM   3658  C  CA     . PHE A 1 226 ? 56.237  41.045  -14.115 1.00 30.94  ? 223  PHE A CA     1 
ATOM   3659  C  C      . PHE A 1 226 ? 57.765  40.948  -14.139 1.00 43.50  ? 223  PHE A C      1 
ATOM   3660  O  O      . PHE A 1 226 ? 58.441  41.757  -13.506 1.00 54.16  ? 223  PHE A O      1 
ATOM   3661  C  CB     . PHE A 1 226 ? 55.678  40.020  -13.135 1.00 26.06  ? 223  PHE A CB     1 
ATOM   3662  C  CG     . PHE A 1 226 ? 56.132  40.251  -11.728 1.00 50.76  ? 223  PHE A CG     1 
ATOM   3663  C  CD1    . PHE A 1 226 ? 55.545  41.243  -10.963 1.00 46.40  ? 223  PHE A CD1    1 
ATOM   3664  C  CD2    . PHE A 1 226 ? 57.168  39.516  -11.183 1.00 46.20  ? 223  PHE A CD2    1 
ATOM   3665  C  CE1    . PHE A 1 226 ? 55.962  41.479  -9.674  1.00 29.58  ? 223  PHE A CE1    1 
ATOM   3666  C  CE2    . PHE A 1 226 ? 57.592  39.748  -9.893  1.00 35.99  ? 223  PHE A CE2    1 
ATOM   3667  C  CZ     . PHE A 1 226 ? 56.986  40.733  -9.138  1.00 33.49  ? 223  PHE A CZ     1 
ATOM   3668  H  H      . PHE A 1 226 ? 55.056  40.248  -15.480 1.00 41.00  ? 223  PHE A H      1 
ATOM   3669  H  HA     . PHE A 1 226 ? 56.010  41.924  -13.773 1.00 37.13  ? 223  PHE A HA     1 
ATOM   3670  H  HB2    . PHE A 1 226 ? 54.709  40.066  -13.148 1.00 31.27  ? 223  PHE A HB2    1 
ATOM   3671  H  HB3    . PHE A 1 226 ? 55.972  39.135  -13.403 1.00 31.27  ? 223  PHE A HB3    1 
ATOM   3672  H  HD1    . PHE A 1 226 ? 54.851  41.749  -11.321 1.00 55.68  ? 223  PHE A HD1    1 
ATOM   3673  H  HD2    . PHE A 1 226 ? 57.577  38.851  -11.689 1.00 55.44  ? 223  PHE A HD2    1 
ATOM   3674  H  HE1    . PHE A 1 226 ? 55.554  42.143  -9.166  1.00 35.50  ? 223  PHE A HE1    1 
ATOM   3675  H  HE2    . PHE A 1 226 ? 58.284  39.243  -9.531  1.00 43.19  ? 223  PHE A HE2    1 
ATOM   3676  H  HZ     . PHE A 1 226 ? 57.270  40.891  -8.266  1.00 40.19  ? 223  PHE A HZ     1 
ATOM   3677  N  N      . GLU A 1 227 ? 58.309  39.968  -14.849 1.00 46.90  ? 224  GLU A N      1 
ATOM   3678  C  CA     . GLU A 1 227 ? 59.753  39.735  -14.835 1.00 40.08  ? 224  GLU A CA     1 
ATOM   3679  C  C      . GLU A 1 227 ? 60.541  40.942  -15.333 1.00 42.90  ? 224  GLU A C      1 
ATOM   3680  O  O      . GLU A 1 227 ? 61.470  41.397  -14.673 1.00 57.48  ? 224  GLU A O      1 
ATOM   3681  C  CB     . GLU A 1 227 ? 60.124  38.538  -15.701 1.00 53.48  ? 224  GLU A CB     1 
ATOM   3682  C  CG     . GLU A 1 227 ? 61.440  37.903  -15.311 1.00 40.84  ? 224  GLU A CG     1 
ATOM   3683  C  CD     . GLU A 1 227 ? 61.840  36.781  -16.244 1.00 60.59  ? 224  GLU A CD     1 
ATOM   3684  O  OE1    . GLU A 1 227 ? 62.484  37.074  -17.274 1.00 71.40  ? 224  GLU A OE1    1 
ATOM   3685  O  OE2    . GLU A 1 227 ? 61.500  35.615  -15.962 1.00 81.21  ? 224  GLU A OE2    1 
ATOM   3686  H  H      . GLU A 1 227 ? 57.868  39.423  -15.348 1.00 56.28  ? 224  GLU A H      1 
ATOM   3687  H  HA     . GLU A 1 227 ? 60.034  39.547  -13.926 1.00 48.10  ? 224  GLU A HA     1 
ATOM   3688  H  HB2    . GLU A 1 227 ? 59.431  37.864  -15.618 1.00 64.18  ? 224  GLU A HB2    1 
ATOM   3689  H  HB3    . GLU A 1 227 ? 60.194  38.827  -16.624 1.00 64.18  ? 224  GLU A HB3    1 
ATOM   3690  H  HG2    . GLU A 1 227 ? 62.136  38.578  -15.336 1.00 49.01  ? 224  GLU A HG2    1 
ATOM   3691  H  HG3    . GLU A 1 227 ? 61.362  37.537  -14.416 1.00 49.01  ? 224  GLU A HG3    1 
ATOM   3692  N  N      . GLU A 1 228 ? 60.173  41.460  -16.497 1.00 51.95  ? 225  GLU A N      1 
ATOM   3693  C  CA     . GLU A 1 228 ? 60.899  42.580  -17.070 1.00 48.48  ? 225  GLU A CA     1 
ATOM   3694  C  C      . GLU A 1 228 ? 60.656  43.851  -16.286 1.00 48.45  ? 225  GLU A C      1 
ATOM   3695  O  O      . GLU A 1 228 ? 61.581  44.638  -16.093 1.00 55.89  ? 225  GLU A O      1 
ATOM   3696  C  CB     . GLU A 1 228 ? 60.480  42.801  -18.529 1.00 74.84  ? 225  GLU A CB     1 
ATOM   3697  C  CG     . GLU A 1 228 ? 61.466  42.283  -19.563 1.00 87.98  ? 225  GLU A CG     1 
ATOM   3698  C  CD     . GLU A 1 228 ? 62.758  43.081  -19.595 1.00 93.86  ? 225  GLU A CD     1 
ATOM   3699  O  OE1    . GLU A 1 228 ? 62.696  44.300  -19.862 1.00 85.18  ? 225  GLU A OE1    1 
ATOM   3700  O  OE2    . GLU A 1 228 ? 63.834  42.488  -19.357 1.00 69.73  ? 225  GLU A OE2    1 
ATOM   3701  H  H      . GLU A 1 228 ? 59.511  41.183  -16.970 1.00 62.33  ? 225  GLU A H      1 
ATOM   3702  H  HA     . GLU A 1 228 ? 61.849  42.388  -17.051 1.00 58.17  ? 225  GLU A HA     1 
ATOM   3703  H  HB2    . GLU A 1 228 ? 59.635  42.350  -18.679 1.00 89.80  ? 225  GLU A HB2    1 
ATOM   3704  H  HB3    . GLU A 1 228 ? 60.373  43.753  -18.678 1.00 89.80  ? 225  GLU A HB3    1 
ATOM   3705  H  HG2    . GLU A 1 228 ? 61.688  41.362  -19.356 1.00 105.58 ? 225  GLU A HG2    1 
ATOM   3706  H  HG3    . GLU A 1 228 ? 61.059  42.337  -20.442 1.00 105.58 ? 225  GLU A HG3    1 
ATOM   3707  N  N      . TYR A 1 229 ? 59.426  44.070  -15.834 1.00 45.06  ? 226  TYR A N      1 
ATOM   3708  C  CA     . TYR A 1 229 ? 59.132  45.309  -15.127 1.00 47.16  ? 226  TYR A CA     1 
ATOM   3709  C  C      . TYR A 1 229 ? 59.717  45.304  -13.724 1.00 48.89  ? 226  TYR A C      1 
ATOM   3710  O  O      . TYR A 1 229 ? 60.447  46.220  -13.343 1.00 52.96  ? 226  TYR A O      1 
ATOM   3711  C  CB     . TYR A 1 229 ? 57.633  45.574  -15.025 1.00 39.58  ? 226  TYR A CB     1 
ATOM   3712  C  CG     . TYR A 1 229 ? 57.342  46.578  -13.936 1.00 40.43  ? 226  TYR A CG     1 
ATOM   3713  C  CD1    . TYR A 1 229 ? 57.612  47.929  -14.122 1.00 35.16  ? 226  TYR A CD1    1 
ATOM   3714  C  CD2    . TYR A 1 229 ? 56.830  46.176  -12.710 1.00 28.99  ? 226  TYR A CD2    1 
ATOM   3715  C  CE1    . TYR A 1 229 ? 57.368  48.852  -13.124 1.00 36.87  ? 226  TYR A CE1    1 
ATOM   3716  C  CE2    . TYR A 1 229 ? 56.585  47.093  -11.709 1.00 50.43  ? 226  TYR A CE2    1 
ATOM   3717  C  CZ     . TYR A 1 229 ? 56.852  48.430  -11.921 1.00 46.45  ? 226  TYR A CZ     1 
ATOM   3718  O  OH     . TYR A 1 229 ? 56.611  49.340  -10.914 1.00 45.19  ? 226  TYR A OH     1 
ATOM   3719  H  H      . TYR A 1 229 ? 58.760  43.533  -15.921 1.00 54.07  ? 226  TYR A H      1 
ATOM   3720  H  HA     . TYR A 1 229 ? 59.531  46.048  -15.613 1.00 56.59  ? 226  TYR A HA     1 
ATOM   3721  H  HB2    . TYR A 1 229 ? 57.311  45.933  -15.867 1.00 47.50  ? 226  TYR A HB2    1 
ATOM   3722  H  HB3    . TYR A 1 229 ? 57.173  44.747  -14.811 1.00 47.50  ? 226  TYR A HB3    1 
ATOM   3723  H  HD1    . TYR A 1 229 ? 57.961  48.217  -14.934 1.00 42.19  ? 226  TYR A HD1    1 
ATOM   3724  H  HD2    . TYR A 1 229 ? 56.649  45.276  -12.562 1.00 34.79  ? 226  TYR A HD2    1 
ATOM   3725  H  HE1    . TYR A 1 229 ? 57.550  49.753  -13.265 1.00 44.24  ? 226  TYR A HE1    1 
ATOM   3726  H  HE2    . TYR A 1 229 ? 56.238  46.810  -10.894 1.00 60.51  ? 226  TYR A HE2    1 
ATOM   3727  H  HH     . TYR A 1 229 ? 56.299  48.948  -10.241 1.00 54.23  ? 226  TYR A HH     1 
ATOM   3728  N  N      . ALA A 1 230 ? 59.398  44.262  -12.963 1.00 43.30  ? 227  ALA A N      1 
ATOM   3729  C  CA     . ALA A 1 230 ? 59.648  44.271  -11.529 1.00 34.74  ? 227  ALA A CA     1 
ATOM   3730  C  C      . ALA A 1 230 ? 61.022  43.730  -11.159 1.00 37.70  ? 227  ALA A C      1 
ATOM   3731  O  O      . ALA A 1 230 ? 61.675  44.263  -10.260 1.00 38.37  ? 227  ALA A O      1 
ATOM   3732  C  CB     . ALA A 1 230 ? 58.564  43.470  -10.813 1.00 26.76  ? 227  ALA A CB     1 
ATOM   3733  H  H      . ALA A 1 230 ? 59.037  43.538  -13.254 1.00 51.96  ? 227  ALA A H      1 
ATOM   3734  H  HA     . ALA A 1 230 ? 59.597  45.186  -11.212 1.00 41.68  ? 227  ALA A HA     1 
ATOM   3735  H  HB1    . ALA A 1 230 ? 58.579  42.557  -11.140 1.00 32.11  ? 227  ALA A HB1    1 
ATOM   3736  H  HB2    . ALA A 1 230 ? 58.741  43.484  -9.860  1.00 32.11  ? 227  ALA A HB2    1 
ATOM   3737  H  HB3    . ALA A 1 230 ? 57.701  43.874  -10.996 1.00 32.11  ? 227  ALA A HB3    1 
ATOM   3738  N  N      . LEU A 1 231 ? 61.469  42.689  -11.854 1.00 29.22  ? 228  LEU A N      1 
ATOM   3739  C  CA     . LEU A 1 231 ? 62.721  42.033  -11.494 1.00 34.24  ? 228  LEU A CA     1 
ATOM   3740  C  C      . LEU A 1 231 ? 63.913  42.636  -12.237 1.00 34.32  ? 228  LEU A C      1 
ATOM   3741  O  O      . LEU A 1 231 ? 65.031  42.606  -11.732 1.00 45.91  ? 228  LEU A O      1 
ATOM   3742  C  CB     . LEU A 1 231 ? 62.617  40.520  -11.732 1.00 33.19  ? 228  LEU A CB     1 
ATOM   3743  C  CG     . LEU A 1 231 ? 61.478  39.852  -10.938 1.00 36.79  ? 228  LEU A CG     1 
ATOM   3744  C  CD1    . LEU A 1 231 ? 61.413  38.352  -11.175 1.00 33.03  ? 228  LEU A CD1    1 
ATOM   3745  C  CD2    . LEU A 1 231 ? 61.569  40.125  -9.437  1.00 37.04  ? 228  LEU A CD2    1 
ATOM   3746  H  H      . LEU A 1 231 ? 61.070  42.346  -12.534 1.00 35.06  ? 228  LEU A H      1 
ATOM   3747  H  HA     . LEU A 1 231 ? 62.874  42.166  -10.546 1.00 41.09  ? 228  LEU A HA     1 
ATOM   3748  H  HB2    . LEU A 1 231 ? 62.455  40.361  -12.676 1.00 39.82  ? 228  LEU A HB2    1 
ATOM   3749  H  HB3    . LEU A 1 231 ? 63.451  40.102  -11.466 1.00 39.82  ? 228  LEU A HB3    1 
ATOM   3750  H  HG     . LEU A 1 231 ? 60.637  40.225  -11.245 1.00 44.15  ? 228  LEU A HG     1 
ATOM   3751  H  HD11   . LEU A 1 231 ? 62.253  37.953  -10.899 1.00 39.64  ? 228  LEU A HD11   1 
ATOM   3752  H  HD12   . LEU A 1 231 ? 60.683  37.981  -10.654 1.00 39.64  ? 228  LEU A HD12   1 
ATOM   3753  H  HD13   . LEU A 1 231 ? 61.263  38.188  -12.119 1.00 39.64  ? 228  LEU A HD13   1 
ATOM   3754  H  HD21   . LEU A 1 231 ? 61.520  41.082  -9.288  1.00 44.44  ? 228  LEU A HD21   1 
ATOM   3755  H  HD22   . LEU A 1 231 ? 60.830  39.682  -8.991  1.00 44.44  ? 228  LEU A HD22   1 
ATOM   3756  H  HD23   . LEU A 1 231 ? 62.412  39.779  -9.105  1.00 44.44  ? 228  LEU A HD23   1 
ATOM   3757  N  N      . VAL A 1 232 ? 63.679  43.185  -13.426 1.00 37.31  ? 229  VAL A N      1 
ATOM   3758  C  CA     . VAL A 1 232 ? 64.758  43.790  -14.215 1.00 43.11  ? 229  VAL A CA     1 
ATOM   3759  C  C      . VAL A 1 232 ? 64.766  45.323  -14.117 1.00 51.29  ? 229  VAL A C      1 
ATOM   3760  O  O      . VAL A 1 232 ? 65.722  45.911  -13.605 1.00 54.52  ? 229  VAL A O      1 
ATOM   3761  C  CB     . VAL A 1 232 ? 64.662  43.376  -15.701 1.00 51.32  ? 229  VAL A CB     1 
ATOM   3762  C  CG1    . VAL A 1 232 ? 65.678  44.137  -16.557 1.00 53.68  ? 229  VAL A CG1    1 
ATOM   3763  C  CG2    . VAL A 1 232 ? 64.863  41.874  -15.836 1.00 50.95  ? 229  VAL A CG2    1 
ATOM   3764  H  H      . VAL A 1 232 ? 62.906  43.221  -13.802 1.00 44.77  ? 229  VAL A H      1 
ATOM   3765  H  HA     . VAL A 1 232 ? 65.607  43.469  -13.874 1.00 51.73  ? 229  VAL A HA     1 
ATOM   3766  H  HB     . VAL A 1 232 ? 63.775  43.589  -16.030 1.00 61.59  ? 229  VAL A HB     1 
ATOM   3767  H  HG11   . VAL A 1 232 ? 66.572  43.941  -16.235 1.00 64.42  ? 229  VAL A HG11   1 
ATOM   3768  H  HG12   . VAL A 1 232 ? 65.589  43.851  -17.480 1.00 64.42  ? 229  VAL A HG12   1 
ATOM   3769  H  HG13   . VAL A 1 232 ? 65.501  45.088  -16.486 1.00 64.42  ? 229  VAL A HG13   1 
ATOM   3770  H  HG21   . VAL A 1 232 ? 64.174  41.417  -15.328 1.00 61.14  ? 229  VAL A HG21   1 
ATOM   3771  H  HG22   . VAL A 1 232 ? 64.800  41.631  -16.773 1.00 61.14  ? 229  VAL A HG22   1 
ATOM   3772  H  HG23   . VAL A 1 232 ? 65.739  41.641  -15.491 1.00 61.14  ? 229  VAL A HG23   1 
ATOM   3773  N  N      . ASN A 1 233 ? 63.717  45.974  -14.609 1.00 43.76  ? 230  ASN A N      1 
ATOM   3774  C  CA     . ASN A 1 233 ? 63.697  47.433  -14.652 1.00 53.17  ? 230  ASN A CA     1 
ATOM   3775  C  C      . ASN A 1 233 ? 63.648  48.058  -13.274 1.00 42.29  ? 230  ASN A C      1 
ATOM   3776  O  O      . ASN A 1 233 ? 64.411  48.978  -12.975 1.00 49.84  ? 230  ASN A O      1 
ATOM   3777  C  CB     . ASN A 1 233 ? 62.497  47.933  -15.460 1.00 56.70  ? 230  ASN A CB     1 
ATOM   3778  C  CG     . ASN A 1 233 ? 62.636  47.661  -16.932 1.00 59.22  ? 230  ASN A CG     1 
ATOM   3779  O  OD1    . ASN A 1 233 ? 63.747  47.511  -17.443 1.00 61.18  ? 230  ASN A OD1    1 
ATOM   3780  N  ND2    . ASN A 1 233 ? 61.503  47.597  -17.632 1.00 72.30  ? 230  ASN A ND2    1 
ATOM   3781  H  H      . ASN A 1 233 ? 63.009  45.598  -14.922 1.00 52.51  ? 230  ASN A H      1 
ATOM   3782  H  HA     . ASN A 1 233 ? 64.503  47.745  -15.092 1.00 63.80  ? 230  ASN A HA     1 
ATOM   3783  H  HB2    . ASN A 1 233 ? 61.696  47.485  -15.147 1.00 68.04  ? 230  ASN A HB2    1 
ATOM   3784  H  HB3    . ASN A 1 233 ? 62.411  48.891  -15.339 1.00 68.04  ? 230  ASN A HB3    1 
ATOM   3785  H  HD21   . ASN A 1 233 ? 60.747  47.710  -17.238 1.00 86.76  ? 230  ASN A HD21   1 
ATOM   3786  H  HD22   . ASN A 1 233 ? 61.528  47.444  -18.478 1.00 86.76  ? 230  ASN A HD22   1 
ATOM   3787  N  N      . GLN A 1 234 ? 62.753  47.555  -12.434 1.00 35.86  ? 231  GLN A N      1 
ATOM   3788  C  CA     . GLN A 1 234 ? 62.586  48.108  -11.099 1.00 41.14  ? 231  GLN A CA     1 
ATOM   3789  C  C      . GLN A 1 234 ? 63.557  47.460  -10.128 1.00 45.52  ? 231  GLN A C      1 
ATOM   3790  O  O      . GLN A 1 234 ? 64.037  48.107  -9.199  1.00 35.08  ? 231  GLN A O      1 
ATOM   3791  C  CB     . GLN A 1 234 ? 61.153  47.905  -10.625 1.00 37.73  ? 231  GLN A CB     1 
ATOM   3792  C  CG     . GLN A 1 234 ? 60.160  48.794  -11.329 1.00 34.29  ? 231  GLN A CG     1 
ATOM   3793  C  CD     . GLN A 1 234 ? 60.392  50.255  -11.017 1.00 47.16  ? 231  GLN A CD     1 
ATOM   3794  O  OE1    . GLN A 1 234 ? 60.659  50.618  -9.869  1.00 47.70  ? 231  GLN A OE1    1 
ATOM   3795  N  NE2    . GLN A 1 234 ? 60.304  51.104  -12.036 1.00 37.76  ? 231  GLN A NE2    1 
ATOM   3796  H  H      . GLN A 1 234 ? 62.231  46.895  -12.613 1.00 43.04  ? 231  GLN A H      1 
ATOM   3797  H  HA     . GLN A 1 234 ? 62.768  49.060  -11.122 1.00 49.36  ? 231  GLN A HA     1 
ATOM   3798  H  HB2    . GLN A 1 234 ? 60.895  46.984  -10.788 1.00 45.28  ? 231  GLN A HB2    1 
ATOM   3799  H  HB3    . GLN A 1 234 ? 61.105  48.099  -9.676  1.00 45.28  ? 231  GLN A HB3    1 
ATOM   3800  H  HG2    . GLN A 1 234 ? 60.246  48.672  -12.288 1.00 41.15  ? 231  GLN A HG2    1 
ATOM   3801  H  HG3    . GLN A 1 234 ? 59.263  48.562  -11.041 1.00 41.15  ? 231  GLN A HG3    1 
ATOM   3802  H  HE21   . GLN A 1 234 ? 60.123  50.812  -12.824 1.00 45.32  ? 231  GLN A HE21   1 
ATOM   3803  H  HE22   . GLN A 1 234 ? 60.429  51.945  -11.907 1.00 45.32  ? 231  GLN A HE22   1 
ATOM   3804  N  N      . ASP A 1 235 ? 63.862  46.188  -10.370 1.00 44.13  ? 232  ASP A N      1 
ATOM   3805  C  CA     . ASP A 1 235 ? 64.800  45.459  -9.539  1.00 38.61  ? 232  ASP A CA     1 
ATOM   3806  C  C      . ASP A 1 235 ? 64.331  45.529  -8.091  1.00 41.52  ? 232  ASP A C      1 
ATOM   3807  O  O      . ASP A 1 235 ? 65.065  45.991  -7.222  1.00 43.74  ? 232  ASP A O      1 
ATOM   3808  C  CB     . ASP A 1 235 ? 66.202  46.053  -9.690  1.00 36.59  ? 232  ASP A CB     1 
ATOM   3809  C  CG     . ASP A 1 235 ? 67.290  45.088  -9.299  1.00 42.95  ? 232  ASP A CG     1 
ATOM   3810  O  OD1    . ASP A 1 235 ? 66.988  44.108  -8.592  1.00 51.52  ? 232  ASP A OD1    1 
ATOM   3811  O  OD2    . ASP A 1 235 ? 68.456  45.318  -9.683  1.00 58.18  ? 232  ASP A OD2    1 
ATOM   3812  H  H      . ASP A 1 235 ? 63.533  45.725  -11.016 1.00 52.95  ? 232  ASP A H      1 
ATOM   3813  H  HA     . ASP A 1 235 ? 64.825  44.528  -9.813  1.00 46.33  ? 232  ASP A HA     1 
ATOM   3814  H  HB2    . ASP A 1 235 ? 66.342  46.302  -10.618 1.00 43.90  ? 232  ASP A HB2    1 
ATOM   3815  H  HB3    . ASP A 1 235 ? 66.277  46.836  -9.122  1.00 43.90  ? 232  ASP A HB3    1 
ATOM   3816  N  N      . ILE A 1 236 ? 63.119  45.056  -7.822  1.00 35.64  ? 233  ILE A N      1 
ATOM   3817  C  CA     . ILE A 1 236 ? 62.535  45.227  -6.495  1.00 42.56  ? 233  ILE A CA     1 
ATOM   3818  C  C      . ILE A 1 236 ? 63.206  44.386  -5.398  1.00 45.47  ? 233  ILE A C      1 
ATOM   3819  O  O      . ILE A 1 236 ? 62.844  44.492  -4.223  1.00 42.82  ? 233  ILE A O      1 
ATOM   3820  C  CB     . ILE A 1 236 ? 61.014  44.926  -6.523  1.00 34.01  ? 233  ILE A CB     1 
ATOM   3821  C  CG1    . ILE A 1 236 ? 60.740  43.493  -6.979  1.00 27.17  ? 233  ILE A CG1    1 
ATOM   3822  C  CG2    . ILE A 1 236 ? 60.300  45.920  -7.436  1.00 21.56  ? 233  ILE A CG2    1 
ATOM   3823  C  CD1    . ILE A 1 236 ? 59.288  43.079  -6.813  1.00 29.98  ? 233  ILE A CD1    1 
ATOM   3824  H  H      . ILE A 1 236 ? 62.619  44.636  -8.382  1.00 42.77  ? 233  ILE A H      1 
ATOM   3825  H  HA     . ILE A 1 236 ? 62.636  46.158  -6.241  1.00 51.07  ? 233  ILE A HA     1 
ATOM   3826  H  HB     . ILE A 1 236 ? 60.666  45.032  -5.624  1.00 40.81  ? 233  ILE A HB     1 
ATOM   3827  H  HG12   . ILE A 1 236 ? 60.968  43.413  -7.918  1.00 32.60  ? 233  ILE A HG12   1 
ATOM   3828  H  HG13   . ILE A 1 236 ? 61.285  42.886  -6.454  1.00 32.60  ? 233  ILE A HG13   1 
ATOM   3829  H  HG21   . ILE A 1 236 ? 60.661  45.841  -8.332  1.00 25.87  ? 233  ILE A HG21   1 
ATOM   3830  H  HG22   . ILE A 1 236 ? 59.351  45.718  -7.441  1.00 25.87  ? 233  ILE A HG22   1 
ATOM   3831  H  HG23   . ILE A 1 236 ? 60.445  46.818  -7.098  1.00 25.87  ? 233  ILE A HG23   1 
ATOM   3832  H  HD11   . ILE A 1 236 ? 58.730  43.671  -7.341  1.00 35.98  ? 233  ILE A HD11   1 
ATOM   3833  H  HD12   . ILE A 1 236 ? 59.184  42.165  -7.120  1.00 35.98  ? 233  ILE A HD12   1 
ATOM   3834  H  HD13   . ILE A 1 236 ? 59.047  43.144  -5.876  1.00 35.98  ? 233  ILE A HD13   1 
ATOM   3835  N  N      . LEU A 1 237 ? 64.184  43.570  -5.779  1.00 35.03  ? 234  LEU A N      1 
ATOM   3836  C  CA     . LEU A 1 237 ? 64.937  42.756  -4.824  1.00 36.08  ? 234  LEU A CA     1 
ATOM   3837  C  C      . LEU A 1 237 ? 66.432  42.992  -4.993  1.00 40.16  ? 234  LEU A C      1 
ATOM   3838  O  O      . LEU A 1 237 ? 67.240  42.089  -4.782  1.00 40.73  ? 234  LEU A O      1 
ATOM   3839  C  CB     . LEU A 1 237 ? 64.628  41.270  -4.996  1.00 26.03  ? 234  LEU A CB     1 
ATOM   3840  C  CG     . LEU A 1 237 ? 63.193  40.836  -4.735  1.00 23.45  ? 234  LEU A CG     1 
ATOM   3841  C  CD1    . LEU A 1 237 ? 63.091  39.344  -4.941  1.00 34.49  ? 234  LEU A CD1    1 
ATOM   3842  C  CD2    . LEU A 1 237 ? 62.720  41.203  -3.350  1.00 23.74  ? 234  LEU A CD2    1 
ATOM   3843  H  H      . LEU A 1 237 ? 64.435  43.467  -6.595  1.00 42.04  ? 234  LEU A H      1 
ATOM   3844  H  HA     . LEU A 1 237 ? 64.690  43.014  -3.922  1.00 43.29  ? 234  LEU A HA     1 
ATOM   3845  H  HB2    . LEU A 1 237 ? 64.842  41.020  -5.908  1.00 31.24  ? 234  LEU A HB2    1 
ATOM   3846  H  HB3    . LEU A 1 237 ? 65.193  40.771  -4.386  1.00 31.24  ? 234  LEU A HB3    1 
ATOM   3847  H  HG     . LEU A 1 237 ? 62.609  41.270  -5.377  1.00 28.14  ? 234  LEU A HG     1 
ATOM   3848  H  HD11   . LEU A 1 237 ? 63.690  38.899  -4.322  1.00 41.38  ? 234  LEU A HD11   1 
ATOM   3849  H  HD12   . LEU A 1 237 ? 62.177  39.065  -4.776  1.00 41.38  ? 234  LEU A HD12   1 
ATOM   3850  H  HD13   . LEU A 1 237 ? 63.341  39.134  -5.854  1.00 41.38  ? 234  LEU A HD13   1 
ATOM   3851  H  HD21   . LEU A 1 237 ? 62.770  42.166  -3.244  1.00 28.49  ? 234  LEU A HD21   1 
ATOM   3852  H  HD22   . LEU A 1 237 ? 61.804  40.904  -3.240  1.00 28.49  ? 234  LEU A HD22   1 
ATOM   3853  H  HD23   . LEU A 1 237 ? 63.291  40.769  -2.697  1.00 28.49  ? 234  LEU A HD23   1 
ATOM   3854  N  N      . GLU A 1 238 ? 66.797  44.207  -5.376  1.00 37.38  ? 235  GLU A N      1 
ATOM   3855  C  CA     . GLU A 1 238 ? 68.190  44.528  -5.654  1.00 45.00  ? 235  GLU A CA     1 
ATOM   3856  C  C      . GLU A 1 238 ? 69.027  44.364  -4.396  1.00 47.52  ? 235  GLU A C      1 
ATOM   3857  O  O      . GLU A 1 238 ? 70.033  43.656  -4.401  1.00 52.97  ? 235  GLU A O      1 
ATOM   3858  C  CB     . GLU A 1 238 ? 68.302  45.960  -6.179  1.00 54.27  ? 235  GLU A CB     1 
ATOM   3859  C  CG     . GLU A 1 238 ? 69.694  46.390  -6.604  1.00 53.42  ? 235  GLU A CG     1 
ATOM   3860  C  CD     . GLU A 1 238 ? 69.782  47.883  -6.837  1.00 73.19  ? 235  GLU A CD     1 
ATOM   3861  O  OE1    . GLU A 1 238 ? 68.809  48.458  -7.371  1.00 73.37  ? 235  GLU A OE1    1 
ATOM   3862  O  OE2    . GLU A 1 238 ? 70.820  48.484  -6.492  1.00 83.71  ? 235  GLU A OE2    1 
ATOM   3863  H  H      . GLU A 1 238 ? 66.255  44.867  -5.484  1.00 44.86  ? 235  GLU A H      1 
ATOM   3864  H  HA     . GLU A 1 238 ? 68.532  43.924  -6.332  1.00 54.01  ? 235  GLU A HA     1 
ATOM   3865  H  HB2    . GLU A 1 238 ? 67.721  46.051  -6.950  1.00 65.13  ? 235  GLU A HB2    1 
ATOM   3866  H  HB3    . GLU A 1 238 ? 68.011  46.567  -5.481  1.00 65.13  ? 235  GLU A HB3    1 
ATOM   3867  H  HG2    . GLU A 1 238 ? 70.327  46.155  -5.907  1.00 64.10  ? 235  GLU A HG2    1 
ATOM   3868  H  HG3    . GLU A 1 238 ? 69.927  45.941  -7.432  1.00 64.10  ? 235  GLU A HG3    1 
ATOM   3869  N  N      . ASN A 1 239 ? 68.594  45.014  -3.322  1.00 44.77  ? 236  ASN A N      1 
ATOM   3870  C  CA     . ASN A 1 239 ? 69.337  45.026  -2.072  1.00 38.29  ? 236  ASN A CA     1 
ATOM   3871  C  C      . ASN A 1 239 ? 68.410  44.883  -0.871  1.00 46.67  ? 236  ASN A C      1 
ATOM   3872  O  O      . ASN A 1 239 ? 67.194  44.752  -1.018  1.00 40.61  ? 236  ASN A O      1 
ATOM   3873  C  CB     . ASN A 1 239 ? 70.119  46.327  -1.940  1.00 45.41  ? 236  ASN A CB     1 
ATOM   3874  C  CG     . ASN A 1 239 ? 69.269  47.536  -2.249  1.00 45.99  ? 236  ASN A CG     1 
ATOM   3875  O  OD1    . ASN A 1 239 ? 68.258  47.777  -1.588  1.00 44.93  ? 236  ASN A OD1    1 
ATOM   3876  N  ND2    . ASN A 1 239 ? 69.677  48.315  -3.242  1.00 56.43  ? 236  ASN A ND2    1 
ATOM   3877  H  H      . ASN A 1 239 ? 67.860  45.463  -3.293  1.00 53.72  ? 236  ASN A H      1 
ATOM   3878  H  HA     . ASN A 1 239 ? 69.966  44.288  -2.064  1.00 45.95  ? 236  ASN A HA     1 
ATOM   3879  H  HB2    . ASN A 1 239 ? 70.445  46.412  -1.031  1.00 54.49  ? 236  ASN A HB2    1 
ATOM   3880  H  HB3    . ASN A 1 239 ? 70.864  46.315  -2.562  1.00 54.49  ? 236  ASN A HB3    1 
ATOM   3881  H  HD21   . ASN A 1 239 ? 70.395  48.121  -3.674  1.00 67.72  ? 236  ASN A HD21   1 
ATOM   3882  H  HD22   . ASN A 1 239 ? 69.225  49.015  -3.453  1.00 67.72  ? 236  ASN A HD22   1 
ATOM   3883  N  N      . LYS A 1 240 ? 68.992  44.922  0.323   1.00 49.32  ? 237  LYS A N      1 
ATOM   3884  C  CA     . LYS A 1 240 ? 68.233  44.714  1.546   1.00 39.40  ? 237  LYS A CA     1 
ATOM   3885  C  C      . LYS A 1 240 ? 67.229  45.837  1.778   1.00 44.61  ? 237  LYS A C      1 
ATOM   3886  O  O      . LYS A 1 240 ? 66.125  45.593  2.274   1.00 36.45  ? 237  LYS A O      1 
ATOM   3887  C  CB     . LYS A 1 240 ? 69.161  44.578  2.748   1.00 49.18  ? 237  LYS A CB     1 
ATOM   3888  C  CG     . LYS A 1 240 ? 68.435  44.127  4.002   1.00 63.53  ? 237  LYS A CG     1 
ATOM   3889  C  CD     . LYS A 1 240 ? 69.379  43.920  5.168   1.00 51.45  ? 237  LYS A CD     1 
ATOM   3890  C  CE     . LYS A 1 240 ? 68.616  43.527  6.420   1.00 49.62  ? 237  LYS A CE     1 
ATOM   3891  N  NZ     . LYS A 1 240 ? 67.732  44.629  6.887   1.00 47.60  ? 237  LYS A NZ     1 
ATOM   3892  H  H      . LYS A 1 240 ? 69.830  45.067  0.450   1.00 59.18  ? 237  LYS A H      1 
ATOM   3893  H  HA     . LYS A 1 240 ? 67.734  43.886  1.465   1.00 47.28  ? 237  LYS A HA     1 
ATOM   3894  H  HB2    . LYS A 1 240 ? 69.846  43.921  2.545   1.00 59.02  ? 237  LYS A HB2    1 
ATOM   3895  H  HB3    . LYS A 1 240 ? 69.570  45.438  2.931   1.00 59.02  ? 237  LYS A HB3    1 
ATOM   3896  H  HG2    . LYS A 1 240 ? 67.787  44.803  4.255   1.00 76.24  ? 237  LYS A HG2    1 
ATOM   3897  H  HG3    . LYS A 1 240 ? 67.986  43.285  3.824   1.00 76.24  ? 237  LYS A HG3    1 
ATOM   3898  H  HD2    . LYS A 1 240 ? 70.004  43.209  4.955   1.00 61.74  ? 237  LYS A HD2    1 
ATOM   3899  H  HD3    . LYS A 1 240 ? 69.855  44.746  5.347   1.00 61.74  ? 237  LYS A HD3    1 
ATOM   3900  H  HE2    . LYS A 1 240 ? 68.062  42.754  6.228   1.00 59.55  ? 237  LYS A HE2    1 
ATOM   3901  H  HE3    . LYS A 1 240 ? 69.246  43.322  7.128   1.00 59.55  ? 237  LYS A HE3    1 
ATOM   3902  H  HZ1    . LYS A 1 240 ? 67.141  44.834  6.254   1.00 57.12  ? 237  LYS A HZ1    1 
ATOM   3903  H  HZ2    . LYS A 1 240 ? 67.294  44.377  7.620   1.00 57.12  ? 237  LYS A HZ2    1 
ATOM   3904  H  HZ3    . LYS A 1 240 ? 68.218  45.351  7.073   1.00 57.12  ? 237  LYS A HZ3    1 
ATOM   3905  N  N      . GLU A 1 241 ? 67.604  47.064  1.427   1.00 44.69  ? 238  GLU A N      1 
ATOM   3906  C  CA     . GLU A 1 241 ? 66.701  48.191  1.621   1.00 45.22  ? 238  GLU A CA     1 
ATOM   3907  C  C      . GLU A 1 241 ? 65.429  47.936  0.841   1.00 51.77  ? 238  GLU A C      1 
ATOM   3908  O  O      . GLU A 1 241 ? 64.337  48.249  1.312   1.00 52.86  ? 238  GLU A O      1 
ATOM   3909  C  CB     . GLU A 1 241 ? 67.332  49.511  1.176   1.00 44.87  ? 238  GLU A CB     1 
ATOM   3910  C  CG     . GLU A 1 241 ? 66.363  50.699  1.235   1.00 52.57  ? 238  GLU A CG     1 
ATOM   3911  C  CD     . GLU A 1 241 ? 66.876  51.934  0.516   1.00 90.76  ? 238  GLU A CD     1 
ATOM   3912  O  OE1    . GLU A 1 241 ? 67.882  51.836  -0.220  1.00 93.64  ? 238  GLU A OE1    1 
ATOM   3913  O  OE2    . GLU A 1 241 ? 66.257  53.007  0.677   1.00 96.49  ? 238  GLU A OE2    1 
ATOM   3914  H  H      . GLU A 1 241 ? 68.364  47.268  1.079   1.00 53.63  ? 238  GLU A H      1 
ATOM   3915  H  HA     . GLU A 1 241 ? 66.474  48.262  2.562   1.00 54.27  ? 238  GLU A HA     1 
ATOM   3916  H  HB2    . GLU A 1 241 ? 68.084  49.710  1.755   1.00 53.84  ? 238  GLU A HB2    1 
ATOM   3917  H  HB3    . GLU A 1 241 ? 67.637  49.420  0.260   1.00 53.84  ? 238  GLU A HB3    1 
ATOM   3918  H  HG2    . GLU A 1 241 ? 65.525  50.440  0.822   1.00 63.09  ? 238  GLU A HG2    1 
ATOM   3919  H  HG3    . GLU A 1 241 ? 66.213  50.935  2.164   1.00 63.09  ? 238  GLU A HG3    1 
ATOM   3920  N  N      . SER A 1 242 ? 65.574  47.357  -0.348  1.00 42.93  ? 239  SER A N      1 
ATOM   3921  C  CA     . SER A 1 242 ? 64.423  47.127  -1.206  1.00 43.90  ? 239  SER A CA     1 
ATOM   3922  C  C      . SER A 1 242 ? 63.690  45.845  -0.832  1.00 43.46  ? 239  SER A C      1 
ATOM   3923  O  O      . SER A 1 242 ? 62.464  45.863  -0.719  1.00 38.57  ? 239  SER A O      1 
ATOM   3924  C  CB     . SER A 1 242 ? 64.835  47.080  -2.678  1.00 46.99  ? 239  SER A CB     1 
ATOM   3925  O  OG     . SER A 1 242 ? 66.026  46.340  -2.850  1.00 65.87  ? 239  SER A OG     1 
ATOM   3926  H  H      . SER A 1 242 ? 66.322  47.091  -0.676  1.00 51.52  ? 239  SER A H      1 
ATOM   3927  H  HA     . SER A 1 242 ? 63.802  47.864  -1.097  1.00 52.68  ? 239  SER A HA     1 
ATOM   3928  H  HB2    . SER A 1 242 ? 64.126  46.659  -3.190  1.00 56.39  ? 239  SER A HB2    1 
ATOM   3929  H  HB3    . SER A 1 242 ? 64.978  47.986  -2.994  1.00 56.39  ? 239  SER A HB3    1 
ATOM   3930  H  HG     . SER A 1 242 ? 65.917  45.552  -2.580  1.00 79.04  ? 239  SER A HG     1 
ATOM   3931  N  N      . TRP A 1 243 ? 64.401  44.735  -0.616  1.00 37.07  ? 240  TRP A N      1 
ATOM   3932  C  CA     . TRP A 1 243 ? 63.674  43.483  -0.416  1.00 26.84  ? 240  TRP A CA     1 
ATOM   3933  C  C      . TRP A 1 243 ? 63.033  43.413  0.954   1.00 37.40  ? 240  TRP A C      1 
ATOM   3934  O  O      . TRP A 1 243 ? 62.151  42.582  1.164   1.00 34.92  ? 240  TRP A O      1 
ATOM   3935  C  CB     . TRP A 1 243 ? 64.536  42.221  -0.605  1.00 26.76  ? 240  TRP A CB     1 
ATOM   3936  C  CG     . TRP A 1 243 ? 65.696  41.982  0.332   1.00 35.80  ? 240  TRP A CG     1 
ATOM   3937  C  CD1    . TRP A 1 243 ? 65.637  41.783  1.687   1.00 50.95  ? 240  TRP A CD1    1 
ATOM   3938  C  CD2    . TRP A 1 243 ? 67.060  41.741  -0.039  1.00 38.49  ? 240  TRP A CD2    1 
ATOM   3939  N  NE1    . TRP A 1 243 ? 66.890  41.519  2.187   1.00 34.74  ? 240  TRP A NE1    1 
ATOM   3940  C  CE2    . TRP A 1 243 ? 67.778  41.469  1.145   1.00 34.17  ? 240  TRP A CE2    1 
ATOM   3941  C  CE3    . TRP A 1 243 ? 67.747  41.754  -1.254  1.00 36.54  ? 240  TRP A CE3    1 
ATOM   3942  C  CZ2    . TRP A 1 243 ? 69.146  41.240  1.146   1.00 33.60  ? 240  TRP A CZ2    1 
ATOM   3943  C  CZ3    . TRP A 1 243 ? 69.104  41.521  -1.249  1.00 38.65  ? 240  TRP A CZ3    1 
ATOM   3944  C  CH2    . TRP A 1 243 ? 69.789  41.264  -0.059  1.00 41.52  ? 240  TRP A CH2    1 
ATOM   3945  H  H      . TRP A 1 243 ? 65.259  44.681  -0.581  1.00 44.49  ? 240  TRP A H      1 
ATOM   3946  H  HA     . TRP A 1 243 ? 62.959  43.442  -1.071  1.00 32.20  ? 240  TRP A HA     1 
ATOM   3947  H  HB2    . TRP A 1 243 ? 63.952  41.450  -0.528  1.00 32.11  ? 240  TRP A HB2    1 
ATOM   3948  H  HB3    . TRP A 1 243 ? 64.904  42.247  -1.503  1.00 32.11  ? 240  TRP A HB3    1 
ATOM   3949  H  HD1    . TRP A 1 243 ? 64.864  41.857  2.200   1.00 61.14  ? 240  TRP A HD1    1 
ATOM   3950  H  HE1    . TRP A 1 243 ? 67.081  41.383  3.014   1.00 41.69  ? 240  TRP A HE1    1 
ATOM   3951  H  HE3    . TRP A 1 243 ? 67.299  41.930  -2.050  1.00 43.85  ? 240  TRP A HE3    1 
ATOM   3952  H  HZ2    . TRP A 1 243 ? 69.606  41.068  1.936   1.00 40.32  ? 240  TRP A HZ2    1 
ATOM   3953  H  HZ3    . TRP A 1 243 ? 69.572  41.532  -2.052  1.00 46.38  ? 240  TRP A HZ3    1 
ATOM   3954  H  HH2    . TRP A 1 243 ? 70.705  41.109  -0.088  1.00 49.82  ? 240  TRP A HH2    1 
ATOM   3955  N  N      . ASP A 1 244 ? 63.439  44.286  1.875   1.00 42.05  ? 241  ASP A N      1 
ATOM   3956  C  CA     . ASP A 1 244 ? 62.789  44.324  3.178   1.00 32.20  ? 241  ASP A CA     1 
ATOM   3957  C  C      . ASP A 1 244 ? 61.351  44.756  2.985   1.00 34.32  ? 241  ASP A C      1 
ATOM   3958  O  O      . ASP A 1 244 ? 60.450  44.295  3.684   1.00 27.35  ? 241  ASP A O      1 
ATOM   3959  C  CB     . ASP A 1 244 ? 63.486  45.293  4.136   1.00 45.19  ? 241  ASP A CB     1 
ATOM   3960  C  CG     . ASP A 1 244 ? 64.727  44.701  4.781   1.00 54.19  ? 241  ASP A CG     1 
ATOM   3961  O  OD1    . ASP A 1 244 ? 64.880  43.460  4.798   1.00 53.60  ? 241  ASP A OD1    1 
ATOM   3962  O  OD2    . ASP A 1 244 ? 65.545  45.494  5.300   1.00 45.07  ? 241  ASP A OD2    1 
ATOM   3963  H  H      . ASP A 1 244 ? 64.076  44.855  1.771   1.00 50.46  ? 241  ASP A H      1 
ATOM   3964  H  HA     . ASP A 1 244 ? 62.797  43.438  3.573   1.00 38.64  ? 241  ASP A HA     1 
ATOM   3965  H  HB2    . ASP A 1 244 ? 63.754  46.085  3.643   1.00 54.23  ? 241  ASP A HB2    1 
ATOM   3966  H  HB3    . ASP A 1 244 ? 62.869  45.536  4.843   1.00 54.23  ? 241  ASP A HB3    1 
ATOM   3967  N  N      . LYS A 1 245 ? 61.141  45.626  2.005   1.00 40.55  ? 242  LYS A N      1 
ATOM   3968  C  CA     . LYS A 1 245 ? 59.803  46.071  1.666   1.00 35.17  ? 242  LYS A CA     1 
ATOM   3969  C  C      . LYS A 1 245 ? 58.951  44.890  1.231   1.00 40.62  ? 242  LYS A C      1 
ATOM   3970  O  O      . LYS A 1 245 ? 57.774  44.808  1.583   1.00 41.14  ? 242  LYS A O      1 
ATOM   3971  C  CB     . LYS A 1 245 ? 59.854  47.130  0.563   1.00 29.98  ? 242  LYS A CB     1 
ATOM   3972  C  CG     . LYS A 1 245 ? 60.599  48.396  0.954   1.00 26.04  ? 242  LYS A CG     1 
ATOM   3973  C  CD     . LYS A 1 245 ? 60.875  49.278  -0.246  1.00 38.26  ? 242  LYS A CD     1 
ATOM   3974  C  CE     . LYS A 1 245 ? 61.685  50.506  0.122   1.00 39.80  ? 242  LYS A CE     1 
ATOM   3975  N  NZ     . LYS A 1 245 ? 61.981  51.335  -1.078  1.00 68.86  ? 242  LYS A NZ     1 
ATOM   3976  H  H      . LYS A 1 245 ? 61.761  45.973  1.521   1.00 48.66  ? 242  LYS A H      1 
ATOM   3977  H  HA     . LYS A 1 245 ? 59.392  46.470  2.449   1.00 42.21  ? 242  LYS A HA     1 
ATOM   3978  H  HB2    . LYS A 1 245 ? 60.300  46.752  -0.211  1.00 35.98  ? 242  LYS A HB2    1 
ATOM   3979  H  HB3    . LYS A 1 245 ? 58.947  47.381  0.330   1.00 35.98  ? 242  LYS A HB3    1 
ATOM   3980  H  HG2    . LYS A 1 245 ? 60.062  48.901  1.584   1.00 31.25  ? 242  LYS A HG2    1 
ATOM   3981  H  HG3    . LYS A 1 245 ? 61.449  48.156  1.355   1.00 31.25  ? 242  LYS A HG3    1 
ATOM   3982  H  HD2    . LYS A 1 245 ? 61.377  48.772  -0.904  1.00 45.91  ? 242  LYS A HD2    1 
ATOM   3983  H  HD3    . LYS A 1 245 ? 60.033  49.575  -0.623  1.00 45.91  ? 242  LYS A HD3    1 
ATOM   3984  H  HE2    . LYS A 1 245 ? 61.181  51.047  0.750   1.00 47.76  ? 242  LYS A HE2    1 
ATOM   3985  H  HE3    . LYS A 1 245 ? 62.527  50.229  0.516   1.00 47.76  ? 242  LYS A HE3    1 
ATOM   3986  H  HZ1    . LYS A 1 245 ? 61.221  51.603  -1.457  1.00 82.64  ? 242  LYS A HZ1    1 
ATOM   3987  H  HZ2    . LYS A 1 245 ? 62.456  52.050  -0.844  1.00 82.64  ? 242  LYS A HZ2    1 
ATOM   3988  H  HZ3    . LYS A 1 245 ? 62.446  50.859  -1.669  1.00 82.64  ? 242  LYS A HZ3    1 
ATOM   3989  N  N      . ILE A 1 246 ? 59.550  43.969  0.479   1.00 33.23  ? 243  ILE A N      1 
ATOM   3990  C  CA     . ILE A 1 246 ? 58.840  42.763  0.062   1.00 33.93  ? 243  ILE A CA     1 
ATOM   3991  C  C      . ILE A 1 246 ? 58.624  41.819  1.236   1.00 29.85  ? 243  ILE A C      1 
ATOM   3992  O  O      . ILE A 1 246 ? 57.565  41.206  1.365   1.00 33.04  ? 243  ILE A O      1 
ATOM   3993  C  CB     . ILE A 1 246 ? 59.585  41.997  -1.053  1.00 32.69  ? 243  ILE A CB     1 
ATOM   3994  C  CG1    . ILE A 1 246 ? 59.931  42.938  -2.214  1.00 28.93  ? 243  ILE A CG1    1 
ATOM   3995  C  CG2    . ILE A 1 246 ? 58.761  40.793  -1.520  1.00 27.40  ? 243  ILE A CG2    1 
ATOM   3996  C  CD1    . ILE A 1 246 ? 58.780  43.267  -3.105  1.00 28.04  ? 243  ILE A CD1    1 
ATOM   3997  H  H      . ILE A 1 246 ? 60.362  44.018  0.198   1.00 39.87  ? 243  ILE A H      1 
ATOM   3998  H  HA     . ILE A 1 246 ? 57.969  43.016  -0.282  1.00 40.71  ? 243  ILE A HA     1 
ATOM   3999  H  HB     . ILE A 1 246 ? 60.417  41.663  -0.682  1.00 39.23  ? 243  ILE A HB     1 
ATOM   4000  H  HG12   . ILE A 1 246 ? 60.269  43.771  -1.849  1.00 34.72  ? 243  ILE A HG12   1 
ATOM   4001  H  HG13   . ILE A 1 246 ? 60.616  42.519  -2.759  1.00 34.72  ? 243  ILE A HG13   1 
ATOM   4002  H  HG21   . ILE A 1 246 ? 57.910  41.108  -1.863  1.00 32.88  ? 243  ILE A HG21   1 
ATOM   4003  H  HG22   . ILE A 1 246 ? 59.248  40.329  -2.219  1.00 32.88  ? 243  ILE A HG22   1 
ATOM   4004  H  HG23   . ILE A 1 246 ? 58.615  40.200  -0.767  1.00 32.88  ? 243  ILE A HG23   1 
ATOM   4005  H  HD11   . ILE A 1 246 ? 58.089  43.701  -2.580  1.00 33.64  ? 243  ILE A HD11   1 
ATOM   4006  H  HD12   . ILE A 1 246 ? 59.085  43.863  -3.808  1.00 33.64  ? 243  ILE A HD12   1 
ATOM   4007  H  HD13   . ILE A 1 246 ? 58.436  42.447  -3.493  1.00 33.64  ? 243  ILE A HD13   1 
ATOM   4008  N  N      . LEU A 1 247 ? 59.625  41.717  2.102   1.00 32.44  ? 244  LEU A N      1 
ATOM   4009  C  CA     . LEU A 1 247 ? 59.525  40.851  3.269   1.00 28.87  ? 244  LEU A CA     1 
ATOM   4010  C  C      . LEU A 1 247 ? 58.443  41.327  4.224   1.00 26.24  ? 244  LEU A C      1 
ATOM   4011  O  O      . LEU A 1 247 ? 57.886  40.534  4.976   1.00 35.53  ? 244  LEU A O      1 
ATOM   4012  C  CB     . LEU A 1 247 ? 60.867  40.763  3.993   1.00 23.85  ? 244  LEU A CB     1 
ATOM   4013  C  CG     . LEU A 1 247 ? 61.956  39.934  3.306   1.00 31.51  ? 244  LEU A CG     1 
ATOM   4014  C  CD1    . LEU A 1 247 ? 63.169  39.835  4.214   1.00 44.94  ? 244  LEU A CD1    1 
ATOM   4015  C  CD2    . LEU A 1 247 ? 61.467  38.540  2.926   1.00 20.57  ? 244  LEU A CD2    1 
ATOM   4016  H  H      . LEU A 1 247 ? 60.372  42.138  2.037   1.00 38.93  ? 244  LEU A H      1 
ATOM   4017  H  HA     . LEU A 1 247 ? 59.288  39.957  2.975   1.00 34.65  ? 244  LEU A HA     1 
ATOM   4018  H  HB2    . LEU A 1 247 ? 61.214  41.663  4.100   1.00 28.62  ? 244  LEU A HB2    1 
ATOM   4019  H  HB3    . LEU A 1 247 ? 60.716  40.372  4.868   1.00 28.62  ? 244  LEU A HB3    1 
ATOM   4020  H  HG     . LEU A 1 247 ? 62.229  40.387  2.493   1.00 37.81  ? 244  LEU A HG     1 
ATOM   4021  H  HD11   . LEU A 1 247 ? 62.907  39.407  5.044   1.00 53.93  ? 244  LEU A HD11   1 
ATOM   4022  H  HD12   . LEU A 1 247 ? 63.852  39.309  3.770   1.00 53.93  ? 244  LEU A HD12   1 
ATOM   4023  H  HD13   . LEU A 1 247 ? 63.502  40.728  4.393   1.00 53.93  ? 244  LEU A HD13   1 
ATOM   4024  H  HD21   . LEU A 1 247 ? 60.717  38.625  2.316   1.00 24.69  ? 244  LEU A HD21   1 
ATOM   4025  H  HD22   . LEU A 1 247 ? 62.191  38.058  2.496   1.00 24.69  ? 244  LEU A HD22   1 
ATOM   4026  H  HD23   . LEU A 1 247 ? 61.189  38.073  3.730   1.00 24.69  ? 244  LEU A HD23   1 
ATOM   4027  N  N      . ALA A 1 248 ? 58.134  42.615  4.182   1.00 21.95  ? 245  ALA A N      1 
ATOM   4028  C  CA     . ALA A 1 248 ? 57.081  43.165  5.020   1.00 17.52  ? 245  ALA A CA     1 
ATOM   4029  C  C      . ALA A 1 248 ? 55.710  42.664  4.590   1.00 25.57  ? 245  ALA A C      1 
ATOM   4030  O  O      . ALA A 1 248 ? 54.745  42.778  5.344   1.00 27.04  ? 245  ALA A O      1 
ATOM   4031  C  CB     . ALA A 1 248 ? 57.118  44.678  4.981   1.00 22.61  ? 245  ALA A CB     1 
ATOM   4032  H  H      . ALA A 1 248 ? 58.520  43.193  3.675   1.00 26.34  ? 245  ALA A H      1 
ATOM   4033  H  HA     . ALA A 1 248 ? 57.229  42.885  5.937   1.00 21.03  ? 245  ALA A HA     1 
ATOM   4034  H  HB1    . ALA A 1 248 ? 56.988  44.973  4.066   1.00 27.13  ? 245  ALA A HB1    1 
ATOM   4035  H  HB2    . ALA A 1 248 ? 56.410  45.026  5.545   1.00 27.13  ? 245  ALA A HB2    1 
ATOM   4036  H  HB3    . ALA A 1 248 ? 57.980  44.981  5.306   1.00 27.13  ? 245  ALA A HB3    1 
ATOM   4037  N  N      . LEU A 1 249 ? 55.619  42.127  3.373   1.00 31.31  ? 246  LEU A N      1 
ATOM   4038  C  CA     . LEU A 1 249 ? 54.343  41.670  2.819   1.00 27.97  ? 246  LEU A CA     1 
ATOM   4039  C  C      . LEU A 1 249 ? 54.117  40.172  3.004   1.00 39.68  ? 246  LEU A C      1 
ATOM   4040  O  O      . LEU A 1 249 ? 53.097  39.644  2.558   1.00 26.25  ? 246  LEU A O      1 
ATOM   4041  C  CB     . LEU A 1 249 ? 54.253  42.018  1.338   1.00 29.75  ? 246  LEU A CB     1 
ATOM   4042  C  CG     . LEU A 1 249 ? 54.624  43.455  0.984   1.00 25.67  ? 246  LEU A CG     1 
ATOM   4043  C  CD1    . LEU A 1 249 ? 54.427  43.686  -0.507  1.00 21.91  ? 246  LEU A CD1    1 
ATOM   4044  C  CD2    . LEU A 1 249 ? 53.786  44.424  1.804   1.00 23.93  ? 246  LEU A CD2    1 
ATOM   4045  H  H      . LEU A 1 249 ? 56.288  42.016  2.843   1.00 37.57  ? 246  LEU A H      1 
ATOM   4046  H  HA     . LEU A 1 249 ? 53.623  42.134  3.275   1.00 33.57  ? 246  LEU A HA     1 
ATOM   4047  H  HB2    . LEU A 1 249 ? 54.851  41.433  0.848   1.00 35.70  ? 246  LEU A HB2    1 
ATOM   4048  H  HB3    . LEU A 1 249 ? 53.341  41.871  1.043   1.00 35.70  ? 246  LEU A HB3    1 
ATOM   4049  H  HG     . LEU A 1 249 ? 55.558  43.607  1.195   1.00 30.80  ? 246  LEU A HG     1 
ATOM   4050  H  HD11   . LEU A 1 249 ? 53.497  43.526  -0.731  1.00 26.29  ? 246  LEU A HD11   1 
ATOM   4051  H  HD12   . LEU A 1 249 ? 54.666  44.602  -0.719  1.00 26.29  ? 246  LEU A HD12   1 
ATOM   4052  H  HD13   . LEU A 1 249 ? 54.996  43.074  -0.999  1.00 26.29  ? 246  LEU A HD13   1 
ATOM   4053  H  HD21   . LEU A 1 249 ? 53.956  44.268  2.746   1.00 28.71  ? 246  LEU A HD21   1 
ATOM   4054  H  HD22   . LEU A 1 249 ? 54.033  45.332  1.568   1.00 28.71  ? 246  LEU A HD22   1 
ATOM   4055  H  HD23   . LEU A 1 249 ? 52.848  44.274  1.607   1.00 28.71  ? 246  LEU A HD23   1 
ATOM   4056  N  N      . VAL A 1 250 ? 55.080  39.491  3.626   1.00 38.70  ? 247  VAL A N      1 
ATOM   4057  C  CA     . VAL A 1 250 ? 54.981  38.053  3.867   1.00 28.99  ? 247  VAL A CA     1 
ATOM   4058  C  C      . VAL A 1 250 ? 55.155  37.757  5.354   1.00 32.74  ? 247  VAL A C      1 
ATOM   4059  O  O      . VAL A 1 250 ? 55.733  38.572  6.069   1.00 41.07  ? 247  VAL A O      1 
ATOM   4060  C  CB     . VAL A 1 250 ? 56.036  37.283  3.068   1.00 34.35  ? 247  VAL A CB     1 
ATOM   4061  C  CG1    . VAL A 1 250 ? 55.873  37.569  1.574   1.00 28.10  ? 247  VAL A CG1    1 
ATOM   4062  C  CG2    . VAL A 1 250 ? 57.433  37.668  3.522   1.00 22.28  ? 247  VAL A CG2    1 
ATOM   4063  H  H      . VAL A 1 250 ? 55.806  39.844  3.921   1.00 46.44  ? 247  VAL A H      1 
ATOM   4064  H  HA     . VAL A 1 250 ? 54.104  37.741  3.595   1.00 34.79  ? 247  VAL A HA     1 
ATOM   4065  H  HB     . VAL A 1 250 ? 55.918  36.331  3.212   1.00 41.22  ? 247  VAL A HB     1 
ATOM   4066  H  HG11   . VAL A 1 250 ? 55.984  38.520  1.421   1.00 33.71  ? 247  VAL A HG11   1 
ATOM   4067  H  HG12   . VAL A 1 250 ? 56.548  37.074  1.083   1.00 33.71  ? 247  VAL A HG12   1 
ATOM   4068  H  HG13   . VAL A 1 250 ? 54.988  37.289  1.294   1.00 33.71  ? 247  VAL A HG13   1 
ATOM   4069  H  HG21   . VAL A 1 250 ? 57.529  37.455  4.463   1.00 26.74  ? 247  VAL A HG21   1 
ATOM   4070  H  HG22   . VAL A 1 250 ? 58.082  37.168  3.002   1.00 26.74  ? 247  VAL A HG22   1 
ATOM   4071  H  HG23   . VAL A 1 250 ? 57.559  38.619  3.382   1.00 26.74  ? 247  VAL A HG23   1 
ATOM   4072  N  N      . PRO A 1 251 ? 54.646  36.603  5.831   1.00 41.66  ? 248  PRO A N      1 
ATOM   4073  C  CA     . PRO A 1 251 ? 54.718  36.243  7.258   1.00 25.22  ? 248  PRO A CA     1 
ATOM   4074  C  C      . PRO A 1 251 ? 56.139  36.221  7.808   1.00 33.61  ? 248  PRO A C      1 
ATOM   4075  O  O      . PRO A 1 251 ? 57.054  35.844  7.081   1.00 35.77  ? 248  PRO A O      1 
ATOM   4076  C  CB     . PRO A 1 251 ? 54.127  34.836  7.300   1.00 20.72  ? 248  PRO A CB     1 
ATOM   4077  C  CG     . PRO A 1 251 ? 53.251  34.753  6.122   1.00 39.85  ? 248  PRO A CG     1 
ATOM   4078  C  CD     . PRO A 1 251 ? 53.906  35.592  5.058   1.00 39.63  ? 248  PRO A CD     1 
ATOM   4079  H  HA     . PRO A 1 251 ? 54.171  36.842  7.790   1.00 30.26  ? 248  PRO A HA     1 
ATOM   4080  H  HB2    . PRO A 1 251 ? 54.840  34.181  7.244   1.00 24.86  ? 248  PRO A HB2    1 
ATOM   4081  H  HB3    . PRO A 1 251 ? 53.616  34.720  8.116   1.00 24.86  ? 248  PRO A HB3    1 
ATOM   4082  H  HG2    . PRO A 1 251 ? 53.183  33.829  5.833   1.00 47.82  ? 248  PRO A HG2    1 
ATOM   4083  H  HG3    . PRO A 1 251 ? 52.375  35.106  6.343   1.00 47.82  ? 248  PRO A HG3    1 
ATOM   4084  H  HD2    . PRO A 1 251 ? 54.518  35.055  4.532   1.00 47.55  ? 248  PRO A HD2    1 
ATOM   4085  H  HD3    . PRO A 1 251 ? 53.235  36.017  4.501   1.00 47.55  ? 248  PRO A HD3    1 
ATOM   4086  N  N      . GLU A 1 252 ? 56.314  36.599  9.071   1.00 40.82  ? 249  GLU A N      1 
ATOM   4087  C  CA     . GLU A 1 252 ? 57.644  36.693  9.676   1.00 31.32  ? 249  GLU A CA     1 
ATOM   4088  C  C      . GLU A 1 252 ? 58.369  35.361  9.722   1.00 34.12  ? 249  GLU A C      1 
ATOM   4089  O  O      . GLU A 1 252 ? 59.598  35.316  9.683   1.00 35.05  ? 249  GLU A O      1 
ATOM   4090  C  CB     . GLU A 1 252 ? 57.557  37.258  11.087  1.00 29.70  ? 249  GLU A CB     1 
ATOM   4091  C  CG     . GLU A 1 252 ? 58.925  37.496  11.718  1.00 36.02  ? 249  GLU A CG     1 
ATOM   4092  C  CD     . GLU A 1 252 ? 59.447  36.286  12.466  1.00 41.32  ? 249  GLU A CD     1 
ATOM   4093  O  OE1    . GLU A 1 252 ? 58.626  35.425  12.846  1.00 35.86  ? 249  GLU A OE1    1 
ATOM   4094  O  OE2    . GLU A 1 252 ? 60.681  36.183  12.667  1.00 27.30  ? 249  GLU A OE2    1 
ATOM   4095  H  H      . GLU A 1 252 ? 55.674  36.809  9.606   1.00 48.99  ? 249  GLU A H      1 
ATOM   4096  H  HA     . GLU A 1 252 ? 58.183  37.302  9.147   1.00 37.58  ? 249  GLU A HA     1 
ATOM   4097  H  HB2    . GLU A 1 252 ? 57.089  38.107  11.058  1.00 35.64  ? 249  GLU A HB2    1 
ATOM   4098  H  HB3    . GLU A 1 252 ? 57.073  36.632  11.648  1.00 35.64  ? 249  GLU A HB3    1 
ATOM   4099  H  HG2    . GLU A 1 252 ? 59.561  37.714  11.019  1.00 43.22  ? 249  GLU A HG2    1 
ATOM   4100  H  HG3    . GLU A 1 252 ? 58.858  38.231  12.348  1.00 43.22  ? 249  GLU A HG3    1 
ATOM   4101  N  N      . THR A 1 253 ? 57.605  34.277  9.791   1.00 27.62  ? 250  THR A N      1 
ATOM   4102  C  CA     . THR A 1 253 ? 58.182  32.958  9.981   1.00 16.03  ? 250  THR A CA     1 
ATOM   4103  C  C      . THR A 1 253 ? 59.040  32.534  8.776   1.00 23.57  ? 250  THR A C      1 
ATOM   4104  O  O      . THR A 1 253 ? 59.726  31.520  8.849   1.00 26.80  ? 250  THR A O      1 
ATOM   4105  C  CB     . THR A 1 253 ? 57.090  31.881  10.241  1.00 18.82  ? 250  THR A CB     1 
ATOM   4106  O  OG1    . THR A 1 253 ? 56.467  31.477  9.017   1.00 32.70  ? 250  THR A OG1    1 
ATOM   4107  C  CG2    . THR A 1 253 ? 56.031  32.383  11.227  1.00 21.11  ? 250  THR A CG2    1 
ATOM   4108  H  H      . THR A 1 253 ? 56.748  34.281  9.731   1.00 33.15  ? 250  THR A H      1 
ATOM   4109  H  HA     . THR A 1 253 ? 58.761  32.982  10.760  1.00 19.24  ? 250  THR A HA     1 
ATOM   4110  H  HB     . THR A 1 253 ? 57.513  31.105  10.640  1.00 22.59  ? 250  THR A HB     1 
ATOM   4111  H  HG1    . THR A 1 253 ? 55.880  30.897  9.171   1.00 39.24  ? 250  THR A HG1    1 
ATOM   4112  H  HG21   . THR A 1 253 ? 55.598  33.175  10.873  1.00 25.33  ? 250  THR A HG21   1 
ATOM   4113  H  HG22   . THR A 1 253 ? 55.362  31.696  11.373  1.00 25.33  ? 250  THR A HG22   1 
ATOM   4114  H  HG23   . THR A 1 253 ? 56.446  32.604  12.075  1.00 25.33  ? 250  THR A HG23   1 
ATOM   4115  N  N      . ILE A 1 254 ? 59.001  33.287  7.671   1.00 30.81  ? 251  ILE A N      1 
ATOM   4116  C  CA     . ILE A 1 254 ? 59.820  32.939  6.497   1.00 28.85  ? 251  ILE A CA     1 
ATOM   4117  C  C      . ILE A 1 254 ? 60.864  34.000  6.157   1.00 31.82  ? 251  ILE A C      1 
ATOM   4118  O  O      . ILE A 1 254 ? 61.587  33.874  5.167   1.00 27.54  ? 251  ILE A O      1 
ATOM   4119  C  CB     . ILE A 1 254 ? 58.962  32.719  5.224   1.00 17.14  ? 251  ILE A CB     1 
ATOM   4120  C  CG1    . ILE A 1 254 ? 58.375  34.033  4.688   1.00 29.92  ? 251  ILE A CG1    1 
ATOM   4121  C  CG2    . ILE A 1 254 ? 57.885  31.678  5.503   1.00 17.48  ? 251  ILE A CG2    1 
ATOM   4122  C  CD1    . ILE A 1 254 ? 57.753  33.901  3.313   1.00 17.65  ? 251  ILE A CD1    1 
ATOM   4123  H  H      . ILE A 1 254 ? 58.519  33.992  7.574   1.00 36.97  ? 251  ILE A H      1 
ATOM   4124  H  HA     . ILE A 1 254 ? 60.290  32.112  6.683   1.00 34.62  ? 251  ILE A HA     1 
ATOM   4125  H  HB     . ILE A 1 254 ? 59.545  32.359  4.538   1.00 20.56  ? 251  ILE A HB     1 
ATOM   4126  H  HG12   . ILE A 1 254 ? 57.685  34.339  5.298   1.00 35.90  ? 251  ILE A HG12   1 
ATOM   4127  H  HG13   . ILE A 1 254 ? 59.083  34.693  4.633   1.00 35.90  ? 251  ILE A HG13   1 
ATOM   4128  H  HG21   . ILE A 1 254 ? 57.320  31.994  6.225   1.00 20.97  ? 251  ILE A HG21   1 
ATOM   4129  H  HG22   . ILE A 1 254 ? 57.356  31.549  4.701   1.00 20.97  ? 251  ILE A HG22   1 
ATOM   4130  H  HG23   . ILE A 1 254 ? 58.311  30.844  5.757   1.00 20.97  ? 251  ILE A HG23   1 
ATOM   4131  H  HD11   . ILE A 1 254 ? 57.034  33.252  3.353   1.00 21.19  ? 251  ILE A HD11   1 
ATOM   4132  H  HD12   . ILE A 1 254 ? 57.405  34.765  3.040   1.00 21.19  ? 251  ILE A HD12   1 
ATOM   4133  H  HD13   . ILE A 1 254 ? 58.433  33.605  2.687   1.00 21.19  ? 251  ILE A HD13   1 
ATOM   4134  N  N      . HIS A 1 255 ? 60.943  35.032  6.987   1.00 27.81  ? 252  HIS A N      1 
ATOM   4135  C  CA     . HIS A 1 255 ? 61.857  36.146  6.764   1.00 27.15  ? 252  HIS A CA     1 
ATOM   4136  C  C      . HIS A 1 255 ? 63.331  35.744  6.763   1.00 34.87  ? 252  HIS A C      1 
ATOM   4137  O  O      . HIS A 1 255 ? 64.093  36.122  5.871   1.00 34.17  ? 252  HIS A O      1 
ATOM   4138  C  CB     . HIS A 1 255 ? 61.616  37.186  7.845   1.00 36.75  ? 252  HIS A CB     1 
ATOM   4139  C  CG     . HIS A 1 255 ? 60.378  37.988  7.627   1.00 31.88  ? 252  HIS A CG     1 
ATOM   4140  N  ND1    . HIS A 1 255 ? 60.109  39.152  8.310   1.00 44.53  ? 252  HIS A ND1    1 
ATOM   4141  C  CD2    . HIS A 1 255 ? 59.328  37.782  6.800   1.00 34.41  ? 252  HIS A CD2    1 
ATOM   4142  C  CE1    . HIS A 1 255 ? 58.941  39.629  7.915   1.00 41.61  ? 252  HIS A CE1    1 
ATOM   4143  N  NE2    . HIS A 1 255 ? 58.447  38.815  7.000   1.00 31.22  ? 252  HIS A NE2    1 
ATOM   4144  H  H      . HIS A 1 255 ? 60.468  35.113  7.699   1.00 33.37  ? 252  HIS A H      1 
ATOM   4145  H  HA     . HIS A 1 255 ? 61.656  36.552  5.906   1.00 32.59  ? 252  HIS A HA     1 
ATOM   4146  H  HB2    . HIS A 1 255 ? 61.533  36.736  8.701   1.00 44.10  ? 252  HIS A HB2    1 
ATOM   4147  H  HB3    . HIS A 1 255 ? 62.368  37.798  7.866   1.00 44.10  ? 252  HIS A HB3    1 
ATOM   4148  H  HD1    . HIS A 1 255 ? 60.617  39.510  8.904   1.00 53.43  ? 252  HIS A HD1    1 
ATOM   4149  H  HD2    . HIS A 1 255 ? 59.220  37.071  6.211   1.00 41.30  ? 252  HIS A HD2    1 
ATOM   4150  H  HE1    . HIS A 1 255 ? 58.538  40.408  8.225   1.00 49.93  ? 252  HIS A HE1    1 
ATOM   4151  H  HE2    . HIS A 1 255 ? 57.698  38.920  6.590   1.00 37.47  ? 252  HIS A HE2    1 
ATOM   4152  N  N      . ASP A 1 256 ? 63.731  34.993  7.783   1.00 36.42  ? 253  ASP A N      1 
ATOM   4153  C  CA     . ASP A 1 256 ? 65.125  34.600  7.944   1.00 35.36  ? 253  ASP A CA     1 
ATOM   4154  C  C      . ASP A 1 256 ? 65.604  33.717  6.795   1.00 37.64  ? 253  ASP A C      1 
ATOM   4155  O  O      . ASP A 1 256 ? 66.660  33.968  6.210   1.00 31.56  ? 253  ASP A O      1 
ATOM   4156  C  CB     . ASP A 1 256 ? 65.316  33.895  9.286   1.00 44.66  ? 253  ASP A CB     1 
ATOM   4157  C  CG     . ASP A 1 256 ? 65.012  34.802  10.470  1.00 54.95  ? 253  ASP A CG     1 
ATOM   4158  O  OD1    . ASP A 1 256 ? 65.264  36.020  10.366  1.00 39.20  ? 253  ASP A OD1    1 
ATOM   4159  O  OD2    . ASP A 1 256 ? 64.525  34.299  11.507  1.00 75.13  ? 253  ASP A OD2    1 
ATOM   4160  H  H      . ASP A 1 256 ? 63.211  34.696  8.400   1.00 43.70  ? 253  ASP A H      1 
ATOM   4161  H  HA     . ASP A 1 256 ? 65.674  35.399  7.950   1.00 42.43  ? 253  ASP A HA     1 
ATOM   4162  H  HB2    . ASP A 1 256 ? 64.719  33.132  9.330   1.00 53.60  ? 253  ASP A HB2    1 
ATOM   4163  H  HB3    . ASP A 1 256 ? 66.238  33.601  9.360   1.00 53.60  ? 253  ASP A HB3    1 
ATOM   4164  N  N      . GLU A 1 257 ? 64.810  32.706  6.459   1.00 41.35  ? 254  GLU A N      1 
ATOM   4165  C  CA     . GLU A 1 257 ? 65.159  31.784  5.385   1.00 30.49  ? 254  GLU A CA     1 
ATOM   4166  C  C      . GLU A 1 257 ? 65.390  32.607  4.131   1.00 32.64  ? 254  GLU A C      1 
ATOM   4167  O  O      . GLU A 1 257 ? 66.385  32.417  3.435   1.00 40.51  ? 254  GLU A O      1 
ATOM   4168  C  CB     . GLU A 1 257 ? 64.065  30.731  5.178   1.00 25.57  ? 254  GLU A CB     1 
ATOM   4169  C  CG     . GLU A 1 257 ? 64.284  29.796  3.990   1.00 25.22  ? 254  GLU A CG     1 
ATOM   4170  C  CD     . GLU A 1 257 ? 63.308  28.621  3.986   1.00 43.71  ? 254  GLU A CD     1 
ATOM   4171  O  OE1    . GLU A 1 257 ? 62.305  28.667  4.733   1.00 32.01  ? 254  GLU A OE1    1 
ATOM   4172  O  OE2    . GLU A 1 257 ? 63.549  27.646  3.241   1.00 47.54  ? 254  GLU A OE2    1 
ATOM   4173  H  H      . GLU A 1 257 ? 64.059  32.531  6.839   1.00 49.62  ? 254  GLU A H      1 
ATOM   4174  H  HA     . GLU A 1 257 ? 65.985  31.327  5.608   1.00 36.59  ? 254  GLU A HA     1 
ATOM   4175  H  HB2    . GLU A 1 257 ? 64.010  30.182  5.976   1.00 30.68  ? 254  GLU A HB2    1 
ATOM   4176  H  HB3    . GLU A 1 257 ? 63.220  31.187  5.039   1.00 30.68  ? 254  GLU A HB3    1 
ATOM   4177  H  HG2    . GLU A 1 257 ? 64.159  30.294  3.167   1.00 30.27  ? 254  GLU A HG2    1 
ATOM   4178  H  HG3    . GLU A 1 257 ? 65.185  29.438  4.029   1.00 30.27  ? 254  GLU A HG3    1 
ATOM   4179  N  N      . LEU A 1 258 ? 64.471  33.529  3.853   1.00 30.31  ? 255  LEU A N      1 
ATOM   4180  C  CA     . LEU A 1 258 ? 64.554  34.349  2.649   1.00 31.37  ? 255  LEU A CA     1 
ATOM   4181  C  C      . LEU A 1 258 ? 65.710  35.343  2.699   1.00 44.77  ? 255  LEU A C      1 
ATOM   4182  O  O      . LEU A 1 258 ? 66.375  35.574  1.689   1.00 41.08  ? 255  LEU A O      1 
ATOM   4183  C  CB     . LEU A 1 258 ? 63.243  35.105  2.435   1.00 29.40  ? 255  LEU A CB     1 
ATOM   4184  C  CG     . LEU A 1 258 ? 62.092  34.287  1.851   1.00 37.79  ? 255  LEU A CG     1 
ATOM   4185  C  CD1    . LEU A 1 258 ? 60.823  35.122  1.805   1.00 30.65  ? 255  LEU A CD1    1 
ATOM   4186  C  CD2    . LEU A 1 258 ? 62.446  33.762  0.467   1.00 24.24  ? 255  LEU A CD2    1 
ATOM   4187  H  H      . LEU A 1 258 ? 63.787  33.698  4.346   1.00 36.37  ? 255  LEU A H      1 
ATOM   4188  H  HA     . LEU A 1 258 ? 64.693  33.769  1.884   1.00 37.64  ? 255  LEU A HA     1 
ATOM   4189  H  HB2    . LEU A 1 258 ? 62.947  35.452  3.291   1.00 35.28  ? 255  LEU A HB2    1 
ATOM   4190  H  HB3    . LEU A 1 258 ? 63.411  35.843  1.828   1.00 35.28  ? 255  LEU A HB3    1 
ATOM   4191  H  HG     . LEU A 1 258 ? 61.926  33.524  2.426   1.00 45.35  ? 255  LEU A HG     1 
ATOM   4192  H  HD11   . LEU A 1 258 ? 60.978  35.901  1.248   1.00 36.77  ? 255  LEU A HD11   1 
ATOM   4193  H  HD12   . LEU A 1 258 ? 60.106  34.586  1.432   1.00 36.77  ? 255  LEU A HD12   1 
ATOM   4194  H  HD13   . LEU A 1 258 ? 60.595  35.399  2.706   1.00 36.77  ? 255  LEU A HD13   1 
ATOM   4195  H  HD21   . LEU A 1 258 ? 63.231  33.197  0.536   1.00 29.09  ? 255  LEU A HD21   1 
ATOM   4196  H  HD22   . LEU A 1 258 ? 61.698  33.248  0.124   1.00 29.09  ? 255  LEU A HD22   1 
ATOM   4197  H  HD23   . LEU A 1 258 ? 62.628  34.513  -0.118  1.00 29.09  ? 255  LEU A HD23   1 
ATOM   4198  N  N      . GLN A 1 259 ? 65.946  35.929  3.871   1.00 48.22  ? 256  GLN A N      1 
ATOM   4199  C  CA     . GLN A 1 259 ? 66.995  36.934  4.024   1.00 34.12  ? 256  GLN A CA     1 
ATOM   4200  C  C      . GLN A 1 259 ? 68.331  36.328  3.607   1.00 48.87  ? 256  GLN A C      1 
ATOM   4201  O  O      . GLN A 1 259 ? 69.124  36.966  2.912   1.00 46.67  ? 256  GLN A O      1 
ATOM   4202  C  CB     . GLN A 1 259 ? 67.066  37.470  5.451   1.00 37.46  ? 256  GLN A CB     1 
ATOM   4203  C  CG     . GLN A 1 259 ? 67.998  38.677  5.599   1.00 49.77  ? 256  GLN A CG     1 
ATOM   4204  C  CD     . GLN A 1 259 ? 67.293  40.004  5.381   1.00 74.21  ? 256  GLN A CD     1 
ATOM   4205  O  OE1    . GLN A 1 259 ? 67.718  40.817  4.558   1.00 72.70  ? 256  GLN A OE1    1 
ATOM   4206  N  NE2    . GLN A 1 259 ? 66.221  40.239  6.130   1.00 82.98  ? 256  GLN A NE2    1 
ATOM   4207  H  H      . GLN A 1 259 ? 65.511  35.762  4.594   1.00 57.86  ? 256  GLN A H      1 
ATOM   4208  H  HA     . GLN A 1 259 ? 66.806  37.679  3.433   1.00 40.94  ? 256  GLN A HA     1 
ATOM   4209  H  HB2    . GLN A 1 259 ? 66.178  37.743  5.728   1.00 44.96  ? 256  GLN A HB2    1 
ATOM   4210  H  HB3    . GLN A 1 259 ? 67.393  36.768  6.035   1.00 44.96  ? 256  GLN A HB3    1 
ATOM   4211  H  HG2    . GLN A 1 259 ? 68.369  38.679  6.495   1.00 59.72  ? 256  GLN A HG2    1 
ATOM   4212  H  HG3    . GLN A 1 259 ? 68.711  38.606  4.945   1.00 59.72  ? 256  GLN A HG3    1 
ATOM   4213  H  HE21   . GLN A 1 259 ? 65.960  39.652  6.702   1.00 99.57  ? 256  GLN A HE21   1 
ATOM   4214  H  HE22   . GLN A 1 259 ? 65.788  40.977  6.043   1.00 99.57  ? 256  GLN A HE22   1 
ATOM   4215  N  N      . GLN A 1 260 ? 68.580  35.095  4.039   1.00 44.01  ? 257  GLN A N      1 
ATOM   4216  C  CA     . GLN A 1 260 ? 69.817  34.417  3.677   1.00 48.73  ? 257  GLN A CA     1 
ATOM   4217  C  C      . GLN A 1 260 ? 69.875  34.103  2.193   1.00 57.84  ? 257  GLN A C      1 
ATOM   4218  O  O      . GLN A 1 260 ? 70.884  34.374  1.546   1.00 67.75  ? 257  GLN A O      1 
ATOM   4219  C  CB     . GLN A 1 260 ? 69.967  33.121  4.474   1.00 54.98  ? 257  GLN A CB     1 
ATOM   4220  C  CG     . GLN A 1 260 ? 70.382  33.322  5.919   1.00 76.83  ? 257  GLN A CG     1 
ATOM   4221  C  CD     . GLN A 1 260 ? 70.767  32.022  6.597   1.00 93.15  ? 257  GLN A CD     1 
ATOM   4222  O  OE1    . GLN A 1 260 ? 71.347  31.130  5.975   1.00 97.02  ? 257  GLN A OE1    1 
ATOM   4223  N  NE2    . GLN A 1 260 ? 70.440  31.906  7.881   1.00 71.73  ? 257  GLN A NE2    1 
ATOM   4224  H  H      . GLN A 1 260 ? 68.053  34.634  4.538   1.00 52.81  ? 257  GLN A H      1 
ATOM   4225  H  HA     . GLN A 1 260 ? 70.568  34.991  3.893   1.00 58.47  ? 257  GLN A HA     1 
ATOM   4226  H  HB2    . GLN A 1 260 ? 69.116  32.656  4.474   1.00 65.98  ? 257  GLN A HB2    1 
ATOM   4227  H  HB3    . GLN A 1 260 ? 70.642  32.570  4.048   1.00 65.98  ? 257  GLN A HB3    1 
ATOM   4228  H  HG2    . GLN A 1 260 ? 71.149  33.915  5.950   1.00 92.20  ? 257  GLN A HG2    1 
ATOM   4229  H  HG3    . GLN A 1 260 ? 69.642  33.710  6.411   1.00 92.20  ? 257  GLN A HG3    1 
ATOM   4230  H  HE21   . GLN A 1 260 ? 70.033  32.550  8.281   1.00 86.08  ? 257  GLN A HE21   1 
ATOM   4231  H  HE22   . GLN A 1 260 ? 70.636  31.188  8.312   1.00 86.08  ? 257  GLN A HE22   1 
ATOM   4232  N  N      . SER A 1 261 ? 68.799  33.538  1.653   1.00 53.60  ? 258  SER A N      1 
ATOM   4233  C  CA     . SER A 1 261 ? 68.752  33.212  0.229   1.00 61.49  ? 258  SER A CA     1 
ATOM   4234  C  C      . SER A 1 261 ? 68.959  34.452  -0.633  1.00 58.82  ? 258  SER A C      1 
ATOM   4235  O  O      . SER A 1 261 ? 69.516  34.370  -1.726  1.00 59.39  ? 258  SER A O      1 
ATOM   4236  C  CB     . SER A 1 261 ? 67.422  32.555  -0.145  1.00 58.44  ? 258  SER A CB     1 
ATOM   4237  O  OG     . SER A 1 261 ? 67.267  31.305  0.501   1.00 80.19  ? 258  SER A OG     1 
ATOM   4238  H  H      . SER A 1 261 ? 68.085  33.332  2.087   1.00 64.32  ? 258  SER A H      1 
ATOM   4239  H  HA     . SER A 1 261 ? 69.464  32.584  0.026   1.00 73.78  ? 258  SER A HA     1 
ATOM   4240  H  HB2    . SER A 1 261 ? 66.696  33.140  0.124   1.00 70.13  ? 258  SER A HB2    1 
ATOM   4241  H  HB3    . SER A 1 261 ? 67.398  32.418  -1.105  1.00 70.13  ? 258  SER A HB3    1 
ATOM   4242  H  HG     . SER A 1 261 ? 66.533  30.959  0.285   1.00 96.22  ? 258  SER A HG     1 
ATOM   4243  N  N      . PHE A 1 262 ? 68.525  35.603  -0.130  1.00 49.21  ? 259  PHE A N      1 
ATOM   4244  C  CA     . PHE A 1 262 ? 68.675  36.840  -0.878  1.00 49.35  ? 259  PHE A CA     1 
ATOM   4245  C  C      . PHE A 1 262 ? 70.127  37.285  -0.875  1.00 62.57  ? 259  PHE A C      1 
ATOM   4246  O  O      . PHE A 1 262 ? 70.625  37.791  -1.879  1.00 66.89  ? 259  PHE A O      1 
ATOM   4247  C  CB     . PHE A 1 262 ? 67.785  37.945  -0.292  1.00 45.16  ? 259  PHE A CB     1 
ATOM   4248  C  CG     . PHE A 1 262 ? 66.306  37.727  -0.501  1.00 39.86  ? 259  PHE A CG     1 
ATOM   4249  C  CD1    . PHE A 1 262 ? 65.838  36.815  -1.432  1.00 35.01  ? 259  PHE A CD1    1 
ATOM   4250  C  CD2    . PHE A 1 262 ? 65.381  38.451  0.234   1.00 37.22  ? 259  PHE A CD2    1 
ATOM   4251  C  CE1    . PHE A 1 262 ? 64.484  36.627  -1.614  1.00 33.12  ? 259  PHE A CE1    1 
ATOM   4252  C  CE2    . PHE A 1 262 ? 64.024  38.265  0.052   1.00 33.39  ? 259  PHE A CE2    1 
ATOM   4253  C  CZ     . PHE A 1 262 ? 63.577  37.353  -0.873  1.00 30.26  ? 259  PHE A CZ     1 
ATOM   4254  H  H      . PHE A 1 262 ? 68.143  35.693  0.635   1.00 59.06  ? 259  PHE A H      1 
ATOM   4255  H  HA     . PHE A 1 262 ? 68.406  36.690  -1.798  1.00 59.22  ? 259  PHE A HA     1 
ATOM   4256  H  HB2    . PHE A 1 262 ? 67.943  37.997  0.664   1.00 54.19  ? 259  PHE A HB2    1 
ATOM   4257  H  HB3    . PHE A 1 262 ? 68.021  38.788  -0.709  1.00 54.19  ? 259  PHE A HB3    1 
ATOM   4258  H  HD1    . PHE A 1 262 ? 66.443  36.320  -1.936  1.00 42.01  ? 259  PHE A HD1    1 
ATOM   4259  H  HD2    . PHE A 1 262 ? 65.678  39.069  0.862   1.00 44.66  ? 259  PHE A HD2    1 
ATOM   4260  H  HE1    . PHE A 1 262 ? 64.182  36.010  -2.240  1.00 39.74  ? 259  PHE A HE1    1 
ATOM   4261  H  HE2    . PHE A 1 262 ? 63.414  38.756  0.554   1.00 40.07  ? 259  PHE A HE2    1 
ATOM   4262  H  HZ     . PHE A 1 262 ? 62.664  37.225  -0.998  1.00 36.31  ? 259  PHE A HZ     1 
ATOM   4263  N  N      . GLN A 1 263 ? 70.810  37.101  0.249   1.00 62.77  ? 260  GLN A N      1 
ATOM   4264  C  CA     . GLN A 1 263 ? 72.204  37.513  0.342   1.00 66.60  ? 260  GLN A CA     1 
ATOM   4265  C  C      . GLN A 1 263 ? 73.100  36.636  -0.539  1.00 74.19  ? 260  GLN A C      1 
ATOM   4266  O  O      . GLN A 1 263 ? 74.025  37.136  -1.179  1.00 80.01  ? 260  GLN A O      1 
ATOM   4267  C  CB     . GLN A 1 263 ? 72.669  37.509  1.800   1.00 51.83  ? 260  GLN A CB     1 
ATOM   4268  C  CG     . GLN A 1 263 ? 72.137  38.721  2.566   1.00 60.77  ? 260  GLN A CG     1 
ATOM   4269  C  CD     . GLN A 1 263 ? 72.059  38.527  4.070   1.00 97.64  ? 260  GLN A CD     1 
ATOM   4270  O  OE1    . GLN A 1 263 ? 72.431  37.481  4.604   1.00 97.38  ? 260  GLN A OE1    1 
ATOM   4271  N  NE2    . GLN A 1 263 ? 71.557  39.545  4.762   1.00 99.83  ? 260  GLN A NE2    1 
ATOM   4272  H  H      . GLN A 1 263 ? 70.493  36.744  0.964   1.00 75.32  ? 260  GLN A H      1 
ATOM   4273  H  HA     . GLN A 1 263 ? 72.277  38.423  0.016   1.00 79.92  ? 260  GLN A HA     1 
ATOM   4274  H  HB2    . GLN A 1 263 ? 72.343  36.707  2.238   1.00 62.20  ? 260  GLN A HB2    1 
ATOM   4275  H  HB3    . GLN A 1 263 ? 73.638  37.535  1.827   1.00 62.20  ? 260  GLN A HB3    1 
ATOM   4276  H  HG2    . GLN A 1 263 ? 72.722  39.476  2.396   1.00 72.93  ? 260  GLN A HG2    1 
ATOM   4277  H  HG3    . GLN A 1 263 ? 71.243  38.922  2.247   1.00 72.93  ? 260  GLN A HG3    1 
ATOM   4278  H  HE21   . GLN A 1 263 ? 71.301  40.258  4.355   1.00 119.80 ? 260  GLN A HE21   1 
ATOM   4279  H  HE22   . GLN A 1 263 ? 71.488  39.491  5.618   1.00 119.80 ? 260  GLN A HE22   1 
ATOM   4280  N  N      . LYS A 1 264 ? 72.827  35.335  -0.572  1.00 69.14  ? 261  LYS A N      1 
ATOM   4281  C  CA     . LYS A 1 264 ? 73.605  34.411  -1.401  1.00 69.57  ? 261  LYS A CA     1 
ATOM   4282  C  C      . LYS A 1 264 ? 73.302  34.481  -2.909  1.00 73.51  ? 261  LYS A C      1 
ATOM   4283  O  O      . LYS A 1 264 ? 74.101  34.004  -3.718  1.00 79.78  ? 261  LYS A O      1 
ATOM   4284  C  CB     . LYS A 1 264 ? 73.412  32.981  -0.891  1.00 87.98  ? 261  LYS A CB     1 
ATOM   4285  C  CG     . LYS A 1 264 ? 73.794  32.829  0.579   1.00 88.02  ? 261  LYS A CG     1 
ATOM   4286  C  CD     . LYS A 1 264 ? 73.819  31.380  1.038   1.00 95.12  ? 261  LYS A CD     1 
ATOM   4287  C  CE     . LYS A 1 264 ? 73.873  31.292  2.558   1.00 107.15 ? 261  LYS A CE     1 
ATOM   4288  N  NZ     . LYS A 1 264 ? 73.876  29.885  3.042   1.00 134.93 ? 261  LYS A NZ     1 
ATOM   4289  H  H      . LYS A 1 264 ? 72.197  34.959  -0.123  1.00 82.96  ? 261  LYS A H      1 
ATOM   4290  H  HA     . LYS A 1 264 ? 74.543  34.629  -1.291  1.00 83.48  ? 261  LYS A HA     1 
ATOM   4291  H  HB2    . LYS A 1 264 ? 72.479  32.733  -0.986  1.00 105.57 ? 261  LYS A HB2    1 
ATOM   4292  H  HB3    . LYS A 1 264 ? 73.971  32.381  -1.410  1.00 105.57 ? 261  LYS A HB3    1 
ATOM   4293  H  HG2    . LYS A 1 264 ? 74.679  33.202  0.715   1.00 105.63 ? 261  LYS A HG2    1 
ATOM   4294  H  HG3    . LYS A 1 264 ? 73.147  33.305  1.124   1.00 105.63 ? 261  LYS A HG3    1 
ATOM   4295  H  HD2    . LYS A 1 264 ? 73.015  30.931  0.734   1.00 114.15 ? 261  LYS A HD2    1 
ATOM   4296  H  HD3    . LYS A 1 264 ? 74.606  30.942  0.678   1.00 114.15 ? 261  LYS A HD3    1 
ATOM   4297  H  HE2    . LYS A 1 264 ? 74.684  31.721  2.872   1.00 128.58 ? 261  LYS A HE2    1 
ATOM   4298  H  HE3    . LYS A 1 264 ? 73.095  31.737  2.929   1.00 128.58 ? 261  LYS A HE3    1 
ATOM   4299  H  HZ1    . LYS A 1 264 ? 74.586  29.454  2.720   1.00 161.92 ? 261  LYS A HZ1    1 
ATOM   4300  H  HZ2    . LYS A 1 264 ? 73.908  29.870  3.931   1.00 161.92 ? 261  LYS A HZ2    1 
ATOM   4301  H  HZ3    . LYS A 1 264 ? 73.138  29.468  2.772   1.00 161.92 ? 261  LYS A HZ3    1 
ATOM   4302  N  N      . SER A 1 265 ? 72.171  35.068  -3.294  1.00 66.38  ? 262  SER A N      1 
ATOM   4303  C  CA     . SER A 1 265 ? 71.833  35.195  -4.716  1.00 60.88  ? 262  SER A CA     1 
ATOM   4304  C  C      . SER A 1 265 ? 72.434  36.486  -5.274  1.00 70.71  ? 262  SER A C      1 
ATOM   4305  O  O      . SER A 1 265 ? 72.896  37.340  -4.519  1.00 76.77  ? 262  SER A O      1 
ATOM   4306  C  CB     . SER A 1 265 ? 70.318  35.174  -4.940  1.00 49.96  ? 262  SER A CB     1 
ATOM   4307  O  OG     . SER A 1 265 ? 69.772  33.891  -4.674  1.00 57.25  ? 262  SER A OG     1 
ATOM   4308  H  H      . SER A 1 265 ? 71.584  35.398  -2.759  1.00 79.66  ? 262  SER A H      1 
ATOM   4309  H  HA     . SER A 1 265 ? 72.220  34.449  -5.201  1.00 73.05  ? 262  SER A HA     1 
ATOM   4310  H  HB2    . SER A 1 265 ? 69.904  35.820  -4.347  1.00 59.95  ? 262  SER A HB2    1 
ATOM   4311  H  HB3    . SER A 1 265 ? 70.134  35.408  -5.863  1.00 59.95  ? 262  SER A HB3    1 
ATOM   4312  H  HG     . SER A 1 265 ? 69.922  33.674  -3.876  1.00 68.70  ? 262  SER A HG     1 
ATOM   4313  N  N      . HIS A 1 266 ? 72.415  36.627  -6.596  1.00 71.10  ? 263  HIS A N      1 
ATOM   4314  C  CA     . HIS A 1 266 ? 73.143  37.704  -7.265  1.00 70.72  ? 263  HIS A CA     1 
ATOM   4315  C  C      . HIS A 1 266 ? 72.223  38.808  -7.776  1.00 69.56  ? 263  HIS A C      1 
ATOM   4316  O  O      . HIS A 1 266 ? 72.555  39.991  -7.678  1.00 80.05  ? 263  HIS A O      1 
ATOM   4317  C  CB     . HIS A 1 266 ? 73.972  37.136  -8.417  1.00 91.26  ? 263  HIS A CB     1 
ATOM   4318  C  CG     . HIS A 1 266 ? 74.987  36.126  -7.978  1.00 108.64 ? 263  HIS A CG     1 
ATOM   4319  N  ND1    . HIS A 1 266 ? 75.859  36.353  -6.935  1.00 87.32  ? 263  HIS A ND1    1 
ATOM   4320  C  CD2    . HIS A 1 266 ? 75.275  34.888  -8.446  1.00 105.40 ? 263  HIS A CD2    1 
ATOM   4321  C  CE1    . HIS A 1 266 ? 76.632  35.295  -6.771  1.00 91.07  ? 263  HIS A CE1    1 
ATOM   4322  N  NE2    . HIS A 1 266 ? 76.300  34.393  -7.677  1.00 115.65 ? 263  HIS A NE2    1 
ATOM   4323  H  H      . HIS A 1 266 ? 71.985  36.110  -7.132  1.00 85.32  ? 263  HIS A H      1 
ATOM   4324  H  HA     . HIS A 1 266 ? 73.757  38.104  -6.630  1.00 84.86  ? 263  HIS A HA     1 
ATOM   4325  H  HB2    . HIS A 1 266 ? 73.376  36.704  -9.049  1.00 109.51 ? 263  HIS A HB2    1 
ATOM   4326  H  HB3    . HIS A 1 266 ? 74.444  37.863  -8.853  1.00 109.51 ? 263  HIS A HB3    1 
ATOM   4327  H  HD1    . HIS A 1 266 ? 75.888  37.069  -6.458  1.00 104.78 ? 263  HIS A HD1    1 
ATOM   4328  H  HD2    . HIS A 1 266 ? 74.854  34.453  -9.152  1.00 126.48 ? 263  HIS A HD2    1 
ATOM   4329  H  HE1    . HIS A 1 266 ? 77.301  35.204  -6.132  1.00 109.28 ? 263  HIS A HE1    1 
ATOM   4330  H  HE2    . HIS A 1 266 ? 76.667  33.621  -7.771  1.00 138.78 ? 263  HIS A HE2    1 
ATOM   4331  N  N      . ASN A 1 267 ? 71.072  38.417  -8.319  1.00 57.55  ? 264  ASN A N      1 
ATOM   4332  C  CA     . ASN A 1 267 ? 70.116  39.369  -8.878  1.00 44.71  ? 264  ASN A CA     1 
ATOM   4333  C  C      . ASN A 1 267 ? 68.701  39.112  -8.371  1.00 50.27  ? 264  ASN A C      1 
ATOM   4334  O  O      . ASN A 1 267 ? 68.470  38.191  -7.590  1.00 52.36  ? 264  ASN A O      1 
ATOM   4335  C  CB     . ASN A 1 267 ? 70.151  39.297  -10.408 1.00 58.08  ? 264  ASN A CB     1 
ATOM   4336  C  CG     . ASN A 1 267 ? 69.875  37.895  -10.944 1.00 56.91  ? 264  ASN A CG     1 
ATOM   4337  O  OD1    . ASN A 1 267 ? 69.173  37.098  -10.321 1.00 55.13  ? 264  ASN A OD1    1 
ATOM   4338  N  ND2    . ASN A 1 267 ? 70.456  37.582  -12.092 1.00 77.21  ? 264  ASN A ND2    1 
ATOM   4339  H  H      . ASN A 1 267 ? 70.819  37.597  -8.376  1.00 69.06  ? 264  ASN A H      1 
ATOM   4340  H  HA     . ASN A 1 267 ? 70.372  40.266  -8.613  1.00 53.66  ? 264  ASN A HA     1 
ATOM   4341  H  HB2    . ASN A 1 267 ? 69.476  39.894  -10.767 1.00 69.70  ? 264  ASN A HB2    1 
ATOM   4342  H  HB3    . ASN A 1 267 ? 71.030  39.568  -10.717 1.00 69.70  ? 264  ASN A HB3    1 
ATOM   4343  H  HD21   . ASN A 1 267 ? 70.955  38.157  -12.492 1.00 92.65  ? 264  ASN A HD21   1 
ATOM   4344  H  HD22   . ASN A 1 267 ? 70.333  36.804  -12.438 1.00 92.65  ? 264  ASN A HD22   1 
ATOM   4345  N  N      . SER A 1 268 ? 67.753  39.923  -8.829  1.00 55.37  ? 265  SER A N      1 
ATOM   4346  C  CA     . SER A 1 268 ? 66.370  39.815  -8.376  1.00 47.22  ? 265  SER A CA     1 
ATOM   4347  C  C      . SER A 1 268 ? 65.687  38.576  -8.939  1.00 49.72  ? 265  SER A C      1 
ATOM   4348  O  O      . SER A 1 268 ? 64.796  38.014  -8.304  1.00 51.21  ? 265  SER A O      1 
ATOM   4349  C  CB     . SER A 1 268 ? 65.578  41.062  -8.762  1.00 39.42  ? 265  SER A CB     1 
ATOM   4350  O  OG     . SER A 1 268 ? 65.947  42.167  -7.957  1.00 44.71  ? 265  SER A OG     1 
ATOM   4351  H  H      . SER A 1 268 ? 67.886  40.548  -9.405  1.00 66.45  ? 265  SER A H      1 
ATOM   4352  H  HA     . SER A 1 268 ? 66.363  39.745  -7.409  1.00 56.66  ? 265  SER A HA     1 
ATOM   4353  H  HB2    . SER A 1 268 ? 65.758  41.275  -9.691  1.00 47.31  ? 265  SER A HB2    1 
ATOM   4354  H  HB3    . SER A 1 268 ? 64.633  40.885  -8.640  1.00 47.31  ? 265  SER A HB3    1 
ATOM   4355  H  HG     . SER A 1 268 ? 65.504  42.845  -8.180  1.00 53.65  ? 265  SER A HG     1 
ATOM   4356  N  N      . LEU A 1 269 ? 66.085  38.158  -10.135 1.00 46.27  ? 266  LEU A N      1 
ATOM   4357  C  CA     . LEU A 1 269 ? 65.491  36.972  -10.733 1.00 51.36  ? 266  LEU A CA     1 
ATOM   4358  C  C      . LEU A 1 269 ? 65.752  35.752  -9.868  1.00 58.90  ? 266  LEU A C      1 
ATOM   4359  O  O      . LEU A 1 269 ? 64.865  34.920  -9.669  1.00 62.98  ? 266  LEU A O      1 
ATOM   4360  C  CB     . LEU A 1 269 ? 66.041  36.739  -12.136 1.00 54.30  ? 266  LEU A CB     1 
ATOM   4361  C  CG     . LEU A 1 269 ? 65.685  37.818  -13.152 1.00 54.88  ? 266  LEU A CG     1 
ATOM   4362  C  CD1    . LEU A 1 269 ? 66.441  37.598  -14.447 1.00 48.96  ? 266  LEU A CD1    1 
ATOM   4363  C  CD2    . LEU A 1 269 ? 64.188  37.820  -13.398 1.00 64.28  ? 266  LEU A CD2    1 
ATOM   4364  H  H      . LEU A 1 269 ? 66.690  38.539  -10.615 1.00 55.52  ? 266  LEU A H      1 
ATOM   4365  H  HA     . LEU A 1 269 ? 64.532  37.095  -10.800 1.00 61.63  ? 266  LEU A HA     1 
ATOM   4366  H  HB2    . LEU A 1 269 ? 67.009  36.693  -12.085 1.00 65.16  ? 266  LEU A HB2    1 
ATOM   4367  H  HB3    . LEU A 1 269 ? 65.692  35.898  -12.469 1.00 65.16  ? 266  LEU A HB3    1 
ATOM   4368  H  HG     . LEU A 1 269 ? 65.936  38.685  -12.798 1.00 65.85  ? 266  LEU A HG     1 
ATOM   4369  H  HD11   . LEU A 1 269 ? 66.203  36.730  -14.807 1.00 58.75  ? 266  LEU A HD11   1 
ATOM   4370  H  HD12   . LEU A 1 269 ? 66.198  38.296  -15.076 1.00 58.75  ? 266  LEU A HD12   1 
ATOM   4371  H  HD13   . LEU A 1 269 ? 67.393  37.633  -14.266 1.00 58.75  ? 266  LEU A HD13   1 
ATOM   4372  H  HD21   . LEU A 1 269 ? 63.731  37.999  -12.562 1.00 77.14  ? 266  LEU A HD21   1 
ATOM   4373  H  HD22   . LEU A 1 269 ? 63.976  38.511  -14.046 1.00 77.14  ? 266  LEU A HD22   1 
ATOM   4374  H  HD23   . LEU A 1 269 ? 63.923  36.952  -13.741 1.00 77.14  ? 266  LEU A HD23   1 
ATOM   4375  N  N      . GLN A 1 270 ? 66.967  35.650  -9.343  1.00 53.53  ? 267  GLN A N      1 
ATOM   4376  C  CA     . GLN A 1 270 ? 67.304  34.521  -8.497  1.00 36.29  ? 267  GLN A CA     1 
ATOM   4377  C  C      . GLN A 1 270 ? 66.479  34.596  -7.232  1.00 45.59  ? 267  GLN A C      1 
ATOM   4378  O  O      . GLN A 1 270 ? 65.904  33.602  -6.785  1.00 46.72  ? 267  GLN A O      1 
ATOM   4379  C  CB     . GLN A 1 270 ? 68.789  34.533  -8.143  1.00 39.79  ? 267  GLN A CB     1 
ATOM   4380  C  CG     . GLN A 1 270 ? 69.711  33.988  -9.212  1.00 70.99  ? 267  GLN A CG     1 
ATOM   4381  C  CD     . GLN A 1 270 ? 71.174  34.167  -8.852  1.00 81.91  ? 267  GLN A CD     1 
ATOM   4382  O  OE1    . GLN A 1 270 ? 71.533  34.220  -7.676  1.00 72.57  ? 267  GLN A OE1    1 
ATOM   4383  N  NE2    . GLN A 1 270 ? 72.025  34.275  -9.865  1.00 90.37  ? 267  GLN A NE2    1 
ATOM   4384  H  H      . GLN A 1 270 ? 67.605  36.215  -9.460  1.00 64.23  ? 267  GLN A H      1 
ATOM   4385  H  HA     . GLN A 1 270 ? 67.098  33.692  -8.957  1.00 43.55  ? 267  GLN A HA     1 
ATOM   4386  H  HB2    . GLN A 1 270 ? 69.056  35.448  -7.966  1.00 47.75  ? 267  GLN A HB2    1 
ATOM   4387  H  HB3    . GLN A 1 270 ? 68.919  33.997  -7.345  1.00 47.75  ? 267  GLN A HB3    1 
ATOM   4388  H  HG2    . GLN A 1 270 ? 69.542  33.039  -9.324  1.00 85.19  ? 267  GLN A HG2    1 
ATOM   4389  H  HG3    . GLN A 1 270 ? 69.545  34.457  -10.044 1.00 85.19  ? 267  GLN A HG3    1 
ATOM   4390  H  HE21   . GLN A 1 270 ? 71.737  34.241  -10.674 1.00 108.44 ? 267  GLN A HE21   1 
ATOM   4391  H  HE22   . GLN A 1 270 ? 72.865  34.378  -9.712  1.00 108.44 ? 267  GLN A HE22   1 
ATOM   4392  N  N      . ARG A 1 271 ? 66.406  35.804  -6.679  1.00 41.55  ? 268  ARG A N      1 
ATOM   4393  C  CA     . ARG A 1 271 ? 65.784  36.013  -5.382  1.00 38.69  ? 268  ARG A CA     1 
ATOM   4394  C  C      . ARG A 1 271 ? 64.279  35.865  -5.441  1.00 41.92  ? 268  ARG A C      1 
ATOM   4395  O  O      . ARG A 1 271 ? 63.662  35.363  -4.499  1.00 26.59  ? 268  ARG A O      1 
ATOM   4396  C  CB     . ARG A 1 271 ? 66.153  37.390  -4.834  1.00 27.49  ? 268  ARG A CB     1 
ATOM   4397  C  CG     . ARG A 1 271 ? 67.622  37.490  -4.471  1.00 47.24  ? 268  ARG A CG     1 
ATOM   4398  C  CD     . ARG A 1 271 ? 67.985  38.817  -3.828  1.00 42.96  ? 268  ARG A CD     1 
ATOM   4399  N  NE     . ARG A 1 271 ? 68.625  39.752  -4.750  1.00 47.02  ? 268  ARG A NE     1 
ATOM   4400  C  CZ     . ARG A 1 271 ? 69.937  39.950  -4.849  1.00 43.75  ? 268  ARG A CZ     1 
ATOM   4401  N  NH1    . ARG A 1 271 ? 70.785  39.243  -4.119  1.00 38.06  ? 268  ARG A NH1    1 
ATOM   4402  N  NH2    . ARG A 1 271 ? 70.407  40.843  -5.712  1.00 49.68  ? 268  ARG A NH2    1 
ATOM   4403  H  H      . ARG A 1 271 ? 66.713  36.521  -7.040  1.00 49.87  ? 268  ARG A H      1 
ATOM   4404  H  HA     . ARG A 1 271 ? 66.122  35.347  -4.763  1.00 46.43  ? 268  ARG A HA     1 
ATOM   4405  H  HB2    . ARG A 1 271 ? 65.963  38.062  -5.508  1.00 32.99  ? 268  ARG A HB2    1 
ATOM   4406  H  HB3    . ARG A 1 271 ? 65.633  37.564  -4.035  1.00 32.99  ? 268  ARG A HB3    1 
ATOM   4407  H  HG2    . ARG A 1 271 ? 67.841  36.783  -3.844  1.00 56.69  ? 268  ARG A HG2    1 
ATOM   4408  H  HG3    . ARG A 1 271 ? 68.153  37.393  -5.277  1.00 56.69  ? 268  ARG A HG3    1 
ATOM   4409  H  HD2    . ARG A 1 271 ? 67.177  39.235  -3.492  1.00 51.55  ? 268  ARG A HD2    1 
ATOM   4410  H  HD3    . ARG A 1 271 ? 68.600  38.653  -3.096  1.00 51.55  ? 268  ARG A HD3    1 
ATOM   4411  H  HE     . ARG A 1 271 ? 68.114  40.211  -5.268  1.00 56.43  ? 268  ARG A HE     1 
ATOM   4412  H  HH11   . ARG A 1 271 ? 70.488  38.665  -3.556  1.00 45.68  ? 268  ARG A HH11   1 
ATOM   4413  H  HH12   . ARG A 1 271 ? 71.631  39.373  -4.197  1.00 45.68  ? 268  ARG A HH12   1 
ATOM   4414  H  HH21   . ARG A 1 271 ? 69.863  41.299  -6.198  1.00 59.62  ? 268  ARG A HH21   1 
ATOM   4415  H  HH22   . ARG A 1 271 ? 71.255  40.961  -5.789  1.00 59.62  ? 268  ARG A HH22   1 
ATOM   4416  N  N      . TRP A 1 272 ? 63.687  36.307  -6.546  1.00 43.00  ? 269  TRP A N      1 
ATOM   4417  C  CA     . TRP A 1 272 ? 62.249  36.181  -6.710  1.00 29.52  ? 269  TRP A CA     1 
ATOM   4418  C  C      . TRP A 1 272 ? 61.854  34.723  -6.785  1.00 37.41  ? 269  TRP A C      1 
ATOM   4419  O  O      . TRP A 1 272 ? 60.809  34.312  -6.276  1.00 35.00  ? 269  TRP A O      1 
ATOM   4420  C  CB     . TRP A 1 272 ? 61.761  36.911  -7.958  1.00 33.37  ? 269  TRP A CB     1 
ATOM   4421  C  CG     . TRP A 1 272 ? 60.284  36.785  -8.110  1.00 33.05  ? 269  TRP A CG     1 
ATOM   4422  C  CD1    . TRP A 1 272 ? 59.618  36.095  -9.072  1.00 21.98  ? 269  TRP A CD1    1 
ATOM   4423  C  CD2    . TRP A 1 272 ? 59.286  37.323  -7.238  1.00 31.26  ? 269  TRP A CD2    1 
ATOM   4424  N  NE1    . TRP A 1 272 ? 58.265  36.182  -8.866  1.00 25.53  ? 269  TRP A NE1    1 
ATOM   4425  C  CE2    . TRP A 1 272 ? 58.033  36.931  -7.745  1.00 27.84  ? 269  TRP A CE2    1 
ATOM   4426  C  CE3    . TRP A 1 272 ? 59.329  38.105  -6.083  1.00 32.67  ? 269  TRP A CE3    1 
ATOM   4427  C  CZ2    . TRP A 1 272 ? 56.834  37.295  -7.140  1.00 31.07  ? 269  TRP A CZ2    1 
ATOM   4428  C  CZ3    . TRP A 1 272 ? 58.137  38.468  -5.483  1.00 38.79  ? 269  TRP A CZ3    1 
ATOM   4429  C  CH2    . TRP A 1 272 ? 56.906  38.063  -6.013  1.00 32.33  ? 269  TRP A CH2    1 
ATOM   4430  H  H      . TRP A 1 272 ? 64.092  36.680  -7.207  1.00 51.61  ? 269  TRP A H      1 
ATOM   4431  H  HA     . TRP A 1 272 ? 61.807  36.573  -5.941  1.00 35.43  ? 269  TRP A HA     1 
ATOM   4432  H  HB2    . TRP A 1 272 ? 61.981  37.853  -7.886  1.00 40.05  ? 269  TRP A HB2    1 
ATOM   4433  H  HB3    . TRP A 1 272 ? 62.183  36.526  -8.742  1.00 40.05  ? 269  TRP A HB3    1 
ATOM   4434  H  HD1    . TRP A 1 272 ? 60.021  35.632  -9.770  1.00 26.38  ? 269  TRP A HD1    1 
ATOM   4435  H  HE1    . TRP A 1 272 ? 57.660  35.824  -9.362  1.00 30.64  ? 269  TRP A HE1    1 
ATOM   4436  H  HE3    . TRP A 1 272 ? 60.143  38.378  -5.725  1.00 39.20  ? 269  TRP A HE3    1 
ATOM   4437  H  HZ2    . TRP A 1 272 ? 56.015  37.030  -7.492  1.00 37.29  ? 269  TRP A HZ2    1 
ATOM   4438  H  HZ3    . TRP A 1 272 ? 58.154  38.989  -4.713  1.00 46.55  ? 269  TRP A HZ3    1 
ATOM   4439  H  HH2    . TRP A 1 272 ? 56.120  38.323  -5.588  1.00 38.79  ? 269  TRP A HH2    1 
ATOM   4440  N  N      . GLU A 1 273 ? 62.705  33.936  -7.426  1.00 38.07  ? 270  GLU A N      1 
ATOM   4441  C  CA     . GLU A 1 273 ? 62.427  32.523  -7.578  1.00 30.65  ? 270  GLU A CA     1 
ATOM   4442  C  C      . GLU A 1 273 ? 62.511  31.852  -6.209  1.00 41.05  ? 270  GLU A C      1 
ATOM   4443  O  O      . GLU A 1 273 ? 61.769  30.913  -5.926  1.00 40.01  ? 270  GLU A O      1 
ATOM   4444  C  CB     . GLU A 1 273 ? 63.379  31.889  -8.589  1.00 39.79  ? 270  GLU A CB     1 
ATOM   4445  C  CG     . GLU A 1 273 ? 62.798  30.646  -9.231  1.00 50.35  ? 270  GLU A CG     1 
ATOM   4446  C  CD     . GLU A 1 273 ? 61.554  30.966  -10.050 1.00 64.71  ? 270  GLU A CD     1 
ATOM   4447  O  OE1    . GLU A 1 273 ? 61.546  32.000  -10.762 1.00 37.42  ? 270  GLU A OE1    1 
ATOM   4448  O  OE2    . GLU A 1 273 ? 60.580  30.193  -9.973  1.00 88.27  ? 270  GLU A OE2    1 
ATOM   4449  H  H      . GLU A 1 273 ? 63.445  34.195  -7.780  1.00 45.68  ? 270  GLU A H      1 
ATOM   4450  H  HA     . GLU A 1 273 ? 61.522  32.413  -7.910  1.00 36.78  ? 270  GLU A HA     1 
ATOM   4451  H  HB2    . GLU A 1 273 ? 63.569  32.530  -9.292  1.00 47.75  ? 270  GLU A HB2    1 
ATOM   4452  H  HB3    . GLU A 1 273 ? 64.200  31.639  -8.137  1.00 47.75  ? 270  GLU A HB3    1 
ATOM   4453  H  HG2    . GLU A 1 273 ? 63.458  30.252  -9.823  1.00 60.42  ? 270  GLU A HG2    1 
ATOM   4454  H  HG3    . GLU A 1 273 ? 62.550  30.014  -8.538  1.00 60.42  ? 270  GLU A HG3    1 
ATOM   4455  N  N      . HIS A 1 274 ? 63.401  32.356  -5.352  1.00 44.18  ? 271  HIS A N      1 
ATOM   4456  C  CA     . HIS A 1 274 ? 63.526  31.838  -3.991  1.00 32.15  ? 271  HIS A CA     1 
ATOM   4457  C  C      . HIS A 1 274 ? 62.275  32.169  -3.202  1.00 34.43  ? 271  HIS A C      1 
ATOM   4458  O  O      . HIS A 1 274 ? 61.743  31.329  -2.475  1.00 28.37  ? 271  HIS A O      1 
ATOM   4459  C  CB     . HIS A 1 274 ? 64.732  32.448  -3.271  1.00 53.59  ? 271  HIS A CB     1 
ATOM   4460  C  CG     . HIS A 1 274 ? 66.026  31.741  -3.519  1.00 66.50  ? 271  HIS A CG     1 
ATOM   4461  N  ND1    . HIS A 1 274 ? 66.289  30.480  -3.030  1.00 61.95  ? 271  HIS A ND1    1 
ATOM   4462  C  CD2    . HIS A 1 274 ? 67.141  32.129  -4.182  1.00 59.23  ? 271  HIS A CD2    1 
ATOM   4463  C  CE1    . HIS A 1 274 ? 67.506  30.115  -3.394  1.00 85.90  ? 271  HIS A CE1    1 
ATOM   4464  N  NE2    . HIS A 1 274 ? 68.044  31.098  -4.094  1.00 63.84  ? 271  HIS A NE2    1 
ATOM   4465  H  H      . HIS A 1 274 ? 63.943  32.998  -5.536  1.00 53.02  ? 271  HIS A H      1 
ATOM   4466  H  HA     . HIS A 1 274 ? 63.633  30.874  -4.016  1.00 38.58  ? 271  HIS A HA     1 
ATOM   4467  H  HB2    . HIS A 1 274 ? 64.838  33.366  -3.566  1.00 64.31  ? 271  HIS A HB2    1 
ATOM   4468  H  HB3    . HIS A 1 274 ? 64.565  32.429  -2.316  1.00 64.31  ? 271  HIS A HB3    1 
ATOM   4469  H  HD1    . HIS A 1 274 ? 65.744  30.002  -2.567  1.00 74.34  ? 271  HIS A HD1    1 
ATOM   4470  H  HD2    . HIS A 1 274 ? 67.269  32.939  -4.622  1.00 71.07  ? 271  HIS A HD2    1 
ATOM   4471  H  HE1    . HIS A 1 274 ? 67.914  29.305  -3.191  1.00 103.08 ? 271  HIS A HE1    1 
ATOM   4472  H  HE2    . HIS A 1 274 ? 68.832  31.093  -4.438  1.00 76.61  ? 271  HIS A HE2    1 
ATOM   4473  N  N      . LEU A 1 275 ? 61.802  33.401  -3.358  1.00 30.74  ? 272  LEU A N      1 
ATOM   4474  C  CA     . LEU A 1 275 ? 60.592  33.838  -2.687  1.00 26.35  ? 272  LEU A CA     1 
ATOM   4475  C  C      . LEU A 1 275 ? 59.458  32.900  -3.054  1.00 36.11  ? 272  LEU A C      1 
ATOM   4476  O  O      . LEU A 1 275 ? 58.695  32.465  -2.189  1.00 24.15  ? 272  LEU A O      1 
ATOM   4477  C  CB     . LEU A 1 275 ? 60.240  35.274  -3.071  1.00 23.22  ? 272  LEU A CB     1 
ATOM   4478  C  CG     . LEU A 1 275 ? 59.077  35.866  -2.273  1.00 30.15  ? 272  LEU A CG     1 
ATOM   4479  C  CD1    . LEU A 1 275 ? 59.272  37.359  -2.079  1.00 38.85  ? 272  LEU A CD1    1 
ATOM   4480  C  CD2    . LEU A 1 275 ? 57.737  35.596  -2.943  1.00 23.80  ? 272  LEU A CD2    1 
ATOM   4481  H  H      . LEU A 1 275 ? 62.169  34.003  -3.851  1.00 36.89  ? 272  LEU A H      1 
ATOM   4482  H  HA     . LEU A 1 275 ? 60.723  33.800  -1.727  1.00 31.63  ? 272  LEU A HA     1 
ATOM   4483  H  HB2    . LEU A 1 275 ? 61.017  35.836  -2.922  1.00 27.87  ? 272  LEU A HB2    1 
ATOM   4484  H  HB3    . LEU A 1 275 ? 59.995  35.295  -4.009  1.00 27.87  ? 272  LEU A HB3    1 
ATOM   4485  H  HG     . LEU A 1 275 ? 59.058  35.453  -1.395  1.00 36.19  ? 272  LEU A HG     1 
ATOM   4486  H  HD11   . LEU A 1 275 ? 59.314  37.787  -2.948  1.00 46.61  ? 272  LEU A HD11   1 
ATOM   4487  H  HD12   . LEU A 1 275 ? 58.524  37.711  -1.571  1.00 46.61  ? 272  LEU A HD12   1 
ATOM   4488  H  HD13   . LEU A 1 275 ? 60.100  37.508  -1.596  1.00 46.61  ? 272  LEU A HD13   1 
ATOM   4489  H  HD21   . LEU A 1 275 ? 57.607  34.637  -3.013  1.00 28.56  ? 272  LEU A HD21   1 
ATOM   4490  H  HD22   . LEU A 1 275 ? 57.031  35.987  -2.405  1.00 28.56  ? 272  LEU A HD22   1 
ATOM   4491  H  HD23   . LEU A 1 275 ? 57.740  35.995  -3.827  1.00 28.56  ? 272  LEU A HD23   1 
ATOM   4492  N  N      . LYS A 1 276 ? 59.371  32.587  -4.347  1.00 30.50  ? 273  LYS A N      1 
ATOM   4493  C  CA     . LYS A 1 276 ? 58.334  31.709  -4.879  1.00 27.54  ? 273  LYS A CA     1 
ATOM   4494  C  C      . LYS A 1 276 ? 58.365  30.314  -4.252  1.00 36.16  ? 273  LYS A C      1 
ATOM   4495  O  O      . LYS A 1 276 ? 57.319  29.789  -3.864  1.00 28.31  ? 273  LYS A O      1 
ATOM   4496  C  CB     . LYS A 1 276 ? 58.473  31.621  -6.402  1.00 41.63  ? 273  LYS A CB     1 
ATOM   4497  C  CG     . LYS A 1 276 ? 57.870  32.819  -7.136  1.00 40.49  ? 273  LYS A CG     1 
ATOM   4498  C  CD     . LYS A 1 276 ? 58.203  32.851  -8.626  1.00 30.95  ? 273  LYS A CD     1 
ATOM   4499  C  CE     . LYS A 1 276 ? 57.517  31.747  -9.407  1.00 57.21  ? 273  LYS A CE     1 
ATOM   4500  N  NZ     . LYS A 1 276 ? 58.145  31.576  -10.748 1.00 38.81  ? 273  LYS A NZ     1 
ATOM   4501  H  H      . LYS A 1 276 ? 59.915  32.877  -4.947  1.00 36.59  ? 273  LYS A H      1 
ATOM   4502  H  HA     . LYS A 1 276 ? 57.467  32.100  -4.684  1.00 33.04  ? 273  LYS A HA     1 
ATOM   4503  H  HB2    . LYS A 1 276 ? 59.415  31.575  -6.629  1.00 49.95  ? 273  LYS A HB2    1 
ATOM   4504  H  HB3    . LYS A 1 276 ? 58.020  30.822  -6.713  1.00 49.95  ? 273  LYS A HB3    1 
ATOM   4505  H  HG2    . LYS A 1 276 ? 56.905  32.788  -7.048  1.00 48.59  ? 273  LYS A HG2    1 
ATOM   4506  H  HG3    . LYS A 1 276 ? 58.211  33.635  -6.738  1.00 48.59  ? 273  LYS A HG3    1 
ATOM   4507  H  HD2    . LYS A 1 276 ? 57.917  33.701  -8.995  1.00 37.14  ? 273  LYS A HD2    1 
ATOM   4508  H  HD3    . LYS A 1 276 ? 59.161  32.747  -8.737  1.00 37.14  ? 273  LYS A HD3    1 
ATOM   4509  H  HE2    . LYS A 1 276 ? 57.600  30.911  -8.922  1.00 68.65  ? 273  LYS A HE2    1 
ATOM   4510  H  HE3    . LYS A 1 276 ? 56.583  31.974  -9.533  1.00 68.65  ? 273  LYS A HE3    1 
ATOM   4511  H  HZ1    . LYS A 1 276 ? 59.005  31.365  -10.657 1.00 46.57  ? 273  LYS A HZ1    1 
ATOM   4512  H  HZ2    . LYS A 1 276 ? 57.733  30.926  -11.195 1.00 46.57  ? 273  LYS A HZ2    1 
ATOM   4513  H  HZ3    . LYS A 1 276 ? 58.080  32.332  -11.212 1.00 46.57  ? 273  LYS A HZ3    1 
ATOM   4514  N  N      . LYS A 1 277 ? 59.549  29.714  -4.146  1.00 40.89  ? 274  LYS A N      1 
ATOM   4515  C  CA     . LYS A 1 277 ? 59.663  28.377  -3.562  1.00 34.61  ? 274  LYS A CA     1 
ATOM   4516  C  C      . LYS A 1 277 ? 59.291  28.380  -2.080  1.00 45.89  ? 274  LYS A C      1 
ATOM   4517  O  O      . LYS A 1 277 ? 58.507  27.545  -1.629  1.00 48.18  ? 274  LYS A O      1 
ATOM   4518  C  CB     . LYS A 1 277 ? 61.085  27.819  -3.727  1.00 30.44  ? 274  LYS A CB     1 
ATOM   4519  C  CG     . LYS A 1 277 ? 61.494  27.518  -5.162  1.00 68.65  ? 274  LYS A CG     1 
ATOM   4520  C  CD     . LYS A 1 277 ? 62.991  27.226  -5.288  1.00 71.44  ? 274  LYS A CD     1 
ATOM   4521  C  CE     . LYS A 1 277 ? 63.385  26.974  -6.742  1.00 82.57  ? 274  LYS A CE     1 
ATOM   4522  N  NZ     . LYS A 1 277 ? 64.861  26.983  -6.968  1.00 87.62  ? 274  LYS A NZ     1 
ATOM   4523  H  H      . LYS A 1 277 ? 60.296  30.055  -4.402  1.00 49.07  ? 274  LYS A H      1 
ATOM   4524  H  HA     . LYS A 1 277 ? 59.052  27.780  -4.022  1.00 41.53  ? 274  LYS A HA     1 
ATOM   4525  H  HB2    . LYS A 1 277 ? 61.713  28.467  -3.373  1.00 36.53  ? 274  LYS A HB2    1 
ATOM   4526  H  HB3    . LYS A 1 277 ? 61.152  26.992  -3.224  1.00 36.53  ? 274  LYS A HB3    1 
ATOM   4527  H  HG2    . LYS A 1 277 ? 61.007  26.740  -5.475  1.00 82.38  ? 274  LYS A HG2    1 
ATOM   4528  H  HG3    . LYS A 1 277 ? 61.289  28.286  -5.719  1.00 82.38  ? 274  LYS A HG3    1 
ATOM   4529  H  HD2    . LYS A 1 277 ? 63.496  27.988  -4.963  1.00 85.73  ? 274  LYS A HD2    1 
ATOM   4530  H  HD3    . LYS A 1 277 ? 63.208  26.434  -4.771  1.00 85.73  ? 274  LYS A HD3    1 
ATOM   4531  H  HE2    . LYS A 1 277 ? 63.048  26.105  -7.013  1.00 99.09  ? 274  LYS A HE2    1 
ATOM   4532  H  HE3    . LYS A 1 277 ? 62.995  27.667  -7.298  1.00 99.09  ? 274  LYS A HE3    1 
ATOM   4533  H  HZ1    . LYS A 1 277 ? 65.248  26.349  -6.477  1.00 105.15 ? 274  LYS A HZ1    1 
ATOM   4534  H  HZ2    . LYS A 1 277 ? 65.038  26.832  -7.827  1.00 105.15 ? 274  LYS A HZ2    1 
ATOM   4535  H  HZ3    . LYS A 1 277 ? 65.199  27.774  -6.738  1.00 105.15 ? 274  LYS A HZ3    1 
ATOM   4536  N  N      . VAL A 1 278 ? 59.849  29.332  -1.333  1.00 35.61  ? 275  VAL A N      1 
ATOM   4537  C  CA     . VAL A 1 278 ? 59.627  29.414  0.111   1.00 32.76  ? 275  VAL A CA     1 
ATOM   4538  C  C      . VAL A 1 278 ? 58.180  29.712  0.483   1.00 37.30  ? 275  VAL A C      1 
ATOM   4539  O  O      . VAL A 1 278 ? 57.637  29.122  1.415   1.00 26.42  ? 275  VAL A O      1 
ATOM   4540  C  CB     . VAL A 1 278 ? 60.525  30.505  0.741   1.00 27.84  ? 275  VAL A CB     1 
ATOM   4541  C  CG1    . VAL A 1 278 ? 60.192  30.723  2.212   1.00 26.05  ? 275  VAL A CG1    1 
ATOM   4542  C  CG2    . VAL A 1 278 ? 61.997  30.159  0.571   1.00 24.52  ? 275  VAL A CG2    1 
ATOM   4543  H  H      . VAL A 1 278 ? 60.364  29.948  -1.641  1.00 42.74  ? 275  VAL A H      1 
ATOM   4544  H  HA     . VAL A 1 278 ? 59.866  28.564  0.512   1.00 39.31  ? 275  VAL A HA     1 
ATOM   4545  H  HB     . VAL A 1 278 ? 60.365  31.342  0.278   1.00 33.41  ? 275  VAL A HB     1 
ATOM   4546  H  HG11   . VAL A 1 278 ? 60.329  29.892  2.693   1.00 31.26  ? 275  VAL A HG11   1 
ATOM   4547  H  HG12   . VAL A 1 278 ? 60.775  31.412  2.568   1.00 31.26  ? 275  VAL A HG12   1 
ATOM   4548  H  HG13   . VAL A 1 278 ? 59.266  31.001  2.288   1.00 31.26  ? 275  VAL A HG13   1 
ATOM   4549  H  HG21   . VAL A 1 278 ? 62.198  30.092  -0.375  1.00 29.42  ? 275  VAL A HG21   1 
ATOM   4550  H  HG22   . VAL A 1 278 ? 62.534  30.859  0.975   1.00 29.42  ? 275  VAL A HG22   1 
ATOM   4551  H  HG23   . VAL A 1 278 ? 62.175  29.312  1.009   1.00 29.42  ? 275  VAL A HG23   1 
ATOM   4552  N  N      . ALA A 1 279 ? 57.558  30.632  -0.242  1.00 40.70  ? 276  ALA A N      1 
ATOM   4553  C  CA     . ALA A 1 279 ? 56.167  30.985  0.011   1.00 31.70  ? 276  ALA A CA     1 
ATOM   4554  C  C      . ALA A 1 279 ? 55.267  29.792  -0.291  1.00 39.21  ? 276  ALA A C      1 
ATOM   4555  O  O      . ALA A 1 279 ? 54.268  29.544  0.387   1.00 37.06  ? 276  ALA A O      1 
ATOM   4556  C  CB     . ALA A 1 279 ? 55.768  32.190  -0.808  1.00 25.60  ? 276  ALA A CB     1 
ATOM   4557  H  H      . ALA A 1 279 ? 57.920  31.069  -0.889  1.00 48.84  ? 276  ALA A H      1 
ATOM   4558  H  HA     . ALA A 1 279 ? 56.063  31.211  0.949   1.00 38.04  ? 276  ALA A HA     1 
ATOM   4559  H  HB1    . ALA A 1 279 ? 55.878  31.981  -1.749  1.00 30.72  ? 276  ALA A HB1    1 
ATOM   4560  H  HB2    . ALA A 1 279 ? 54.841  32.404  -0.622  1.00 30.72  ? 276  ALA A HB2    1 
ATOM   4561  H  HB3    . ALA A 1 279 ? 56.337  32.938  -0.566  1.00 30.72  ? 276  ALA A HB3    1 
ATOM   4562  N  N      . SER A 1 280 ? 55.603  29.087  -1.361  1.00 38.06  ? 277  SER A N      1 
ATOM   4563  C  CA     . SER A 1 280 ? 54.850  27.913  -1.766  1.00 35.63  ? 277  SER A CA     1 
ATOM   4564  C  C      . SER A 1 280 ? 54.836  26.837  -0.682  1.00 49.12  ? 277  SER A C      1 
ATOM   4565  O  O      . SER A 1 280 ? 53.795  26.231  -0.433  1.00 45.48  ? 277  SER A O      1 
ATOM   4566  C  CB     . SER A 1 280 ? 55.415  27.359  -3.067  1.00 42.21  ? 277  SER A CB     1 
ATOM   4567  O  OG     . SER A 1 280 ? 55.222  28.291  -4.117  1.00 46.42  ? 277  SER A OG     1 
ATOM   4568  H  H      . SER A 1 280 ? 56.269  29.270  -1.874  1.00 45.67  ? 277  SER A H      1 
ATOM   4569  H  HA     . SER A 1 280 ? 53.931  28.175  -1.932  1.00 42.75  ? 277  SER A HA     1 
ATOM   4570  H  HB2    . SER A 1 280 ? 56.365  27.195  -2.957  1.00 50.65  ? 277  SER A HB2    1 
ATOM   4571  H  HB3    . SER A 1 280 ? 54.957  26.532  -3.287  1.00 50.65  ? 277  SER A HB3    1 
ATOM   4572  H  HG     . SER A 1 280 ? 55.612  29.012  -3.936  1.00 55.70  ? 277  SER A HG     1 
ATOM   4573  N  N      . ARG A 1 281 ? 55.983  26.602  -0.039  1.00 53.35  ? 278  ARG A N      1 
ATOM   4574  C  CA     . ARG A 1 281 ? 56.058  25.618  1.042   1.00 36.96  ? 278  ARG A CA     1 
ATOM   4575  C  C      . ARG A 1 281 ? 55.147  26.044  2.155   1.00 37.30  ? 278  ARG A C      1 
ATOM   4576  O  O      . ARG A 1 281 ? 54.504  25.229  2.811   1.00 54.47  ? 278  ARG A O      1 
ATOM   4577  C  CB     . ARG A 1 281 ? 57.453  25.500  1.644   1.00 28.49  ? 278  ARG A CB     1 
ATOM   4578  C  CG     . ARG A 1 281 ? 58.578  25.191  0.720   1.00 36.71  ? 278  ARG A CG     1 
ATOM   4579  C  CD     . ARG A 1 281 ? 59.714  24.597  1.518   1.00 30.66  ? 278  ARG A CD     1 
ATOM   4580  N  NE     . ARG A 1 281 ? 60.904  24.435  0.700   1.00 41.69  ? 278  ARG A NE     1 
ATOM   4581  C  CZ     . ARG A 1 281 ? 61.824  25.383  0.547   1.00 69.70  ? 278  ARG A CZ     1 
ATOM   4582  N  NH1    . ARG A 1 281 ? 61.698  26.555  1.161   1.00 62.56  ? 278  ARG A NH1    1 
ATOM   4583  N  NH2    . ARG A 1 281 ? 62.878  25.159  -0.220  1.00 89.34  ? 278  ARG A NH2    1 
ATOM   4584  H  H      . ARG A 1 281 ? 56.728  26.998  -0.209  1.00 64.02  ? 278  ARG A H      1 
ATOM   4585  H  HA     . ARG A 1 281 ? 55.777  24.747  0.719   1.00 44.36  ? 278  ARG A HA     1 
ATOM   4586  H  HB2    . ARG A 1 281 ? 57.664  26.342  2.077   1.00 34.18  ? 278  ARG A HB2    1 
ATOM   4587  H  HB3    . ARG A 1 281 ? 57.433  24.797  2.311   1.00 34.18  ? 278  ARG A HB3    1 
ATOM   4588  H  HG2    . ARG A 1 281 ? 58.291  24.545  0.057   1.00 44.05  ? 278  ARG A HG2    1 
ATOM   4589  H  HG3    . ARG A 1 281 ? 58.888  26.006  0.295   1.00 44.05  ? 278  ARG A HG3    1 
ATOM   4590  H  HD2    . ARG A 1 281 ? 59.930  25.188  2.256   1.00 36.79  ? 278  ARG A HD2    1 
ATOM   4591  H  HD3    . ARG A 1 281 ? 59.451  23.725  1.850   1.00 36.79  ? 278  ARG A HD3    1 
ATOM   4592  H  HE     . ARG A 1 281 ? 60.954  23.741  0.195   1.00 50.02  ? 278  ARG A HE     1 
ATOM   4593  H  HH11   . ARG A 1 281 ? 61.014  26.707  1.660   1.00 75.08  ? 278  ARG A HH11   1 
ATOM   4594  H  HH12   . ARG A 1 281 ? 62.298  27.162  1.057   1.00 75.08  ? 278  ARG A HH12   1 
ATOM   4595  H  HH21   . ARG A 1 281 ? 62.967  24.402  -0.618  1.00 107.20 ? 278  ARG A HH21   1 
ATOM   4596  H  HH22   . ARG A 1 281 ? 63.476  25.769  -0.318  1.00 107.20 ? 278  ARG A HH22   1 
ATOM   4597  N  N      . TYR A 1 282 ? 55.109  27.354  2.354   1.00 33.56  ? 279  TYR A N      1 
ATOM   4598  C  CA     . TYR A 1 282 ? 54.361  27.943  3.439   1.00 32.32  ? 279  TYR A CA     1 
ATOM   4599  C  C      . TYR A 1 282 ? 52.870  27.664  3.256   1.00 46.09  ? 279  TYR A C      1 
ATOM   4600  O  O      . TYR A 1 282 ? 52.132  27.553  4.236   1.00 38.95  ? 279  TYR A O      1 
ATOM   4601  C  CB     . TYR A 1 282 ? 54.626  29.447  3.500   1.00 29.94  ? 279  TYR A CB     1 
ATOM   4602  C  CG     . TYR A 1 282 ? 53.986  30.104  4.683   1.00 31.65  ? 279  TYR A CG     1 
ATOM   4603  C  CD1    . TYR A 1 282 ? 54.623  30.114  5.910   1.00 21.51  ? 279  TYR A CD1    1 
ATOM   4604  C  CD2    . TYR A 1 282 ? 52.725  30.662  4.589   1.00 24.06  ? 279  TYR A CD2    1 
ATOM   4605  C  CE1    . TYR A 1 282 ? 54.041  30.695  6.999   1.00 25.32  ? 279  TYR A CE1    1 
ATOM   4606  C  CE2    . TYR A 1 282 ? 52.128  31.240  5.672   1.00 27.92  ? 279  TYR A CE2    1 
ATOM   4607  C  CZ     . TYR A 1 282 ? 52.789  31.255  6.881   1.00 33.87  ? 279  TYR A CZ     1 
ATOM   4608  O  OH     . TYR A 1 282 ? 52.193  31.836  7.978   1.00 40.48  ? 279  TYR A OH     1 
ATOM   4609  H  H      . TYR A 1 282 ? 55.518  27.928  1.863   1.00 40.28  ? 279  TYR A H      1 
ATOM   4610  H  HA     . TYR A 1 282 ? 54.646  27.548  4.278   1.00 38.78  ? 279  TYR A HA     1 
ATOM   4611  H  HB2    . TYR A 1 282 ? 55.583  29.596  3.555   1.00 35.93  ? 279  TYR A HB2    1 
ATOM   4612  H  HB3    . TYR A 1 282 ? 54.271  29.862  2.698   1.00 35.93  ? 279  TYR A HB3    1 
ATOM   4613  H  HD1    . TYR A 1 282 ? 55.469  29.737  5.990   1.00 25.82  ? 279  TYR A HD1    1 
ATOM   4614  H  HD2    . TYR A 1 282 ? 52.279  30.653  3.773   1.00 28.87  ? 279  TYR A HD2    1 
ATOM   4615  H  HE1    . TYR A 1 282 ? 54.483  30.703  7.817   1.00 30.38  ? 279  TYR A HE1    1 
ATOM   4616  H  HE2    . TYR A 1 282 ? 51.284  31.621  5.595   1.00 33.50  ? 279  TYR A HE2    1 
ATOM   4617  H  HH     . TYR A 1 282 ? 51.437  32.136  7.769   1.00 48.57  ? 279  TYR A HH     1 
ATOM   4618  N  N      . GLN A 1 283 ? 52.437  27.545  1.999   1.00 52.30  ? 280  GLN A N      1 
ATOM   4619  C  CA     . GLN A 1 283 ? 51.038  27.254  1.683   1.00 46.90  ? 280  GLN A CA     1 
ATOM   4620  C  C      . GLN A 1 283 ? 50.582  25.904  2.221   1.00 72.17  ? 280  GLN A C      1 
ATOM   4621  O  O      . GLN A 1 283 ? 49.414  25.732  2.575   1.00 73.73  ? 280  GLN A O      1 
ATOM   4622  C  CB     . GLN A 1 283 ? 50.804  27.260  0.174   1.00 65.38  ? 280  GLN A CB     1 
ATOM   4623  C  CG     . GLN A 1 283 ? 51.167  28.536  -0.548  1.00 85.20  ? 280  GLN A CG     1 
ATOM   4624  C  CD     . GLN A 1 283 ? 50.549  28.594  -1.943  1.00 93.66  ? 280  GLN A CD     1 
ATOM   4625  O  OE1    . GLN A 1 283 ? 49.371  28.282  -2.129  1.00 69.47  ? 280  GLN A OE1    1 
ATOM   4626  N  NE2    . GLN A 1 283 ? 51.352  28.976  -2.932  1.00 89.38  ? 280  GLN A NE2    1 
ATOM   4627  H  H      . GLN A 1 283 ? 52.939  27.629  1.306   1.00 62.76  ? 280  GLN A H      1 
ATOM   4628  H  HA     . GLN A 1 283 ? 50.476  27.939  2.077   1.00 56.28  ? 280  GLN A HA     1 
ATOM   4629  H  HB2    . GLN A 1 283 ? 51.330  26.545  -0.219  1.00 78.46  ? 280  GLN A HB2    1 
ATOM   4630  H  HB3    . GLN A 1 283 ? 49.862  27.093  0.010   1.00 78.46  ? 280  GLN A HB3    1 
ATOM   4631  H  HG2    . GLN A 1 283 ? 50.840  29.294  -0.040  1.00 102.24 ? 280  GLN A HG2    1 
ATOM   4632  H  HG3    . GLN A 1 283 ? 52.132  28.586  -0.641  1.00 102.24 ? 280  GLN A HG3    1 
ATOM   4633  H  HE21   . GLN A 1 283 ? 52.172  29.174  -2.767  1.00 107.26 ? 280  GLN A HE21   1 
ATOM   4634  H  HE22   . GLN A 1 283 ? 51.050  29.024  -3.735  1.00 107.26 ? 280  GLN A HE22   1 
ATOM   4635  N  N      . ASN A 1 284 ? 51.507  24.949  2.261   1.00 73.48  ? 281  ASN A N      1 
ATOM   4636  C  CA     . ASN A 1 284 ? 51.172  23.549  2.503   1.00 61.80  ? 281  ASN A CA     1 
ATOM   4637  C  C      . ASN A 1 284 ? 50.609  23.279  3.892   1.00 67.45  ? 281  ASN A C      1 
ATOM   4638  O  O      . ASN A 1 284 ? 49.688  22.477  4.045   1.00 95.50  ? 281  ASN A O      1 
ATOM   4639  C  CB     . ASN A 1 284 ? 52.407  22.681  2.274   1.00 54.81  ? 281  ASN A CB     1 
ATOM   4640  C  CG     . ASN A 1 284 ? 52.784  22.583  0.807   1.00 74.82  ? 281  ASN A CG     1 
ATOM   4641  O  OD1    . ASN A 1 284 ? 52.182  23.235  -0.047  1.00 91.68  ? 281  ASN A OD1    1 
ATOM   4642  N  ND2    . ASN A 1 284 ? 53.791  21.770  0.508   1.00 54.55  ? 281  ASN A ND2    1 
ATOM   4643  H  H      . ASN A 1 284 ? 52.348  25.089  2.149   1.00 88.18  ? 281  ASN A H      1 
ATOM   4644  H  HA     . ASN A 1 284 ? 50.500  23.278  1.858   1.00 74.16  ? 281  ASN A HA     1 
ATOM   4645  H  HB2    . ASN A 1 284 ? 53.158  23.066  2.752   1.00 65.77  ? 281  ASN A HB2    1 
ATOM   4646  H  HB3    . ASN A 1 284 ? 52.230  21.785  2.599   1.00 65.77  ? 281  ASN A HB3    1 
ATOM   4647  H  HD21   . ASN A 1 284 ? 54.191  21.334  1.132   1.00 65.46  ? 281  ASN A HD21   1 
ATOM   4648  H  HD22   . ASN A 1 284 ? 54.043  21.680  -0.309  1.00 65.46  ? 281  ASN A HD22   1 
ATOM   4649  N  N      . ASN A 1 285 ? 51.158  23.958  4.893   1.00 51.07  ? 282  ASN A N      1 
ATOM   4650  C  CA     . ASN A 1 285 ? 50.717  23.787  6.275   1.00 60.22  ? 282  ASN A CA     1 
ATOM   4651  C  C      . ASN A 1 285 ? 49.838  24.948  6.719   1.00 73.74  ? 282  ASN A C      1 
ATOM   4652  O  O      . ASN A 1 285 ? 48.726  25.122  6.222   1.00 64.57  ? 282  ASN A O      1 
ATOM   4653  C  CB     . ASN A 1 285 ? 51.917  23.650  7.217   1.00 51.43  ? 282  ASN A CB     1 
ATOM   4654  C  CG     . ASN A 1 285 ? 53.188  24.246  6.639   1.00 64.09  ? 282  ASN A CG     1 
ATOM   4655  O  OD1    . ASN A 1 285 ? 53.359  25.466  6.606   1.00 58.85  ? 282  ASN A OD1    1 
ATOM   4656  N  ND2    . ASN A 1 285 ? 54.088  23.382  6.180   1.00 59.97  ? 282  ASN A ND2    1 
ATOM   4657  H  H      . ASN A 1 285 ? 51.793  24.529  4.799   1.00 61.28  ? 282  ASN A H      1 
ATOM   4658  H  HA     . ASN A 1 285 ? 50.192  22.973  6.340   1.00 72.27  ? 282  ASN A HA     1 
ATOM   4659  H  HB2    . ASN A 1 285 ? 51.721  24.110  8.048   1.00 61.72  ? 282  ASN A HB2    1 
ATOM   4660  H  HB3    . ASN A 1 285 ? 52.078  22.709  7.388   1.00 61.72  ? 282  ASN A HB3    1 
ATOM   4661  H  HD21   . ASN A 1 285 ? 53.932  22.537  6.220   1.00 71.96  ? 282  ASN A HD21   1 
ATOM   4662  H  HD22   . ASN A 1 285 ? 54.825  23.668  5.842   1.00 71.96  ? 282  ASN A HD22   1 
ATOM   4663  N  N      . PRO A 1 293 ? 48.738  32.642  2.608   1.00 50.66  ? 290  PRO A N      1 
ATOM   4664  C  CA     . PRO A 1 293 ? 48.264  31.679  1.603   1.00 66.33  ? 290  PRO A CA     1 
ATOM   4665  C  C      . PRO A 1 293 ? 48.736  31.947  0.171   1.00 57.48  ? 290  PRO A C      1 
ATOM   4666  O  O      . PRO A 1 293 ? 49.347  31.045  -0.393  1.00 67.65  ? 290  PRO A O      1 
ATOM   4667  C  CB     . PRO A 1 293 ? 46.736  31.783  1.702   1.00 55.67  ? 290  PRO A CB     1 
ATOM   4668  C  CG     . PRO A 1 293 ? 46.468  33.083  2.368   1.00 83.68  ? 290  PRO A CG     1 
ATOM   4669  C  CD     . PRO A 1 293 ? 47.619  33.305  3.300   1.00 65.45  ? 290  PRO A CD     1 
ATOM   4670  H  HA     . PRO A 1 293 ? 48.533  30.782  1.857   1.00 79.59  ? 290  PRO A HA     1 
ATOM   4671  H  HB2    . PRO A 1 293 ? 46.351  31.769  0.812   1.00 66.81  ? 290  PRO A HB2    1 
ATOM   4672  H  HB3    . PRO A 1 293 ? 46.393  31.049  2.235   1.00 66.81  ? 290  PRO A HB3    1 
ATOM   4673  H  HG2    . PRO A 1 293 ? 46.427  33.788  1.703   1.00 100.41 ? 290  PRO A HG2    1 
ATOM   4674  H  HG3    . PRO A 1 293 ? 45.635  33.030  2.862   1.00 100.41 ? 290  PRO A HG3    1 
ATOM   4675  H  HD2    . PRO A 1 293 ? 47.796  34.253  3.400   1.00 78.54  ? 290  PRO A HD2    1 
ATOM   4676  H  HD3    . PRO A 1 293 ? 47.450  32.880  4.155   1.00 78.54  ? 290  PRO A HD3    1 
ATOM   4677  N  N      . TRP A 1 294 ? 48.479  33.122  -0.407  1.00 45.36  ? 291  TRP A N      1 
ATOM   4678  C  CA     . TRP A 1 294 ? 48.919  33.384  -1.785  1.00 48.47  ? 291  TRP A CA     1 
ATOM   4679  C  C      . TRP A 1 294 ? 49.943  34.499  -1.856  1.00 40.50  ? 291  TRP A C      1 
ATOM   4680  O  O      . TRP A 1 294 ? 49.758  35.487  -2.565  1.00 49.60  ? 291  TRP A O      1 
ATOM   4681  C  CB     . TRP A 1 294 ? 47.747  33.762  -2.687  1.00 35.82  ? 291  TRP A CB     1 
ATOM   4682  C  CG     . TRP A 1 294 ? 46.663  32.758  -2.785  1.00 37.59  ? 291  TRP A CG     1 
ATOM   4683  C  CD1    . TRP A 1 294 ? 45.411  32.839  -2.247  1.00 44.77  ? 291  TRP A CD1    1 
ATOM   4684  C  CD2    . TRP A 1 294 ? 46.728  31.508  -3.470  1.00 47.47  ? 291  TRP A CD2    1 
ATOM   4685  N  NE1    . TRP A 1 294 ? 44.686  31.714  -2.565  1.00 29.48  ? 291  TRP A NE1    1 
ATOM   4686  C  CE2    . TRP A 1 294 ? 45.477  30.880  -3.313  1.00 48.30  ? 291  TRP A CE2    1 
ATOM   4687  C  CE3    . TRP A 1 294 ? 47.725  30.859  -4.205  1.00 56.13  ? 291  TRP A CE3    1 
ATOM   4688  C  CZ2    . TRP A 1 294 ? 45.198  29.634  -3.863  1.00 50.94  ? 291  TRP A CZ2    1 
ATOM   4689  C  CZ3    . TRP A 1 294 ? 47.447  29.625  -4.748  1.00 54.69  ? 291  TRP A CZ3    1 
ATOM   4690  C  CH2    . TRP A 1 294 ? 46.193  29.024  -4.575  1.00 60.49  ? 291  TRP A CH2    1 
ATOM   4691  H  H      . TRP A 1 294 ? 48.060  33.774  -0.034  1.00 54.44  ? 291  TRP A H      1 
ATOM   4692  H  HA     . TRP A 1 294 ? 49.326  32.580  -2.144  1.00 58.16  ? 291  TRP A HA     1 
ATOM   4693  H  HB2    . TRP A 1 294 ? 47.353  34.582  -2.350  1.00 42.99  ? 291  TRP A HB2    1 
ATOM   4694  H  HB3    . TRP A 1 294 ? 48.087  33.911  -3.583  1.00 42.99  ? 291  TRP A HB3    1 
ATOM   4695  H  HD1    . TRP A 1 294 ? 45.092  33.556  -1.748  1.00 53.73  ? 291  TRP A HD1    1 
ATOM   4696  H  HE1    . TRP A 1 294 ? 43.874  31.556  -2.327  1.00 35.38  ? 291  TRP A HE1    1 
ATOM   4697  H  HE3    . TRP A 1 294 ? 48.559  31.253  -4.325  1.00 67.35  ? 291  TRP A HE3    1 
ATOM   4698  H  HZ2    . TRP A 1 294 ? 44.368  29.230  -3.749  1.00 61.12  ? 291  TRP A HZ2    1 
ATOM   4699  H  HZ3    . TRP A 1 294 ? 48.101  29.183  -5.239  1.00 65.63  ? 291  TRP A HZ3    1 
ATOM   4700  H  HH2    . TRP A 1 294 ? 46.034  28.189  -4.952  1.00 72.59  ? 291  TRP A HH2    1 
ATOM   4701  N  N      . LEU A 1 295 ? 51.023  34.330  -1.111  1.00 31.59  ? 292  LEU A N      1 
ATOM   4702  C  CA     . LEU A 1 295 ? 51.994  35.390  -0.941  1.00 31.31  ? 292  LEU A CA     1 
ATOM   4703  C  C      . LEU A 1 295 ? 52.555  35.909  -2.262  1.00 30.77  ? 292  LEU A C      1 
ATOM   4704  O  O      . LEU A 1 295 ? 52.728  37.116  -2.427  1.00 32.31  ? 292  LEU A O      1 
ATOM   4705  C  CB     . LEU A 1 295 ? 53.128  34.901  -0.049  1.00 28.77  ? 292  LEU A CB     1 
ATOM   4706  C  CG     . LEU A 1 295 ? 52.675  34.492  1.352   1.00 19.65  ? 292  LEU A CG     1 
ATOM   4707  C  CD1    . LEU A 1 295 ? 53.872  33.975  2.111   1.00 40.58  ? 292  LEU A CD1    1 
ATOM   4708  C  CD2    . LEU A 1 295 ? 51.995  35.625  2.110   1.00 21.25  ? 292  LEU A CD2    1 
ATOM   4709  H  H      . LEU A 1 295 ? 51.217  33.605  -0.692  1.00 37.91  ? 292  LEU A H      1 
ATOM   4710  H  HA     . LEU A 1 295 ? 51.565  36.135  -0.492  1.00 37.57  ? 292  LEU A HA     1 
ATOM   4711  H  HB2    . LEU A 1 295 ? 53.542  34.129  -0.465  1.00 34.52  ? 292  LEU A HB2    1 
ATOM   4712  H  HB3    . LEU A 1 295 ? 53.780  35.613  0.045   1.00 34.52  ? 292  LEU A HB3    1 
ATOM   4713  H  HG     . LEU A 1 295 ? 52.038  33.765  1.274   1.00 23.58  ? 292  LEU A HG     1 
ATOM   4714  H  HD11   . LEU A 1 295 ? 54.538  34.679  2.166   1.00 48.69  ? 292  LEU A HD11   1 
ATOM   4715  H  HD12   . LEU A 1 295 ? 53.592  33.714  3.002   1.00 48.69  ? 292  LEU A HD12   1 
ATOM   4716  H  HD13   . LEU A 1 295 ? 54.237  33.210  1.640   1.00 48.69  ? 292  LEU A HD13   1 
ATOM   4717  H  HD21   . LEU A 1 295 ? 51.212  35.911  1.613   1.00 25.51  ? 292  LEU A HD21   1 
ATOM   4718  H  HD22   . LEU A 1 295 ? 51.732  35.305  2.987   1.00 25.51  ? 292  LEU A HD22   1 
ATOM   4719  H  HD23   . LEU A 1 295 ? 52.618  36.364  2.199   1.00 25.51  ? 292  LEU A HD23   1 
ATOM   4720  N  N      . GLU A 1 296 ? 52.833  35.006  -3.202  1.00 36.40  ? 293  GLU A N      1 
ATOM   4721  C  CA     . GLU A 1 296 ? 53.455  35.415  -4.462  1.00 30.94  ? 293  GLU A CA     1 
ATOM   4722  C  C      . GLU A 1 296 ? 52.560  36.390  -5.209  1.00 28.29  ? 293  GLU A C      1 
ATOM   4723  O  O      . GLU A 1 296 ? 53.033  37.402  -5.726  1.00 27.75  ? 293  GLU A O      1 
ATOM   4724  C  CB     . GLU A 1 296 ? 53.771  34.208  -5.352  1.00 27.44  ? 293  GLU A CB     1 
ATOM   4725  C  CG     . GLU A 1 296 ? 54.507  34.581  -6.644  1.00 38.96  ? 293  GLU A CG     1 
ATOM   4726  C  CD     . GLU A 1 296 ? 54.507  33.473  -7.690  1.00 44.59  ? 293  GLU A CD     1 
ATOM   4727  O  OE1    . GLU A 1 296 ? 54.383  32.289  -7.316  1.00 39.68  ? 293  GLU A OE1    1 
ATOM   4728  O  OE2    . GLU A 1 296 ? 54.664  33.789  -8.891  1.00 46.80  ? 293  GLU A OE2    1 
ATOM   4729  H  H      . GLU A 1 296 ? 52.675  34.163  -3.137  1.00 43.68  ? 293  GLU A H      1 
ATOM   4730  H  HA     . GLU A 1 296 ? 54.291  35.867  -4.267  1.00 37.12  ? 293  GLU A HA     1 
ATOM   4731  H  HB2    . GLU A 1 296 ? 54.332  33.591  -4.857  1.00 32.93  ? 293  GLU A HB2    1 
ATOM   4732  H  HB3    . GLU A 1 296 ? 52.939  33.773  -5.598  1.00 32.93  ? 293  GLU A HB3    1 
ATOM   4733  H  HG2    . GLU A 1 296 ? 54.079  35.359  -7.035  1.00 46.76  ? 293  GLU A HG2    1 
ATOM   4734  H  HG3    . GLU A 1 296 ? 55.431  34.787  -6.429  1.00 46.76  ? 293  GLU A HG3    1 
ATOM   4735  N  N      . TRP A 1 297 ? 51.267  36.082  -5.260  1.00 25.64  ? 294  TRP A N      1 
ATOM   4736  C  CA     . TRP A 1 297 ? 50.324  36.894  -6.024  1.00 33.91  ? 294  TRP A CA     1 
ATOM   4737  C  C      . TRP A 1 297 ? 49.993  38.202  -5.344  1.00 30.70  ? 294  TRP A C      1 
ATOM   4738  O  O      . TRP A 1 297 ? 49.817  39.225  -6.009  1.00 30.26  ? 294  TRP A O      1 
ATOM   4739  C  CB     . TRP A 1 297 ? 49.043  36.104  -6.291  1.00 37.48  ? 294  TRP A CB     1 
ATOM   4740  C  CG     . TRP A 1 297 ? 49.234  35.039  -7.322  1.00 40.84  ? 294  TRP A CG     1 
ATOM   4741  C  CD1    . TRP A 1 297 ? 50.221  34.978  -8.264  1.00 37.06  ? 294  TRP A CD1    1 
ATOM   4742  C  CD2    . TRP A 1 297 ? 48.437  33.866  -7.501  1.00 35.68  ? 294  TRP A CD2    1 
ATOM   4743  N  NE1    . TRP A 1 297 ? 50.082  33.844  -9.021  1.00 43.62  ? 294  TRP A NE1    1 
ATOM   4744  C  CE2    . TRP A 1 297 ? 48.995  33.143  -8.571  1.00 30.34  ? 294  TRP A CE2    1 
ATOM   4745  C  CE3    . TRP A 1 297 ? 47.308  33.354  -6.858  1.00 38.63  ? 294  TRP A CE3    1 
ATOM   4746  C  CZ2    . TRP A 1 297 ? 48.462  31.944  -9.012  1.00 37.95  ? 294  TRP A CZ2    1 
ATOM   4747  C  CZ3    . TRP A 1 297 ? 46.782  32.161  -7.296  1.00 35.25  ? 294  TRP A CZ3    1 
ATOM   4748  C  CH2    . TRP A 1 297 ? 47.357  31.470  -8.363  1.00 52.76  ? 294  TRP A CH2    1 
ATOM   4749  H  H      . TRP A 1 297 ? 50.910  35.409  -4.861  1.00 30.77  ? 294  TRP A H      1 
ATOM   4750  H  HA     . TRP A 1 297 ? 50.724  37.104  -6.883  1.00 40.69  ? 294  TRP A HA     1 
ATOM   4751  H  HB2    . TRP A 1 297 ? 48.756  35.678  -5.468  1.00 44.98  ? 294  TRP A HB2    1 
ATOM   4752  H  HB3    . TRP A 1 297 ? 48.356  36.711  -6.609  1.00 44.98  ? 294  TRP A HB3    1 
ATOM   4753  H  HD1    . TRP A 1 297 ? 50.888  35.616  -8.378  1.00 44.47  ? 294  TRP A HD1    1 
ATOM   4754  H  HE1    . TRP A 1 297 ? 50.594  33.611  -9.672  1.00 52.34  ? 294  TRP A HE1    1 
ATOM   4755  H  HE3    . TRP A 1 297 ? 46.922  33.809  -6.145  1.00 46.36  ? 294  TRP A HE3    1 
ATOM   4756  H  HZ2    . TRP A 1 297 ? 48.841  31.480  -9.723  1.00 45.55  ? 294  TRP A HZ2    1 
ATOM   4757  H  HZ3    . TRP A 1 297 ? 46.028  31.813  -6.878  1.00 42.30  ? 294  TRP A HZ3    1 
ATOM   4758  H  HH2    . TRP A 1 297 ? 46.976  30.668  -8.642  1.00 63.31  ? 294  TRP A HH2    1 
ATOM   4759  N  N      . GLU A 1 298 ? 49.916  38.178  -4.019  1.00 28.42  ? 295  GLU A N      1 
ATOM   4760  C  CA     . GLU A 1 298 ? 49.630  39.396  -3.276  1.00 26.31  ? 295  GLU A CA     1 
ATOM   4761  C  C      . GLU A 1 298 ? 50.758  40.392  -3.501  1.00 30.55  ? 295  GLU A C      1 
ATOM   4762  O  O      . GLU A 1 298 ? 50.521  41.599  -3.612  1.00 29.02  ? 295  GLU A O      1 
ATOM   4763  C  CB     . GLU A 1 298 ? 49.431  39.103  -1.791  1.00 24.69  ? 295  GLU A CB     1 
ATOM   4764  C  CG     . GLU A 1 298 ? 48.221  38.232  -1.513  1.00 32.35  ? 295  GLU A CG     1 
ATOM   4765  C  CD     . GLU A 1 298 ? 48.048  37.898  -0.045  1.00 40.96  ? 295  GLU A CD     1 
ATOM   4766  O  OE1    . GLU A 1 298 ? 48.984  38.147  0.743   1.00 47.52  ? 295  GLU A OE1    1 
ATOM   4767  O  OE2    . GLU A 1 298 ? 46.969  37.384  0.324   1.00 46.19  ? 295  GLU A OE2    1 
ATOM   4768  H  H      . GLU A 1 298 ? 50.025  37.478  -3.532  1.00 34.11  ? 295  GLU A H      1 
ATOM   4769  H  HA     . GLU A 1 298 ? 48.811  39.788  -3.616  1.00 31.57  ? 295  GLU A HA     1 
ATOM   4770  H  HB2    . GLU A 1 298 ? 50.215  38.643  -1.453  1.00 29.63  ? 295  GLU A HB2    1 
ATOM   4771  H  HB3    . GLU A 1 298 ? 49.311  39.942  -1.318  1.00 29.63  ? 295  GLU A HB3    1 
ATOM   4772  H  HG2    . GLU A 1 298 ? 47.424  38.698  -1.809  1.00 38.82  ? 295  GLU A HG2    1 
ATOM   4773  H  HG3    . GLU A 1 298 ? 48.317  37.398  -1.999  1.00 38.82  ? 295  GLU A HG3    1 
ATOM   4774  N  N      . ILE A 1 299 ? 51.978  39.886  -3.641  1.00 27.17  ? 296  ILE A N      1 
ATOM   4775  C  CA     . ILE A 1 299 ? 53.114  40.764  -3.859  1.00 22.86  ? 296  ILE A CA     1 
ATOM   4776  C  C      . ILE A 1 299 ? 53.030  41.353  -5.247  1.00 28.27  ? 296  ILE A C      1 
ATOM   4777  O  O      . ILE A 1 299 ? 53.213  42.561  -5.402  1.00 24.04  ? 296  ILE A O      1 
ATOM   4778  C  CB     . ILE A 1 299 ? 54.449  40.035  -3.683  1.00 20.59  ? 296  ILE A CB     1 
ATOM   4779  C  CG1    . ILE A 1 299 ? 54.609  39.599  -2.228  1.00 14.71  ? 296  ILE A CG1    1 
ATOM   4780  C  CG2    . ILE A 1 299 ? 55.611  40.952  -4.048  1.00 22.42  ? 296  ILE A CG2    1 
ATOM   4781  C  CD1    . ILE A 1 299 ? 55.726  38.611  -2.005  1.00 19.05  ? 296  ILE A CD1    1 
ATOM   4782  H  H      . ILE A 1 299 ? 52.171  39.048  -3.614  1.00 32.60  ? 296  ILE A H      1 
ATOM   4783  H  HA     . ILE A 1 299 ? 53.081  41.492  -3.218  1.00 27.44  ? 296  ILE A HA     1 
ATOM   4784  H  HB     . ILE A 1 299 ? 54.465  39.253  -4.257  1.00 24.70  ? 296  ILE A HB     1 
ATOM   4785  H  HG12   . ILE A 1 299 ? 54.793  40.382  -1.686  1.00 17.66  ? 296  ILE A HG12   1 
ATOM   4786  H  HG13   . ILE A 1 299 ? 53.783  39.183  -1.935  1.00 17.66  ? 296  ILE A HG13   1 
ATOM   4787  H  HG21   . ILE A 1 299 ? 55.594  41.729  -3.467  1.00 26.90  ? 296  ILE A HG21   1 
ATOM   4788  H  HG22   . ILE A 1 299 ? 56.444  40.468  -3.928  1.00 26.90  ? 296  ILE A HG22   1 
ATOM   4789  H  HG23   . ILE A 1 299 ? 55.518  41.227  -4.973  1.00 26.90  ? 296  ILE A HG23   1 
ATOM   4790  H  HD11   . ILE A 1 299 ? 56.564  39.015  -2.281  1.00 22.86  ? 296  ILE A HD11   1 
ATOM   4791  H  HD12   . ILE A 1 299 ? 55.763  38.385  -1.062  1.00 22.86  ? 296  ILE A HD12   1 
ATOM   4792  H  HD13   . ILE A 1 299 ? 55.553  37.814  -2.530  1.00 22.86  ? 296  ILE A HD13   1 
ATOM   4793  N  N      . MET A 1 300 ? 52.744  40.518  -6.249  1.00 35.25  ? 297  MET A N      1 
ATOM   4794  C  CA     . MET A 1 300 ? 52.635  40.993  -7.634  1.00 25.12  ? 297  MET A CA     1 
ATOM   4795  C  C      . MET A 1 300 ? 51.508  41.998  -7.793  1.00 27.08  ? 297  MET A C      1 
ATOM   4796  O  O      . MET A 1 300 ? 51.677  43.027  -8.449  1.00 26.74  ? 297  MET A O      1 
ATOM   4797  C  CB     . MET A 1 300 ? 52.418  39.840  -8.606  1.00 25.80  ? 297  MET A CB     1 
ATOM   4798  C  CG     . MET A 1 300 ? 53.600  38.920  -8.797  1.00 26.05  ? 297  MET A CG     1 
ATOM   4799  S  SD     . MET A 1 300 ? 53.082  37.469  -9.722  1.00 39.19  ? 297  MET A SD     1 
ATOM   4800  C  CE     . MET A 1 300 ? 52.868  38.219  -11.332 1.00 35.75  ? 297  MET A CE     1 
ATOM   4801  H  H      . MET A 1 300 ? 52.608  39.674  -6.154  1.00 42.30  ? 297  MET A H      1 
ATOM   4802  H  HA     . MET A 1 300 ? 53.469  41.425  -7.876  1.00 30.15  ? 297  MET A HA     1 
ATOM   4803  H  HB2    . MET A 1 300 ? 51.680  39.301  -8.282  1.00 30.96  ? 297  MET A HB2    1 
ATOM   4804  H  HB3    . MET A 1 300 ? 52.194  40.209  -9.474  1.00 30.96  ? 297  MET A HB3    1 
ATOM   4805  H  HG2    . MET A 1 300 ? 54.292  39.378  -9.299  1.00 31.26  ? 297  MET A HG2    1 
ATOM   4806  H  HG3    . MET A 1 300 ? 53.935  38.634  -7.933  1.00 31.26  ? 297  MET A HG3    1 
ATOM   4807  H  HE1    . MET A 1 300 ? 53.713  38.599  -11.618 1.00 42.90  ? 297  MET A HE1    1 
ATOM   4808  H  HE2    . MET A 1 300 ? 52.580  37.539  -11.961 1.00 42.90  ? 297  MET A HE2    1 
ATOM   4809  H  HE3    . MET A 1 300 ? 52.197  38.917  -11.268 1.00 42.90  ? 297  MET A HE3    1 
ATOM   4810  N  N      . LEU A 1 301 ? 50.355  41.700  -7.201  1.00 20.49  ? 298  LEU A N      1 
ATOM   4811  C  CA     . LEU A 1 301 ? 49.239  42.633  -7.230  1.00 17.35  ? 298  LEU A CA     1 
ATOM   4812  C  C      . LEU A 1 301 ? 49.628  43.948  -6.547  1.00 33.77  ? 298  LEU A C      1 
ATOM   4813  O  O      . LEU A 1 301 ? 49.362  45.017  -7.091  1.00 32.53  ? 298  LEU A O      1 
ATOM   4814  C  CB     . LEU A 1 301 ? 48.010  42.016  -6.565  1.00 18.37  ? 298  LEU A CB     1 
ATOM   4815  C  CG     . LEU A 1 301 ? 47.382  40.822  -7.284  1.00 28.61  ? 298  LEU A CG     1 
ATOM   4816  C  CD1    . LEU A 1 301 ? 46.308  40.189  -6.425  1.00 31.10  ? 298  LEU A CD1    1 
ATOM   4817  C  CD2    . LEU A 1 301 ? 46.772  41.280  -8.602  1.00 16.69  ? 298  LEU A CD2    1 
ATOM   4818  H  H      . LEU A 1 301 ? 50.197  40.968  -6.778  1.00 24.59  ? 298  LEU A H      1 
ATOM   4819  H  HA     . LEU A 1 301 ? 49.014  42.829  -8.153  1.00 20.82  ? 298  LEU A HA     1 
ATOM   4820  H  HB2    . LEU A 1 301 ? 48.262  41.718  -5.676  1.00 22.05  ? 298  LEU A HB2    1 
ATOM   4821  H  HB3    . LEU A 1 301 ? 47.326  42.701  -6.492  1.00 22.05  ? 298  LEU A HB3    1 
ATOM   4822  H  HG     . LEU A 1 301 ? 48.064  40.157  -7.471  1.00 34.33  ? 298  LEU A HG     1 
ATOM   4823  H  HD11   . LEU A 1 301 ? 45.621  40.848  -6.242  1.00 37.32  ? 298  LEU A HD11   1 
ATOM   4824  H  HD12   . LEU A 1 301 ? 45.926  39.435  -6.901  1.00 37.32  ? 298  LEU A HD12   1 
ATOM   4825  H  HD13   . LEU A 1 301 ? 46.706  39.887  -5.593  1.00 37.32  ? 298  LEU A HD13   1 
ATOM   4826  H  HD21   . LEU A 1 301 ? 47.470  41.664  -9.156  1.00 20.03  ? 298  LEU A HD21   1 
ATOM   4827  H  HD22   . LEU A 1 301 ? 46.378  40.516  -9.050  1.00 20.03  ? 298  LEU A HD22   1 
ATOM   4828  H  HD23   . LEU A 1 301 ? 46.091  41.945  -8.420  1.00 20.03  ? 298  LEU A HD23   1 
ATOM   4829  N  N      . GLN A 1 302 ? 50.254  43.888  -5.368  1.00 29.18  ? 299  GLN A N      1 
ATOM   4830  C  CA     . GLN A 1 302 ? 50.629  45.125  -4.676  1.00 25.57  ? 299  GLN A CA     1 
ATOM   4831  C  C      . GLN A 1 302 ? 51.603  45.985  -5.488  1.00 32.63  ? 299  GLN A C      1 
ATOM   4832  O  O      . GLN A 1 302 ? 51.593  47.208  -5.368  1.00 37.62  ? 299  GLN A O      1 
ATOM   4833  C  CB     . GLN A 1 302 ? 51.232  44.843  -3.298  1.00 30.17  ? 299  GLN A CB     1 
ATOM   4834  C  CG     . GLN A 1 302 ? 51.698  46.137  -2.609  1.00 24.30  ? 299  GLN A CG     1 
ATOM   4835  C  CD     . GLN A 1 302 ? 51.559  46.143  -1.098  1.00 24.16  ? 299  GLN A CD     1 
ATOM   4836  O  OE1    . GLN A 1 302 ? 51.039  45.206  -0.495  1.00 32.80  ? 299  GLN A OE1    1 
ATOM   4837  N  NE2    . GLN A 1 302 ? 51.990  47.235  -0.483  1.00 18.83  ? 299  GLN A NE2    1 
ATOM   4838  H  H      . GLN A 1 302 ? 50.467  43.164  -4.956  1.00 35.02  ? 299  GLN A H      1 
ATOM   4839  H  HA     . GLN A 1 302 ? 49.826  45.651  -4.538  1.00 30.68  ? 299  GLN A HA     1 
ATOM   4840  H  HB2    . GLN A 1 302 ? 50.562  44.424  -2.736  1.00 36.21  ? 299  GLN A HB2    1 
ATOM   4841  H  HB3    . GLN A 1 302 ? 52.000  44.259  -3.398  1.00 36.21  ? 299  GLN A HB3    1 
ATOM   4842  H  HG2    . GLN A 1 302 ? 52.635  46.277  -2.817  1.00 29.16  ? 299  GLN A HG2    1 
ATOM   4843  H  HG3    . GLN A 1 302 ? 51.174  46.877  -2.954  1.00 29.16  ? 299  GLN A HG3    1 
ATOM   4844  H  HE21   . GLN A 1 302 ? 52.322  47.883  -0.941  1.00 22.59  ? 299  GLN A HE21   1 
ATOM   4845  H  HE22   . GLN A 1 302 ? 51.936  47.296  0.373   1.00 22.59  ? 299  GLN A HE22   1 
ATOM   4846  N  N      . TYR A 1 303 ? 52.429  45.357  -6.320  1.00 24.44  ? 300  TYR A N      1 
ATOM   4847  C  CA     . TYR A 1 303 ? 53.464  46.080  -7.061  1.00 22.06  ? 300  TYR A CA     1 
ATOM   4848  C  C      . TYR A 1 303 ? 53.057  46.480  -8.466  1.00 38.22  ? 300  TYR A C      1 
ATOM   4849  O  O      . TYR A 1 303 ? 53.690  47.367  -9.045  1.00 41.49  ? 300  TYR A O      1 
ATOM   4850  C  CB     . TYR A 1 303 ? 54.743  45.237  -7.115  1.00 22.07  ? 300  TYR A CB     1 
ATOM   4851  C  CG     . TYR A 1 303 ? 55.680  45.536  -5.973  1.00 21.71  ? 300  TYR A CG     1 
ATOM   4852  C  CD1    . TYR A 1 303 ? 55.414  45.086  -4.696  1.00 20.24  ? 300  TYR A CD1    1 
ATOM   4853  C  CD2    . TYR A 1 303 ? 56.841  46.259  -6.183  1.00 25.45  ? 300  TYR A CD2    1 
ATOM   4854  C  CE1    . TYR A 1 303 ? 56.261  45.376  -3.649  1.00 32.41  ? 300  TYR A CE1    1 
ATOM   4855  C  CE2    . TYR A 1 303 ? 57.695  46.547  -5.152  1.00 26.05  ? 300  TYR A CE2    1 
ATOM   4856  C  CZ     . TYR A 1 303 ? 57.405  46.103  -3.880  1.00 35.91  ? 300  TYR A CZ     1 
ATOM   4857  O  OH     . TYR A 1 303 ? 58.264  46.383  -2.834  1.00 26.29  ? 300  TYR A OH     1 
ATOM   4858  H  H      . TYR A 1 303 ? 52.412  44.511  -6.475  1.00 29.33  ? 300  TYR A H      1 
ATOM   4859  H  HA     . TYR A 1 303 ? 53.673  46.895  -6.577  1.00 26.47  ? 300  TYR A HA     1 
ATOM   4860  H  HB2    . TYR A 1 303 ? 54.504  44.297  -7.070  1.00 26.49  ? 300  TYR A HB2    1 
ATOM   4861  H  HB3    . TYR A 1 303 ? 55.210  45.422  -7.944  1.00 26.49  ? 300  TYR A HB3    1 
ATOM   4862  H  HD1    . TYR A 1 303 ? 57.037  46.569  -7.037  1.00 30.54  ? 300  TYR A HD1    1 
ATOM   4863  H  HD2    . TYR A 1 303 ? 54.637  44.602  -4.534  1.00 24.29  ? 300  TYR A HD2    1 
ATOM   4864  H  HE1    . TYR A 1 303 ? 58.468  47.039  -5.310  1.00 31.26  ? 300  TYR A HE1    1 
ATOM   4865  H  HE2    . TYR A 1 303 ? 56.067  45.070  -2.793  1.00 38.90  ? 300  TYR A HE2    1 
ATOM   4866  H  HH     . TYR A 1 303 ? 57.965  46.054  -2.121  1.00 31.55  ? 300  TYR A HH     1 
ATOM   4867  N  N      . CYS A 1 304 ? 52.012  45.844  -9.005  1.00 33.98  ? 301  CYS A N      1 
ATOM   4868  C  CA     . CYS A 1 304 ? 51.648  45.995  -10.418 1.00 18.82  ? 301  CYS A CA     1 
ATOM   4869  C  C      . CYS A 1 304 ? 50.162  46.245  -10.717 1.00 29.78  ? 301  CYS A C      1 
ATOM   4870  O  O      . CYS A 1 304 ? 49.826  46.729  -11.797 1.00 42.52  ? 301  CYS A O      1 
ATOM   4871  C  CB     . CYS A 1 304 ? 52.122  44.767  -11.189 1.00 27.64  ? 301  CYS A CB     1 
ATOM   4872  S  SG     . CYS A 1 304 ? 53.914  44.566  -11.189 1.00 28.94  ? 301  CYS A SG     1 
ATOM   4873  H  H      . CYS A 1 304 ? 51.494  45.314  -8.569  1.00 40.78  ? 301  CYS A H      1 
ATOM   4874  H  HA     . CYS A 1 304 ? 52.137  46.756  -10.770 1.00 22.58  ? 301  CYS A HA     1 
ATOM   4875  H  HB2    . CYS A 1 304 ? 51.733  43.975  -10.785 1.00 33.17  ? 301  CYS A HB2    1 
ATOM   4876  H  HB3    . CYS A 1 304 ? 51.831  44.844  -12.111 1.00 33.17  ? 301  CYS A HB3    1 
ATOM   4877  H  HG     . CYS A 1 304 ? 54.416  45.530  -11.697 1.00 34.73  ? 301  CYS A HG     1 
ATOM   4878  N  N      . PHE A 1 305 ? 49.276  45.937  -9.776  1.00 26.70  ? 302  PHE A N      1 
ATOM   4879  C  CA     . PHE A 1 305 ? 47.833  46.098  -10.002 1.00 21.48  ? 302  PHE A CA     1 
ATOM   4880  C  C      . PHE A 1 305 ? 47.404  47.563  -9.949  1.00 42.86  ? 302  PHE A C      1 
ATOM   4881  O  O      . PHE A 1 305 ? 47.938  48.335  -9.146  1.00 46.86  ? 302  PHE A O      1 
ATOM   4882  C  CB     . PHE A 1 305 ? 47.026  45.310  -8.972  1.00 31.96  ? 302  PHE A CB     1 
ATOM   4883  C  CG     . PHE A 1 305 ? 45.557  45.255  -9.279  1.00 31.55  ? 302  PHE A CG     1 
ATOM   4884  C  CD1    . PHE A 1 305 ? 45.031  44.267  -10.095 1.00 37.57  ? 302  PHE A CD1    1 
ATOM   4885  C  CD2    . PHE A 1 305 ? 44.703  46.222  -8.780  1.00 36.16  ? 302  PHE A CD2    1 
ATOM   4886  C  CE1    . PHE A 1 305 ? 43.674  44.236  -10.383 1.00 33.77  ? 302  PHE A CE1    1 
ATOM   4887  C  CE2    . PHE A 1 305 ? 43.351  46.196  -9.068  1.00 43.05  ? 302  PHE A CE2    1 
ATOM   4888  C  CZ     . PHE A 1 305 ? 42.837  45.204  -9.868  1.00 30.12  ? 302  PHE A CZ     1 
ATOM   4889  H  H      . PHE A 1 305 ? 49.479  45.634  -8.997  1.00 32.04  ? 302  PHE A H      1 
ATOM   4890  H  HA     . PHE A 1 305 ? 47.613  45.753  -10.882 1.00 25.78  ? 302  PHE A HA     1 
ATOM   4891  H  HB2    . PHE A 1 305 ? 47.358  44.400  -8.943  1.00 38.35  ? 302  PHE A HB2    1 
ATOM   4892  H  HB3    . PHE A 1 305 ? 47.133  45.729  -8.104  1.00 38.35  ? 302  PHE A HB3    1 
ATOM   4893  H  HD1    . PHE A 1 305 ? 45.591  43.612  -10.444 1.00 45.08  ? 302  PHE A HD1    1 
ATOM   4894  H  HD2    . PHE A 1 305 ? 45.042  46.896  -8.236  1.00 43.39  ? 302  PHE A HD2    1 
ATOM   4895  H  HE1    . PHE A 1 305 ? 43.329  43.565  -10.926 1.00 40.53  ? 302  PHE A HE1    1 
ATOM   4896  H  HE2    . PHE A 1 305 ? 42.789  46.848  -8.717  1.00 51.65  ? 302  PHE A HE2    1 
ATOM   4897  H  HZ     . PHE A 1 305 ? 41.928  45.184  -10.060 1.00 36.14  ? 302  PHE A HZ     1 
ATOM   4898  N  N      . PRO A 1 306 ? 46.440  47.965  -10.806 1.00 50.53  ? 303  PRO A N      1 
ATOM   4899  C  CA     . PRO A 1 306 ? 46.108  49.395  -10.877 1.00 37.49  ? 303  PRO A CA     1 
ATOM   4900  C  C      . PRO A 1 306 ? 45.554  50.035  -9.605  1.00 32.98  ? 303  PRO A C      1 
ATOM   4901  O  O      . PRO A 1 306 ? 44.812  49.388  -8.868  1.00 38.15  ? 303  PRO A O      1 
ATOM   4902  C  CB     . PRO A 1 306 ? 45.041  49.447  -11.978 1.00 40.57  ? 303  PRO A CB     1 
ATOM   4903  C  CG     . PRO A 1 306 ? 44.527  48.068  -12.101 1.00 41.79  ? 303  PRO A CG     1 
ATOM   4904  C  CD     . PRO A 1 306 ? 45.707  47.206  -11.836 1.00 49.10  ? 303  PRO A CD     1 
ATOM   4905  H  HA     . PRO A 1 306 ? 46.884  49.899  -11.169 1.00 44.99  ? 303  PRO A HA     1 
ATOM   4906  H  HB2    . PRO A 1 306 ? 44.331  50.054  -11.714 1.00 48.69  ? 303  PRO A HB2    1 
ATOM   4907  H  HB3    . PRO A 1 306 ? 45.446  49.736  -12.810 1.00 48.69  ? 303  PRO A HB3    1 
ATOM   4908  H  HG2    . PRO A 1 306 ? 43.833  47.916  -11.440 1.00 50.15  ? 303  PRO A HG2    1 
ATOM   4909  H  HG3    . PRO A 1 306 ? 44.188  47.922  -12.998 1.00 50.15  ? 303  PRO A HG3    1 
ATOM   4910  H  HD2    . PRO A 1 306 ? 45.428  46.345  -11.488 1.00 58.92  ? 303  PRO A HD2    1 
ATOM   4911  H  HD3    . PRO A 1 306 ? 46.246  47.112  -12.637 1.00 58.92  ? 303  PRO A HD3    1 
ATOM   4912  N  N      . ARG A 1 307 ? 45.923  51.294  -9.360  1.00 28.94  ? 304  ARG A N      1 
ATOM   4913  C  CA     . ARG A 1 307 ? 45.318  52.088  -8.289  1.00 38.63  ? 304  ARG A CA     1 
ATOM   4914  C  C      . ARG A 1 307 ? 44.367  53.121  -8.871  1.00 31.24  ? 304  ARG A C      1 
ATOM   4915  O  O      . ARG A 1 307 ? 44.745  53.911  -9.735  1.00 31.99  ? 304  ARG A O      1 
ATOM   4916  C  CB     . ARG A 1 307 ? 46.364  52.810  -7.440  1.00 45.32  ? 304  ARG A CB     1 
ATOM   4917  C  CG     . ARG A 1 307 ? 47.144  51.940  -6.472  1.00 35.55  ? 304  ARG A CG     1 
ATOM   4918  C  CD     . ARG A 1 307 ? 48.543  51.632  -6.948  1.00 35.39  ? 304  ARG A CD     1 
ATOM   4919  N  NE     . ARG A 1 307 ? 49.424  51.406  -5.804  1.00 38.49  ? 304  ARG A NE     1 
ATOM   4920  C  CZ     . ARG A 1 307 ? 49.966  50.245  -5.465  1.00 41.05  ? 304  ARG A CZ     1 
ATOM   4921  N  NH1    . ARG A 1 307 ? 49.730  49.147  -6.171  1.00 52.37  ? 304  ARG A NH1    1 
ATOM   4922  N  NH2    . ARG A 1 307 ? 50.750  50.185  -4.398  1.00 26.17  ? 304  ARG A NH2    1 
ATOM   4923  H  H      . ARG A 1 307 ? 46.528  51.714  -9.805  1.00 34.73  ? 304  ARG A H      1 
ATOM   4924  H  HA     . ARG A 1 307 ? 44.809  51.502  -7.708  1.00 46.36  ? 304  ARG A HA     1 
ATOM   4925  H  HB2    . ARG A 1 307 ? 47.006  53.228  -8.035  1.00 54.38  ? 304  ARG A HB2    1 
ATOM   4926  H  HB3    . ARG A 1 307 ? 45.916  53.494  -6.918  1.00 54.38  ? 304  ARG A HB3    1 
ATOM   4927  H  HG2    . ARG A 1 307 ? 47.213  52.400  -5.620  1.00 42.66  ? 304  ARG A HG2    1 
ATOM   4928  H  HG3    . ARG A 1 307 ? 46.676  51.099  -6.357  1.00 42.66  ? 304  ARG A HG3    1 
ATOM   4929  H  HD2    . ARG A 1 307 ? 48.532  50.829  -7.492  1.00 42.47  ? 304  ARG A HD2    1 
ATOM   4930  H  HD3    . ARG A 1 307 ? 48.886  52.384  -7.457  1.00 42.47  ? 304  ARG A HD3    1 
ATOM   4931  H  HE     . ARG A 1 307 ? 49.606  52.084  -5.308  1.00 46.19  ? 304  ARG A HE     1 
ATOM   4932  H  HH11   . ARG A 1 307 ? 49.221  49.182  -6.864  1.00 62.85  ? 304  ARG A HH11   1 
ATOM   4933  H  HH12   . ARG A 1 307 ? 50.088  48.400  -5.938  1.00 62.85  ? 304  ARG A HH12   1 
ATOM   4934  H  HH21   . ARG A 1 307 ? 50.904  50.894  -3.937  1.00 31.40  ? 304  ARG A HH21   1 
ATOM   4935  H  HH22   . ARG A 1 307 ? 51.106  49.436  -4.167  1.00 31.40  ? 304  ARG A HH22   1 
ATOM   4936  N  N      . LEU A 1 308 ? 43.146  53.129  -8.351  1.00 25.46  ? 305  LEU A N      1 
ATOM   4937  C  CA     . LEU A 1 308 ? 42.065  53.936  -8.890  1.00 34.96  ? 305  LEU A CA     1 
ATOM   4938  C  C      . LEU A 1 308 ? 41.509  54.941  -7.881  1.00 46.39  ? 305  LEU A C      1 
ATOM   4939  O  O      . LEU A 1 308 ? 41.175  54.579  -6.754  1.00 43.21  ? 305  LEU A O      1 
ATOM   4940  C  CB     . LEU A 1 308 ? 40.932  53.027  -9.369  1.00 31.32  ? 305  LEU A CB     1 
ATOM   4941  C  CG     . LEU A 1 308 ? 41.190  52.112  -10.566 1.00 31.36  ? 305  LEU A CG     1 
ATOM   4942  C  CD1    . LEU A 1 308 ? 39.922  51.344  -10.871 1.00 36.29  ? 305  LEU A CD1    1 
ATOM   4943  C  CD2    . LEU A 1 308 ? 41.649  52.884  -11.789 1.00 37.85  ? 305  LEU A CD2    1 
ATOM   4944  H  H      . LEU A 1 308 ? 42.915  52.661  -7.667  1.00 30.56  ? 305  LEU A H      1 
ATOM   4945  H  HA     . LEU A 1 308 ? 42.395  54.432  -9.655  1.00 41.95  ? 305  LEU A HA     1 
ATOM   4946  H  HB2    . LEU A 1 308 ? 40.678  52.454  -8.628  1.00 37.58  ? 305  LEU A HB2    1 
ATOM   4947  H  HB3    . LEU A 1 308 ? 40.179  53.591  -9.605  1.00 37.58  ? 305  LEU A HB3    1 
ATOM   4948  H  HG     . LEU A 1 308 ? 41.882  51.472  -10.335 1.00 37.63  ? 305  LEU A HG     1 
ATOM   4949  H  HD11   . LEU A 1 308 ? 39.215  51.974  -11.079 1.00 43.55  ? 305  LEU A HD11   1 
ATOM   4950  H  HD12   . LEU A 1 308 ? 40.081  50.762  -11.630 1.00 43.55  ? 305  LEU A HD12   1 
ATOM   4951  H  HD13   . LEU A 1 308 ? 39.679  50.817  -10.094 1.00 43.55  ? 305  LEU A HD13   1 
ATOM   4952  H  HD21   . LEU A 1 308 ? 42.473  53.349  -11.578 1.00 45.42  ? 305  LEU A HD21   1 
ATOM   4953  H  HD22   . LEU A 1 308 ? 41.798  52.261  -12.518 1.00 45.42  ? 305  LEU A HD22   1 
ATOM   4954  H  HD23   . LEU A 1 308 ? 40.962  53.522  -12.035 1.00 45.42  ? 305  LEU A HD23   1 
ATOM   4955  N  N      . ASP A 1 309 ? 41.394  56.196  -8.300  1.00 29.12  ? 306  ASP A N      1 
ATOM   4956  C  CA     . ASP A 1 309 ? 40.798  57.225  -7.463  1.00 36.57  ? 306  ASP A CA     1 
ATOM   4957  C  C      . ASP A 1 309 ? 39.280  57.049  -7.470  1.00 39.15  ? 306  ASP A C      1 
ATOM   4958  O  O      . ASP A 1 309 ? 38.630  57.400  -8.450  1.00 56.88  ? 306  ASP A O      1 
ATOM   4959  C  CB     . ASP A 1 309 ? 41.185  58.615  -7.988  1.00 52.82  ? 306  ASP A CB     1 
ATOM   4960  C  CG     . ASP A 1 309 ? 40.801  59.738  -7.036  1.00 74.77  ? 306  ASP A CG     1 
ATOM   4961  O  OD1    . ASP A 1 309 ? 40.089  59.483  -6.038  1.00 63.86  ? 306  ASP A OD1    1 
ATOM   4962  O  OD2    . ASP A 1 309 ? 41.208  60.889  -7.300  1.00 59.52  ? 306  ASP A OD2    1 
ATOM   4963  H  H      . ASP A 1 309 ? 41.655  56.477  -9.070  1.00 34.95  ? 306  ASP A H      1 
ATOM   4964  H  HA     . ASP A 1 309 ? 41.119  57.134  -6.552  1.00 43.89  ? 306  ASP A HA     1 
ATOM   4965  H  HB2    . ASP A 1 309 ? 42.146  58.647  -8.117  1.00 63.39  ? 306  ASP A HB2    1 
ATOM   4966  H  HB3    . ASP A 1 309 ? 40.732  58.770  -8.831  1.00 63.39  ? 306  ASP A HB3    1 
ATOM   4967  N  N      . ILE A 1 310 ? 38.712  56.522  -6.387  1.00 29.46  ? 307  ILE A N      1 
ATOM   4968  C  CA     . ILE A 1 310 ? 37.269  56.257  -6.355  1.00 55.88  ? 307  ILE A CA     1 
ATOM   4969  C  C      . ILE A 1 310 ? 36.426  57.507  -6.599  1.00 57.46  ? 307  ILE A C      1 
ATOM   4970  O  O      . ILE A 1 310 ? 35.319  57.424  -7.131  1.00 51.34  ? 307  ILE A O      1 
ATOM   4971  C  CB     . ILE A 1 310 ? 36.821  55.636  -5.000  1.00 64.11  ? 307  ILE A CB     1 
ATOM   4972  C  CG1    . ILE A 1 310 ? 35.328  55.285  -5.053  1.00 62.68  ? 307  ILE A CG1    1 
ATOM   4973  C  CG2    . ILE A 1 310 ? 37.027  56.611  -3.845  1.00 61.69  ? 307  ILE A CG2    1 
ATOM   4974  C  CD1    . ILE A 1 310 ? 34.912  54.111  -4.186  1.00 66.80  ? 307  ILE A CD1    1 
ATOM   4975  H  H      . ILE A 1 310 ? 39.130  56.311  -5.666  1.00 35.35  ? 307  ILE A H      1 
ATOM   4976  H  HA     . ILE A 1 310 ? 37.057  55.619  -7.054  1.00 67.05  ? 307  ILE A HA     1 
ATOM   4977  H  HB     . ILE A 1 310 ? 37.333  54.830  -4.833  1.00 76.93  ? 307  ILE A HB     1 
ATOM   4978  H  HG12   . ILE A 1 310 ? 34.819  56.058  -4.762  1.00 75.22  ? 307  ILE A HG12   1 
ATOM   4979  H  HG13   . ILE A 1 310 ? 35.094  55.069  -5.970  1.00 75.22  ? 307  ILE A HG13   1 
ATOM   4980  H  HG21   . ILE A 1 310 ? 36.503  57.411  -4.010  1.00 74.02  ? 307  ILE A HG21   1 
ATOM   4981  H  HG22   . ILE A 1 310 ? 36.737  56.189  -3.021  1.00 74.02  ? 307  ILE A HG22   1 
ATOM   4982  H  HG23   . ILE A 1 310 ? 37.968  56.838  -3.788  1.00 74.02  ? 307  ILE A HG23   1 
ATOM   4983  H  HD11   . ILE A 1 310 ? 35.121  54.313  -3.260  1.00 80.17  ? 307  ILE A HD11   1 
ATOM   4984  H  HD12   . ILE A 1 310 ? 33.958  53.967  -4.286  1.00 80.17  ? 307  ILE A HD12   1 
ATOM   4985  H  HD13   . ILE A 1 310 ? 35.397  53.321  -4.470  1.00 80.17  ? 307  ILE A HD13   1 
ATOM   4986  N  N      . ASN A 1 311 ? 36.950  58.664  -6.213  1.00 59.14  ? 308  ASN A N      1 
ATOM   4987  C  CA     . ASN A 1 311 ? 36.204  59.911  -6.329  1.00 55.07  ? 308  ASN A CA     1 
ATOM   4988  C  C      . ASN A 1 311 ? 35.949  60.347  -7.767  1.00 54.12  ? 308  ASN A C      1 
ATOM   4989  O  O      . ASN A 1 311 ? 34.905  60.927  -8.075  1.00 59.71  ? 308  ASN A O      1 
ATOM   4990  C  CB     . ASN A 1 311 ? 36.930  61.025  -5.578  1.00 54.38  ? 308  ASN A CB     1 
ATOM   4991  C  CG     . ASN A 1 311 ? 36.855  60.854  -4.079  1.00 69.65  ? 308  ASN A CG     1 
ATOM   4992  O  OD1    . ASN A 1 311 ? 35.863  60.347  -3.552  1.00 59.94  ? 308  ASN A OD1    1 
ATOM   4993  N  ND2    . ASN A 1 311 ? 37.907  61.267  -3.380  1.00 91.02  ? 308  ASN A ND2    1 
ATOM   4994  H  H      . ASN A 1 311 ? 37.738  58.754  -5.881  1.00 70.96  ? 308  ASN A H      1 
ATOM   4995  H  HA     . ASN A 1 311 ? 35.339  59.791  -5.905  1.00 66.08  ? 308  ASN A HA     1 
ATOM   4996  H  HB2    . ASN A 1 311 ? 37.866  61.022  -5.835  1.00 65.26  ? 308  ASN A HB2    1 
ATOM   4997  H  HB3    . ASN A 1 311 ? 36.525  61.877  -5.805  1.00 65.26  ? 308  ASN A HB3    1 
ATOM   4998  H  HD21   . ASN A 1 311 ? 38.583  61.611  -3.784  1.00 109.22 ? 308  ASN A HD21   1 
ATOM   4999  H  HD22   . ASN A 1 311 ? 37.911  61.191  -2.523  1.00 109.22 ? 308  ASN A HD22   1 
ATOM   5000  N  N      . VAL A 1 312 ? 36.900  60.068  -8.649  1.00 40.50  ? 309  VAL A N      1 
ATOM   5001  C  CA     . VAL A 1 312 ? 36.758  60.472  -10.039 1.00 43.41  ? 309  VAL A CA     1 
ATOM   5002  C  C      . VAL A 1 312 ? 35.601  59.719  -10.694 1.00 46.47  ? 309  VAL A C      1 
ATOM   5003  O  O      . VAL A 1 312 ? 34.874  60.285  -11.510 1.00 63.65  ? 309  VAL A O      1 
ATOM   5004  C  CB     . VAL A 1 312 ? 38.057  60.220  -10.833 1.00 39.41  ? 309  VAL A CB     1 
ATOM   5005  C  CG1    . VAL A 1 312 ? 37.864  60.540  -12.310 1.00 48.58  ? 309  VAL A CG1    1 
ATOM   5006  C  CG2    . VAL A 1 312 ? 39.187  61.064  -10.272 1.00 36.61  ? 309  VAL A CG2    1 
ATOM   5007  H  H      . VAL A 1 312 ? 37.630  59.650  -8.470  1.00 48.60  ? 309  VAL A H      1 
ATOM   5008  H  HA     . VAL A 1 312 ? 36.561  61.421  -10.076 1.00 52.09  ? 309  VAL A HA     1 
ATOM   5009  H  HB     . VAL A 1 312 ? 38.305  59.286  -10.753 1.00 47.30  ? 309  VAL A HB     1 
ATOM   5010  H  HG11   . VAL A 1 312 ? 37.615  61.473  -12.401 1.00 58.30  ? 309  VAL A HG11   1 
ATOM   5011  H  HG12   . VAL A 1 312 ? 38.696  60.371  -12.780 1.00 58.30  ? 309  VAL A HG12   1 
ATOM   5012  H  HG13   . VAL A 1 312 ? 37.162  59.973  -12.666 1.00 58.30  ? 309  VAL A HG13   1 
ATOM   5013  H  HG21   . VAL A 1 312 ? 39.327  60.825  -9.342  1.00 43.93  ? 309  VAL A HG21   1 
ATOM   5014  H  HG22   . VAL A 1 312 ? 39.993  60.891  -10.783 1.00 43.93  ? 309  VAL A HG22   1 
ATOM   5015  H  HG23   . VAL A 1 312 ? 38.945  62.000  -10.340 1.00 43.93  ? 309  VAL A HG23   1 
ATOM   5016  N  N      . SER A 1 313 ? 35.426  58.452  -10.325 1.00 43.24  ? 310  SER A N      1 
ATOM   5017  C  CA     . SER A 1 313 ? 34.459  57.589  -10.993 1.00 30.91  ? 310  SER A CA     1 
ATOM   5018  C  C      . SER A 1 313 ? 33.119  57.494  -10.271 1.00 27.20  ? 310  SER A C      1 
ATOM   5019  O  O      . SER A 1 313 ? 32.139  57.042  -10.846 1.00 46.86  ? 310  SER A O      1 
ATOM   5020  C  CB     . SER A 1 313 ? 35.036  56.182  -11.140 1.00 29.65  ? 310  SER A CB     1 
ATOM   5021  O  OG     . SER A 1 313 ? 36.316  56.206  -11.744 1.00 33.88  ? 310  SER A OG     1 
ATOM   5022  H  H      . SER A 1 313 ? 35.858  58.068  -9.688  1.00 51.89  ? 310  SER A H      1 
ATOM   5023  H  HA     . SER A 1 313 ? 34.293  57.937  -11.883 1.00 37.10  ? 310  SER A HA     1 
ATOM   5024  H  HB2    . SER A 1 313 ? 35.111  55.780  -10.260 1.00 35.57  ? 310  SER A HB2    1 
ATOM   5025  H  HB3    . SER A 1 313 ? 34.438  55.654  -11.693 1.00 35.57  ? 310  SER A HB3    1 
ATOM   5026  H  HG     . SER A 1 313 ? 36.266  56.550  -12.509 1.00 40.66  ? 310  SER A HG     1 
ATOM   5027  N  N      . LYS A 1 314 ? 33.067  57.931  -9.021  1.00 40.34  ? 311  LYS A N      1 
ATOM   5028  C  CA     . LYS A 1 314 ? 31.842  57.808  -8.235  1.00 50.21  ? 311  LYS A CA     1 
ATOM   5029  C  C      . LYS A 1 314 ? 30.788  58.815  -8.681  1.00 53.23  ? 311  LYS A C      1 
ATOM   5030  O  O      . LYS A 1 314 ? 29.650  58.451  -8.983  1.00 48.57  ? 311  LYS A O      1 
ATOM   5031  C  CB     . LYS A 1 314 ? 32.165  57.999  -6.746  1.00 61.47  ? 311  LYS A CB     1 
ATOM   5032  C  CG     . LYS A 1 314 ? 30.985  57.846  -5.792  1.00 74.99  ? 311  LYS A CG     1 
ATOM   5033  C  CD     . LYS A 1 314 ? 31.417  58.121  -4.353  1.00 96.75  ? 311  LYS A CD     1 
ATOM   5034  C  CE     . LYS A 1 314 ? 30.253  58.085  -3.369  1.00 115.13 ? 311  LYS A CE     1 
ATOM   5035  N  NZ     . LYS A 1 314 ? 29.264  57.008  -3.658  1.00 120.31 ? 311  LYS A NZ     1 
ATOM   5036  H  H      . LYS A 1 314 ? 33.722  58.301  -8.604  1.00 48.41  ? 311  LYS A H      1 
ATOM   5037  H  HA     . LYS A 1 314 ? 31.477  56.917  -8.353  1.00 60.25  ? 311  LYS A HA     1 
ATOM   5038  H  HB2    . LYS A 1 314 ? 32.832  57.343  -6.490  1.00 73.76  ? 311  LYS A HB2    1 
ATOM   5039  H  HB3    . LYS A 1 314 ? 32.525  58.891  -6.622  1.00 73.76  ? 311  LYS A HB3    1 
ATOM   5040  H  HG2    . LYS A 1 314 ? 30.292  58.481  -6.031  1.00 89.98  ? 311  LYS A HG2    1 
ATOM   5041  H  HG3    . LYS A 1 314 ? 30.645  56.939  -5.842  1.00 89.98  ? 311  LYS A HG3    1 
ATOM   5042  H  HD2    . LYS A 1 314 ? 32.060  57.446  -4.081  1.00 116.09 ? 311  LYS A HD2    1 
ATOM   5043  H  HD3    . LYS A 1 314 ? 31.822  59.001  -4.307  1.00 116.09 ? 311  LYS A HD3    1 
ATOM   5044  H  HE2    . LYS A 1 314 ? 30.601  57.937  -2.475  1.00 138.15 ? 311  LYS A HE2    1 
ATOM   5045  H  HE3    . LYS A 1 314 ? 29.786  58.935  -3.404  1.00 138.15 ? 311  LYS A HE3    1 
ATOM   5046  H  HZ1    . LYS A 1 314 ? 29.662  56.213  -3.623  1.00 144.38 ? 311  LYS A HZ1    1 
ATOM   5047  H  HZ2    . LYS A 1 314 ? 28.607  57.030  -3.058  1.00 144.38 ? 311  LYS A HZ2    1 
ATOM   5048  H  HZ3    . LYS A 1 314 ? 28.918  57.123  -4.470  1.00 144.38 ? 311  LYS A HZ3    1 
ATOM   5049  N  N      . GLY A 1 315 ? 31.187  60.081  -8.726  1.00 55.68  ? 312  GLY A N      1 
ATOM   5050  C  CA     . GLY A 1 315 ? 30.277  61.185  -8.972  1.00 51.43  ? 312  GLY A CA     1 
ATOM   5051  C  C      . GLY A 1 315 ? 29.906  61.426  -10.425 1.00 55.65  ? 312  GLY A C      1 
ATOM   5052  O  O      . GLY A 1 315 ? 30.781  61.482  -11.295 1.00 42.74  ? 312  GLY A O      1 
ATOM   5053  H  H      . GLY A 1 315 ? 32.003  60.329  -8.614  1.00 66.82  ? 312  GLY A H      1 
ATOM   5054  H  HA2    . GLY A 1 315 ? 29.457  61.028  -8.480  1.00 61.72  ? 312  GLY A HA2    1 
ATOM   5055  H  HA3    . GLY A 1 315 ? 30.677  62.000  -8.631  1.00 61.72  ? 312  GLY A HA3    1 
ATOM   5056  N  N      . ILE A 1 316 ? 28.610  61.565  -10.697 1.00 53.37  ? 313  ILE A N      1 
ATOM   5057  C  CA     . ILE A 1 316 ? 28.156  61.820  -12.062 1.00 65.33  ? 313  ILE A CA     1 
ATOM   5058  C  C      . ILE A 1 316 ? 28.535  63.232  -12.486 1.00 59.99  ? 313  ILE A C      1 
ATOM   5059  O  O      . ILE A 1 316 ? 28.696  63.497  -13.669 1.00 45.99  ? 313  ILE A O      1 
ATOM   5060  C  CB     . ILE A 1 316 ? 26.628  61.650  -12.237 1.00 52.51  ? 313  ILE A CB     1 
ATOM   5061  C  CG1    . ILE A 1 316 ? 26.176  60.274  -11.748 1.00 61.67  ? 313  ILE A CG1    1 
ATOM   5062  C  CG2    . ILE A 1 316 ? 26.251  61.762  -13.712 1.00 52.39  ? 313  ILE A CG2    1 
ATOM   5063  C  CD1    . ILE A 1 316 ? 24.664  60.076  -11.758 1.00 54.74  ? 313  ILE A CD1    1 
ATOM   5064  H  H      . ILE A 1 316 ? 27.979  61.516  -10.115 1.00 64.05  ? 313  ILE A H      1 
ATOM   5065  H  HA     . ILE A 1 316 ? 28.597  61.199  -12.662 1.00 78.40  ? 313  ILE A HA     1 
ATOM   5066  H  HB     . ILE A 1 316 ? 26.167  62.338  -11.733 1.00 63.02  ? 313  ILE A HB     1 
ATOM   5067  H  HG12   . ILE A 1 316 ? 26.566  59.596  -12.321 1.00 74.00  ? 313  ILE A HG12   1 
ATOM   5068  H  HG13   . ILE A 1 316 ? 26.484  60.150  -10.837 1.00 74.00  ? 313  ILE A HG13   1 
ATOM   5069  H  HG21   . ILE A 1 316 ? 26.711  61.068  -14.209 1.00 62.86  ? 313  ILE A HG21   1 
ATOM   5070  H  HG22   . ILE A 1 316 ? 25.291  61.653  -13.801 1.00 62.86  ? 313  ILE A HG22   1 
ATOM   5071  H  HG23   . ILE A 1 316 ? 26.517  62.636  -14.039 1.00 62.86  ? 313  ILE A HG23   1 
ATOM   5072  H  HD11   . ILE A 1 316 ? 24.338  60.183  -12.666 1.00 65.68  ? 313  ILE A HD11   1 
ATOM   5073  H  HD12   . ILE A 1 316 ? 24.461  59.184  -11.436 1.00 65.68  ? 313  ILE A HD12   1 
ATOM   5074  H  HD13   . ILE A 1 316 ? 24.255  60.738  -11.179 1.00 65.68  ? 313  ILE A HD13   1 
ATOM   5075  N  N      . ASN A 1 317 ? 28.691  64.133  -11.522 1.00 49.69  ? 314  ASN A N      1 
ATOM   5076  C  CA     . ASN A 1 317 ? 28.983  65.523  -11.843 1.00 52.32  ? 314  ASN A CA     1 
ATOM   5077  C  C      . ASN A 1 317 ? 30.471  65.823  -11.873 1.00 52.65  ? 314  ASN A C      1 
ATOM   5078  O  O      . ASN A 1 317 ? 30.870  66.976  -11.737 1.00 64.05  ? 314  ASN A O      1 
ATOM   5079  C  CB     . ASN A 1 317 ? 28.325  66.444  -10.821 1.00 50.42  ? 314  ASN A CB     1 
ATOM   5080  C  CG     . ASN A 1 317 ? 28.906  66.273  -9.438  1.00 61.71  ? 314  ASN A CG     1 
ATOM   5081  O  OD1    . ASN A 1 317 ? 29.255  65.165  -9.033  1.00 75.01  ? 314  ASN A OD1    1 
ATOM   5082  N  ND2    . ASN A 1 317 ? 29.040  67.374  -8.713  1.00 81.12  ? 314  ASN A ND2    1 
ATOM   5083  H  H      . ASN A 1 317 ? 28.634  63.966  -10.680 1.00 59.63  ? 314  ASN A H      1 
ATOM   5084  H  HA     . ASN A 1 317 ? 28.616  65.730  -12.716 1.00 62.78  ? 314  ASN A HA     1 
ATOM   5085  H  HB2    . ASN A 1 317 ? 28.459  67.366  -11.092 1.00 60.51  ? 314  ASN A HB2    1 
ATOM   5086  H  HB3    . ASN A 1 317 ? 27.377  66.244  -10.777 1.00 60.51  ? 314  ASN A HB3    1 
ATOM   5087  H  HD21   . ASN A 1 317 ? 28.800  68.134  -9.037  1.00 97.34  ? 314  ASN A HD21   1 
ATOM   5088  H  HD22   . ASN A 1 317 ? 29.366  67.329  -7.918  1.00 97.34  ? 314  ASN A HD22   1 
ATOM   5089  N  N      . HIS A 1 318 ? 31.294  64.800  -12.066 1.00 56.19  ? 315  HIS A N      1 
ATOM   5090  C  CA     . HIS A 1 318 ? 32.735  65.003  -12.010 1.00 58.12  ? 315  HIS A CA     1 
ATOM   5091  C  C      . HIS A 1 318 ? 33.251  65.523  -13.350 1.00 47.12  ? 315  HIS A C      1 
ATOM   5092  O  O      . HIS A 1 318 ? 32.915  64.998  -14.413 1.00 43.11  ? 315  HIS A O      1 
ATOM   5093  C  CB     . HIS A 1 318 ? 33.475  63.721  -11.629 1.00 66.84  ? 315  HIS A CB     1 
ATOM   5094  C  CG     . HIS A 1 318 ? 34.919  63.949  -11.308 1.00 63.94  ? 315  HIS A CG     1 
ATOM   5095  N  ND1    . HIS A 1 318 ? 35.330  64.505  -10.116 1.00 51.31  ? 315  HIS A ND1    1 
ATOM   5096  C  CD2    . HIS A 1 318 ? 36.044  63.740  -12.033 1.00 66.53  ? 315  HIS A CD2    1 
ATOM   5097  C  CE1    . HIS A 1 318 ? 36.647  64.605  -10.110 1.00 56.43  ? 315  HIS A CE1    1 
ATOM   5098  N  NE2    . HIS A 1 318 ? 37.105  64.150  -11.262 1.00 39.95  ? 315  HIS A NE2    1 
ATOM   5099  H  H      . HIS A 1 318 ? 31.050  63.992  -12.227 1.00 67.43  ? 315  HIS A H      1 
ATOM   5100  H  HA     . HIS A 1 318 ? 32.932  65.672  -11.335 1.00 69.75  ? 315  HIS A HA     1 
ATOM   5101  H  HB2    . HIS A 1 318 ? 33.052  63.335  -10.846 1.00 80.20  ? 315  HIS A HB2    1 
ATOM   5102  H  HB3    . HIS A 1 318 ? 33.428  63.099  -12.372 1.00 80.20  ? 315  HIS A HB3    1 
ATOM   5103  H  HD1    . HIS A 1 318 ? 34.810  64.738  -9.472  1.00 61.57  ? 315  HIS A HD1    1 
ATOM   5104  H  HD2    . HIS A 1 318 ? 36.090  63.376  -12.888 1.00 79.83  ? 315  HIS A HD2    1 
ATOM   5105  H  HE1    . HIS A 1 318 ? 37.163  64.943  -9.414  1.00 67.71  ? 315  HIS A HE1    1 
ATOM   5106  H  HE2    . HIS A 1 318 ? 37.933  64.114  -11.492 1.00 47.94  ? 315  HIS A HE2    1 
ATOM   5107  N  N      . LEU A 1 319 ? 34.078  66.555  -13.279 1.00 46.73  ? 316  LEU A N      1 
ATOM   5108  C  CA     . LEU A 1 319 ? 34.651  67.188  -14.453 1.00 47.15  ? 316  LEU A CA     1 
ATOM   5109  C  C      . LEU A 1 319 ? 36.013  66.582  -14.748 1.00 38.69  ? 316  LEU A C      1 
ATOM   5110  O  O      . LEU A 1 319 ? 36.904  66.734  -13.946 1.00 63.12  ? 316  LEU A O      1 
ATOM   5111  C  CB     . LEU A 1 319 ? 34.813  68.690  -14.195 1.00 63.09  ? 316  LEU A CB     1 
ATOM   5112  C  CG     . LEU A 1 319 ? 33.581  69.591  -14.208 1.00 59.76  ? 316  LEU A CG     1 
ATOM   5113  C  CD1    . LEU A 1 319 ? 33.815  70.809  -13.332 1.00 46.64  ? 316  LEU A CD1    1 
ATOM   5114  C  CD2    . LEU A 1 319 ? 33.293  70.021  -15.627 1.00 65.45  ? 316  LEU A CD2    1 
ATOM   5115  H  H      . LEU A 1 319 ? 34.328  66.916  -12.540 1.00 56.08  ? 316  LEU A H      1 
ATOM   5116  H  HA     . LEU A 1 319 ? 34.072  67.058  -15.220 1.00 56.59  ? 316  LEU A HA     1 
ATOM   5117  H  HB2    . LEU A 1 319 ? 35.223  68.795  -13.322 1.00 75.71  ? 316  LEU A HB2    1 
ATOM   5118  H  HB3    . LEU A 1 319 ? 35.418  69.039  -14.868 1.00 75.71  ? 316  LEU A HB3    1 
ATOM   5119  H  HG     . LEU A 1 319 ? 32.815  69.104  -13.868 1.00 71.72  ? 316  LEU A HG     1 
ATOM   5120  H  HD11   . LEU A 1 319 ? 34.578  71.301  -13.673 1.00 55.97  ? 316  LEU A HD11   1 
ATOM   5121  H  HD12   . LEU A 1 319 ? 33.024  71.369  -13.352 1.00 55.97  ? 316  LEU A HD12   1 
ATOM   5122  H  HD13   . LEU A 1 319 ? 33.990  70.515  -12.424 1.00 55.97  ? 316  LEU A HD13   1 
ATOM   5123  H  HD21   . LEU A 1 319 ? 33.129  69.233  -16.168 1.00 78.54  ? 316  LEU A HD21   1 
ATOM   5124  H  HD22   . LEU A 1 319 ? 32.509  70.593  -15.630 1.00 78.54  ? 316  LEU A HD22   1 
ATOM   5125  H  HD23   . LEU A 1 319 ? 34.059  70.507  -15.971 1.00 78.54  ? 316  LEU A HD23   1 
ATOM   5126  N  N      . LEU A 1 320 ? 36.197  65.933  -15.892 1.00 34.66  ? 317  LEU A N      1 
ATOM   5127  C  CA     . LEU A 1 320 ? 37.492  65.331  -16.226 1.00 39.85  ? 317  LEU A CA     1 
ATOM   5128  C  C      . LEU A 1 320 ? 38.124  66.004  -17.442 1.00 43.42  ? 317  LEU A C      1 
ATOM   5129  O  O      . LEU A 1 320 ? 37.433  66.394  -18.383 1.00 49.77  ? 317  LEU A O      1 
ATOM   5130  C  CB     . LEU A 1 320 ? 37.340  63.822  -16.477 1.00 50.65  ? 317  LEU A CB     1 
ATOM   5131  C  CG     . LEU A 1 320 ? 38.618  63.034  -16.813 1.00 42.49  ? 317  LEU A CG     1 
ATOM   5132  C  CD1    . LEU A 1 320 ? 39.583  62.999  -15.640 1.00 46.61  ? 317  LEU A CD1    1 
ATOM   5133  C  CD2    . LEU A 1 320 ? 38.272  61.616  -17.217 1.00 30.33  ? 317  LEU A CD2    1 
ATOM   5134  H  H      . LEU A 1 320 ? 35.592  65.825  -16.494 1.00 41.59  ? 317  LEU A H      1 
ATOM   5135  H  HA     . LEU A 1 320 ? 38.095  65.448  -15.475 1.00 47.82  ? 317  LEU A HA     1 
ATOM   5136  H  HB2    . LEU A 1 320 ? 36.958  63.422  -15.681 1.00 60.78  ? 317  LEU A HB2    1 
ATOM   5137  H  HB3    . LEU A 1 320 ? 36.727  63.702  -17.220 1.00 60.78  ? 317  LEU A HB3    1 
ATOM   5138  H  HG     . LEU A 1 320 ? 39.067  63.460  -17.560 1.00 50.99  ? 317  LEU A HG     1 
ATOM   5139  H  HD11   . LEU A 1 320 ? 39.147  62.573  -14.886 1.00 55.94  ? 317  LEU A HD11   1 
ATOM   5140  H  HD12   . LEU A 1 320 ? 40.371  62.494  -15.896 1.00 55.94  ? 317  LEU A HD12   1 
ATOM   5141  H  HD13   . LEU A 1 320 ? 39.832  63.908  -15.410 1.00 55.94  ? 317  LEU A HD13   1 
ATOM   5142  H  HD21   . LEU A 1 320 ? 37.698  61.642  -17.998 1.00 36.40  ? 317  LEU A HD21   1 
ATOM   5143  H  HD22   . LEU A 1 320 ? 39.091  61.138  -17.423 1.00 36.40  ? 317  LEU A HD22   1 
ATOM   5144  H  HD23   . LEU A 1 320 ? 37.812  61.182  -16.482 1.00 36.40  ? 317  LEU A HD23   1 
ATOM   5145  N  N      . LYS A 1 321 ? 39.446  66.131  -17.401 1.00 36.87  ? 318  LYS A N      1 
ATOM   5146  C  CA     . LYS A 1 321 ? 40.225  66.716  -18.490 1.00 33.46  ? 318  LYS A CA     1 
ATOM   5147  C  C      . LYS A 1 321 ? 39.814  66.160  -19.846 1.00 38.93  ? 318  LYS A C      1 
ATOM   5148  O  O      . LYS A 1 321 ? 39.813  64.948  -20.059 1.00 48.47  ? 318  LYS A O      1 
ATOM   5149  C  CB     . LYS A 1 321 ? 41.711  66.467  -18.244 1.00 34.21  ? 318  LYS A CB     1 
ATOM   5150  C  CG     . LYS A 1 321 ? 42.653  67.066  -19.260 1.00 25.42  ? 318  LYS A CG     1 
ATOM   5151  C  CD     . LYS A 1 321 ? 44.087  66.724  -18.903 1.00 31.41  ? 318  LYS A CD     1 
ATOM   5152  C  CE     . LYS A 1 321 ? 45.073  67.595  -19.656 1.00 54.89  ? 318  LYS A CE     1 
ATOM   5153  N  NZ     . LYS A 1 321 ? 46.481  67.245  -19.341 1.00 58.02  ? 318  LYS A NZ     1 
ATOM   5154  H  H      . LYS A 1 321 ? 39.928  65.878  -16.735 1.00 44.24  ? 318  LYS A H      1 
ATOM   5155  H  HA     . LYS A 1 321 ? 40.080  67.675  -18.502 1.00 40.15  ? 318  LYS A HA     1 
ATOM   5156  H  HB2    . LYS A 1 321 ? 41.944  66.838  -17.378 1.00 41.05  ? 318  LYS A HB2    1 
ATOM   5157  H  HB3    . LYS A 1 321 ? 41.863  65.509  -18.236 1.00 41.05  ? 318  LYS A HB3    1 
ATOM   5158  H  HG2    . LYS A 1 321 ? 42.458  66.702  -20.138 1.00 30.50  ? 318  LYS A HG2    1 
ATOM   5159  H  HG3    . LYS A 1 321 ? 42.557  68.031  -19.262 1.00 30.50  ? 318  LYS A HG3    1 
ATOM   5160  H  HD2    . LYS A 1 321 ? 44.222  66.865  -17.953 1.00 37.69  ? 318  LYS A HD2    1 
ATOM   5161  H  HD3    . LYS A 1 321 ? 44.262  65.799  -19.134 1.00 37.69  ? 318  LYS A HD3    1 
ATOM   5162  H  HE2    . LYS A 1 321 ? 44.938  67.478  -20.609 1.00 65.86  ? 318  LYS A HE2    1 
ATOM   5163  H  HE3    . LYS A 1 321 ? 44.930  68.523  -19.410 1.00 65.86  ? 318  LYS A HE3    1 
ATOM   5164  H  HZ1    . LYS A 1 321 ? 46.640  66.398  -19.563 1.00 69.62  ? 318  LYS A HZ1    1 
ATOM   5165  H  HZ2    . LYS A 1 321 ? 47.034  67.772  -19.797 1.00 69.62  ? 318  LYS A HZ2    1 
ATOM   5166  H  HZ3    . LYS A 1 321 ? 46.633  67.350  -18.471 1.00 69.62  ? 318  LYS A HZ3    1 
ATOM   5167  N  N      . SER A 1 322 ? 39.471  67.064  -20.760 1.00 49.59  ? 319  SER A N      1 
ATOM   5168  C  CA     . SER A 1 322 ? 38.962  66.692  -22.078 1.00 48.20  ? 319  SER A CA     1 
ATOM   5169  C  C      . SER A 1 322 ? 40.043  66.098  -22.975 1.00 36.67  ? 319  SER A C      1 
ATOM   5170  O  O      . SER A 1 322 ? 41.202  66.508  -22.905 1.00 43.03  ? 319  SER A O      1 
ATOM   5171  C  CB     . SER A 1 322 ? 38.350  67.908  -22.774 1.00 39.57  ? 319  SER A CB     1 
ATOM   5172  O  OG     . SER A 1 322 ? 37.905  67.571  -24.070 1.00 37.15  ? 319  SER A OG     1 
ATOM   5173  H  H      . SER A 1 322 ? 39.526  67.913  -20.638 1.00 59.51  ? 319  SER A H      1 
ATOM   5174  H  HA     . SER A 1 322 ? 38.264  66.026  -21.970 1.00 57.84  ? 319  SER A HA     1 
ATOM   5175  H  HB2    . SER A 1 322 ? 37.595  68.224  -22.253 1.00 47.49  ? 319  SER A HB2    1 
ATOM   5176  H  HB3    . SER A 1 322 ? 39.021  68.604  -22.842 1.00 47.49  ? 319  SER A HB3    1 
ATOM   5177  H  HG     . SER A 1 322 ? 37.571  68.245  -24.443 1.00 44.58  ? 319  SER A HG     1 
ATOM   5178  N  N      . PRO A 1 323 ? 39.674  65.128  -23.825 1.00 27.03  ? 320  PRO A N      1 
ATOM   5179  C  CA     . PRO A 1 323 ? 40.619  64.676  -24.848 1.00 25.69  ? 320  PRO A CA     1 
ATOM   5180  C  C      . PRO A 1 323 ? 41.078  65.837  -25.725 1.00 38.45  ? 320  PRO A C      1 
ATOM   5181  O  O      . PRO A 1 323 ? 40.348  66.817  -25.875 1.00 33.20  ? 320  PRO A O      1 
ATOM   5182  C  CB     . PRO A 1 323 ? 39.804  63.667  -25.655 1.00 27.80  ? 320  PRO A CB     1 
ATOM   5183  C  CG     . PRO A 1 323 ? 38.790  63.154  -24.698 1.00 28.34  ? 320  PRO A CG     1 
ATOM   5184  C  CD     . PRO A 1 323 ? 38.434  64.331  -23.835 1.00 30.53  ? 320  PRO A CD     1 
ATOM   5185  H  HA     . PRO A 1 323 ? 41.385  64.238  -24.446 1.00 30.83  ? 320  PRO A HA     1 
ATOM   5186  H  HB2    . PRO A 1 323 ? 39.377  64.113  -26.403 1.00 33.37  ? 320  PRO A HB2    1 
ATOM   5187  H  HB3    . PRO A 1 323 ? 40.380  62.951  -25.963 1.00 33.37  ? 320  PRO A HB3    1 
ATOM   5188  H  HG2    . PRO A 1 323 ? 38.013  62.837  -25.184 1.00 34.01  ? 320  PRO A HG2    1 
ATOM   5189  H  HG3    . PRO A 1 323 ? 39.175  62.441  -24.164 1.00 34.01  ? 320  PRO A HG3    1 
ATOM   5190  H  HD2    . PRO A 1 323 ? 37.709  64.837  -24.234 1.00 36.64  ? 320  PRO A HD2    1 
ATOM   5191  H  HD3    . PRO A 1 323 ? 38.212  64.038  -22.937 1.00 36.64  ? 320  PRO A HD3    1 
ATOM   5192  N  N      . PHE A 1 324 ? 42.286  65.734  -26.265 1.00 46.61  ? 321  PHE A N      1 
ATOM   5193  C  CA     . PHE A 1 324 ? 42.854  66.776  -27.116 1.00 41.13  ? 321  PHE A CA     1 
ATOM   5194  C  C      . PHE A 1 324 ? 43.013  68.112  -26.385 1.00 42.98  ? 321  PHE A C      1 
ATOM   5195  O  O      . PHE A 1 324 ? 43.073  69.163  -27.024 1.00 55.46  ? 321  PHE A O      1 
ATOM   5196  C  CB     . PHE A 1 324 ? 42.010  66.956  -28.389 1.00 49.34  ? 321  PHE A CB     1 
ATOM   5197  C  CG     . PHE A 1 324 ? 41.960  65.726  -29.258 1.00 37.28  ? 321  PHE A CG     1 
ATOM   5198  C  CD1    . PHE A 1 324 ? 43.054  65.368  -30.035 1.00 33.92  ? 321  PHE A CD1    1 
ATOM   5199  C  CD2    . PHE A 1 324 ? 40.820  64.936  -29.304 1.00 28.50  ? 321  PHE A CD2    1 
ATOM   5200  C  CE1    . PHE A 1 324 ? 43.021  64.239  -30.829 1.00 29.89  ? 321  PHE A CE1    1 
ATOM   5201  C  CE2    . PHE A 1 324 ? 40.778  63.806  -30.100 1.00 27.56  ? 321  PHE A CE2    1 
ATOM   5202  C  CZ     . PHE A 1 324 ? 41.879  63.458  -30.863 1.00 37.18  ? 321  PHE A CZ     1 
ATOM   5203  H  H      . PHE A 1 324 ? 42.807  65.059  -26.151 1.00 55.93  ? 321  PHE A H      1 
ATOM   5204  H  HA     . PHE A 1 324 ? 43.739  66.493  -27.394 1.00 49.36  ? 321  PHE A HA     1 
ATOM   5205  H  HB2    . PHE A 1 324 ? 41.101  67.176  -28.133 1.00 59.21  ? 321  PHE A HB2    1 
ATOM   5206  H  HB3    . PHE A 1 324 ? 42.388  67.677  -28.916 1.00 59.21  ? 321  PHE A HB3    1 
ATOM   5207  H  HD1    . PHE A 1 324 ? 43.824  65.889  -30.011 1.00 40.71  ? 321  PHE A HD1    1 
ATOM   5208  H  HD2    . PHE A 1 324 ? 40.080  65.164  -28.789 1.00 34.21  ? 321  PHE A HD2    1 
ATOM   5209  H  HE1    . PHE A 1 324 ? 43.760  64.008  -31.344 1.00 35.87  ? 321  PHE A HE1    1 
ATOM   5210  H  HE2    . PHE A 1 324 ? 40.011  63.281  -30.123 1.00 33.08  ? 321  PHE A HE2    1 
ATOM   5211  H  HZ     . PHE A 1 324 ? 41.850  62.700  -31.401 1.00 44.62  ? 321  PHE A HZ     1 
ATOM   5212  N  N      . SER A 1 325 ? 43.077  68.072  -25.053 1.00 49.13  ? 322  SER A N      1 
ATOM   5213  C  CA     . SER A 1 325 ? 43.444  69.258  -24.275 1.00 44.71  ? 322  SER A CA     1 
ATOM   5214  C  C      . SER A 1 325 ? 44.955  69.412  -24.353 1.00 37.01  ? 322  SER A C      1 
ATOM   5215  O  O      . SER A 1 325 ? 45.648  68.502  -24.812 1.00 44.42  ? 322  SER A O      1 
ATOM   5216  C  CB     . SER A 1 325 ? 43.009  69.141  -22.814 1.00 39.75  ? 322  SER A CB     1 
ATOM   5217  O  OG     . SER A 1 325 ? 41.614  68.934  -22.696 1.00 52.89  ? 322  SER A OG     1 
ATOM   5218  H  H      . SER A 1 325 ? 42.914  67.374  -24.578 1.00 58.95  ? 322  SER A H      1 
ATOM   5219  H  HA     . SER A 1 325 ? 43.030  70.045  -24.662 1.00 53.65  ? 322  SER A HA     1 
ATOM   5220  H  HB2    . SER A 1 325 ? 43.472  68.390  -22.409 1.00 47.70  ? 322  SER A HB2    1 
ATOM   5221  H  HB3    . SER A 1 325 ? 43.244  69.960  -22.352 1.00 47.70  ? 322  SER A HB3    1 
ATOM   5222  H  HG     . SER A 1 325 ? 41.394  68.225  -23.091 1.00 63.47  ? 322  SER A HG     1 
ATOM   5223  N  N      . VAL A 1 326 ? 45.466  70.553  -23.905 1.00 28.86  ? 323  VAL A N      1 
ATOM   5224  C  CA     . VAL A 1 326 ? 46.909  70.775  -23.894 1.00 50.41  ? 323  VAL A CA     1 
ATOM   5225  C  C      . VAL A 1 326 ? 47.416  70.847  -22.454 1.00 68.74  ? 323  VAL A C      1 
ATOM   5226  O  O      . VAL A 1 326 ? 46.911  71.624  -21.641 1.00 65.19  ? 323  VAL A O      1 
ATOM   5227  C  CB     . VAL A 1 326 ? 47.283  72.058  -24.641 1.00 46.60  ? 323  VAL A CB     1 
ATOM   5228  C  CG1    . VAL A 1 326 ? 48.794  72.187  -24.745 1.00 40.30  ? 323  VAL A CG1    1 
ATOM   5229  C  CG2    . VAL A 1 326 ? 46.691  72.026  -26.033 1.00 71.67  ? 323  VAL A CG2    1 
ATOM   5230  H  H      . VAL A 1 326 ? 45.002  71.213  -23.604 1.00 34.63  ? 323  VAL A H      1 
ATOM   5231  H  HA     . VAL A 1 326 ? 47.348  70.030  -24.333 1.00 60.49  ? 323  VAL A HA     1 
ATOM   5232  H  HB     . VAL A 1 326 ? 46.933  72.829  -24.168 1.00 55.92  ? 323  VAL A HB     1 
ATOM   5233  H  HG11   . VAL A 1 326 ? 49.144  71.422  -25.228 1.00 48.36  ? 323  VAL A HG11   1 
ATOM   5234  H  HG12   . VAL A 1 326 ? 49.009  73.005  -25.221 1.00 48.36  ? 323  VAL A HG12   1 
ATOM   5235  H  HG13   . VAL A 1 326 ? 49.171  72.215  -23.851 1.00 48.36  ? 323  VAL A HG13   1 
ATOM   5236  H  HG21   . VAL A 1 326 ? 45.726  71.959  -25.964 1.00 86.01  ? 323  VAL A HG21   1 
ATOM   5237  H  HG22   . VAL A 1 326 ? 46.934  72.843  -26.497 1.00 86.01  ? 323  VAL A HG22   1 
ATOM   5238  H  HG23   . VAL A 1 326 ? 47.044  71.258  -26.508 1.00 86.01  ? 323  VAL A HG23   1 
ATOM   5239  N  N      . HIS A 1 327 ? 48.419  70.038  -22.141 1.00 52.24  ? 324  HIS A N      1 
ATOM   5240  C  CA     . HIS A 1 327 ? 48.997  70.057  -20.808 1.00 55.27  ? 324  HIS A CA     1 
ATOM   5241  C  C      . HIS A 1 327 ? 49.856  71.320  -20.613 1.00 58.48  ? 324  HIS A C      1 
ATOM   5242  O  O      . HIS A 1 327 ? 50.854  71.499  -21.311 1.00 47.18  ? 324  HIS A O      1 
ATOM   5243  C  CB     . HIS A 1 327 ? 49.825  68.797  -20.571 1.00 69.58  ? 324  HIS A CB     1 
ATOM   5244  C  CG     . HIS A 1 327 ? 50.123  68.546  -19.129 1.00 54.97  ? 324  HIS A CG     1 
ATOM   5245  N  ND1    . HIS A 1 327 ? 51.039  69.292  -18.423 1.00 41.81  ? 324  HIS A ND1    1 
ATOM   5246  C  CD2    . HIS A 1 327 ? 49.593  67.667  -18.246 1.00 50.08  ? 324  HIS A CD2    1 
ATOM   5247  C  CE1    . HIS A 1 327 ? 51.082  68.869  -17.174 1.00 65.14  ? 324  HIS A CE1    1 
ATOM   5248  N  NE2    . HIS A 1 327 ? 50.213  67.884  -17.039 1.00 67.08  ? 324  HIS A NE2    1 
ATOM   5249  H  H      . HIS A 1 327 ? 48.781  69.474  -22.679 1.00 62.69  ? 324  HIS A H      1 
ATOM   5250  H  HA     . HIS A 1 327 ? 48.281  70.075  -20.153 1.00 66.33  ? 324  HIS A HA     1 
ATOM   5251  H  HB2    . HIS A 1 327 ? 49.337  68.031  -20.912 1.00 83.49  ? 324  HIS A HB2    1 
ATOM   5252  H  HB3    . HIS A 1 327 ? 50.670  68.884  -21.039 1.00 83.49  ? 324  HIS A HB3    1 
ATOM   5253  H  HD1    . HIS A 1 327 ? 51.518  69.927  -18.749 1.00 50.17  ? 324  HIS A HD1    1 
ATOM   5254  H  HD2    . HIS A 1 327 ? 48.941  67.029  -18.425 1.00 60.10  ? 324  HIS A HD2    1 
ATOM   5255  H  HE1    . HIS A 1 327 ? 51.629  69.208  -16.503 1.00 78.17  ? 324  HIS A HE1    1 
ATOM   5256  H  HE2    . HIS A 1 327 ? 50.061  67.448  -16.314 1.00 80.49  ? 324  HIS A HE2    1 
ATOM   5257  N  N      . PRO A 1 328 ? 49.469  72.201  -19.668 1.00 58.98  ? 325  PRO A N      1 
ATOM   5258  C  CA     . PRO A 1 328 ? 50.162  73.482  -19.452 1.00 40.55  ? 325  PRO A CA     1 
ATOM   5259  C  C      . PRO A 1 328 ? 51.667  73.448  -19.183 1.00 41.66  ? 325  PRO A C      1 
ATOM   5260  O  O      . PRO A 1 328 ? 52.321  74.475  -19.359 1.00 55.74  ? 325  PRO A O      1 
ATOM   5261  C  CB     . PRO A 1 328 ? 49.459  74.043  -18.218 1.00 32.81  ? 325  PRO A CB     1 
ATOM   5262  C  CG     . PRO A 1 328 ? 48.126  73.425  -18.217 1.00 43.39  ? 325  PRO A CG     1 
ATOM   5263  C  CD     . PRO A 1 328 ? 48.326  72.048  -18.750 1.00 58.90  ? 325  PRO A CD     1 
ATOM   5264  H  HA     . PRO A 1 328 ? 49.994  74.074  -20.202 1.00 48.66  ? 325  PRO A HA     1 
ATOM   5265  H  HB2    . PRO A 1 328 ? 49.952  73.796  -17.420 1.00 39.37  ? 325  PRO A HB2    1 
ATOM   5266  H  HB3    . PRO A 1 328 ? 49.388  75.008  -18.293 1.00 39.37  ? 325  PRO A HB3    1 
ATOM   5267  H  HG2    . PRO A 1 328 ? 47.782  73.393  -17.310 1.00 52.07  ? 325  PRO A HG2    1 
ATOM   5268  H  HG3    . PRO A 1 328 ? 47.531  73.931  -18.791 1.00 52.07  ? 325  PRO A HG3    1 
ATOM   5269  H  HD2    . PRO A 1 328 ? 48.549  71.436  -18.031 1.00 70.67  ? 325  PRO A HD2    1 
ATOM   5270  H  HD3    . PRO A 1 328 ? 47.539  71.756  -19.235 1.00 70.67  ? 325  PRO A HD3    1 
ATOM   5271  N  N      . LYS A 1 329 ? 52.205  72.306  -18.774 1.00 47.70  ? 326  LYS A N      1 
ATOM   5272  C  CA     . LYS A 1 329 ? 53.604  72.224  -18.351 1.00 56.40  ? 326  LYS A CA     1 
ATOM   5273  C  C      . LYS A 1 329 ? 54.427  71.365  -19.300 1.00 51.51  ? 326  LYS A C      1 
ATOM   5274  O  O      . LYS A 1 329 ? 55.531  71.750  -19.688 1.00 37.49  ? 326  LYS A O      1 
ATOM   5275  C  CB     . LYS A 1 329 ? 53.695  71.688  -16.918 1.00 57.65  ? 326  LYS A CB     1 
ATOM   5276  C  CG     . LYS A 1 329 ? 53.141  72.658  -15.873 1.00 69.21  ? 326  LYS A CG     1 
ATOM   5277  C  CD     . LYS A 1 329 ? 53.288  72.119  -14.456 1.00 86.36  ? 326  LYS A CD     1 
ATOM   5278  C  CE     . LYS A 1 329 ? 52.690  73.065  -13.421 1.00 73.52  ? 326  LYS A CE     1 
ATOM   5279  N  NZ     . LYS A 1 329 ? 52.821  72.523  -12.038 1.00 53.59  ? 326  LYS A NZ     1 
ATOM   5280  H  H      . LYS A 1 329 ? 51.782  71.558  -18.732 1.00 57.24  ? 326  LYS A H      1 
ATOM   5281  H  HA     . LYS A 1 329 ? 53.984  73.117  -18.357 1.00 67.68  ? 326  LYS A HA     1 
ATOM   5282  H  HB2    . LYS A 1 329 ? 53.188  70.863  -16.858 1.00 69.18  ? 326  LYS A HB2    1 
ATOM   5283  H  HB3    . LYS A 1 329 ? 54.626  71.519  -16.704 1.00 69.18  ? 326  LYS A HB3    1 
ATOM   5284  H  HG2    . LYS A 1 329 ? 53.625  73.497  -15.929 1.00 83.05  ? 326  LYS A HG2    1 
ATOM   5285  H  HG3    . LYS A 1 329 ? 52.197  72.805  -16.044 1.00 83.05  ? 326  LYS A HG3    1 
ATOM   5286  H  HD2    . LYS A 1 329 ? 52.827  71.268  -14.390 1.00 103.64 ? 326  LYS A HD2    1 
ATOM   5287  H  HD3    . LYS A 1 329 ? 54.230  72.006  -14.255 1.00 103.64 ? 326  LYS A HD3    1 
ATOM   5288  H  HE2    . LYS A 1 329 ? 53.155  73.915  -13.459 1.00 88.22  ? 326  LYS A HE2    1 
ATOM   5289  H  HE3    . LYS A 1 329 ? 51.747  73.190  -13.610 1.00 88.22  ? 326  LYS A HE3    1 
ATOM   5290  H  HZ1    . LYS A 1 329 ? 53.680  72.403  -11.839 1.00 64.30  ? 326  LYS A HZ1    1 
ATOM   5291  H  HZ2    . LYS A 1 329 ? 52.465  73.093  -11.454 1.00 64.30  ? 326  LYS A HZ2    1 
ATOM   5292  H  HZ3    . LYS A 1 329 ? 52.398  71.743  -11.976 1.00 64.30  ? 326  LYS A HZ3    1 
ATOM   5293  N  N      . THR A 1 330 ? 53.907  70.184  -19.630 1.00 52.53  ? 327  THR A N      1 
ATOM   5294  C  CA     . THR A 1 330 ? 54.589  69.259  -20.529 1.00 59.66  ? 327  THR A CA     1 
ATOM   5295  C  C      . THR A 1 330 ? 54.335  69.641  -21.982 1.00 56.66  ? 327  THR A C      1 
ATOM   5296  O  O      . THR A 1 330 ? 55.143  69.348  -22.861 1.00 52.84  ? 327  THR A O      1 
ATOM   5297  C  CB     . THR A 1 330 ? 54.121  67.810  -20.319 1.00 51.66  ? 327  THR A CB     1 
ATOM   5298  O  OG1    . THR A 1 330 ? 52.783  67.666  -20.810 1.00 46.97  ? 327  THR A OG1    1 
ATOM   5299  C  CG2    . THR A 1 330 ? 54.152  67.439  -18.851 1.00 62.76  ? 327  THR A CG2    1 
ATOM   5300  H  H      . THR A 1 330 ? 53.150  69.894  -19.342 1.00 63.03  ? 327  THR A H      1 
ATOM   5301  H  HA     . THR A 1 330 ? 55.545  69.298  -20.365 1.00 71.59  ? 327  THR A HA     1 
ATOM   5302  H  HB     . THR A 1 330 ? 54.708  67.207  -20.801 1.00 62.00  ? 327  THR A HB     1 
ATOM   5303  H  HG1    . THR A 1 330 ? 52.520  66.877  -20.699 1.00 56.36  ? 327  THR A HG1    1 
ATOM   5304  H  HG21   . THR A 1 330 ? 53.567  68.027  -18.348 1.00 75.32  ? 327  THR A HG21   1 
ATOM   5305  H  HG22   . THR A 1 330 ? 53.854  66.523  -18.734 1.00 75.32  ? 327  THR A HG22   1 
ATOM   5306  H  HG23   . THR A 1 330 ? 55.055  67.523  -18.507 1.00 75.32  ? 327  THR A HG23   1 
ATOM   5307  N  N      . GLY A 1 331 ? 53.207  70.303  -22.221 1.00 46.97  ? 328  GLY A N      1 
ATOM   5308  C  CA     . GLY A 1 331 ? 52.831  70.700  -23.562 1.00 56.03  ? 328  GLY A CA     1 
ATOM   5309  C  C      . GLY A 1 331 ? 52.241  69.570  -24.392 1.00 60.62  ? 328  GLY A C      1 
ATOM   5310  O  O      . GLY A 1 331 ? 51.817  69.787  -25.526 1.00 72.91  ? 328  GLY A O      1 
ATOM   5311  H  H      . GLY A 1 331 ? 52.641  70.533  -21.615 1.00 56.37  ? 328  GLY A H      1 
ATOM   5312  H  HA2    . GLY A 1 331 ? 52.174  71.413  -23.511 1.00 67.23  ? 328  GLY A HA2    1 
ATOM   5313  H  HA3    . GLY A 1 331 ? 53.612  71.040  -24.025 1.00 67.23  ? 328  GLY A HA3    1 
ATOM   5314  N  N      . ARG A 1 332 ? 52.204  68.365  -23.833 1.00 48.16  ? 329  ARG A N      1 
ATOM   5315  C  CA     . ARG A 1 332 ? 51.688  67.206  -24.555 1.00 47.64  ? 329  ARG A CA     1 
ATOM   5316  C  C      . ARG A 1 332 ? 50.183  67.321  -24.786 1.00 50.26  ? 329  ARG A C      1 
ATOM   5317  O  O      . ARG A 1 332 ? 49.467  67.983  -24.029 1.00 47.05  ? 329  ARG A O      1 
ATOM   5318  C  CB     . ARG A 1 332 ? 52.032  65.919  -23.797 1.00 37.91  ? 329  ARG A CB     1 
ATOM   5319  C  CG     . ARG A 1 332 ? 53.515  65.824  -23.460 1.00 46.37  ? 329  ARG A CG     1 
ATOM   5320  C  CD     . ARG A 1 332 ? 54.301  65.073  -24.515 1.00 39.04  ? 329  ARG A CD     1 
ATOM   5321  N  NE     . ARG A 1 332 ? 55.716  65.009  -24.169 1.00 64.22  ? 329  ARG A NE     1 
ATOM   5322  C  CZ     . ARG A 1 332 ? 56.656  64.445  -24.922 1.00 55.91  ? 329  ARG A CZ     1 
ATOM   5323  N  NH1    . ARG A 1 332 ? 56.338  63.845  -26.057 1.00 53.05  ? 329  ARG A NH1    1 
ATOM   5324  N  NH2    . ARG A 1 332 ? 57.920  64.458  -24.520 1.00 74.94  ? 329  ARG A NH2    1 
ATOM   5325  H  H      . ARG A 1 332 ? 52.473  68.191  -23.035 1.00 57.80  ? 329  ARG A H      1 
ATOM   5326  H  HA     . ARG A 1 332 ? 52.119  67.162  -25.423 1.00 57.17  ? 329  ARG A HA     1 
ATOM   5327  H  HB2    . ARG A 1 332 ? 51.532  65.897  -22.965 1.00 45.49  ? 329  ARG A HB2    1 
ATOM   5328  H  HB3    . ARG A 1 332 ? 51.798  65.155  -24.346 1.00 45.49  ? 329  ARG A HB3    1 
ATOM   5329  H  HG2    . ARG A 1 332 ? 53.882  66.719  -23.392 1.00 55.64  ? 329  ARG A HG2    1 
ATOM   5330  H  HG3    . ARG A 1 332 ? 53.620  65.356  -22.617 1.00 55.64  ? 329  ARG A HG3    1 
ATOM   5331  H  HD2    . ARG A 1 332 ? 53.963  64.166  -24.584 1.00 46.85  ? 329  ARG A HD2    1 
ATOM   5332  H  HD3    . ARG A 1 332 ? 54.215  65.530  -25.366 1.00 46.85  ? 329  ARG A HD3    1 
ATOM   5333  H  HE     . ARG A 1 332 ? 55.961  65.362  -23.424 1.00 77.07  ? 329  ARG A HE     1 
ATOM   5334  H  HH11   . ARG A 1 332 ? 55.521  63.836  -26.324 1.00 63.66  ? 329  ARG A HH11   1 
ATOM   5335  H  HH12   . ARG A 1 332 ? 56.951  63.477  -26.535 1.00 63.66  ? 329  ARG A HH12   1 
ATOM   5336  H  HH21   . ARG A 1 332 ? 58.131  64.839  -23.778 1.00 89.93  ? 329  ARG A HH21   1 
ATOM   5337  H  HH22   . ARG A 1 332 ? 58.527  64.082  -24.998 1.00 89.93  ? 329  ARG A HH22   1 
ATOM   5338  N  N      . ILE A 1 333 ? 49.715  66.660  -25.840 1.00 40.57  ? 330  ILE A N      1 
ATOM   5339  C  CA     . ILE A 1 333 ? 48.300  66.631  -26.176 1.00 41.71  ? 330  ILE A CA     1 
ATOM   5340  C  C      . ILE A 1 333 ? 47.670  65.416  -25.501 1.00 37.64  ? 330  ILE A C      1 
ATOM   5341  O  O      . ILE A 1 333 ? 48.246  64.325  -25.503 1.00 32.00  ? 330  ILE A O      1 
ATOM   5342  C  CB     . ILE A 1 333 ? 48.081  66.558  -27.719 1.00 48.13  ? 330  ILE A CB     1 
ATOM   5343  C  CG1    . ILE A 1 333 ? 48.775  67.722  -28.441 1.00 39.77  ? 330  ILE A CG1    1 
ATOM   5344  C  CG2    . ILE A 1 333 ? 46.591  66.489  -28.067 1.00 39.93  ? 330  ILE A CG2    1 
ATOM   5345  C  CD1    . ILE A 1 333 ? 48.258  69.097  -28.079 1.00 43.26  ? 330  ILE A CD1    1 
ATOM   5346  H  H      . ILE A 1 333 ? 50.208  66.213  -26.384 1.00 48.69  ? 330  ILE A H      1 
ATOM   5347  H  HA     . ILE A 1 333 ? 47.868  67.431  -25.839 1.00 50.05  ? 330  ILE A HA     1 
ATOM   5348  H  HB     . ILE A 1 333 ? 48.491  65.736  -28.032 1.00 57.75  ? 330  ILE A HB     1 
ATOM   5349  H  HG12   . ILE A 1 333 ? 49.720  67.699  -28.225 1.00 47.73  ? 330  ILE A HG12   1 
ATOM   5350  H  HG13   . ILE A 1 333 ? 48.656  67.607  -29.396 1.00 47.73  ? 330  ILE A HG13   1 
ATOM   5351  H  HG21   . ILE A 1 333 ? 46.150  67.283  -27.726 1.00 47.92  ? 330  ILE A HG21   1 
ATOM   5352  H  HG22   . ILE A 1 333 ? 46.494  66.445  -29.031 1.00 47.92  ? 330  ILE A HG22   1 
ATOM   5353  H  HG23   . ILE A 1 333 ? 46.208  65.697  -27.659 1.00 47.92  ? 330  ILE A HG23   1 
ATOM   5354  H  HD11   . ILE A 1 333 ? 48.382  69.240  -27.128 1.00 51.91  ? 330  ILE A HD11   1 
ATOM   5355  H  HD12   . ILE A 1 333 ? 48.753  69.762  -28.582 1.00 51.91  ? 330  ILE A HD12   1 
ATOM   5356  H  HD13   . ILE A 1 333 ? 47.315  69.148  -28.302 1.00 51.91  ? 330  ILE A HD13   1 
ATOM   5357  N  N      . SER A 1 334 ? 46.520  65.609  -24.869 1.00 28.00  ? 331  SER A N      1 
ATOM   5358  C  CA     . SER A 1 334 ? 45.766  64.474  -24.362 1.00 29.25  ? 331  SER A CA     1 
ATOM   5359  C  C      . SER A 1 334 ? 45.250  63.642  -25.529 1.00 43.32  ? 331  SER A C      1 
ATOM   5360  O  O      . SER A 1 334 ? 44.137  63.853  -26.007 1.00 55.43  ? 331  SER A O      1 
ATOM   5361  C  CB     . SER A 1 334 ? 44.611  64.936  -23.474 1.00 36.62  ? 331  SER A CB     1 
ATOM   5362  O  OG     . SER A 1 334 ? 45.079  65.263  -22.173 1.00 49.52  ? 331  SER A OG     1 
ATOM   5363  H  H      . SER A 1 334 ? 46.159  66.376  -24.723 1.00 33.60  ? 331  SER A H      1 
ATOM   5364  H  HA     . SER A 1 334 ? 46.352  63.915  -23.828 1.00 35.10  ? 331  SER A HA     1 
ATOM   5365  H  HB2    . SER A 1 334 ? 44.203  65.722  -23.871 1.00 43.95  ? 331  SER A HB2    1 
ATOM   5366  H  HB3    . SER A 1 334 ? 43.959  64.222  -23.406 1.00 43.95  ? 331  SER A HB3    1 
ATOM   5367  H  HG     . SER A 1 334 ? 44.438  65.516  -21.693 1.00 59.43  ? 331  SER A HG     1 
ATOM   5368  N  N      . VAL A 1 335 ? 46.060  62.687  -25.973 1.00 41.42  ? 332  VAL A N      1 
ATOM   5369  C  CA     . VAL A 1 335 ? 45.799  61.971  -27.219 1.00 27.46  ? 332  VAL A CA     1 
ATOM   5370  C  C      . VAL A 1 335 ? 45.176  60.608  -26.947 1.00 41.55  ? 332  VAL A C      1 
ATOM   5371  O  O      . VAL A 1 335 ? 45.495  59.971  -25.945 1.00 44.57  ? 332  VAL A O      1 
ATOM   5372  C  CB     . VAL A 1 335 ? 47.081  61.763  -28.048 1.00 35.41  ? 332  VAL A CB     1 
ATOM   5373  C  CG1    . VAL A 1 335 ? 47.644  63.103  -28.501 1.00 35.84  ? 332  VAL A CG1    1 
ATOM   5374  C  CG2    . VAL A 1 335 ? 48.120  60.964  -27.268 1.00 35.76  ? 332  VAL A CG2    1 
ATOM   5375  H  H      . VAL A 1 335 ? 46.774  62.431  -25.568 1.00 49.71  ? 332  VAL A H      1 
ATOM   5376  H  HA     . VAL A 1 335 ? 45.175  62.486  -27.754 1.00 32.95  ? 332  VAL A HA     1 
ATOM   5377  H  HB     . VAL A 1 335 ? 46.857  61.256  -28.844 1.00 42.49  ? 332  VAL A HB     1 
ATOM   5378  H  HG11   . VAL A 1 335 ? 47.852  63.638  -27.719 1.00 43.01  ? 332  VAL A HG11   1 
ATOM   5379  H  HG12   . VAL A 1 335 ? 48.448  62.948  -29.020 1.00 43.01  ? 332  VAL A HG12   1 
ATOM   5380  H  HG13   . VAL A 1 335 ? 46.980  63.555  -29.045 1.00 43.01  ? 332  VAL A HG13   1 
ATOM   5381  H  HG21   . VAL A 1 335 ? 47.748  60.096  -27.045 1.00 42.91  ? 332  VAL A HG21   1 
ATOM   5382  H  HG22   . VAL A 1 335 ? 48.911  60.852  -27.819 1.00 42.91  ? 332  VAL A HG22   1 
ATOM   5383  H  HG23   . VAL A 1 335 ? 48.346  61.446  -26.458 1.00 42.91  ? 332  VAL A HG23   1 
ATOM   5384  N  N      . PRO A 1 336 ? 44.264  60.159  -27.821 1.00 49.86  ? 333  PRO A N      1 
ATOM   5385  C  CA     . PRO A 1 336 ? 43.699  58.815  -27.647 1.00 55.42  ? 333  PRO A CA     1 
ATOM   5386  C  C      . PRO A 1 336 ? 44.747  57.713  -27.791 1.00 47.91  ? 333  PRO A C      1 
ATOM   5387  O  O      . PRO A 1 336 ? 45.713  57.869  -28.541 1.00 47.79  ? 333  PRO A O      1 
ATOM   5388  C  CB     . PRO A 1 336 ? 42.654  58.730  -28.761 1.00 37.48  ? 333  PRO A CB     1 
ATOM   5389  C  CG     . PRO A 1 336 ? 42.267  60.139  -28.998 1.00 48.03  ? 333  PRO A CG     1 
ATOM   5390  C  CD     . PRO A 1 336 ? 43.530  60.919  -28.844 1.00 41.72  ? 333  PRO A CD     1 
ATOM   5391  H  HA     . PRO A 1 336 ? 43.262  58.739  -26.784 1.00 66.50  ? 333  PRO A HA     1 
ATOM   5392  H  HB2    . PRO A 1 336 ? 43.051  58.341  -29.557 1.00 44.97  ? 333  PRO A HB2    1 
ATOM   5393  H  HB3    . PRO A 1 336 ? 41.894  58.207  -28.461 1.00 44.97  ? 333  PRO A HB3    1 
ATOM   5394  H  HG2    . PRO A 1 336 ? 41.912  60.234  -29.896 1.00 57.63  ? 333  PRO A HG2    1 
ATOM   5395  H  HG3    . PRO A 1 336 ? 41.611  60.414  -28.338 1.00 57.63  ? 333  PRO A HG3    1 
ATOM   5396  H  HD2    . PRO A 1 336 ? 44.025  60.932  -29.678 1.00 50.06  ? 333  PRO A HD2    1 
ATOM   5397  H  HD3    . PRO A 1 336 ? 43.338  61.816  -28.528 1.00 50.06  ? 333  PRO A HD3    1 
ATOM   5398  N  N      . ILE A 1 337 ? 44.538  56.613  -27.073 1.00 32.99  ? 334  ILE A N      1 
ATOM   5399  C  CA     . ILE A 1 337 ? 45.478  55.500  -27.045 1.00 44.70  ? 334  ILE A CA     1 
ATOM   5400  C  C      . ILE A 1 337 ? 44.874  54.321  -27.801 1.00 45.47  ? 334  ILE A C      1 
ATOM   5401  O  O      . ILE A 1 337 ? 43.757  53.876  -27.521 1.00 40.68  ? 334  ILE A O      1 
ATOM   5402  C  CB     . ILE A 1 337 ? 45.826  55.106  -25.576 1.00 44.94  ? 334  ILE A CB     1 
ATOM   5403  C  CG1    . ILE A 1 337 ? 46.401  56.324  -24.845 1.00 46.05  ? 334  ILE A CG1    1 
ATOM   5404  C  CG2    . ILE A 1 337 ? 46.817  53.942  -25.527 1.00 21.54  ? 334  ILE A CG2    1 
ATOM   5405  C  CD1    . ILE A 1 337 ? 46.735  56.108  -23.385 1.00 38.69  ? 334  ILE A CD1    1 
ATOM   5406  H  H      . ILE A 1 337 ? 43.842  56.487  -26.584 1.00 39.58  ? 334  ILE A H      1 
ATOM   5407  H  HA     . ILE A 1 337 ? 46.298  55.761  -27.493 1.00 53.64  ? 334  ILE A HA     1 
ATOM   5408  H  HB     . ILE A 1 337 ? 45.009  54.834  -25.128 1.00 53.93  ? 334  ILE A HB     1 
ATOM   5409  H  HG12   . ILE A 1 337 ? 47.218  56.593  -25.293 1.00 55.26  ? 334  ILE A HG12   1 
ATOM   5410  H  HG13   . ILE A 1 337 ? 45.754  57.045  -24.892 1.00 55.26  ? 334  ILE A HG13   1 
ATOM   5411  H  HG21   . ILE A 1 337 ? 47.633  54.204  -25.981 1.00 25.85  ? 334  ILE A HG21   1 
ATOM   5412  H  HG22   . ILE A 1 337 ? 47.007  53.729  -24.600 1.00 25.85  ? 334  ILE A HG22   1 
ATOM   5413  H  HG23   . ILE A 1 337 ? 46.424  53.174  -25.970 1.00 25.85  ? 334  ILE A HG23   1 
ATOM   5414  H  HD11   . ILE A 1 337 ? 47.396  55.402  -23.313 1.00 46.42  ? 334  ILE A HD11   1 
ATOM   5415  H  HD12   . ILE A 1 337 ? 47.089  56.933  -23.017 1.00 46.42  ? 334  ILE A HD12   1 
ATOM   5416  H  HD13   . ILE A 1 337 ? 45.927  55.855  -22.911 1.00 46.42  ? 334  ILE A HD13   1 
ATOM   5417  N  N      . ASP A 1 338 ? 45.628  53.832  -28.779 1.00 34.12  ? 335  ASP A N      1 
ATOM   5418  C  CA     . ASP A 1 338 ? 45.203  52.708  -29.595 1.00 54.74  ? 335  ASP A CA     1 
ATOM   5419  C  C      . ASP A 1 338 ? 45.327  51.441  -28.759 1.00 47.83  ? 335  ASP A C      1 
ATOM   5420  O  O      . ASP A 1 338 ? 46.439  51.016  -28.442 1.00 46.07  ? 335  ASP A O      1 
ATOM   5421  C  CB     . ASP A 1 338 ? 46.072  52.645  -30.860 1.00 88.31  ? 335  ASP A CB     1 
ATOM   5422  C  CG     . ASP A 1 338 ? 45.654  51.551  -31.825 1.00 75.58  ? 335  ASP A CG     1 
ATOM   5423  O  OD1    . ASP A 1 338 ? 44.651  50.850  -31.569 1.00 74.54  ? 335  ASP A OD1    1 
ATOM   5424  O  OD2    . ASP A 1 338 ? 46.345  51.398  -32.855 1.00 67.30  ? 335  ASP A OD2    1 
ATOM   5425  H  H      . ASP A 1 338 ? 46.403  54.141  -28.991 1.00 40.94  ? 335  ASP A H      1 
ATOM   5426  H  HA     . ASP A 1 338 ? 44.276  52.822  -29.856 1.00 65.68  ? 335  ASP A HA     1 
ATOM   5427  H  HB2    . ASP A 1 338 ? 46.010  53.493  -31.326 1.00 105.98 ? 335  ASP A HB2    1 
ATOM   5428  H  HB3    . ASP A 1 338 ? 46.992  52.478  -30.601 1.00 105.98 ? 335  ASP A HB3    1 
ATOM   5429  N  N      . LEU A 1 339 ? 44.191  50.829  -28.421 1.00 37.18  ? 336  LEU A N      1 
ATOM   5430  C  CA     . LEU A 1 339 ? 44.193  49.635  -27.572 1.00 52.25  ? 336  LEU A CA     1 
ATOM   5431  C  C      . LEU A 1 339 ? 44.938  48.453  -28.184 1.00 52.79  ? 336  LEU A C      1 
ATOM   5432  O  O      . LEU A 1 339 ? 45.463  47.607  -27.466 1.00 59.84  ? 336  LEU A O      1 
ATOM   5433  C  CB     . LEU A 1 339 ? 42.761  49.212  -27.222 1.00 33.55  ? 336  LEU A CB     1 
ATOM   5434  C  CG     . LEU A 1 339 ? 42.097  50.012  -26.096 1.00 50.39  ? 336  LEU A CG     1 
ATOM   5435  C  CD1    . LEU A 1 339 ? 40.634  49.617  -25.891 1.00 32.93  ? 336  LEU A CD1    1 
ATOM   5436  C  CD2    . LEU A 1 339 ? 42.874  49.856  -24.790 1.00 47.39  ? 336  LEU A CD2    1 
ATOM   5437  H  H      . LEU A 1 339 ? 43.408  51.085  -28.669 1.00 44.61  ? 336  LEU A H      1 
ATOM   5438  H  HA     . LEU A 1 339 ? 44.639  49.856  -26.739 1.00 62.70  ? 336  LEU A HA     1 
ATOM   5439  H  HB2    . LEU A 1 339 ? 42.209  49.311  -28.014 1.00 40.26  ? 336  LEU A HB2    1 
ATOM   5440  H  HB3    . LEU A 1 339 ? 42.773  48.281  -26.950 1.00 40.26  ? 336  LEU A HB3    1 
ATOM   5441  H  HG     . LEU A 1 339 ? 42.115  50.952  -26.335 1.00 60.47  ? 336  LEU A HG     1 
ATOM   5442  H  HD11   . LEU A 1 339 ? 40.590  48.676  -25.663 1.00 39.52  ? 336  LEU A HD11   1 
ATOM   5443  H  HD12   . LEU A 1 339 ? 40.262  50.150  -25.170 1.00 39.52  ? 336  LEU A HD12   1 
ATOM   5444  H  HD13   . LEU A 1 339 ? 40.145  49.783  -26.712 1.00 39.52  ? 336  LEU A HD13   1 
ATOM   5445  H  HD21   . LEU A 1 339 ? 43.778  50.182  -24.920 1.00 56.87  ? 336  LEU A HD21   1 
ATOM   5446  H  HD22   . LEU A 1 339 ? 42.432  50.372  -24.097 1.00 56.87  ? 336  LEU A HD22   1 
ATOM   5447  H  HD23   . LEU A 1 339 ? 42.892  48.918  -24.544 1.00 56.87  ? 336  LEU A HD23   1 
ATOM   5448  N  N      . GLN A 1 340 ? 44.988  48.397  -29.507 1.00 67.34  ? 337  GLN A N      1 
ATOM   5449  C  CA     . GLN A 1 340 ? 45.684  47.314  -30.188 1.00 77.10  ? 337  GLN A CA     1 
ATOM   5450  C  C      . GLN A 1 340 ? 47.196  47.495  -30.099 1.00 59.62  ? 337  GLN A C      1 
ATOM   5451  O  O      . GLN A 1 340 ? 47.946  46.527  -30.200 1.00 71.86  ? 337  GLN A O      1 
ATOM   5452  C  CB     . GLN A 1 340 ? 45.246  47.217  -31.649 1.00 88.06  ? 337  GLN A CB     1 
ATOM   5453  C  CG     . GLN A 1 340 ? 43.757  46.986  -31.840 1.00 72.33  ? 337  GLN A CG     1 
ATOM   5454  C  CD     . GLN A 1 340 ? 43.415  46.657  -33.279 1.00 111.81 ? 337  GLN A CD     1 
ATOM   5455  O  OE1    . GLN A 1 340 ? 43.684  47.443  -34.188 1.00 113.32 ? 337  GLN A OE1    1 
ATOM   5456  N  NE2    . GLN A 1 340 ? 42.834  45.482  -33.496 1.00 118.69 ? 337  GLN A NE2    1 
ATOM   5457  H  H      . GLN A 1 340 ? 44.628  48.974  -30.034 1.00 80.81  ? 337  GLN A H      1 
ATOM   5458  H  HA     . GLN A 1 340 ? 45.459  46.476  -29.754 1.00 92.52  ? 337  GLN A HA     1 
ATOM   5459  H  HB2    . GLN A 1 340 ? 45.475  48.046  -32.098 1.00 105.67 ? 337  GLN A HB2    1 
ATOM   5460  H  HB3    . GLN A 1 340 ? 45.715  46.478  -32.066 1.00 105.67 ? 337  GLN A HB3    1 
ATOM   5461  H  HG2    . GLN A 1 340 ? 43.477  46.241  -31.285 1.00 86.80  ? 337  GLN A HG2    1 
ATOM   5462  H  HG3    . GLN A 1 340 ? 43.275  47.789  -31.590 1.00 86.80  ? 337  GLN A HG3    1 
ATOM   5463  H  HE21   . GLN A 1 340 ? 42.672  44.954  -32.837 1.00 142.43 ? 337  GLN A HE21   1 
ATOM   5464  H  HE22   . GLN A 1 340 ? 42.620  45.249  -34.296 1.00 142.43 ? 337  GLN A HE22   1 
ATOM   5465  N  N      . LYS A 1 341 ? 47.635  48.738  -29.934 1.00 55.53  ? 338  LYS A N      1 
ATOM   5466  C  CA     . LYS A 1 341 ? 49.058  49.047  -29.828 1.00 67.57  ? 338  LYS A CA     1 
ATOM   5467  C  C      . LYS A 1 341 ? 49.415  49.580  -28.437 1.00 58.22  ? 338  LYS A C      1 
ATOM   5468  O  O      . LYS A 1 341 ? 50.243  50.482  -28.309 1.00 55.10  ? 338  LYS A O      1 
ATOM   5469  C  CB     . LYS A 1 341 ? 49.451  50.075  -30.898 1.00 84.72  ? 338  LYS A CB     1 
ATOM   5470  C  CG     . LYS A 1 341 ? 49.448  49.542  -32.321 1.00 78.90  ? 338  LYS A CG     1 
ATOM   5471  C  CD     . LYS A 1 341 ? 50.117  50.519  -33.281 1.00 88.74  ? 338  LYS A CD     1 
ATOM   5472  C  CE     . LYS A 1 341 ? 50.285  49.907  -34.666 1.00 130.73 ? 338  LYS A CE     1 
ATOM   5473  N  NZ     . LYS A 1 341 ? 51.110  50.753  -35.577 1.00 139.58 ? 338  LYS A NZ     1 
ATOM   5474  H  H      . LYS A 1 341 ? 47.125  49.428  -29.880 1.00 66.63  ? 338  LYS A H      1 
ATOM   5475  H  HA     . LYS A 1 341 ? 49.571  48.238  -29.983 1.00 81.08  ? 338  LYS A HA     1 
ATOM   5476  H  HB2    . LYS A 1 341 ? 48.826  50.815  -30.860 1.00 101.67 ? 338  LYS A HB2    1 
ATOM   5477  H  HB3    . LYS A 1 341 ? 50.347  50.395  -30.705 1.00 101.67 ? 338  LYS A HB3    1 
ATOM   5478  H  HG2    . LYS A 1 341 ? 49.936  48.704  -32.350 1.00 94.68  ? 338  LYS A HG2    1 
ATOM   5479  H  HG3    . LYS A 1 341 ? 48.533  49.409  -32.611 1.00 94.68  ? 338  LYS A HG3    1 
ATOM   5480  H  HD2    . LYS A 1 341 ? 49.568  51.314  -33.364 1.00 106.49 ? 338  LYS A HD2    1 
ATOM   5481  H  HD3    . LYS A 1 341 ? 50.996  50.751  -32.942 1.00 106.49 ? 338  LYS A HD3    1 
ATOM   5482  H  HE2    . LYS A 1 341 ? 50.723  49.045  -34.580 1.00 156.87 ? 338  LYS A HE2    1 
ATOM   5483  H  HE3    . LYS A 1 341 ? 49.411  49.795  -35.070 1.00 156.87 ? 338  LYS A HE3    1 
ATOM   5484  H  HZ1    . LYS A 1 341 ? 51.923  50.866  -35.234 1.00 167.49 ? 338  LYS A HZ1    1 
ATOM   5485  H  HZ2    . LYS A 1 341 ? 51.183  50.360  -36.373 1.00 167.49 ? 338  LYS A HZ2    1 
ATOM   5486  H  HZ3    . LYS A 1 341 ? 50.727  51.549  -35.682 1.00 167.49 ? 338  LYS A HZ3    1 
ATOM   5487  N  N      . VAL A 1 342 ? 48.788  49.034  -27.396 1.00 56.60  ? 339  VAL A N      1 
ATOM   5488  C  CA     . VAL A 1 342 ? 48.967  49.577  -26.047 1.00 56.35  ? 339  VAL A CA     1 
ATOM   5489  C  C      . VAL A 1 342 ? 50.384  49.347  -25.508 1.00 32.65  ? 339  VAL A C      1 
ATOM   5490  O  O      . VAL A 1 342 ? 50.919  50.209  -24.820 1.00 38.88  ? 339  VAL A O      1 
ATOM   5491  C  CB     . VAL A 1 342 ? 47.947  48.993  -25.043 1.00 37.51  ? 339  VAL A CB     1 
ATOM   5492  C  CG1    . VAL A 1 342 ? 48.153  47.499  -24.852 1.00 45.83  ? 339  VAL A CG1    1 
ATOM   5493  C  CG2    . VAL A 1 342 ? 48.055  49.713  -23.705 1.00 41.92  ? 339  VAL A CG2    1 
ATOM   5494  H  H      . VAL A 1 342 ? 48.259  48.357  -27.441 1.00 67.93  ? 339  VAL A H      1 
ATOM   5495  H  HA     . VAL A 1 342 ? 48.823  50.535  -26.083 1.00 67.62  ? 339  VAL A HA     1 
ATOM   5496  H  HB     . VAL A 1 342 ? 47.050  49.131  -25.386 1.00 45.01  ? 339  VAL A HB     1 
ATOM   5497  H  HG11   . VAL A 1 342 ? 49.049  47.345  -24.513 1.00 55.00  ? 339  VAL A HG11   1 
ATOM   5498  H  HG12   . VAL A 1 342 ? 47.497  47.169  -24.218 1.00 55.00  ? 339  VAL A HG12   1 
ATOM   5499  H  HG13   . VAL A 1 342 ? 48.041  47.054  -25.706 1.00 55.00  ? 339  VAL A HG13   1 
ATOM   5500  H  HG21   . VAL A 1 342 ? 47.872  50.656  -23.839 1.00 50.31  ? 339  VAL A HG21   1 
ATOM   5501  H  HG22   . VAL A 1 342 ? 47.409  49.333  -23.090 1.00 50.31  ? 339  VAL A HG22   1 
ATOM   5502  H  HG23   . VAL A 1 342 ? 48.953  49.596  -23.356 1.00 50.31  ? 339  VAL A HG23   1 
ATOM   5503  N  N      . ASP A 1 343 ? 50.996  48.209  -25.825 1.00 34.32  ? 340  ASP A N      1 
ATOM   5504  C  CA     . ASP A 1 343 ? 52.354  47.927  -25.343 1.00 38.92  ? 340  ASP A CA     1 
ATOM   5505  C  C      . ASP A 1 343 ? 53.338  48.835  -26.063 1.00 32.23  ? 340  ASP A C      1 
ATOM   5506  O  O      . ASP A 1 343 ? 54.479  49.004  -25.635 1.00 51.00  ? 340  ASP A O      1 
ATOM   5507  C  CB     . ASP A 1 343 ? 52.759  46.461  -25.546 1.00 31.02  ? 340  ASP A CB     1 
ATOM   5508  C  CG     . ASP A 1 343 ? 52.002  45.505  -24.638 1.00 44.86  ? 340  ASP A CG     1 
ATOM   5509  O  OD1    . ASP A 1 343 ? 50.813  45.744  -24.344 1.00 58.71  ? 340  ASP A OD1    1 
ATOM   5510  O  OD2    . ASP A 1 343 ? 52.603  44.499  -24.210 1.00 56.72  ? 340  ASP A OD2    1 
ATOM   5511  H  H      . ASP A 1 343 ? 50.655  47.587  -26.311 1.00 41.18  ? 340  ASP A H      1 
ATOM   5512  H  HA     . ASP A 1 343 ? 52.400  48.124  -24.394 1.00 46.71  ? 340  ASP A HA     1 
ATOM   5513  H  HB2    . ASP A 1 343 ? 52.577  46.208  -26.464 1.00 37.23  ? 340  ASP A HB2    1 
ATOM   5514  H  HB3    . ASP A 1 343 ? 53.705  46.366  -25.357 1.00 37.23  ? 340  ASP A HB3    1 
ATOM   5515  N  N      . GLN A 1 344 ? 52.893  49.403  -27.174 1.00 39.02  ? 341  GLN A N      1 
ATOM   5516  C  CA     . GLN A 1 344 ? 53.756  50.218  -28.013 1.00 48.52  ? 341  GLN A CA     1 
ATOM   5517  C  C      . GLN A 1 344 ? 53.573  51.707  -27.716 1.00 53.37  ? 341  GLN A C      1 
ATOM   5518  O  O      . GLN A 1 344 ? 54.345  52.531  -28.207 1.00 48.04  ? 341  GLN A O      1 
ATOM   5519  C  CB     . GLN A 1 344 ? 53.495  49.922  -29.493 1.00 47.01  ? 341  GLN A CB     1 
ATOM   5520  C  CG     . GLN A 1 344 ? 53.979  48.545  -29.953 1.00 57.40  ? 341  GLN A CG     1 
ATOM   5521  C  CD     . GLN A 1 344 ? 53.172  47.391  -29.382 1.00 71.58  ? 341  GLN A CD     1 
ATOM   5522  O  OE1    . GLN A 1 344 ? 51.962  47.501  -29.171 1.00 65.91  ? 341  GLN A OE1    1 
ATOM   5523  N  NE2    . GLN A 1 344 ? 53.845  46.270  -29.130 1.00 52.19  ? 341  GLN A NE2    1 
ATOM   5524  H  H      . GLN A 1 344 ? 52.087  49.332  -27.466 1.00 46.83  ? 341  GLN A H      1 
ATOM   5525  H  HA     . GLN A 1 344 ? 54.680  49.990  -27.824 1.00 58.22  ? 341  GLN A HA     1 
ATOM   5526  H  HB2    . GLN A 1 344 ? 52.540  49.969  -29.656 1.00 56.41  ? 341  GLN A HB2    1 
ATOM   5527  H  HB3    . GLN A 1 344 ? 53.951  50.590  -30.029 1.00 56.41  ? 341  GLN A HB3    1 
ATOM   5528  H  HG2    . GLN A 1 344 ? 53.919  48.499  -30.920 1.00 68.88  ? 341  GLN A HG2    1 
ATOM   5529  H  HG3    . GLN A 1 344 ? 54.901  48.429  -29.675 1.00 68.88  ? 341  GLN A HG3    1 
ATOM   5530  H  HE21   . GLN A 1 344 ? 54.689  46.230  -29.291 1.00 62.63  ? 341  GLN A HE21   1 
ATOM   5531  H  HE22   . GLN A 1 344 ? 53.436  45.586  -28.806 1.00 62.63  ? 341  GLN A HE22   1 
ATOM   5532  N  N      . PHE A 1 345 ? 52.567  52.054  -26.912 1.00 47.45  ? 342  PHE A N      1 
ATOM   5533  C  CA     . PHE A 1 345 ? 52.316  53.458  -26.590 1.00 35.43  ? 342  PHE A CA     1 
ATOM   5534  C  C      . PHE A 1 345 ? 53.499  54.054  -25.840 1.00 51.10  ? 342  PHE A C      1 
ATOM   5535  O  O      . PHE A 1 345 ? 54.072  53.420  -24.952 1.00 61.07  ? 342  PHE A O      1 
ATOM   5536  C  CB     . PHE A 1 345 ? 51.046  53.624  -25.750 1.00 30.00  ? 342  PHE A CB     1 
ATOM   5537  C  CG     . PHE A 1 345 ? 50.726  55.059  -25.419 1.00 38.18  ? 342  PHE A CG     1 
ATOM   5538  C  CD1    . PHE A 1 345 ? 49.996  55.847  -26.285 1.00 32.12  ? 342  PHE A CD1    1 
ATOM   5539  C  CD2    . PHE A 1 345 ? 51.188  55.624  -24.240 1.00 58.03  ? 342  PHE A CD2    1 
ATOM   5540  C  CE1    . PHE A 1 345 ? 49.720  57.167  -25.976 1.00 44.74  ? 342  PHE A CE1    1 
ATOM   5541  C  CE2    . PHE A 1 345 ? 50.913  56.944  -23.926 1.00 50.31  ? 342  PHE A CE2    1 
ATOM   5542  C  CZ     . PHE A 1 345 ? 50.178  57.714  -24.795 1.00 52.99  ? 342  PHE A CZ     1 
ATOM   5543  H  H      . PHE A 1 345 ? 52.020  51.501  -26.544 1.00 56.93  ? 342  PHE A H      1 
ATOM   5544  H  HA     . PHE A 1 345 ? 52.199  53.957  -27.413 1.00 42.51  ? 342  PHE A HA     1 
ATOM   5545  H  HB2    . PHE A 1 345 ? 50.295  53.258  -26.242 1.00 36.00  ? 342  PHE A HB2    1 
ATOM   5546  H  HB3    . PHE A 1 345 ? 51.158  53.144  -24.914 1.00 36.00  ? 342  PHE A HB3    1 
ATOM   5547  H  HD1    . PHE A 1 345 ? 51.685  55.107  -23.648 1.00 69.63  ? 342  PHE A HD1    1 
ATOM   5548  H  HD2    . PHE A 1 345 ? 49.683  55.486  -27.082 1.00 38.55  ? 342  PHE A HD2    1 
ATOM   5549  H  HE1    . PHE A 1 345 ? 51.224  57.309  -23.129 1.00 60.37  ? 342  PHE A HE1    1 
ATOM   5550  H  HE2    . PHE A 1 345 ? 49.222  57.687  -26.565 1.00 53.69  ? 342  PHE A HE2    1 
ATOM   5551  H  HZ     . PHE A 1 345 ? 49.990  58.602  -24.588 1.00 63.59  ? 342  PHE A HZ     1 
ATOM   5552  N  N      . ASP A 1 346 ? 53.849  55.282  -26.204 1.00 48.33  ? 343  ASP A N      1 
ATOM   5553  C  CA     . ASP A 1 346 ? 55.016  55.959  -25.653 1.00 52.92  ? 343  ASP A CA     1 
ATOM   5554  C  C      . ASP A 1 346 ? 54.642  57.376  -25.247 1.00 58.23  ? 343  ASP A C      1 
ATOM   5555  O  O      . ASP A 1 346 ? 54.400  58.216  -26.111 1.00 66.66  ? 343  ASP A O      1 
ATOM   5556  C  CB     . ASP A 1 346 ? 56.147  55.991  -26.683 1.00 58.99  ? 343  ASP A CB     1 
ATOM   5557  C  CG     . ASP A 1 346 ? 57.458  56.485  -26.104 1.00 61.11  ? 343  ASP A CG     1 
ATOM   5558  O  OD1    . ASP A 1 346 ? 57.440  57.228  -25.099 1.00 66.49  ? 343  ASP A OD1    1 
ATOM   5559  O  OD2    . ASP A 1 346 ? 58.516  56.132  -26.666 1.00 64.25  ? 343  ASP A OD2    1 
ATOM   5560  H  H      . ASP A 1 346 ? 53.418  55.753  -26.781 1.00 58.00  ? 343  ASP A H      1 
ATOM   5561  H  HA     . ASP A 1 346 ? 55.327  55.484  -24.866 1.00 63.50  ? 343  ASP A HA     1 
ATOM   5562  H  HB2    . ASP A 1 346 ? 56.289  55.095  -27.024 1.00 70.79  ? 343  ASP A HB2    1 
ATOM   5563  H  HB3    . ASP A 1 346 ? 55.897  56.586  -27.407 1.00 70.79  ? 343  ASP A HB3    1 
ATOM   5564  N  N      . PRO A 1 347 ? 54.603  57.657  -23.937 1.00 53.31  ? 344  PRO A N      1 
ATOM   5565  C  CA     . PRO A 1 347 ? 54.185  59.006  -23.546 1.00 58.06  ? 344  PRO A CA     1 
ATOM   5566  C  C      . PRO A 1 347 ? 55.242  60.069  -23.837 1.00 53.60  ? 344  PRO A C      1 
ATOM   5567  O  O      . PRO A 1 347 ? 54.957  61.255  -23.674 1.00 61.02  ? 344  PRO A O      1 
ATOM   5568  C  CB     . PRO A 1 347 ? 53.954  58.876  -22.038 1.00 55.98  ? 344  PRO A CB     1 
ATOM   5569  C  CG     . PRO A 1 347 ? 54.862  57.777  -21.622 1.00 54.91  ? 344  PRO A CG     1 
ATOM   5570  C  CD     . PRO A 1 347 ? 54.873  56.805  -22.765 1.00 49.98  ? 344  PRO A CD     1 
ATOM   5571  H  HA     . PRO A 1 347 ? 53.353  59.246  -23.983 1.00 69.68  ? 344  PRO A HA     1 
ATOM   5572  H  HB2    . PRO A 1 347 ? 54.192  59.707  -21.596 1.00 67.18  ? 344  PRO A HB2    1 
ATOM   5573  H  HB3    . PRO A 1 347 ? 53.029  58.644  -21.865 1.00 67.18  ? 344  PRO A HB3    1 
ATOM   5574  H  HG2    . PRO A 1 347 ? 55.752  58.132  -21.468 1.00 65.90  ? 344  PRO A HG2    1 
ATOM   5575  H  HG3    . PRO A 1 347 ? 54.517  57.357  -20.819 1.00 65.90  ? 344  PRO A HG3    1 
ATOM   5576  H  HD2    . PRO A 1 347 ? 55.744  56.385  -22.845 1.00 59.98  ? 344  PRO A HD2    1 
ATOM   5577  H  HD3    . PRO A 1 347 ? 54.168  56.147  -22.656 1.00 59.98  ? 344  PRO A HD3    1 
ATOM   5578  N  N      . PHE A 1 348 ? 56.431  59.652  -24.269 1.00 43.42  ? 345  PHE A N      1 
ATOM   5579  C  CA     . PHE A 1 348 ? 57.528  60.588  -24.492 1.00 53.26  ? 345  PHE A CA     1 
ATOM   5580  C  C      . PHE A 1 348 ? 57.675  60.989  -25.956 1.00 70.58  ? 345  PHE A C      1 
ATOM   5581  O  O      . PHE A 1 348 ? 58.441  61.899  -26.283 1.00 72.64  ? 345  PHE A O      1 
ATOM   5582  C  CB     . PHE A 1 348 ? 58.828  59.980  -23.964 1.00 66.69  ? 345  PHE A CB     1 
ATOM   5583  C  CG     . PHE A 1 348 ? 58.773  59.654  -22.500 1.00 61.53  ? 345  PHE A CG     1 
ATOM   5584  C  CD1    . PHE A 1 348 ? 59.033  60.628  -21.554 1.00 56.17  ? 345  PHE A CD1    1 
ATOM   5585  C  CD2    . PHE A 1 348 ? 58.446  58.379  -22.070 1.00 62.43  ? 345  PHE A CD2    1 
ATOM   5586  C  CE1    . PHE A 1 348 ? 58.967  60.338  -20.208 1.00 50.39  ? 345  PHE A CE1    1 
ATOM   5587  C  CE2    . PHE A 1 348 ? 58.385  58.082  -20.722 1.00 49.93  ? 345  PHE A CE2    1 
ATOM   5588  C  CZ     . PHE A 1 348 ? 58.644  59.063  -19.792 1.00 44.39  ? 345  PHE A CZ     1 
ATOM   5589  H  H      . PHE A 1 348 ? 56.626  58.832  -24.441 1.00 52.10  ? 345  PHE A H      1 
ATOM   5590  H  HA     . PHE A 1 348 ? 57.353  61.396  -23.983 1.00 63.92  ? 345  PHE A HA     1 
ATOM   5591  H  HB2    . PHE A 1 348 ? 59.010  59.159  -24.446 1.00 80.03  ? 345  PHE A HB2    1 
ATOM   5592  H  HB3    . PHE A 1 348 ? 59.550  60.613  -24.102 1.00 80.03  ? 345  PHE A HB3    1 
ATOM   5593  H  HD1    . PHE A 1 348 ? 59.248  61.490  -21.829 1.00 67.41  ? 345  PHE A HD1    1 
ATOM   5594  H  HD2    . PHE A 1 348 ? 58.266  57.715  -22.696 1.00 74.91  ? 345  PHE A HD2    1 
ATOM   5595  H  HE1    . PHE A 1 348 ? 59.148  61.001  -19.581 1.00 60.46  ? 345  PHE A HE1    1 
ATOM   5596  H  HE2    . PHE A 1 348 ? 58.166  57.222  -20.443 1.00 59.92  ? 345  PHE A HE2    1 
ATOM   5597  H  HZ     . PHE A 1 348 ? 58.606  58.865  -18.884 1.00 53.27  ? 345  PHE A HZ     1 
ATOM   5598  N  N      . THR A 1 349 ? 56.942  60.301  -26.829 1.00 80.80  ? 346  THR A N      1 
ATOM   5599  C  CA     . THR A 1 349 ? 56.862  60.658  -28.244 1.00 50.13  ? 346  THR A CA     1 
ATOM   5600  C  C      . THR A 1 349 ? 55.477  61.179  -28.595 1.00 44.64  ? 346  THR A C      1 
ATOM   5601  O  O      . THR A 1 349 ? 55.168  61.381  -29.765 1.00 79.02  ? 346  THR A O      1 
ATOM   5602  C  CB     . THR A 1 349 ? 57.187  59.475  -29.156 1.00 45.88  ? 346  THR A CB     1 
ATOM   5603  O  OG1    . THR A 1 349 ? 56.047  58.608  -29.223 1.00 59.10  ? 346  THR A OG1    1 
ATOM   5604  C  CG2    . THR A 1 349 ? 58.377  58.699  -28.629 1.00 64.18  ? 346  THR A CG2    1 
ATOM   5605  H  H      . THR A 1 349 ? 56.474  59.610  -26.622 1.00 96.96  ? 346  THR A H      1 
ATOM   5606  H  HA     . THR A 1 349 ? 57.503  61.363  -28.428 1.00 60.16  ? 346  THR A HA     1 
ATOM   5607  H  HB     . THR A 1 349 ? 57.400  59.800  -30.045 1.00 55.05  ? 346  THR A HB     1 
ATOM   5608  H  HG1    . THR A 1 349 ? 56.213  57.953  -29.722 1.00 70.92  ? 346  THR A HG1    1 
ATOM   5609  H  HG21   . THR A 1 349 ? 58.185  58.360  -27.740 1.00 77.02  ? 346  THR A HG21   1 
ATOM   5610  H  HG22   . THR A 1 349 ? 58.573  57.952  -29.216 1.00 77.02  ? 346  THR A HG22   1 
ATOM   5611  H  HG23   . THR A 1 349 ? 59.156  59.277  -28.584 1.00 77.02  ? 346  THR A HG23   1 
ATOM   5612  N  N      . VAL A 1 350 ? 54.646  61.404  -27.585 1.00 41.26  ? 347  VAL A N      1 
ATOM   5613  C  CA     . VAL A 1 350 ? 53.337  61.997  -27.819 1.00 40.81  ? 347  VAL A CA     1 
ATOM   5614  C  C      . VAL A 1 350 ? 53.549  63.443  -28.256 1.00 51.95  ? 347  VAL A C      1 
ATOM   5615  O  O      . VAL A 1 350 ? 54.258  64.184  -27.589 1.00 62.63  ? 347  VAL A O      1 
ATOM   5616  C  CB     . VAL A 1 350 ? 52.434  61.939  -26.568 1.00 42.14  ? 347  VAL A CB     1 
ATOM   5617  C  CG1    . VAL A 1 350 ? 51.249  62.899  -26.689 1.00 33.58  ? 347  VAL A CG1    1 
ATOM   5618  C  CG2    . VAL A 1 350 ? 51.944  60.516  -26.340 1.00 45.08  ? 347  VAL A CG2    1 
ATOM   5619  H  H      . VAL A 1 350 ? 54.814  61.224  -26.761 1.00 49.52  ? 347  VAL A H      1 
ATOM   5620  H  HA     . VAL A 1 350 ? 52.892  61.522  -28.539 1.00 48.97  ? 347  VAL A HA     1 
ATOM   5621  H  HB     . VAL A 1 350 ? 52.954  62.203  -25.793 1.00 50.56  ? 347  VAL A HB     1 
ATOM   5622  H  HG11   . VAL A 1 350 ? 50.722  62.653  -27.465 1.00 40.29  ? 347  VAL A HG11   1 
ATOM   5623  H  HG12   . VAL A 1 350 ? 50.707  62.834  -25.887 1.00 40.29  ? 347  VAL A HG12   1 
ATOM   5624  H  HG13   . VAL A 1 350 ? 51.584  63.803  -26.789 1.00 40.29  ? 347  VAL A HG13   1 
ATOM   5625  H  HG21   . VAL A 1 350 ? 52.710  59.935  -26.211 1.00 54.09  ? 347  VAL A HG21   1 
ATOM   5626  H  HG22   . VAL A 1 350 ? 51.379  60.500  -25.552 1.00 54.09  ? 347  VAL A HG22   1 
ATOM   5627  H  HG23   . VAL A 1 350 ? 51.437  60.229  -27.116 1.00 54.09  ? 347  VAL A HG23   1 
ATOM   5628  N  N      . PRO A 1 351 ? 52.948  63.846  -29.388 1.00 71.92  ? 348  PRO A N      1 
ATOM   5629  C  CA     . PRO A 1 351 ? 53.152  65.197  -29.922 1.00 56.59  ? 348  PRO A CA     1 
ATOM   5630  C  C      . PRO A 1 351 ? 52.862  66.302  -28.915 1.00 55.37  ? 348  PRO A C      1 
ATOM   5631  O  O      . PRO A 1 351 ? 51.850  66.245  -28.215 1.00 53.15  ? 348  PRO A O      1 
ATOM   5632  C  CB     . PRO A 1 351 ? 52.147  65.268  -31.073 1.00 47.55  ? 348  PRO A CB     1 
ATOM   5633  C  CG     . PRO A 1 351 ? 51.972  63.873  -31.506 1.00 52.34  ? 348  PRO A CG     1 
ATOM   5634  C  CD     . PRO A 1 351 ? 52.091  63.037  -30.275 1.00 62.83  ? 348  PRO A CD     1 
ATOM   5635  H  HA     . PRO A 1 351 ? 54.053  65.297  -30.268 1.00 67.91  ? 348  PRO A HA     1 
ATOM   5636  H  HB2    . PRO A 1 351 ? 51.309  65.637  -30.755 1.00 57.06  ? 348  PRO A HB2    1 
ATOM   5637  H  HB3    . PRO A 1 351 ? 52.510  65.808  -31.793 1.00 57.06  ? 348  PRO A HB3    1 
ATOM   5638  H  HG2    . PRO A 1 351 ? 51.094  63.766  -31.906 1.00 62.81  ? 348  PRO A HG2    1 
ATOM   5639  H  HG3    . PRO A 1 351 ? 52.666  63.641  -32.143 1.00 62.81  ? 348  PRO A HG3    1 
ATOM   5640  H  HD2    . PRO A 1 351 ? 51.219  62.903  -29.872 1.00 75.39  ? 348  PRO A HD2    1 
ATOM   5641  H  HD3    . PRO A 1 351 ? 52.521  62.192  -30.480 1.00 75.39  ? 348  PRO A HD3    1 
ATOM   5642  N  N      . THR A 1 352 ? 53.746  67.293  -28.848 1.00 54.35  ? 349  THR A N      1 
ATOM   5643  C  CA     . THR A 1 352 ? 53.484  68.490  -28.057 1.00 60.84  ? 349  THR A CA     1 
ATOM   5644  C  C      . THR A 1 352 ? 52.822  69.534  -28.940 1.00 66.70  ? 349  THR A C      1 
ATOM   5645  O  O      . THR A 1 352 ? 52.851  69.433  -30.166 1.00 68.58  ? 349  THR A O      1 
ATOM   5646  C  CB     . THR A 1 352 ? 54.765  69.087  -27.445 1.00 56.22  ? 349  THR A CB     1 
ATOM   5647  O  OG1    . THR A 1 352 ? 55.827  69.050  -28.408 1.00 47.66  ? 349  THR A OG1    1 
ATOM   5648  C  CG2    . THR A 1 352 ? 55.175  68.304  -26.213 1.00 70.65  ? 349  THR A CG2    1 
ATOM   5649  H  H      . THR A 1 352 ? 54.506  67.297  -29.252 1.00 65.22  ? 349  THR A H      1 
ATOM   5650  H  HA     . THR A 1 352 ? 52.875  68.271  -27.335 1.00 73.01  ? 349  THR A HA     1 
ATOM   5651  H  HB     . THR A 1 352 ? 54.599  70.006  -27.183 1.00 67.46  ? 349  THR A HB     1 
ATOM   5652  H  HG1    . THR A 1 352 ? 56.527  69.375  -28.077 1.00 57.19  ? 349  THR A HG1    1 
ATOM   5653  H  HG21   . THR A 1 352 ? 55.344  67.379  -26.449 1.00 84.79  ? 349  THR A HG21   1 
ATOM   5654  H  HG22   . THR A 1 352 ? 55.982  68.685  -25.833 1.00 84.79  ? 349  THR A HG22   1 
ATOM   5655  H  HG23   . THR A 1 352 ? 54.469  68.336  -25.549 1.00 84.79  ? 349  THR A HG23   1 
ATOM   5656  N  N      . ILE A 1 353 ? 52.221  70.536  -28.312 1.00 73.10  ? 350  ILE A N      1 
ATOM   5657  C  CA     . ILE A 1 353 ? 51.537  71.585  -29.052 1.00 62.35  ? 350  ILE A CA     1 
ATOM   5658  C  C      . ILE A 1 353 ? 52.523  72.387  -29.899 1.00 49.97  ? 350  ILE A C      1 
ATOM   5659  O  O      . ILE A 1 353 ? 52.176  72.846  -30.981 1.00 64.11  ? 350  ILE A O      1 
ATOM   5660  C  CB     . ILE A 1 353 ? 50.755  72.525  -28.107 1.00 68.35  ? 350  ILE A CB     1 
ATOM   5661  C  CG1    . ILE A 1 353 ? 49.955  73.539  -28.928 1.00 50.34  ? 350  ILE A CG1    1 
ATOM   5662  C  CG2    . ILE A 1 353 ? 51.697  73.224  -27.124 1.00 66.17  ? 350  ILE A CG2    1 
ATOM   5663  C  CD1    . ILE A 1 353 ? 49.005  74.383  -28.113 1.00 62.56  ? 350  ILE A CD1    1 
ATOM   5664  H  H      . ILE A 1 353 ? 52.195  70.632  -27.457 1.00 87.72  ? 350  ILE A H      1 
ATOM   5665  H  HA     . ILE A 1 353 ? 50.898  71.173  -29.654 1.00 74.82  ? 350  ILE A HA     1 
ATOM   5666  H  HB     . ILE A 1 353 ? 50.130  71.988  -27.596 1.00 82.02  ? 350  ILE A HB     1 
ATOM   5667  H  HG12   . ILE A 1 353 ? 50.575  74.138  -29.373 1.00 60.41  ? 350  ILE A HG12   1 
ATOM   5668  H  HG13   . ILE A 1 353 ? 49.431  73.060  -29.589 1.00 60.41  ? 350  ILE A HG13   1 
ATOM   5669  H  HG21   . ILE A 1 353 ? 52.344  73.746  -27.624 1.00 79.40  ? 350  ILE A HG21   1 
ATOM   5670  H  HG22   . ILE A 1 353 ? 51.177  73.804  -26.547 1.00 79.40  ? 350  ILE A HG22   1 
ATOM   5671  H  HG23   . ILE A 1 353 ? 52.154  72.552  -26.593 1.00 79.40  ? 350  ILE A HG23   1 
ATOM   5672  H  HD11   . ILE A 1 353 ? 49.513  74.882  -27.453 1.00 75.07  ? 350  ILE A HD11   1 
ATOM   5673  H  HD12   . ILE A 1 353 ? 48.540  74.995  -28.704 1.00 75.07  ? 350  ILE A HD12   1 
ATOM   5674  H  HD13   . ILE A 1 353 ? 48.367  73.802  -27.669 1.00 75.07  ? 350  ILE A HD13   1 
ATOM   5675  N  N      . SER A 1 354 ? 53.749  72.552  -29.416 1.00 54.04  ? 351  SER A N      1 
ATOM   5676  C  CA     . SER A 1 354 ? 54.747  73.304  -30.168 1.00 59.27  ? 351  SER A CA     1 
ATOM   5677  C  C      . SER A 1 354 ? 55.158  72.521  -31.411 1.00 57.53  ? 351  SER A C      1 
ATOM   5678  O  O      . SER A 1 354 ? 55.561  73.099  -32.419 1.00 77.96  ? 351  SER A O      1 
ATOM   5679  C  CB     . SER A 1 354 ? 55.980  73.612  -29.312 1.00 57.28  ? 351  SER A CB     1 
ATOM   5680  O  OG     . SER A 1 354 ? 56.829  72.482  -29.201 1.00 75.48  ? 351  SER A OG     1 
ATOM   5681  H  H      . SER A 1 354 ? 54.027  72.243  -28.663 1.00 64.85  ? 351  SER A H      1 
ATOM   5682  H  HA     . SER A 1 354 ? 54.361  74.146  -30.456 1.00 71.13  ? 351  SER A HA     1 
ATOM   5683  H  HB2    . SER A 1 354 ? 56.475  74.338  -29.724 1.00 68.74  ? 351  SER A HB2    1 
ATOM   5684  H  HB3    . SER A 1 354 ? 55.688  73.874  -28.425 1.00 68.74  ? 351  SER A HB3    1 
ATOM   5685  H  HG     . SER A 1 354 ? 57.498  72.670  -28.729 1.00 90.58  ? 351  SER A HG     1 
ATOM   5686  N  N      . PHE A 1 355 ? 55.051  71.199  -31.334 1.00 48.94  ? 352  PHE A N      1 
ATOM   5687  C  CA     . PHE A 1 355 ? 55.488  70.339  -32.426 1.00 47.89  ? 352  PHE A CA     1 
ATOM   5688  C  C      . PHE A 1 355 ? 54.464  70.287  -33.552 1.00 61.49  ? 352  PHE A C      1 
ATOM   5689  O  O      . PHE A 1 355 ? 54.841  70.279  -34.720 1.00 70.89  ? 352  PHE A O      1 
ATOM   5690  C  CB     . PHE A 1 355 ? 55.776  68.933  -31.901 1.00 58.15  ? 352  PHE A CB     1 
ATOM   5691  C  CG     . PHE A 1 355 ? 56.583  68.085  -32.843 1.00 51.07  ? 352  PHE A CG     1 
ATOM   5692  C  CD1    . PHE A 1 355 ? 57.967  68.158  -32.837 1.00 54.17  ? 352  PHE A CD1    1 
ATOM   5693  C  CD2    . PHE A 1 355 ? 55.968  67.178  -33.690 1.00 53.32  ? 352  PHE A CD2    1 
ATOM   5694  C  CE1    . PHE A 1 355 ? 58.722  67.377  -33.684 1.00 55.23  ? 352  PHE A CE1    1 
ATOM   5695  C  CE2    . PHE A 1 355 ? 56.721  66.387  -34.539 1.00 59.13  ? 352  PHE A CE2    1 
ATOM   5696  C  CZ     . PHE A 1 355 ? 58.100  66.487  -34.534 1.00 67.68  ? 352  PHE A CZ     1 
ATOM   5697  H  H      . PHE A 1 355 ? 54.728  70.775  -30.659 1.00 58.73  ? 352  PHE A H      1 
ATOM   5698  H  HA     . PHE A 1 355 ? 56.314  70.694  -32.793 1.00 57.46  ? 352  PHE A HA     1 
ATOM   5699  H  HB2    . PHE A 1 355 ? 56.271  69.005  -31.070 1.00 69.77  ? 352  PHE A HB2    1 
ATOM   5700  H  HB3    . PHE A 1 355 ? 54.933  68.480  -31.743 1.00 69.77  ? 352  PHE A HB3    1 
ATOM   5701  H  HD1    . PHE A 1 355 ? 58.391  68.759  -32.268 1.00 65.00  ? 352  PHE A HD1    1 
ATOM   5702  H  HD2    . PHE A 1 355 ? 55.041  67.110  -33.698 1.00 63.99  ? 352  PHE A HD2    1 
ATOM   5703  H  HE1    . PHE A 1 355 ? 59.650  67.444  -33.677 1.00 66.27  ? 352  PHE A HE1    1 
ATOM   5704  H  HE2    . PHE A 1 355 ? 56.299  65.789  -35.113 1.00 70.96  ? 352  PHE A HE2    1 
ATOM   5705  H  HZ     . PHE A 1 355 ? 58.607  65.956  -35.105 1.00 81.21  ? 352  PHE A HZ     1 
ATOM   5706  N  N      . ILE A 1 356 ? 53.177  70.262  -33.217 1.00 53.96  ? 353  ILE A N      1 
ATOM   5707  C  CA     . ILE A 1 356 ? 52.157  70.155  -34.254 1.00 54.94  ? 353  ILE A CA     1 
ATOM   5708  C  C      . ILE A 1 356 ? 51.846  71.543  -34.825 1.00 73.33  ? 353  ILE A C      1 
ATOM   5709  O  O      . ILE A 1 356 ? 51.278  71.660  -35.913 1.00 81.95  ? 353  ILE A O      1 
ATOM   5710  C  CB     . ILE A 1 356 ? 50.856  69.481  -33.753 1.00 47.28  ? 353  ILE A CB     1 
ATOM   5711  C  CG1    . ILE A 1 356 ? 50.212  70.260  -32.601 1.00 44.29  ? 353  ILE A CG1    1 
ATOM   5712  C  CG2    . ILE A 1 356 ? 51.142  68.033  -33.381 1.00 48.49  ? 353  ILE A CG2    1 
ATOM   5713  C  CD1    . ILE A 1 356 ? 48.813  69.758  -32.245 1.00 35.19  ? 353  ILE A CD1    1 
ATOM   5714  H  H      . ILE A 1 356 ? 52.873  70.306  -32.413 1.00 64.75  ? 353  ILE A H      1 
ATOM   5715  H  HA     . ILE A 1 356 ? 52.508  69.612  -34.977 1.00 65.93  ? 353  ILE A HA     1 
ATOM   5716  H  HB     . ILE A 1 356 ? 50.225  69.476  -34.491 1.00 56.73  ? 353  ILE A HB     1 
ATOM   5717  H  HG12   . ILE A 1 356 ? 50.770  70.174  -31.812 1.00 53.15  ? 353  ILE A HG12   1 
ATOM   5718  H  HG13   . ILE A 1 356 ? 50.139  71.194  -32.854 1.00 53.15  ? 353  ILE A HG13   1 
ATOM   5719  H  HG21   . ILE A 1 356 ? 51.811  68.014  -32.679 1.00 58.19  ? 353  ILE A HG21   1 
ATOM   5720  H  HG22   . ILE A 1 356 ? 50.322  67.619  -33.069 1.00 58.19  ? 353  ILE A HG22   1 
ATOM   5721  H  HG23   . ILE A 1 356 ? 51.472  67.565  -34.165 1.00 58.19  ? 353  ILE A HG23   1 
ATOM   5722  H  HD11   . ILE A 1 356 ? 48.870  68.826  -31.980 1.00 42.22  ? 353  ILE A HD11   1 
ATOM   5723  H  HD12   . ILE A 1 356 ? 48.464  70.289  -31.513 1.00 42.22  ? 353  ILE A HD12   1 
ATOM   5724  H  HD13   . ILE A 1 356 ? 48.239  69.847  -33.022 1.00 42.22  ? 353  ILE A HD13   1 
ATOM   5725  N  N      . CYS A 1 357 ? 52.215  72.592  -34.093 1.00 58.04  ? 354  CYS A N      1 
ATOM   5726  C  CA     . CYS A 1 357 ? 52.125  73.943  -34.636 1.00 61.94  ? 354  CYS A CA     1 
ATOM   5727  C  C      . CYS A 1 357 ? 53.344  74.207  -35.513 1.00 70.90  ? 354  CYS A C      1 
ATOM   5728  O  O      . CYS A 1 357 ? 53.243  74.882  -36.534 1.00 85.68  ? 354  CYS A O      1 
ATOM   5729  C  CB     . CYS A 1 357 ? 52.027  74.992  -33.523 1.00 63.10  ? 354  CYS A CB     1 
ATOM   5730  S  SG     . CYS A 1 357 ? 50.410  75.065  -32.687 1.00 71.35  ? 354  CYS A SG     1 
ATOM   5731  H  H      . CYS A 1 357 ? 52.517  72.549  -33.289 1.00 69.64  ? 354  CYS A H      1 
ATOM   5732  H  HA     . CYS A 1 357 ? 51.331  74.013  -35.189 1.00 74.33  ? 354  CYS A HA     1 
ATOM   5733  H  HB2    . CYS A 1 357 ? 52.696  74.793  -32.850 1.00 75.72  ? 354  CYS A HB2    1 
ATOM   5734  H  HB3    . CYS A 1 357 ? 52.199  75.866  -33.905 1.00 75.72  ? 354  CYS A HB3    1 
ATOM   5735  H  HG     . CYS A 1 357 ? 50.180  73.998  -32.188 1.00 85.62  ? 354  CYS A HG     1 
ATOM   5736  N  N      . ARG A 1 358 ? 54.495  73.681  -35.103 1.00 66.09  ? 355  ARG A N      1 
ATOM   5737  C  CA     . ARG A 1 358 ? 55.704  73.737  -35.920 1.00 64.24  ? 355  ARG A CA     1 
ATOM   5738  C  C      . ARG A 1 358 ? 55.470  73.104  -37.291 1.00 69.79  ? 355  ARG A C      1 
ATOM   5739  O  O      . ARG A 1 358 ? 55.868  73.661  -38.311 1.00 81.50  ? 355  ARG A O      1 
ATOM   5740  C  CB     . ARG A 1 358 ? 56.865  73.039  -35.210 1.00 79.53  ? 355  ARG A CB     1 
ATOM   5741  C  CG     . ARG A 1 358 ? 58.136  72.906  -36.043 1.00 105.55 ? 355  ARG A CG     1 
ATOM   5742  C  CD     . ARG A 1 358 ? 59.181  72.089  -35.301 1.00 138.62 ? 355  ARG A CD     1 
ATOM   5743  N  NE     . ARG A 1 358 ? 60.305  71.714  -36.154 1.00 170.59 ? 355  ARG A NE     1 
ATOM   5744  C  CZ     . ARG A 1 358 ? 61.306  70.929  -35.769 1.00 161.84 ? 355  ARG A CZ     1 
ATOM   5745  N  NH1    . ARG A 1 358 ? 61.321  70.418  -34.543 1.00 130.91 ? 355  ARG A NH1    1 
ATOM   5746  N  NH2    . ARG A 1 358 ? 62.287  70.641  -36.613 1.00 166.02 ? 355  ARG A NH2    1 
ATOM   5747  H  H      . ARG A 1 358 ? 54.602  73.283  -34.348 1.00 79.31  ? 355  ARG A H      1 
ATOM   5748  H  HA     . ARG A 1 358 ? 55.950  74.665  -36.057 1.00 77.09  ? 355  ARG A HA     1 
ATOM   5749  H  HB2    . ARG A 1 358 ? 57.089  73.545  -34.413 1.00 95.44  ? 355  ARG A HB2    1 
ATOM   5750  H  HB3    . ARG A 1 358 ? 56.583  72.146  -34.960 1.00 95.44  ? 355  ARG A HB3    1 
ATOM   5751  H  HG2    . ARG A 1 358 ? 57.929  72.454  -36.876 1.00 126.66 ? 355  ARG A HG2    1 
ATOM   5752  H  HG3    . ARG A 1 358 ? 58.502  73.787  -36.217 1.00 126.66 ? 355  ARG A HG3    1 
ATOM   5753  H  HD2    . ARG A 1 358 ? 59.526  72.614  -34.561 1.00 166.34 ? 355  ARG A HD2    1 
ATOM   5754  H  HD3    . ARG A 1 358 ? 58.770  71.276  -34.968 1.00 166.34 ? 355  ARG A HD3    1 
ATOM   5755  H  HE     . ARG A 1 358 ? 60.335  72.045  -36.948 1.00 204.70 ? 355  ARG A HE     1 
ATOM   5756  H  HH11   . ARG A 1 358 ? 60.687  70.601  -33.993 1.00 157.09 ? 355  ARG A HH11   1 
ATOM   5757  H  HH12   . ARG A 1 358 ? 61.969  69.908  -34.298 1.00 157.09 ? 355  ARG A HH12   1 
ATOM   5758  H  HH21   . ARG A 1 358 ? 62.280  70.967  -37.408 1.00 199.23 ? 355  ARG A HH21   1 
ATOM   5759  H  HH22   . ARG A 1 358 ? 62.932  70.130  -36.364 1.00 199.23 ? 355  ARG A HH22   1 
ATOM   5760  N  N      . GLU A 1 359 ? 54.822  71.940  -37.306 1.00 72.06  ? 356  GLU A N      1 
ATOM   5761  C  CA     . GLU A 1 359 ? 54.550  71.224  -38.553 1.00 67.86  ? 356  GLU A CA     1 
ATOM   5762  C  C      . GLU A 1 359 ? 53.530  71.944  -39.436 1.00 75.92  ? 356  GLU A C      1 
ATOM   5763  O  O      . GLU A 1 359 ? 53.620  71.904  -40.665 1.00 76.22  ? 356  GLU A O      1 
ATOM   5764  C  CB     . GLU A 1 359 ? 54.052  69.800  -38.263 1.00 68.25  ? 356  GLU A CB     1 
ATOM   5765  C  CG     . GLU A 1 359 ? 55.104  68.841  -37.710 1.00 76.54  ? 356  GLU A CG     1 
ATOM   5766  C  CD     . GLU A 1 359 ? 54.541  67.454  -37.420 1.00 75.39  ? 356  GLU A CD     1 
ATOM   5767  O  OE1    . GLU A 1 359 ? 53.313  67.333  -37.235 1.00 64.87  ? 356  GLU A OE1    1 
ATOM   5768  O  OE2    . GLU A 1 359 ? 55.324  66.480  -37.396 1.00 64.40  ? 356  GLU A OE2    1 
ATOM   5769  H  H      . GLU A 1 359 ? 54.527  71.541  -36.604 1.00 86.47  ? 356  GLU A H      1 
ATOM   5770  H  HA     . GLU A 1 359 ? 55.377  71.152  -39.056 1.00 81.43  ? 356  GLU A HA     1 
ATOM   5771  H  HB2    . GLU A 1 359 ? 53.335  69.852  -37.612 1.00 81.90  ? 356  GLU A HB2    1 
ATOM   5772  H  HB3    . GLU A 1 359 ? 53.714  69.419  -39.088 1.00 81.90  ? 356  GLU A HB3    1 
ATOM   5773  H  HG2    . GLU A 1 359 ? 55.817  68.744  -38.361 1.00 91.85  ? 356  GLU A HG2    1 
ATOM   5774  H  HG3    . GLU A 1 359 ? 55.457  69.201  -36.882 1.00 91.85  ? 356  GLU A HG3    1 
ATOM   5775  N  N      . LEU A 1 360 ? 52.557  72.595  -38.812 1.00 67.58  ? 357  LEU A N      1 
ATOM   5776  C  CA     . LEU A 1 360 ? 51.536  73.327  -39.552 1.00 61.65  ? 357  LEU A CA     1 
ATOM   5777  C  C      . LEU A 1 360 ? 52.123  74.609  -40.145 1.00 75.98  ? 357  LEU A C      1 
ATOM   5778  O  O      . LEU A 1 360 ? 51.625  75.118  -41.146 1.00 94.35  ? 357  LEU A O      1 
ATOM   5779  C  CB     . LEU A 1 360 ? 50.348  73.643  -38.641 1.00 76.32  ? 357  LEU A CB     1 
ATOM   5780  C  CG     . LEU A 1 360 ? 49.110  74.273  -39.281 1.00 69.11  ? 357  LEU A CG     1 
ATOM   5781  C  CD1    . LEU A 1 360 ? 48.250  73.192  -39.919 1.00 85.23  ? 357  LEU A CD1    1 
ATOM   5782  C  CD2    . LEU A 1 360 ? 48.308  75.047  -38.249 1.00 56.91  ? 357  LEU A CD2    1 
ATOM   5783  H  H      . LEU A 1 360 ? 52.464  72.629  -37.957 1.00 81.09  ? 357  LEU A H      1 
ATOM   5784  H  HA     . LEU A 1 360 ? 51.217  72.775  -40.283 1.00 73.98  ? 357  LEU A HA     1 
ATOM   5785  H  HB2    . LEU A 1 360 ? 50.062  72.816  -38.224 1.00 91.58  ? 357  LEU A HB2    1 
ATOM   5786  H  HB3    . LEU A 1 360 ? 50.654  74.255  -37.953 1.00 91.58  ? 357  LEU A HB3    1 
ATOM   5787  H  HG     . LEU A 1 360 ? 49.388  74.890  -39.975 1.00 82.93  ? 357  LEU A HG     1 
ATOM   5788  H  HD11   . LEU A 1 360 ? 47.976  72.562  -39.234 1.00 102.28 ? 357  LEU A HD11   1 
ATOM   5789  H  HD12   . LEU A 1 360 ? 47.470  73.606  -40.320 1.00 102.28 ? 357  LEU A HD12   1 
ATOM   5790  H  HD13   . LEU A 1 360 ? 48.770  72.736  -40.599 1.00 102.28 ? 357  LEU A HD13   1 
ATOM   5791  H  HD21   . LEU A 1 360 ? 48.865  75.749  -37.878 1.00 68.30  ? 357  LEU A HD21   1 
ATOM   5792  H  HD22   . LEU A 1 360 ? 47.530  75.434  -38.681 1.00 68.30  ? 357  LEU A HD22   1 
ATOM   5793  H  HD23   . LEU A 1 360 ? 48.028  74.439  -37.547 1.00 68.30  ? 357  LEU A HD23   1 
ATOM   5794  N  N      . ASP A 1 361 ? 53.179  75.127  -39.518 1.00 82.26  ? 358  ASP A N      1 
ATOM   5795  C  CA     . ASP A 1 361 ? 53.875  76.317  -40.011 1.00 79.87  ? 358  ASP A CA     1 
ATOM   5796  C  C      . ASP A 1 361 ? 54.954  75.954  -41.029 1.00 80.84  ? 358  ASP A C      1 
ATOM   5797  O  O      . ASP A 1 361 ? 55.796  76.784  -41.373 1.00 91.42  ? 358  ASP A O      1 
ATOM   5798  C  CB     . ASP A 1 361 ? 54.506  77.096  -38.850 1.00 83.83  ? 358  ASP A CB     1 
ATOM   5799  C  CG     . ASP A 1 361 ? 53.528  78.037  -38.170 1.00 95.96  ? 358  ASP A CG     1 
ATOM   5800  O  OD1    . ASP A 1 361 ? 52.303  77.882  -38.365 1.00 92.45  ? 358  ASP A OD1    1 
ATOM   5801  O  OD2    . ASP A 1 361 ? 53.989  78.935  -37.432 1.00 84.75  ? 358  ASP A OD2    1 
ATOM   5802  H  H      . ASP A 1 361 ? 53.515  74.804  -38.795 1.00 98.71  ? 358  ASP A H      1 
ATOM   5803  H  HA     . ASP A 1 361 ? 53.234  76.899  -40.449 1.00 95.85  ? 358  ASP A HA     1 
ATOM   5804  H  HB2    . ASP A 1 361 ? 54.828  76.467  -38.186 1.00 100.59 ? 358  ASP A HB2    1 
ATOM   5805  H  HB3    . ASP A 1 361 ? 55.244  77.627  -39.190 1.00 100.59 ? 358  ASP A HB3    1 
ATOM   5806  N  N      . ALA A 1 362 ? 54.921  74.715  -41.508 1.00 72.85  ? 359  ALA A N      1 
ATOM   5807  C  CA     . ALA A 1 362 ? 55.898  74.237  -42.479 1.00 81.28  ? 359  ALA A CA     1 
ATOM   5808  C  C      . ALA A 1 362 ? 55.204  73.728  -43.738 1.00 101.30 ? 359  ALA A C      1 
ATOM   5809  O  O      . ALA A 1 362 ? 55.702  72.824  -44.411 1.00 107.63 ? 359  ALA A O      1 
ATOM   5810  C  CB     . ALA A 1 362 ? 56.760  73.146  -41.865 1.00 82.66  ? 359  ALA A CB     1 
ATOM   5811  H  H      . ALA A 1 362 ? 54.337  74.125  -41.283 1.00 87.42  ? 359  ALA A H      1 
ATOM   5812  H  HA     . ALA A 1 362 ? 56.479  74.972  -42.732 1.00 97.54  ? 359  ALA A HA     1 
ATOM   5813  H  HB1    . ALA A 1 362 ? 56.190  72.409  -41.594 1.00 99.19  ? 359  ALA A HB1    1 
ATOM   5814  H  HB2    . ALA A 1 362 ? 57.402  72.842  -42.525 1.00 99.19  ? 359  ALA A HB2    1 
ATOM   5815  H  HB3    . ALA A 1 362 ? 57.223  73.506  -41.093 1.00 99.19  ? 359  ALA A HB3    1 
ATOM   5816  N  N      . ILE A 1 363 ? 54.048  74.311  -44.049 1.00 94.42  ? 360  ILE A N      1 
ATOM   5817  C  CA     . ILE A 1 363 ? 53.300  73.945  -45.247 1.00 99.04  ? 360  ILE A CA     1 
ATOM   5818  C  C      . ILE A 1 363 ? 52.668  75.177  -45.890 1.00 96.61  ? 360  ILE A C      1 
ATOM   5819  O  O      . ILE A 1 363 ? 52.344  75.172  -47.078 1.00 110.11 ? 360  ILE A O      1 
ATOM   5820  C  CB     . ILE A 1 363 ? 52.199  72.907  -44.933 1.00 102.73 ? 360  ILE A CB     1 
ATOM   5821  C  CG1    . ILE A 1 363 ? 51.136  73.510  -44.004 1.00 102.12 ? 360  ILE A CG1    1 
ATOM   5822  C  CG2    . ILE A 1 363 ? 52.822  71.653  -44.325 1.00 85.13  ? 360  ILE A CG2    1 
ATOM   5823  C  CD1    . ILE A 1 363 ? 49.985  72.575  -43.671 1.00 90.52  ? 360  ILE A CD1    1 
ATOM   5824  H  H      . ILE A 1 363 ? 53.675  74.925  -43.578 1.00 113.30 ? 360  ILE A H      1 
ATOM   5825  H  HA     . ILE A 1 363 ? 53.909  73.551  -45.891 1.00 118.85 ? 360  ILE A HA     1 
ATOM   5826  H  HB     . ILE A 1 363 ? 51.768  72.658  -45.766 1.00 123.28 ? 360  ILE A HB     1 
ATOM   5827  H  HG12   . ILE A 1 363 ? 51.562  73.762  -43.170 1.00 122.55 ? 360  ILE A HG12   1 
ATOM   5828  H  HG13   . ILE A 1 363 ? 50.762  74.296  -44.431 1.00 122.55 ? 360  ILE A HG13   1 
ATOM   5829  H  HG21   . ILE A 1 363 ? 53.282  71.895  -43.506 1.00 102.15 ? 360  ILE A HG21   1 
ATOM   5830  H  HG22   . ILE A 1 363 ? 52.120  71.013  -44.134 1.00 102.15 ? 360  ILE A HG22   1 
ATOM   5831  H  HG23   . ILE A 1 363 ? 53.452  71.276  -44.959 1.00 102.15 ? 360  ILE A HG23   1 
ATOM   5832  H  HD11   . ILE A 1 363 ? 50.337  71.787  -43.229 1.00 108.63 ? 360  ILE A HD11   1 
ATOM   5833  H  HD12   . ILE A 1 363 ? 49.366  73.036  -43.083 1.00 108.63 ? 360  ILE A HD12   1 
ATOM   5834  H  HD13   . ILE A 1 363 ? 49.536  72.322  -44.492 1.00 108.63 ? 360  ILE A HD13   1 
ATOM   5835  N  N      . ARG A 1 382 ? 41.243  73.029  -46.009 1.00 72.70  ? 379  ARG A N      1 
ATOM   5836  C  CA     . ARG A 1 382 ? 41.257  73.843  -44.795 1.00 80.13  ? 379  ARG A CA     1 
ATOM   5837  C  C      . ARG A 1 382 ? 40.767  73.049  -43.582 1.00 88.23  ? 379  ARG A C      1 
ATOM   5838  O  O      . ARG A 1 382 ? 41.007  73.439  -42.435 1.00 88.31  ? 379  ARG A O      1 
ATOM   5839  C  CB     . ARG A 1 382 ? 40.394  75.094  -44.989 1.00 83.51  ? 379  ARG A CB     1 
ATOM   5840  C  CG     . ARG A 1 382 ? 38.932  74.797  -45.290 1.00 72.78  ? 379  ARG A CG     1 
ATOM   5841  C  CD     . ARG A 1 382 ? 38.154  76.064  -45.610 1.00 72.05  ? 379  ARG A CD     1 
ATOM   5842  N  NE     . ARG A 1 382 ? 36.738  75.777  -45.816 1.00 78.02  ? 379  ARG A NE     1 
ATOM   5843  C  CZ     . ARG A 1 382 ? 36.234  75.279  -46.942 1.00 92.89  ? 379  ARG A CZ     1 
ATOM   5844  N  NH1    . ARG A 1 382 ? 37.030  75.010  -47.974 1.00 81.35  ? 379  ARG A NH1    1 
ATOM   5845  N  NH2    . ARG A 1 382 ? 34.931  75.045  -47.040 1.00 94.82  ? 379  ARG A NH2    1 
ATOM   5846  H  HA     . ARG A 1 382 ? 42.166  74.130  -44.618 1.00 96.16  ? 379  ARG A HA     1 
ATOM   5847  H  HB2    . ARG A 1 382 ? 40.427  75.625  -44.178 1.00 100.22 ? 379  ARG A HB2    1 
ATOM   5848  H  HB3    . ARG A 1 382 ? 40.751  75.607  -45.731 1.00 100.22 ? 379  ARG A HB3    1 
ATOM   5849  H  HG2    . ARG A 1 382 ? 38.878  74.206  -46.057 1.00 87.33  ? 379  ARG A HG2    1 
ATOM   5850  H  HG3    . ARG A 1 382 ? 38.525  74.379  -44.515 1.00 87.33  ? 379  ARG A HG3    1 
ATOM   5851  H  HD2    . ARG A 1 382 ? 38.235  76.686  -44.870 1.00 86.46  ? 379  ARG A HD2    1 
ATOM   5852  H  HD3    . ARG A 1 382 ? 38.506  76.460  -46.423 1.00 86.46  ? 379  ARG A HD3    1 
ATOM   5853  H  HE     . ARG A 1 382 ? 36.204  75.891  -45.152 1.00 93.63  ? 379  ARG A HE     1 
ATOM   5854  H  HH11   . ARG A 1 382 ? 37.876  75.158  -47.915 1.00 97.62  ? 379  ARG A HH11   1 
ATOM   5855  H  HH12   . ARG A 1 382 ? 36.700  74.688  -48.700 1.00 97.62  ? 379  ARG A HH12   1 
ATOM   5856  H  HH21   . ARG A 1 382 ? 34.412  75.217  -46.376 1.00 113.78 ? 379  ARG A HH21   1 
ATOM   5857  H  HH22   . ARG A 1 382 ? 34.605  74.724  -47.768 1.00 113.78 ? 379  ARG A HH22   1 
ATOM   5858  N  N      . THR A 1 383 ? 40.088  71.935  -43.846 1.00 99.42  ? 380  THR A N      1 
ATOM   5859  C  CA     . THR A 1 383 ? 39.488  71.118  -42.795 1.00 95.91  ? 380  THR A CA     1 
ATOM   5860  C  C      . THR A 1 383 ? 40.354  69.914  -42.438 1.00 82.35  ? 380  THR A C      1 
ATOM   5861  O  O      . THR A 1 383 ? 40.161  69.290  -41.395 1.00 86.15  ? 380  THR A O      1 
ATOM   5862  C  CB     . THR A 1 383 ? 38.095  70.609  -43.213 1.00 94.93  ? 380  THR A CB     1 
ATOM   5863  O  OG1    . THR A 1 383 ? 38.200  69.873  -44.438 1.00 83.32  ? 380  THR A OG1    1 
ATOM   5864  C  CG2    . THR A 1 383 ? 37.132  71.768  -43.404 1.00 95.40  ? 380  THR A CG2    1 
ATOM   5865  H  H      . THR A 1 383 ? 39.959  71.628  -44.639 1.00 119.31 ? 380  THR A H      1 
ATOM   5866  H  HA     . THR A 1 383 ? 39.383  71.659  -41.997 1.00 115.10 ? 380  THR A HA     1 
ATOM   5867  H  HB     . THR A 1 383 ? 37.743  70.030  -42.519 1.00 113.92 ? 380  THR A HB     1 
ATOM   5868  H  HG1    . THR A 1 383 ? 37.443  69.593  -44.671 1.00 99.99  ? 380  THR A HG1    1 
ATOM   5869  H  HG21   . THR A 1 383 ? 37.462  72.363  -44.095 1.00 114.48 ? 380  THR A HG21   1 
ATOM   5870  H  HG22   . THR A 1 383 ? 36.260  71.434  -43.666 1.00 114.48 ? 380  THR A HG22   1 
ATOM   5871  H  HG23   . THR A 1 383 ? 37.043  72.265  -42.576 1.00 114.48 ? 380  THR A HG23   1 
ATOM   5872  N  N      . ARG A 1 384 ? 41.302  69.593  -43.314 1.00 76.40  ? 381  ARG A N      1 
ATOM   5873  C  CA     . ARG A 1 384 ? 42.167  68.434  -43.131 1.00 82.72  ? 381  ARG A CA     1 
ATOM   5874  C  C      . ARG A 1 384 ? 43.595  68.887  -42.867 1.00 85.97  ? 381  ARG A C      1 
ATOM   5875  O  O      . ARG A 1 384 ? 44.551  68.215  -43.255 1.00 83.17  ? 381  ARG A O      1 
ATOM   5876  C  CB     . ARG A 1 384 ? 42.128  67.527  -44.362 1.00 75.33  ? 381  ARG A CB     1 
ATOM   5877  C  CG     . ARG A 1 384 ? 40.736  67.285  -44.934 1.00 77.06  ? 381  ARG A CG     1 
ATOM   5878  C  CD     . ARG A 1 384 ? 40.828  66.807  -46.374 1.00 109.16 ? 381  ARG A CD     1 
ATOM   5879  N  NE     . ARG A 1 384 ? 41.355  67.857  -47.248 1.00 103.18 ? 381  ARG A NE     1 
ATOM   5880  C  CZ     . ARG A 1 384 ? 40.621  68.633  -48.043 1.00 85.07  ? 381  ARG A CZ     1 
ATOM   5881  N  NH1    . ARG A 1 384 ? 39.303  68.489  -48.113 1.00 82.55  ? 381  ARG A NH1    1 
ATOM   5882  N  NH2    . ARG A 1 384 ? 41.216  69.559  -48.784 1.00 71.44  ? 381  ARG A NH2    1 
ATOM   5883  H  H      . ARG A 1 384 ? 41.466  70.038  -44.031 1.00 91.67  ? 381  ARG A H      1 
ATOM   5884  H  HA     . ARG A 1 384 ? 41.862  67.923  -42.365 1.00 99.27  ? 381  ARG A HA     1 
ATOM   5885  H  HB2    . ARG A 1 384 ? 42.666  67.931  -45.061 1.00 90.39  ? 381  ARG A HB2    1 
ATOM   5886  H  HB3    . ARG A 1 384 ? 42.500  66.664  -44.123 1.00 90.39  ? 381  ARG A HB3    1 
ATOM   5887  H  HG2    . ARG A 1 384 ? 40.286  66.603  -44.412 1.00 92.47  ? 381  ARG A HG2    1 
ATOM   5888  H  HG3    . ARG A 1 384 ? 40.231  68.113  -44.917 1.00 92.47  ? 381  ARG A HG3    1 
ATOM   5889  H  HD2    . ARG A 1 384 ? 41.423  66.043  -46.421 1.00 131.00 ? 381  ARG A HD2    1 
ATOM   5890  H  HD3    . ARG A 1 384 ? 39.943  66.565  -46.688 1.00 131.00 ? 381  ARG A HD3    1 
ATOM   5891  H  HE     . ARG A 1 384 ? 42.206  67.981  -47.248 1.00 123.81 ? 381  ARG A HE     1 
ATOM   5892  H  HH11   . ARG A 1 384 ? 38.909  67.893  -47.635 1.00 99.06  ? 381  ARG A HH11   1 
ATOM   5893  H  HH12   . ARG A 1 384 ? 38.842  68.996  -48.633 1.00 99.06  ? 381  ARG A HH12   1 
ATOM   5894  H  HH21   . ARG A 1 384 ? 42.070  69.656  -48.747 1.00 85.72  ? 381  ARG A HH21   1 
ATOM   5895  H  HH22   . ARG A 1 384 ? 40.748  70.059  -49.304 1.00 85.72  ? 381  ARG A HH22   1 
ATOM   5896  N  N      . ASP A 1 385 ? 43.737  70.031  -42.208 1.00 85.57  ? 382  ASP A N      1 
ATOM   5897  C  CA     . ASP A 1 385 ? 45.057  70.583  -41.933 1.00 90.77  ? 382  ASP A CA     1 
ATOM   5898  C  C      . ASP A 1 385 ? 45.764  69.774  -40.847 1.00 79.96  ? 382  ASP A C      1 
ATOM   5899  O  O      . ASP A 1 385 ? 46.995  69.705  -40.807 1.00 70.79  ? 382  ASP A O      1 
ATOM   5900  C  CB     . ASP A 1 385 ? 44.952  72.054  -41.506 1.00 89.49  ? 382  ASP A CB     1 
ATOM   5901  C  CG     . ASP A 1 385 ? 45.753  72.993  -42.398 1.00 90.49  ? 382  ASP A CG     1 
ATOM   5902  O  OD1    . ASP A 1 385 ? 46.696  72.544  -43.089 1.00 83.12  ? 382  ASP A OD1    1 
ATOM   5903  O  OD2    . ASP A 1 385 ? 45.445  74.202  -42.393 1.00 106.95 ? 382  ASP A OD2    1 
ATOM   5904  H  H      . ASP A 1 385 ? 43.086  70.507  -41.910 1.00 102.69 ? 382  ASP A H      1 
ATOM   5905  H  HA     . ASP A 1 385 ? 45.594  70.540  -42.740 1.00 108.92 ? 382  ASP A HA     1 
ATOM   5906  H  HB2    . ASP A 1 385 ? 44.022  72.327  -41.544 1.00 107.38 ? 382  ASP A HB2    1 
ATOM   5907  H  HB3    . ASP A 1 385 ? 45.286  72.143  -40.600 1.00 107.38 ? 382  ASP A HB3    1 
ATOM   5908  N  N      . TYR A 1 386 ? 44.982  69.158  -39.967 1.00 66.42  ? 383  TYR A N      1 
ATOM   5909  C  CA     . TYR A 1 386 ? 45.554  68.402  -38.863 1.00 66.65  ? 383  TYR A CA     1 
ATOM   5910  C  C      . TYR A 1 386 ? 46.127  67.076  -39.357 1.00 68.29  ? 383  TYR A C      1 
ATOM   5911  O  O      . TYR A 1 386 ? 47.074  66.548  -38.773 1.00 59.53  ? 383  TYR A O      1 
ATOM   5912  C  CB     . TYR A 1 386 ? 44.509  68.164  -37.767 1.00 63.84  ? 383  TYR A CB     1 
ATOM   5913  C  CG     . TYR A 1 386 ? 43.389  67.214  -38.136 1.00 47.92  ? 383  TYR A CG     1 
ATOM   5914  C  CD1    . TYR A 1 386 ? 43.618  65.848  -38.251 1.00 47.48  ? 383  TYR A CD1    1 
ATOM   5915  C  CD2    . TYR A 1 386 ? 42.094  67.677  -38.332 1.00 54.79  ? 383  TYR A CD2    1 
ATOM   5916  C  CE1    . TYR A 1 386 ? 42.604  64.975  -38.577 1.00 54.87  ? 383  TYR A CE1    1 
ATOM   5917  C  CE2    . TYR A 1 386 ? 41.067  66.804  -38.653 1.00 62.78  ? 383  TYR A CE2    1 
ATOM   5918  C  CZ     . TYR A 1 386 ? 41.333  65.454  -38.773 1.00 52.31  ? 383  TYR A CZ     1 
ATOM   5919  O  OH     . TYR A 1 386 ? 40.333  64.570  -39.091 1.00 61.42  ? 383  TYR A OH     1 
ATOM   5920  H  H      . TYR A 1 386 ? 44.122  69.162  -39.988 1.00 79.71  ? 383  TYR A H      1 
ATOM   5921  H  HA     . TYR A 1 386 ? 46.280  68.915  -38.476 1.00 79.97  ? 383  TYR A HA     1 
ATOM   5922  H  HB2    . TYR A 1 386 ? 44.958  67.797  -36.989 1.00 76.60  ? 383  TYR A HB2    1 
ATOM   5923  H  HB3    . TYR A 1 386 ? 44.105  69.015  -37.537 1.00 76.60  ? 383  TYR A HB3    1 
ATOM   5924  H  HD1    . TYR A 1 386 ? 44.478  65.518  -38.120 1.00 56.98  ? 383  TYR A HD1    1 
ATOM   5925  H  HD2    . TYR A 1 386 ? 41.915  68.586  -38.252 1.00 65.75  ? 383  TYR A HD2    1 
ATOM   5926  H  HE1    . TYR A 1 386 ? 42.778  64.065  -38.655 1.00 65.84  ? 383  TYR A HE1    1 
ATOM   5927  H  HE2    . TYR A 1 386 ? 40.205  67.125  -38.789 1.00 75.33  ? 383  TYR A HE2    1 
ATOM   5928  H  HH     . TYR A 1 386 ? 40.641  63.790  -39.130 1.00 73.71  ? 383  TYR A HH     1 
ATOM   5929  N  N      . LYS A 1 387 ? 45.552  66.541  -40.433 1.00 74.77  ? 384  LYS A N      1 
ATOM   5930  C  CA     . LYS A 1 387 ? 45.999  65.265  -40.989 1.00 65.97  ? 384  LYS A CA     1 
ATOM   5931  C  C      . LYS A 1 387 ? 47.439  65.340  -41.482 1.00 61.45  ? 384  LYS A C      1 
ATOM   5932  O  O      . LYS A 1 387 ? 48.080  64.312  -41.695 1.00 46.68  ? 384  LYS A O      1 
ATOM   5933  C  CB     . LYS A 1 387 ? 45.084  64.824  -42.133 1.00 57.65  ? 384  LYS A CB     1 
ATOM   5934  C  CG     . LYS A 1 387 ? 43.763  64.228  -41.674 1.00 71.40  ? 384  LYS A CG     1 
ATOM   5935  C  CD     . LYS A 1 387 ? 43.025  63.544  -42.818 1.00 88.22  ? 384  LYS A CD     1 
ATOM   5936  C  CE     . LYS A 1 387 ? 41.715  62.927  -42.343 1.00 94.52  ? 384  LYS A CE     1 
ATOM   5937  N  NZ     . LYS A 1 387 ? 40.940  62.301  -43.450 1.00 74.39  ? 384  LYS A NZ     1 
ATOM   5938  H  H      . LYS A 1 387 ? 44.898  66.900  -40.861 1.00 89.73  ? 384  LYS A H      1 
ATOM   5939  H  HA     . LYS A 1 387 ? 45.956  64.589  -40.296 1.00 79.17  ? 384  LYS A HA     1 
ATOM   5940  H  HB2    . LYS A 1 387 ? 44.883  65.595  -42.687 1.00 69.19  ? 384  LYS A HB2    1 
ATOM   5941  H  HB3    . LYS A 1 387 ? 45.544  64.153  -42.660 1.00 69.19  ? 384  LYS A HB3    1 
ATOM   5942  H  HG2    . LYS A 1 387 ? 43.934  63.566  -40.985 1.00 85.68  ? 384  LYS A HG2    1 
ATOM   5943  H  HG3    . LYS A 1 387 ? 43.196  64.934  -41.327 1.00 85.68  ? 384  LYS A HG3    1 
ATOM   5944  H  HD2    . LYS A 1 387 ? 42.822  64.198  -43.505 1.00 105.86 ? 384  LYS A HD2    1 
ATOM   5945  H  HD3    . LYS A 1 387 ? 43.581  62.836  -43.180 1.00 105.86 ? 384  LYS A HD3    1 
ATOM   5946  H  HE2    . LYS A 1 387 ? 41.909  62.240  -41.686 1.00 113.42 ? 384  LYS A HE2    1 
ATOM   5947  H  HE3    . LYS A 1 387 ? 41.165  63.620  -41.946 1.00 113.42 ? 384  LYS A HE3    1 
ATOM   5948  H  HZ1    . LYS A 1 387 ? 41.419  61.654  -43.829 1.00 89.27  ? 384  LYS A HZ1    1 
ATOM   5949  H  HZ2    . LYS A 1 387 ? 40.184  61.953  -43.133 1.00 89.27  ? 384  LYS A HZ2    1 
ATOM   5950  H  HZ3    . LYS A 1 387 ? 40.741  62.912  -44.066 1.00 89.27  ? 384  LYS A HZ3    1 
ATOM   5951  N  N      . LYS A 1 388 ? 47.940  66.561  -41.657 1.00 58.60  ? 385  LYS A N      1 
ATOM   5952  C  CA     . LYS A 1 388 ? 49.304  66.780  -42.122 1.00 66.32  ? 385  LYS A CA     1 
ATOM   5953  C  C      . LYS A 1 388 ? 50.282  66.809  -40.955 1.00 68.13  ? 385  LYS A C      1 
ATOM   5954  O  O      . LYS A 1 388 ? 51.483  66.611  -41.138 1.00 75.58  ? 385  LYS A O      1 
ATOM   5955  C  CB     . LYS A 1 388 ? 49.388  68.085  -42.916 1.00 78.71  ? 385  LYS A CB     1 
ATOM   5956  C  CG     . LYS A 1 388 ? 48.500  68.107  -44.153 1.00 88.84  ? 385  LYS A CG     1 
ATOM   5957  C  CD     . LYS A 1 388 ? 48.525  69.460  -44.841 1.00 83.24  ? 385  LYS A CD     1 
ATOM   5958  C  CE     . LYS A 1 388 ? 47.547  69.507  -46.003 1.00 72.95  ? 385  LYS A CE     1 
ATOM   5959  N  NZ     . LYS A 1 388 ? 47.555  70.835  -46.674 1.00 82.89  ? 385  LYS A NZ     1 
ATOM   5960  H  H      . LYS A 1 388 ? 47.502  67.286  -41.511 1.00 70.32  ? 385  LYS A H      1 
ATOM   5961  H  HA     . LYS A 1 388 ? 49.559  66.053  -42.711 1.00 79.59  ? 385  LYS A HA     1 
ATOM   5962  H  HB2    . LYS A 1 388 ? 49.116  68.819  -42.343 1.00 94.45  ? 385  LYS A HB2    1 
ATOM   5963  H  HB3    . LYS A 1 388 ? 50.304  68.217  -43.206 1.00 94.45  ? 385  LYS A HB3    1 
ATOM   5964  H  HG2    . LYS A 1 388 ? 48.814  67.440  -44.784 1.00 106.61 ? 385  LYS A HG2    1 
ATOM   5965  H  HG3    . LYS A 1 388 ? 47.585  67.916  -43.893 1.00 106.61 ? 385  LYS A HG3    1 
ATOM   5966  H  HD2    . LYS A 1 388 ? 48.275  70.148  -44.205 1.00 99.89  ? 385  LYS A HD2    1 
ATOM   5967  H  HD3    . LYS A 1 388 ? 49.416  69.628  -45.186 1.00 99.89  ? 385  LYS A HD3    1 
ATOM   5968  H  HE2    . LYS A 1 388 ? 47.796  68.835  -46.656 1.00 87.54  ? 385  LYS A HE2    1 
ATOM   5969  H  HE3    . LYS A 1 388 ? 46.651  69.339  -45.672 1.00 87.54  ? 385  LYS A HE3    1 
ATOM   5970  H  HZ1    . LYS A 1 388 ? 48.368  71.011  -46.990 1.00 99.47  ? 385  LYS A HZ1    1 
ATOM   5971  H  HZ2    . LYS A 1 388 ? 46.975  70.837  -47.349 1.00 99.47  ? 385  LYS A HZ2    1 
ATOM   5972  H  HZ3    . LYS A 1 388 ? 47.326  71.470  -46.094 1.00 99.47  ? 385  LYS A HZ3    1 
ATOM   5973  N  N      . THR A 1 389 ? 49.760  67.053  -39.756 1.00 71.46  ? 386  THR A N      1 
ATOM   5974  C  CA     . THR A 1 389 ? 50.578  67.067  -38.549 1.00 65.31  ? 386  THR A CA     1 
ATOM   5975  C  C      . THR A 1 389 ? 50.707  65.671  -37.942 1.00 66.45  ? 386  THR A C      1 
ATOM   5976  O  O      . THR A 1 389 ? 50.081  64.719  -38.410 1.00 60.28  ? 386  THR A O      1 
ATOM   5977  C  CB     . THR A 1 389 ? 49.991  68.019  -37.486 1.00 68.87  ? 386  THR A CB     1 
ATOM   5978  O  OG1    . THR A 1 389 ? 48.634  67.646  -37.212 1.00 68.43  ? 386  THR A OG1    1 
ATOM   5979  C  CG2    . THR A 1 389 ? 50.028  69.464  -37.968 1.00 61.09  ? 386  THR A CG2    1 
ATOM   5980  H  H      . THR A 1 389 ? 48.927  67.214  -39.615 1.00 85.76  ? 386  THR A H      1 
ATOM   5981  H  HA     . THR A 1 389 ? 51.468  67.380  -38.774 1.00 78.37  ? 386  THR A HA     1 
ATOM   5982  H  HB     . THR A 1 389 ? 50.514  67.954  -36.671 1.00 82.64  ? 386  THR A HB     1 
ATOM   5983  H  HG1    . THR A 1 389 ? 48.175  67.698  -37.914 1.00 82.11  ? 386  THR A HG1    1 
ATOM   5984  H  HG21   . THR A 1 389 ? 49.508  69.554  -38.782 1.00 73.31  ? 386  THR A HG21   1 
ATOM   5985  H  HG22   . THR A 1 389 ? 49.656  70.049  -37.289 1.00 73.31  ? 386  THR A HG22   1 
ATOM   5986  H  HG23   . THR A 1 389 ? 50.943  69.730  -38.147 1.00 73.31  ? 386  THR A HG23   1 
ATOM   5987  N  N      . SER A 1 390 ? 51.516  65.562  -36.891 1.00 83.03  ? 387  SER A N      1 
ATOM   5988  C  CA     . SER A 1 390 ? 51.744  64.290  -36.205 1.00 79.47  ? 387  SER A CA     1 
ATOM   5989  C  C      . SER A 1 390 ? 50.565  63.935  -35.305 1.00 62.48  ? 387  SER A C      1 
ATOM   5990  O  O      . SER A 1 390 ? 50.534  62.862  -34.710 1.00 56.79  ? 387  SER A O      1 
ATOM   5991  C  CB     . SER A 1 390 ? 53.034  64.336  -35.389 1.00 62.15  ? 387  SER A CB     1 
ATOM   5992  O  OG     . SER A 1 390 ? 54.169  64.285  -36.237 1.00 70.45  ? 387  SER A OG     1 
ATOM   5993  H  H      . SER A 1 390 ? 51.952  66.220  -36.550 1.00 99.64  ? 387  SER A H      1 
ATOM   5994  H  HA     . SER A 1 390 ? 51.835  63.588  -36.868 1.00 95.37  ? 387  SER A HA     1 
ATOM   5995  H  HB2    . SER A 1 390 ? 53.057  65.161  -34.880 1.00 74.58  ? 387  SER A HB2    1 
ATOM   5996  H  HB3    . SER A 1 390 ? 53.055  63.575  -34.788 1.00 74.58  ? 387  SER A HB3    1 
ATOM   5997  H  HG     . SER A 1 390 ? 54.164  64.939  -36.764 1.00 84.55  ? 387  SER A HG     1 
ATOM   5998  N  N      . LEU A 1 391 ? 49.598  64.844  -35.227 1.00 55.73  ? 388  LEU A N      1 
ATOM   5999  C  CA     . LEU A 1 391 ? 48.384  64.628  -34.456 1.00 44.81  ? 388  LEU A CA     1 
ATOM   6000  C  C      . LEU A 1 391 ? 47.415  63.682  -35.147 1.00 56.98  ? 388  LEU A C      1 
ATOM   6001  O  O      . LEU A 1 391 ? 46.497  63.166  -34.518 1.00 65.99  ? 388  LEU A O      1 
ATOM   6002  C  CB     . LEU A 1 391 ? 47.678  65.966  -34.222 1.00 43.91  ? 388  LEU A CB     1 
ATOM   6003  C  CG     . LEU A 1 391 ? 46.492  65.992  -33.253 1.00 60.86  ? 388  LEU A CG     1 
ATOM   6004  C  CD1    . LEU A 1 391 ? 46.902  65.625  -31.834 1.00 75.27  ? 388  LEU A CD1    1 
ATOM   6005  C  CD2    . LEU A 1 391 ? 45.807  67.351  -33.291 1.00 53.58  ? 388  LEU A CD2    1 
ATOM   6006  H  H      . LEU A 1 391 ? 49.624  65.608  -35.620 1.00 66.88  ? 388  LEU A H      1 
ATOM   6007  H  HA     . LEU A 1 391 ? 48.615  64.250  -33.593 1.00 53.77  ? 388  LEU A HA     1 
ATOM   6008  H  HB2    . LEU A 1 391 ? 48.335  66.594  -33.881 1.00 52.69  ? 388  LEU A HB2    1 
ATOM   6009  H  HB3    . LEU A 1 391 ? 47.350  66.284  -35.078 1.00 52.69  ? 388  LEU A HB3    1 
ATOM   6010  H  HG     . LEU A 1 391 ? 45.844  65.333  -33.546 1.00 73.03  ? 388  LEU A HG     1 
ATOM   6011  H  HD11   . LEU A 1 391 ? 47.565  66.261  -31.523 1.00 90.32  ? 388  LEU A HD11   1 
ATOM   6012  H  HD12   . LEU A 1 391 ? 46.119  65.656  -31.262 1.00 90.32  ? 388  LEU A HD12   1 
ATOM   6013  H  HD13   . LEU A 1 391 ? 47.276  64.731  -31.836 1.00 90.32  ? 388  LEU A HD13   1 
ATOM   6014  H  HD21   . LEU A 1 391 ? 45.489  67.518  -34.192 1.00 64.30  ? 388  LEU A HD21   1 
ATOM   6015  H  HD22   . LEU A 1 391 ? 45.061  67.345  -32.672 1.00 64.30  ? 388  LEU A HD22   1 
ATOM   6016  H  HD23   . LEU A 1 391 ? 46.447  68.034  -33.034 1.00 64.30  ? 388  LEU A HD23   1 
ATOM   6017  N  N      . ALA A 1 392 ? 47.638  63.431  -36.433 1.00 70.19  ? 389  ALA A N      1 
ATOM   6018  C  CA     . ALA A 1 392 ? 46.655  62.726  -37.255 1.00 76.07  ? 389  ALA A CA     1 
ATOM   6019  C  C      . ALA A 1 392 ? 46.300  61.312  -36.780 1.00 65.29  ? 389  ALA A C      1 
ATOM   6020  O  O      . ALA A 1 392 ? 45.122  61.016  -36.559 1.00 46.77  ? 389  ALA A O      1 
ATOM   6021  C  CB     . ALA A 1 392 ? 47.158  62.663  -38.688 1.00 67.90  ? 389  ALA A CB     1 
ATOM   6022  H  H      . ALA A 1 392 ? 48.351  63.658  -36.855 1.00 84.23  ? 389  ALA A H      1 
ATOM   6023  H  HA     . ALA A 1 392 ? 45.834  63.243  -37.259 1.00 91.29  ? 389  ALA A HA     1 
ATOM   6024  H  HB1    . ALA A 1 392 ? 48.004  62.188  -38.705 1.00 81.48  ? 389  ALA A HB1    1 
ATOM   6025  H  HB2    . ALA A 1 392 ? 46.505  62.195  -39.231 1.00 81.48  ? 389  ALA A HB2    1 
ATOM   6026  H  HB3    . ALA A 1 392 ? 47.279  63.566  -39.020 1.00 81.48  ? 389  ALA A HB3    1 
ATOM   6027  N  N      . PRO A 1 393 ? 47.312  60.449  -36.578 1.00 62.13  ? 390  PRO A N      1 
ATOM   6028  C  CA     . PRO A 1 393 ? 47.005  59.046  -36.270 1.00 56.12  ? 390  PRO A CA     1 
ATOM   6029  C  C      . PRO A 1 393 ? 46.181  58.893  -35.005 1.00 58.89  ? 390  PRO A C      1 
ATOM   6030  O  O      . PRO A 1 393 ? 45.494  57.888  -34.841 1.00 60.79  ? 390  PRO A O      1 
ATOM   6031  C  CB     . PRO A 1 393 ? 48.386  58.406  -36.106 1.00 45.59  ? 390  PRO A CB     1 
ATOM   6032  C  CG     . PRO A 1 393 ? 49.292  59.524  -35.815 1.00 62.84  ? 390  PRO A CG     1 
ATOM   6033  C  CD     . PRO A 1 393 ? 48.763  60.690  -36.585 1.00 59.06  ? 390  PRO A CD     1 
ATOM   6034  H  HA     . PRO A 1 393 ? 46.541  58.629  -37.013 1.00 67.34  ? 390  PRO A HA     1 
ATOM   6035  H  HB2    . PRO A 1 393 ? 48.369  57.777  -35.369 1.00 54.71  ? 390  PRO A HB2    1 
ATOM   6036  H  HB3    . PRO A 1 393 ? 48.641  57.963  -36.931 1.00 54.71  ? 390  PRO A HB3    1 
ATOM   6037  H  HG2    . PRO A 1 393 ? 49.281  59.711  -34.863 1.00 75.41  ? 390  PRO A HG2    1 
ATOM   6038  H  HG3    . PRO A 1 393 ? 50.189  59.300  -36.108 1.00 75.41  ? 390  PRO A HG3    1 
ATOM   6039  H  HD2    . PRO A 1 393 ? 48.973  61.521  -36.130 1.00 70.88  ? 390  PRO A HD2    1 
ATOM   6040  H  HD3    . PRO A 1 393 ? 49.105  60.681  -37.492 1.00 70.88  ? 390  PRO A HD3    1 
ATOM   6041  N  N      . TYR A 1 394 ? 46.251  59.883  -34.123 1.00 63.67  ? 391  TYR A N      1 
ATOM   6042  C  CA     . TYR A 1 394 ? 45.492  59.844  -32.884 1.00 61.73  ? 391  TYR A CA     1 
ATOM   6043  C  C      . TYR A 1 394 ? 44.053  60.262  -33.147 1.00 60.34  ? 391  TYR A C      1 
ATOM   6044  O  O      . TYR A 1 394 ? 43.124  59.755  -32.512 1.00 48.08  ? 391  TYR A O      1 
ATOM   6045  C  CB     . TYR A 1 394 ? 46.119  60.756  -31.828 1.00 43.93  ? 391  TYR A CB     1 
ATOM   6046  C  CG     . TYR A 1 394 ? 47.575  60.480  -31.540 1.00 48.41  ? 391  TYR A CG     1 
ATOM   6047  C  CD1    . TYR A 1 394 ? 47.963  59.331  -30.866 1.00 45.80  ? 391  TYR A CD1    1 
ATOM   6048  C  CD2    . TYR A 1 394 ? 48.561  61.370  -31.935 1.00 54.02  ? 391  TYR A CD2    1 
ATOM   6049  C  CE1    . TYR A 1 394 ? 49.290  59.076  -30.595 1.00 53.68  ? 391  TYR A CE1    1 
ATOM   6050  C  CE2    . TYR A 1 394 ? 49.892  61.124  -31.669 1.00 52.06  ? 391  TYR A CE2    1 
ATOM   6051  C  CZ     . TYR A 1 394 ? 50.252  59.976  -30.998 1.00 58.30  ? 391  TYR A CZ     1 
ATOM   6052  O  OH     . TYR A 1 394 ? 51.577  59.721  -30.727 1.00 55.74  ? 391  TYR A OH     1 
ATOM   6053  H  H      . TYR A 1 394 ? 46.731  60.590  -34.221 1.00 76.40  ? 391  TYR A H      1 
ATOM   6054  H  HA     . TYR A 1 394 ? 45.487  58.937  -32.540 1.00 74.08  ? 391  TYR A HA     1 
ATOM   6055  H  HB2    . TYR A 1 394 ? 46.048  61.674  -32.130 1.00 52.71  ? 391  TYR A HB2    1 
ATOM   6056  H  HB3    . TYR A 1 394 ? 45.630  60.648  -30.997 1.00 52.71  ? 391  TYR A HB3    1 
ATOM   6057  H  HD1    . TYR A 1 394 ? 47.316  58.722  -30.591 1.00 54.96  ? 391  TYR A HD1    1 
ATOM   6058  H  HD2    . TYR A 1 394 ? 48.321  62.147  -32.387 1.00 64.83  ? 391  TYR A HD2    1 
ATOM   6059  H  HE1    . TYR A 1 394 ? 49.535  58.301  -30.143 1.00 64.41  ? 391  TYR A HE1    1 
ATOM   6060  H  HE2    . TYR A 1 394 ? 50.543  61.730  -31.940 1.00 62.47  ? 391  TYR A HE2    1 
ATOM   6061  H  HH     . TYR A 1 394 ? 52.056  60.344  -31.024 1.00 66.89  ? 391  TYR A HH     1 
ATOM   6062  N  N      . VAL A 1 395 ? 43.862  61.181  -34.090 1.00 66.89  ? 392  VAL A N      1 
ATOM   6063  C  CA     . VAL A 1 395 ? 42.512  61.573  -34.459 1.00 59.00  ? 392  VAL A CA     1 
ATOM   6064  C  C      . VAL A 1 395 ? 41.839  60.399  -35.156 1.00 50.04  ? 392  VAL A C      1 
ATOM   6065  O  O      . VAL A 1 395 ? 40.623  60.240  -35.069 1.00 50.90  ? 392  VAL A O      1 
ATOM   6066  C  CB     . VAL A 1 395 ? 42.474  62.808  -35.380 1.00 47.34  ? 392  VAL A CB     1 
ATOM   6067  C  CG1    . VAL A 1 395 ? 41.030  63.243  -35.600 1.00 56.57  ? 392  VAL A CG1    1 
ATOM   6068  C  CG2    . VAL A 1 395 ? 43.251  63.969  -34.780 1.00 41.23  ? 392  VAL A CG2    1 
ATOM   6069  H  H      . VAL A 1 395 ? 44.486  61.584  -34.522 1.00 80.27  ? 392  VAL A H      1 
ATOM   6070  H  HA     . VAL A 1 395 ? 42.008  61.778  -33.656 1.00 70.80  ? 392  VAL A HA     1 
ATOM   6071  H  HB     . VAL A 1 395 ? 42.864  62.586  -36.240 1.00 56.80  ? 392  VAL A HB     1 
ATOM   6072  H  HG11   . VAL A 1 395 ? 40.634  63.465  -34.743 1.00 67.89  ? 392  VAL A HG11   1 
ATOM   6073  H  HG12   . VAL A 1 395 ? 41.020  64.021  -36.181 1.00 67.89  ? 392  VAL A HG12   1 
ATOM   6074  H  HG13   . VAL A 1 395 ? 40.541  62.515  -36.013 1.00 67.89  ? 392  VAL A HG13   1 
ATOM   6075  H  HG21   . VAL A 1 395 ? 44.175  63.699  -34.656 1.00 49.48  ? 392  VAL A HG21   1 
ATOM   6076  H  HG22   . VAL A 1 395 ? 43.205  64.726  -35.386 1.00 49.48  ? 392  VAL A HG22   1 
ATOM   6077  H  HG23   . VAL A 1 395 ? 42.857  64.204  -33.926 1.00 49.48  ? 392  VAL A HG23   1 
ATOM   6078  N  N      . LYS A 1 396 ? 42.635  59.570  -35.830 1.00 41.59  ? 393  LYS A N      1 
ATOM   6079  C  CA     . LYS A 1 396 ? 42.099  58.391  -36.503 1.00 48.30  ? 393  LYS A CA     1 
ATOM   6080  C  C      . LYS A 1 396 ? 41.492  57.445  -35.500 1.00 59.96  ? 393  LYS A C      1 
ATOM   6081  O  O      . LYS A 1 396 ? 40.404  56.911  -35.713 1.00 52.75  ? 393  LYS A O      1 
ATOM   6082  C  CB     . LYS A 1 396 ? 43.191  57.654  -37.281 1.00 60.50  ? 393  LYS A CB     1 
ATOM   6083  C  CG     . LYS A 1 396 ? 43.857  58.480  -38.356 1.00 99.44  ? 393  LYS A CG     1 
ATOM   6084  C  CD     . LYS A 1 396 ? 44.998  57.734  -39.020 1.00 86.00  ? 393  LYS A CD     1 
ATOM   6085  C  CE     . LYS A 1 396 ? 45.908  58.706  -39.745 1.00 76.59  ? 393  LYS A CE     1 
ATOM   6086  N  NZ     . LYS A 1 396 ? 46.981  58.005  -40.482 1.00 77.15  ? 393  LYS A NZ     1 
ATOM   6087  H  H      . LYS A 1 396 ? 43.486  59.668  -35.911 1.00 49.91  ? 393  LYS A H      1 
ATOM   6088  H  HA     . LYS A 1 396 ? 41.407  58.662  -37.126 1.00 57.96  ? 393  LYS A HA     1 
ATOM   6089  H  HB2    . LYS A 1 396 ? 43.879  57.371  -36.659 1.00 72.61  ? 393  LYS A HB2    1 
ATOM   6090  H  HB3    . LYS A 1 396 ? 42.797  56.877  -37.709 1.00 72.61  ? 393  LYS A HB3    1 
ATOM   6091  H  HG2    . LYS A 1 396 ? 43.203  58.703  -39.037 1.00 119.33 ? 393  LYS A HG2    1 
ATOM   6092  H  HG3    . LYS A 1 396 ? 44.215  59.290  -37.959 1.00 119.33 ? 393  LYS A HG3    1 
ATOM   6093  H  HD2    . LYS A 1 396 ? 45.518  57.270  -38.346 1.00 103.20 ? 393  LYS A HD2    1 
ATOM   6094  H  HD3    . LYS A 1 396 ? 44.642  57.106  -39.667 1.00 103.20 ? 393  LYS A HD3    1 
ATOM   6095  H  HE2    . LYS A 1 396 ? 45.386  59.217  -40.383 1.00 91.91  ? 393  LYS A HE2    1 
ATOM   6096  H  HE3    . LYS A 1 396 ? 46.322  59.299  -39.099 1.00 91.91  ? 393  LYS A HE3    1 
ATOM   6097  H  HZ1    . LYS A 1 396 ? 46.626  57.456  -41.086 1.00 92.59  ? 393  LYS A HZ1    1 
ATOM   6098  H  HZ2    . LYS A 1 396 ? 47.500  58.596  -40.898 1.00 92.59  ? 393  LYS A HZ2    1 
ATOM   6099  H  HZ3    . LYS A 1 396 ? 47.478  57.531  -39.917 1.00 92.59  ? 393  LYS A HZ3    1 
ATOM   6100  N  N      . VAL A 1 397 ? 42.204  57.262  -34.392 1.00 67.89  ? 394  VAL A N      1 
ATOM   6101  C  CA     . VAL A 1 397 ? 41.749  56.404  -33.315 1.00 49.77  ? 394  VAL A CA     1 
ATOM   6102  C  C      . VAL A 1 397 ? 40.462  56.932  -32.714 1.00 50.44  ? 394  VAL A C      1 
ATOM   6103  O  O      . VAL A 1 397 ? 39.554  56.163  -32.395 1.00 43.87  ? 394  VAL A O      1 
ATOM   6104  C  CB     . VAL A 1 397 ? 42.812  56.284  -32.217 1.00 51.66  ? 394  VAL A CB     1 
ATOM   6105  C  CG1    . VAL A 1 397 ? 42.309  55.411  -31.076 1.00 49.66  ? 394  VAL A CG1    1 
ATOM   6106  C  CG2    . VAL A 1 397 ? 44.091  55.705  -32.790 1.00 53.49  ? 394  VAL A CG2    1 
ATOM   6107  H  H      . VAL A 1 397 ? 42.966  57.633  -34.242 1.00 81.47  ? 394  VAL A H      1 
ATOM   6108  H  HA     . VAL A 1 397 ? 41.576  55.516  -33.667 1.00 59.72  ? 394  VAL A HA     1 
ATOM   6109  H  HB     . VAL A 1 397 ? 43.008  57.165  -31.863 1.00 61.99  ? 394  VAL A HB     1 
ATOM   6110  H  HG11   . VAL A 1 397 ? 42.107  54.527  -31.421 1.00 59.60  ? 394  VAL A HG11   1 
ATOM   6111  H  HG12   . VAL A 1 397 ? 42.998  55.351  -30.397 1.00 59.60  ? 394  VAL A HG12   1 
ATOM   6112  H  HG13   . VAL A 1 397 ? 41.508  55.811  -30.702 1.00 59.60  ? 394  VAL A HG13   1 
ATOM   6113  H  HG21   . VAL A 1 397 ? 44.417  56.291  -33.491 1.00 64.19  ? 394  VAL A HG21   1 
ATOM   6114  H  HG22   . VAL A 1 397 ? 44.751  55.636  -32.082 1.00 64.19  ? 394  VAL A HG22   1 
ATOM   6115  H  HG23   . VAL A 1 397 ? 43.904  54.826  -33.154 1.00 64.19  ? 394  VAL A HG23   1 
ATOM   6116  N  N      . PHE A 1 398 ? 40.389  58.248  -32.556 1.00 44.39  ? 395  PHE A N      1 
ATOM   6117  C  CA     . PHE A 1 398 ? 39.187  58.858  -32.022 1.00 52.81  ? 395  PHE A CA     1 
ATOM   6118  C  C      . PHE A 1 398 ? 38.056  58.625  -33.014 1.00 62.08  ? 395  PHE A C      1 
ATOM   6119  O  O      . PHE A 1 398 ? 36.922  58.380  -32.620 1.00 57.51  ? 395  PHE A O      1 
ATOM   6120  C  CB     . PHE A 1 398 ? 39.407  60.351  -31.732 1.00 48.28  ? 395  PHE A CB     1 
ATOM   6121  C  CG     . PHE A 1 398 ? 38.279  61.003  -30.971 1.00 48.17  ? 395  PHE A CG     1 
ATOM   6122  C  CD1    . PHE A 1 398 ? 37.602  60.311  -29.978 1.00 47.37  ? 395  PHE A CD1    1 
ATOM   6123  C  CD2    . PHE A 1 398 ? 37.945  62.326  -31.197 1.00 44.66  ? 395  PHE A CD2    1 
ATOM   6124  C  CE1    . PHE A 1 398 ? 36.576  60.911  -29.266 1.00 48.22  ? 395  PHE A CE1    1 
ATOM   6125  C  CE2    . PHE A 1 398 ? 36.926  62.931  -30.481 1.00 43.64  ? 395  PHE A CE2    1 
ATOM   6126  C  CZ     . PHE A 1 398 ? 36.243  62.222  -29.514 1.00 43.20  ? 395  PHE A CZ     1 
ATOM   6127  H  H      . PHE A 1 398 ? 41.017  58.803  -32.750 1.00 53.27  ? 395  PHE A H      1 
ATOM   6128  H  HA     . PHE A 1 398 ? 38.953  58.421  -31.189 1.00 63.37  ? 395  PHE A HA     1 
ATOM   6129  H  HB2    . PHE A 1 398 ? 40.216  60.450  -31.205 1.00 57.94  ? 395  PHE A HB2    1 
ATOM   6130  H  HB3    . PHE A 1 398 ? 39.506  60.821  -32.574 1.00 57.94  ? 395  PHE A HB3    1 
ATOM   6131  H  HD1    . PHE A 1 398 ? 37.819  59.423  -29.808 1.00 56.84  ? 395  PHE A HD1    1 
ATOM   6132  H  HD2    . PHE A 1 398 ? 38.397  62.810  -31.850 1.00 53.59  ? 395  PHE A HD2    1 
ATOM   6133  H  HE1    . PHE A 1 398 ? 36.121  60.431  -28.612 1.00 57.87  ? 395  PHE A HE1    1 
ATOM   6134  H  HE2    . PHE A 1 398 ? 36.700  63.817  -30.653 1.00 52.37  ? 395  PHE A HE2    1 
ATOM   6135  H  HZ     . PHE A 1 398 ? 35.558  62.628  -29.034 1.00 51.83  ? 395  PHE A HZ     1 
ATOM   6136  N  N      . GLU A 1 399 ? 38.376  58.667  -34.304 1.00 68.87  ? 396  GLU A N      1 
ATOM   6137  C  CA     . GLU A 1 399 ? 37.375  58.429  -35.341 1.00 56.38  ? 396  GLU A CA     1 
ATOM   6138  C  C      . GLU A 1 399 ? 36.880  56.981  -35.310 1.00 58.23  ? 396  GLU A C      1 
ATOM   6139  O  O      . GLU A 1 399 ? 35.674  56.738  -35.369 1.00 52.53  ? 396  GLU A O      1 
ATOM   6140  C  CB     . GLU A 1 399 ? 37.935  58.787  -36.718 1.00 54.32  ? 396  GLU A CB     1 
ATOM   6141  C  CG     . GLU A 1 399 ? 37.753  60.264  -37.060 1.00 63.49  ? 396  GLU A CG     1 
ATOM   6142  C  CD     . GLU A 1 399 ? 38.737  60.775  -38.102 1.00 67.73  ? 396  GLU A CD     1 
ATOM   6143  O  OE1    . GLU A 1 399 ? 39.489  59.962  -38.684 1.00 60.98  ? 396  GLU A OE1    1 
ATOM   6144  O  OE2    . GLU A 1 399 ? 38.760  62.004  -38.335 1.00 59.52  ? 396  GLU A OE2    1 
ATOM   6145  H  H      . GLU A 1 399 ? 39.165  58.831  -34.606 1.00 82.65  ? 396  GLU A H      1 
ATOM   6146  H  HA     . GLU A 1 399 ? 36.613  59.004  -35.173 1.00 67.66  ? 396  GLU A HA     1 
ATOM   6147  H  HB2    . GLU A 1 399 ? 38.884  58.590  -36.736 1.00 65.18  ? 396  GLU A HB2    1 
ATOM   6148  H  HB3    . GLU A 1 399 ? 37.474  58.264  -37.393 1.00 65.18  ? 396  GLU A HB3    1 
ATOM   6149  H  HG2    . GLU A 1 399 ? 36.857  60.397  -37.408 1.00 76.19  ? 396  GLU A HG2    1 
ATOM   6150  H  HG3    . GLU A 1 399 ? 37.874  60.790  -36.254 1.00 76.19  ? 396  GLU A HG3    1 
ATOM   6151  N  N      A HIS A 1 400 ? 37.802  56.025  -35.210 0.51 59.73  ? 397  HIS A N      1 
ATOM   6152  N  N      B HIS A 1 400 ? 37.807  56.034  -35.220 0.49 59.74  ? 397  HIS A N      1 
ATOM   6153  C  CA     A HIS A 1 400 ? 37.429  54.615  -35.067 0.51 61.91  ? 397  HIS A CA     1 
ATOM   6154  C  CA     B HIS A 1 400 ? 37.442  54.630  -35.077 0.49 61.91  ? 397  HIS A CA     1 
ATOM   6155  C  C      A HIS A 1 400 ? 36.586  54.406  -33.812 0.51 58.19  ? 397  HIS A C      1 
ATOM   6156  C  C      B HIS A 1 400 ? 36.573  54.431  -33.831 0.49 58.21  ? 397  HIS A C      1 
ATOM   6157  O  O      A HIS A 1 400 ? 35.726  53.526  -33.771 0.51 54.36  ? 397  HIS A O      1 
ATOM   6158  O  O      B HIS A 1 400 ? 35.679  53.586  -33.818 0.49 54.41  ? 397  HIS A O      1 
ATOM   6159  C  CB     A HIS A 1 400 ? 38.676  53.724  -35.014 0.51 60.57  ? 397  HIS A CB     1 
ATOM   6160  C  CB     B HIS A 1 400 ? 38.694  53.750  -35.009 0.49 60.57  ? 397  HIS A CB     1 
ATOM   6161  C  CG     A HIS A 1 400 ? 38.375  52.264  -34.844 0.51 63.40  ? 397  HIS A CG     1 
ATOM   6162  C  CG     B HIS A 1 400 ? 39.443  53.665  -36.304 0.49 67.35  ? 397  HIS A CG     1 
ATOM   6163  N  ND1    A HIS A 1 400 ? 38.056  51.439  -35.901 0.51 80.47  ? 397  HIS A ND1    1 
ATOM   6164  N  ND1    B HIS A 1 400 ? 38.924  53.057  -37.427 0.49 76.04  ? 397  HIS A ND1    1 
ATOM   6165  C  CD2    A HIS A 1 400 ? 38.352  51.482  -33.738 0.51 63.37  ? 397  HIS A CD2    1 
ATOM   6166  C  CD2    B HIS A 1 400 ? 40.676  54.105  -36.652 0.49 65.77  ? 397  HIS A CD2    1 
ATOM   6167  C  CE1    A HIS A 1 400 ? 37.847  50.213  -35.454 0.51 74.56  ? 397  HIS A CE1    1 
ATOM   6168  C  CE1    B HIS A 1 400 ? 39.801  53.131  -38.411 0.49 78.54  ? 397  HIS A CE1    1 
ATOM   6169  N  NE2    A HIS A 1 400 ? 38.020  50.212  -34.145 0.51 57.42  ? 397  HIS A NE2    1 
ATOM   6170  N  NE2    B HIS A 1 400 ? 40.873  53.762  -37.967 0.49 65.48  ? 397  HIS A NE2    1 
ATOM   6171  H  H      A HIS A 1 400 ? 38.651  56.164  -35.222 0.51 71.68  ? 397  HIS A H      1 
ATOM   6172  H  H      B HIS A 1 400 ? 38.655  56.177  -35.240 0.49 71.69  ? 397  HIS A H      1 
ATOM   6173  H  HA     A HIS A 1 400 ? 36.900  54.348  -35.834 0.51 74.29  ? 397  HIS A HA     1 
ATOM   6174  H  HA     B HIS A 1 400 ? 36.924  54.357  -35.850 0.49 74.29  ? 397  HIS A HA     1 
ATOM   6175  H  HB2    A HIS A 1 400 ? 39.170  53.830  -35.842 0.51 72.68  ? 397  HIS A HB2    1 
ATOM   6176  H  HB2    B HIS A 1 400 ? 39.296  54.114  -34.341 0.49 72.69  ? 397  HIS A HB2    1 
ATOM   6177  H  HB3    A HIS A 1 400 ? 39.227  54.002  -34.266 0.51 72.68  ? 397  HIS A HB3    1 
ATOM   6178  H  HB3    B HIS A 1 400 ? 38.431  52.851  -34.759 0.49 72.69  ? 397  HIS A HB3    1 
ATOM   6179  H  HD1    A HIS A 1 400 ? 38.002  51.684  -36.724 0.51 96.56  ? 397  HIS A HD1    1 
ATOM   6180  H  HD1    B HIS A 1 400 ? 38.148  52.690  -37.479 0.49 91.25  ? 397  HIS A HD1    1 
ATOM   6181  H  HD2    A HIS A 1 400 ? 38.527  51.754  -32.866 0.51 76.04  ? 397  HIS A HD2    1 
ATOM   6182  H  HD2    B HIS A 1 400 ? 41.275  54.558  -36.104 0.49 78.93  ? 397  HIS A HD2    1 
ATOM   6183  H  HE1    A HIS A 1 400 ? 37.617  49.476  -35.973 0.51 89.47  ? 397  HIS A HE1    1 
ATOM   6184  H  HE1    B HIS A 1 400 ? 39.684  52.795  -39.271 0.49 94.25  ? 397  HIS A HE1    1 
ATOM   6185  H  HE2    A HIS A 1 400 ? 37.938  49.528  -33.630 0.51 68.91  ? 397  HIS A HE2    1 
ATOM   6186  H  HE2    B HIS A 1 400 ? 41.580  53.930  -38.427 0.49 78.58  ? 397  HIS A HE2    1 
ATOM   6187  N  N      . PHE A 1 401 ? 36.836  55.217  -32.790 1.00 62.56  ? 398  PHE A N      1 
ATOM   6188  C  CA     . PHE A 1 401 ? 36.005  55.197  -31.590 1.00 65.67  ? 398  PHE A CA     1 
ATOM   6189  C  C      . PHE A 1 401 ? 34.615  55.716  -31.947 1.00 59.38  ? 398  PHE A C      1 
ATOM   6190  O  O      . PHE A 1 401 ? 33.601  55.159  -31.524 1.00 55.87  ? 398  PHE A O      1 
ATOM   6191  C  CB     . PHE A 1 401 ? 36.639  56.023  -30.458 1.00 55.55  ? 398  PHE A CB     1 
ATOM   6192  C  CG     . PHE A 1 401 ? 35.678  56.388  -29.355 1.00 39.93  ? 398  PHE A CG     1 
ATOM   6193  C  CD1    . PHE A 1 401 ? 35.088  55.413  -28.575 1.00 27.19  ? 398  PHE A CD1    1 
ATOM   6194  C  CD2    . PHE A 1 401 ? 35.383  57.714  -29.091 1.00 45.63  ? 398  PHE A CD2    1 
ATOM   6195  C  CE1    . PHE A 1 401 ? 34.202  55.753  -27.570 1.00 33.21  ? 398  PHE A CE1    1 
ATOM   6196  C  CE2    . PHE A 1 401 ? 34.502  58.059  -28.083 1.00 43.40  ? 398  PHE A CE2    1 
ATOM   6197  C  CZ     . PHE A 1 401 ? 33.913  57.076  -27.321 1.00 32.10  ? 398  PHE A CZ     1 
ATOM   6198  H  H      A PHE A 1 401 ? 37.479  55.788  -32.766 0.51 75.08  ? 398  PHE A H      1 
ATOM   6199  H  H      B PHE A 1 401 ? 37.492  55.773  -32.754 0.49 75.08  ? 398  PHE A H      1 
ATOM   6200  H  HA     . PHE A 1 401 ? 35.915  54.282  -31.281 1.00 78.80  ? 398  PHE A HA     1 
ATOM   6201  H  HB2    . PHE A 1 401 ? 37.361  55.509  -30.063 1.00 66.66  ? 398  PHE A HB2    1 
ATOM   6202  H  HB3    . PHE A 1 401 ? 36.988  56.847  -30.831 1.00 66.66  ? 398  PHE A HB3    1 
ATOM   6203  H  HD1    . PHE A 1 401 ? 35.274  54.517  -28.740 1.00 32.63  ? 398  PHE A HD1    1 
ATOM   6204  H  HD2    . PHE A 1 401 ? 35.775  58.383  -29.606 1.00 54.76  ? 398  PHE A HD2    1 
ATOM   6205  H  HE1    . PHE A 1 401 ? 33.809  55.087  -27.053 1.00 39.85  ? 398  PHE A HE1    1 
ATOM   6206  H  HE2    . PHE A 1 401 ? 34.309  58.954  -27.919 1.00 52.08  ? 398  PHE A HE2    1 
ATOM   6207  H  HZ     . PHE A 1 401 ? 33.322  57.305  -26.640 1.00 38.52  ? 398  PHE A HZ     1 
ATOM   6208  N  N      . LEU A 1 402 ? 34.578  56.783  -32.738 1.00 57.96  ? 399  LEU A N      1 
ATOM   6209  C  CA     . LEU A 1 402 ? 33.320  57.404  -33.138 1.00 67.60  ? 399  LEU A CA     1 
ATOM   6210  C  C      . LEU A 1 402 ? 32.525  56.537  -34.115 1.00 67.42  ? 399  LEU A C      1 
ATOM   6211  O  O      . LEU A 1 402 ? 31.294  56.487  -34.048 1.00 55.62  ? 399  LEU A O      1 
ATOM   6212  C  CB     . LEU A 1 402 ? 33.581  58.783  -33.747 1.00 64.57  ? 399  LEU A CB     1 
ATOM   6213  C  CG     . LEU A 1 402 ? 34.133  59.837  -32.786 1.00 59.08  ? 399  LEU A CG     1 
ATOM   6214  C  CD1    . LEU A 1 402 ? 34.386  61.145  -33.509 1.00 54.85  ? 399  LEU A CD1    1 
ATOM   6215  C  CD2    . LEU A 1 402 ? 33.187  60.062  -31.618 1.00 57.02  ? 399  LEU A CD2    1 
ATOM   6216  H  H      . LEU A 1 402 ? 35.275  57.171  -33.059 1.00 69.55  ? 399  LEU A H      1 
ATOM   6217  H  HA     . LEU A 1 402 ? 32.773  57.532  -32.347 1.00 81.12  ? 399  LEU A HA     1 
ATOM   6218  H  HB2    . LEU A 1 402 ? 34.223  58.682  -34.468 1.00 77.49  ? 399  LEU A HB2    1 
ATOM   6219  H  HB3    . LEU A 1 402 ? 32.746  59.123  -34.103 1.00 77.49  ? 399  LEU A HB3    1 
ATOM   6220  H  HG     . LEU A 1 402 ? 34.979  59.525  -32.429 1.00 70.90  ? 399  LEU A HG     1 
ATOM   6221  H  HD11   . LEU A 1 402 ? 33.550  61.464  -33.884 1.00 65.82  ? 399  LEU A HD11   1 
ATOM   6222  H  HD12   . LEU A 1 402 ? 34.734  61.793  -32.877 1.00 65.82  ? 399  LEU A HD12   1 
ATOM   6223  H  HD13   . LEU A 1 402 ? 35.031  60.994  -34.218 1.00 65.82  ? 399  LEU A HD13   1 
ATOM   6224  H  HD21   . LEU A 1 402 ? 33.076  59.227  -31.138 1.00 68.42  ? 399  LEU A HD21   1 
ATOM   6225  H  HD22   . LEU A 1 402 ? 33.566  60.734  -31.031 1.00 68.42  ? 399  LEU A HD22   1 
ATOM   6226  H  HD23   . LEU A 1 402 ? 32.331  60.365  -31.960 1.00 68.42  ? 399  LEU A HD23   1 
ATOM   6227  N  N      . GLU A 1 403 ? 33.222  55.866  -35.026 1.00 63.40  ? 400  GLU A N      1 
ATOM   6228  C  CA     . GLU A 1 403 ? 32.556  55.026  -36.016 1.00 66.69  ? 400  GLU A CA     1 
ATOM   6229  C  C      . GLU A 1 403 ? 31.754  53.918  -35.350 1.00 63.69  ? 400  GLU A C      1 
ATOM   6230  O  O      . GLU A 1 403 ? 30.579  53.722  -35.657 1.00 50.23  ? 400  GLU A O      1 
ATOM   6231  C  CB     . GLU A 1 403 ? 33.580  54.401  -36.966 1.00 58.17  ? 400  GLU A CB     1 
ATOM   6232  C  CG     . GLU A 1 403 ? 33.808  55.173  -38.252 1.00 85.80  ? 400  GLU A CG     1 
ATOM   6233  C  CD     . GLU A 1 403 ? 35.215  54.988  -38.795 1.00 104.20 ? 400  GLU A CD     1 
ATOM   6234  O  OE1    . GLU A 1 403 ? 35.812  53.914  -38.555 1.00 86.00  ? 400  GLU A OE1    1 
ATOM   6235  O  OE2    . GLU A 1 403 ? 35.726  55.917  -39.458 1.00 97.30  ? 400  GLU A OE2    1 
ATOM   6236  H  H      . GLU A 1 403 ? 34.080  55.880  -35.093 1.00 76.08  ? 400  GLU A H      1 
ATOM   6237  H  HA     . GLU A 1 403 ? 31.947  55.570  -36.540 1.00 80.02  ? 400  GLU A HA     1 
ATOM   6238  H  HB2    . GLU A 1 403 ? 34.432  54.341  -36.505 1.00 69.81  ? 400  GLU A HB2    1 
ATOM   6239  H  HB3    . GLU A 1 403 ? 33.277  53.512  -37.207 1.00 69.81  ? 400  GLU A HB3    1 
ATOM   6240  H  HG2    . GLU A 1 403 ? 33.182  54.861  -38.924 1.00 102.96 ? 400  GLU A HG2    1 
ATOM   6241  H  HG3    . GLU A 1 403 ? 33.672  56.118  -38.083 1.00 102.96 ? 400  GLU A HG3    1 
ATOM   6242  N  N      . ASN A 1 404 ? 32.393  53.219  -34.415 1.00 62.70  ? 401  ASN A N      1 
ATOM   6243  C  CA     . ASN A 1 404 ? 31.770  52.104  -33.711 1.00 42.67  ? 401  ASN A CA     1 
ATOM   6244  C  C      . ASN A 1 404 ? 30.557  52.546  -32.897 1.00 52.39  ? 401  ASN A C      1 
ATOM   6245  O  O      . ASN A 1 404 ? 29.648  51.753  -32.653 1.00 44.55  ? 401  ASN A O      1 
ATOM   6246  C  CB     . ASN A 1 404 ? 32.803  51.417  -32.828 1.00 38.64  ? 401  ASN A CB     1 
ATOM   6247  C  CG     . ASN A 1 404 ? 33.791  50.592  -33.632 1.00 54.78  ? 401  ASN A CG     1 
ATOM   6248  O  OD1    . ASN A 1 404 ? 33.562  50.307  -34.807 1.00 80.73  ? 401  ASN A OD1    1 
ATOM   6249  N  ND2    . ASN A 1 404 ? 34.915  50.232  -33.012 1.00 64.06  ? 401  ASN A ND2    1 
ATOM   6250  H  H      . ASN A 1 404 ? 33.202  53.375  -34.167 1.00 75.24  ? 401  ASN A H      1 
ATOM   6251  H  HA     . ASN A 1 404 ? 31.464  51.456  -34.365 1.00 51.21  ? 401  ASN A HA     1 
ATOM   6252  H  HB2    . ASN A 1 404 ? 33.300  52.091  -32.339 1.00 46.37  ? 401  ASN A HB2    1 
ATOM   6253  H  HB3    . ASN A 1 404 ? 32.348  50.824  -32.210 1.00 46.37  ? 401  ASN A HB3    1 
ATOM   6254  H  HD21   . ASN A 1 404 ? 35.050  50.468  -32.196 1.00 76.87  ? 401  ASN A HD21   1 
ATOM   6255  H  HD22   . ASN A 1 404 ? 35.505  49.764  -33.428 1.00 76.87  ? 401  ASN A HD22   1 
ATOM   6256  N  N      . LEU A 1 405 ? 30.553  53.803  -32.459 1.00 49.73  ? 402  LEU A N      1 
ATOM   6257  C  CA     . LEU A 1 405 ? 29.398  54.356  -31.755 1.00 56.35  ? 402  LEU A CA     1 
ATOM   6258  C  C      . LEU A 1 405 ? 28.203  54.494  -32.679 1.00 69.43  ? 402  LEU A C      1 
ATOM   6259  O  O      . LEU A 1 405 ? 27.080  54.157  -32.304 1.00 72.02  ? 402  LEU A O      1 
ATOM   6260  C  CB     . LEU A 1 405 ? 29.727  55.722  -31.148 1.00 70.99  ? 402  LEU A CB     1 
ATOM   6261  C  CG     . LEU A 1 405 ? 30.661  55.783  -29.949 1.00 53.19  ? 402  LEU A CG     1 
ATOM   6262  C  CD1    . LEU A 1 405 ? 31.024  57.208  -29.614 1.00 56.79  ? 402  LEU A CD1    1 
ATOM   6263  C  CD2    . LEU A 1 405 ? 29.910  55.186  -28.790 1.00 49.44  ? 402  LEU A CD2    1 
ATOM   6264  H  H      . LEU A 1 405 ? 31.205  54.356  -32.556 1.00 59.67  ? 402  LEU A H      1 
ATOM   6265  H  HA     . LEU A 1 405 ? 29.152  53.757  -31.032 1.00 67.62  ? 402  LEU A HA     1 
ATOM   6266  H  HB2    . LEU A 1 405 ? 30.129  56.266  -31.844 1.00 85.19  ? 402  LEU A HB2    1 
ATOM   6267  H  HB3    . LEU A 1 405 ? 28.892  56.132  -30.873 1.00 85.19  ? 402  LEU A HB3    1 
ATOM   6268  H  HG     . LEU A 1 405 ? 31.467  55.270  -30.116 1.00 63.83  ? 402  LEU A HG     1 
ATOM   6269  H  HD11   . LEU A 1 405 ? 30.215  57.700  -29.405 1.00 68.15  ? 402  LEU A HD11   1 
ATOM   6270  H  HD12   . LEU A 1 405 ? 31.619  57.209  -28.847 1.00 68.15  ? 402  LEU A HD12   1 
ATOM   6271  H  HD13   . LEU A 1 405 ? 31.468  57.609  -30.378 1.00 68.15  ? 402  LEU A HD13   1 
ATOM   6272  H  HD21   . LEU A 1 405 ? 29.676  54.270  -29.005 1.00 59.32  ? 402  LEU A HD21   1 
ATOM   6273  H  HD22   . LEU A 1 405 ? 30.477  55.208  -28.003 1.00 59.32  ? 402  LEU A HD22   1 
ATOM   6274  H  HD23   . LEU A 1 405 ? 29.106  55.706  -28.634 1.00 59.32  ? 402  LEU A HD23   1 
ATOM   6275  N  N      . ASP A 1 406 ? 28.451  54.999  -33.884 1.00 75.60  ? 403  ASP A N      1 
ATOM   6276  C  CA     . ASP A 1 406 ? 27.397  55.189  -34.877 1.00 80.03  ? 403  ASP A CA     1 
ATOM   6277  C  C      . ASP A 1 406 ? 26.723  53.861  -35.205 1.00 66.00  ? 403  ASP A C      1 
ATOM   6278  O  O      . ASP A 1 406 ? 25.498  53.762  -35.195 1.00 72.79  ? 403  ASP A O      1 
ATOM   6279  C  CB     . ASP A 1 406 ? 27.956  55.840  -36.144 1.00 73.75  ? 403  ASP A CB     1 
ATOM   6280  C  CG     . ASP A 1 406 ? 28.416  57.273  -35.911 1.00 87.91  ? 403  ASP A CG     1 
ATOM   6281  O  OD1    . ASP A 1 406 ? 27.812  57.963  -35.063 1.00 86.05  ? 403  ASP A OD1    1 
ATOM   6282  O  OD2    . ASP A 1 406 ? 29.378  57.713  -36.576 1.00 66.27  ? 403  ASP A OD2    1 
ATOM   6283  H  H      . ASP A 1 406 ? 29.231  55.242  -34.154 1.00 90.72  ? 403  ASP A H      1 
ATOM   6284  H  HA     . ASP A 1 406 ? 26.723  55.782  -34.510 1.00 96.03  ? 403  ASP A HA     1 
ATOM   6285  H  HB2    . ASP A 1 406 ? 28.718  55.327  -36.454 1.00 88.50  ? 403  ASP A HB2    1 
ATOM   6286  H  HB3    . ASP A 1 406 ? 27.265  55.853  -36.825 1.00 88.50  ? 403  ASP A HB3    1 
ATOM   6287  N  N      . LYS A 1 407 ? 27.537  52.850  -35.495 1.00 46.58  ? 404  LYS A N      1 
ATOM   6288  C  CA     . LYS A 1 407 ? 27.041  51.530  -35.868 1.00 52.67  ? 404  LYS A CA     1 
ATOM   6289  C  C      . LYS A 1 407 ? 26.119  50.980  -34.787 1.00 61.73  ? 404  LYS A C      1 
ATOM   6290  O  O      . LYS A 1 407 ? 25.085  50.387  -35.081 1.00 82.09  ? 404  LYS A O      1 
ATOM   6291  C  CB     . LYS A 1 407 ? 28.202  50.567  -36.109 1.00 37.89  ? 404  LYS A CB     1 
ATOM   6292  C  CG     . LYS A 1 407 ? 29.211  51.076  -37.114 1.00 50.31  ? 404  LYS A CG     1 
ATOM   6293  C  CD     . LYS A 1 407 ? 30.192  50.002  -37.533 1.00 62.21  ? 404  LYS A CD     1 
ATOM   6294  C  CE     . LYS A 1 407 ? 31.255  50.578  -38.451 1.00 65.46  ? 404  LYS A CE     1 
ATOM   6295  N  NZ     . LYS A 1 407 ? 32.440  49.687  -38.543 1.00 85.90  ? 404  LYS A NZ     1 
ATOM   6296  H  H      . LYS A 1 407 ? 28.395  52.906  -35.482 1.00 55.89  ? 404  LYS A H      1 
ATOM   6297  H  HA     . LYS A 1 407 ? 26.532  51.602  -36.691 1.00 63.21  ? 404  LYS A HA     1 
ATOM   6298  H  HB2    . LYS A 1 407 ? 28.666  50.419  -35.270 1.00 45.47  ? 404  LYS A HB2    1 
ATOM   6299  H  HB3    . LYS A 1 407 ? 27.848  49.727  -36.442 1.00 45.47  ? 404  LYS A HB3    1 
ATOM   6300  H  HG2    . LYS A 1 407 ? 28.744  51.384  -37.906 1.00 60.37  ? 404  LYS A HG2    1 
ATOM   6301  H  HG3    . LYS A 1 407 ? 29.714  51.805  -36.718 1.00 60.37  ? 404  LYS A HG3    1 
ATOM   6302  H  HD2    . LYS A 1 407 ? 30.628  49.638  -36.747 1.00 74.66  ? 404  LYS A HD2    1 
ATOM   6303  H  HD3    . LYS A 1 407 ? 29.719  49.302  -38.012 1.00 74.66  ? 404  LYS A HD3    1 
ATOM   6304  H  HE2    . LYS A 1 407 ? 30.886  50.684  -39.341 1.00 78.55  ? 404  LYS A HE2    1 
ATOM   6305  H  HE3    . LYS A 1 407 ? 31.547  51.435  -38.103 1.00 78.55  ? 404  LYS A HE3    1 
ATOM   6306  H  HZ1    . LYS A 1 407 ? 32.199  48.892  -38.864 1.00 103.08 ? 404  LYS A HZ1    1 
ATOM   6307  H  HZ2    . LYS A 1 407 ? 33.049  50.045  -39.085 1.00 103.08 ? 404  LYS A HZ2    1 
ATOM   6308  H  HZ3    . LYS A 1 407 ? 32.801  49.576  -37.737 1.00 103.08 ? 404  LYS A HZ3    1 
ATOM   6309  N  N      . SER A 1 408 ? 26.501  51.181  -33.532 1.00 73.08  ? 405  SER A N      1 
ATOM   6310  C  CA     . SER A 1 408 ? 25.710  50.692  -32.411 1.00 84.76  ? 405  SER A CA     1 
ATOM   6311  C  C      . SER A 1 408 ? 24.361  51.410  -32.352 1.00 82.38  ? 405  SER A C      1 
ATOM   6312  O  O      . SER A 1 408 ? 23.335  50.779  -32.091 1.00 84.90  ? 405  SER A O      1 
ATOM   6313  C  CB     . SER A 1 408 ? 26.475  50.865  -31.096 1.00 70.42  ? 405  SER A CB     1 
ATOM   6314  O  OG     . SER A 1 408 ? 26.698  52.235  -30.811 1.00 83.96  ? 405  SER A OG     1 
ATOM   6315  H  H      . SER A 1 408 ? 27.216  51.599  -33.303 1.00 87.70  ? 405  SER A H      1 
ATOM   6316  H  HA     . SER A 1 408 ? 25.540  49.745  -32.535 1.00 101.71 ? 405  SER A HA     1 
ATOM   6317  H  HB2    . SER A 1 408 ? 25.955  50.475  -30.375 1.00 84.50  ? 405  SER A HB2    1 
ATOM   6318  H  HB3    . SER A 1 408 ? 27.331  50.415  -31.167 1.00 84.50  ? 405  SER A HB3    1 
ATOM   6319  H  HG     . SER A 1 408 ? 27.148  52.587  -31.427 1.00 100.75 ? 405  SER A HG     1 
ATOM   6320  N  N      . ARG A 1 409 ? 24.353  52.720  -32.587 1.00 68.92  ? 406  ARG A N      1 
ATOM   6321  C  CA     . ARG A 1 409 ? 23.103  53.474  -32.543 1.00 73.36  ? 406  ARG A CA     1 
ATOM   6322  C  C      . ARG A 1 409 ? 22.167  52.987  -33.636 1.00 98.22  ? 406  ARG A C      1 
ATOM   6323  O  O      . ARG A 1 409 ? 20.951  52.919  -33.445 1.00 103.98 ? 406  ARG A O      1 
ATOM   6324  C  CB     . ARG A 1 409 ? 23.332  54.978  -32.713 1.00 51.39  ? 406  ARG A CB     1 
ATOM   6325  C  CG     . ARG A 1 409 ? 23.746  55.706  -31.455 1.00 75.84  ? 406  ARG A CG     1 
ATOM   6326  C  CD     . ARG A 1 409 ? 23.690  57.211  -31.660 1.00 52.42  ? 406  ARG A CD     1 
ATOM   6327  N  NE     . ARG A 1 409 ? 24.707  57.680  -32.596 1.00 58.40  ? 406  ARG A NE     1 
ATOM   6328  C  CZ     . ARG A 1 409 ? 25.922  58.092  -32.247 1.00 74.14  ? 406  ARG A CZ     1 
ATOM   6329  N  NH1    . ARG A 1 409 ? 26.296  58.099  -30.974 1.00 83.20  ? 406  ARG A NH1    1 
ATOM   6330  N  NH2    . ARG A 1 409 ? 26.768  58.501  -33.180 1.00 72.58  ? 406  ARG A NH2    1 
ATOM   6331  H  H      . ARG A 1 409 ? 25.049  53.191  -32.772 1.00 82.71  ? 406  ARG A H      1 
ATOM   6332  H  HA     . ARG A 1 409 ? 22.672  53.327  -31.686 1.00 88.03  ? 406  ARG A HA     1 
ATOM   6333  H  HB2    . ARG A 1 409 ? 24.031  55.111  -33.372 1.00 61.66  ? 406  ARG A HB2    1 
ATOM   6334  H  HB3    . ARG A 1 409 ? 22.508  55.382  -33.027 1.00 61.66  ? 406  ARG A HB3    1 
ATOM   6335  H  HG2    . ARG A 1 409 ? 23.141  55.472  -30.734 1.00 91.01  ? 406  ARG A HG2    1 
ATOM   6336  H  HG3    . ARG A 1 409 ? 24.656  55.461  -31.226 1.00 91.01  ? 406  ARG A HG3    1 
ATOM   6337  H  HD2    . ARG A 1 409 ? 22.820  57.450  -32.016 1.00 62.90  ? 406  ARG A HD2    1 
ATOM   6338  H  HD3    . ARG A 1 409 ? 23.836  57.653  -30.809 1.00 62.90  ? 406  ARG A HD3    1 
ATOM   6339  H  HE     . ARG A 1 409 ? 24.505  57.692  -33.432 1.00 70.08  ? 406  ARG A HE     1 
ATOM   6340  H  HH11   . ARG A 1 409 ? 25.750  57.835  -30.365 1.00 99.83  ? 406  ARG A HH11   1 
ATOM   6341  H  HH12   . ARG A 1 409 ? 27.084  58.367  -30.759 1.00 99.83  ? 406  ARG A HH12   1 
ATOM   6342  H  HH21   . ARG A 1 409 ? 26.531  58.499  -34.006 1.00 87.09  ? 406  ARG A HH21   1 
ATOM   6343  H  HH22   . ARG A 1 409 ? 27.555  58.768  -32.959 1.00 87.09  ? 406  ARG A HH22   1 
ATOM   6344  N  N      . LYS A 1 410 ? 22.747  52.650  -34.781 1.00 95.38  ? 407  LYS A N      1 
ATOM   6345  C  CA     . LYS A 1 410 ? 21.985  52.165  -35.922 1.00 78.16  ? 407  LYS A CA     1 
ATOM   6346  C  C      . LYS A 1 410 ? 21.493  50.736  -35.699 1.00 83.55  ? 407  LYS A C      1 
ATOM   6347  O  O      . LYS A 1 410 ? 20.293  50.469  -35.761 1.00 101.02 ? 407  LYS A O      1 
ATOM   6348  C  CB     . LYS A 1 410 ? 22.848  52.245  -37.179 1.00 66.48  ? 407  LYS A CB     1 
ATOM   6349  C  CG     . LYS A 1 410 ? 23.022  53.669  -37.688 1.00 71.70  ? 407  LYS A CG     1 
ATOM   6350  C  CD     . LYS A 1 410 ? 24.265  53.821  -38.551 1.00 84.45  ? 407  LYS A CD     1 
ATOM   6351  C  CE     . LYS A 1 410 ? 24.525  55.285  -38.878 1.00 114.48 ? 407  LYS A CE     1 
ATOM   6352  N  NZ     . LYS A 1 410 ? 25.660  55.472  -39.822 1.00 132.21 ? 407  LYS A NZ     1 
ATOM   6353  H  H      . LYS A 1 410 ? 23.594  52.693  -34.924 1.00 114.45 ? 407  LYS A H      1 
ATOM   6354  H  HA     . LYS A 1 410 ? 21.210  52.735  -36.051 1.00 93.80  ? 407  LYS A HA     1 
ATOM   6355  H  HB2    . LYS A 1 410 ? 23.728  51.888  -36.981 1.00 79.78  ? 407  LYS A HB2    1 
ATOM   6356  H  HB3    . LYS A 1 410 ? 22.430  51.725  -37.883 1.00 79.78  ? 407  LYS A HB3    1 
ATOM   6357  H  HG2    . LYS A 1 410 ? 22.251  53.912  -38.224 1.00 86.03  ? 407  LYS A HG2    1 
ATOM   6358  H  HG3    . LYS A 1 410 ? 23.105  54.269  -36.931 1.00 86.03  ? 407  LYS A HG3    1 
ATOM   6359  H  HD2    . LYS A 1 410 ? 25.034  53.474  -38.072 1.00 101.34 ? 407  LYS A HD2    1 
ATOM   6360  H  HD3    . LYS A 1 410 ? 24.140  53.339  -39.384 1.00 101.34 ? 407  LYS A HD3    1 
ATOM   6361  H  HE2    . LYS A 1 410 ? 23.730  55.664  -39.285 1.00 137.38 ? 407  LYS A HE2    1 
ATOM   6362  H  HE3    . LYS A 1 410 ? 24.735  55.760  -38.058 1.00 137.38 ? 407  LYS A HE3    1 
ATOM   6363  H  HZ1    . LYS A 1 410 ? 25.490  55.052  -40.589 1.00 158.65 ? 407  LYS A HZ1    1 
ATOM   6364  H  HZ2    . LYS A 1 410 ? 25.779  56.338  -39.987 1.00 158.65 ? 407  LYS A HZ2    1 
ATOM   6365  H  HZ3    . LYS A 1 410 ? 26.407  55.139  -39.470 1.00 158.65 ? 407  LYS A HZ3    1 
ATOM   6366  N  N      . GLY A 1 411 ? 22.425  49.830  -35.421 1.00 89.82  ? 408  GLY A N      1 
ATOM   6367  C  CA     . GLY A 1 411 ? 22.103  48.432  -35.186 1.00 69.92  ? 408  GLY A CA     1 
ATOM   6368  C  C      . GLY A 1 411 ? 23.172  47.509  -35.739 1.00 86.08  ? 408  GLY A C      1 
ATOM   6369  O  O      . GLY A 1 411 ? 23.303  46.363  -35.308 1.00 98.78  ? 408  GLY A O      1 
ATOM   6370  H  H      . GLY A 1 411 ? 23.265  50.005  -35.363 1.00 107.78 ? 408  GLY A H      1 
ATOM   6371  H  HA2    . GLY A 1 411 ? 22.020  48.273  -34.232 1.00 83.90  ? 408  GLY A HA2    1 
ATOM   6372  H  HA3    . GLY A 1 411 ? 21.258  48.217  -35.610 1.00 83.90  ? 408  GLY A HA3    1 
ATOM   6373  N  N      . GLU A 1 412 ? 23.939  48.017  -36.700 1.00 94.18  ? 409  GLU A N      1 
ATOM   6374  C  CA     . GLU A 1 412 ? 25.001  47.251  -37.344 1.00 105.21 ? 409  GLU A CA     1 
ATOM   6375  C  C      . GLU A 1 412 ? 26.120  46.883  -36.359 1.00 105.90 ? 409  GLU A C      1 
ATOM   6376  O  O      . GLU A 1 412 ? 26.602  47.728  -35.605 1.00 97.81  ? 409  GLU A O      1 
ATOM   6377  C  CB     . GLU A 1 412 ? 25.566  48.047  -38.525 1.00 102.16 ? 409  GLU A CB     1 
ATOM   6378  C  CG     . GLU A 1 412 ? 24.528  48.368  -39.600 1.00 139.92 ? 409  GLU A CG     1 
ATOM   6379  C  CD     . GLU A 1 412 ? 25.081  49.231  -40.721 1.00 157.20 ? 409  GLU A CD     1 
ATOM   6380  O  OE1    . GLU A 1 412 ? 26.263  49.626  -40.643 1.00 156.42 ? 409  GLU A OE1    1 
ATOM   6381  O  OE2    . GLU A 1 412 ? 24.332  49.514  -41.680 1.00 150.19 ? 409  GLU A OE2    1 
ATOM   6382  H  H      . GLU A 1 412 ? 23.861  48.819  -37.001 1.00 113.01 ? 409  GLU A H      1 
ATOM   6383  H  HA     . GLU A 1 412 ? 24.627  46.426  -37.691 1.00 126.25 ? 409  GLU A HA     1 
ATOM   6384  H  HB2    . GLU A 1 412 ? 25.921  48.887  -38.195 1.00 122.59 ? 409  GLU A HB2    1 
ATOM   6385  H  HB3    . GLU A 1 412 ? 26.274  47.530  -38.941 1.00 122.59 ? 409  GLU A HB3    1 
ATOM   6386  H  HG2    . GLU A 1 412 ? 24.211  47.538  -39.990 1.00 167.90 ? 409  GLU A HG2    1 
ATOM   6387  H  HG3    . GLU A 1 412 ? 23.789  48.845  -39.192 1.00 167.90 ? 409  GLU A HG3    1 
ATOM   6388  N  N      . LEU A 1 413 ? 26.530  45.616  -36.383 1.00 107.98 ? 410  LEU A N      1 
ATOM   6389  C  CA     . LEU A 1 413 ? 27.516  45.092  -35.439 1.00 107.75 ? 410  LEU A CA     1 
ATOM   6390  C  C      . LEU A 1 413 ? 28.924  45.639  -35.680 1.00 100.63 ? 410  LEU A C      1 
ATOM   6391  O  O      . LEU A 1 413 ? 29.136  46.513  -36.520 1.00 84.59  ? 410  LEU A O      1 
ATOM   6392  C  CB     . LEU A 1 413 ? 27.548  43.561  -35.510 1.00 115.20 ? 410  LEU A CB     1 
ATOM   6393  C  CG     . LEU A 1 413 ? 26.249  42.822  -35.176 1.00 108.84 ? 410  LEU A CG     1 
ATOM   6394  C  CD1    . LEU A 1 413 ? 26.453  41.317  -35.298 1.00 107.54 ? 410  LEU A CD1    1 
ATOM   6395  C  CD2    . LEU A 1 413 ? 25.749  43.183  -33.784 1.00 105.20 ? 410  LEU A CD2    1 
ATOM   6396  H  H      . LEU A 1 413 ? 26.247  45.031  -36.946 1.00 129.58 ? 410  LEU A H      1 
ATOM   6397  H  HA     . LEU A 1 413 ? 27.251  45.342  -34.540 1.00 129.30 ? 410  LEU A HA     1 
ATOM   6398  H  HB2    . LEU A 1 413 ? 27.797  43.307  -36.412 1.00 138.24 ? 410  LEU A HB2    1 
ATOM   6399  H  HB3    . LEU A 1 413 ? 28.224  43.244  -34.891 1.00 138.24 ? 410  LEU A HB3    1 
ATOM   6400  H  HG     . LEU A 1 413 ? 25.567  43.082  -35.814 1.00 130.61 ? 410  LEU A HG     1 
ATOM   6401  H  HD11   . LEU A 1 413 ? 27.148  41.042  -34.679 1.00 129.05 ? 410  LEU A HD11   1 
ATOM   6402  H  HD12   . LEU A 1 413 ? 25.621  40.868  -35.083 1.00 129.05 ? 410  LEU A HD12   1 
ATOM   6403  H  HD13   . LEU A 1 413 ? 26.718  41.108  -36.207 1.00 129.05 ? 410  LEU A HD13   1 
ATOM   6404  H  HD21   . LEU A 1 413 ? 25.583  44.138  -33.747 1.00 126.23 ? 410  LEU A HD21   1 
ATOM   6405  H  HD22   . LEU A 1 413 ? 24.928  42.697  -33.609 1.00 126.23 ? 410  LEU A HD22   1 
ATOM   6406  H  HD23   . LEU A 1 413 ? 26.425  42.938  -33.133 1.00 126.23 ? 410  LEU A HD23   1 
ATOM   6407  N  N      . LEU B 2 11  ? -1.972  54.441  11.391  1.00 112.72 ? 11   LEU B N      1 
ATOM   6408  C  CA     . LEU B 2 11  ? -2.704  53.338  12.004  1.00 115.83 ? 11   LEU B CA     1 
ATOM   6409  C  C      . LEU B 2 11  ? -3.771  53.874  12.959  1.00 115.13 ? 11   LEU B C      1 
ATOM   6410  O  O      . LEU B 2 11  ? -3.579  54.914  13.590  1.00 114.75 ? 11   LEU B O      1 
ATOM   6411  C  CB     . LEU B 2 11  ? -1.738  52.402  12.742  1.00 103.68 ? 11   LEU B CB     1 
ATOM   6412  C  CG     . LEU B 2 11  ? -2.322  51.120  13.344  1.00 101.00 ? 11   LEU B CG     1 
ATOM   6413  C  CD1    . LEU B 2 11  ? -2.990  50.275  12.272  1.00 128.24 ? 11   LEU B CD1    1 
ATOM   6414  C  CD2    . LEU B 2 11  ? -1.240  50.314  14.050  1.00 87.10  ? 11   LEU B CD2    1 
ATOM   6415  H  HA     . LEU B 2 11  ? -3.149  52.827  11.310  1.00 138.99 ? 11   LEU B HA     1 
ATOM   6416  H  HB2    . LEU B 2 11  ? -1.045  52.134  12.119  1.00 124.41 ? 11   LEU B HB2    1 
ATOM   6417  H  HB3    . LEU B 2 11  ? -1.336  52.901  13.471  1.00 124.41 ? 11   LEU B HB3    1 
ATOM   6418  H  HG     . LEU B 2 11  ? -2.995  51.358  14.001  1.00 121.20 ? 11   LEU B HG     1 
ATOM   6419  H  HD11   . LEU B 2 11  ? -2.330  50.039  11.601  1.00 153.88 ? 11   LEU B HD11   1 
ATOM   6420  H  HD12   . LEU B 2 11  ? -3.349  49.473  12.681  1.00 153.88 ? 11   LEU B HD12   1 
ATOM   6421  H  HD13   . LEU B 2 11  ? -3.706  50.789  11.866  1.00 153.88 ? 11   LEU B HD13   1 
ATOM   6422  H  HD21   . LEU B 2 11  ? -0.858  50.853  14.760  1.00 104.52 ? 11   LEU B HD21   1 
ATOM   6423  H  HD22   . LEU B 2 11  ? -1.637  49.510  14.420  1.00 104.52 ? 11   LEU B HD22   1 
ATOM   6424  H  HD23   . LEU B 2 11  ? -0.553  50.079  13.407  1.00 104.52 ? 11   LEU B HD23   1 
ATOM   6425  N  N      . ARG B 2 12  ? -4.897  53.168  13.050  1.00 111.83 ? 12   ARG B N      1 
ATOM   6426  C  CA     . ARG B 2 12  ? -5.988  53.560  13.942  1.00 117.39 ? 12   ARG B CA     1 
ATOM   6427  C  C      . ARG B 2 12  ? -6.599  52.352  14.648  1.00 123.42 ? 12   ARG B C      1 
ATOM   6428  O  O      . ARG B 2 12  ? -6.577  51.236  14.126  1.00 114.05 ? 12   ARG B O      1 
ATOM   6429  C  CB     . ARG B 2 12  ? -7.077  54.305  13.164  1.00 108.83 ? 12   ARG B CB     1 
ATOM   6430  C  CG     . ARG B 2 12  ? -6.620  55.625  12.577  1.00 109.34 ? 12   ARG B CG     1 
ATOM   6431  C  CD     . ARG B 2 12  ? -7.677  56.251  11.681  1.00 107.75 ? 12   ARG B CD     1 
ATOM   6432  N  NE     . ARG B 2 12  ? -7.152  57.431  10.998  1.00 120.20 ? 12   ARG B NE     1 
ATOM   6433  C  CZ     . ARG B 2 12  ? -7.293  58.684  11.422  1.00 126.32 ? 12   ARG B CZ     1 
ATOM   6434  N  NH1    . ARG B 2 12  ? -7.953  58.954  12.541  1.00 133.79 ? 12   ARG B NH1    1 
ATOM   6435  N  NH2    . ARG B 2 12  ? -6.762  59.678  10.723  1.00 122.25 ? 12   ARG B NH2    1 
ATOM   6436  H  H      . ARG B 2 12  ? -5.055  52.452  12.601  1.00 134.20 ? 12   ARG B H      1 
ATOM   6437  H  HA     . ARG B 2 12  ? -5.641  54.159  14.621  1.00 140.87 ? 12   ARG B HA     1 
ATOM   6438  H  HB2    . ARG B 2 12  ? -7.377  53.744  12.432  1.00 130.59 ? 12   ARG B HB2    1 
ATOM   6439  H  HB3    . ARG B 2 12  ? -7.818  54.488  13.762  1.00 130.59 ? 12   ARG B HB3    1 
ATOM   6440  H  HG2    . ARG B 2 12  ? -6.430  56.245  13.298  1.00 131.21 ? 12   ARG B HG2    1 
ATOM   6441  H  HG3    . ARG B 2 12  ? -5.822  55.478  12.045  1.00 131.21 ? 12   ARG B HG3    1 
ATOM   6442  H  HD2    . ARG B 2 12  ? -7.952  55.607  11.010  1.00 129.30 ? 12   ARG B HD2    1 
ATOM   6443  H  HD3    . ARG B 2 12  ? -8.436  56.522  12.220  1.00 129.30 ? 12   ARG B HD3    1 
ATOM   6444  H  HE     . ARG B 2 12  ? -6.719  57.307  10.265  1.00 144.23 ? 12   ARG B HE     1 
ATOM   6445  H  HH11   . ARG B 2 12  ? -8.297  58.315  13.002  1.00 160.55 ? 12   ARG B HH11   1 
ATOM   6446  H  HH12   . ARG B 2 12  ? -8.037  59.768  12.805  1.00 160.55 ? 12   ARG B HH12   1 
ATOM   6447  H  HH21   . ARG B 2 12  ? -6.334  59.511  9.996   1.00 146.70 ? 12   ARG B HH21   1 
ATOM   6448  H  HH22   . ARG B 2 12  ? -6.853  60.490  10.992  1.00 146.70 ? 12   ARG B HH22   1 
ATOM   6449  N  N      . LEU B 2 13  ? -7.143  52.582  15.841  1.00 122.43 ? 13   LEU B N      1 
ATOM   6450  C  CA     . LEU B 2 13  ? -7.848  51.536  16.571  1.00 120.96 ? 13   LEU B CA     1 
ATOM   6451  C  C      . LEU B 2 13  ? -9.166  51.233  15.863  1.00 118.27 ? 13   LEU B C      1 
ATOM   6452  O  O      . LEU B 2 13  ? -9.645  50.100  15.877  1.00 117.71 ? 13   LEU B O      1 
ATOM   6453  C  CB     . LEU B 2 13  ? -8.096  51.951  18.027  1.00 124.75 ? 13   LEU B CB     1 
ATOM   6454  C  CG     . LEU B 2 13  ? -6.868  52.101  18.937  1.00 126.52 ? 13   LEU B CG     1 
ATOM   6455  C  CD1    . LEU B 2 13  ? -7.280  52.537  20.340  1.00 126.83 ? 13   LEU B CD1    1 
ATOM   6456  C  CD2    . LEU B 2 13  ? -6.062  50.813  19.011  1.00 119.10 ? 13   LEU B CD2    1 
ATOM   6457  H  H      . LEU B 2 13  ? -7.116  53.339  16.249  1.00 146.92 ? 13   LEU B H      1 
ATOM   6458  H  HA     . LEU B 2 13  ? -7.311  50.728  16.573  1.00 145.15 ? 13   LEU B HA     1 
ATOM   6459  H  HB2    . LEU B 2 13  ? -8.552  52.807  18.022  1.00 149.70 ? 13   LEU B HB2    1 
ATOM   6460  H  HB3    . LEU B 2 13  ? -8.672  51.286  18.435  1.00 149.70 ? 13   LEU B HB3    1 
ATOM   6461  H  HG     . LEU B 2 13  ? -6.292  52.790  18.572  1.00 151.82 ? 13   LEU B HG     1 
ATOM   6462  H  HD11   . LEU B 2 13  ? -7.873  51.867  20.717  1.00 152.20 ? 13   LEU B HD11   1 
ATOM   6463  H  HD12   . LEU B 2 13  ? -6.486  52.623  20.890  1.00 152.20 ? 13   LEU B HD12   1 
ATOM   6464  H  HD13   . LEU B 2 13  ? -7.738  53.390  20.284  1.00 152.20 ? 13   LEU B HD13   1 
ATOM   6465  H  HD21   . LEU B 2 13  ? -5.759  50.578  18.120  1.00 142.92 ? 13   LEU B HD21   1 
ATOM   6466  H  HD22   . LEU B 2 13  ? -5.299  50.951  19.594  1.00 142.92 ? 13   LEU B HD22   1 
ATOM   6467  H  HD23   . LEU B 2 13  ? -6.626  50.108  19.366  1.00 142.92 ? 13   LEU B HD23   1 
ATOM   6468  N  N      . ALA B 2 14  ? -9.743  52.264  15.250  1.00 118.02 ? 14   ALA B N      1 
ATOM   6469  C  CA     . ALA B 2 14  ? -10.904 52.113  14.377  1.00 111.05 ? 14   ALA B CA     1 
ATOM   6470  C  C      . ALA B 2 14  ? -10.660 52.888  13.085  1.00 120.96 ? 14   ALA B C      1 
ATOM   6471  O  O      . ALA B 2 14  ? -10.674 54.120  13.081  1.00 115.00 ? 14   ALA B O      1 
ATOM   6472  C  CB     . ALA B 2 14  ? -12.169 52.598  15.069  1.00 82.82  ? 14   ALA B CB     1 
ATOM   6473  H  H      . ALA B 2 14  ? -9.474  53.077  15.326  1.00 141.62 ? 14   ALA B H      1 
ATOM   6474  H  HA     . ALA B 2 14  ? -11.018 51.175  14.155  1.00 133.26 ? 14   ALA B HA     1 
ATOM   6475  H  HB1    . ALA B 2 14  ? -12.064 53.535  15.297  1.00 99.38  ? 14   ALA B HB1    1 
ATOM   6476  H  HB2    . ALA B 2 14  ? -12.921 52.485  14.467  1.00 99.38  ? 14   ALA B HB2    1 
ATOM   6477  H  HB3    . ALA B 2 14  ? -12.308 52.075  15.874  1.00 99.38  ? 14   ALA B HB3    1 
ATOM   6478  N  N      . GLY B 2 15  ? -10.428 52.156  11.996  1.00 111.47 ? 15   GLY B N      1 
ATOM   6479  C  CA     . GLY B 2 15  ? -10.055 52.753  10.725  1.00 99.26  ? 15   GLY B CA     1 
ATOM   6480  C  C      . GLY B 2 15  ? -11.048 53.782  10.214  1.00 114.24 ? 15   GLY B C      1 
ATOM   6481  O  O      . GLY B 2 15  ? -10.664 54.786  9.610   1.00 84.69  ? 15   GLY B O      1 
ATOM   6482  H  H      . GLY B 2 15  ? -10.483 51.298  11.973  1.00 133.77 ? 15   GLY B H      1 
ATOM   6483  H  HA2    . GLY B 2 15  ? -9.192  53.186  10.818  1.00 119.11 ? 15   GLY B HA2    1 
ATOM   6484  H  HA3    . GLY B 2 15  ? -9.973  52.055  10.057  1.00 119.11 ? 15   GLY B HA3    1 
ATOM   6485  N  N      . TYR B 2 29  ? 4.059   43.530  3.582   1.00 114.89 ? 29   TYR B N      1 
ATOM   6486  C  CA     . TYR B 2 29  ? 4.364   44.739  4.339   1.00 137.00 ? 29   TYR B CA     1 
ATOM   6487  C  C      . TYR B 2 29  ? 4.450   45.964  3.434   1.00 145.60 ? 29   TYR B C      1 
ATOM   6488  O  O      . TYR B 2 29  ? 5.469   46.657  3.411   1.00 138.94 ? 29   TYR B O      1 
ATOM   6489  C  CB     . TYR B 2 29  ? 5.675   44.578  5.114   1.00 144.50 ? 29   TYR B CB     1 
ATOM   6490  C  CG     . TYR B 2 29  ? 5.784   43.290  5.898   1.00 143.64 ? 29   TYR B CG     1 
ATOM   6491  C  CD1    . TYR B 2 29  ? 5.087   43.120  7.087   1.00 140.30 ? 29   TYR B CD1    1 
ATOM   6492  C  CD2    . TYR B 2 29  ? 6.605   42.256  5.467   1.00 142.57 ? 29   TYR B CD2    1 
ATOM   6493  C  CE1    . TYR B 2 29  ? 5.186   41.951  7.815   1.00 128.19 ? 29   TYR B CE1    1 
ATOM   6494  C  CE2    . TYR B 2 29  ? 6.713   41.082  6.190   1.00 142.72 ? 29   TYR B CE2    1 
ATOM   6495  C  CZ     . TYR B 2 29  ? 6.001   40.936  7.364   1.00 138.38 ? 29   TYR B CZ     1 
ATOM   6496  O  OH     . TYR B 2 29  ? 6.103   39.771  8.089   1.00 143.13 ? 29   TYR B OH     1 
ATOM   6497  H  HA     . TYR B 2 29  ? 3.655   44.894  4.983   1.00 164.41 ? 29   TYR B HA     1 
ATOM   6498  H  HB2    . TYR B 2 29  ? 6.413   44.603  4.485   1.00 173.40 ? 29   TYR B HB2    1 
ATOM   6499  H  HB3    . TYR B 2 29  ? 5.757   45.313  5.742   1.00 173.40 ? 29   TYR B HB3    1 
ATOM   6500  H  HD1    . TYR B 2 29  ? 4.535   43.803  7.394   1.00 168.36 ? 29   TYR B HD1    1 
ATOM   6501  H  HD2    . TYR B 2 29  ? 7.084   42.352  4.676   1.00 171.08 ? 29   TYR B HD2    1 
ATOM   6502  H  HE1    . TYR B 2 29  ? 4.708   41.851  8.606   1.00 153.83 ? 29   TYR B HE1    1 
ATOM   6503  H  HE2    . TYR B 2 29  ? 7.261   40.395  5.887   1.00 171.26 ? 29   TYR B HE2    1 
ATOM   6504  H  HH     . TYR B 2 29  ? 5.620   39.817  8.775   1.00 171.76 ? 29   TYR B HH     1 
ATOM   6505  N  N      . LEU B 2 30  ? 3.377   46.222  2.693   1.00 159.66 ? 30   LEU B N      1 
ATOM   6506  C  CA     . LEU B 2 30  ? 3.319   47.358  1.777   1.00 157.71 ? 30   LEU B CA     1 
ATOM   6507  C  C      . LEU B 2 30  ? 2.290   48.401  2.213   1.00 154.14 ? 30   LEU B C      1 
ATOM   6508  O  O      . LEU B 2 30  ? 2.625   49.573  2.396   1.00 141.45 ? 30   LEU B O      1 
ATOM   6509  C  CB     . LEU B 2 30  ? 3.000   46.875  0.358   1.00 143.09 ? 30   LEU B CB     1 
ATOM   6510  C  CG     . LEU B 2 30  ? 4.052   45.985  -0.313  1.00 126.89 ? 30   LEU B CG     1 
ATOM   6511  C  CD1    . LEU B 2 30  ? 3.558   45.507  -1.667  1.00 115.45 ? 30   LEU B CD1    1 
ATOM   6512  C  CD2    . LEU B 2 30  ? 5.378   46.719  -0.471  1.00 131.48 ? 30   LEU B CD2    1 
ATOM   6513  H  H      . LEU B 2 30  ? 2.660   45.748  2.703   1.00 191.60 ? 30   LEU B H      1 
ATOM   6514  H  HA     . LEU B 2 30  ? 4.188   47.788  1.756   1.00 189.26 ? 30   LEU B HA     1 
ATOM   6515  H  HB2    . LEU B 2 30  ? 2.173   46.369  0.388   1.00 171.71 ? 30   LEU B HB2    1 
ATOM   6516  H  HB3    . LEU B 2 30  ? 2.879   47.654  -0.208  1.00 171.71 ? 30   LEU B HB3    1 
ATOM   6517  H  HG     . LEU B 2 30  ? 4.205   45.205  0.243   1.00 152.27 ? 30   LEU B HG     1 
ATOM   6518  H  HD11   . LEU B 2 30  ? 3.387   46.278  -2.230  1.00 138.54 ? 30   LEU B HD11   1 
ATOM   6519  H  HD12   . LEU B 2 30  ? 4.240   44.947  -2.071  1.00 138.54 ? 30   LEU B HD12   1 
ATOM   6520  H  HD13   . LEU B 2 30  ? 2.742   44.998  -1.544  1.00 138.54 ? 30   LEU B HD13   1 
ATOM   6521  H  HD21   . LEU B 2 30  ? 5.701   46.978  0.406   1.00 157.78 ? 30   LEU B HD21   1 
ATOM   6522  H  HD22   . LEU B 2 30  ? 6.017   46.126  -0.897  1.00 157.78 ? 30   LEU B HD22   1 
ATOM   6523  H  HD23   . LEU B 2 30  ? 5.239   47.506  -1.019  1.00 157.78 ? 30   LEU B HD23   1 
ATOM   6524  N  N      . GLN B 2 31  ? 1.044   47.970  2.389   1.00 157.68 ? 31   GLN B N      1 
ATOM   6525  C  CA     . GLN B 2 31  ? -0.049  48.885  2.715   1.00 163.57 ? 31   GLN B CA     1 
ATOM   6526  C  C      . GLN B 2 31  ? -0.447  48.878  4.198   1.00 167.85 ? 31   GLN B C      1 
ATOM   6527  O  O      . GLN B 2 31  ? -0.491  47.815  4.817   1.00 159.86 ? 31   GLN B O      1 
ATOM   6528  C  CB     . GLN B 2 31  ? -1.274  48.523  1.875   1.00 162.69 ? 31   GLN B CB     1 
ATOM   6529  C  CG     . GLN B 2 31  ? -1.009  48.478  0.379   1.00 174.17 ? 31   GLN B CG     1 
ATOM   6530  C  CD     . GLN B 2 31  ? -2.285  48.403  -0.436  1.00 199.04 ? 31   GLN B CD     1 
ATOM   6531  O  OE1    . GLN B 2 31  ? -3.326  47.970  0.059   1.00 202.53 ? 31   GLN B OE1    1 
ATOM   6532  N  NE2    . GLN B 2 31  ? -2.209  48.819  -1.695  1.00 201.46 ? 31   GLN B NE2    1 
ATOM   6533  H  H      . GLN B 2 31  ? 0.803   47.147  2.324   1.00 189.22 ? 31   GLN B H      1 
ATOM   6534  H  HA     . GLN B 2 31  ? 0.217   49.788  2.482   1.00 196.29 ? 31   GLN B HA     1 
ATOM   6535  H  HB2    . GLN B 2 31  ? -1.589  47.646  2.145   1.00 195.23 ? 31   GLN B HB2    1 
ATOM   6536  H  HB3    . GLN B 2 31  ? -1.967  49.183  2.033   1.00 195.23 ? 31   GLN B HB3    1 
ATOM   6537  H  HG2    . GLN B 2 31  ? -0.532  49.282  0.118   1.00 209.00 ? 31   GLN B HG2    1 
ATOM   6538  H  HG3    . GLN B 2 31  ? -0.476  47.694  0.176   1.00 209.00 ? 31   GLN B HG3    1 
ATOM   6539  H  HE21   . GLN B 2 31  ? -1.463  49.110  -2.008  1.00 241.75 ? 31   GLN B HE21   1 
ATOM   6540  H  HE22   . GLN B 2 31  ? -2.906  48.796  -2.198  1.00 241.75 ? 31   GLN B HE22   1 
ATOM   6541  N  N      . PRO B 2 32  ? -0.727  50.067  4.775   1.00 168.92 ? 32   PRO B N      1 
ATOM   6542  C  CA     . PRO B 2 32  ? -1.222  50.161  6.156   1.00 158.46 ? 32   PRO B CA     1 
ATOM   6543  C  C      . PRO B 2 32  ? -2.473  49.304  6.377   1.00 156.47 ? 32   PRO B C      1 
ATOM   6544  O  O      . PRO B 2 32  ? -3.382  49.370  5.552   1.00 163.31 ? 32   PRO B O      1 
ATOM   6545  C  CB     . PRO B 2 32  ? -1.538  51.650  6.316   1.00 151.26 ? 32   PRO B CB     1 
ATOM   6546  C  CG     . PRO B 2 32  ? -0.616  52.325  5.378   1.00 154.99 ? 32   PRO B CG     1 
ATOM   6547  C  CD     . PRO B 2 32  ? -0.486  51.403  4.198   1.00 164.86 ? 32   PRO B CD     1 
ATOM   6548  H  HA     . PRO B 2 32  ? -0.531  49.903  6.787   1.00 190.15 ? 32   PRO B HA     1 
ATOM   6549  H  HB2    . PRO B 2 32  ? -2.462  51.818  6.073   1.00 181.51 ? 32   PRO B HB2    1 
ATOM   6550  H  HB3    . PRO B 2 32  ? -1.364  51.927  7.229   1.00 181.51 ? 32   PRO B HB3    1 
ATOM   6551  H  HG2    . PRO B 2 32  ? -0.995  53.175  5.106   1.00 185.99 ? 32   PRO B HG2    1 
ATOM   6552  H  HG3    . PRO B 2 32  ? 0.245   52.455  5.806   1.00 185.99 ? 32   PRO B HG3    1 
ATOM   6553  H  HD2    . PRO B 2 32  ? -1.160  51.610  3.532   1.00 197.83 ? 32   PRO B HD2    1 
ATOM   6554  H  HD3    . PRO B 2 32  ? 0.409   51.455  3.827   1.00 197.83 ? 32   PRO B HD3    1 
ATOM   6555  N  N      . PRO B 2 33  ? -2.528  48.514  7.463   1.00 153.18 ? 33   PRO B N      1 
ATOM   6556  C  CA     . PRO B 2 33  ? -3.722  47.680  7.654   1.00 158.24 ? 33   PRO B CA     1 
ATOM   6557  C  C      . PRO B 2 33  ? -4.980  48.465  8.037   1.00 157.91 ? 33   PRO B C      1 
ATOM   6558  O  O      . PRO B 2 33  ? -4.984  49.181  9.039   1.00 157.18 ? 33   PRO B O      1 
ATOM   6559  C  CB     . PRO B 2 33  ? -3.317  46.738  8.800   1.00 148.46 ? 33   PRO B CB     1 
ATOM   6560  C  CG     . PRO B 2 33  ? -1.831  46.865  8.926   1.00 144.08 ? 33   PRO B CG     1 
ATOM   6561  C  CD     . PRO B 2 33  ? -1.504  48.247  8.485   1.00 148.47 ? 33   PRO B CD     1 
ATOM   6562  H  HA     . PRO B 2 33  ? -3.900  47.157  6.857   1.00 189.88 ? 33   PRO B HA     1 
ATOM   6563  H  HB2    . PRO B 2 33  ? -3.753  47.017  9.620   1.00 178.15 ? 33   PRO B HB2    1 
ATOM   6564  H  HB3    . PRO B 2 33  ? -3.563  45.827  8.575   1.00 178.15 ? 33   PRO B HB3    1 
ATOM   6565  H  HG2    . PRO B 2 33  ? -1.571  46.731  9.851   1.00 172.89 ? 33   PRO B HG2    1 
ATOM   6566  H  HG3    . PRO B 2 33  ? -1.399  46.213  8.352   1.00 172.89 ? 33   PRO B HG3    1 
ATOM   6567  H  HD2    . PRO B 2 33  ? -1.591  48.869  9.225   1.00 178.16 ? 33   PRO B HD2    1 
ATOM   6568  H  HD3    . PRO B 2 33  ? -0.617  48.278  8.094   1.00 178.16 ? 33   PRO B HD3    1 
ATOM   6569  N  N      . SER B 2 34  ? -6.031  48.322  7.231   1.00 155.27 ? 34   SER B N      1 
ATOM   6570  C  CA     . SER B 2 34  ? -7.324  48.956  7.491   1.00 154.99 ? 34   SER B CA     1 
ATOM   6571  C  C      . SER B 2 34  ? -8.232  48.005  8.268   1.00 153.45 ? 34   SER B C      1 
ATOM   6572  O  O      . SER B 2 34  ? -9.066  47.315  7.680   1.00 145.25 ? 34   SER B O      1 
ATOM   6573  C  CB     . SER B 2 34  ? -7.989  49.378  6.180   1.00 155.76 ? 34   SER B CB     1 
ATOM   6574  O  OG     . SER B 2 34  ? -8.320  48.252  5.385   1.00 160.90 ? 34   SER B OG     1 
ATOM   6575  H  H      . SER B 2 34  ? -6.020  47.851  6.512   1.00 186.33 ? 34   SER B H      1 
ATOM   6576  H  HA     . SER B 2 34  ? -7.186  49.751  8.030   1.00 185.99 ? 34   SER B HA     1 
ATOM   6577  H  HB2    . SER B 2 34  ? -8.801  49.869  6.383   1.00 186.92 ? 34   SER B HB2    1 
ATOM   6578  H  HB3    . SER B 2 34  ? -7.376  49.943  5.684   1.00 186.92 ? 34   SER B HB3    1 
ATOM   6579  H  HG     . SER B 2 34  ? -8.851  47.752  5.801   1.00 193.08 ? 34   SER B HG     1 
ATOM   6580  N  N      . GLU B 2 35  ? -8.066  47.973  9.587   1.00 154.27 ? 35   GLU B N      1 
ATOM   6581  C  CA     . GLU B 2 35  ? -8.844  47.078  10.443  1.00 144.28 ? 35   GLU B CA     1 
ATOM   6582  C  C      . GLU B 2 35  ? -9.040  47.592  11.864  1.00 135.23 ? 35   GLU B C      1 
ATOM   6583  O  O      . GLU B 2 35  ? -8.171  48.266  12.417  1.00 139.37 ? 35   GLU B O      1 
ATOM   6584  C  CB     . GLU B 2 35  ? -8.159  45.715  10.499  1.00 137.48 ? 35   GLU B CB     1 
ATOM   6585  C  CG     . GLU B 2 35  ? -8.871  44.691  11.362  1.00 139.99 ? 35   GLU B CG     1 
ATOM   6586  C  CD     . GLU B 2 35  ? -8.189  43.343  11.341  1.00 157.20 ? 35   GLU B CD     1 
ATOM   6587  O  OE1    . GLU B 2 35  ? -7.378  43.095  10.424  1.00 154.85 ? 35   GLU B OE1    1 
ATOM   6588  O  OE2    . GLU B 2 35  ? -8.453  42.539  12.258  1.00 164.88 ? 35   GLU B OE2    1 
ATOM   6589  H  H      . GLU B 2 35  ? -7.505  48.464  10.016  1.00 185.13 ? 35   GLU B H      1 
ATOM   6590  H  HA     . GLU B 2 35  ? -9.721  46.954  10.049  1.00 173.13 ? 35   GLU B HA     1 
ATOM   6591  H  HB2    . GLU B 2 35  ? -8.106  45.356  9.599   1.00 164.98 ? 35   GLU B HB2    1 
ATOM   6592  H  HB3    . GLU B 2 35  ? -7.265  45.831  10.857  1.00 164.98 ? 35   GLU B HB3    1 
ATOM   6593  H  HG2    . GLU B 2 35  ? -8.887  45.006  12.279  1.00 167.99 ? 35   GLU B HG2    1 
ATOM   6594  H  HG3    . GLU B 2 35  ? -9.776  44.575  11.034  1.00 167.99 ? 35   GLU B HG3    1 
ATOM   6595  N  N      . ASN B 2 36  ? -10.190 47.270  12.451  1.00 133.63 ? 36   ASN B N      1 
ATOM   6596  C  CA     . ASN B 2 36  ? -10.473 47.678  13.820  1.00 135.37 ? 36   ASN B CA     1 
ATOM   6597  C  C      . ASN B 2 36  ? -9.822  46.716  14.803  1.00 135.20 ? 36   ASN B C      1 
ATOM   6598  O  O      . ASN B 2 36  ? -9.946  45.497  14.675  1.00 133.57 ? 36   ASN B O      1 
ATOM   6599  C  CB     . ASN B 2 36  ? -11.980 47.739  14.080  1.00 123.25 ? 36   ASN B CB     1 
ATOM   6600  C  CG     . ASN B 2 36  ? -12.700 48.666  13.127  1.00 127.07 ? 36   ASN B CG     1 
ATOM   6601  O  OD1    . ASN B 2 36  ? -12.081 49.502  12.468  1.00 130.01 ? 36   ASN B OD1    1 
ATOM   6602  N  ND2    . ASN B 2 36  ? -14.019 48.531  13.055  1.00 122.08 ? 36   ASN B ND2    1 
ATOM   6603  H  H      . ASN B 2 36  ? -10.818 46.816  12.079  1.00 160.36 ? 36   ASN B H      1 
ATOM   6604  H  HA     . ASN B 2 36  ? -10.104 48.562  13.972  1.00 162.44 ? 36   ASN B HA     1 
ATOM   6605  H  HB2    . ASN B 2 36  ? -12.355 46.851  13.977  1.00 147.90 ? 36   ASN B HB2    1 
ATOM   6606  H  HB3    . ASN B 2 36  ? -12.132 48.060  14.983  1.00 147.90 ? 36   ASN B HB3    1 
ATOM   6607  H  HD21   . ASN B 2 36  ? -14.417 47.940  13.536  1.00 146.49 ? 36   ASN B HD21   1 
ATOM   6608  H  HD22   . ASN B 2 36  ? -14.475 49.034  12.527  1.00 146.49 ? 36   ASN B HD22   1 
ATOM   6609  N  N      . ILE B 2 37  ? -9.129  47.279  15.784  1.00 133.74 ? 37   ILE B N      1 
ATOM   6610  C  CA     . ILE B 2 37  ? -8.502  46.504  16.845  1.00 126.31 ? 37   ILE B CA     1 
ATOM   6611  C  C      . ILE B 2 37  ? -8.788  47.171  18.183  1.00 124.04 ? 37   ILE B C      1 
ATOM   6612  O  O      . ILE B 2 37  ? -8.904  48.393  18.261  1.00 122.44 ? 37   ILE B O      1 
ATOM   6613  C  CB     . ILE B 2 37  ? -6.986  46.366  16.623  1.00 128.75 ? 37   ILE B CB     1 
ATOM   6614  C  CG1    . ILE B 2 37  ? -6.374  47.740  16.330  1.00 142.48 ? 37   ILE B CG1    1 
ATOM   6615  C  CG2    . ILE B 2 37  ? -6.721  45.409  15.468  1.00 128.51 ? 37   ILE B CG2    1 
ATOM   6616  C  CD1    . ILE B 2 37  ? -4.871  47.734  16.136  1.00 149.85 ? 37   ILE B CD1    1 
ATOM   6617  H  H      . ILE B 2 37  ? -9.005  48.126  15.858  1.00 160.49 ? 37   ILE B H      1 
ATOM   6618  H  HA     . ILE B 2 37  ? -8.888  45.614  16.861  1.00 151.57 ? 37   ILE B HA     1 
ATOM   6619  H  HB     . ILE B 2 37  ? -6.582  46.006  17.428  1.00 154.50 ? 37   ILE B HB     1 
ATOM   6620  H  HG12   . ILE B 2 37  ? -6.774  48.090  15.518  1.00 170.97 ? 37   ILE B HG12   1 
ATOM   6621  H  HG13   . ILE B 2 37  ? -6.573  48.332  17.072  1.00 170.97 ? 37   ILE B HG13   1 
ATOM   6622  H  HG21   . ILE B 2 37  ? -7.137  45.761  14.665  1.00 154.21 ? 37   ILE B HG21   1 
ATOM   6623  H  HG22   . ILE B 2 37  ? -5.763  45.330  15.337  1.00 154.21 ? 37   ILE B HG22   1 
ATOM   6624  H  HG23   . ILE B 2 37  ? -7.099  44.541  15.683  1.00 154.21 ? 37   ILE B HG23   1 
ATOM   6625  H  HD11   . ILE B 2 37  ? -4.652  47.158  15.387  1.00 179.82 ? 37   ILE B HD11   1 
ATOM   6626  H  HD12   . ILE B 2 37  ? -4.573  48.640  15.957  1.00 179.82 ? 37   ILE B HD12   1 
ATOM   6627  H  HD13   . ILE B 2 37  ? -4.451  47.401  16.945  1.00 179.82 ? 37   ILE B HD13   1 
ATOM   6628  N  N      . SER B 2 38  ? -8.895  46.365  19.232  1.00 128.39 ? 38   SER B N      1 
ATOM   6629  C  CA     . SER B 2 38  ? -9.171  46.886  20.563  1.00 126.72 ? 38   SER B CA     1 
ATOM   6630  C  C      . SER B 2 38  ? -7.880  47.317  21.238  1.00 131.74 ? 38   SER B C      1 
ATOM   6631  O  O      . SER B 2 38  ? -6.799  46.843  20.890  1.00 128.80 ? 38   SER B O      1 
ATOM   6632  C  CB     . SER B 2 38  ? -9.888  45.839  21.413  1.00 127.20 ? 38   SER B CB     1 
ATOM   6633  O  OG     . SER B 2 38  ? -9.010  44.787  21.774  1.00 134.03 ? 38   SER B OG     1 
ATOM   6634  H  H      . SER B 2 38  ? -8.811  45.510  19.200  1.00 154.07 ? 38   SER B H      1 
ATOM   6635  H  HA     . SER B 2 38  ? -9.748  47.663  20.488  1.00 152.07 ? 38   SER B HA     1 
ATOM   6636  H  HB2    . SER B 2 38  ? -10.221 46.262  22.220  1.00 152.63 ? 38   SER B HB2    1 
ATOM   6637  H  HB3    . SER B 2 38  ? -10.627 45.471  20.903  1.00 152.63 ? 38   SER B HB3    1 
ATOM   6638  H  HG     . SER B 2 38  ? -9.417  44.220  22.241  1.00 160.84 ? 38   SER B HG     1 
ATOM   6639  N  N      . LEU B 2 39  ? -8.000  48.226  22.199  1.00 136.22 ? 39   LEU B N      1 
ATOM   6640  C  CA     . LEU B 2 39  ? -6.842  48.726  22.922  1.00 133.60 ? 39   LEU B CA     1 
ATOM   6641  C  C      . LEU B 2 39  ? -6.149  47.597  23.680  1.00 130.85 ? 39   LEU B C      1 
ATOM   6642  O  O      . LEU B 2 39  ? -4.947  47.664  23.934  1.00 131.43 ? 39   LEU B O      1 
ATOM   6643  C  CB     . LEU B 2 39  ? -7.244  49.843  23.886  1.00 130.40 ? 39   LEU B CB     1 
ATOM   6644  C  CG     . LEU B 2 39  ? -6.084  50.531  24.611  1.00 137.55 ? 39   LEU B CG     1 
ATOM   6645  C  CD1    . LEU B 2 39  ? -5.098  51.156  23.626  1.00 133.35 ? 39   LEU B CD1    1 
ATOM   6646  C  CD2    . LEU B 2 39  ? -6.612  51.579  25.575  1.00 146.44 ? 39   LEU B CD2    1 
ATOM   6647  H  H      . LEU B 2 39  ? -8.747  48.569  22.452  1.00 163.46 ? 39   LEU B H      1 
ATOM   6648  H  HA     . LEU B 2 39  ? -6.207  49.093  22.286  1.00 160.32 ? 39   LEU B HA     1 
ATOM   6649  H  HB2    . LEU B 2 39  ? -7.720  50.524  23.386  1.00 156.48 ? 39   LEU B HB2    1 
ATOM   6650  H  HB3    . LEU B 2 39  ? -7.829  49.468  24.563  1.00 156.48 ? 39   LEU B HB3    1 
ATOM   6651  H  HG     . LEU B 2 39  ? -5.603  49.867  25.130  1.00 165.05 ? 39   LEU B HG     1 
ATOM   6652  H  HD11   . LEU B 2 39  ? -5.565  51.816  23.090  1.00 160.03 ? 39   LEU B HD11   1 
ATOM   6653  H  HD12   . LEU B 2 39  ? -4.382  51.580  24.124  1.00 160.03 ? 39   LEU B HD12   1 
ATOM   6654  H  HD13   . LEU B 2 39  ? -4.738  50.460  23.055  1.00 160.03 ? 39   LEU B HD13   1 
ATOM   6655  H  HD21   . LEU B 2 39  ? -7.186  51.147  26.227  1.00 175.73 ? 39   LEU B HD21   1 
ATOM   6656  H  HD22   . LEU B 2 39  ? -5.862  52.001  26.023  1.00 175.73 ? 39   LEU B HD22   1 
ATOM   6657  H  HD23   . LEU B 2 39  ? -7.116  52.241  25.077  1.00 175.73 ? 39   LEU B HD23   1 
ATOM   6658  N  N      . ILE B 2 40  ? -6.907  46.565  24.044  1.00 126.38 ? 40   ILE B N      1 
ATOM   6659  C  CA     . ILE B 2 40  ? -6.332  45.406  24.718  1.00 130.42 ? 40   ILE B CA     1 
ATOM   6660  C  C      . ILE B 2 40  ? -5.557  44.566  23.707  1.00 130.64 ? 40   ILE B C      1 
ATOM   6661  O  O      . ILE B 2 40  ? -4.453  44.106  23.996  1.00 122.78 ? 40   ILE B O      1 
ATOM   6662  C  CB     . ILE B 2 40  ? -7.419  44.532  25.401  1.00 130.25 ? 40   ILE B CB     1 
ATOM   6663  C  CG1    . ILE B 2 40  ? -8.049  45.296  26.574  1.00 126.88 ? 40   ILE B CG1    1 
ATOM   6664  C  CG2    . ILE B 2 40  ? -6.823  43.199  25.879  1.00 118.14 ? 40   ILE B CG2    1 
ATOM   6665  C  CD1    . ILE B 2 40  ? -9.028  44.485  27.425  1.00 90.61  ? 40   ILE B CD1    1 
ATOM   6666  H  H      . ILE B 2 40  ? -7.755  46.512  23.913  1.00 151.65 ? 40   ILE B H      1 
ATOM   6667  H  HA     . ILE B 2 40  ? -5.712  45.708  25.400  1.00 156.51 ? 40   ILE B HA     1 
ATOM   6668  H  HB     . ILE B 2 40  ? -8.113  44.342  24.751  1.00 156.30 ? 40   ILE B HB     1 
ATOM   6669  H  HG12   . ILE B 2 40  ? -7.339  45.604  27.158  1.00 152.25 ? 40   ILE B HG12   1 
ATOM   6670  H  HG13   . ILE B 2 40  ? -8.532  46.059  26.220  1.00 152.25 ? 40   ILE B HG13   1 
ATOM   6671  H  HG21   . ILE B 2 40  ? -6.115  43.381  26.516  1.00 141.77 ? 40   ILE B HG21   1 
ATOM   6672  H  HG22   . ILE B 2 40  ? -7.522  42.675  26.301  1.00 141.77 ? 40   ILE B HG22   1 
ATOM   6673  H  HG23   . ILE B 2 40  ? -6.466  42.721  25.114  1.00 141.77 ? 40   ILE B HG23   1 
ATOM   6674  H  HD11   . ILE B 2 40  ? -8.560  43.724  27.804  1.00 108.74 ? 40   ILE B HD11   1 
ATOM   6675  H  HD12   . ILE B 2 40  ? -9.370  45.050  28.135  1.00 108.74 ? 40   ILE B HD12   1 
ATOM   6676  H  HD13   . ILE B 2 40  ? -9.757  44.180  26.863  1.00 108.74 ? 40   ILE B HD13   1 
ATOM   6677  N  N      . GLU B 2 41  ? -6.136  44.370  22.525  1.00 138.43 ? 41   GLU B N      1 
ATOM   6678  C  CA     . GLU B 2 41  ? -5.461  43.644  21.453  1.00 132.61 ? 41   GLU B CA     1 
ATOM   6679  C  C      . GLU B 2 41  ? -4.239  44.402  20.937  1.00 134.93 ? 41   GLU B C      1 
ATOM   6680  O  O      . GLU B 2 41  ? -3.206  43.800  20.653  1.00 127.30 ? 41   GLU B O      1 
ATOM   6681  C  CB     . GLU B 2 41  ? -6.421  43.372  20.292  1.00 130.76 ? 41   GLU B CB     1 
ATOM   6682  C  CG     . GLU B 2 41  ? -7.368  42.199  20.517  1.00 139.25 ? 41   GLU B CG     1 
ATOM   6683  C  CD     . GLU B 2 41  ? -8.133  41.812  19.262  1.00 149.39 ? 41   GLU B CD     1 
ATOM   6684  O  OE1    . GLU B 2 41  ? -7.878  42.409  18.194  1.00 139.46 ? 41   GLU B OE1    1 
ATOM   6685  O  OE2    . GLU B 2 41  ? -8.991  40.908  19.344  1.00 154.67 ? 41   GLU B OE2    1 
ATOM   6686  H  H      . GLU B 2 41  ? -6.923  44.648  22.318  1.00 166.12 ? 41   GLU B H      1 
ATOM   6687  H  HA     . GLU B 2 41  ? -5.158  42.788  21.796  1.00 159.13 ? 41   GLU B HA     1 
ATOM   6688  H  HB2    . GLU B 2 41  ? -6.962  44.163  20.145  1.00 156.91 ? 41   GLU B HB2    1 
ATOM   6689  H  HB3    . GLU B 2 41  ? -5.900  43.180  19.496  1.00 156.91 ? 41   GLU B HB3    1 
ATOM   6690  H  HG2    . GLU B 2 41  ? -6.854  41.428  20.805  1.00 167.10 ? 41   GLU B HG2    1 
ATOM   6691  H  HG3    . GLU B 2 41  ? -8.014  42.441  21.200  1.00 167.10 ? 41   GLU B HG3    1 
ATOM   6692  N  N      . PHE B 2 42  ? -4.371  45.722  20.825  1.00 136.29 ? 42   PHE B N      1 
ATOM   6693  C  CA     . PHE B 2 42  ? -3.285  46.589  20.367  1.00 124.48 ? 42   PHE B CA     1 
ATOM   6694  C  C      . PHE B 2 42  ? -1.979  46.352  21.124  1.00 125.07 ? 42   PHE B C      1 
ATOM   6695  O  O      . PHE B 2 42  ? -0.957  46.013  20.529  1.00 122.40 ? 42   PHE B O      1 
ATOM   6696  C  CB     . PHE B 2 42  ? -3.696  48.054  20.516  1.00 121.37 ? 42   PHE B CB     1 
ATOM   6697  C  CG     . PHE B 2 42  ? -2.673  49.025  20.004  1.00 122.32 ? 42   PHE B CG     1 
ATOM   6698  C  CD1    . PHE B 2 42  ? -2.606  49.328  18.656  1.00 120.21 ? 42   PHE B CD1    1 
ATOM   6699  C  CD2    . PHE B 2 42  ? -1.768  49.620  20.865  1.00 112.30 ? 42   PHE B CD2    1 
ATOM   6700  C  CE1    . PHE B 2 42  ? -1.666  50.219  18.178  1.00 115.77 ? 42   PHE B CE1    1 
ATOM   6701  C  CE2    . PHE B 2 42  ? -0.823  50.511  20.391  1.00 112.71 ? 42   PHE B CE2    1 
ATOM   6702  C  CZ     . PHE B 2 42  ? -0.773  50.811  19.046  1.00 110.14 ? 42   PHE B CZ     1 
ATOM   6703  H  H      . PHE B 2 42  ? -5.094  46.148  21.012  1.00 163.54 ? 42   PHE B H      1 
ATOM   6704  H  HA     . PHE B 2 42  ? -3.121  46.418  19.426  1.00 149.38 ? 42   PHE B HA     1 
ATOM   6705  H  HB2    . PHE B 2 42  ? -4.517  48.200  20.022  1.00 145.65 ? 42   PHE B HB2    1 
ATOM   6706  H  HB3    . PHE B 2 42  ? -3.839  48.244  21.457  1.00 145.65 ? 42   PHE B HB3    1 
ATOM   6707  H  HD1    . PHE B 2 42  ? -3.208  48.935  18.066  1.00 144.25 ? 42   PHE B HD1    1 
ATOM   6708  H  HD2    . PHE B 2 42  ? -1.799  49.423  21.773  1.00 134.76 ? 42   PHE B HD2    1 
ATOM   6709  H  HE1    . PHE B 2 42  ? -1.634  50.418  17.270  1.00 138.93 ? 42   PHE B HE1    1 
ATOM   6710  H  HE2    . PHE B 2 42  ? -0.222  50.908  20.980  1.00 135.25 ? 42   PHE B HE2    1 
ATOM   6711  H  HZ     . PHE B 2 42  ? -0.137  51.409  18.725  1.00 132.17 ? 42   PHE B HZ     1 
ATOM   6712  N  N      . GLU B 2 43  ? -2.026  46.539  22.439  1.00 130.64 ? 43   GLU B N      1 
ATOM   6713  C  CA     . GLU B 2 43  ? -0.850  46.377  23.289  1.00 133.86 ? 43   GLU B CA     1 
ATOM   6714  C  C      . GLU B 2 43  ? -0.424  44.912  23.361  1.00 133.77 ? 43   GLU B C      1 
ATOM   6715  O  O      . GLU B 2 43  ? 0.768   44.608  23.419  1.00 127.17 ? 43   GLU B O      1 
ATOM   6716  C  CB     . GLU B 2 43  ? -1.123  46.932  24.692  1.00 132.91 ? 43   GLU B CB     1 
ATOM   6717  C  CG     . GLU B 2 43  ? -2.316  46.306  25.406  1.00 140.94 ? 43   GLU B CG     1 
ATOM   6718  C  CD     . GLU B 2 43  ? -2.768  47.104  26.619  1.00 138.93 ? 43   GLU B CD     1 
ATOM   6719  O  OE1    . GLU B 2 43  ? -2.370  48.280  26.751  1.00 139.28 ? 43   GLU B OE1    1 
ATOM   6720  O  OE2    . GLU B 2 43  ? -3.530  46.552  27.442  1.00 132.50 ? 43   GLU B OE2    1 
ATOM   6721  H  H      . GLU B 2 43  ? -2.736  46.764  22.869  1.00 156.77 ? 43   GLU B H      1 
ATOM   6722  H  HA     . GLU B 2 43  ? -0.115  46.882  22.907  1.00 160.63 ? 43   GLU B HA     1 
ATOM   6723  H  HB2    . GLU B 2 43  ? -0.339  46.780  25.242  1.00 159.50 ? 43   GLU B HB2    1 
ATOM   6724  H  HB3    . GLU B 2 43  ? -1.291  47.885  24.620  1.00 159.50 ? 43   GLU B HB3    1 
ATOM   6725  H  HG2    . GLU B 2 43  ? -3.062  46.254  24.788  1.00 169.13 ? 43   GLU B HG2    1 
ATOM   6726  H  HG3    . GLU B 2 43  ? -2.073  45.416  25.707  1.00 169.13 ? 43   GLU B HG3    1 
ATOM   6727  N  N      . ASN B 2 44  ? -1.402  44.008  23.365  1.00 132.16 ? 44   ASN B N      1 
ATOM   6728  C  CA     . ASN B 2 44  ? -1.117  42.577  23.357  1.00 124.56 ? 44   ASN B CA     1 
ATOM   6729  C  C      . ASN B 2 44  ? -0.362  42.162  22.098  1.00 128.77 ? 44   ASN B C      1 
ATOM   6730  O  O      . ASN B 2 44  ? 0.659   41.479  22.179  1.00 128.95 ? 44   ASN B O      1 
ATOM   6731  C  CB     . ASN B 2 44  ? -2.416  41.776  23.465  1.00 127.32 ? 44   ASN B CB     1 
ATOM   6732  C  CG     . ASN B 2 44  ? -2.889  41.615  24.898  1.00 122.80 ? 44   ASN B CG     1 
ATOM   6733  O  OD1    . ASN B 2 44  ? -2.430  42.315  25.800  1.00 136.91 ? 44   ASN B OD1    1 
ATOM   6734  N  ND2    . ASN B 2 44  ? -3.821  40.692  25.111  1.00 105.90 ? 44   ASN B ND2    1 
ATOM   6735  H  H      . ASN B 2 44  ? -2.240  44.199  23.372  1.00 158.59 ? 44   ASN B H      1 
ATOM   6736  H  HA     . ASN B 2 44  ? -0.564  42.360  24.125  1.00 149.48 ? 44   ASN B HA     1 
ATOM   6737  H  HB2    . ASN B 2 44  ? -3.112  42.234  22.969  1.00 152.79 ? 44   ASN B HB2    1 
ATOM   6738  H  HB3    . ASN B 2 44  ? -2.273  40.890  23.095  1.00 152.79 ? 44   ASN B HB3    1 
ATOM   6739  H  HD21   . ASN B 2 44  ? -4.122  40.226  24.454  1.00 127.08 ? 44   ASN B HD21   1 
ATOM   6740  H  HD22   . ASN B 2 44  ? -4.123  40.562  25.906  1.00 127.08 ? 44   ASN B HD22   1 
ATOM   6741  N  N      . LEU B 2 45  ? -0.868  42.574  20.937  1.00 130.09 ? 45   LEU B N      1 
ATOM   6742  C  CA     . LEU B 2 45  ? -0.227  42.258  19.661  1.00 126.66 ? 45   LEU B CA     1 
ATOM   6743  C  C      . LEU B 2 45  ? 1.171   42.848  19.610  1.00 125.67 ? 45   LEU B C      1 
ATOM   6744  O  O      . LEU B 2 45  ? 2.107   42.229  19.102  1.00 121.04 ? 45   LEU B O      1 
ATOM   6745  C  CB     . LEU B 2 45  ? -1.055  42.787  18.481  1.00 131.85 ? 45   LEU B CB     1 
ATOM   6746  C  CG     . LEU B 2 45  ? -1.202  41.959  17.195  1.00 133.09 ? 45   LEU B CG     1 
ATOM   6747  C  CD1    . LEU B 2 45  ? -1.230  40.449  17.427  1.00 138.97 ? 45   LEU B CD1    1 
ATOM   6748  C  CD2    . LEU B 2 45  ? -2.443  42.398  16.425  1.00 124.60 ? 45   LEU B CD2    1 
ATOM   6749  H  H      . LEU B 2 45  ? -1.586  43.041  20.861  1.00 156.11 ? 45   LEU B H      1 
ATOM   6750  H  HA     . LEU B 2 45  ? -0.153  41.295  19.571  1.00 152.00 ? 45   LEU B HA     1 
ATOM   6751  H  HB2    . LEU B 2 45  ? -1.955  42.945  18.807  1.00 158.22 ? 45   LEU B HB2    1 
ATOM   6752  H  HB3    . LEU B 2 45  ? -0.669  43.636  18.215  1.00 158.22 ? 45   LEU B HB3    1 
ATOM   6753  H  HG     . LEU B 2 45  ? -0.437  42.145  16.630  1.00 159.70 ? 45   LEU B HG     1 
ATOM   6754  H  HD11   . LEU B 2 45  ? -1.981  40.231  18.000  1.00 166.76 ? 45   LEU B HD11   1 
ATOM   6755  H  HD12   . LEU B 2 45  ? -1.324  40.001  16.572  1.00 166.76 ? 45   LEU B HD12   1 
ATOM   6756  H  HD13   . LEU B 2 45  ? -0.400  40.180  17.852  1.00 166.76 ? 45   LEU B HD13   1 
ATOM   6757  H  HD21   . LEU B 2 45  ? -2.356  43.336  16.195  1.00 149.52 ? 45   LEU B HD21   1 
ATOM   6758  H  HD22   . LEU B 2 45  ? -2.519  41.864  15.619  1.00 149.52 ? 45   LEU B HD22   1 
ATOM   6759  H  HD23   . LEU B 2 45  ? -3.225  42.265  16.985  1.00 149.52 ? 45   LEU B HD23   1 
ATOM   6760  N  N      . ALA B 2 46  ? 1.298   44.059  20.138  1.00 127.42 ? 46   ALA B N      1 
ATOM   6761  C  CA     . ALA B 2 46  ? 2.576   44.746  20.185  1.00 118.21 ? 46   ALA B CA     1 
ATOM   6762  C  C      . ALA B 2 46  ? 3.580   44.023  21.078  1.00 121.86 ? 46   ALA B C      1 
ATOM   6763  O  O      . ALA B 2 46  ? 4.680   43.704  20.636  1.00 124.82 ? 46   ALA B O      1 
ATOM   6764  C  CB     . ALA B 2 46  ? 2.380   46.165  20.662  1.00 111.19 ? 46   ALA B CB     1 
ATOM   6765  H  H      . ALA B 2 46  ? 0.649   44.507  20.480  1.00 152.91 ? 46   ALA B H      1 
ATOM   6766  H  HA     . ALA B 2 46  ? 2.946   44.782  19.289  1.00 141.85 ? 46   ALA B HA     1 
ATOM   6767  H  HB1    . ALA B 2 46  ? 1.988   46.148  21.549  1.00 133.43 ? 46   ALA B HB1    1 
ATOM   6768  H  HB2    . ALA B 2 46  ? 3.241   46.611  20.688  1.00 133.43 ? 46   ALA B HB2    1 
ATOM   6769  H  HB3    . ALA B 2 46  ? 1.787   46.625  20.047  1.00 133.43 ? 46   ALA B HB3    1 
ATOM   6770  N  N      . ILE B 2 47  ? 3.195   43.752  22.323  1.00 124.71 ? 47   ILE B N      1 
ATOM   6771  C  CA     . ILE B 2 47  ? 4.070   43.057  23.270  1.00 133.53 ? 47   ILE B CA     1 
ATOM   6772  C  C      . ILE B 2 47  ? 4.548   41.715  22.708  1.00 124.58 ? 47   ILE B C      1 
ATOM   6773  O  O      . ILE B 2 47  ? 5.721   41.362  22.848  1.00 111.25 ? 47   ILE B O      1 
ATOM   6774  C  CB     . ILE B 2 47  ? 3.360   42.836  24.631  1.00 137.92 ? 47   ILE B CB     1 
ATOM   6775  C  CG1    . ILE B 2 47  ? 3.269   44.160  25.398  1.00 133.67 ? 47   ILE B CG1    1 
ATOM   6776  C  CG2    . ILE B 2 47  ? 4.094   41.794  25.484  1.00 135.47 ? 47   ILE B CG2    1 
ATOM   6777  C  CD1    . ILE B 2 47  ? 2.393   44.107  26.639  1.00 130.81 ? 47   ILE B CD1    1 
ATOM   6778  H  H      . ILE B 2 47  ? 2.426   43.960  22.647  1.00 149.65 ? 47   ILE B H      1 
ATOM   6779  H  HA     . ILE B 2 47  ? 4.854   43.607  23.430  1.00 160.24 ? 47   ILE B HA     1 
ATOM   6780  H  HB     . ILE B 2 47  ? 2.460   42.517  24.461  1.00 165.50 ? 47   ILE B HB     1 
ATOM   6781  H  HG12   . ILE B 2 47  ? 4.161   44.418  25.678  1.00 160.41 ? 47   ILE B HG12   1 
ATOM   6782  H  HG13   . ILE B 2 47  ? 2.903   44.837  24.807  1.00 160.41 ? 47   ILE B HG13   1 
ATOM   6783  H  HG21   . ILE B 2 47  ? 4.998   42.104  25.651  1.00 162.56 ? 47   ILE B HG21   1 
ATOM   6784  H  HG22   . ILE B 2 47  ? 3.621   41.685  26.324  1.00 162.56 ? 47   ILE B HG22   1 
ATOM   6785  H  HG23   . ILE B 2 47  ? 4.115   40.952  25.003  1.00 162.56 ? 47   ILE B HG23   1 
ATOM   6786  H  HD11   . ILE B 2 47  ? 2.752   43.445  27.250  1.00 156.97 ? 47   ILE B HD11   1 
ATOM   6787  H  HD12   . ILE B 2 47  ? 2.392   44.981  27.061  1.00 156.97 ? 47   ILE B HD12   1 
ATOM   6788  H  HD13   . ILE B 2 47  ? 1.491   43.864  26.378  1.00 156.97 ? 47   ILE B HD13   1 
ATOM   6789  N  N      . ASP B 2 48  ? 3.641   40.969  22.081  1.00 131.88 ? 48   ASP B N      1 
ATOM   6790  C  CA     . ASP B 2 48  ? 3.982   39.673  21.494  1.00 143.46 ? 48   ASP B CA     1 
ATOM   6791  C  C      . ASP B 2 48  ? 5.122   39.785  20.488  1.00 143.81 ? 48   ASP B C      1 
ATOM   6792  O  O      . ASP B 2 48  ? 6.106   39.053  20.574  1.00 145.69 ? 48   ASP B O      1 
ATOM   6793  C  CB     . ASP B 2 48  ? 2.763   39.041  20.811  1.00 147.52 ? 48   ASP B CB     1 
ATOM   6794  C  CG     . ASP B 2 48  ? 1.818   38.370  21.792  1.00 142.75 ? 48   ASP B CG     1 
ATOM   6795  O  OD1    . ASP B 2 48  ? 2.296   37.804  22.799  1.00 125.86 ? 48   ASP B OD1    1 
ATOM   6796  O  OD2    . ASP B 2 48  ? 0.592   38.399  21.550  1.00 129.82 ? 48   ASP B OD2    1 
ATOM   6797  H  H      . ASP B 2 48  ? 2.816   41.192  21.981  1.00 158.25 ? 48   ASP B H      1 
ATOM   6798  H  HA     . ASP B 2 48  ? 4.269   39.075  22.202  1.00 172.15 ? 48   ASP B HA     1 
ATOM   6799  H  HB2    . ASP B 2 48  ? 2.269   39.733  20.344  1.00 177.02 ? 48   ASP B HB2    1 
ATOM   6800  H  HB3    . ASP B 2 48  ? 3.067   38.369  20.181  1.00 177.02 ? 48   ASP B HB3    1 
ATOM   6801  N  N      . ARG B 2 49  ? 4.982   40.686  19.522  1.00 135.40 ? 49   ARG B N      1 
ATOM   6802  C  CA     . ARG B 2 49  ? 5.980   40.814  18.468  1.00 124.47 ? 49   ARG B CA     1 
ATOM   6803  C  C      . ARG B 2 49  ? 7.324   41.271  19.038  1.00 125.34 ? 49   ARG B C      1 
ATOM   6804  O  O      . ARG B 2 49  ? 8.372   40.858  18.548  1.00 126.00 ? 49   ARG B O      1 
ATOM   6805  C  CB     . ARG B 2 49  ? 5.507   41.778  17.382  1.00 129.34 ? 49   ARG B CB     1 
ATOM   6806  C  CG     . ARG B 2 49  ? 6.326   41.680  16.102  1.00 130.50 ? 49   ARG B CG     1 
ATOM   6807  C  CD     . ARG B 2 49  ? 5.766   42.555  14.995  1.00 119.13 ? 49   ARG B CD     1 
ATOM   6808  N  NE     . ARG B 2 49  ? 6.285   42.168  13.685  1.00 125.71 ? 49   ARG B NE     1 
ATOM   6809  C  CZ     . ARG B 2 49  ? 5.728   41.249  12.897  1.00 132.16 ? 49   ARG B CZ     1 
ATOM   6810  N  NH1    . ARG B 2 49  ? 4.634   40.603  13.282  1.00 129.37 ? 49   ARG B NH1    1 
ATOM   6811  N  NH2    . ARG B 2 49  ? 6.270   40.963  11.721  1.00 130.68 ? 49   ARG B NH2    1 
ATOM   6812  H  H      . ARG B 2 49  ? 4.321   41.232  19.453  1.00 162.48 ? 49   ARG B H      1 
ATOM   6813  H  HA     . ARG B 2 49  ? 6.113   39.945  18.057  1.00 149.36 ? 49   ARG B HA     1 
ATOM   6814  H  HB2    . ARG B 2 49  ? 4.584   41.578  17.162  1.00 155.21 ? 49   ARG B HB2    1 
ATOM   6815  H  HB3    . ARG B 2 49  ? 5.579   42.687  17.714  1.00 155.21 ? 49   ARG B HB3    1 
ATOM   6816  H  HG2    . ARG B 2 49  ? 7.235   41.967  16.283  1.00 156.60 ? 49   ARG B HG2    1 
ATOM   6817  H  HG3    . ARG B 2 49  ? 6.322   40.761  15.792  1.00 156.60 ? 49   ARG B HG3    1 
ATOM   6818  H  HD2    . ARG B 2 49  ? 4.800   42.467  14.976  1.00 142.96 ? 49   ARG B HD2    1 
ATOM   6819  H  HD3    . ARG B 2 49  ? 6.016   43.477  15.160  1.00 142.96 ? 49   ARG B HD3    1 
ATOM   6820  H  HE     . ARG B 2 49  ? 6.997   42.560  13.404  1.00 150.85 ? 49   ARG B HE     1 
ATOM   6821  H  HH11   . ARG B 2 49  ? 4.275   40.780  14.043  1.00 155.25 ? 49   ARG B HH11   1 
ATOM   6822  H  HH12   . ARG B 2 49  ? 4.282   40.010  12.768  1.00 155.25 ? 49   ARG B HH12   1 
ATOM   6823  H  HH21   . ARG B 2 49  ? 6.980   41.375  11.463  1.00 156.81 ? 49   ARG B HH21   1 
ATOM   6824  H  HH22   . ARG B 2 49  ? 5.910   40.368  11.215  1.00 156.81 ? 49   ARG B HH22   1 
ATOM   6825  N  N      . VAL B 2 50  ? 7.295   42.127  20.058  1.00 122.22 ? 50   VAL B N      1 
ATOM   6826  C  CA     . VAL B 2 50  ? 8.530   42.568  20.704  1.00 119.67 ? 50   VAL B CA     1 
ATOM   6827  C  C      . VAL B 2 50  ? 9.298   41.368  21.250  1.00 123.96 ? 50   VAL B C      1 
ATOM   6828  O  O      . VAL B 2 50  ? 10.520  41.307  21.141  1.00 125.70 ? 50   VAL B O      1 
ATOM   6829  C  CB     . VAL B 2 50  ? 8.265   43.574  21.850  1.00 112.08 ? 50   VAL B CB     1 
ATOM   6830  C  CG1    . VAL B 2 50  ? 9.554   43.902  22.601  1.00 120.88 ? 50   VAL B CG1    1 
ATOM   6831  C  CG2    . VAL B 2 50  ? 7.653   44.852  21.308  1.00 108.99 ? 50   VAL B CG2    1 
ATOM   6832  H  H      . VAL B 2 50  ? 6.579   42.465  20.394  1.00 146.67 ? 50   VAL B H      1 
ATOM   6833  H  HA     . VAL B 2 50  ? 9.090   43.007  20.045  1.00 143.60 ? 50   VAL B HA     1 
ATOM   6834  H  HB     . VAL B 2 50  ? 7.640   43.182  22.480  1.00 134.50 ? 50   VAL B HB     1 
ATOM   6835  H  HG11   . VAL B 2 50  ? 10.190  44.292  21.980  1.00 145.05 ? 50   VAL B HG11   1 
ATOM   6836  H  HG12   . VAL B 2 50  ? 9.355   44.532  23.310  1.00 145.05 ? 50   VAL B HG12   1 
ATOM   6837  H  HG13   . VAL B 2 50  ? 9.917   43.084  22.977  1.00 145.05 ? 50   VAL B HG13   1 
ATOM   6838  H  HG21   . VAL B 2 50  ? 6.814   44.639  20.871  1.00 130.79 ? 50   VAL B HG21   1 
ATOM   6839  H  HG22   . VAL B 2 50  ? 7.498   45.464  22.044  1.00 130.79 ? 50   VAL B HG22   1 
ATOM   6840  H  HG23   . VAL B 2 50  ? 8.267   45.250  20.670  1.00 130.79 ? 50   VAL B HG23   1 
ATOM   6841  N  N      . LYS B 2 51  ? 8.580   40.416  21.837  1.00 119.35 ? 51   LYS B N      1 
ATOM   6842  C  CA     . LYS B 2 51  ? 9.188   39.160  22.262  1.00 124.53 ? 51   LYS B CA     1 
ATOM   6843  C  C      . LYS B 2 51  ? 9.796   38.442  21.061  1.00 135.36 ? 51   LYS B C      1 
ATOM   6844  O  O      . LYS B 2 51  ? 10.949  38.014  21.105  1.00 132.51 ? 51   LYS B O      1 
ATOM   6845  C  CB     . LYS B 2 51  ? 8.164   38.267  22.966  1.00 122.42 ? 51   LYS B CB     1 
ATOM   6846  C  CG     . LYS B 2 51  ? 7.892   38.678  24.403  1.00 131.26 ? 51   LYS B CG     1 
ATOM   6847  C  CD     . LYS B 2 51  ? 6.974   37.695  25.106  1.00 131.97 ? 51   LYS B CD     1 
ATOM   6848  C  CE     . LYS B 2 51  ? 6.508   38.243  26.444  1.00 114.58 ? 51   LYS B CE     1 
ATOM   6849  N  NZ     . LYS B 2 51  ? 5.525   37.339  27.100  1.00 131.02 ? 51   LYS B NZ     1 
ATOM   6850  H  H      . LYS B 2 51  ? 7.737   40.473  22.000  1.00 143.22 ? 51   LYS B H      1 
ATOM   6851  H  HA     . LYS B 2 51  ? 9.902   39.351  22.891  1.00 149.44 ? 51   LYS B HA     1 
ATOM   6852  H  HB2    . LYS B 2 51  ? 7.326   38.309  22.480  1.00 146.90 ? 51   LYS B HB2    1 
ATOM   6853  H  HB3    . LYS B 2 51  ? 8.496   37.356  22.975  1.00 146.90 ? 51   LYS B HB3    1 
ATOM   6854  H  HG2    . LYS B 2 51  ? 8.730   38.711  24.889  1.00 157.52 ? 51   LYS B HG2    1 
ATOM   6855  H  HG3    . LYS B 2 51  ? 7.465   39.549  24.410  1.00 157.52 ? 51   LYS B HG3    1 
ATOM   6856  H  HD2    . LYS B 2 51  ? 6.193   37.533  24.553  1.00 158.37 ? 51   LYS B HD2    1 
ATOM   6857  H  HD3    . LYS B 2 51  ? 7.452   36.866  25.265  1.00 158.37 ? 51   LYS B HD3    1 
ATOM   6858  H  HE2    . LYS B 2 51  ? 7.272   38.338  27.033  1.00 137.50 ? 51   LYS B HE2    1 
ATOM   6859  H  HE3    . LYS B 2 51  ? 6.082   39.104  26.306  1.00 137.50 ? 51   LYS B HE3    1 
ATOM   6860  H  HZ1    . LYS B 2 51  ? 5.893   36.542  27.242  1.00 157.22 ? 51   LYS B HZ1    1 
ATOM   6861  H  HZ2    . LYS B 2 51  ? 5.269   37.684  27.880  1.00 157.22 ? 51   LYS B HZ2    1 
ATOM   6862  H  HZ3    . LYS B 2 51  ? 4.810   37.239  26.579  1.00 157.22 ? 51   LYS B HZ3    1 
ATOM   6863  N  N      . LEU B 2 52  ? 9.008   38.309  19.995  1.00 144.48 ? 52   LEU B N      1 
ATOM   6864  C  CA     . LEU B 2 52  ? 9.447   37.627  18.778  1.00 137.34 ? 52   LEU B CA     1 
ATOM   6865  C  C      . LEU B 2 52  ? 10.735  38.209  18.201  1.00 132.88 ? 52   LEU B C      1 
ATOM   6866  O  O      . LEU B 2 52  ? 11.659  37.469  17.883  1.00 134.23 ? 52   LEU B O      1 
ATOM   6867  C  CB     . LEU B 2 52  ? 8.346   37.679  17.713  1.00 128.11 ? 52   LEU B CB     1 
ATOM   6868  C  CG     . LEU B 2 52  ? 8.721   37.128  16.332  1.00 136.86 ? 52   LEU B CG     1 
ATOM   6869  C  CD1    . LEU B 2 52  ? 9.190   35.683  16.419  1.00 132.93 ? 52   LEU B CD1    1 
ATOM   6870  C  CD2    . LEU B 2 52  ? 7.554   37.258  15.367  1.00 139.54 ? 52   LEU B CD2    1 
ATOM   6871  H  H      . LEU B 2 52  ? 8.203   38.610  19.951  1.00 173.38 ? 52   LEU B H      1 
ATOM   6872  H  HA     . LEU B 2 52  ? 9.612   36.694  18.987  1.00 164.80 ? 52   LEU B HA     1 
ATOM   6873  H  HB2    . LEU B 2 52  ? 7.588   37.166  18.033  1.00 153.73 ? 52   LEU B HB2    1 
ATOM   6874  H  HB3    . LEU B 2 52  ? 8.082   38.605  17.593  1.00 153.73 ? 52   LEU B HB3    1 
ATOM   6875  H  HG     . LEU B 2 52  ? 9.455   37.654  15.978  1.00 164.23 ? 52   LEU B HG     1 
ATOM   6876  H  HD11   . LEU B 2 52  ? 8.474   35.141  16.787  1.00 159.51 ? 52   LEU B HD11   1 
ATOM   6877  H  HD12   . LEU B 2 52  ? 9.417   35.371  15.529  1.00 159.51 ? 52   LEU B HD12   1 
ATOM   6878  H  HD13   . LEU B 2 52  ? 9.969   35.637  16.995  1.00 159.51 ? 52   LEU B HD13   1 
ATOM   6879  H  HD21   . LEU B 2 52  ? 7.318   38.195  15.282  1.00 167.45 ? 52   LEU B HD21   1 
ATOM   6880  H  HD22   . LEU B 2 52  ? 7.817   36.903  14.504  1.00 167.45 ? 52   LEU B HD22   1 
ATOM   6881  H  HD23   . LEU B 2 52  ? 6.800   36.757  15.716  1.00 167.45 ? 52   LEU B HD23   1 
ATOM   6882  N  N      . LEU B 2 53  ? 10.800  39.529  18.070  1.00 131.97 ? 53   LEU B N      1 
ATOM   6883  C  CA     . LEU B 2 53  ? 11.988  40.171  17.516  1.00 130.48 ? 53   LEU B CA     1 
ATOM   6884  C  C      . LEU B 2 53  ? 13.177  39.966  18.445  1.00 128.10 ? 53   LEU B C      1 
ATOM   6885  O  O      . LEU B 2 53  ? 14.301  39.751  17.989  1.00 129.93 ? 53   LEU B O      1 
ATOM   6886  C  CB     . LEU B 2 53  ? 11.748  41.664  17.271  1.00 128.13 ? 53   LEU B CB     1 
ATOM   6887  C  CG     . LEU B 2 53  ? 10.630  42.041  16.291  1.00 124.24 ? 53   LEU B CG     1 
ATOM   6888  C  CD1    . LEU B 2 53  ? 10.754  43.504  15.894  1.00 116.83 ? 53   LEU B CD1    1 
ATOM   6889  C  CD2    . LEU B 2 53  ? 10.634  41.158  15.047  1.00 118.42 ? 53   LEU B CD2    1 
ATOM   6890  H  H      . LEU B 2 53  ? 10.173  40.074  18.292  1.00 158.37 ? 53   LEU B H      1 
ATOM   6891  H  HA     . LEU B 2 53  ? 12.200  39.759  16.664  1.00 156.58 ? 53   LEU B HA     1 
ATOM   6892  H  HB2    . LEU B 2 53  ? 11.532  42.077  18.122  1.00 153.76 ? 53   LEU B HB2    1 
ATOM   6893  H  HB3    . LEU B 2 53  ? 12.570  42.048  16.929  1.00 153.76 ? 53   LEU B HB3    1 
ATOM   6894  H  HG     . LEU B 2 53  ? 9.775   41.926  16.733  1.00 149.08 ? 53   LEU B HG     1 
ATOM   6895  H  HD11   . LEU B 2 53  ? 11.616  43.644  15.471  1.00 140.20 ? 53   LEU B HD11   1 
ATOM   6896  H  HD12   . LEU B 2 53  ? 10.041  43.725  15.275  1.00 140.20 ? 53   LEU B HD12   1 
ATOM   6897  H  HD13   . LEU B 2 53  ? 10.684  44.054  16.691  1.00 140.20 ? 53   LEU B HD13   1 
ATOM   6898  H  HD21   . LEU B 2 53  ? 10.506  40.234  15.315  1.00 142.10 ? 53   LEU B HD21   1 
ATOM   6899  H  HD22   . LEU B 2 53  ? 9.912   41.435  14.461  1.00 142.10 ? 53   LEU B HD22   1 
ATOM   6900  H  HD23   . LEU B 2 53  ? 11.485  41.256  14.593  1.00 142.10 ? 53   LEU B HD23   1 
ATOM   6901  N  N      . LYS B 2 54  ? 12.926  40.031  19.748  1.00 132.08 ? 54   LYS B N      1 
ATOM   6902  C  CA     . LYS B 2 54  ? 13.973  39.792  20.731  1.00 132.94 ? 54   LYS B CA     1 
ATOM   6903  C  C      . LYS B 2 54  ? 14.396  38.325  20.723  1.00 135.32 ? 54   LYS B C      1 
ATOM   6904  O  O      . LYS B 2 54  ? 15.512  37.998  21.126  1.00 140.07 ? 54   LYS B O      1 
ATOM   6905  C  CB     . LYS B 2 54  ? 13.494  40.209  22.123  1.00 128.16 ? 54   LYS B CB     1 
ATOM   6906  C  CG     . LYS B 2 54  ? 13.435  41.718  22.309  1.00 124.50 ? 54   LYS B CG     1 
ATOM   6907  C  CD     . LYS B 2 54  ? 13.181  42.107  23.755  1.00 122.97 ? 54   LYS B CD     1 
ATOM   6908  C  CE     . LYS B 2 54  ? 13.166  43.619  23.926  1.00 119.43 ? 54   LYS B CE     1 
ATOM   6909  N  NZ     . LYS B 2 54  ? 14.397  44.271  23.396  1.00 118.09 ? 54   LYS B NZ     1 
ATOM   6910  H  H      . LYS B 2 54  ? 12.157  40.213  20.087  1.00 158.49 ? 54   LYS B H      1 
ATOM   6911  H  HA     . LYS B 2 54  ? 14.748  40.330  20.506  1.00 159.53 ? 54   LYS B HA     1 
ATOM   6912  H  HB2    . LYS B 2 54  ? 12.603  39.855  22.268  1.00 153.79 ? 54   LYS B HB2    1 
ATOM   6913  H  HB3    . LYS B 2 54  ? 14.104  39.850  22.786  1.00 153.79 ? 54   LYS B HB3    1 
ATOM   6914  H  HG2    . LYS B 2 54  ? 14.282  42.105  22.037  1.00 149.40 ? 54   LYS B HG2    1 
ATOM   6915  H  HG3    . LYS B 2 54  ? 12.715  42.078  21.769  1.00 149.40 ? 54   LYS B HG3    1 
ATOM   6916  H  HD2    . LYS B 2 54  ? 12.319  41.760  24.034  1.00 147.56 ? 54   LYS B HD2    1 
ATOM   6917  H  HD3    . LYS B 2 54  ? 13.886  41.745  24.314  1.00 147.56 ? 54   LYS B HD3    1 
ATOM   6918  H  HE2    . LYS B 2 54  ? 12.404  43.983  23.449  1.00 143.31 ? 54   LYS B HE2    1 
ATOM   6919  H  HE3    . LYS B 2 54  ? 13.097  43.829  24.871  1.00 143.31 ? 54   LYS B HE3    1 
ATOM   6920  H  HZ1    . LYS B 2 54  ? 14.481  44.100  22.527  1.00 141.71 ? 54   LYS B HZ1    1 
ATOM   6921  H  HZ2    . LYS B 2 54  ? 14.349  45.152  23.515  1.00 141.71 ? 54   LYS B HZ2    1 
ATOM   6922  H  HZ3    . LYS B 2 54  ? 15.113  43.960  23.823  1.00 141.71 ? 54   LYS B HZ3    1 
ATOM   6923  N  N      . SER B 2 55  ? 13.507  37.442  20.272  1.00 137.38 ? 55   SER B N      1 
ATOM   6924  C  CA     . SER B 2 55  ? 13.861  36.036  20.089  1.00 141.68 ? 55   SER B CA     1 
ATOM   6925  C  C      . SER B 2 55  ? 14.816  35.881  18.905  1.00 146.11 ? 55   SER B C      1 
ATOM   6926  O  O      . SER B 2 55  ? 15.805  35.154  18.987  1.00 152.16 ? 55   SER B O      1 
ATOM   6927  C  CB     . SER B 2 55  ? 12.615  35.173  19.880  1.00 136.34 ? 55   SER B CB     1 
ATOM   6928  O  OG     . SER B 2 55  ? 11.782  35.186  21.026  1.00 137.60 ? 55   SER B OG     1 
ATOM   6929  H  H      . SER B 2 55  ? 12.695  37.632  20.064  1.00 164.85 ? 55   SER B H      1 
ATOM   6930  H  HA     . SER B 2 55  ? 14.316  35.719  20.885  1.00 170.01 ? 55   SER B HA     1 
ATOM   6931  H  HB2    . SER B 2 55  ? 12.115  35.520  19.125  1.00 163.60 ? 55   SER B HB2    1 
ATOM   6932  H  HB3    . SER B 2 55  ? 12.890  34.260  19.703  1.00 163.60 ? 55   SER B HB3    1 
ATOM   6933  H  HG     . SER B 2 55  ? 11.534  35.971  21.192  1.00 165.12 ? 55   SER B HG     1 
ATOM   6934  N  N      . VAL B 2 56  ? 14.515  36.574  17.808  1.00 142.31 ? 56   VAL B N      1 
ATOM   6935  C  CA     . VAL B 2 56  ? 15.359  36.544  16.614  1.00 134.73 ? 56   VAL B CA     1 
ATOM   6936  C  C      . VAL B 2 56  ? 16.759  37.056  16.928  1.00 133.60 ? 56   VAL B C      1 
ATOM   6937  O  O      . VAL B 2 56  ? 17.744  36.561  16.382  1.00 143.90 ? 56   VAL B O      1 
ATOM   6938  C  CB     . VAL B 2 56  ? 14.759  37.380  15.456  1.00 130.71 ? 56   VAL B CB     1 
ATOM   6939  C  CG1    . VAL B 2 56  ? 15.643  37.304  14.218  1.00 126.76 ? 56   VAL B CG1    1 
ATOM   6940  C  CG2    . VAL B 2 56  ? 13.359  36.901  15.110  1.00 122.17 ? 56   VAL B CG2    1 
ATOM   6941  H  H      . VAL B 2 56  ? 13.820  37.074  17.729  1.00 170.78 ? 56   VAL B H      1 
ATOM   6942  H  HA     . VAL B 2 56  ? 15.438  35.626  16.309  1.00 161.68 ? 56   VAL B HA     1 
ATOM   6943  H  HB     . VAL B 2 56  ? 14.702  38.308  15.730  1.00 156.85 ? 56   VAL B HB     1 
ATOM   6944  H  HG11   . VAL B 2 56  ? 15.713  36.379  13.936  1.00 152.11 ? 56   VAL B HG11   1 
ATOM   6945  H  HG12   . VAL B 2 56  ? 15.243  37.836  13.512  1.00 152.11 ? 56   VAL B HG12   1 
ATOM   6946  H  HG13   . VAL B 2 56  ? 16.522  37.651  14.436  1.00 152.11 ? 56   VAL B HG13   1 
ATOM   6947  H  HG21   . VAL B 2 56  ? 12.793  36.992  15.892  1.00 146.60 ? 56   VAL B HG21   1 
ATOM   6948  H  HG22   . VAL B 2 56  ? 13.011  37.441  14.384  1.00 146.60 ? 56   VAL B HG22   1 
ATOM   6949  H  HG23   . VAL B 2 56  ? 13.402  35.970  14.839  1.00 146.60 ? 56   VAL B HG23   1 
ATOM   6950  N  N      . GLU B 2 57  ? 16.845  38.045  17.810  1.00 132.01 ? 57   GLU B N      1 
ATOM   6951  C  CA     . GLU B 2 57  ? 18.135  38.593  18.216  1.00 140.43 ? 57   GLU B CA     1 
ATOM   6952  C  C      . GLU B 2 57  ? 18.908  37.594  19.078  1.00 148.46 ? 57   GLU B C      1 
ATOM   6953  O  O      . GLU B 2 57  ? 20.139  37.556  19.047  1.00 138.10 ? 57   GLU B O      1 
ATOM   6954  C  CB     . GLU B 2 57  ? 17.936  39.899  18.986  1.00 127.39 ? 57   GLU B CB     1 
ATOM   6955  C  CG     . GLU B 2 57  ? 19.208  40.712  19.174  1.00 121.02 ? 57   GLU B CG     1 
ATOM   6956  C  CD     . GLU B 2 57  ? 19.053  41.821  20.199  1.00 127.91 ? 57   GLU B CD     1 
ATOM   6957  O  OE1    . GLU B 2 57  ? 18.018  41.857  20.898  1.00 127.25 ? 57   GLU B OE1    1 
ATOM   6958  O  OE2    . GLU B 2 57  ? 19.970  42.663  20.304  1.00 126.24 ? 57   GLU B OE2    1 
ATOM   6959  H  H      . GLU B 2 57  ? 16.170  38.418  18.190  1.00 158.41 ? 57   GLU B H      1 
ATOM   6960  H  HA     . GLU B 2 57  ? 18.664  38.784  17.426  1.00 168.52 ? 57   GLU B HA     1 
ATOM   6961  H  HB2    . GLU B 2 57  ? 17.302  40.451  18.503  1.00 152.87 ? 57   GLU B HB2    1 
ATOM   6962  H  HB3    . GLU B 2 57  ? 17.586  39.692  19.866  1.00 152.87 ? 57   GLU B HB3    1 
ATOM   6963  H  HG2    . GLU B 2 57  ? 19.918  40.123  19.475  1.00 145.23 ? 57   GLU B HG2    1 
ATOM   6964  H  HG3    . GLU B 2 57  ? 19.451  41.118  18.327  1.00 145.23 ? 57   GLU B HG3    1 
ATOM   6965  N  N      . ASN B 2 58  ? 18.178  36.789  19.844  1.00 151.42 ? 58   ASN B N      1 
ATOM   6966  C  CA     . ASN B 2 58  ? 18.786  35.757  20.677  1.00 148.78 ? 58   ASN B CA     1 
ATOM   6967  C  C      . ASN B 2 58  ? 19.295  34.569  19.871  1.00 153.56 ? 58   ASN B C      1 
ATOM   6968  O  O      . ASN B 2 58  ? 20.397  34.076  20.106  1.00 164.17 ? 58   ASN B O      1 
ATOM   6969  C  CB     . ASN B 2 58  ? 17.789  35.256  21.724  1.00 148.74 ? 58   ASN B CB     1 
ATOM   6970  C  CG     . ASN B 2 58  ? 17.461  36.301  22.769  1.00 163.75 ? 58   ASN B CG     1 
ATOM   6971  O  OD1    . ASN B 2 58  ? 18.167  37.300  22.912  1.00 165.23 ? 58   ASN B OD1    1 
ATOM   6972  N  ND2    . ASN B 2 58  ? 16.388  36.069  23.517  1.00 165.50 ? 58   ASN B ND2    1 
ATOM   6973  H  H      . ASN B 2 58  ? 17.320  36.820  19.899  1.00 181.70 ? 58   ASN B H      1 
ATOM   6974  H  HA     . ASN B 2 58  ? 19.543  36.141  21.148  1.00 178.53 ? 58   ASN B HA     1 
ATOM   6975  H  HB2    . ASN B 2 58  ? 16.963  35.007  21.280  1.00 178.49 ? 58   ASN B HB2    1 
ATOM   6976  H  HB3    . ASN B 2 58  ? 18.167  34.486  22.177  1.00 178.49 ? 58   ASN B HB3    1 
ATOM   6977  H  HD21   . ASN B 2 58  ? 15.923  35.356  23.392  1.00 198.60 ? 58   ASN B HD21   1 
ATOM   6978  H  HD22   . ASN B 2 58  ? 16.158  36.631  24.126  1.00 198.60 ? 58   ASN B HD22   1 
ATOM   6979  N  N      . LEU B 2 59  ? 18.486  34.113  18.920  1.00 150.29 ? 59   LEU B N      1 
ATOM   6980  C  CA     . LEU B 2 59  ? 18.856  32.978  18.085  1.00 152.51 ? 59   LEU B CA     1 
ATOM   6981  C  C      . LEU B 2 59  ? 19.947  33.329  17.077  1.00 153.82 ? 59   LEU B C      1 
ATOM   6982  O  O      . LEU B 2 59  ? 20.631  32.440  16.567  1.00 158.19 ? 59   LEU B O      1 
ATOM   6983  C  CB     . LEU B 2 59  ? 17.618  32.451  17.352  1.00 144.95 ? 59   LEU B CB     1 
ATOM   6984  C  CG     . LEU B 2 59  ? 16.459  31.986  18.242  1.00 149.64 ? 59   LEU B CG     1 
ATOM   6985  C  CD1    . LEU B 2 59  ? 15.314  31.446  17.397  1.00 134.82 ? 59   LEU B CD1    1 
ATOM   6986  C  CD2    . LEU B 2 59  ? 16.914  30.941  19.252  1.00 166.74 ? 59   LEU B CD2    1 
ATOM   6987  H  H      . LEU B 2 59  ? 17.714  34.446  18.739  1.00 180.35 ? 59   LEU B H      1 
ATOM   6988  H  HA     . LEU B 2 59  ? 19.192  32.267  18.653  1.00 183.01 ? 59   LEU B HA     1 
ATOM   6989  H  HB2    . LEU B 2 59  ? 17.279  33.156  16.780  1.00 173.94 ? 59   LEU B HB2    1 
ATOM   6990  H  HB3    . LEU B 2 59  ? 17.885  31.694  16.807  1.00 173.94 ? 59   LEU B HB3    1 
ATOM   6991  H  HG     . LEU B 2 59  ? 16.124  32.749  18.738  1.00 179.57 ? 59   LEU B HG     1 
ATOM   6992  H  HD11   . LEU B 2 59  ? 15.634  30.694  16.875  1.00 161.79 ? 59   LEU B HD11   1 
ATOM   6993  H  HD12   . LEU B 2 59  ? 14.597  31.160  17.985  1.00 161.79 ? 59   LEU B HD12   1 
ATOM   6994  H  HD13   . LEU B 2 59  ? 14.999  32.149  16.807  1.00 161.79 ? 59   LEU B HD13   1 
ATOM   6995  H  HD21   . LEU B 2 59  ? 17.604  31.326  19.815  1.00 200.09 ? 59   LEU B HD21   1 
ATOM   6996  H  HD22   . LEU B 2 59  ? 16.155  30.674  19.793  1.00 200.09 ? 59   LEU B HD22   1 
ATOM   6997  H  HD23   . LEU B 2 59  ? 17.267  30.174  18.774  1.00 200.09 ? 59   LEU B HD23   1 
ATOM   6998  N  N      . GLY B 2 60  ? 20.110  34.617  16.787  1.00 150.65 ? 60   GLY B N      1 
ATOM   6999  C  CA     . GLY B 2 60  ? 21.128  35.051  15.847  1.00 152.39 ? 60   GLY B CA     1 
ATOM   7000  C  C      . GLY B 2 60  ? 22.529  35.098  16.429  1.00 152.84 ? 60   GLY B C      1 
ATOM   7001  O  O      . GLY B 2 60  ? 23.506  34.826  15.729  1.00 144.84 ? 60   GLY B O      1 
ATOM   7002  H  H      . GLY B 2 60  ? 19.643  35.256  17.122  1.00 180.78 ? 60   GLY B H      1 
ATOM   7003  H  HA2    . GLY B 2 60  ? 21.137  34.448  15.087  1.00 182.87 ? 60   GLY B HA2    1 
ATOM   7004  H  HA3    . GLY B 2 60  ? 20.905  35.939  15.525  1.00 182.87 ? 60   GLY B HA3    1 
ATOM   7005  N  N      . VAL B 2 61  ? 22.629  35.440  17.712  1.00 163.75 ? 61   VAL B N      1 
ATOM   7006  C  CA     . VAL B 2 61  ? 23.923  35.523  18.385  1.00 171.84 ? 61   VAL B CA     1 
ATOM   7007  C  C      . VAL B 2 61  ? 24.355  34.159  18.925  1.00 167.58 ? 61   VAL B C      1 
ATOM   7008  O  O      . VAL B 2 61  ? 25.527  33.788  18.844  1.00 166.29 ? 61   VAL B O      1 
ATOM   7009  C  CB     . VAL B 2 61  ? 23.882  36.551  19.542  1.00 159.91 ? 61   VAL B CB     1 
ATOM   7010  C  CG1    . VAL B 2 61  ? 25.201  36.572  20.313  1.00 152.14 ? 61   VAL B CG1    1 
ATOM   7011  C  CG2    . VAL B 2 61  ? 23.577  37.941  19.001  1.00 141.65 ? 61   VAL B CG2    1 
ATOM   7012  H  H      . VAL B 2 61  ? 21.960  35.629  18.217  1.00 196.50 ? 61   VAL B H      1 
ATOM   7013  H  HA     . VAL B 2 61  ? 24.592  35.817  17.747  1.00 206.21 ? 61   VAL B HA     1 
ATOM   7014  H  HB     . VAL B 2 61  ? 23.176  36.305  20.160  1.00 191.90 ? 61   VAL B HB     1 
ATOM   7015  H  HG11   . VAL B 2 61  ? 25.917  36.813  19.705  1.00 182.57 ? 61   VAL B HG11   1 
ATOM   7016  H  HG12   . VAL B 2 61  ? 25.139  37.224  21.027  1.00 182.57 ? 61   VAL B HG12   1 
ATOM   7017  H  HG13   . VAL B 2 61  ? 25.364  35.690  20.683  1.00 182.57 ? 61   VAL B HG13   1 
ATOM   7018  H  HG21   . VAL B 2 61  ? 22.715  37.924  18.556  1.00 169.98 ? 61   VAL B HG21   1 
ATOM   7019  H  HG22   . VAL B 2 61  ? 23.555  38.569  19.740  1.00 169.98 ? 61   VAL B HG22   1 
ATOM   7020  H  HG23   . VAL B 2 61  ? 24.270  38.194  18.372  1.00 169.98 ? 61   VAL B HG23   1 
ATOM   7021  N  N      . SER B 2 62  ? 23.399  33.421  19.482  1.00 157.21 ? 62   SER B N      1 
ATOM   7022  C  CA     . SER B 2 62  ? 23.650  32.070  19.974  1.00 156.56 ? 62   SER B CA     1 
ATOM   7023  C  C      . SER B 2 62  ? 24.006  31.087  18.858  1.00 173.03 ? 62   SER B C      1 
ATOM   7024  O  O      . SER B 2 62  ? 25.159  30.671  18.733  1.00 174.22 ? 62   SER B O      1 
ATOM   7025  C  CB     . SER B 2 62  ? 22.429  31.558  20.740  1.00 161.96 ? 62   SER B CB     1 
ATOM   7026  O  OG     . SER B 2 62  ? 21.285  31.520  19.907  1.00 166.19 ? 62   SER B OG     1 
ATOM   7027  H  H      . SER B 2 62  ? 22.587  33.684  19.588  1.00 188.66 ? 62   SER B H      1 
ATOM   7028  H  HA     . SER B 2 62  ? 24.397  32.097  20.592  1.00 187.87 ? 62   SER B HA     1 
ATOM   7029  H  HB2    . SER B 2 62  ? 22.613  30.663  21.064  1.00 194.35 ? 62   SER B HB2    1 
ATOM   7030  H  HB3    . SER B 2 62  ? 22.255  32.152  21.488  1.00 194.35 ? 62   SER B HB3    1 
ATOM   7031  H  HG     . SER B 2 62  ? 21.114  32.290  19.619  1.00 199.43 ? 62   SER B HG     1 
ATOM   7032  N  N      . TYR B 2 63  ? 23.008  30.720  18.055  1.00 180.92 ? 63   TYR B N      1 
ATOM   7033  C  CA     . TYR B 2 63  ? 23.188  29.724  16.999  1.00 175.76 ? 63   TYR B CA     1 
ATOM   7034  C  C      . TYR B 2 63  ? 23.576  30.367  15.671  1.00 168.21 ? 63   TYR B C      1 
ATOM   7035  O  O      . TYR B 2 63  ? 23.840  31.567  15.605  1.00 172.11 ? 63   TYR B O      1 
ATOM   7036  C  CB     . TYR B 2 63  ? 21.901  28.917  16.803  1.00 172.81 ? 63   TYR B CB     1 
ATOM   7037  C  CG     . TYR B 2 63  ? 21.279  28.383  18.075  1.00 181.70 ? 63   TYR B CG     1 
ATOM   7038  C  CD1    . TYR B 2 63  ? 22.064  27.996  19.153  1.00 190.26 ? 63   TYR B CD1    1 
ATOM   7039  C  CD2    . TYR B 2 63  ? 19.900  28.268  18.195  1.00 177.47 ? 63   TYR B CD2    1 
ATOM   7040  C  CE1    . TYR B 2 63  ? 21.493  27.508  20.315  1.00 189.63 ? 63   TYR B CE1    1 
ATOM   7041  C  CE2    . TYR B 2 63  ? 19.319  27.782  19.350  1.00 177.63 ? 63   TYR B CE2    1 
ATOM   7042  C  CZ     . TYR B 2 63  ? 20.120  27.404  20.407  1.00 186.92 ? 63   TYR B CZ     1 
ATOM   7043  O  OH     . TYR B 2 63  ? 19.545  26.919  21.560  1.00 183.09 ? 63   TYR B OH     1 
ATOM   7044  H  H      . TYR B 2 63  ? 22.210  31.037  18.101  1.00 217.11 ? 63   TYR B H      1 
ATOM   7045  H  HA     . TYR B 2 63  ? 23.894  29.110  17.257  1.00 210.91 ? 63   TYR B HA     1 
ATOM   7046  H  HB2    . TYR B 2 63  ? 21.243  29.486  16.373  1.00 207.37 ? 63   TYR B HB2    1 
ATOM   7047  H  HB3    . TYR B 2 63  ? 22.096  28.157  16.233  1.00 207.37 ? 63   TYR B HB3    1 
ATOM   7048  H  HD1    . TYR B 2 63  ? 22.990  28.065  19.093  1.00 228.31 ? 63   TYR B HD1    1 
ATOM   7049  H  HD2    . TYR B 2 63  ? 19.357  28.522  17.484  1.00 212.96 ? 63   TYR B HD2    1 
ATOM   7050  H  HE1    . TYR B 2 63  ? 22.030  27.252  21.029  1.00 227.56 ? 63   TYR B HE1    1 
ATOM   7051  H  HE2    . TYR B 2 63  ? 18.394  27.711  19.415  1.00 213.16 ? 63   TYR B HE2    1 
ATOM   7052  H  HH     . TYR B 2 63  ? 18.709  26.909  21.481  1.00 219.71 ? 63   TYR B HH     1 
ATOM   7053  N  N      . VAL B 2 64  ? 23.617  29.552  14.619  1.00 168.02 ? 64   VAL B N      1 
ATOM   7054  C  CA     . VAL B 2 64  ? 23.836  30.037  13.258  1.00 178.76 ? 64   VAL B CA     1 
ATOM   7055  C  C      . VAL B 2 64  ? 22.688  29.608  12.343  1.00 177.17 ? 64   VAL B C      1 
ATOM   7056  O  O      . VAL B 2 64  ? 22.172  28.498  12.470  1.00 173.64 ? 64   VAL B O      1 
ATOM   7057  C  CB     . VAL B 2 64  ? 25.171  29.521  12.683  1.00 178.01 ? 64   VAL B CB     1 
ATOM   7058  C  CG1    . VAL B 2 64  ? 25.446  30.148  11.321  1.00 170.77 ? 64   VAL B CG1    1 
ATOM   7059  C  CG2    . VAL B 2 64  ? 26.313  29.824  13.643  1.00 175.00 ? 64   VAL B CG2    1 
ATOM   7060  H  H      . VAL B 2 64  ? 23.519  28.699  14.669  1.00 201.63 ? 64   VAL B H      1 
ATOM   7061  H  HA     . VAL B 2 64  ? 23.868  31.007  13.268  1.00 214.51 ? 64   VAL B HA     1 
ATOM   7062  H  HB     . VAL B 2 64  ? 25.118  28.559  12.569  1.00 213.61 ? 64   VAL B HB     1 
ATOM   7063  H  HG11   . VAL B 2 64  ? 25.494  31.112  11.422  1.00 204.92 ? 64   VAL B HG11   1 
ATOM   7064  H  HG12   . VAL B 2 64  ? 26.289  29.808  10.982  1.00 204.92 ? 64   VAL B HG12   1 
ATOM   7065  H  HG13   . VAL B 2 64  ? 24.726  29.914  10.715  1.00 204.92 ? 64   VAL B HG13   1 
ATOM   7066  H  HG21   . VAL B 2 64  ? 26.138  29.385  14.490  1.00 209.99 ? 64   VAL B HG21   1 
ATOM   7067  H  HG22   . VAL B 2 64  ? 27.141  29.492  13.262  1.00 209.99 ? 64   VAL B HG22   1 
ATOM   7068  H  HG23   . VAL B 2 64  ? 26.369  30.783  13.772  1.00 209.99 ? 64   VAL B HG23   1 
ATOM   7069  N  N      . LYS B 2 65  ? 22.281  30.494  11.436  1.00 174.98 ? 65   LYS B N      1 
ATOM   7070  C  CA     . LYS B 2 65  ? 21.185  30.209  10.507  1.00 173.88 ? 65   LYS B CA     1 
ATOM   7071  C  C      . LYS B 2 65  ? 21.465  28.945  9.693   1.00 180.75 ? 65   LYS B C      1 
ATOM   7072  O  O      . LYS B 2 65  ? 22.595  28.718  9.259   1.00 184.90 ? 65   LYS B O      1 
ATOM   7073  C  CB     . LYS B 2 65  ? 20.948  31.390  9.565   1.00 170.08 ? 65   LYS B CB     1 
ATOM   7074  C  CG     . LYS B 2 65  ? 19.771  31.186  8.612   1.00 177.60 ? 65   LYS B CG     1 
ATOM   7075  C  CD     . LYS B 2 65  ? 19.607  32.347  7.641   1.00 177.92 ? 65   LYS B CD     1 
ATOM   7076  C  CE     . LYS B 2 65  ? 20.738  32.407  6.623   1.00 160.15 ? 65   LYS B CE     1 
ATOM   7077  N  NZ     . LYS B 2 65  ? 20.812  31.185  5.774   1.00 156.96 ? 65   LYS B NZ     1 
ATOM   7078  H  H      . LYS B 2 65  ? 22.626  31.275  11.337  1.00 209.97 ? 65   LYS B H      1 
ATOM   7079  H  HA     . LYS B 2 65  ? 20.372  30.064  11.016  1.00 208.65 ? 65   LYS B HA     1 
ATOM   7080  H  HB2    . LYS B 2 65  ? 20.767  32.182  10.095  1.00 204.09 ? 65   LYS B HB2    1 
ATOM   7081  H  HB3    . LYS B 2 65  ? 21.744  31.528  9.029   1.00 204.09 ? 65   LYS B HB3    1 
ATOM   7082  H  HG2    . LYS B 2 65  ? 19.917  30.379  8.095   1.00 213.12 ? 65   LYS B HG2    1 
ATOM   7083  H  HG3    . LYS B 2 65  ? 18.954  31.108  9.129   1.00 213.12 ? 65   LYS B HG3    1 
ATOM   7084  H  HD2    . LYS B 2 65  ? 18.771  32.243  7.159   1.00 213.50 ? 65   LYS B HD2    1 
ATOM   7085  H  HD3    . LYS B 2 65  ? 19.603  33.180  8.139   1.00 213.50 ? 65   LYS B HD3    1 
ATOM   7086  H  HE2    . LYS B 2 65  ? 20.599  33.169  6.040   1.00 192.18 ? 65   LYS B HE2    1 
ATOM   7087  H  HE3    . LYS B 2 65  ? 21.582  32.498  7.092   1.00 192.18 ? 65   LYS B HE3    1 
ATOM   7088  H  HZ1    . LYS B 2 65  ? 20.051  31.080  5.324   1.00 188.35 ? 65   LYS B HZ1    1 
ATOM   7089  H  HZ2    . LYS B 2 65  ? 21.483  31.258  5.194   1.00 188.35 ? 65   LYS B HZ2    1 
ATOM   7090  H  HZ3    . LYS B 2 65  ? 20.948  30.468  6.284   1.00 188.35 ? 65   LYS B HZ3    1 
ATOM   7091  N  N      . GLY B 2 66  ? 20.433  28.129  9.492   1.00 177.95 ? 66   GLY B N      1 
ATOM   7092  C  CA     . GLY B 2 66  ? 20.548  26.913  8.703   1.00 175.94 ? 66   GLY B CA     1 
ATOM   7093  C  C      . GLY B 2 66  ? 20.444  25.675  9.570   1.00 181.92 ? 66   GLY B C      1 
ATOM   7094  O  O      . GLY B 2 66  ? 19.751  24.718  9.220   1.00 179.55 ? 66   GLY B O      1 
ATOM   7095  H  H      . GLY B 2 66  ? 19.645  28.263  9.809   1.00 213.54 ? 66   GLY B H      1 
ATOM   7096  H  HA2    . GLY B 2 66  ? 19.841  26.888  8.039   1.00 211.13 ? 66   GLY B HA2    1 
ATOM   7097  H  HA3    . GLY B 2 66  ? 21.403  26.901  8.246   1.00 211.13 ? 66   GLY B HA3    1 
ATOM   7098  N  N      . THR B 2 67  ? 21.144  25.694  10.700  1.00 185.74 ? 67   THR B N      1 
ATOM   7099  C  CA     . THR B 2 67  ? 21.162  24.564  11.625  1.00 187.18 ? 67   THR B CA     1 
ATOM   7100  C  C      . THR B 2 67  ? 19.746  24.259  12.099  1.00 189.80 ? 67   THR B C      1 
ATOM   7101  O  O      . THR B 2 67  ? 18.924  25.165  12.228  1.00 185.68 ? 67   THR B O      1 
ATOM   7102  C  CB     . THR B 2 67  ? 22.069  24.823  12.851  1.00 177.62 ? 67   THR B CB     1 
ATOM   7103  O  OG1    . THR B 2 67  ? 21.404  25.702  13.767  1.00 179.33 ? 67   THR B OG1    1 
ATOM   7104  C  CG2    . THR B 2 67  ? 23.406  25.438  12.438  1.00 170.91 ? 67   THR B CG2    1 
ATOM   7105  H  H      . THR B 2 67  ? 21.624  26.360  10.957  1.00 222.89 ? 67   THR B H      1 
ATOM   7106  H  HA     . THR B 2 67  ? 21.500  23.782  11.162  1.00 224.62 ? 67   THR B HA     1 
ATOM   7107  H  HB     . THR B 2 67  ? 22.250  23.980  13.295  1.00 213.15 ? 67   THR B HB     1 
ATOM   7108  H  HG1    . THR B 2 67  ? 21.234  26.433  13.391  1.00 215.20 ? 67   THR B HG1    1 
ATOM   7109  H  HG21   . THR B 2 67  ? 23.257  26.285  11.989  1.00 205.09 ? 67   THR B HG21   1 
ATOM   7110  H  HG22   . THR B 2 67  ? 23.957  25.591  13.222  1.00 205.09 ? 67   THR B HG22   1 
ATOM   7111  H  HG23   . THR B 2 67  ? 23.875  24.840  11.836  1.00 205.09 ? 67   THR B HG23   1 
ATOM   7112  N  N      . GLU B 2 68  ? 19.464  22.982  12.348  1.00 195.18 ? 68   GLU B N      1 
ATOM   7113  C  CA     . GLU B 2 68  ? 18.124  22.553  12.742  1.00 192.91 ? 68   GLU B CA     1 
ATOM   7114  C  C      . GLU B 2 68  ? 17.637  23.281  13.995  1.00 193.72 ? 68   GLU B C      1 
ATOM   7115  O  O      . GLU B 2 68  ? 16.433  23.434  14.199  1.00 195.73 ? 68   GLU B O      1 
ATOM   7116  C  CB     . GLU B 2 68  ? 18.100  21.041  12.989  1.00 186.03 ? 68   GLU B CB     1 
ATOM   7117  C  CG     . GLU B 2 68  ? 18.230  20.191  11.732  1.00 181.30 ? 68   GLU B CG     1 
ATOM   7118  C  CD     . GLU B 2 68  ? 18.187  18.701  12.028  1.00 182.06 ? 68   GLU B CD     1 
ATOM   7119  O  OE1    . GLU B 2 68  ? 18.185  18.328  13.221  1.00 170.79 ? 68   GLU B OE1    1 
ATOM   7120  O  OE2    . GLU B 2 68  ? 18.154  17.903  11.068  1.00 177.28 ? 68   GLU B OE2    1 
ATOM   7121  H  H      . GLU B 2 68  ? 20.035  22.341  12.296  1.00 234.22 ? 68   GLU B H      1 
ATOM   7122  H  HA     . GLU B 2 68  ? 17.505  22.750  12.022  1.00 231.49 ? 68   GLU B HA     1 
ATOM   7123  H  HB2    . GLU B 2 68  ? 18.837  20.811  13.576  1.00 223.23 ? 68   GLU B HB2    1 
ATOM   7124  H  HB3    . GLU B 2 68  ? 17.259  20.810  13.414  1.00 223.23 ? 68   GLU B HB3    1 
ATOM   7125  H  HG2    . GLU B 2 68  ? 17.498  20.399  11.131  1.00 217.56 ? 68   GLU B HG2    1 
ATOM   7126  H  HG3    . GLU B 2 68  ? 19.078  20.387  11.303  1.00 217.56 ? 68   GLU B HG3    1 
ATOM   7127  N  N      . GLN B 2 69  ? 18.572  23.723  14.831  1.00 186.09 ? 69   GLN B N      1 
ATOM   7128  C  CA     . GLN B 2 69  ? 18.233  24.515  16.009  1.00 183.36 ? 69   GLN B CA     1 
ATOM   7129  C  C      . GLN B 2 69  ? 17.542  25.825  15.633  1.00 178.89 ? 69   GLN B C      1 
ATOM   7130  O  O      . GLN B 2 69  ? 16.421  26.092  16.064  1.00 175.67 ? 69   GLN B O      1 
ATOM   7131  C  CB     . GLN B 2 69  ? 19.489  24.805  16.831  1.00 190.60 ? 69   GLN B CB     1 
ATOM   7132  C  CG     . GLN B 2 69  ? 20.034  23.589  17.559  1.00 193.34 ? 69   GLN B CG     1 
ATOM   7133  C  CD     . GLN B 2 69  ? 21.245  23.912  18.411  1.00 202.80 ? 69   GLN B CD     1 
ATOM   7134  O  OE1    . GLN B 2 69  ? 21.857  24.970  18.265  1.00 205.80 ? 69   GLN B OE1    1 
ATOM   7135  N  NE2    . GLN B 2 69  ? 21.594  23.000  19.312  1.00 196.47 ? 69   GLN B NE2    1 
ATOM   7136  H  H      . GLN B 2 69  ? 19.414  23.577  14.738  1.00 223.31 ? 69   GLN B H      1 
ATOM   7137  H  HA     . GLN B 2 69  ? 17.623  24.005  16.566  1.00 220.03 ? 69   GLN B HA     1 
ATOM   7138  H  HB2    . GLN B 2 69  ? 20.183  25.131  16.237  1.00 228.72 ? 69   GLN B HB2    1 
ATOM   7139  H  HB3    . GLN B 2 69  ? 19.280  25.480  17.495  1.00 228.72 ? 69   GLN B HB3    1 
ATOM   7140  H  HG2    . GLN B 2 69  ? 19.344  23.233  18.141  1.00 232.00 ? 69   GLN B HG2    1 
ATOM   7141  H  HG3    . GLN B 2 69  ? 20.296  22.921  16.907  1.00 232.00 ? 69   GLN B HG3    1 
ATOM   7142  H  HE21   . GLN B 2 69  ? 21.140  22.274  19.387  1.00 235.77 ? 69   GLN B HE21   1 
ATOM   7143  H  HE22   . GLN B 2 69  ? 22.275  23.136  19.820  1.00 235.77 ? 69   GLN B HE22   1 
ATOM   7144  N  N      . TYR B 2 70  ? 18.226  26.637  14.832  1.00 182.09 ? 70   TYR B N      1 
ATOM   7145  C  CA     . TYR B 2 70  ? 17.656  27.862  14.276  1.00 180.46 ? 70   TYR B CA     1 
ATOM   7146  C  C      . TYR B 2 70  ? 16.307  27.635  13.595  1.00 180.36 ? 70   TYR B C      1 
ATOM   7147  O  O      . TYR B 2 70  ? 15.332  28.326  13.889  1.00 173.68 ? 70   TYR B O      1 
ATOM   7148  C  CB     . TYR B 2 70  ? 18.637  28.484  13.277  1.00 183.06 ? 70   TYR B CB     1 
ATOM   7149  C  CG     . TYR B 2 70  ? 18.303  29.903  12.866  1.00 182.56 ? 70   TYR B CG     1 
ATOM   7150  C  CD1    . TYR B 2 70  ? 17.389  30.155  11.851  1.00 176.88 ? 70   TYR B CD1    1 
ATOM   7151  C  CD2    . TYR B 2 70  ? 18.908  30.990  13.485  1.00 180.37 ? 70   TYR B CD2    1 
ATOM   7152  C  CE1    . TYR B 2 70  ? 17.082  31.446  11.466  1.00 166.45 ? 70   TYR B CE1    1 
ATOM   7153  C  CE2    . TYR B 2 70  ? 18.607  32.287  13.106  1.00 174.86 ? 70   TYR B CE2    1 
ATOM   7154  C  CZ     . TYR B 2 70  ? 17.693  32.508  12.096  1.00 164.43 ? 70   TYR B CZ     1 
ATOM   7155  O  OH     . TYR B 2 70  ? 17.389  33.794  11.715  1.00 143.30 ? 70   TYR B OH     1 
ATOM   7156  H  H      . TYR B 2 70  ? 19.040  26.497  14.591  1.00 218.51 ? 70   TYR B H      1 
ATOM   7157  H  HA     . TYR B 2 70  ? 17.521  28.499  14.995  1.00 216.55 ? 70   TYR B HA     1 
ATOM   7158  H  HB2    . TYR B 2 70  ? 19.521  28.494  13.676  1.00 219.67 ? 70   TYR B HB2    1 
ATOM   7159  H  HB3    . TYR B 2 70  ? 18.648  27.940  12.474  1.00 219.67 ? 70   TYR B HB3    1 
ATOM   7160  H  HD1    . TYR B 2 70  ? 19.525  30.844  14.165  1.00 216.44 ? 70   TYR B HD1    1 
ATOM   7161  H  HD2    . TYR B 2 70  ? 16.975  29.440  11.423  1.00 212.25 ? 70   TYR B HD2    1 
ATOM   7162  H  HE1    . TYR B 2 70  ? 19.018  33.005  13.530  1.00 209.83 ? 70   TYR B HE1    1 
ATOM   7163  H  HE2    . TYR B 2 70  ? 16.466  31.597  10.786  1.00 199.74 ? 70   TYR B HE2    1 
ATOM   7164  H  HH     . TYR B 2 70  ? 16.822  33.783  11.095  1.00 171.96 ? 70   TYR B HH     1 
ATOM   7165  N  N      . GLN B 2 71  ? 16.258  26.664  12.686  1.00 184.02 ? 71   GLN B N      1 
ATOM   7166  C  CA     . GLN B 2 71  ? 15.044  26.378  11.926  1.00 178.25 ? 71   GLN B CA     1 
ATOM   7167  C  C      . GLN B 2 71  ? 13.894  25.861  12.791  1.00 180.39 ? 71   GLN B C      1 
ATOM   7168  O  O      . GLN B 2 71  ? 12.744  25.854  12.351  1.00 174.59 ? 71   GLN B O      1 
ATOM   7169  C  CB     . GLN B 2 71  ? 15.339  25.351  10.828  1.00 173.55 ? 71   GLN B CB     1 
ATOM   7170  C  CG     . GLN B 2 71  ? 16.499  25.709  9.908   1.00 180.33 ? 71   GLN B CG     1 
ATOM   7171  C  CD     . GLN B 2 71  ? 16.210  26.908  9.027   1.00 172.23 ? 71   GLN B CD     1 
ATOM   7172  O  OE1    . GLN B 2 71  ? 15.063  27.167  8.663   1.00 166.53 ? 71   GLN B OE1    1 
ATOM   7173  N  NE2    . GLN B 2 71  ? 17.255  27.649  8.678   1.00 169.45 ? 71   GLN B NE2    1 
ATOM   7174  H  H      . GLN B 2 71  ? 16.921  26.152  12.490  1.00 220.82 ? 71   GLN B H      1 
ATOM   7175  H  HA     . GLN B 2 71  ? 14.746  27.195  11.496  1.00 213.89 ? 71   GLN B HA     1 
ATOM   7176  H  HB2    . GLN B 2 71  ? 15.550  24.502  11.248  1.00 208.26 ? 71   GLN B HB2    1 
ATOM   7177  H  HB3    . GLN B 2 71  ? 14.547  25.252  10.276  1.00 208.26 ? 71   GLN B HB3    1 
ATOM   7178  H  HG2    . GLN B 2 71  ? 17.277  25.917  10.449  1.00 216.39 ? 71   GLN B HG2    1 
ATOM   7179  H  HG3    . GLN B 2 71  ? 16.690  24.953  9.332   1.00 216.39 ? 71   GLN B HG3    1 
ATOM   7180  H  HE21   . GLN B 2 71  ? 18.042  27.437  8.952   1.00 203.34 ? 71   GLN B HE21   1 
ATOM   7181  H  HE22   . GLN B 2 71  ? 17.145  28.340  8.179   1.00 203.34 ? 71   GLN B HE22   1 
ATOM   7182  N  N      . SER B 2 72  ? 14.203  25.435  14.013  1.00 184.12 ? 72   SER B N      1 
ATOM   7183  C  CA     . SER B 2 72  ? 13.180  24.948  14.937  1.00 177.90 ? 72   SER B CA     1 
ATOM   7184  C  C      . SER B 2 72  ? 12.814  25.991  15.987  1.00 170.73 ? 72   SER B C      1 
ATOM   7185  O  O      . SER B 2 72  ? 11.636  26.267  16.210  1.00 169.13 ? 72   SER B O      1 
ATOM   7186  C  CB     . SER B 2 72  ? 13.655  23.669  15.627  1.00 178.05 ? 72   SER B CB     1 
ATOM   7187  O  OG     . SER B 2 72  ? 12.647  23.144  16.474  1.00 169.97 ? 72   SER B OG     1 
ATOM   7188  H  H      . SER B 2 72  ? 15.001  25.417  14.333  1.00 220.94 ? 72   SER B H      1 
ATOM   7189  H  HA     . SER B 2 72  ? 12.378  24.736  14.435  1.00 213.49 ? 72   SER B HA     1 
ATOM   7190  H  HB2    . SER B 2 72  ? 13.875  23.009  14.951  1.00 213.66 ? 72   SER B HB2    1 
ATOM   7191  H  HB3    . SER B 2 72  ? 14.440  23.871  16.160  1.00 213.66 ? 72   SER B HB3    1 
ATOM   7192  H  HG     . SER B 2 72  ? 12.921  22.442  16.846  1.00 203.96 ? 72   SER B HG     1 
ATOM   7193  N  N      . LYS B 2 73  ? 13.827  26.560  16.632  1.00 176.26 ? 73   LYS B N      1 
ATOM   7194  C  CA     . LYS B 2 73  ? 13.608  27.545  17.688  1.00 178.99 ? 73   LYS B CA     1 
ATOM   7195  C  C      . LYS B 2 73  ? 12.836  28.761  17.179  1.00 170.90 ? 73   LYS B C      1 
ATOM   7196  O  O      . LYS B 2 73  ? 11.921  29.243  17.845  1.00 166.50 ? 73   LYS B O      1 
ATOM   7197  C  CB     . LYS B 2 73  ? 14.945  27.981  18.301  1.00 180.57 ? 73   LYS B CB     1 
ATOM   7198  C  CG     . LYS B 2 73  ? 15.370  27.206  19.557  1.00 162.06 ? 73   LYS B CG     1 
ATOM   7199  C  CD     . LYS B 2 73  ? 14.361  27.325  20.702  1.00 151.72 ? 73   LYS B CD     1 
ATOM   7200  C  CE     . LYS B 2 73  ? 14.569  26.251  21.755  1.00 147.18 ? 73   LYS B CE     1 
ATOM   7201  N  NZ     . LYS B 2 73  ? 13.458  26.243  22.749  1.00 152.39 ? 73   LYS B NZ     1 
ATOM   7202  H  H      . LYS B 2 73  ? 14.656  26.393  16.477  1.00 211.52 ? 73   LYS B H      1 
ATOM   7203  H  HA     . LYS B 2 73  ? 13.081  27.134  18.391  1.00 214.79 ? 73   LYS B HA     1 
ATOM   7204  H  HB2    . LYS B 2 73  ? 15.642  27.864  17.636  1.00 216.69 ? 73   LYS B HB2    1 
ATOM   7205  H  HB3    . LYS B 2 73  ? 14.882  28.918  18.543  1.00 216.69 ? 73   LYS B HB3    1 
ATOM   7206  H  HG2    . LYS B 2 73  ? 15.459  26.267  19.333  1.00 194.48 ? 73   LYS B HG2    1 
ATOM   7207  H  HG3    . LYS B 2 73  ? 16.220  27.555  19.870  1.00 194.48 ? 73   LYS B HG3    1 
ATOM   7208  H  HD2    . LYS B 2 73  ? 14.462  28.190  21.127  1.00 182.06 ? 73   LYS B HD2    1 
ATOM   7209  H  HD3    . LYS B 2 73  ? 13.463  27.230  20.346  1.00 182.06 ? 73   LYS B HD3    1 
ATOM   7210  H  HE2    . LYS B 2 73  ? 14.600  25.382  21.326  1.00 176.62 ? 73   LYS B HE2    1 
ATOM   7211  H  HE3    . LYS B 2 73  ? 15.399  26.423  22.228  1.00 176.62 ? 73   LYS B HE3    1 
ATOM   7212  H  HZ1    . LYS B 2 73  ? 12.684  26.084  22.338  1.00 182.86 ? 73   LYS B HZ1    1 
ATOM   7213  H  HZ2    . LYS B 2 73  ? 13.598  25.608  23.356  1.00 182.86 ? 73   LYS B HZ2    1 
ATOM   7214  H  HZ3    . LYS B 2 73  ? 13.411  27.031  23.159  1.00 182.86 ? 73   LYS B HZ3    1 
ATOM   7215  N  N      . LEU B 2 74  ? 13.214  29.273  16.013  1.00 165.20 ? 74   LEU B N      1 
ATOM   7216  C  CA     . LEU B 2 74  ? 12.476  30.383  15.426  1.00 164.93 ? 74   LEU B CA     1 
ATOM   7217  C  C      . LEU B 2 74  ? 11.074  29.945  15.017  1.00 165.63 ? 74   LEU B C      1 
ATOM   7218  O  O      . LEU B 2 74  ? 10.106  30.682  15.206  1.00 166.64 ? 74   LEU B O      1 
ATOM   7219  C  CB     . LEU B 2 74  ? 13.222  30.950  14.217  1.00 165.34 ? 74   LEU B CB     1 
ATOM   7220  C  CG     . LEU B 2 74  ? 12.675  32.254  13.626  1.00 154.82 ? 74   LEU B CG     1 
ATOM   7221  C  CD1    . LEU B 2 74  ? 12.567  33.356  14.669  1.00 168.91 ? 74   LEU B CD1    1 
ATOM   7222  C  CD2    . LEU B 2 74  ? 13.552  32.707  12.472  1.00 146.87 ? 74   LEU B CD2    1 
ATOM   7223  H  H      . LEU B 2 74  ? 13.884  29.000  15.547  1.00 198.24 ? 74   LEU B H      1 
ATOM   7224  H  HA     . LEU B 2 74  ? 12.390  31.090  16.085  1.00 197.91 ? 74   LEU B HA     1 
ATOM   7225  H  HB2    . LEU B 2 74  ? 14.141  31.116  14.479  1.00 198.40 ? 74   LEU B HB2    1 
ATOM   7226  H  HB3    . LEU B 2 74  ? 13.205  30.285  13.511  1.00 198.40 ? 74   LEU B HB3    1 
ATOM   7227  H  HG     . LEU B 2 74  ? 11.786  32.089  13.276  1.00 185.78 ? 74   LEU B HG     1 
ATOM   7228  H  HD11   . LEU B 2 74  ? 13.448  33.532  15.035  1.00 202.70 ? 74   LEU B HD11   1 
ATOM   7229  H  HD12   . LEU B 2 74  ? 12.218  34.157  14.247  1.00 202.70 ? 74   LEU B HD12   1 
ATOM   7230  H  HD13   . LEU B 2 74  ? 11.968  33.065  15.375  1.00 202.70 ? 74   LEU B HD13   1 
ATOM   7231  H  HD21   . LEU B 2 74  ? 13.554  32.018  11.789  1.00 176.24 ? 74   LEU B HD21   1 
ATOM   7232  H  HD22   . LEU B 2 74  ? 13.193  33.532  12.109  1.00 176.24 ? 74   LEU B HD22   1 
ATOM   7233  H  HD23   . LEU B 2 74  ? 14.453  32.853  12.798  1.00 176.24 ? 74   LEU B HD23   1 
ATOM   7234  N  N      . GLU B 2 75  ? 10.972  28.744  14.456  1.00 164.88 ? 75   GLU B N      1 
ATOM   7235  C  CA     . GLU B 2 75  ? 9.679   28.169  14.101  1.00 162.29 ? 75   GLU B CA     1 
ATOM   7236  C  C      . GLU B 2 75  ? 8.841   27.971  15.360  1.00 168.89 ? 75   GLU B C      1 
ATOM   7237  O  O      . GLU B 2 75  ? 7.616   28.095  15.337  1.00 169.05 ? 75   GLU B O      1 
ATOM   7238  C  CB     . GLU B 2 75  ? 9.868   26.839  13.364  1.00 162.95 ? 75   GLU B CB     1 
ATOM   7239  C  CG     . GLU B 2 75  ? 8.581   26.072  13.067  1.00 162.11 ? 75   GLU B CG     1 
ATOM   7240  C  CD     . GLU B 2 75  ? 7.669   26.809  12.103  1.00 159.56 ? 75   GLU B CD     1 
ATOM   7241  O  OE1    . GLU B 2 75  ? 6.965   27.742  12.539  1.00 165.99 ? 75   GLU B OE1    1 
ATOM   7242  O  OE2    . GLU B 2 75  ? 7.654   26.448  10.906  1.00 148.54 ? 75   GLU B OE2    1 
ATOM   7243  H  H      . GLU B 2 75  ? 11.642  28.238  14.269  1.00 197.86 ? 75   GLU B H      1 
ATOM   7244  H  HA     . GLU B 2 75  ? 9.207   28.779  13.513  1.00 194.75 ? 75   GLU B HA     1 
ATOM   7245  H  HB2    . GLU B 2 75  ? 10.305  27.016  12.516  1.00 195.53 ? 75   GLU B HB2    1 
ATOM   7246  H  HB3    . GLU B 2 75  ? 10.431  26.264  13.906  1.00 195.53 ? 75   GLU B HB3    1 
ATOM   7247  H  HG2    . GLU B 2 75  ? 8.808   25.216  12.671  1.00 194.53 ? 75   GLU B HG2    1 
ATOM   7248  H  HG3    . GLU B 2 75  ? 8.096   25.937  13.895  1.00 194.53 ? 75   GLU B HG3    1 
ATOM   7249  N  N      . SER B 2 76  ? 9.522   27.667  16.462  1.00 174.21 ? 76   SER B N      1 
ATOM   7250  C  CA     . SER B 2 76  ? 8.874   27.491  17.757  1.00 171.23 ? 76   SER B CA     1 
ATOM   7251  C  C      . SER B 2 76  ? 8.339   28.810  18.299  1.00 165.53 ? 76   SER B C      1 
ATOM   7252  O  O      . SER B 2 76  ? 7.168   28.913  18.661  1.00 162.65 ? 76   SER B O      1 
ATOM   7253  C  CB     . SER B 2 76  ? 9.852   26.868  18.758  1.00 165.85 ? 76   SER B CB     1 
ATOM   7254  O  OG     . SER B 2 76  ? 9.308   26.856  20.065  1.00 161.12 ? 76   SER B OG     1 
ATOM   7255  H  H      . SER B 2 76  ? 10.375  27.555  16.484  1.00 209.06 ? 76   SER B H      1 
ATOM   7256  H  HA     . SER B 2 76  ? 8.125   26.884  17.654  1.00 205.48 ? 76   SER B HA     1 
ATOM   7257  H  HB2    . SER B 2 76  ? 10.040  25.956  18.487  1.00 199.02 ? 76   SER B HB2    1 
ATOM   7258  H  HB3    . SER B 2 76  ? 10.671  27.388  18.762  1.00 199.02 ? 76   SER B HB3    1 
ATOM   7259  H  HG     . SER B 2 76  ? 9.856   26.512  20.601  1.00 193.35 ? 76   SER B HG     1 
ATOM   7260  N  N      . GLU B 2 77  ? 9.204   29.817  18.350  1.00 162.86 ? 77   GLU B N      1 
ATOM   7261  C  CA     . GLU B 2 77  ? 8.828   31.120  18.883  1.00 159.28 ? 77   GLU B CA     1 
ATOM   7262  C  C      . GLU B 2 77  ? 7.724   31.758  18.048  1.00 157.83 ? 77   GLU B C      1 
ATOM   7263  O  O      . GLU B 2 77  ? 6.872   32.468  18.581  1.00 159.57 ? 77   GLU B O      1 
ATOM   7264  C  CB     . GLU B 2 77  ? 10.048  32.041  18.961  1.00 160.29 ? 77   GLU B CB     1 
ATOM   7265  C  CG     . GLU B 2 77  ? 10.884  31.833  20.218  1.00 159.51 ? 77   GLU B CG     1 
ATOM   7266  C  CD     . GLU B 2 77  ? 10.104  32.116  21.490  1.00 159.25 ? 77   GLU B CD     1 
ATOM   7267  O  OE1    . GLU B 2 77  ? 9.367   33.124  21.526  1.00 151.09 ? 77   GLU B OE1    1 
ATOM   7268  O  OE2    . GLU B 2 77  ? 10.221  31.325  22.450  1.00 164.23 ? 77   GLU B OE2    1 
ATOM   7269  H  H      . GLU B 2 77  ? 10.019  29.771  18.080  1.00 195.44 ? 77   GLU B H      1 
ATOM   7270  H  HA     . GLU B 2 77  ? 8.487   31.003  19.784  1.00 191.14 ? 77   GLU B HA     1 
ATOM   7271  H  HB2    . GLU B 2 77  ? 10.617  31.875  18.194  1.00 192.35 ? 77   GLU B HB2    1 
ATOM   7272  H  HB3    . GLU B 2 77  ? 9.746   32.963  18.954  1.00 192.35 ? 77   GLU B HB3    1 
ATOM   7273  H  HG2    . GLU B 2 77  ? 11.184  30.911  20.248  1.00 191.41 ? 77   GLU B HG2    1 
ATOM   7274  H  HG3    . GLU B 2 77  ? 11.647  32.431  20.193  1.00 191.41 ? 77   GLU B HG3    1 
ATOM   7275  N  N      . LEU B 2 78  ? 7.735   31.508  16.742  1.00 161.07 ? 78   LEU B N      1 
ATOM   7276  C  CA     . LEU B 2 78  ? 6.669   32.007  15.883  1.00 162.11 ? 78   LEU B CA     1 
ATOM   7277  C  C      . LEU B 2 78  ? 5.374   31.262  16.175  1.00 163.80 ? 78   LEU B C      1 
ATOM   7278  O  O      . LEU B 2 78  ? 4.295   31.853  16.185  1.00 162.34 ? 78   LEU B O      1 
ATOM   7279  C  CB     . LEU B 2 78  ? 7.041   31.843  14.407  1.00 161.24 ? 78   LEU B CB     1 
ATOM   7280  C  CG     . LEU B 2 78  ? 7.876   32.955  13.773  1.00 167.42 ? 78   LEU B CG     1 
ATOM   7281  C  CD1    . LEU B 2 78  ? 8.735   32.401  12.646  1.00 156.32 ? 78   LEU B CD1    1 
ATOM   7282  C  CD2    . LEU B 2 78  ? 6.974   34.069  13.264  1.00 157.03 ? 78   LEU B CD2    1 
ATOM   7283  H  H      . LEU B 2 78  ? 8.343   31.057  16.333  1.00 193.29 ? 78   LEU B H      1 
ATOM   7284  H  HA     . LEU B 2 78  ? 6.527   32.950  16.060  1.00 194.53 ? 78   LEU B HA     1 
ATOM   7285  H  HB2    . LEU B 2 78  ? 7.545   31.019  14.313  1.00 193.49 ? 78   LEU B HB2    1 
ATOM   7286  H  HB3    . LEU B 2 78  ? 6.220   31.775  13.895  1.00 193.49 ? 78   LEU B HB3    1 
ATOM   7287  H  HG     . LEU B 2 78  ? 8.467   33.330  14.445  1.00 200.90 ? 78   LEU B HG     1 
ATOM   7288  H  HD11   . LEU B 2 78  ? 8.156   32.011  11.972  1.00 187.58 ? 78   LEU B HD11   1 
ATOM   7289  H  HD12   . LEU B 2 78  ? 9.254   33.123  12.261  1.00 187.58 ? 78   LEU B HD12   1 
ATOM   7290  H  HD13   . LEU B 2 78  ? 9.327   31.722  13.006  1.00 187.58 ? 78   LEU B HD13   1 
ATOM   7291  H  HD21   . LEU B 2 78  ? 6.470   34.431  14.009  1.00 188.43 ? 78   LEU B HD21   1 
ATOM   7292  H  HD22   . LEU B 2 78  ? 7.524   34.762  12.867  1.00 188.43 ? 78   LEU B HD22   1 
ATOM   7293  H  HD23   . LEU B 2 78  ? 6.368   33.705  12.600  1.00 188.43 ? 78   LEU B HD23   1 
ATOM   7294  N  N      . ARG B 2 79  ? 5.488   29.958  16.408  1.00 166.97 ? 79   ARG B N      1 
ATOM   7295  C  CA     . ARG B 2 79  ? 4.335   29.141  16.768  1.00 163.67 ? 79   ARG B CA     1 
ATOM   7296  C  C      . ARG B 2 79  ? 3.776   29.537  18.135  1.00 174.67 ? 79   ARG B C      1 
ATOM   7297  O  O      . ARG B 2 79  ? 2.561   29.596  18.325  1.00 174.44 ? 79   ARG B O      1 
ATOM   7298  C  CB     . ARG B 2 79  ? 4.718   27.661  16.762  1.00 155.30 ? 79   ARG B CB     1 
ATOM   7299  C  CG     . ARG B 2 79  ? 3.539   26.707  16.924  1.00 151.29 ? 79   ARG B CG     1 
ATOM   7300  C  CD     . ARG B 2 79  ? 3.985   25.328  17.386  1.00 161.31 ? 79   ARG B CD     1 
ATOM   7301  N  NE     . ARG B 2 79  ? 4.878   25.408  18.539  1.00 180.57 ? 79   ARG B NE     1 
ATOM   7302  C  CZ     . ARG B 2 79  ? 4.488   25.346  19.809  1.00 178.16 ? 79   ARG B CZ     1 
ATOM   7303  N  NH1    . ARG B 2 79  ? 3.206   25.207  20.120  1.00 177.97 ? 79   ARG B NH1    1 
ATOM   7304  N  NH2    . ARG B 2 79  ? 5.389   25.434  20.778  1.00 165.36 ? 79   ARG B NH2    1 
ATOM   7305  H  H      . ARG B 2 79  ? 6.227   29.520  16.364  1.00 200.36 ? 79   ARG B H      1 
ATOM   7306  H  HA     . ARG B 2 79  ? 3.637   29.273  16.108  1.00 196.40 ? 79   ARG B HA     1 
ATOM   7307  H  HB2    . ARG B 2 79  ? 5.150   27.455  15.918  1.00 186.36 ? 79   ARG B HB2    1 
ATOM   7308  H  HB3    . ARG B 2 79  ? 5.333   27.496  17.493  1.00 186.36 ? 79   ARG B HB3    1 
ATOM   7309  H  HG2    . ARG B 2 79  ? 2.928   27.065  17.587  1.00 181.55 ? 79   ARG B HG2    1 
ATOM   7310  H  HG3    . ARG B 2 79  ? 3.088   26.610  16.071  1.00 181.55 ? 79   ARG B HG3    1 
ATOM   7311  H  HD2    . ARG B 2 79  ? 3.206   24.809  17.641  1.00 193.58 ? 79   ARG B HD2    1 
ATOM   7312  H  HD3    . ARG B 2 79  ? 4.460   24.887  16.664  1.00 193.58 ? 79   ARG B HD3    1 
ATOM   7313  H  HE     . ARG B 2 79  ? 5.719   25.504  18.385  1.00 216.68 ? 79   ARG B HE     1 
ATOM   7314  H  HH11   . ARG B 2 79  ? 2.616   25.151  19.496  1.00 213.56 ? 79   ARG B HH11   1 
ATOM   7315  H  HH12   . ARG B 2 79  ? 2.965   25.169  20.944  1.00 213.56 ? 79   ARG B HH12   1 
ATOM   7316  H  HH21   . ARG B 2 79  ? 6.222   25.525  20.583  1.00 198.43 ? 79   ARG B HH21   1 
ATOM   7317  H  HH22   . ARG B 2 79  ? 5.142   25.395  21.600  1.00 198.43 ? 79   ARG B HH22   1 
ATOM   7318  N  N      . LYS B 2 80  ? 4.675   29.809  19.081  1.00 174.65 ? 80   LYS B N      1 
ATOM   7319  C  CA     . LYS B 2 80  ? 4.292   30.121  20.458  1.00 161.69 ? 80   LYS B CA     1 
ATOM   7320  C  C      . LYS B 2 80  ? 3.603   31.476  20.589  1.00 158.87 ? 80   LYS B C      1 
ATOM   7321  O  O      . LYS B 2 80  ? 2.745   31.666  21.453  1.00 149.91 ? 80   LYS B O      1 
ATOM   7322  C  CB     . LYS B 2 80  ? 5.522   30.100  21.372  1.00 157.24 ? 80   LYS B CB     1 
ATOM   7323  C  CG     . LYS B 2 80  ? 6.046   28.714  21.717  1.00 166.26 ? 80   LYS B CG     1 
ATOM   7324  C  CD     . LYS B 2 80  ? 7.250   28.803  22.650  1.00 162.57 ? 80   LYS B CD     1 
ATOM   7325  C  CE     . LYS B 2 80  ? 7.780   27.426  23.021  1.00 159.21 ? 80   LYS B CE     1 
ATOM   7326  N  NZ     . LYS B 2 80  ? 8.998   27.501  23.877  1.00 142.25 ? 80   LYS B NZ     1 
ATOM   7327  H  H      . LYS B 2 80  ? 5.525   29.818  18.948  1.00 209.58 ? 80   LYS B H      1 
ATOM   7328  H  HA     . LYS B 2 80  ? 3.675   29.442  20.774  1.00 194.02 ? 80   LYS B HA     1 
ATOM   7329  H  HB2    . LYS B 2 80  ? 6.240   30.582  20.933  1.00 188.69 ? 80   LYS B HB2    1 
ATOM   7330  H  HB3    . LYS B 2 80  ? 5.296   30.542  22.204  1.00 188.69 ? 80   LYS B HB3    1 
ATOM   7331  H  HG2    . LYS B 2 80  ? 5.350   28.209  22.165  1.00 199.51 ? 80   LYS B HG2    1 
ATOM   7332  H  HG3    . LYS B 2 80  ? 6.322   28.262  20.905  1.00 199.51 ? 80   LYS B HG3    1 
ATOM   7333  H  HD2    . LYS B 2 80  ? 7.961   29.292  22.207  1.00 195.09 ? 80   LYS B HD2    1 
ATOM   7334  H  HD3    . LYS B 2 80  ? 6.988   29.258  23.466  1.00 195.09 ? 80   LYS B HD3    1 
ATOM   7335  H  HE2    . LYS B 2 80  ? 7.096   26.945  23.513  1.00 191.06 ? 80   LYS B HE2    1 
ATOM   7336  H  HE3    . LYS B 2 80  ? 8.009   26.945  22.211  1.00 191.06 ? 80   LYS B HE3    1 
ATOM   7337  H  HZ1    . LYS B 2 80  ? 8.813   27.934  24.632  1.00 170.70 ? 80   LYS B HZ1    1 
ATOM   7338  H  HZ2    . LYS B 2 80  ? 9.281   26.681  24.075  1.00 170.70 ? 80   LYS B HZ2    1 
ATOM   7339  H  HZ3    . LYS B 2 80  ? 9.646   27.934  23.446  1.00 170.70 ? 80   LYS B HZ3    1 
ATOM   7340  N  N      . LEU B 2 81  ? 3.986   32.409  19.723  1.00 161.48 ? 81   LEU B N      1 
ATOM   7341  C  CA     . LEU B 2 81  ? 3.469   33.773  19.765  1.00 154.15 ? 81   LEU B CA     1 
ATOM   7342  C  C      . LEU B 2 81  ? 2.399   34.003  18.697  1.00 157.95 ? 81   LEU B C      1 
ATOM   7343  O  O      . LEU B 2 81  ? 2.209   35.127  18.233  1.00 162.02 ? 81   LEU B O      1 
ATOM   7344  C  CB     . LEU B 2 81  ? 4.619   34.772  19.606  1.00 150.50 ? 81   LEU B CB     1 
ATOM   7345  C  CG     . LEU B 2 81  ? 5.662   34.754  20.731  1.00 144.56 ? 81   LEU B CG     1 
ATOM   7346  C  CD1    . LEU B 2 81  ? 6.827   35.670  20.397  1.00 133.62 ? 81   LEU B CD1    1 
ATOM   7347  C  CD2    . LEU B 2 81  ? 5.052   35.156  22.070  1.00 147.73 ? 81   LEU B CD2    1 
ATOM   7348  H  H      . LEU B 2 81  ? 4.554   32.274  19.091  1.00 193.77 ? 81   LEU B H      1 
ATOM   7349  H  HA     . LEU B 2 81  ? 3.060   33.926  20.631  1.00 184.98 ? 81   LEU B HA     1 
ATOM   7350  H  HB2    . LEU B 2 81  ? 5.082   34.579  18.775  1.00 180.60 ? 81   LEU B HB2    1 
ATOM   7351  H  HB3    . LEU B 2 81  ? 4.246   35.667  19.568  1.00 180.60 ? 81   LEU B HB3    1 
ATOM   7352  H  HG     . LEU B 2 81  ? 6.010   33.853  20.821  1.00 173.47 ? 81   LEU B HG     1 
ATOM   7353  H  HD11   . LEU B 2 81  ? 6.495   36.575  20.286  1.00 160.35 ? 81   LEU B HD11   1 
ATOM   7354  H  HD12   . LEU B 2 81  ? 7.470   35.640  21.122  1.00 160.35 ? 81   LEU B HD12   1 
ATOM   7355  H  HD13   . LEU B 2 81  ? 7.241   35.366  19.574  1.00 160.35 ? 81   LEU B HD13   1 
ATOM   7356  H  HD21   . LEU B 2 81  ? 4.344   34.531  22.293  1.00 177.28 ? 81   LEU B HD21   1 
ATOM   7357  H  HD22   . LEU B 2 81  ? 5.742   35.131  22.751  1.00 177.28 ? 81   LEU B HD22   1 
ATOM   7358  H  HD23   . LEU B 2 81  ? 4.691   36.053  21.996  1.00 177.28 ? 81   LEU B HD23   1 
ATOM   7359  N  N      . LYS B 2 82  ? 1.757   32.914  18.277  1.00 163.11 ? 82   LYS B N      1 
ATOM   7360  C  CA     . LYS B 2 82  ? 0.619   32.933  17.347  1.00 167.63 ? 82   LYS B CA     1 
ATOM   7361  C  C      . LYS B 2 82  ? 0.862   33.756  16.075  1.00 160.33 ? 82   LYS B C      1 
ATOM   7362  O  O      . LYS B 2 82  ? -0.046  34.424  15.578  1.00 158.77 ? 82   LYS B O      1 
ATOM   7363  C  CB     . LYS B 2 82  ? -0.655  33.423  18.068  1.00 179.51 ? 82   LYS B CB     1 
ATOM   7364  C  CG     . LYS B 2 82  ? -0.656  34.863  18.582  1.00 174.09 ? 82   LYS B CG     1 
ATOM   7365  C  CD     . LYS B 2 82  ? -1.904  35.162  19.394  1.00 170.71 ? 82   LYS B CD     1 
ATOM   7366  C  CE     . LYS B 2 82  ? -1.865  36.566  19.974  1.00 162.19 ? 82   LYS B CE     1 
ATOM   7367  N  NZ     . LYS B 2 82  ? -1.797  37.606  18.911  1.00 154.82 ? 82   LYS B NZ     1 
ATOM   7368  H  H      . LYS B 2 82  ? 1.970   32.118  18.526  1.00 195.73 ? 82   LYS B H      1 
ATOM   7369  H  HA     . LYS B 2 82  ? 0.451   32.021  17.064  1.00 201.16 ? 82   LYS B HA     1 
ATOM   7370  H  HB2    . LYS B 2 82  ? -1.400  33.339  17.452  1.00 215.41 ? 82   LYS B HB2    1 
ATOM   7371  H  HB3    . LYS B 2 82  ? -0.808  32.847  18.833  1.00 215.41 ? 82   LYS B HB3    1 
ATOM   7372  H  HG2    . LYS B 2 82  ? 0.117   35.000  19.151  1.00 208.91 ? 82   LYS B HG2    1 
ATOM   7373  H  HG3    . LYS B 2 82  ? -0.630  35.472  17.828  1.00 208.91 ? 82   LYS B HG3    1 
ATOM   7374  H  HD2    . LYS B 2 82  ? -2.684  35.091  18.820  1.00 204.85 ? 82   LYS B HD2    1 
ATOM   7375  H  HD3    . LYS B 2 82  ? -1.968  34.531  20.127  1.00 204.85 ? 82   LYS B HD3    1 
ATOM   7376  H  HE2    . LYS B 2 82  ? -2.669  36.718  20.495  1.00 194.62 ? 82   LYS B HE2    1 
ATOM   7377  H  HE3    . LYS B 2 82  ? -1.080  36.656  20.537  1.00 194.62 ? 82   LYS B HE3    1 
ATOM   7378  H  HZ1    . LYS B 2 82  ? -2.510  37.547  18.383  1.00 185.79 ? 82   LYS B HZ1    1 
ATOM   7379  H  HZ2    . LYS B 2 82  ? -1.775  38.416  19.280  1.00 185.79 ? 82   LYS B HZ2    1 
ATOM   7380  H  HZ3    . LYS B 2 82  ? -1.063  37.491  18.421  1.00 185.79 ? 82   LYS B HZ3    1 
ATOM   7381  N  N      . PHE B 2 83  ? 2.088   33.697  15.557  1.00 160.40 ? 83   PHE B N      1 
ATOM   7382  C  CA     . PHE B 2 83  ? 2.428   34.318  14.275  1.00 166.94 ? 83   PHE B CA     1 
ATOM   7383  C  C      . PHE B 2 83  ? 2.853   33.273  13.243  1.00 167.90 ? 83   PHE B C      1 
ATOM   7384  O  O      . PHE B 2 83  ? 4.012   32.856  13.217  1.00 166.26 ? 83   PHE B O      1 
ATOM   7385  C  CB     . PHE B 2 83  ? 3.549   35.346  14.453  1.00 162.68 ? 83   PHE B CB     1 
ATOM   7386  C  CG     . PHE B 2 83  ? 3.182   36.507  15.335  1.00 163.25 ? 83   PHE B CG     1 
ATOM   7387  C  CD1    . PHE B 2 83  ? 1.972   37.165  15.179  1.00 161.99 ? 83   PHE B CD1    1 
ATOM   7388  C  CD2    . PHE B 2 83  ? 4.056   36.950  16.314  1.00 157.12 ? 83   PHE B CD2    1 
ATOM   7389  C  CE1    . PHE B 2 83  ? 1.639   38.236  15.989  1.00 152.86 ? 83   PHE B CE1    1 
ATOM   7390  C  CE2    . PHE B 2 83  ? 3.729   38.019  17.125  1.00 153.56 ? 83   PHE B CE2    1 
ATOM   7391  C  CZ     . PHE B 2 83  ? 2.520   38.663  16.963  1.00 148.02 ? 83   PHE B CZ     1 
ATOM   7392  H  H      . PHE B 2 83  ? 2.750   33.298  15.933  1.00 192.48 ? 83   PHE B H      1 
ATOM   7393  H  HA     . PHE B 2 83  ? 1.648   34.780  13.930  1.00 200.33 ? 83   PHE B HA     1 
ATOM   7394  H  HB2    . PHE B 2 83  ? 4.317   34.905  14.849  1.00 195.22 ? 83   PHE B HB2    1 
ATOM   7395  H  HB3    . PHE B 2 83  ? 3.788   35.700  13.582  1.00 195.22 ? 83   PHE B HB3    1 
ATOM   7396  H  HD1    . PHE B 2 83  ? 1.375   36.881  14.524  1.00 194.39 ? 83   PHE B HD1    1 
ATOM   7397  H  HD2    . PHE B 2 83  ? 4.872   36.519  16.428  1.00 188.55 ? 83   PHE B HD2    1 
ATOM   7398  H  HE1    . PHE B 2 83  ? 0.824   38.668  15.877  1.00 183.43 ? 83   PHE B HE1    1 
ATOM   7399  H  HE2    . PHE B 2 83  ? 4.324   38.305  17.781  1.00 184.27 ? 83   PHE B HE2    1 
ATOM   7400  H  HZ     . PHE B 2 83  ? 2.298   39.383  17.508  1.00 177.63 ? 83   PHE B HZ     1 
ATOM   7401  N  N      . SER B 2 84  ? 1.915   32.851  12.398  1.00 165.42 ? 84   SER B N      1 
ATOM   7402  C  CA     . SER B 2 84  ? 2.176   31.797  11.417  1.00 158.12 ? 84   SER B CA     1 
ATOM   7403  C  C      . SER B 2 84  ? 3.286   32.197  10.449  1.00 155.02 ? 84   SER B C      1 
ATOM   7404  O  O      . SER B 2 84  ? 3.421   31.614  9.372   1.00 148.07 ? 84   SER B O      1 
ATOM   7405  C  CB     . SER B 2 84  ? 0.904   31.465  10.632  1.00 154.18 ? 84   SER B CB     1 
ATOM   7406  O  OG     . SER B 2 84  ? 1.165   30.522  9.603   1.00 139.32 ? 84   SER B OG     1 
ATOM   7407  H  H      . SER B 2 84  ? 1.113   33.160  12.371  1.00 198.50 ? 84   SER B H      1 
ATOM   7408  H  HA     . SER B 2 84  ? 2.459   30.995  11.883  1.00 189.74 ? 84   SER B HA     1 
ATOM   7409  H  HB2    . SER B 2 84  ? 0.247   31.092  11.241  1.00 185.02 ? 84   SER B HB2    1 
ATOM   7410  H  HB3    . SER B 2 84  ? 0.560   32.279  10.233  1.00 185.02 ? 84   SER B HB3    1 
ATOM   7411  H  HG     . SER B 2 84  ? 1.732   30.832  9.067   1.00 167.19 ? 84   SER B HG     1 
ATOM   7412  N  N      . PRO B 2 95  ? -3.284  34.871  12.955  1.00 160.45 ? 95   PRO B N      1 
ATOM   7413  C  CA     . PRO B 2 95  ? -2.426  34.068  12.077  1.00 153.55 ? 95   PRO B CA     1 
ATOM   7414  C  C      . PRO B 2 95  ? -1.749  34.945  11.013  1.00 157.95 ? 95   PRO B C      1 
ATOM   7415  O  O      . PRO B 2 95  ? -0.702  35.519  11.313  1.00 156.89 ? 95   PRO B O      1 
ATOM   7416  C  CB     . PRO B 2 95  ? -3.404  33.039  11.481  1.00 149.34 ? 95   PRO B CB     1 
ATOM   7417  C  CG     . PRO B 2 95  ? -4.518  32.963  12.470  1.00 150.21 ? 95   PRO B CG     1 
ATOM   7418  C  CD     . PRO B 2 95  ? -4.659  34.350  13.011  1.00 153.59 ? 95   PRO B CD     1 
ATOM   7419  H  HA     . PRO B 2 95  ? -1.748  33.606  12.595  1.00 184.26 ? 95   PRO B HA     1 
ATOM   7420  H  HB2    . PRO B 2 95  ? -3.727  33.352  10.621  1.00 179.20 ? 95   PRO B HB2    1 
ATOM   7421  H  HB3    . PRO B 2 95  ? -2.963  32.179  11.392  1.00 179.20 ? 95   PRO B HB3    1 
ATOM   7422  H  HG2    . PRO B 2 95  ? -5.333  32.686  12.023  1.00 180.26 ? 95   PRO B HG2    1 
ATOM   7423  H  HG3    . PRO B 2 95  ? -4.286  32.341  13.177  1.00 180.26 ? 95   PRO B HG3    1 
ATOM   7424  H  HD2    . PRO B 2 95  ? -5.244  34.877  12.445  1.00 184.31 ? 95   PRO B HD2    1 
ATOM   7425  H  HD3    . PRO B 2 95  ? -4.975  34.326  13.928  1.00 184.31 ? 95   PRO B HD3    1 
ATOM   7426  N  N      . ARG B 2 96  ? -2.314  35.049  9.812   1.00 154.65 ? 96   ARG B N      1 
ATOM   7427  C  CA     . ARG B 2 96  ? -1.797  35.957  8.792   1.00 147.32 ? 96   ARG B CA     1 
ATOM   7428  C  C      . ARG B 2 96  ? -2.214  37.379  9.130   1.00 144.34 ? 96   ARG B C      1 
ATOM   7429  O  O      . ARG B 2 96  ? -1.480  38.339  8.895   1.00 137.13 ? 96   ARG B O      1 
ATOM   7430  C  CB     . ARG B 2 96  ? -2.315  35.575  7.404   1.00 155.94 ? 96   ARG B CB     1 
ATOM   7431  C  CG     . ARG B 2 96  ? -1.407  34.642  6.621   1.00 161.21 ? 96   ARG B CG     1 
ATOM   7432  C  CD     . ARG B 2 96  ? -2.136  34.025  5.435   1.00 153.70 ? 96   ARG B CD     1 
ATOM   7433  N  NE     . ARG B 2 96  ? -1.297  33.075  4.709   1.00 157.08 ? 96   ARG B NE     1 
ATOM   7434  C  CZ     . ARG B 2 96  ? -1.751  32.182  3.834   1.00 166.87 ? 96   ARG B CZ     1 
ATOM   7435  N  NH1    . ARG B 2 96  ? -3.048  32.105  3.562   1.00 175.36 ? 96   ARG B NH1    1 
ATOM   7436  N  NH2    . ARG B 2 96  ? -0.904  31.363  3.224   1.00 156.54 ? 96   ARG B NH2    1 
ATOM   7437  H  H      . ARG B 2 96  ? -3.004  34.601  9.563   1.00 185.58 ? 96   ARG B H      1 
ATOM   7438  H  HA     . ARG B 2 96  ? -0.828  35.914  8.781   1.00 176.79 ? 96   ARG B HA     1 
ATOM   7439  H  HB2    . ARG B 2 96  ? -3.173  35.134  7.504   1.00 187.13 ? 96   ARG B HB2    1 
ATOM   7440  H  HB3    . ARG B 2 96  ? -2.424  36.385  6.881   1.00 187.13 ? 96   ARG B HB3    1 
ATOM   7441  H  HG2    . ARG B 2 96  ? -0.646  35.141  6.285   1.00 193.45 ? 96   ARG B HG2    1 
ATOM   7442  H  HG3    . ARG B 2 96  ? -1.108  33.924  7.201   1.00 193.45 ? 96   ARG B HG3    1 
ATOM   7443  H  HD2    . ARG B 2 96  ? -2.921  33.552  5.754   1.00 184.44 ? 96   ARG B HD2    1 
ATOM   7444  H  HD3    . ARG B 2 96  ? -2.397  34.729  4.820   1.00 184.44 ? 96   ARG B HD3    1 
ATOM   7445  H  HE     . ARG B 2 96  ? -0.450  33.094  4.858   1.00 188.49 ? 96   ARG B HE     1 
ATOM   7446  H  HH11   . ARG B 2 96  ? -3.602  32.634  3.954   1.00 210.44 ? 96   ARG B HH11   1 
ATOM   7447  H  HH12   . ARG B 2 96  ? -3.335  31.525  2.995   1.00 210.44 ? 96   ARG B HH12   1 
ATOM   7448  H  HH21   . ARG B 2 96  ? -0.063  31.409  3.396   1.00 187.85 ? 96   ARG B HH21   1 
ATOM   7449  H  HH22   . ARG B 2 96  ? -1.197  30.785  2.659   1.00 187.85 ? 96   ARG B HH22   1 
ATOM   7450  N  N      . ARG B 2 97  ? -3.413  37.489  9.690   1.00 150.46 ? 97   ARG B N      1 
ATOM   7451  C  CA     . ARG B 2 97  ? -3.983  38.761  10.109  1.00 155.83 ? 97   ARG B CA     1 
ATOM   7452  C  C      . ARG B 2 97  ? -3.180  39.370  11.253  1.00 151.87 ? 97   ARG B C      1 
ATOM   7453  O  O      . ARG B 2 97  ? -2.919  40.573  11.277  1.00 151.21 ? 97   ARG B O      1 
ATOM   7454  C  CB     . ARG B 2 97  ? -5.441  38.556  10.526  1.00 155.07 ? 97   ARG B CB     1 
ATOM   7455  C  CG     . ARG B 2 97  ? -6.188  39.817  10.926  1.00 152.27 ? 97   ARG B CG     1 
ATOM   7456  C  CD     . ARG B 2 97  ? -7.419  39.468  11.746  1.00 147.38 ? 97   ARG B CD     1 
ATOM   7457  N  NE     . ARG B 2 97  ? -7.073  38.924  13.058  1.00 148.90 ? 97   ARG B NE     1 
ATOM   7458  C  CZ     . ARG B 2 97  ? -6.813  39.660  14.135  1.00 156.18 ? 97   ARG B CZ     1 
ATOM   7459  N  NH1    . ARG B 2 97  ? -6.852  40.985  14.075  1.00 155.57 ? 97   ARG B NH1    1 
ATOM   7460  N  NH2    . ARG B 2 97  ? -6.508  39.066  15.280  1.00 148.87 ? 97   ARG B NH2    1 
ATOM   7461  H  H      . ARG B 2 97  ? -3.930  36.819  9.842   1.00 180.55 ? 97   ARG B H      1 
ATOM   7462  H  HA     . ARG B 2 97  ? -3.965  39.380  9.362   1.00 186.99 ? 97   ARG B HA     1 
ATOM   7463  H  HB2    . ARG B 2 97  ? -5.920  38.157  9.783   1.00 186.09 ? 97   ARG B HB2    1 
ATOM   7464  H  HB3    . ARG B 2 97  ? -5.461  37.953  11.286  1.00 186.09 ? 97   ARG B HB3    1 
ATOM   7465  H  HG2    . ARG B 2 97  ? -5.609  40.379  11.464  1.00 182.73 ? 97   ARG B HG2    1 
ATOM   7466  H  HG3    . ARG B 2 97  ? -6.474  40.289  10.128  1.00 182.73 ? 97   ARG B HG3    1 
ATOM   7467  H  HD2    . ARG B 2 97  ? -7.948  40.269  11.882  1.00 176.85 ? 97   ARG B HD2    1 
ATOM   7468  H  HD3    . ARG B 2 97  ? -7.939  38.801  11.271  1.00 176.85 ? 97   ARG B HD3    1 
ATOM   7469  H  HE     . ARG B 2 97  ? -7.035  38.069  13.139  1.00 178.68 ? 97   ARG B HE     1 
ATOM   7470  H  HH11   . ARG B 2 97  ? -7.049  41.376  13.335  1.00 186.68 ? 97   ARG B HH11   1 
ATOM   7471  H  HH12   . ARG B 2 97  ? -6.682  41.452  14.777  1.00 186.68 ? 97   ARG B HH12   1 
ATOM   7472  H  HH21   . ARG B 2 97  ? -6.480  38.208  15.326  1.00 178.65 ? 97   ARG B HH21   1 
ATOM   7473  H  HH22   . ARG B 2 97  ? -6.338  39.539  15.978  1.00 178.65 ? 97   ARG B HH22   1 
ATOM   7474  N  N      . ARG B 2 98  ? -2.793  38.525  12.198  1.00 150.46 ? 98   ARG B N      1 
ATOM   7475  C  CA     . ARG B 2 98  ? -2.025  38.954  13.359  1.00 148.26 ? 98   ARG B CA     1 
ATOM   7476  C  C      . ARG B 2 98  ? -0.647  39.512  12.987  1.00 140.19 ? 98   ARG B C      1 
ATOM   7477  O  O      . ARG B 2 98  ? -0.240  40.553  13.502  1.00 141.53 ? 98   ARG B O      1 
ATOM   7478  C  CB     . ARG B 2 98  ? -1.886  37.784  14.334  1.00 153.18 ? 98   ARG B CB     1 
ATOM   7479  C  CG     . ARG B 2 98  ? -3.125  37.594  15.195  1.00 161.94 ? 98   ARG B CG     1 
ATOM   7480  C  CD     . ARG B 2 98  ? -3.065  36.333  16.035  1.00 169.99 ? 98   ARG B CD     1 
ATOM   7481  N  NE     . ARG B 2 98  ? -4.274  36.171  16.840  1.00 176.81 ? 98   ARG B NE     1 
ATOM   7482  C  CZ     . ARG B 2 98  ? -4.742  35.005  17.277  1.00 175.40 ? 98   ARG B CZ     1 
ATOM   7483  N  NH1    . ARG B 2 98  ? -4.108  33.874  16.993  1.00 175.44 ? 98   ARG B NH1    1 
ATOM   7484  N  NH2    . ARG B 2 98  ? -5.850  34.969  18.005  1.00 172.30 ? 98   ARG B NH2    1 
ATOM   7485  H  H      . ARG B 2 98  ? -2.966  37.682  12.190  1.00 180.55 ? 98   ARG B H      1 
ATOM   7486  H  HA     . ARG B 2 98  ? -2.514  39.658  13.812  1.00 177.91 ? 98   ARG B HA     1 
ATOM   7487  H  HB2    . ARG B 2 98  ? -1.741  36.968  13.831  1.00 183.82 ? 98   ARG B HB2    1 
ATOM   7488  H  HB3    . ARG B 2 98  ? -1.133  37.950  14.923  1.00 183.82 ? 98   ARG B HB3    1 
ATOM   7489  H  HG2    . ARG B 2 98  ? -3.212  38.351  15.796  1.00 194.32 ? 98   ARG B HG2    1 
ATOM   7490  H  HG3    . ARG B 2 98  ? -3.904  37.535  14.620  1.00 194.32 ? 98   ARG B HG3    1 
ATOM   7491  H  HD2    . ARG B 2 98  ? -2.982  35.563  15.451  1.00 203.98 ? 98   ARG B HD2    1 
ATOM   7492  H  HD3    . ARG B 2 98  ? -2.304  36.383  16.635  1.00 203.98 ? 98   ARG B HD3    1 
ATOM   7493  H  HE     . ARG B 2 98  ? -4.715  36.880  17.045  1.00 212.17 ? 98   ARG B HE     1 
ATOM   7494  H  HH11   . ARG B 2 98  ? -3.389  33.892  16.522  1.00 210.53 ? 98   ARG B HH11   1 
ATOM   7495  H  HH12   . ARG B 2 98  ? -4.417  33.124  17.279  1.00 210.53 ? 98   ARG B HH12   1 
ATOM   7496  H  HH21   . ARG B 2 98  ? -6.266  35.698  18.192  1.00 206.76 ? 98   ARG B HH21   1 
ATOM   7497  H  HH22   . ARG B 2 98  ? -6.155  34.216  18.288  1.00 206.76 ? 98   ARG B HH22   1 
ATOM   7498  N  N      . ASP B 2 99  ? 0.066   38.830  12.096  1.00 142.47 ? 99   ASP B N      1 
ATOM   7499  C  CA     . ASP B 2 99  ? 1.405   39.266  11.695  1.00 139.36 ? 99   ASP B CA     1 
ATOM   7500  C  C      . ASP B 2 99  ? 1.443   40.619  10.991  1.00 136.68 ? 99   ASP B C      1 
ATOM   7501  O  O      . ASP B 2 99  ? 2.374   41.399  11.191  1.00 133.43 ? 99   ASP B O      1 
ATOM   7502  C  CB     . ASP B 2 99  ? 2.051   38.234  10.773  1.00 143.85 ? 99   ASP B CB     1 
ATOM   7503  C  CG     . ASP B 2 99  ? 3.428   38.666  10.301  1.00 141.93 ? 99   ASP B CG     1 
ATOM   7504  O  OD1    . ASP B 2 99  ? 4.416   38.395  11.014  1.00 141.30 ? 99   ASP B OD1    1 
ATOM   7505  O  OD2    . ASP B 2 99  ? 3.518   39.292  9.223   1.00 141.45 ? 99   ASP B OD2    1 
ATOM   7506  H  H      . ASP B 2 99  ? -0.200  38.110  11.708  1.00 170.96 ? 99   ASP B H      1 
ATOM   7507  H  HA     . ASP B 2 99  ? 1.957   39.335  12.490  1.00 167.23 ? 99   ASP B HA     1 
ATOM   7508  H  HB2    . ASP B 2 99  ? 2.146   37.396  11.251  1.00 172.62 ? 99   ASP B HB2    1 
ATOM   7509  H  HB3    . ASP B 2 99  ? 1.490   38.111  9.991   1.00 172.62 ? 99   ASP B HB3    1 
ATOM   7510  N  N      . HIS B 2 100 ? 0.439   40.899  10.170  1.00 140.67 ? 100  HIS B N      1 
ATOM   7511  C  CA     . HIS B 2 100 ? 0.428   42.137  9.401   1.00 145.73 ? 100  HIS B CA     1 
ATOM   7512  C  C      . HIS B 2 100 ? 0.291   43.343  10.330  1.00 141.34 ? 100  HIS B C      1 
ATOM   7513  O  O      . HIS B 2 100 ? 1.111   44.259  10.282  1.00 138.69 ? 100  HIS B O      1 
ATOM   7514  C  CB     . HIS B 2 100 ? -0.698  42.129  8.363   1.00 152.46 ? 100  HIS B CB     1 
ATOM   7515  C  CG     . HIS B 2 100 ? -0.584  43.222  7.344   1.00 157.80 ? 100  HIS B CG     1 
ATOM   7516  N  ND1    . HIS B 2 100 ? -1.674  43.740  6.678   1.00 155.26 ? 100  HIS B ND1    1 
ATOM   7517  C  CD2    . HIS B 2 100 ? 0.496   43.886  6.867   1.00 152.32 ? 100  HIS B CD2    1 
ATOM   7518  C  CE1    . HIS B 2 100 ? -1.272  44.681  5.842   1.00 153.23 ? 100  HIS B CE1    1 
ATOM   7519  N  NE2    . HIS B 2 100 ? 0.041   44.789  5.938   1.00 145.15 ? 100  HIS B NE2    1 
ATOM   7520  H  H      . HIS B 2 100 ? -0.244  40.393  10.040  1.00 168.80 ? 100  HIS B H      1 
ATOM   7521  H  HA     . HIS B 2 100 ? 1.270   42.219  8.927   1.00 174.87 ? 100  HIS B HA     1 
ATOM   7522  H  HB2    . HIS B 2 100 ? -0.683  41.281  7.891   1.00 182.95 ? 100  HIS B HB2    1 
ATOM   7523  H  HB3    . HIS B 2 100 ? -1.546  42.236  8.820   1.00 182.95 ? 100  HIS B HB3    1 
ATOM   7524  H  HD1    . HIS B 2 100 ? -2.490  43.492  6.792   1.00 186.31 ? 100  HIS B HD1    1 
ATOM   7525  H  HD2    . HIS B 2 100 ? 1.381   43.758  7.125   1.00 182.79 ? 100  HIS B HD2    1 
ATOM   7526  H  HE1    . HIS B 2 100 ? -1.820  45.181  5.282   1.00 183.88 ? 100  HIS B HE1    1 
ATOM   7527  H  HE2    . HIS B 2 100 ? 0.531   45.336  5.490   1.00 174.18 ? 100  HIS B HE2    1 
ATOM   7528  N  N      . ILE B 2 101 ? -0.738  43.343  11.172  1.00 131.36 ? 101  ILE B N      1 
ATOM   7529  C  CA     . ILE B 2 101 ? -0.985  44.475  12.062  1.00 135.57 ? 101  ILE B CA     1 
ATOM   7530  C  C      . ILE B 2 101 ? 0.174   44.700  13.031  1.00 136.19 ? 101  ILE B C      1 
ATOM   7531  O  O      . ILE B 2 101 ? 0.613   45.834  13.213  1.00 131.23 ? 101  ILE B O      1 
ATOM   7532  C  CB     . ILE B 2 101 ? -2.282  44.277  12.888  1.00 134.16 ? 101  ILE B CB     1 
ATOM   7533  C  CG1    . ILE B 2 101 ? -3.489  44.121  11.958  1.00 142.21 ? 101  ILE B CG1    1 
ATOM   7534  C  CG2    . ILE B 2 101 ? -2.496  45.451  13.851  1.00 122.48 ? 101  ILE B CG2    1 
ATOM   7535  C  CD1    . ILE B 2 101 ? -4.803  43.847  12.678  1.00 145.04 ? 101  ILE B CD1    1 
ATOM   7536  H  H      . ILE B 2 101 ? -1.307  42.702  11.248  1.00 157.64 ? 101  ILE B H      1 
ATOM   7537  H  HA     . ILE B 2 101 ? -1.090  45.278  11.528  1.00 162.68 ? 101  ILE B HA     1 
ATOM   7538  H  HB     . ILE B 2 101 ? -2.191  43.465  13.410  1.00 160.99 ? 101  ILE B HB     1 
ATOM   7539  H  HG12   . ILE B 2 101 ? -3.598  44.940  11.449  1.00 170.65 ? 101  ILE B HG12   1 
ATOM   7540  H  HG13   . ILE B 2 101 ? -3.324  43.380  11.355  1.00 170.65 ? 101  ILE B HG13   1 
ATOM   7541  H  HG21   . ILE B 2 101 ? -2.568  46.271  13.338  1.00 146.98 ? 101  ILE B HG21   1 
ATOM   7542  H  HG22   . ILE B 2 101 ? -3.312  45.302  14.354  1.00 146.98 ? 101  ILE B HG22   1 
ATOM   7543  H  HG23   . ILE B 2 101 ? -1.739  45.505  14.456  1.00 146.98 ? 101  ILE B HG23   1 
ATOM   7544  H  HD11   . ILE B 2 101 ? -4.994  44.585  13.277  1.00 174.05 ? 101  ILE B HD11   1 
ATOM   7545  H  HD12   . ILE B 2 101 ? -5.511  43.762  12.020  1.00 174.05 ? 101  ILE B HD12   1 
ATOM   7546  H  HD13   . ILE B 2 101 ? -4.720  43.023  13.183  1.00 174.05 ? 101  ILE B HD13   1 
ATOM   7547  N  N      . SER B 2 102 ? 0.679   43.625  13.629  1.00 140.98 ? 102  SER B N      1 
ATOM   7548  C  CA     . SER B 2 102 ? 1.728   43.724  14.645  1.00 133.74 ? 102  SER B CA     1 
ATOM   7549  C  C      . SER B 2 102 ? 2.962   44.440  14.109  1.00 129.91 ? 102  SER B C      1 
ATOM   7550  O  O      . SER B 2 102 ? 3.604   45.213  14.823  1.00 124.79 ? 102  SER B O      1 
ATOM   7551  C  CB     . SER B 2 102 ? 2.123   42.338  15.157  1.00 126.76 ? 102  SER B CB     1 
ATOM   7552  O  OG     . SER B 2 102 ? 2.604   41.520  14.108  1.00 129.21 ? 102  SER B OG     1 
ATOM   7553  H  H      . SER B 2 102 ? 0.431   42.818  13.464  1.00 169.17 ? 102  SER B H      1 
ATOM   7554  H  HA     . SER B 2 102 ? 1.389   44.235  15.397  1.00 160.49 ? 102  SER B HA     1 
ATOM   7555  H  HB2    . SER B 2 102 ? 2.820   42.436  15.824  1.00 152.11 ? 102  SER B HB2    1 
ATOM   7556  H  HB3    . SER B 2 102 ? 1.344   41.916  15.552  1.00 152.11 ? 102  SER B HB3    1 
ATOM   7557  H  HG     . SER B 2 102 ? 2.010   41.424  13.522  1.00 155.05 ? 102  SER B HG     1 
ATOM   7558  N  N      . HIS B 2 103 ? 3.287   44.175  12.848  1.00 123.33 ? 103  HIS B N      1 
ATOM   7559  C  CA     . HIS B 2 103 ? 4.469   44.750  12.224  1.00 123.97 ? 103  HIS B CA     1 
ATOM   7560  C  C      . HIS B 2 103 ? 4.317   46.260  12.111  1.00 119.41 ? 103  HIS B C      1 
ATOM   7561  O  O      . HIS B 2 103 ? 5.277   47.006  12.298  1.00 105.14 ? 103  HIS B O      1 
ATOM   7562  C  CB     . HIS B 2 103 ? 4.678   44.124  10.841  1.00 125.34 ? 103  HIS B CB     1 
ATOM   7563  C  CG     . HIS B 2 103 ? 5.751   44.778  10.026  1.00 119.73 ? 103  HIS B CG     1 
ATOM   7564  N  ND1    . HIS B 2 103 ? 7.087   44.485  10.188  1.00 118.50 ? 103  HIS B ND1    1 
ATOM   7565  C  CD2    . HIS B 2 103 ? 5.686   45.690  9.027   1.00 115.15 ? 103  HIS B CD2    1 
ATOM   7566  C  CE1    . HIS B 2 103 ? 7.800   45.196  9.334   1.00 113.64 ? 103  HIS B CE1    1 
ATOM   7567  N  NE2    . HIS B 2 103 ? 6.974   45.935  8.617   1.00 107.38 ? 103  HIS B NE2    1 
ATOM   7568  H  H      . HIS B 2 103 ? 2.833   43.661  12.329  1.00 148.00 ? 103  HIS B H      1 
ATOM   7569  H  HA     . HIS B 2 103 ? 5.248   44.560  12.770  1.00 148.77 ? 103  HIS B HA     1 
ATOM   7570  H  HB2    . HIS B 2 103 ? 4.921   43.192  10.955  1.00 150.41 ? 103  HIS B HB2    1 
ATOM   7571  H  HB3    . HIS B 2 103 ? 3.849   44.188  10.342  1.00 150.41 ? 103  HIS B HB3    1 
ATOM   7572  H  HD1    . HIS B 2 103 ? 7.407   43.929  10.761  1.00 142.20 ? 103  HIS B HD1    1 
ATOM   7573  H  HD2    . HIS B 2 103 ? 4.914   46.081  8.685   1.00 138.19 ? 103  HIS B HD2    1 
ATOM   7574  H  HE1    . HIS B 2 103 ? 8.727   45.179  9.251   1.00 136.37 ? 103  HIS B HE1    1 
ATOM   7575  H  HE2    . HIS B 2 103 ? 7.205   46.482  7.995   1.00 128.86 ? 103  HIS B HE2    1 
ATOM   7576  N  N      . PHE B 2 104 ? 3.098   46.701  11.821  1.00 126.39 ? 104  PHE B N      1 
ATOM   7577  C  CA     . PHE B 2 104 ? 2.831   48.114  11.591  1.00 129.37 ? 104  PHE B CA     1 
ATOM   7578  C  C      . PHE B 2 104 ? 2.668   48.890  12.896  1.00 120.54 ? 104  PHE B C      1 
ATOM   7579  O  O      . PHE B 2 104 ? 2.744   50.120  12.910  1.00 118.72 ? 104  PHE B O      1 
ATOM   7580  C  CB     . PHE B 2 104 ? 1.591   48.273  10.715  1.00 130.13 ? 104  PHE B CB     1 
ATOM   7581  C  CG     . PHE B 2 104 ? 1.884   48.171  9.249   1.00 126.42 ? 104  PHE B CG     1 
ATOM   7582  C  CD1    . PHE B 2 104 ? 1.887   46.941  8.617   1.00 139.32 ? 104  PHE B CD1    1 
ATOM   7583  C  CD2    . PHE B 2 104 ? 2.179   49.301  8.508   1.00 126.31 ? 104  PHE B CD2    1 
ATOM   7584  C  CE1    . PHE B 2 104 ? 2.165   46.838  7.269   1.00 148.49 ? 104  PHE B CE1    1 
ATOM   7585  C  CE2    . PHE B 2 104 ? 2.457   49.206  7.160   1.00 148.38 ? 104  PHE B CE2    1 
ATOM   7586  C  CZ     . PHE B 2 104 ? 2.451   47.972  6.539   1.00 152.14 ? 104  PHE B CZ     1 
ATOM   7587  H  H      . PHE B 2 104 ? 2.404   46.198  11.752  1.00 151.66 ? 104  PHE B H      1 
ATOM   7588  H  HA     . PHE B 2 104 ? 3.582   48.498  11.111  1.00 155.25 ? 104  PHE B HA     1 
ATOM   7589  H  HB2    . PHE B 2 104 ? 0.955   47.576  10.941  1.00 156.16 ? 104  PHE B HB2    1 
ATOM   7590  H  HB3    . PHE B 2 104 ? 1.199   49.145  10.881  1.00 156.16 ? 104  PHE B HB3    1 
ATOM   7591  H  HD1    . PHE B 2 104 ? 2.183   50.134  8.921   1.00 151.58 ? 104  PHE B HD1    1 
ATOM   7592  H  HD2    . PHE B 2 104 ? 1.695   46.173  9.105   1.00 167.18 ? 104  PHE B HD2    1 
ATOM   7593  H  HE1    . PHE B 2 104 ? 2.650   49.972  6.670   1.00 178.06 ? 104  PHE B HE1    1 
ATOM   7594  H  HE2    . PHE B 2 104 ? 2.160   46.005  6.854   1.00 178.19 ? 104  PHE B HE2    1 
ATOM   7595  H  HZ     . PHE B 2 104 ? 2.638   47.907  5.630   1.00 182.57 ? 104  PHE B HZ     1 
ATOM   7596  N  N      . ILE B 2 105 ? 2.448   48.171  13.992  1.00 122.29 ? 105  ILE B N      1 
ATOM   7597  C  CA     . ILE B 2 105 ? 2.355   48.804  15.300  1.00 115.71 ? 105  ILE B CA     1 
ATOM   7598  C  C      . ILE B 2 105 ? 3.757   49.163  15.763  1.00 114.10 ? 105  ILE B C      1 
ATOM   7599  O  O      . ILE B 2 105 ? 3.996   50.269  16.247  1.00 117.74 ? 105  ILE B O      1 
ATOM   7600  C  CB     . ILE B 2 105 ? 1.676   47.890  16.343  1.00 108.94 ? 105  ILE B CB     1 
ATOM   7601  C  CG1    . ILE B 2 105 ? 0.217   47.637  15.954  1.00 119.91 ? 105  ILE B CG1    1 
ATOM   7602  C  CG2    . ILE B 2 105 ? 1.739   48.527  17.733  1.00 103.73 ? 105  ILE B CG2    1 
ATOM   7603  C  CD1    . ILE B 2 105 ? -0.536  46.697  16.884  1.00 118.93 ? 105  ILE B CD1    1 
ATOM   7604  H  H      . ILE B 2 105 ? 2.350   47.317  14.004  1.00 146.75 ? 105  ILE B H      1 
ATOM   7605  H  HA     . ILE B 2 105 ? 1.838   49.622  15.226  1.00 138.85 ? 105  ILE B HA     1 
ATOM   7606  H  HB     . ILE B 2 105 ? 2.144   47.041  16.367  1.00 130.72 ? 105  ILE B HB     1 
ATOM   7607  H  HG12   . ILE B 2 105 ? -0.254  48.486  15.951  1.00 143.89 ? 105  ILE B HG12   1 
ATOM   7608  H  HG13   . ILE B 2 105 ? 0.196   47.250  15.066  1.00 143.89 ? 105  ILE B HG13   1 
ATOM   7609  H  HG21   . ILE B 2 105 ? 1.280   49.381  17.709  1.00 124.48 ? 105  ILE B HG21   1 
ATOM   7610  H  HG22   . ILE B 2 105 ? 1.308   47.937  18.370  1.00 124.48 ? 105  ILE B HG22   1 
ATOM   7611  H  HG23   . ILE B 2 105 ? 2.668   48.657  17.978  1.00 124.48 ? 105  ILE B HG23   1 
ATOM   7612  H  HD11   . ILE B 2 105 ? -0.541  47.074  17.778  1.00 142.72 ? 105  ILE B HD11   1 
ATOM   7613  H  HD12   . ILE B 2 105 ? -1.446  46.597  16.563  1.00 142.72 ? 105  ILE B HD12   1 
ATOM   7614  H  HD13   . ILE B 2 105 ? -0.090  45.836  16.891  1.00 142.72 ? 105  ILE B HD13   1 
ATOM   7615  N  N      . LEU B 2 106 ? 4.680   48.219  15.610  1.00 107.74 ? 106  LEU B N      1 
ATOM   7616  C  CA     . LEU B 2 106 ? 6.046   48.414  16.072  1.00 115.35 ? 106  LEU B CA     1 
ATOM   7617  C  C      . LEU B 2 106 ? 6.763   49.498  15.271  1.00 109.92 ? 106  LEU B C      1 
ATOM   7618  O  O      . LEU B 2 106 ? 7.757   50.055  15.734  1.00 116.47 ? 106  LEU B O      1 
ATOM   7619  C  CB     . LEU B 2 106 ? 6.827   47.098  15.987  1.00 103.89 ? 106  LEU B CB     1 
ATOM   7620  C  CG     . LEU B 2 106 ? 6.465   45.974  16.966  1.00 99.93  ? 106  LEU B CG     1 
ATOM   7621  C  CD1    . LEU B 2 106 ? 7.654   45.047  17.153  1.00 103.55 ? 106  LEU B CD1    1 
ATOM   7622  C  CD2    . LEU B 2 106 ? 6.001   46.501  18.320  1.00 119.27 ? 106  LEU B CD2    1 
ATOM   7623  H  H      . LEU B 2 106 ? 4.539   47.456  15.240  1.00 129.29 ? 106  LEU B H      1 
ATOM   7624  H  HA     . LEU B 2 106 ? 6.028   48.692  17.001  1.00 138.42 ? 106  LEU B HA     1 
ATOM   7625  H  HB2    . LEU B 2 106 ? 6.709   46.740  15.093  1.00 124.66 ? 106  LEU B HB2    1 
ATOM   7626  H  HB3    . LEU B 2 106 ? 7.765   47.300  16.125  1.00 124.66 ? 106  LEU B HB3    1 
ATOM   7627  H  HG     . LEU B 2 106 ? 5.740   45.452  16.588  1.00 119.92 ? 106  LEU B HG     1 
ATOM   7628  H  HD11   . LEU B 2 106 ? 8.399   45.557  17.507  1.00 124.27 ? 106  LEU B HD11   1 
ATOM   7629  H  HD12   . LEU B 2 106 ? 7.410   44.343  17.774  1.00 124.27 ? 106  LEU B HD12   1 
ATOM   7630  H  HD13   . LEU B 2 106 ? 7.893   44.663  16.294  1.00 124.27 ? 106  LEU B HD13   1 
ATOM   7631  H  HD21   . LEU B 2 106 ? 5.214   47.053  18.191  1.00 143.12 ? 106  LEU B HD21   1 
ATOM   7632  H  HD22   . LEU B 2 106 ? 5.787   45.749  18.895  1.00 143.12 ? 106  LEU B HD22   1 
ATOM   7633  H  HD23   . LEU B 2 106 ? 6.714   47.027  18.715  1.00 143.12 ? 106  LEU B HD23   1 
ATOM   7634  N  N      . ARG B 2 107 ? 6.266   49.794  14.072  1.00 111.62 ? 107  ARG B N      1 
ATOM   7635  C  CA     . ARG B 2 107 ? 6.872   50.838  13.253  1.00 118.70 ? 107  ARG B CA     1 
ATOM   7636  C  C      . ARG B 2 107 ? 6.829   52.176  13.986  1.00 119.61 ? 107  ARG B C      1 
ATOM   7637  O  O      . ARG B 2 107 ? 7.791   52.943  13.957  1.00 126.85 ? 107  ARG B O      1 
ATOM   7638  C  CB     . ARG B 2 107 ? 6.169   50.956  11.897  1.00 120.83 ? 107  ARG B CB     1 
ATOM   7639  C  CG     . ARG B 2 107 ? 6.500   49.838  10.915  1.00 109.30 ? 107  ARG B CG     1 
ATOM   7640  C  CD     . ARG B 2 107 ? 5.911   50.125  9.541   1.00 128.14 ? 107  ARG B CD     1 
ATOM   7641  N  NE     . ARG B 2 107 ? 6.191   49.073  8.565   1.00 138.31 ? 107  ARG B NE     1 
ATOM   7642  C  CZ     . ARG B 2 107 ? 5.912   49.169  7.267   1.00 124.01 ? 107  ARG B CZ     1 
ATOM   7643  N  NH1    . ARG B 2 107 ? 5.352   50.270  6.788   1.00 116.49 ? 107  ARG B NH1    1 
ATOM   7644  N  NH2    . ARG B 2 107 ? 6.195   48.173  6.440   1.00 119.47 ? 107  ARG B NH2    1 
ATOM   7645  H  H      . ARG B 2 107 ? 5.586   49.409  13.714  1.00 133.94 ? 107  ARG B H      1 
ATOM   7646  H  HA     . ARG B 2 107 ? 7.802   50.614  13.091  1.00 142.43 ? 107  ARG B HA     1 
ATOM   7647  H  HB2    . ARG B 2 107 ? 5.210   50.945  12.043  1.00 144.99 ? 107  ARG B HB2    1 
ATOM   7648  H  HB3    . ARG B 2 107 ? 6.428   51.795  11.485  1.00 144.99 ? 107  ARG B HB3    1 
ATOM   7649  H  HG2    . ARG B 2 107 ? 7.463   49.764  10.826  1.00 131.16 ? 107  ARG B HG2    1 
ATOM   7650  H  HG3    . ARG B 2 107 ? 6.126   49.004  11.240  1.00 131.16 ? 107  ARG B HG3    1 
ATOM   7651  H  HD2    . ARG B 2 107 ? 4.948   50.208  9.622   1.00 153.77 ? 107  ARG B HD2    1 
ATOM   7652  H  HD3    . ARG B 2 107 ? 6.288   50.953  9.204   1.00 153.77 ? 107  ARG B HD3    1 
ATOM   7653  H  HE     . ARG B 2 107 ? 6.487   48.320  8.858   1.00 165.97 ? 107  ARG B HE     1 
ATOM   7654  H  HH11   . ARG B 2 107 ? 5.165   50.922  7.316   1.00 139.79 ? 107  ARG B HH11   1 
ATOM   7655  H  HH12   . ARG B 2 107 ? 5.173   50.331  5.949   1.00 139.79 ? 107  ARG B HH12   1 
ATOM   7656  H  HH21   . ARG B 2 107 ? 6.560   47.454  6.742   1.00 143.36 ? 107  ARG B HH21   1 
ATOM   7657  H  HH22   . ARG B 2 107 ? 6.013   48.244  5.603   1.00 143.36 ? 107  ARG B HH22   1 
ATOM   7658  N  N      . LEU B 2 108 ? 5.702   52.445  14.639  1.00 115.35 ? 108  LEU B N      1 
ATOM   7659  C  CA     . LEU B 2 108 ? 5.526   53.658  15.433  1.00 118.08 ? 108  LEU B CA     1 
ATOM   7660  C  C      . LEU B 2 108 ? 6.541   53.758  16.565  1.00 111.70 ? 108  LEU B C      1 
ATOM   7661  O  O      . LEU B 2 108 ? 6.991   54.847  16.915  1.00 118.33 ? 108  LEU B O      1 
ATOM   7662  C  CB     . LEU B 2 108 ? 4.109   53.717  16.002  1.00 121.24 ? 108  LEU B CB     1 
ATOM   7663  C  CG     . LEU B 2 108 ? 2.982   53.866  14.978  1.00 112.72 ? 108  LEU B CG     1 
ATOM   7664  C  CD1    . LEU B 2 108 ? 1.639   53.767  15.677  1.00 119.47 ? 108  LEU B CD1    1 
ATOM   7665  C  CD2    . LEU B 2 108 ? 3.097   55.185  14.226  1.00 113.65 ? 108  LEU B CD2    1 
ATOM   7666  H  H      . LEU B 2 108 ? 5.013   51.930  14.638  1.00 138.42 ? 108  LEU B H      1 
ATOM   7667  H  HA     . LEU B 2 108 ? 5.647   54.428  14.857  1.00 141.70 ? 108  LEU B HA     1 
ATOM   7668  H  HB2    . LEU B 2 108 ? 3.944   52.899  16.497  1.00 145.49 ? 108  LEU B HB2    1 
ATOM   7669  H  HB3    . LEU B 2 108 ? 4.054   54.475  16.605  1.00 145.49 ? 108  LEU B HB3    1 
ATOM   7670  H  HG     . LEU B 2 108 ? 3.041   53.144  14.334  1.00 135.27 ? 108  LEU B HG     1 
ATOM   7671  H  HD11   . LEU B 2 108 ? 1.575   54.475  16.337  1.00 143.36 ? 108  LEU B HD11   1 
ATOM   7672  H  HD12   . LEU B 2 108 ? 0.934   53.863  15.019  1.00 143.36 ? 108  LEU B HD12   1 
ATOM   7673  H  HD13   . LEU B 2 108 ? 1.573   52.902  16.111  1.00 143.36 ? 108  LEU B HD13   1 
ATOM   7674  H  HD21   . LEU B 2 108 ? 3.949   55.210  13.762  1.00 136.38 ? 108  LEU B HD21   1 
ATOM   7675  H  HD22   . LEU B 2 108 ? 2.370   55.248  13.586  1.00 136.38 ? 108  LEU B HD22   1 
ATOM   7676  H  HD23   . LEU B 2 108 ? 3.044   55.916  14.861  1.00 136.38 ? 108  LEU B HD23   1 
ATOM   7677  N  N      . ALA B 2 109 ? 6.861   52.619  17.165  1.00 114.27 ? 109  ALA B N      1 
ATOM   7678  C  CA     . ALA B 2 109 ? 7.756   52.581  18.315  1.00 119.14 ? 109  ALA B CA     1 
ATOM   7679  C  C      . ALA B 2 109 ? 9.218   52.840  17.943  1.00 117.98 ? 109  ALA B C      1 
ATOM   7680  O  O      . ALA B 2 109 ? 9.864   53.723  18.510  1.00 119.54 ? 109  ALA B O      1 
ATOM   7681  C  CB     . ALA B 2 109 ? 7.631   51.240  19.021  1.00 118.46 ? 109  ALA B CB     1 
ATOM   7682  H  H      . ALA B 2 109 ? 6.571   51.846  16.924  1.00 137.13 ? 109  ALA B H      1 
ATOM   7683  H  HA     . ALA B 2 109 ? 7.486   53.271  18.941  1.00 142.96 ? 109  ALA B HA     1 
ATOM   7684  H  HB1    . ALA B 2 109 ? 7.869   50.533  18.401  1.00 142.16 ? 109  ALA B HB1    1 
ATOM   7685  H  HB2    . ALA B 2 109 ? 8.231   51.227  19.783  1.00 142.16 ? 109  ALA B HB2    1 
ATOM   7686  H  HB3    . ALA B 2 109 ? 6.715   51.124  19.319  1.00 142.16 ? 109  ALA B HB3    1 
ATOM   7687  N  N      . TYR B 2 110 ? 9.725   52.071  16.983  1.00 115.00 ? 110  TYR B N      1 
ATOM   7688  C  CA     . TYR B 2 110 ? 11.158  52.023  16.697  1.00 118.66 ? 110  TYR B CA     1 
ATOM   7689  C  C      . TYR B 2 110 ? 11.620  52.990  15.604  1.00 120.45 ? 110  TYR B C      1 
ATOM   7690  O  O      . TYR B 2 110 ? 12.687  52.792  15.022  1.00 124.53 ? 110  TYR B O      1 
ATOM   7691  C  CB     . TYR B 2 110 ? 11.542  50.603  16.270  1.00 113.17 ? 110  TYR B CB     1 
ATOM   7692  C  CG     . TYR B 2 110 ? 11.379  49.549  17.336  1.00 114.26 ? 110  TYR B CG     1 
ATOM   7693  C  CD1    . TYR B 2 110 ? 12.398  49.281  18.239  1.00 119.06 ? 110  TYR B CD1    1 
ATOM   7694  C  CD2    . TYR B 2 110 ? 10.210  48.807  17.427  1.00 113.19 ? 110  TYR B CD2    1 
ATOM   7695  C  CE1    . TYR B 2 110 ? 12.252  48.309  19.209  1.00 121.18 ? 110  TYR B CE1    1 
ATOM   7696  C  CE2    . TYR B 2 110 ? 10.055  47.835  18.391  1.00 126.06 ? 110  TYR B CE2    1 
ATOM   7697  C  CZ     . TYR B 2 110 ? 11.081  47.586  19.277  1.00 127.60 ? 110  TYR B CZ     1 
ATOM   7698  O  OH     . TYR B 2 110 ? 10.928  46.617  20.244  1.00 122.21 ? 110  TYR B OH     1 
ATOM   7699  H  H      . TYR B 2 110 ? 9.254   51.560  16.477  1.00 138.00 ? 110  TYR B H      1 
ATOM   7700  H  HA     . TYR B 2 110 ? 11.647  52.234  17.508  1.00 142.39 ? 110  TYR B HA     1 
ATOM   7701  H  HB2    . TYR B 2 110 ? 10.986  50.347  15.518  1.00 135.81 ? 110  TYR B HB2    1 
ATOM   7702  H  HB3    . TYR B 2 110 ? 12.474  50.604  16.001  1.00 135.81 ? 110  TYR B HB3    1 
ATOM   7703  H  HD1    . TYR B 2 110 ? 13.190  49.765  18.192  1.00 142.87 ? 110  TYR B HD1    1 
ATOM   7704  H  HD2    . TYR B 2 110 ? 9.518   48.971  16.828  1.00 135.83 ? 110  TYR B HD2    1 
ATOM   7705  H  HE1    . TYR B 2 110 ? 12.942  48.141  19.809  1.00 145.42 ? 110  TYR B HE1    1 
ATOM   7706  H  HE2    . TYR B 2 110 ? 9.265   47.347  18.441  1.00 151.27 ? 110  TYR B HE2    1 
ATOM   7707  H  HH     . TYR B 2 110 ? 11.620  46.574  20.719  1.00 146.66 ? 110  TYR B HH     1 
ATOM   7708  N  N      . CYS B 2 111 ? 10.847  54.038  15.337  1.00 120.01 ? 111  CYS B N      1 
ATOM   7709  C  CA     . CYS B 2 111 ? 11.220  55.011  14.308  1.00 125.03 ? 111  CYS B CA     1 
ATOM   7710  C  C      . CYS B 2 111 ? 11.809  56.292  14.887  1.00 123.37 ? 111  CYS B C      1 
ATOM   7711  O  O      . CYS B 2 111 ? 12.318  57.139  14.153  1.00 124.44 ? 111  CYS B O      1 
ATOM   7712  C  CB     . CYS B 2 111 ? 10.005  55.358  13.450  1.00 126.35 ? 111  CYS B CB     1 
ATOM   7713  S  SG     . CYS B 2 111 ? 8.760   56.331  14.309  1.00 128.49 ? 111  CYS B SG     1 
ATOM   7714  H  H      . CYS B 2 111 ? 10.104  54.210  15.735  1.00 144.01 ? 111  CYS B H      1 
ATOM   7715  H  HA     . CYS B 2 111 ? 11.888  54.613  13.729  1.00 150.04 ? 111  CYS B HA     1 
ATOM   7716  H  HB2    . CYS B 2 111 ? 10.302  55.869  12.681  1.00 151.62 ? 111  CYS B HB2    1 
ATOM   7717  H  HB3    . CYS B 2 111 ? 9.586   54.535  13.156  1.00 151.62 ? 111  CYS B HB3    1 
ATOM   7718  H  HG     . CYS B 2 111 ? 8.366   55.712  15.258  1.00 154.19 ? 111  CYS B HG     1 
ATOM   7719  N  N      . GLN B 2 112 ? 11.747  56.427  16.205  1.00 122.94 ? 112  GLN B N      1 
ATOM   7720  C  CA     . GLN B 2 112 ? 12.078  57.683  16.861  1.00 129.59 ? 112  GLN B CA     1 
ATOM   7721  C  C      . GLN B 2 112 ? 13.555  58.047  16.717  1.00 130.91 ? 112  GLN B C      1 
ATOM   7722  O  O      . GLN B 2 112 ? 13.896  59.223  16.578  1.00 132.99 ? 112  GLN B O      1 
ATOM   7723  C  CB     . GLN B 2 112 ? 11.699  57.601  18.338  1.00 127.04 ? 112  GLN B CB     1 
ATOM   7724  C  CG     . GLN B 2 112 ? 10.208  57.418  18.559  1.00 131.26 ? 112  GLN B CG     1 
ATOM   7725  C  CD     . GLN B 2 112 ? 9.858   57.126  20.000  1.00 131.30 ? 112  GLN B CD     1 
ATOM   7726  O  OE1    . GLN B 2 112 ? 10.737  57.016  20.854  1.00 143.82 ? 112  GLN B OE1    1 
ATOM   7727  N  NE2    . GLN B 2 112 ? 8.567   56.995  20.279  1.00 143.08 ? 112  GLN B NE2    1 
ATOM   7728  H  H      . GLN B 2 112 ? 11.513  55.800  16.746  1.00 147.53 ? 112  GLN B H      1 
ATOM   7729  H  HA     . GLN B 2 112 ? 11.556  58.394  16.458  1.00 155.51 ? 112  GLN B HA     1 
ATOM   7730  H  HB2    . GLN B 2 112 ? 12.156  56.845  18.739  1.00 152.45 ? 112  GLN B HB2    1 
ATOM   7731  H  HB3    . GLN B 2 112 ? 11.968  58.422  18.778  1.00 152.45 ? 112  GLN B HB3    1 
ATOM   7732  H  HG2    . GLN B 2 112 ? 9.749   58.231  18.297  1.00 157.51 ? 112  GLN B HG2    1 
ATOM   7733  H  HG3    . GLN B 2 112 ? 9.899   56.674  18.019  1.00 157.51 ? 112  GLN B HG3    1 
ATOM   7734  H  HE21   . GLN B 2 112 ? 7.981   57.077  19.655  1.00 171.70 ? 112  GLN B HE21   1 
ATOM   7735  H  HE22   . GLN B 2 112 ? 8.315   56.829  21.085  1.00 171.70 ? 112  GLN B HE22   1 
ATOM   7736  N  N      . SER B 2 113 ? 14.423  57.039  16.742  1.00 124.72 ? 113  SER B N      1 
ATOM   7737  C  CA     . SER B 2 113 ? 15.866  57.267  16.693  1.00 128.78 ? 113  SER B CA     1 
ATOM   7738  C  C      . SER B 2 113 ? 16.555  56.360  15.683  1.00 128.85 ? 113  SER B C      1 
ATOM   7739  O  O      . SER B 2 113 ? 16.008  55.340  15.269  1.00 128.42 ? 113  SER B O      1 
ATOM   7740  C  CB     . SER B 2 113 ? 16.482  57.052  18.076  1.00 146.01 ? 113  SER B CB     1 
ATOM   7741  O  OG     . SER B 2 113 ? 16.432  55.686  18.452  1.00 138.93 ? 113  SER B OG     1 
ATOM   7742  H  H      . SER B 2 113 ? 14.201  56.209  16.788  1.00 149.66 ? 113  SER B H      1 
ATOM   7743  H  HA     . SER B 2 113 ? 16.030  58.186  16.431  1.00 154.54 ? 113  SER B HA     1 
ATOM   7744  H  HB2    . SER B 2 113 ? 17.408  57.340  18.055  1.00 175.21 ? 113  SER B HB2    1 
ATOM   7745  H  HB3    . SER B 2 113 ? 15.988  57.576  18.725  1.00 175.21 ? 113  SER B HB3    1 
ATOM   7746  H  HG     . SER B 2 113 ? 16.774  55.585  19.212  1.00 166.71 ? 113  SER B HG     1 
ATOM   7747  N  N      . GLU B 2 114 ? 17.770  56.741  15.301  1.00 132.51 ? 114  GLU B N      1 
ATOM   7748  C  CA     . GLU B 2 114 ? 18.560  55.977  14.342  1.00 141.89 ? 114  GLU B CA     1 
ATOM   7749  C  C      . GLU B 2 114 ? 18.902  54.584  14.862  1.00 138.31 ? 114  GLU B C      1 
ATOM   7750  O  O      . GLU B 2 114 ? 18.851  53.609  14.114  1.00 134.89 ? 114  GLU B O      1 
ATOM   7751  C  CB     . GLU B 2 114 ? 19.838  56.740  13.981  1.00 145.15 ? 114  GLU B CB     1 
ATOM   7752  C  CG     . GLU B 2 114 ? 19.581  58.002  13.169  1.00 152.12 ? 114  GLU B CG     1 
ATOM   7753  C  CD     . GLU B 2 114 ? 20.854  58.730  12.783  1.00 149.89 ? 114  GLU B CD     1 
ATOM   7754  O  OE1    . GLU B 2 114 ? 21.953  58.242  13.123  1.00 144.94 ? 114  GLU B OE1    1 
ATOM   7755  O  OE2    . GLU B 2 114 ? 20.755  59.788  12.126  1.00 141.34 ? 114  GLU B OE2    1 
ATOM   7756  H  H      . GLU B 2 114 ? 18.164  57.449  15.588  1.00 159.01 ? 114  GLU B H      1 
ATOM   7757  H  HA     . GLU B 2 114 ? 18.042  55.869  13.529  1.00 170.27 ? 114  GLU B HA     1 
ATOM   7758  H  HB2    . GLU B 2 114 ? 20.290  56.999  14.799  1.00 174.18 ? 114  GLU B HB2    1 
ATOM   7759  H  HB3    . GLU B 2 114 ? 20.412  56.160  13.457  1.00 174.18 ? 114  GLU B HB3    1 
ATOM   7760  H  HG2    . GLU B 2 114 ? 19.114  57.762  12.353  1.00 182.54 ? 114  GLU B HG2    1 
ATOM   7761  H  HG3    . GLU B 2 114 ? 19.037  58.610  13.695  1.00 182.54 ? 114  GLU B HG3    1 
ATOM   7762  N  N      . GLU B 2 115 ? 19.246  54.491  16.142  1.00 140.69 ? 115  GLU B N      1 
ATOM   7763  C  CA     . GLU B 2 115 ? 19.552  53.200  16.751  1.00 145.35 ? 115  GLU B CA     1 
ATOM   7764  C  C      . GLU B 2 115 ? 18.346  52.268  16.724  1.00 141.46 ? 115  GLU B C      1 
ATOM   7765  O  O      . GLU B 2 115 ? 18.490  51.068  16.486  1.00 140.00 ? 115  GLU B O      1 
ATOM   7766  C  CB     . GLU B 2 115 ? 20.038  53.386  18.193  1.00 142.64 ? 115  GLU B CB     1 
ATOM   7767  C  CG     . GLU B 2 115 ? 20.001  52.114  19.040  1.00 148.33 ? 115  GLU B CG     1 
ATOM   7768  C  CD     . GLU B 2 115 ? 20.915  51.029  18.506  1.00 148.20 ? 115  GLU B CD     1 
ATOM   7769  O  OE1    . GLU B 2 115 ? 21.851  51.360  17.749  1.00 148.74 ? 115  GLU B OE1    1 
ATOM   7770  O  OE2    . GLU B 2 115 ? 20.693  49.845  18.836  1.00 153.50 ? 115  GLU B OE2    1 
ATOM   7771  H  H      . GLU B 2 115 ? 19.310  55.159  16.680  1.00 168.82 ? 115  GLU B H      1 
ATOM   7772  H  HA     . GLU B 2 115 ? 20.266  52.778  16.248  1.00 174.42 ? 115  GLU B HA     1 
ATOM   7773  H  HB2    . GLU B 2 115 ? 20.955  53.700  18.173  1.00 171.17 ? 115  GLU B HB2    1 
ATOM   7774  H  HB3    . GLU B 2 115 ? 19.475  54.046  18.628  1.00 171.17 ? 115  GLU B HB3    1 
ATOM   7775  H  HG2    . GLU B 2 115 ? 20.285  52.327  19.943  1.00 178.00 ? 115  GLU B HG2    1 
ATOM   7776  H  HG3    . GLU B 2 115 ? 19.096  51.766  19.050  1.00 178.00 ? 115  GLU B HG3    1 
ATOM   7777  N  N      . LEU B 2 116 ? 17.161  52.818  16.967  1.00 135.64 ? 116  LEU B N      1 
ATOM   7778  C  CA     . LEU B 2 116 ? 15.950  52.009  17.027  1.00 131.31 ? 116  LEU B CA     1 
ATOM   7779  C  C      . LEU B 2 116 ? 15.556  51.473  15.653  1.00 122.74 ? 116  LEU B C      1 
ATOM   7780  O  O      . LEU B 2 116 ? 15.121  50.327  15.530  1.00 111.32 ? 116  LEU B O      1 
ATOM   7781  C  CB     . LEU B 2 116 ? 14.805  52.829  17.622  1.00 127.07 ? 116  LEU B CB     1 
ATOM   7782  C  CG     . LEU B 2 116 ? 14.849  52.997  19.144  1.00 119.31 ? 116  LEU B CG     1 
ATOM   7783  C  CD1    . LEU B 2 116 ? 13.809  54.006  19.601  1.00 129.60 ? 116  LEU B CD1    1 
ATOM   7784  C  CD2    . LEU B 2 116 ? 14.634  51.665  19.850  1.00 103.01 ? 116  LEU B CD2    1 
ATOM   7785  H  H      . LEU B 2 116 ? 17.032  53.658  17.101  1.00 162.77 ? 116  LEU B H      1 
ATOM   7786  H  HA     . LEU B 2 116 ? 16.108  51.250  17.609  1.00 157.58 ? 116  LEU B HA     1 
ATOM   7787  H  HB2    . LEU B 2 116 ? 14.824  53.715  17.230  1.00 152.48 ? 116  LEU B HB2    1 
ATOM   7788  H  HB3    . LEU B 2 116 ? 13.967  52.393  17.401  1.00 152.48 ? 116  LEU B HB3    1 
ATOM   7789  H  HG     . LEU B 2 116 ? 15.723  53.333  19.398  1.00 143.17 ? 116  LEU B HG     1 
ATOM   7790  H  HD11   . LEU B 2 116 ? 12.929  53.692  19.341  1.00 155.52 ? 116  LEU B HD11   1 
ATOM   7791  H  HD12   . LEU B 2 116 ? 13.857  54.094  20.566  1.00 155.52 ? 116  LEU B HD12   1 
ATOM   7792  H  HD13   . LEU B 2 116 ? 13.993  54.861  19.181  1.00 155.52 ? 116  LEU B HD13   1 
ATOM   7793  H  HD21   . LEU B 2 116 ? 15.334  51.049  19.582  1.00 123.61 ? 116  LEU B HD21   1 
ATOM   7794  H  HD22   . LEU B 2 116 ? 14.668  51.808  20.809  1.00 123.61 ? 116  LEU B HD22   1 
ATOM   7795  H  HD23   . LEU B 2 116 ? 13.767  51.311  19.598  1.00 123.61 ? 116  LEU B HD23   1 
ATOM   7796  N  N      . ARG B 2 117 ? 15.707  52.296  14.621  1.00 126.74 ? 117  ARG B N      1 
ATOM   7797  C  CA     . ARG B 2 117 ? 15.373  51.866  13.268  1.00 123.79 ? 117  ARG B CA     1 
ATOM   7798  C  C      . ARG B 2 117 ? 16.303  50.735  12.841  1.00 125.44 ? 117  ARG B C      1 
ATOM   7799  O  O      . ARG B 2 117 ? 15.847  49.722  12.313  1.00 122.31 ? 117  ARG B O      1 
ATOM   7800  C  CB     . ARG B 2 117 ? 15.422  53.036  12.278  1.00 119.51 ? 117  ARG B CB     1 
ATOM   7801  C  CG     . ARG B 2 117 ? 14.397  54.119  12.595  1.00 125.57 ? 117  ARG B CG     1 
ATOM   7802  C  CD     . ARG B 2 117 ? 14.271  55.185  11.513  1.00 127.52 ? 117  ARG B CD     1 
ATOM   7803  N  NE     . ARG B 2 117 ? 15.407  56.105  11.478  1.00 133.63 ? 117  ARG B NE     1 
ATOM   7804  C  CZ     . ARG B 2 117 ? 16.315  56.169  10.505  1.00 138.78 ? 117  ARG B CZ     1 
ATOM   7805  N  NH1    . ARG B 2 117 ? 16.250  55.366  9.449   1.00 126.06 ? 117  ARG B NH1    1 
ATOM   7806  N  NH2    . ARG B 2 117 ? 17.299  57.053  10.590  1.00 133.70 ? 117  ARG B NH2    1 
ATOM   7807  H  H      . ARG B 2 117 ? 15.998  53.103  14.676  1.00 152.09 ? 117  ARG B H      1 
ATOM   7808  H  HA     . ARG B 2 117 ? 14.467  51.519  13.267  1.00 148.54 ? 117  ARG B HA     1 
ATOM   7809  H  HB2    . ARG B 2 117 ? 16.303  53.440  12.309  1.00 143.41 ? 117  ARG B HB2    1 
ATOM   7810  H  HB3    . ARG B 2 117 ? 15.241  52.703  11.385  1.00 143.41 ? 117  ARG B HB3    1 
ATOM   7811  H  HG2    . ARG B 2 117 ? 13.527  53.703  12.703  1.00 150.69 ? 117  ARG B HG2    1 
ATOM   7812  H  HG3    . ARG B 2 117 ? 14.654  54.561  13.419  1.00 150.69 ? 117  ARG B HG3    1 
ATOM   7813  H  HD2    . ARG B 2 117 ? 14.212  54.751  10.648  1.00 153.02 ? 117  ARG B HD2    1 
ATOM   7814  H  HD3    . ARG B 2 117 ? 13.470  55.707  11.677  1.00 153.02 ? 117  ARG B HD3    1 
ATOM   7815  H  HE     . ARG B 2 117 ? 15.497  56.649  12.138  1.00 160.35 ? 117  ARG B HE     1 
ATOM   7816  H  HH11   . ARG B 2 117 ? 15.614  54.790  9.386   1.00 151.27 ? 117  ARG B HH11   1 
ATOM   7817  H  HH12   . ARG B 2 117 ? 16.844  55.420  8.830   1.00 151.27 ? 117  ARG B HH12   1 
ATOM   7818  H  HH21   . ARG B 2 117 ? 17.349  57.577  11.270  1.00 160.45 ? 117  ARG B HH21   1 
ATOM   7819  H  HH22   . ARG B 2 117 ? 17.889  57.100  9.966   1.00 160.45 ? 117  ARG B HH22   1 
ATOM   7820  N  N      . ARG B 2 118 ? 17.602  50.906  13.069  1.00 127.69 ? 118  ARG B N      1 
ATOM   7821  C  CA     . ARG B 2 118 ? 18.576  49.890  12.685  1.00 127.62 ? 118  ARG B CA     1 
ATOM   7822  C  C      . ARG B 2 118 ? 18.269  48.539  13.330  1.00 126.62 ? 118  ARG B C      1 
ATOM   7823  O  O      . ARG B 2 118 ? 18.350  47.501  12.673  1.00 130.17 ? 118  ARG B O      1 
ATOM   7824  C  CB     . ARG B 2 118 ? 19.990  50.337  13.064  1.00 127.17 ? 118  ARG B CB     1 
ATOM   7825  C  CG     . ARG B 2 118 ? 20.517  51.467  12.201  1.00 144.99 ? 118  ARG B CG     1 
ATOM   7826  C  CD     . ARG B 2 118 ? 22.010  51.679  12.374  1.00 143.91 ? 118  ARG B CD     1 
ATOM   7827  N  NE     . ARG B 2 118 ? 22.519  52.632  11.390  1.00 153.06 ? 118  ARG B NE     1 
ATOM   7828  C  CZ     . ARG B 2 118 ? 22.574  53.949  11.567  1.00 148.76 ? 118  ARG B CZ     1 
ATOM   7829  N  NH1    . ARG B 2 118 ? 22.163  54.495  12.704  1.00 158.49 ? 118  ARG B NH1    1 
ATOM   7830  N  NH2    . ARG B 2 118 ? 23.049  54.725  10.603  1.00 120.04 ? 118  ARG B NH2    1 
ATOM   7831  H  H      . ARG B 2 118 ? 17.944  51.601  13.442  1.00 153.23 ? 118  ARG B H      1 
ATOM   7832  H  HA     . ARG B 2 118 ? 18.547  49.774  11.722  1.00 153.15 ? 118  ARG B HA     1 
ATOM   7833  H  HB2    . ARG B 2 118 ? 19.987  50.642  13.984  1.00 152.60 ? 118  ARG B HB2    1 
ATOM   7834  H  HB3    . ARG B 2 118 ? 20.594  49.584  12.968  1.00 152.60 ? 118  ARG B HB3    1 
ATOM   7835  H  HG2    . ARG B 2 118 ? 20.348  51.260  11.269  1.00 173.99 ? 118  ARG B HG2    1 
ATOM   7836  H  HG3    . ARG B 2 118 ? 20.065  52.290  12.447  1.00 173.99 ? 118  ARG B HG3    1 
ATOM   7837  H  HD2    . ARG B 2 118 ? 22.185  52.033  13.261  1.00 172.70 ? 118  ARG B HD2    1 
ATOM   7838  H  HD3    . ARG B 2 118 ? 22.472  50.835  12.250  1.00 172.70 ? 118  ARG B HD3    1 
ATOM   7839  H  HE     . ARG B 2 118 ? 22.803  52.318  10.641  1.00 183.68 ? 118  ARG B HE     1 
ATOM   7840  H  HH11   . ARG B 2 118 ? 21.853  53.997  13.333  1.00 190.18 ? 118  ARG B HH11   1 
ATOM   7841  H  HH12   . ARG B 2 118 ? 22.204  55.347  12.811  1.00 190.18 ? 118  ARG B HH12   1 
ATOM   7842  H  HH21   . ARG B 2 118 ? 23.319  54.377  9.864   1.00 144.04 ? 118  ARG B HH21   1 
ATOM   7843  H  HH22   . ARG B 2 118 ? 23.089  55.577  10.717  1.00 144.04 ? 118  ARG B HH22   1 
ATOM   7844  N  N      . TRP B 2 119 ? 17.919  48.553  14.612  1.00 119.27 ? 119  TRP B N      1 
ATOM   7845  C  CA     . TRP B 2 119 ? 17.603  47.316  15.324  1.00 117.96 ? 119  TRP B CA     1 
ATOM   7846  C  C      . TRP B 2 119 ? 16.356  46.641  14.764  1.00 119.21 ? 119  TRP B C      1 
ATOM   7847  O  O      . TRP B 2 119 ? 16.370  45.449  14.455  1.00 113.61 ? 119  TRP B O      1 
ATOM   7848  C  CB     . TRP B 2 119 ? 17.426  47.562  16.822  1.00 113.93 ? 119  TRP B CB     1 
ATOM   7849  C  CG     . TRP B 2 119 ? 17.311  46.271  17.567  1.00 89.96  ? 119  TRP B CG     1 
ATOM   7850  C  CD1    . TRP B 2 119 ? 18.335  45.537  18.078  1.00 94.32  ? 119  TRP B CD1    1 
ATOM   7851  C  CD2    . TRP B 2 119 ? 16.107  45.557  17.884  1.00 92.01  ? 119  TRP B CD2    1 
ATOM   7852  N  NE1    . TRP B 2 119 ? 17.851  44.408  18.686  1.00 109.35 ? 119  TRP B NE1    1 
ATOM   7853  C  CE2    . TRP B 2 119 ? 16.486  44.397  18.585  1.00 94.99  ? 119  TRP B CE2    1 
ATOM   7854  C  CE3    . TRP B 2 119 ? 14.750  45.786  17.644  1.00 110.72 ? 119  TRP B CE3    1 
ATOM   7855  C  CZ2    . TRP B 2 119 ? 15.557  43.468  19.050  1.00 103.41 ? 119  TRP B CZ2    1 
ATOM   7856  C  CZ3    . TRP B 2 119 ? 13.828  44.860  18.107  1.00 108.62 ? 119  TRP B CZ3    1 
ATOM   7857  C  CH2    . TRP B 2 119 ? 14.237  43.717  18.801  1.00 104.68 ? 119  TRP B CH2    1 
ATOM   7858  H  H      . TRP B 2 119 ? 17.857  49.263  15.093  1.00 143.12 ? 119  TRP B H      1 
ATOM   7859  H  HA     . TRP B 2 119 ? 18.344  46.700  15.214  1.00 141.55 ? 119  TRP B HA     1 
ATOM   7860  H  HB2    . TRP B 2 119 ? 18.197  48.043  17.162  1.00 136.71 ? 119  TRP B HB2    1 
ATOM   7861  H  HB3    . TRP B 2 119 ? 16.616  48.074  16.970  1.00 136.71 ? 119  TRP B HB3    1 
ATOM   7862  H  HD1    . TRP B 2 119 ? 19.235  45.762  18.014  1.00 113.19 ? 119  TRP B HD1    1 
ATOM   7863  H  HE1    . TRP B 2 119 ? 18.328  43.807  19.075  1.00 131.22 ? 119  TRP B HE1    1 
ATOM   7864  H  HE3    . TRP B 2 119 ? 14.471  46.543  17.182  1.00 132.86 ? 119  TRP B HE3    1 
ATOM   7865  H  HZ2    . TRP B 2 119 ? 15.826  42.708  19.513  1.00 124.09 ? 119  TRP B HZ2    1 
ATOM   7866  H  HZ3    . TRP B 2 119 ? 12.922  45.001  17.953  1.00 130.35 ? 119  TRP B HZ3    1 
ATOM   7867  H  HH2    . TRP B 2 119 ? 13.596  43.113  19.101  1.00 125.61 ? 119  TRP B HH2    1 
ATOM   7868  N  N      . PHE B 2 120 ? 15.279  47.412  14.650  1.00 120.20 ? 120  PHE B N      1 
ATOM   7869  C  CA     . PHE B 2 120 ? 14.004  46.901  14.162  1.00 113.21 ? 120  PHE B CA     1 
ATOM   7870  C  C      . PHE B 2 120 ? 14.137  46.303  12.769  1.00 122.80 ? 120  PHE B C      1 
ATOM   7871  O  O      . PHE B 2 120 ? 13.518  45.284  12.466  1.00 122.02 ? 120  PHE B O      1 
ATOM   7872  C  CB     . PHE B 2 120 ? 12.955  48.014  14.159  1.00 99.13  ? 120  PHE B CB     1 
ATOM   7873  C  CG     . PHE B 2 120 ? 11.595  47.567  13.704  1.00 105.63 ? 120  PHE B CG     1 
ATOM   7874  C  CD1    . PHE B 2 120 ? 10.825  46.726  14.488  1.00 105.76 ? 120  PHE B CD1    1 
ATOM   7875  C  CD2    . PHE B 2 120 ? 11.081  48.002  12.494  1.00 105.98 ? 120  PHE B CD2    1 
ATOM   7876  C  CE1    . PHE B 2 120 ? 9.573   46.318  14.067  1.00 110.32 ? 120  PHE B CE1    1 
ATOM   7877  C  CE2    . PHE B 2 120 ? 9.829   47.600  12.070  1.00 99.16  ? 120  PHE B CE2    1 
ATOM   7878  C  CZ     . PHE B 2 120 ? 9.074   46.758  12.857  1.00 98.19  ? 120  PHE B CZ     1 
ATOM   7879  H  H      . PHE B 2 120 ? 15.262  48.248  14.852  1.00 144.24 ? 120  PHE B H      1 
ATOM   7880  H  HA     . PHE B 2 120 ? 13.695  46.201  14.759  1.00 135.86 ? 120  PHE B HA     1 
ATOM   7881  H  HB2    . PHE B 2 120 ? 12.866  48.363  15.060  1.00 118.96 ? 120  PHE B HB2    1 
ATOM   7882  H  HB3    . PHE B 2 120 ? 13.250  48.720  13.562  1.00 118.96 ? 120  PHE B HB3    1 
ATOM   7883  H  HD1    . PHE B 2 120 ? 11.157  46.427  15.304  1.00 126.91 ? 120  PHE B HD1    1 
ATOM   7884  H  HD2    . PHE B 2 120 ? 11.587  48.570  11.958  1.00 127.18 ? 120  PHE B HD2    1 
ATOM   7885  H  HE1    . PHE B 2 120 ? 9.064   45.751  14.601  1.00 132.39 ? 120  PHE B HE1    1 
ATOM   7886  H  HE2    . PHE B 2 120 ? 9.497   47.897  11.253  1.00 119.00 ? 120  PHE B HE2    1 
ATOM   7887  H  HZ     . PHE B 2 120 ? 8.231   46.485  12.573  1.00 117.82 ? 120  PHE B HZ     1 
ATOM   7888  N  N      . ILE B 2 121 ? 14.948  46.934  11.927  1.00 127.42 ? 121  ILE B N      1 
ATOM   7889  C  CA     . ILE B 2 121 ? 15.130  46.470  10.559  1.00 121.30 ? 121  ILE B CA     1 
ATOM   7890  C  C      . ILE B 2 121 ? 15.802  45.099  10.529  1.00 117.31 ? 121  ILE B C      1 
ATOM   7891  O  O      . ILE B 2 121 ? 15.287  44.173  9.910   1.00 122.72 ? 121  ILE B O      1 
ATOM   7892  C  CB     . ILE B 2 121 ? 15.969  47.477  9.740   1.00 121.71 ? 121  ILE B CB     1 
ATOM   7893  C  CG1    . ILE B 2 121 ? 15.140  48.727  9.441   1.00 128.55 ? 121  ILE B CG1    1 
ATOM   7894  C  CG2    . ILE B 2 121 ? 16.441  46.862  8.422   1.00 128.81 ? 121  ILE B CG2    1 
ATOM   7895  C  CD1    . ILE B 2 121 ? 15.939  49.880  8.865   1.00 132.83 ? 121  ILE B CD1    1 
ATOM   7896  H  H      . ILE B 2 121 ? 15.406  47.635  12.125  1.00 152.91 ? 121  ILE B H      1 
ATOM   7897  H  HA     . ILE B 2 121 ? 14.262  46.388  10.135  1.00 145.56 ? 121  ILE B HA     1 
ATOM   7898  H  HB     . ILE B 2 121 ? 16.746  47.734  10.261  1.00 146.05 ? 121  ILE B HB     1 
ATOM   7899  H  HG12   . ILE B 2 121 ? 14.450  48.496  8.800   1.00 154.26 ? 121  ILE B HG12   1 
ATOM   7900  H  HG13   . ILE B 2 121 ? 14.731  49.033  10.266  1.00 154.26 ? 121  ILE B HG13   1 
ATOM   7901  H  HG21   . ILE B 2 121 ? 15.666  46.603  7.900   1.00 154.57 ? 121  ILE B HG21   1 
ATOM   7902  H  HG22   . ILE B 2 121 ? 16.963  47.520  7.936   1.00 154.57 ? 121  ILE B HG22   1 
ATOM   7903  H  HG23   . ILE B 2 121 ? 16.986  46.083  8.614   1.00 154.57 ? 121  ILE B HG23   1 
ATOM   7904  H  HD11   . ILE B 2 121 ? 16.345  49.597  8.031   1.00 159.39 ? 121  ILE B HD11   1 
ATOM   7905  H  HD12   . ILE B 2 121 ? 15.342  50.628  8.706   1.00 159.39 ? 121  ILE B HD12   1 
ATOM   7906  H  HD13   . ILE B 2 121 ? 16.627  50.134  9.499   1.00 159.39 ? 121  ILE B HD13   1 
ATOM   7907  N  N      . GLN B 2 122 ? 16.936  44.969  11.212  1.00 116.02 ? 122  GLN B N      1 
ATOM   7908  C  CA     . GLN B 2 122 ? 17.709  43.728  11.187  1.00 120.72 ? 122  GLN B CA     1 
ATOM   7909  C  C      . GLN B 2 122 ? 16.903  42.526  11.681  1.00 120.91 ? 122  GLN B C      1 
ATOM   7910  O  O      . GLN B 2 122 ? 16.911  41.468  11.051  1.00 125.29 ? 122  GLN B O      1 
ATOM   7911  C  CB     . GLN B 2 122 ? 18.983  43.873  12.023  1.00 120.08 ? 122  GLN B CB     1 
ATOM   7912  C  CG     . GLN B 2 122 ? 19.916  42.671  11.938  1.00 125.09 ? 122  GLN B CG     1 
ATOM   7913  C  CD     . GLN B 2 122 ? 21.035  42.726  12.957  1.00 148.83 ? 122  GLN B CD     1 
ATOM   7914  O  OE1    . GLN B 2 122 ? 21.689  43.756  13.124  1.00 169.37 ? 122  GLN B OE1    1 
ATOM   7915  N  NE2    . GLN B 2 122 ? 21.257  41.615  13.651  1.00 141.40 ? 122  GLN B NE2    1 
ATOM   7916  H  H      . GLN B 2 122 ? 17.282  45.587  11.700  1.00 139.22 ? 122  GLN B H      1 
ATOM   7917  H  HA     . GLN B 2 122 ? 17.976  43.547  10.273  1.00 144.87 ? 122  GLN B HA     1 
ATOM   7918  H  HB2    . GLN B 2 122 ? 19.472  44.652  11.714  1.00 144.09 ? 122  GLN B HB2    1 
ATOM   7919  H  HB3    . GLN B 2 122 ? 18.734  43.990  12.954  1.00 144.09 ? 122  GLN B HB3    1 
ATOM   7920  H  HG2    . GLN B 2 122 ? 19.406  41.862  12.096  1.00 150.11 ? 122  GLN B HG2    1 
ATOM   7921  H  HG3    . GLN B 2 122 ? 20.317  42.644  11.055  1.00 150.11 ? 122  GLN B HG3    1 
ATOM   7922  H  HE21   . GLN B 2 122 ? 20.777  40.916  13.510  1.00 169.68 ? 122  GLN B HE21   1 
ATOM   7923  H  HE22   . GLN B 2 122 ? 21.882  41.595  14.243  1.00 169.68 ? 122  GLN B HE22   1 
ATOM   7924  N  N      . GLN B 2 123 ? 16.215  42.684  12.806  1.00 124.59 ? 123  GLN B N      1 
ATOM   7925  C  CA     . GLN B 2 123 ? 15.436  41.588  13.374  1.00 114.50 ? 123  GLN B CA     1 
ATOM   7926  C  C      . GLN B 2 123 ? 14.291  41.189  12.462  1.00 109.43 ? 123  GLN B C      1 
ATOM   7927  O  O      . GLN B 2 123 ? 13.970  40.008  12.340  1.00 113.97 ? 123  GLN B O      1 
ATOM   7928  C  CB     . GLN B 2 123 ? 14.892  41.970  14.750  1.00 111.75 ? 123  GLN B CB     1 
ATOM   7929  C  CG     . GLN B 2 123 ? 15.794  41.536  15.882  1.00 108.61 ? 123  GLN B CG     1 
ATOM   7930  C  CD     . GLN B 2 123 ? 17.199  42.069  15.723  1.00 110.83 ? 123  GLN B CD     1 
ATOM   7931  O  OE1    . GLN B 2 123 ? 18.171  41.314  15.768  1.00 113.80 ? 123  GLN B OE1    1 
ATOM   7932  N  NE2    . GLN B 2 123 ? 17.315  43.376  15.520  1.00 116.09 ? 123  GLN B NE2    1 
ATOM   7933  H  H      . GLN B 2 123 ? 16.181  43.413  13.260  1.00 149.50 ? 123  GLN B H      1 
ATOM   7934  H  HA     . GLN B 2 123 ? 16.013  40.816  13.484  1.00 137.40 ? 123  GLN B HA     1 
ATOM   7935  H  HB2    . GLN B 2 123 ? 14.799  42.935  14.796  1.00 134.10 ? 123  GLN B HB2    1 
ATOM   7936  H  HB3    . GLN B 2 123 ? 14.029  41.548  14.876  1.00 134.10 ? 123  GLN B HB3    1 
ATOM   7937  H  HG2    . GLN B 2 123 ? 15.437  41.869  16.720  1.00 130.34 ? 123  GLN B HG2    1 
ATOM   7938  H  HG3    . GLN B 2 123 ? 15.838  40.567  15.899  1.00 130.34 ? 123  GLN B HG3    1 
ATOM   7939  H  HE21   . GLN B 2 123 ? 16.611  43.870  15.485  1.00 139.30 ? 123  GLN B HE21   1 
ATOM   7940  H  HE22   . GLN B 2 123 ? 18.093  43.729  15.424  1.00 139.30 ? 123  GLN B HE22   1 
ATOM   7941  N  N      . GLU B 2 124 ? 13.676  42.175  11.821  1.00 115.59 ? 124  GLU B N      1 
ATOM   7942  C  CA     . GLU B 2 124 ? 12.580  41.902  10.904  1.00 120.44 ? 124  GLU B CA     1 
ATOM   7943  C  C      . GLU B 2 124 ? 13.112  41.306  9.607   1.00 119.95 ? 124  GLU B C      1 
ATOM   7944  O  O      . GLU B 2 124 ? 12.425  40.538  8.935   1.00 116.23 ? 124  GLU B O      1 
ATOM   7945  C  CB     . GLU B 2 124 ? 11.791  43.175  10.621  1.00 106.88 ? 124  GLU B CB     1 
ATOM   7946  C  CG     . GLU B 2 124 ? 10.335  42.902  10.312  1.00 104.06 ? 124  GLU B CG     1 
ATOM   7947  C  CD     . GLU B 2 124 ? 9.454   42.913  11.549  1.00 110.15 ? 124  GLU B CD     1 
ATOM   7948  O  OE1    . GLU B 2 124 ? 9.842   43.506  12.577  1.00 116.32 ? 124  GLU B OE1    1 
ATOM   7949  O  OE2    . GLU B 2 124 ? 8.361   42.315  11.491  1.00 118.14 ? 124  GLU B OE2    1 
ATOM   7950  H  H      . GLU B 2 124 ? 13.874  43.009  11.899  1.00 138.71 ? 124  GLU B H      1 
ATOM   7951  H  HA     . GLU B 2 124 ? 11.979  41.258  11.310  1.00 144.53 ? 124  GLU B HA     1 
ATOM   7952  H  HB2    . GLU B 2 124 ? 11.829  43.751  11.400  1.00 128.26 ? 124  GLU B HB2    1 
ATOM   7953  H  HB3    . GLU B 2 124 ? 12.181  43.625  9.855   1.00 128.26 ? 124  GLU B HB3    1 
ATOM   7954  H  HG2    . GLU B 2 124 ? 10.008  43.585  9.706   1.00 124.87 ? 124  GLU B HG2    1 
ATOM   7955  H  HG3    . GLU B 2 124 ? 10.259  42.028  9.898   1.00 124.87 ? 124  GLU B HG3    1 
ATOM   7956  N  N      . MET B 2 125 ? 14.343  41.672  9.267   1.00 119.92 ? 125  MET B N      1 
ATOM   7957  C  CA     . MET B 2 125 ? 15.028  41.123  8.105   1.00 123.34 ? 125  MET B CA     1 
ATOM   7958  C  C      . MET B 2 125 ? 15.323  39.638  8.305   1.00 126.71 ? 125  MET B C      1 
ATOM   7959  O  O      . MET B 2 125 ? 14.933  38.805  7.485   1.00 131.59 ? 125  MET B O      1 
ATOM   7960  C  CB     . MET B 2 125 ? 16.319  41.897  7.823   1.00 119.68 ? 125  MET B CB     1 
ATOM   7961  C  CG     . MET B 2 125 ? 16.575  42.184  6.346   1.00 130.56 ? 125  MET B CG     1 
ATOM   7962  S  SD     . MET B 2 125 ? 15.173  42.914  5.463   1.00 139.62 ? 125  MET B SD     1 
ATOM   7963  C  CE     . MET B 2 125 ? 14.800  44.351  6.465   1.00 129.36 ? 125  MET B CE     1 
ATOM   7964  H  H      . MET B 2 125 ? 14.810  42.249  9.703   1.00 143.90 ? 125  MET B H      1 
ATOM   7965  H  HA     . MET B 2 125 ? 14.452  41.222  7.331   1.00 148.01 ? 125  MET B HA     1 
ATOM   7966  H  HB2    . MET B 2 125 ? 16.277  42.749  8.285   1.00 143.62 ? 125  MET B HB2    1 
ATOM   7967  H  HB3    . MET B 2 125 ? 17.070  41.381  8.156   1.00 143.62 ? 125  MET B HB3    1 
ATOM   7968  H  HG2    . MET B 2 125 ? 17.320  42.802  6.276   1.00 156.68 ? 125  MET B HG2    1 
ATOM   7969  H  HG3    . MET B 2 125 ? 16.800  41.351  5.903   1.00 156.68 ? 125  MET B HG3    1 
ATOM   7970  H  HE1    . MET B 2 125 ? 15.578  44.929  6.490   1.00 155.23 ? 125  MET B HE1    1 
ATOM   7971  H  HE2    . MET B 2 125 ? 14.049  44.823  6.072   1.00 155.23 ? 125  MET B HE2    1 
ATOM   7972  H  HE3    . MET B 2 125 ? 14.575  44.060  7.363   1.00 155.23 ? 125  MET B HE3    1 
ATOM   7973  N  N      . ASP B 2 126 ? 16.026  39.317  9.389   1.00 124.49 ? 126  ASP B N      1 
ATOM   7974  C  CA     . ASP B 2 126 ? 16.346  37.932  9.724   1.00 123.54 ? 126  ASP B CA     1 
ATOM   7975  C  C      . ASP B 2 126 ? 15.089  37.070  9.724   1.00 124.15 ? 126  ASP B C      1 
ATOM   7976  O  O      . ASP B 2 126 ? 15.128  35.900  9.343   1.00 133.77 ? 126  ASP B O      1 
ATOM   7977  C  CB     . ASP B 2 126 ? 17.020  37.858  11.097  1.00 122.46 ? 126  ASP B CB     1 
ATOM   7978  C  CG     . ASP B 2 126 ? 18.424  38.427  11.092  1.00 118.76 ? 126  ASP B CG     1 
ATOM   7979  O  OD1    . ASP B 2 126 ? 18.841  38.987  10.055  1.00 122.13 ? 126  ASP B OD1    1 
ATOM   7980  O  OD2    . ASP B 2 126 ? 19.110  38.318  12.129  1.00 111.65 ? 126  ASP B OD2    1 
ATOM   7981  H  H      . ASP B 2 126 ? 16.332  39.890  9.952   1.00 149.39 ? 126  ASP B H      1 
ATOM   7982  H  HA     . ASP B 2 126 ? 16.961  37.576  9.063   1.00 148.25 ? 126  ASP B HA     1 
ATOM   7983  H  HB2    . ASP B 2 126 ? 16.493  38.364  11.735  1.00 146.95 ? 126  ASP B HB2    1 
ATOM   7984  H  HB3    . ASP B 2 126 ? 17.074  36.929  11.373  1.00 146.95 ? 126  ASP B HB3    1 
ATOM   7985  N  N      . LEU B 2 127 ? 13.978  37.655  10.158  1.00 123.24 ? 127  LEU B N      1 
ATOM   7986  C  CA     . LEU B 2 127 ? 12.694  36.965  10.154  1.00 127.12 ? 127  LEU B CA     1 
ATOM   7987  C  C      . LEU B 2 127 ? 12.229  36.697  8.726   1.00 126.35 ? 127  LEU B C      1 
ATOM   7988  O  O      . LEU B 2 127 ? 11.790  35.597  8.402   1.00 129.00 ? 127  LEU B O      1 
ATOM   7989  C  CB     . LEU B 2 127 ? 11.642  37.780  10.906  1.00 123.42 ? 127  LEU B CB     1 
ATOM   7990  C  CG     . LEU B 2 127 ? 10.236  37.175  10.947  1.00 123.21 ? 127  LEU B CG     1 
ATOM   7991  C  CD1    . LEU B 2 127 ? 10.238  35.844  11.683  1.00 135.23 ? 127  LEU B CD1    1 
ATOM   7992  C  CD2    . LEU B 2 127 ? 9.264   38.144  11.598  1.00 140.57 ? 127  LEU B CD2    1 
ATOM   7993  H  H      . LEU B 2 127 ? 13.941  38.458  10.462  1.00 147.89 ? 127  LEU B H      1 
ATOM   7994  H  HA     . LEU B 2 127 ? 12.792  36.111  10.604  1.00 152.55 ? 127  LEU B HA     1 
ATOM   7995  H  HB2    . LEU B 2 127 ? 11.937  37.890  11.823  1.00 148.10 ? 127  LEU B HB2    1 
ATOM   7996  H  HB3    . LEU B 2 127 ? 11.570  38.651  10.484  1.00 148.10 ? 127  LEU B HB3    1 
ATOM   7997  H  HG     . LEU B 2 127 ? 9.935   37.014  10.039  1.00 147.86 ? 127  LEU B HG     1 
ATOM   7998  H  HD11   . LEU B 2 127 ? 10.547  35.987  12.591  1.00 162.27 ? 127  LEU B HD11   1 
ATOM   7999  H  HD12   . LEU B 2 127 ? 9.336   35.487  11.691  1.00 162.27 ? 127  LEU B HD12   1 
ATOM   8000  H  HD13   . LEU B 2 127 ? 10.833  35.231  11.223  1.00 162.27 ? 127  LEU B HD13   1 
ATOM   8001  H  HD21   . LEU B 2 127 ? 9.245   38.965  11.082  1.00 168.68 ? 127  LEU B HD21   1 
ATOM   8002  H  HD22   . LEU B 2 127 ? 8.381   37.742  11.614  1.00 168.68 ? 127  LEU B HD22   1 
ATOM   8003  H  HD23   . LEU B 2 127 ? 9.561   38.327  12.503  1.00 168.68 ? 127  LEU B HD23   1 
ATOM   8004  N  N      . LEU B 2 128 ? 12.332  37.716  7.879   1.00 126.25 ? 128  LEU B N      1 
ATOM   8005  C  CA     . LEU B 2 128 ? 11.934  37.606  6.481   1.00 126.45 ? 128  LEU B CA     1 
ATOM   8006  C  C      . LEU B 2 128 ? 12.858  36.635  5.745   1.00 129.65 ? 128  LEU B C      1 
ATOM   8007  O  O      . LEU B 2 128 ? 12.420  35.874  4.880   1.00 116.43 ? 128  LEU B O      1 
ATOM   8008  C  CB     . LEU B 2 128 ? 11.952  38.996  5.832   1.00 114.91 ? 128  LEU B CB     1 
ATOM   8009  C  CG     . LEU B 2 128 ? 11.294  39.241  4.470   1.00 108.02 ? 128  LEU B CG     1 
ATOM   8010  C  CD1    . LEU B 2 128 ? 12.179  38.776  3.323   1.00 126.79 ? 128  LEU B CD1    1 
ATOM   8011  C  CD2    . LEU B 2 128 ? 9.916   38.592  4.393   1.00 119.67 ? 128  LEU B CD2    1 
ATOM   8012  H  H      . LEU B 2 128 ? 12.634  38.492  8.094   1.00 151.50 ? 128  LEU B H      1 
ATOM   8013  H  HA     . LEU B 2 128 ? 11.029  37.260  6.432   1.00 151.74 ? 128  LEU B HA     1 
ATOM   8014  H  HB2    . LEU B 2 128 ? 11.527  39.608  6.452   1.00 137.89 ? 128  LEU B HB2    1 
ATOM   8015  H  HB3    . LEU B 2 128 ? 12.882  39.254  5.733   1.00 137.89 ? 128  LEU B HB3    1 
ATOM   8016  H  HG     . LEU B 2 128 ? 11.166  40.197  4.363   1.00 129.63 ? 128  LEU B HG     1 
ATOM   8017  H  HD11   . LEU B 2 128 ? 12.346  37.825  3.419   1.00 152.15 ? 128  LEU B HD11   1 
ATOM   8018  H  HD12   . LEU B 2 128 ? 11.725  38.949  2.484   1.00 152.15 ? 128  LEU B HD12   1 
ATOM   8019  H  HD13   . LEU B 2 128 ? 13.017  39.264  3.354   1.00 152.15 ? 128  LEU B HD13   1 
ATOM   8020  H  HD21   . LEU B 2 128 ? 9.351   38.969  5.086   1.00 143.61 ? 128  LEU B HD21   1 
ATOM   8021  H  HD22   . LEU B 2 128 ? 9.532   38.769  3.520   1.00 143.61 ? 128  LEU B HD22   1 
ATOM   8022  H  HD23   . LEU B 2 128 ? 10.010  37.636  4.527   1.00 143.61 ? 128  LEU B HD23   1 
ATOM   8023  N  N      . ARG B 2 129 ? 14.137  36.665  6.110   1.00 135.80 ? 129  ARG B N      1 
ATOM   8024  C  CA     . ARG B 2 129 ? 15.142  35.753  5.570   1.00 136.59 ? 129  ARG B CA     1 
ATOM   8025  C  C      . ARG B 2 129 ? 14.712  34.310  5.801   1.00 141.98 ? 129  ARG B C      1 
ATOM   8026  O  O      . ARG B 2 129 ? 14.825  33.461  4.916   1.00 144.13 ? 129  ARG B O      1 
ATOM   8027  C  CB     . ARG B 2 129 ? 16.504  36.014  6.212   1.00 136.73 ? 129  ARG B CB     1 
ATOM   8028  C  CG     . ARG B 2 129 ? 17.688  35.462  5.435   1.00 140.44 ? 129  ARG B CG     1 
ATOM   8029  C  CD     . ARG B 2 129 ? 18.990  36.015  5.991   1.00 150.75 ? 129  ARG B CD     1 
ATOM   8030  N  NE     . ARG B 2 129 ? 20.165  35.522  5.279   1.00 157.87 ? 129  ARG B NE     1 
ATOM   8031  C  CZ     . ARG B 2 129 ? 21.396  35.994  5.452   1.00 158.05 ? 129  ARG B CZ     1 
ATOM   8032  N  NH1    . ARG B 2 129 ? 21.620  36.979  6.313   1.00 148.54 ? 129  ARG B NH1    1 
ATOM   8033  N  NH2    . ARG B 2 129 ? 22.408  35.483  4.764   1.00 158.14 ? 129  ARG B NH2    1 
ATOM   8034  H  H      . ARG B 2 129 ? 14.455  37.220  6.685   1.00 162.96 ? 129  ARG B H      1 
ATOM   8035  H  HA     . ARG B 2 129 ? 15.224  35.897  4.614   1.00 163.91 ? 129  ARG B HA     1 
ATOM   8036  H  HB2    . ARG B 2 129 ? 16.628  36.973  6.294   1.00 164.07 ? 129  ARG B HB2    1 
ATOM   8037  H  HB3    . ARG B 2 129 ? 16.514  35.608  7.092   1.00 164.07 ? 129  ARG B HB3    1 
ATOM   8038  H  HG2    . ARG B 2 129 ? 17.705  34.495  5.516   1.00 168.53 ? 129  ARG B HG2    1 
ATOM   8039  H  HG3    . ARG B 2 129 ? 17.615  35.723  4.504   1.00 168.53 ? 129  ARG B HG3    1 
ATOM   8040  H  HD2    . ARG B 2 129 ? 18.979  36.982  5.917   1.00 180.90 ? 129  ARG B HD2    1 
ATOM   8041  H  HD3    . ARG B 2 129 ? 19.073  35.754  6.921   1.00 180.90 ? 129  ARG B HD3    1 
ATOM   8042  H  HE     . ARG B 2 129 ? 20.060  34.863  4.736   1.00 189.45 ? 129  ARG B HE     1 
ATOM   8043  H  HH11   . ARG B 2 129 ? 20.967  37.314  6.762   1.00 178.25 ? 129  ARG B HH11   1 
ATOM   8044  H  HH12   . ARG B 2 129 ? 22.417  37.283  6.422   1.00 178.25 ? 129  ARG B HH12   1 
ATOM   8045  H  HH21   . ARG B 2 129 ? 22.268  34.845  4.204   1.00 189.77 ? 129  ARG B HH21   1 
ATOM   8046  H  HH22   . ARG B 2 129 ? 23.203  35.790  4.875   1.00 189.77 ? 129  ARG B HH22   1 
ATOM   8047  N  N      . PHE B 2 130 ? 14.220  34.052  7.007   1.00 142.78 ? 130  PHE B N      1 
ATOM   8048  C  CA     . PHE B 2 130 ? 13.709  32.741  7.383   1.00 141.99 ? 130  PHE B CA     1 
ATOM   8049  C  C      . PHE B 2 130 ? 12.506  32.369  6.528   1.00 136.97 ? 130  PHE B C      1 
ATOM   8050  O  O      . PHE B 2 130 ? 12.477  31.290  5.941   1.00 135.90 ? 130  PHE B O      1 
ATOM   8051  C  CB     . PHE B 2 130 ? 13.332  32.716  8.866   1.00 140.72 ? 130  PHE B CB     1 
ATOM   8052  C  CG     . PHE B 2 130 ? 12.607  31.470  9.287   1.00 144.43 ? 130  PHE B CG     1 
ATOM   8053  C  CD1    . PHE B 2 130 ? 13.306  30.339  9.670   1.00 151.75 ? 130  PHE B CD1    1 
ATOM   8054  C  CD2    . PHE B 2 130 ? 11.222  31.436  9.309   1.00 144.41 ? 130  PHE B CD2    1 
ATOM   8055  C  CE1    . PHE B 2 130 ? 12.636  29.196  10.061  1.00 166.10 ? 130  PHE B CE1    1 
ATOM   8056  C  CE2    . PHE B 2 130 ? 10.547  30.296  9.698   1.00 142.81 ? 130  PHE B CE2    1 
ATOM   8057  C  CZ     . PHE B 2 130 ? 11.255  29.175  10.075  1.00 156.51 ? 130  PHE B CZ     1 
ATOM   8058  H  H      . PHE B 2 130 ? 14.170  34.633  7.639   1.00 171.34 ? 130  PHE B H      1 
ATOM   8059  H  HA     . PHE B 2 130 ? 14.401  32.077  7.236   1.00 170.39 ? 130  PHE B HA     1 
ATOM   8060  H  HB2    . PHE B 2 130 ? 14.143  32.780  9.395   1.00 168.87 ? 130  PHE B HB2    1 
ATOM   8061  H  HB3    . PHE B 2 130 ? 12.756  33.473  9.054   1.00 168.87 ? 130  PHE B HB3    1 
ATOM   8062  H  HD1    . PHE B 2 130 ? 14.236  30.348  9.662   1.00 182.10 ? 130  PHE B HD1    1 
ATOM   8063  H  HD2    . PHE B 2 130 ? 10.741  32.190  9.055   1.00 173.29 ? 130  PHE B HD2    1 
ATOM   8064  H  HE1    . PHE B 2 130 ? 13.115  28.440  10.314  1.00 199.31 ? 130  PHE B HE1    1 
ATOM   8065  H  HE2    . PHE B 2 130 ? 9.618   30.285  9.707   1.00 171.37 ? 130  PHE B HE2    1 
ATOM   8066  H  HZ     . PHE B 2 130 ? 10.803  28.405  10.337  1.00 187.81 ? 130  PHE B HZ     1 
ATOM   8067  N  N      . ARG B 2 131 ? 11.511  33.250  6.473   1.00 135.38 ? 131  ARG B N      1 
ATOM   8068  C  CA     . ARG B 2 131 ? 10.271  32.951  5.763   1.00 138.35 ? 131  ARG B CA     1 
ATOM   8069  C  C      . ARG B 2 131 ? 10.534  32.570  4.308   1.00 138.87 ? 131  ARG B C      1 
ATOM   8070  O  O      . ARG B 2 131 ? 9.782   31.789  3.724   1.00 142.39 ? 131  ARG B O      1 
ATOM   8071  C  CB     . ARG B 2 131 ? 9.316   34.144  5.826   1.00 131.18 ? 131  ARG B CB     1 
ATOM   8072  C  CG     . ARG B 2 131 ? 8.964   34.565  7.240   1.00 136.31 ? 131  ARG B CG     1 
ATOM   8073  C  CD     . ARG B 2 131 ? 7.539   35.070  7.344   1.00 133.76 ? 131  ARG B CD     1 
ATOM   8074  N  NE     . ARG B 2 131 ? 7.307   35.737  8.620   1.00 147.83 ? 131  ARG B NE     1 
ATOM   8075  C  CZ     . ARG B 2 131 ? 6.120   36.155  9.046   1.00 142.17 ? 131  ARG B CZ     1 
ATOM   8076  N  NH1    . ARG B 2 131 ? 5.036   35.977  8.301   1.00 134.00 ? 131  ARG B NH1    1 
ATOM   8077  N  NH2    . ARG B 2 131 ? 6.017   36.748  10.226  1.00 137.03 ? 131  ARG B NH2    1 
ATOM   8078  H  H      . ARG B 2 131 ? 11.529  34.029  6.838   1.00 162.45 ? 131  ARG B H      1 
ATOM   8079  H  HA     . ARG B 2 131 ? 9.837   32.198  6.195   1.00 166.01 ? 131  ARG B HA     1 
ATOM   8080  H  HB2    . ARG B 2 131 ? 9.731   34.902  5.385   1.00 157.41 ? 131  ARG B HB2    1 
ATOM   8081  H  HB3    . ARG B 2 131 ? 8.491   33.910  5.372   1.00 157.41 ? 131  ARG B HB3    1 
ATOM   8082  H  HG2    . ARG B 2 131 ? 9.059   33.803  7.832   1.00 163.57 ? 131  ARG B HG2    1 
ATOM   8083  H  HG3    . ARG B 2 131 ? 9.559   35.280  7.516   1.00 163.57 ? 131  ARG B HG3    1 
ATOM   8084  H  HD2    . ARG B 2 131 ? 7.372   35.707  6.632   1.00 160.52 ? 131  ARG B HD2    1 
ATOM   8085  H  HD3    . ARG B 2 131 ? 6.928   34.320  7.276   1.00 160.52 ? 131  ARG B HD3    1 
ATOM   8086  H  HE     . ARG B 2 131 ? 7.985   35.868  9.133   1.00 177.40 ? 131  ARG B HE     1 
ATOM   8087  H  HH11   . ARG B 2 131 ? 5.099   35.591  7.535   1.00 160.80 ? 131  ARG B HH11   1 
ATOM   8088  H  HH12   . ARG B 2 131 ? 4.271   36.250  8.583   1.00 160.80 ? 131  ARG B HH12   1 
ATOM   8089  H  HH21   . ARG B 2 131 ? 6.718   36.864  10.711  1.00 164.43 ? 131  ARG B HH21   1 
ATOM   8090  H  HH22   . ARG B 2 131 ? 5.251   37.020  10.505  1.00 164.43 ? 131  ARG B HH22   1 
ATOM   8091  N  N      . PHE B 2 132 ? 11.598  33.119  3.726   1.00 138.33 ? 132  PHE B N      1 
ATOM   8092  C  CA     . PHE B 2 132 ? 11.978  32.770  2.359   1.00 146.16 ? 132  PHE B CA     1 
ATOM   8093  C  C      . PHE B 2 132 ? 12.861  31.524  2.365   1.00 149.52 ? 132  PHE B C      1 
ATOM   8094  O  O      . PHE B 2 132 ? 12.912  30.793  1.375   1.00 159.91 ? 132  PHE B O      1 
ATOM   8095  C  CB     . PHE B 2 132 ? 12.690  33.936  1.659   1.00 131.25 ? 132  PHE B CB     1 
ATOM   8096  C  CG     . PHE B 2 132 ? 11.755  34.966  1.053   1.00 114.13 ? 132  PHE B CG     1 
ATOM   8097  C  CD1    . PHE B 2 132 ? 10.413  34.685  0.824   1.00 127.30 ? 132  PHE B CD1    1 
ATOM   8098  C  CD2    . PHE B 2 132 ? 12.233  36.218  0.699   1.00 112.51 ? 132  PHE B CD2    1 
ATOM   8099  C  CE1    . PHE B 2 132 ? 9.573   35.632  0.266   1.00 138.43 ? 132  PHE B CE1    1 
ATOM   8100  C  CE2    . PHE B 2 132 ? 11.393  37.168  0.140   1.00 128.59 ? 132  PHE B CE2    1 
ATOM   8101  C  CZ     . PHE B 2 132 ? 10.064  36.872  -0.076  1.00 141.14 ? 132  PHE B CZ     1 
ATOM   8102  H  H      . PHE B 2 132 ? 12.115  33.695  4.099   1.00 166.00 ? 132  PHE B H      1 
ATOM   8103  H  HA     . PHE B 2 132 ? 11.176  32.564  1.853   1.00 175.39 ? 132  PHE B HA     1 
ATOM   8104  H  HB2    . PHE B 2 132 ? 13.250  34.392  2.307   1.00 157.50 ? 132  PHE B HB2    1 
ATOM   8105  H  HB3    . PHE B 2 132 ? 13.241  33.581  0.944   1.00 157.50 ? 132  PHE B HB3    1 
ATOM   8106  H  HD1    . PHE B 2 132 ? 10.074  33.850  1.052   1.00 152.76 ? 132  PHE B HD1    1 
ATOM   8107  H  HD2    . PHE B 2 132 ? 13.128  36.425  0.842   1.00 135.01 ? 132  PHE B HD2    1 
ATOM   8108  H  HE1    . PHE B 2 132 ? 8.677   35.430  0.121   1.00 166.12 ? 132  PHE B HE1    1 
ATOM   8109  H  HE2    . PHE B 2 132 ? 11.727  38.005  -0.090  1.00 154.31 ? 132  PHE B HE2    1 
ATOM   8110  H  HZ     . PHE B 2 132 ? 9.499   37.509  -0.452  1.00 169.37 ? 132  PHE B HZ     1 
ATOM   8111  N  N      . SER B 2 133 ? 13.557  31.280  3.473   1.00 143.99 ? 133  SER B N      1 
ATOM   8112  C  CA     . SER B 2 133 ? 14.418  30.106  3.573   1.00 146.48 ? 133  SER B CA     1 
ATOM   8113  C  C      . SER B 2 133 ? 13.538  28.863  3.534   1.00 143.27 ? 133  SER B C      1 
ATOM   8114  O  O      . SER B 2 133 ? 13.941  27.816  3.024   1.00 138.24 ? 133  SER B O      1 
ATOM   8115  C  CB     . SER B 2 133 ? 15.253  30.129  4.856   1.00 143.47 ? 133  SER B CB     1 
ATOM   8116  O  OG     . SER B 2 133 ? 16.216  31.167  4.828   1.00 149.58 ? 133  SER B OG     1 
ATOM   8117  H  H      . SER B 2 133 ? 13.549  31.775  4.176   1.00 172.78 ? 133  SER B H      1 
ATOM   8118  H  HA     . SER B 2 133 ? 15.021  30.080  2.813   1.00 175.77 ? 133  SER B HA     1 
ATOM   8119  H  HB2    . SER B 2 133 ? 14.663  30.270  5.612   1.00 172.17 ? 133  SER B HB2    1 
ATOM   8120  H  HB3    . SER B 2 133 ? 15.711  29.279  4.948   1.00 172.17 ? 133  SER B HB3    1 
ATOM   8121  H  HG     . SER B 2 133 ? 15.835  31.911  4.750   1.00 179.50 ? 133  SER B HG     1 
ATOM   8122  N  N      . ILE B 2 134 ? 12.333  28.995  4.083   1.00 146.74 ? 134  ILE B N      1 
ATOM   8123  C  CA     . ILE B 2 134 ? 11.365  27.906  4.103   1.00 139.59 ? 134  ILE B CA     1 
ATOM   8124  C  C      . ILE B 2 134 ? 10.396  28.050  2.931   1.00 111.58 ? 134  ILE B C      1 
ATOM   8125  O  O      . ILE B 2 134 ? 9.198   27.810  3.066   1.00 108.02 ? 134  ILE B O      1 
ATOM   8126  C  CB     . ILE B 2 134 ? 10.582  27.860  5.440   1.00 137.31 ? 134  ILE B CB     1 
ATOM   8127  C  CG1    . ILE B 2 134 ? 9.800   29.158  5.681   1.00 138.84 ? 134  ILE B CG1    1 
ATOM   8128  C  CG2    . ILE B 2 134 ? 11.539  27.624  6.598   1.00 135.86 ? 134  ILE B CG2    1 
ATOM   8129  C  CD1    . ILE B 2 134 ? 8.698   29.023  6.716   1.00 124.85 ? 134  ILE B CD1    1 
ATOM   8130  H  H      . ILE B 2 134 ? 12.050  29.717  4.455   1.00 176.08 ? 134  ILE B H      1 
ATOM   8131  H  HA     . ILE B 2 134 ? 11.835  27.064  4.002   1.00 167.51 ? 134  ILE B HA     1 
ATOM   8132  H  HB     . ILE B 2 134 ? 9.953   27.123  5.404   1.00 164.77 ? 134  ILE B HB     1 
ATOM   8133  H  HG12   . ILE B 2 134 ? 10.416  29.841  5.989   1.00 166.61 ? 134  ILE B HG12   1 
ATOM   8134  H  HG13   . ILE B 2 134 ? 9.391   29.436  4.846   1.00 166.61 ? 134  ILE B HG13   1 
ATOM   8135  H  HG21   . ILE B 2 134 ? 12.184  28.348  6.627   1.00 163.03 ? 134  ILE B HG21   1 
ATOM   8136  H  HG22   . ILE B 2 134 ? 11.033  27.598  7.425   1.00 163.03 ? 134  ILE B HG22   1 
ATOM   8137  H  HG23   . ILE B 2 134 ? 11.996  26.779  6.463   1.00 163.03 ? 134  ILE B HG23   1 
ATOM   8138  H  HD11   . ILE B 2 134 ? 9.091   28.756  7.562   1.00 149.82 ? 134  ILE B HD11   1 
ATOM   8139  H  HD12   . ILE B 2 134 ? 8.251   29.878  6.814   1.00 149.82 ? 134  ILE B HD12   1 
ATOM   8140  H  HD13   . ILE B 2 134 ? 8.066   28.350  6.418   1.00 149.82 ? 134  ILE B HD13   1 
ATOM   8141  N  N      . PRO B 2 136 ? 9.638   25.918  -1.133  1.00 124.14 ? 136  PRO B N      1 
ATOM   8142  C  CA     . PRO B 2 136 ? 8.723   26.615  -2.041  1.00 134.76 ? 136  PRO B CA     1 
ATOM   8143  C  C      . PRO B 2 136 ? 9.472   27.286  -3.188  1.00 141.35 ? 136  PRO B C      1 
ATOM   8144  O  O      . PRO B 2 136 ? 9.163   28.419  -3.548  1.00 134.36 ? 136  PRO B O      1 
ATOM   8145  C  CB     . PRO B 2 136 ? 8.049   27.650  -1.129  1.00 132.68 ? 136  PRO B CB     1 
ATOM   8146  C  CG     . PRO B 2 136 ? 9.026   27.887  -0.046  1.00 123.61 ? 136  PRO B CG     1 
ATOM   8147  C  CD     . PRO B 2 136 ? 9.686   26.560  0.191   1.00 137.35 ? 136  PRO B CD     1 
ATOM   8148  H  HA     . PRO B 2 136 ? 8.056   26.005  -2.393  1.00 161.71 ? 136  PRO B HA     1 
ATOM   8149  H  HB2    . PRO B 2 136 ? 7.882   28.466  -1.626  1.00 159.22 ? 136  PRO B HB2    1 
ATOM   8150  H  HB3    . PRO B 2 136 ? 7.223   27.287  -0.774  1.00 159.22 ? 136  PRO B HB3    1 
ATOM   8151  H  HG2    . PRO B 2 136 ? 9.677   28.547  -0.332  1.00 148.33 ? 136  PRO B HG2    1 
ATOM   8152  H  HG3    . PRO B 2 136 ? 8.563   28.186  0.752   1.00 148.33 ? 136  PRO B HG3    1 
ATOM   8153  H  HD2    . PRO B 2 136 ? 10.606  26.685  0.474   1.00 164.82 ? 136  PRO B HD2    1 
ATOM   8154  H  HD3    . PRO B 2 136 ? 9.182   26.041  0.837   1.00 164.82 ? 136  PRO B HD3    1 
ATOM   8155  N  N      . LYS B 2 137 ? 10.411  26.563  -3.791  1.00 149.65 ? 137  LYS B N      1 
ATOM   8156  C  CA     . LYS B 2 137 ? 11.251  27.127  -4.839  1.00 146.10 ? 137  LYS B CA     1 
ATOM   8157  C  C      . LYS B 2 137 ? 10.435  27.463  -6.075  1.00 152.24 ? 137  LYS B C      1 
ATOM   8158  O  O      . LYS B 2 137 ? 10.755  28.409  -6.795  1.00 155.94 ? 137  LYS B O      1 
ATOM   8159  C  CB     . LYS B 2 137 ? 12.368  26.152  -5.215  1.00 139.06 ? 137  LYS B CB     1 
ATOM   8160  C  CG     . LYS B 2 137 ? 13.395  25.905  -4.124  1.00 126.60 ? 137  LYS B CG     1 
ATOM   8161  C  CD     . LYS B 2 137 ? 14.657  25.295  -4.711  1.00 129.51 ? 137  LYS B CD     1 
ATOM   8162  C  CE     . LYS B 2 137 ? 15.758  25.150  -3.678  1.00 144.57 ? 137  LYS B CE     1 
ATOM   8163  N  NZ     . LYS B 2 137 ? 17.009  24.615  -4.284  1.00 142.35 ? 137  LYS B NZ     1 
ATOM   8164  H  H      . LYS B 2 137 ? 10.581  25.740  -3.610  1.00 179.58 ? 137  LYS B H      1 
ATOM   8165  H  HA     . LYS B 2 137 ? 11.659  27.945  -4.515  1.00 175.32 ? 137  LYS B HA     1 
ATOM   8166  H  HB2    . LYS B 2 137 ? 11.969  25.297  -5.440  1.00 166.87 ? 137  LYS B HB2    1 
ATOM   8167  H  HB3    . LYS B 2 137 ? 12.840  26.504  -5.986  1.00 166.87 ? 137  LYS B HB3    1 
ATOM   8168  H  HG2    . LYS B 2 137 ? 13.628  26.747  -3.702  1.00 151.92 ? 137  LYS B HG2    1 
ATOM   8169  H  HG3    . LYS B 2 137 ? 13.030  25.288  -3.470  1.00 151.92 ? 137  LYS B HG3    1 
ATOM   8170  H  HD2    . LYS B 2 137 ? 14.451  24.412  -5.058  1.00 155.41 ? 137  LYS B HD2    1 
ATOM   8171  H  HD3    . LYS B 2 137 ? 14.984  25.866  -5.424  1.00 155.41 ? 137  LYS B HD3    1 
ATOM   8172  H  HE2    . LYS B 2 137 ? 15.954  26.020  -3.295  1.00 173.49 ? 137  LYS B HE2    1 
ATOM   8173  H  HE3    . LYS B 2 137 ? 15.468  24.536  -2.985  1.00 173.49 ? 137  LYS B HE3    1 
ATOM   8174  H  HZ1    . LYS B 2 137 ? 17.297  25.164  -4.922  1.00 170.82 ? 137  LYS B HZ1    1 
ATOM   8175  H  HZ2    . LYS B 2 137 ? 17.640  24.538  -3.662  1.00 170.82 ? 137  LYS B HZ2    1 
ATOM   8176  H  HZ3    . LYS B 2 137 ? 16.855  23.813  -4.640  1.00 170.82 ? 137  LYS B HZ3    1 
ATOM   8177  N  N      . ASP B 2 138 ? 9.391   26.680  -6.331  1.00 161.43 ? 138  ASP B N      1 
ATOM   8178  C  CA     . ASP B 2 138 ? 8.522   26.939  -7.471  1.00 170.71 ? 138  ASP B CA     1 
ATOM   8179  C  C      . ASP B 2 138 ? 7.889   28.322  -7.373  1.00 174.31 ? 138  ASP B C      1 
ATOM   8180  O  O      . ASP B 2 138 ? 7.820   29.050  -8.364  1.00 168.88 ? 138  ASP B O      1 
ATOM   8181  C  CB     . ASP B 2 138 ? 7.432   25.870  -7.572  1.00 170.93 ? 138  ASP B CB     1 
ATOM   8182  C  CG     . ASP B 2 138 ? 7.981   24.461  -7.442  1.00 173.14 ? 138  ASP B CG     1 
ATOM   8183  O  OD1    . ASP B 2 138 ? 9.215   24.292  -7.538  1.00 170.70 ? 138  ASP B OD1    1 
ATOM   8184  O  OD2    . ASP B 2 138 ? 7.179   23.524  -7.246  1.00 170.49 ? 138  ASP B OD2    1 
ATOM   8185  H  H      . ASP B 2 138 ? 9.166   25.996  -5.860  1.00 193.71 ? 138  ASP B H      1 
ATOM   8186  H  HA     . ASP B 2 138 ? 9.050   26.907  -8.285  1.00 204.85 ? 138  ASP B HA     1 
ATOM   8187  H  HB2    . ASP B 2 138 ? 6.787   26.008  -6.861  1.00 205.12 ? 138  ASP B HB2    1 
ATOM   8188  H  HB3    . ASP B 2 138 ? 6.995   25.944  -8.435  1.00 205.12 ? 138  ASP B HB3    1 
ATOM   8189  N  N      . LYS B 2 139 ? 7.425   28.684  -6.178  1.00 176.20 ? 139  LYS B N      1 
ATOM   8190  C  CA     . LYS B 2 139 ? 6.802   29.987  -5.980  1.00 170.98 ? 139  LYS B CA     1 
ATOM   8191  C  C      . LYS B 2 139 ? 7.828   31.121  -5.954  1.00 167.00 ? 139  LYS B C      1 
ATOM   8192  O  O      . LYS B 2 139 ? 7.507   32.252  -6.323  1.00 157.93 ? 139  LYS B O      1 
ATOM   8193  C  CB     . LYS B 2 139 ? 5.986   29.991  -4.684  1.00 152.82 ? 139  LYS B CB     1 
ATOM   8194  C  CG     . LYS B 2 139 ? 4.744   29.112  -4.738  1.00 155.42 ? 139  LYS B CG     1 
ATOM   8195  C  CD     . LYS B 2 139 ? 3.932   29.206  -3.454  1.00 156.01 ? 139  LYS B CD     1 
ATOM   8196  C  CE     . LYS B 2 139 ? 2.660   28.376  -3.535  1.00 139.04 ? 139  LYS B CE     1 
ATOM   8197  N  NZ     . LYS B 2 139 ? 1.879   28.433  -2.268  1.00 137.26 ? 139  LYS B NZ     1 
ATOM   8198  H  H      . LYS B 2 139 ? 7.460   28.195  -5.471  1.00 211.44 ? 139  LYS B H      1 
ATOM   8199  H  HA     . LYS B 2 139 ? 6.192   30.156  -6.714  1.00 205.17 ? 139  LYS B HA     1 
ATOM   8200  H  HB2    . LYS B 2 139 ? 6.547   29.668  -3.960  1.00 183.38 ? 139  LYS B HB2    1 
ATOM   8201  H  HB3    . LYS B 2 139 ? 5.700   30.899  -4.497  1.00 183.38 ? 139  LYS B HB3    1 
ATOM   8202  H  HG2    . LYS B 2 139 ? 4.181   29.400  -5.474  1.00 186.50 ? 139  LYS B HG2    1 
ATOM   8203  H  HG3    . LYS B 2 139 ? 5.011   28.188  -4.861  1.00 186.50 ? 139  LYS B HG3    1 
ATOM   8204  H  HD2    . LYS B 2 139 ? 4.465   28.875  -2.714  1.00 187.22 ? 139  LYS B HD2    1 
ATOM   8205  H  HD3    . LYS B 2 139 ? 3.683   30.131  -3.301  1.00 187.22 ? 139  LYS B HD3    1 
ATOM   8206  H  HE2    . LYS B 2 139 ? 2.101   28.718  -4.250  1.00 166.85 ? 139  LYS B HE2    1 
ATOM   8207  H  HE3    . LYS B 2 139 ? 2.893   27.450  -3.705  1.00 166.85 ? 139  LYS B HE3    1 
ATOM   8208  H  HZ1    . LYS B 2 139 ? 1.648   29.274  -2.091  1.00 164.71 ? 139  LYS B HZ1    1 
ATOM   8209  H  HZ2    . LYS B 2 139 ? 1.142   27.940  -2.343  1.00 164.71 ? 139  LYS B HZ2    1 
ATOM   8210  H  HZ3    . LYS B 2 139 ? 2.369   28.120  -1.594  1.00 164.71 ? 139  LYS B HZ3    1 
ATOM   8211  N  N      . ILE B 2 140 ? 9.045   30.827  -5.495  1.00 164.69 ? 140  ILE B N      1 
ATOM   8212  C  CA     . ILE B 2 140 ? 10.109  31.832  -5.462  1.00 160.75 ? 140  ILE B CA     1 
ATOM   8213  C  C      . ILE B 2 140 ? 10.289  32.444  -6.849  1.00 160.01 ? 140  ILE B C      1 
ATOM   8214  O  O      . ILE B 2 140 ? 10.361  33.662  -7.001  1.00 155.29 ? 140  ILE B O      1 
ATOM   8215  C  CB     . ILE B 2 140 ? 11.458  31.227  -4.984  1.00 151.32 ? 140  ILE B CB     1 
ATOM   8216  C  CG1    . ILE B 2 140 ? 11.384  30.803  -3.513  1.00 136.71 ? 140  ILE B CG1    1 
ATOM   8217  C  CG2    . ILE B 2 140 ? 12.613  32.208  -5.183  1.00 144.63 ? 140  ILE B CG2    1 
ATOM   8218  C  CD1    . ILE B 2 140 ? 11.147  31.930  -2.526  1.00 143.86 ? 140  ILE B CD1    1 
ATOM   8219  H  H      . ILE B 2 140 ? 9.280   30.056  -5.197  1.00 197.63 ? 140  ILE B H      1 
ATOM   8220  H  HA     . ILE B 2 140 ? 9.860   32.540  -4.848  1.00 192.90 ? 140  ILE B HA     1 
ATOM   8221  H  HB     . ILE B 2 140 ? 11.639  30.436  -5.517  1.00 181.59 ? 140  ILE B HB     1 
ATOM   8222  H  HG12   . ILE B 2 140 ? 10.657  30.169  -3.412  1.00 164.05 ? 140  ILE B HG12   1 
ATOM   8223  H  HG13   . ILE B 2 140 ? 12.222  30.376  -3.274  1.00 164.05 ? 140  ILE B HG13   1 
ATOM   8224  H  HG21   . ILE B 2 140 ? 12.435  33.013  -4.673  1.00 173.55 ? 140  ILE B HG21   1 
ATOM   8225  H  HG22   . ILE B 2 140 ? 13.435  31.795  -4.874  1.00 173.55 ? 140  ILE B HG22   1 
ATOM   8226  H  HG23   . ILE B 2 140 ? 12.685  32.423  -6.126  1.00 173.55 ? 140  ILE B HG23   1 
ATOM   8227  H  HD11   . ILE B 2 140 ? 10.304  32.361  -2.737  1.00 172.63 ? 140  ILE B HD11   1 
ATOM   8228  H  HD12   . ILE B 2 140 ? 11.116  31.563  -1.629  1.00 172.63 ? 140  ILE B HD12   1 
ATOM   8229  H  HD13   . ILE B 2 140 ? 11.873  32.570  -2.598  1.00 172.63 ? 140  ILE B HD13   1 
ATOM   8230  N  N      . GLN B 2 141 ? 10.351  31.574  -7.854  1.00 157.98 ? 141  GLN B N      1 
ATOM   8231  C  CA     . GLN B 2 141 ? 10.487  31.987  -9.248  1.00 167.13 ? 141  GLN B CA     1 
ATOM   8232  C  C      . GLN B 2 141 ? 9.327   32.864  -9.699  1.00 176.08 ? 141  GLN B C      1 
ATOM   8233  O  O      . GLN B 2 141 ? 9.512   33.839  -10.428 1.00 169.05 ? 141  GLN B O      1 
ATOM   8234  C  CB     . GLN B 2 141 ? 10.589  30.763  -10.161 1.00 166.09 ? 141  GLN B CB     1 
ATOM   8235  C  CG     . GLN B 2 141 ? 11.979  30.154  -10.234 1.00 157.40 ? 141  GLN B CG     1 
ATOM   8236  C  CD     . GLN B 2 141 ? 12.064  29.024  -11.244 1.00 160.10 ? 141  GLN B CD     1 
ATOM   8237  O  OE1    . GLN B 2 141 ? 11.453  27.970  -11.066 1.00 173.59 ? 141  GLN B OE1    1 
ATOM   8238  N  NE2    . GLN B 2 141 ? 12.820  29.242  -12.314 1.00 135.56 ? 141  GLN B NE2    1 
ATOM   8239  H  H      . GLN B 2 141 ? 10.315  30.721  -7.751  1.00 189.57 ? 141  GLN B H      1 
ATOM   8240  H  HA     . GLN B 2 141 ? 11.304  32.500  -9.345  1.00 200.55 ? 141  GLN B HA     1 
ATOM   8241  H  HB2    . GLN B 2 141 ? 9.984   30.079  -9.832  1.00 199.31 ? 141  GLN B HB2    1 
ATOM   8242  H  HB3    . GLN B 2 141 ? 10.332  31.023  -11.059 1.00 199.31 ? 141  GLN B HB3    1 
ATOM   8243  H  HG2    . GLN B 2 141 ? 12.612  30.840  -10.497 1.00 188.88 ? 141  GLN B HG2    1 
ATOM   8244  H  HG3    . GLN B 2 141 ? 12.216  29.798  -9.364  1.00 188.88 ? 141  GLN B HG3    1 
ATOM   8245  H  HE21   . GLN B 2 141 ? 13.229  29.993  -12.406 1.00 162.67 ? 141  GLN B HE21   1 
ATOM   8246  H  HE22   . GLN B 2 141 ? 12.900  28.633  -12.915 1.00 162.67 ? 141  GLN B HE22   1 
ATOM   8247  N  N      . ASP B 2 142 ? 8.128   32.502  -9.256  1.00 177.63 ? 142  ASP B N      1 
ATOM   8248  C  CA     . ASP B 2 142 ? 6.929   33.254  -9.589  1.00 174.82 ? 142  ASP B CA     1 
ATOM   8249  C  C      . ASP B 2 142 ? 6.880   34.572  -8.831  1.00 175.78 ? 142  ASP B C      1 
ATOM   8250  O  O      . ASP B 2 142 ? 6.383   35.571  -9.350  1.00 178.58 ? 142  ASP B O      1 
ATOM   8251  C  CB     . ASP B 2 142 ? 5.685   32.418  -9.286  1.00 172.49 ? 142  ASP B CB     1 
ATOM   8252  C  CG     . ASP B 2 142 ? 5.702   31.075  -9.993  1.00 171.24 ? 142  ASP B CG     1 
ATOM   8253  O  OD1    . ASP B 2 142 ? 6.277   30.993  -11.098 1.00 167.45 ? 142  ASP B OD1    1 
ATOM   8254  O  OD2    . ASP B 2 142 ? 5.146   30.101  -9.442  1.00 175.14 ? 142  ASP B OD2    1 
ATOM   8255  H  H      . ASP B 2 142 ? 7.984   31.818  -8.755  1.00 213.15 ? 142  ASP B H      1 
ATOM   8256  H  HA     . ASP B 2 142 ? 6.934   33.453  -10.539 1.00 209.78 ? 142  ASP B HA     1 
ATOM   8257  H  HB2    . ASP B 2 142 ? 5.637   32.254  -8.331  1.00 206.99 ? 142  ASP B HB2    1 
ATOM   8258  H  HB3    . ASP B 2 142 ? 4.898   32.903  -9.581  1.00 206.99 ? 142  ASP B HB3    1 
ATOM   8259  N  N      . PHE B 2 143 ? 7.394   34.579  -7.605  1.00 169.88 ? 143  PHE B N      1 
ATOM   8260  C  CA     . PHE B 2 143 ? 7.415   35.803  -6.817  1.00 165.54 ? 143  PHE B CA     1 
ATOM   8261  C  C      . PHE B 2 143 ? 8.417   36.786  -7.410  1.00 163.18 ? 143  PHE B C      1 
ATOM   8262  O  O      . PHE B 2 143 ? 8.252   38.001  -7.299  1.00 159.41 ? 143  PHE B O      1 
ATOM   8263  C  CB     . PHE B 2 143 ? 7.769   35.506  -5.359  1.00 160.49 ? 143  PHE B CB     1 
ATOM   8264  C  CG     . PHE B 2 143 ? 8.020   36.738  -4.540  1.00 155.96 ? 143  PHE B CG     1 
ATOM   8265  C  CD1    . PHE B 2 143 ? 6.999   37.641  -4.297  1.00 152.32 ? 143  PHE B CD1    1 
ATOM   8266  C  CD2    . PHE B 2 143 ? 9.281   37.007  -4.037  1.00 143.00 ? 143  PHE B CD2    1 
ATOM   8267  C  CE1    . PHE B 2 143 ? 7.226   38.781  -3.552  1.00 140.43 ? 143  PHE B CE1    1 
ATOM   8268  C  CE2    . PHE B 2 143 ? 9.515   38.145  -3.291  1.00 133.23 ? 143  PHE B CE2    1 
ATOM   8269  C  CZ     . PHE B 2 143 ? 8.486   39.033  -3.049  1.00 135.72 ? 143  PHE B CZ     1 
ATOM   8270  H  H      . PHE B 2 143 ? 7.734   33.894  -7.211  1.00 203.86 ? 143  PHE B H      1 
ATOM   8271  H  HA     . PHE B 2 143 ? 6.536   36.213  -6.839  1.00 198.65 ? 143  PHE B HA     1 
ATOM   8272  H  HB2    . PHE B 2 143 ? 7.035   35.021  -4.951  1.00 192.59 ? 143  PHE B HB2    1 
ATOM   8273  H  HB3    . PHE B 2 143 ? 8.574   34.965  -5.337  1.00 192.59 ? 143  PHE B HB3    1 
ATOM   8274  H  HD1    . PHE B 2 143 ? 9.977   36.411  -4.196  1.00 171.60 ? 143  PHE B HD1    1 
ATOM   8275  H  HD2    . PHE B 2 143 ? 6.148   37.474  -4.633  1.00 182.78 ? 143  PHE B HD2    1 
ATOM   8276  H  HE1    . PHE B 2 143 ? 10.365  38.313  -2.953  1.00 159.88 ? 143  PHE B HE1    1 
ATOM   8277  H  HE2    . PHE B 2 143 ? 6.532   39.378  -3.390  1.00 168.52 ? 143  PHE B HE2    1 
ATOM   8278  H  HZ     . PHE B 2 143 ? 8.642   39.800  -2.547  1.00 162.86 ? 143  PHE B HZ     1 
ATOM   8279  N  N      . LEU B 2 144 ? 9.452   36.249  -8.047  1.00 167.04 ? 144  LEU B N      1 
ATOM   8280  C  CA     . LEU B 2 144 ? 10.487  37.068  -8.667  1.00 164.68 ? 144  LEU B CA     1 
ATOM   8281  C  C      . LEU B 2 144 ? 9.994   37.711  -9.958  1.00 170.70 ? 144  LEU B C      1 
ATOM   8282  O  O      . LEU B 2 144 ? 10.321  38.856  -10.254 1.00 164.11 ? 144  LEU B O      1 
ATOM   8283  C  CB     . LEU B 2 144 ? 11.737  36.232  -8.948  1.00 155.00 ? 144  LEU B CB     1 
ATOM   8284  C  CG     . LEU B 2 144 ? 12.556  35.819  -7.726  1.00 155.95 ? 144  LEU B CG     1 
ATOM   8285  C  CD1    . LEU B 2 144 ? 13.468  34.652  -8.066  1.00 149.61 ? 144  LEU B CD1    1 
ATOM   8286  C  CD2    . LEU B 2 144 ? 13.364  36.999  -7.211  1.00 145.57 ? 144  LEU B CD2    1 
ATOM   8287  H  H      . LEU B 2 144 ? 9.579   35.403  -8.135  1.00 200.45 ? 144  LEU B H      1 
ATOM   8288  H  HA     . LEU B 2 144 ? 10.734  37.779  -8.055  1.00 197.61 ? 144  LEU B HA     1 
ATOM   8289  H  HB2    . LEU B 2 144 ? 11.465  35.419  -9.402  1.00 186.00 ? 144  LEU B HB2    1 
ATOM   8290  H  HB3    . LEU B 2 144 ? 12.322  36.744  -9.529  1.00 186.00 ? 144  LEU B HB3    1 
ATOM   8291  H  HG     . LEU B 2 144 ? 11.953  35.536  -7.021  1.00 187.14 ? 144  LEU B HG     1 
ATOM   8292  H  HD11   . LEU B 2 144 ? 14.070  34.919  -8.778  1.00 179.53 ? 144  LEU B HD11   1 
ATOM   8293  H  HD12   . LEU B 2 144 ? 13.976  34.408  -7.277  1.00 179.53 ? 144  LEU B HD12   1 
ATOM   8294  H  HD13   . LEU B 2 144 ? 12.925  33.902  -8.355  1.00 179.53 ? 144  LEU B HD13   1 
ATOM   8295  H  HD21   . LEU B 2 144 ? 12.757  37.714  -6.964  1.00 174.68 ? 144  LEU B HD21   1 
ATOM   8296  H  HD22   . LEU B 2 144 ? 13.876  36.717  -6.437  1.00 174.68 ? 144  LEU B HD22   1 
ATOM   8297  H  HD23   . LEU B 2 144 ? 13.963  37.301  -7.912  1.00 174.68 ? 144  LEU B HD23   1 
ATOM   8298  N  N      . LYS B 2 145 ? 9.217   36.961  -10.730 1.00 179.73 ? 145  LYS B N      1 
ATOM   8299  C  CA     . LYS B 2 145 ? 8.705   37.454  -12.002 1.00 179.12 ? 145  LYS B CA     1 
ATOM   8300  C  C      . LYS B 2 145 ? 7.690   38.579  -11.779 1.00 177.57 ? 145  LYS B C      1 
ATOM   8301  O  O      . LYS B 2 145 ? 7.488   39.429  -12.646 1.00 164.44 ? 145  LYS B O      1 
ATOM   8302  C  CB     . LYS B 2 145 ? 8.081   36.311  -12.807 1.00 164.40 ? 145  LYS B CB     1 
ATOM   8303  C  CG     . LYS B 2 145 ? 7.758   36.658  -14.257 1.00 151.39 ? 145  LYS B CG     1 
ATOM   8304  C  CD     . LYS B 2 145 ? 9.005   37.116  -15.014 1.00 135.51 ? 145  LYS B CD     1 
ATOM   8305  C  CE     . LYS B 2 145 ? 8.722   37.377  -16.484 1.00 129.85 ? 145  LYS B CE     1 
ATOM   8306  N  NZ     . LYS B 2 145 ? 8.243   36.162  -17.198 1.00 137.94 ? 145  LYS B NZ     1 
ATOM   8307  H  H      . LYS B 2 145 ? 8.970   36.160  -10.539 1.00 215.68 ? 145  LYS B H      1 
ATOM   8308  H  HA     . LYS B 2 145 ? 9.442   37.816  -12.519 1.00 214.94 ? 145  LYS B HA     1 
ATOM   8309  H  HB2    . LYS B 2 145 ? 8.699   35.564  -12.814 1.00 197.27 ? 145  LYS B HB2    1 
ATOM   8310  H  HB3    . LYS B 2 145 ? 7.253   36.045  -12.377 1.00 197.27 ? 145  LYS B HB3    1 
ATOM   8311  H  HG2    . LYS B 2 145 ? 7.403   35.873  -14.702 1.00 181.67 ? 145  LYS B HG2    1 
ATOM   8312  H  HG3    . LYS B 2 145 ? 7.109   37.379  -14.277 1.00 181.67 ? 145  LYS B HG3    1 
ATOM   8313  H  HD2    . LYS B 2 145 ? 9.332   37.940  -14.619 1.00 162.62 ? 145  LYS B HD2    1 
ATOM   8314  H  HD3    . LYS B 2 145 ? 9.684   36.426  -14.956 1.00 162.62 ? 145  LYS B HD3    1 
ATOM   8315  H  HE2    . LYS B 2 145 ? 8.037   38.060  -16.558 1.00 155.82 ? 145  LYS B HE2    1 
ATOM   8316  H  HE3    . LYS B 2 145 ? 9.538   37.677  -16.915 1.00 155.82 ? 145  LYS B HE3    1 
ATOM   8317  H  HZ1    . LYS B 2 145 ? 7.489   35.869  -16.826 1.00 165.53 ? 145  LYS B HZ1    1 
ATOM   8318  H  HZ2    . LYS B 2 145 ? 8.088   36.354  -18.053 1.00 165.53 ? 145  LYS B HZ2    1 
ATOM   8319  H  HZ3    . LYS B 2 145 ? 8.857   35.520  -17.152 1.00 165.53 ? 145  LYS B HZ3    1 
ATOM   8320  N  N      . ASP B 2 146 ? 7.057   38.572  -10.608 1.00 185.55 ? 146  ASP B N      1 
ATOM   8321  C  CA     . ASP B 2 146 ? 6.065   39.580  -10.244 1.00 184.59 ? 146  ASP B CA     1 
ATOM   8322  C  C      . ASP B 2 146 ? 6.735   40.896  -9.847  1.00 180.03 ? 146  ASP B C      1 
ATOM   8323  O  O      . ASP B 2 146 ? 6.082   41.937  -9.778  1.00 175.74 ? 146  ASP B O      1 
ATOM   8324  C  CB     . ASP B 2 146 ? 5.175   39.078  -9.103  1.00 183.75 ? 146  ASP B CB     1 
ATOM   8325  C  CG     . ASP B 2 146 ? 4.366   37.852  -9.488  1.00 181.10 ? 146  ASP B CG     1 
ATOM   8326  O  OD1    . ASP B 2 146 ? 4.245   37.571  -10.699 1.00 170.18 ? 146  ASP B OD1    1 
ATOM   8327  O  OD2    . ASP B 2 146 ? 3.847   37.171  -8.578  1.00 181.28 ? 146  ASP B OD2    1 
ATOM   8328  H  H      . ASP B 2 146 ? 7.188   37.982  -9.996  1.00 222.66 ? 146  ASP B H      1 
ATOM   8329  H  HA     . ASP B 2 146 ? 5.497   39.754  -11.012 1.00 221.51 ? 146  ASP B HA     1 
ATOM   8330  H  HB2    . ASP B 2 146 ? 5.734   38.844  -8.346  1.00 220.50 ? 146  ASP B HB2    1 
ATOM   8331  H  HB3    . ASP B 2 146 ? 4.555   39.781  -8.853  1.00 220.50 ? 146  ASP B HB3    1 
ATOM   8332  N  N      . SER B 2 147 ? 8.038   40.840  -9.584  1.00 177.39 ? 147  SER B N      1 
ATOM   8333  C  CA     . SER B 2 147 ? 8.804   42.023  -9.200  1.00 177.93 ? 147  SER B CA     1 
ATOM   8334  C  C      . SER B 2 147 ? 9.136   42.904  -10.407 1.00 178.57 ? 147  SER B C      1 
ATOM   8335  O  O      . SER B 2 147 ? 9.711   43.980  -10.246 1.00 165.22 ? 147  SER B O      1 
ATOM   8336  C  CB     . SER B 2 147 ? 10.096  41.618  -8.486  1.00 165.73 ? 147  SER B CB     1 
ATOM   8337  O  OG     . SER B 2 147 ? 11.004  40.998  -9.377  1.00 153.69 ? 147  SER B OG     1 
ATOM   8338  H  H      . SER B 2 147 ? 8.507   40.120  -9.623  1.00 212.87 ? 147  SER B H      1 
ATOM   8339  H  HA     . SER B 2 147 ? 8.275   42.551  -8.582  1.00 213.52 ? 147  SER B HA     1 
ATOM   8340  H  HB2    . SER B 2 147 ? 10.512  42.412  -8.115  1.00 198.87 ? 147  SER B HB2    1 
ATOM   8341  H  HB3    . SER B 2 147 ? 9.880   40.995  -7.774  1.00 198.87 ? 147  SER B HB3    1 
ATOM   8342  H  HG     . SER B 2 147 ? 10.657  40.307  -9.706  1.00 184.42 ? 147  SER B HG     1 
ATOM   8343  N  N      . GLN B 2 148 ? 8.803   42.427  -11.607 1.00 185.26 ? 148  GLN B N      1 
ATOM   8344  C  CA     . GLN B 2 148 ? 9.019   43.175  -12.852 1.00 184.17 ? 148  GLN B CA     1 
ATOM   8345  C  C      . GLN B 2 148 ? 10.502  43.378  -13.191 1.00 182.34 ? 148  GLN B C      1 
ATOM   8346  O  O      . GLN B 2 148 ? 10.830  44.087  -14.143 1.00 171.89 ? 148  GLN B O      1 
ATOM   8347  C  CB     . GLN B 2 148 ? 8.305   44.539  -12.802 1.00 183.49 ? 148  GLN B CB     1 
ATOM   8348  C  CG     . GLN B 2 148 ? 6.780   44.448  -12.770 1.00 172.01 ? 148  GLN B CG     1 
ATOM   8349  C  CD     . GLN B 2 148 ? 6.110   45.797  -12.558 1.00 162.04 ? 148  GLN B CD     1 
ATOM   8350  O  OE1    . GLN B 2 148 ? 6.644   46.670  -11.875 1.00 171.97 ? 148  GLN B OE1    1 
ATOM   8351  N  NE2    . GLN B 2 148 ? 4.932   45.971  -13.148 1.00 146.69 ? 148  GLN B NE2    1 
ATOM   8352  H  H      . GLN B 2 148 ? 8.443   41.655  -11.730 1.00 222.32 ? 148  GLN B H      1 
ATOM   8353  H  HA     . GLN B 2 148 ? 8.625   42.670  -13.580 1.00 221.00 ? 148  GLN B HA     1 
ATOM   8354  H  HB2    . GLN B 2 148 ? 8.590   45.010  -12.003 1.00 220.19 ? 148  GLN B HB2    1 
ATOM   8355  H  HB3    . GLN B 2 148 ? 8.554   45.048  -13.589 1.00 220.19 ? 148  GLN B HB3    1 
ATOM   8356  H  HG2    . GLN B 2 148 ? 6.467   44.088  -13.615 1.00 206.41 ? 148  GLN B HG2    1 
ATOM   8357  H  HG3    . GLN B 2 148 ? 6.514   43.864  -12.042 1.00 206.41 ? 148  GLN B HG3    1 
ATOM   8358  H  HE21   . GLN B 2 148 ? 4.589   45.339  -13.619 1.00 176.03 ? 148  GLN B HE21   1 
ATOM   8359  H  HE22   . GLN B 2 148 ? 4.513   46.717  -13.058 1.00 176.03 ? 148  GLN B HE22   1 
ATOM   8360  N  N      . LEU B 2 149 ? 11.392  42.755  -12.422 1.00 177.18 ? 149  LEU B N      1 
ATOM   8361  C  CA     . LEU B 2 149 ? 12.829  42.850  -12.680 1.00 162.13 ? 149  LEU B CA     1 
ATOM   8362  C  C      . LEU B 2 149 ? 13.211  41.881  -13.804 1.00 154.51 ? 149  LEU B C      1 
ATOM   8363  O  O      . LEU B 2 149 ? 12.342  41.233  -14.387 1.00 160.37 ? 149  LEU B O      1 
ATOM   8364  C  CB     . LEU B 2 149 ? 13.618  42.536  -11.400 1.00 159.03 ? 149  LEU B CB     1 
ATOM   8365  C  CG     . LEU B 2 149 ? 15.071  43.006  -11.245 1.00 147.99 ? 149  LEU B CG     1 
ATOM   8366  C  CD1    . LEU B 2 149 ? 15.216  44.493  -11.536 1.00 133.83 ? 149  LEU B CD1    1 
ATOM   8367  C  CD2    . LEU B 2 149 ? 15.591  42.685  -9.849  1.00 126.64 ? 149  LEU B CD2    1 
ATOM   8368  H  H      . LEU B 2 149 ? 11.190  42.270  -11.741 1.00 212.62 ? 149  LEU B H      1 
ATOM   8369  H  HA     . LEU B 2 149 ? 13.048  43.751  -12.963 1.00 194.56 ? 149  LEU B HA     1 
ATOM   8370  H  HB2    . LEU B 2 149 ? 13.126  42.919  -10.656 1.00 190.84 ? 149  LEU B HB2    1 
ATOM   8371  H  HB3    . LEU B 2 149 ? 13.631  41.571  -11.298 1.00 190.84 ? 149  LEU B HB3    1 
ATOM   8372  H  HG     . LEU B 2 149 ? 15.622  42.526  -11.883 1.00 177.59 ? 149  LEU B HG     1 
ATOM   8373  H  HD11   . LEU B 2 149 ? 14.662  44.991  -10.915 1.00 160.60 ? 149  LEU B HD11   1 
ATOM   8374  H  HD12   . LEU B 2 149 ? 16.146  44.746  -11.427 1.00 160.60 ? 149  LEU B HD12   1 
ATOM   8375  H  HD13   . LEU B 2 149 ? 14.930  44.666  -12.447 1.00 160.60 ? 149  LEU B HD13   1 
ATOM   8376  H  HD21   . LEU B 2 149 ? 15.549  41.726  -9.710  1.00 151.97 ? 149  LEU B HD21   1 
ATOM   8377  H  HD22   . LEU B 2 149 ? 16.508  42.991  -9.776  1.00 151.97 ? 149  LEU B HD22   1 
ATOM   8378  H  HD23   . LEU B 2 149 ? 15.037  43.139  -9.195  1.00 151.97 ? 149  LEU B HD23   1 
ATOM   8379  N  N      . GLN B 2 150 ? 14.505  41.778  -14.098 1.00 140.94 ? 150  GLN B N      1 
ATOM   8380  C  CA     . GLN B 2 150 ? 14.996  40.875  -15.139 1.00 134.10 ? 150  GLN B CA     1 
ATOM   8381  C  C      . GLN B 2 150 ? 15.606  39.619  -14.534 1.00 129.31 ? 150  GLN B C      1 
ATOM   8382  O  O      . GLN B 2 150 ? 16.510  39.693  -13.702 1.00 138.24 ? 150  GLN B O      1 
ATOM   8383  C  CB     . GLN B 2 150 ? 16.031  41.568  -16.030 1.00 131.34 ? 150  GLN B CB     1 
ATOM   8384  C  CG     . GLN B 2 150 ? 15.523  42.823  -16.730 1.00 129.22 ? 150  GLN B CG     1 
ATOM   8385  C  CD     . GLN B 2 150 ? 16.052  42.967  -18.150 1.00 135.60 ? 150  GLN B CD     1 
ATOM   8386  O  OE1    . GLN B 2 150 ? 17.081  42.392  -18.509 1.00 109.74 ? 150  GLN B OE1    1 
ATOM   8387  N  NE2    . GLN B 2 150 ? 15.346  43.744  -18.964 1.00 151.00 ? 150  GLN B NE2    1 
ATOM   8388  H  H      . GLN B 2 150 ? 15.126  42.225  -13.706 1.00 169.12 ? 150  GLN B H      1 
ATOM   8389  H  HA     . GLN B 2 150 ? 14.251  40.606  -15.700 1.00 160.92 ? 150  GLN B HA     1 
ATOM   8390  H  HB2    . GLN B 2 150 ? 16.790  41.824  -15.482 1.00 157.61 ? 150  GLN B HB2    1 
ATOM   8391  H  HB3    . GLN B 2 150 ? 16.319  40.945  -16.715 1.00 157.61 ? 150  GLN B HB3    1 
ATOM   8392  H  HG2    . GLN B 2 150 ? 14.555  42.789  -16.773 1.00 155.06 ? 150  GLN B HG2    1 
ATOM   8393  H  HG3    . GLN B 2 150 ? 15.805  43.602  -16.225 1.00 155.06 ? 150  GLN B HG3    1 
ATOM   8394  H  HE21   . GLN B 2 150 ? 14.634  44.132  -18.679 1.00 181.20 ? 150  GLN B HE21   1 
ATOM   8395  H  HE22   . GLN B 2 150 ? 15.602  43.859  -19.777 1.00 181.20 ? 150  GLN B HE22   1 
ATOM   8396  N  N      . PHE B 2 151 ? 15.101  38.467  -14.962 1.00 115.08 ? 151  PHE B N      1 
ATOM   8397  C  CA     . PHE B 2 151 ? 15.554  37.181  -14.454 1.00 99.59  ? 151  PHE B CA     1 
ATOM   8398  C  C      . PHE B 2 151 ? 15.531  36.179  -15.593 1.00 95.59  ? 151  PHE B C      1 
ATOM   8399  O  O      . PHE B 2 151 ? 14.632  36.201  -16.431 1.00 120.91 ? 151  PHE B O      1 
ATOM   8400  C  CB     . PHE B 2 151 ? 14.662  36.696  -13.310 1.00 92.57  ? 151  PHE B CB     1 
ATOM   8401  C  CG     . PHE B 2 151 ? 14.728  37.554  -12.083 1.00 145.11 ? 151  PHE B CG     1 
ATOM   8402  C  CD1    . PHE B 2 151 ? 15.925  37.755  -11.416 1.00 145.68 ? 151  PHE B CD1    1 
ATOM   8403  C  CD2    . PHE B 2 151 ? 13.584  38.160  -11.591 1.00 165.64 ? 151  PHE B CD2    1 
ATOM   8404  C  CE1    . PHE B 2 151 ? 15.978  38.554  -10.285 1.00 146.58 ? 151  PHE B CE1    1 
ATOM   8405  C  CE2    . PHE B 2 151 ? 13.635  38.952  -10.459 1.00 169.34 ? 151  PHE B CE2    1 
ATOM   8406  C  CZ     . PHE B 2 151 ? 14.832  39.146  -9.805  1.00 152.48 ? 151  PHE B CZ     1 
ATOM   8407  H  H      . PHE B 2 151 ? 14.483  38.405  -15.557 1.00 138.10 ? 151  PHE B H      1 
ATOM   8408  H  HA     . PHE B 2 151 ? 16.464  37.261  -14.127 1.00 119.51 ? 151  PHE B HA     1 
ATOM   8409  H  HB2    . PHE B 2 151 ? 13.741  36.685  -13.616 1.00 111.08 ? 151  PHE B HB2    1 
ATOM   8410  H  HB3    . PHE B 2 151 ? 14.936  35.799  -13.060 1.00 111.08 ? 151  PHE B HB3    1 
ATOM   8411  H  HD1    . PHE B 2 151 ? 16.702  37.356  -11.735 1.00 174.82 ? 151  PHE B HD1    1 
ATOM   8412  H  HD2    . PHE B 2 151 ? 12.773  38.032  -12.027 1.00 198.77 ? 151  PHE B HD2    1 
ATOM   8413  H  HE1    . PHE B 2 151 ? 16.787  38.681  -9.844  1.00 175.89 ? 151  PHE B HE1    1 
ATOM   8414  H  HE2    . PHE B 2 151 ? 12.860  39.354  -10.139 1.00 203.21 ? 151  PHE B HE2    1 
ATOM   8415  H  HZ     . PHE B 2 151 ? 14.867  39.681  -9.045  1.00 182.98 ? 151  PHE B HZ     1 
ATOM   8416  N  N      . GLU B 2 152 ? 16.523  35.300  -15.619 1.00 96.47  ? 152  GLU B N      1 
ATOM   8417  C  CA     . GLU B 2 152 ? 16.620  34.293  -16.665 1.00 89.04  ? 152  GLU B CA     1 
ATOM   8418  C  C      . GLU B 2 152 ? 17.402  33.092  -16.172 1.00 90.79  ? 152  GLU B C      1 
ATOM   8419  O  O      . GLU B 2 152 ? 18.610  33.175  -15.955 1.00 99.98  ? 152  GLU B O      1 
ATOM   8420  C  CB     . GLU B 2 152 ? 17.298  34.882  -17.904 1.00 78.98  ? 152  GLU B CB     1 
ATOM   8421  C  CG     . GLU B 2 152 ? 17.416  33.920  -19.073 1.00 91.04  ? 152  GLU B CG     1 
ATOM   8422  C  CD     . GLU B 2 152 ? 17.890  34.605  -20.343 1.00 114.78 ? 152  GLU B CD     1 
ATOM   8423  O  OE1    . GLU B 2 152 ? 17.393  35.710  -20.650 1.00 117.89 ? 152  GLU B OE1    1 
ATOM   8424  O  OE2    . GLU B 2 152 ? 18.766  34.040  -21.032 1.00 111.71 ? 152  GLU B OE2    1 
ATOM   8425  H  H      . GLU B 2 152 ? 17.157  35.265  -15.039 1.00 115.76 ? 152  GLU B H      1 
ATOM   8426  H  HA     . GLU B 2 152 ? 15.730  33.999  -16.914 1.00 106.85 ? 152  GLU B HA     1 
ATOM   8427  H  HB2    . GLU B 2 152 ? 16.785  35.648  -18.203 1.00 94.77  ? 152  GLU B HB2    1 
ATOM   8428  H  HB3    . GLU B 2 152 ? 18.195  35.163  -17.662 1.00 94.77  ? 152  GLU B HB3    1 
ATOM   8429  H  HG2    . GLU B 2 152 ? 18.056  33.226  -18.849 1.00 109.25 ? 152  GLU B HG2    1 
ATOM   8430  H  HG3    . GLU B 2 152 ? 16.547  33.528  -19.250 1.00 109.25 ? 152  GLU B HG3    1 
ATOM   8431  N  N      . ALA B 2 153 ? 16.714  31.972  -15.992 1.00 91.49  ? 153  ALA B N      1 
ATOM   8432  C  CA     . ALA B 2 153 ? 17.378  30.772  -15.517 1.00 81.56  ? 153  ALA B CA     1 
ATOM   8433  C  C      . ALA B 2 153 ? 18.290  30.259  -16.624 1.00 93.23  ? 153  ALA B C      1 
ATOM   8434  O  O      . ALA B 2 153 ? 17.849  30.033  -17.750 1.00 104.30 ? 153  ALA B O      1 
ATOM   8435  C  CB     . ALA B 2 153 ? 16.362  29.718  -15.110 1.00 98.90  ? 153  ALA B CB     1 
ATOM   8436  H  H      . ALA B 2 153 ? 15.871  31.882  -16.136 1.00 109.79 ? 153  ALA B H      1 
ATOM   8437  H  HA     . ALA B 2 153 ? 17.923  30.988  -14.745 1.00 97.87  ? 153  ALA B HA     1 
ATOM   8438  H  HB1    . ALA B 2 153 ? 15.815  29.494  -15.880 1.00 118.68 ? 153  ALA B HB1    1 
ATOM   8439  H  HB2    . ALA B 2 153 ? 16.833  28.930  -14.798 1.00 118.68 ? 153  ALA B HB2    1 
ATOM   8440  H  HB3    . ALA B 2 153 ? 15.805  30.074  -14.400 1.00 118.68 ? 153  ALA B HB3    1 
ATOM   8441  N  N      . ILE B 2 154 ? 19.563  30.079  -16.297 1.00 92.28  ? 154  ILE B N      1 
ATOM   8442  C  CA     . ILE B 2 154 ? 20.541  29.599  -17.261 1.00 101.70 ? 154  ILE B CA     1 
ATOM   8443  C  C      . ILE B 2 154 ? 20.288  28.132  -17.583 1.00 106.48 ? 154  ILE B C      1 
ATOM   8444  O  O      . ILE B 2 154 ? 19.652  27.420  -16.804 1.00 104.33 ? 154  ILE B O      1 
ATOM   8445  C  CB     . ILE B 2 154 ? 21.980  29.777  -16.734 1.00 91.10  ? 154  ILE B CB     1 
ATOM   8446  C  CG1    . ILE B 2 154 ? 22.979  29.738  -17.895 1.00 98.51  ? 154  ILE B CG1    1 
ATOM   8447  C  CG2    . ILE B 2 154 ? 22.303  28.703  -15.693 1.00 96.29  ? 154  ILE B CG2    1 
ATOM   8448  C  CD1    . ILE B 2 154 ? 24.418  29.973  -17.485 1.00 102.57 ? 154  ILE B CD1    1 
ATOM   8449  H  H      . ILE B 2 154 ? 19.888  30.230  -15.515 1.00 110.74 ? 154  ILE B H      1 
ATOM   8450  H  HA     . ILE B 2 154 ? 20.455  30.109  -18.082 1.00 122.04 ? 154  ILE B HA     1 
ATOM   8451  H  HB     . ILE B 2 154 ? 22.044  30.645  -16.306 1.00 109.31 ? 154  ILE B HB     1 
ATOM   8452  H  HG12   . ILE B 2 154 ? 22.931  28.866  -18.317 1.00 118.21 ? 154  ILE B HG12   1 
ATOM   8453  H  HG13   . ILE B 2 154 ? 22.738  30.425  -18.536 1.00 118.21 ? 154  ILE B HG13   1 
ATOM   8454  H  HG21   . ILE B 2 154 ? 22.218  27.829  -16.105 1.00 115.54 ? 154  ILE B HG21   1 
ATOM   8455  H  HG22   . ILE B 2 154 ? 23.210  28.833  -15.376 1.00 115.54 ? 154  ILE B HG22   1 
ATOM   8456  H  HG23   . ILE B 2 154 ? 21.679  28.783  -14.954 1.00 115.54 ? 154  ILE B HG23   1 
ATOM   8457  H  HD11   . ILE B 2 154 ? 24.682  29.286  -16.853 1.00 123.09 ? 154  ILE B HD11   1 
ATOM   8458  H  HD12   . ILE B 2 154 ? 24.981  29.932  -18.274 1.00 123.09 ? 154  ILE B HD12   1 
ATOM   8459  H  HD13   . ILE B 2 154 ? 24.489  30.848  -17.072 1.00 123.09 ? 154  ILE B HD13   1 
ATOM   8460  N  N      . SER B 2 155 ? 20.786  27.675  -18.727 1.00 92.02  ? 155  SER B N      1 
ATOM   8461  C  CA     . SER B 2 155 ? 20.670  26.269  -19.073 1.00 88.76  ? 155  SER B CA     1 
ATOM   8462  C  C      . SER B 2 155 ? 21.659  25.456  -18.250 1.00 93.72  ? 155  SER B C      1 
ATOM   8463  O  O      . SER B 2 155 ? 22.520  26.011  -17.575 1.00 111.58 ? 155  SER B O      1 
ATOM   8464  C  CB     . SER B 2 155 ? 20.928  26.057  -20.567 1.00 109.24 ? 155  SER B CB     1 
ATOM   8465  O  OG     . SER B 2 155 ? 22.270  26.361  -20.904 1.00 94.57  ? 155  SER B OG     1 
ATOM   8466  H  H      . SER B 2 155 ? 21.193  28.156  -19.313 1.00 110.43 ? 155  SER B H      1 
ATOM   8467  H  HA     . SER B 2 155 ? 19.773  25.959  -18.869 1.00 106.51 ? 155  SER B HA     1 
ATOM   8468  H  HB2    . SER B 2 155 ? 20.751  25.129  -20.787 1.00 131.09 ? 155  SER B HB2    1 
ATOM   8469  H  HB3    . SER B 2 155 ? 20.337  26.635  -21.073 1.00 131.09 ? 155  SER B HB3    1 
ATOM   8470  H  HG     . SER B 2 155 ? 22.394  26.240  -21.726 1.00 113.48 ? 155  SER B HG     1 
ATOM   8471  N  N      . ASP B 2 156 ? 21.550  24.138  -18.335 1.00 103.31 ? 156  ASP B N      1 
ATOM   8472  C  CA     . ASP B 2 156 ? 22.461  23.245  -17.630 1.00 100.29 ? 156  ASP B CA     1 
ATOM   8473  C  C      . ASP B 2 156 ? 23.730  23.110  -18.455 1.00 97.61  ? 156  ASP B C      1 
ATOM   8474  O  O      . ASP B 2 156 ? 24.807  22.838  -17.928 1.00 92.57  ? 156  ASP B O      1 
ATOM   8475  C  CB     . ASP B 2 156 ? 21.812  21.883  -17.385 1.00 118.94 ? 156  ASP B CB     1 
ATOM   8476  C  CG     . ASP B 2 156 ? 20.570  21.982  -16.521 1.00 116.76 ? 156  ASP B CG     1 
ATOM   8477  O  OD1    . ASP B 2 156 ? 20.446  22.971  -15.768 1.00 108.30 ? 156  ASP B OD1    1 
ATOM   8478  O  OD2    . ASP B 2 156 ? 19.715  21.073  -16.597 1.00 125.42 ? 156  ASP B OD2    1 
ATOM   8479  H  H      . ASP B 2 156 ? 20.951  23.731  -18.798 1.00 123.98 ? 156  ASP B H      1 
ATOM   8480  H  HA     . ASP B 2 156 ? 22.693  23.632  -16.772 1.00 120.35 ? 156  ASP B HA     1 
ATOM   8481  H  HB2    . ASP B 2 156 ? 21.557  21.496  -18.237 1.00 142.73 ? 156  ASP B HB2    1 
ATOM   8482  H  HB3    . ASP B 2 156 ? 22.448  21.306  -16.933 1.00 142.73 ? 156  ASP B HB3    1 
ATOM   8483  N  N      . GLU B 2 157 ? 23.583  23.302  -19.761 1.00 108.72 ? 157  GLU B N      1 
ATOM   8484  C  CA     . GLU B 2 157 ? 24.701  23.244  -20.688 1.00 113.93 ? 157  GLU B CA     1 
ATOM   8485  C  C      . GLU B 2 157 ? 25.677  24.390  -20.433 1.00 100.60 ? 157  GLU B C      1 
ATOM   8486  O  O      . GLU B 2 157 ? 26.889  24.185  -20.366 1.00 91.12  ? 157  GLU B O      1 
ATOM   8487  C  CB     . GLU B 2 157 ? 24.178  23.311  -22.125 1.00 110.94 ? 157  GLU B CB     1 
ATOM   8488  C  CG     . GLU B 2 157 ? 23.203  22.196  -22.480 1.00 99.88  ? 157  GLU B CG     1 
ATOM   8489  C  CD     . GLU B 2 157 ? 22.679  22.305  -23.899 1.00 127.64 ? 157  GLU B CD     1 
ATOM   8490  O  OE1    . GLU B 2 157 ? 23.397  22.850  -24.762 1.00 153.61 ? 157  GLU B OE1    1 
ATOM   8491  O  OE2    . GLU B 2 157 ? 21.543  21.848  -24.150 1.00 124.82 ? 157  GLU B OE2    1 
ATOM   8492  H  H      . GLU B 2 157 ? 22.829  23.469  -20.139 1.00 130.46 ? 157  GLU B H      1 
ATOM   8493  H  HA     . GLU B 2 157 ? 25.175  22.406  -20.573 1.00 136.71 ? 157  GLU B HA     1 
ATOM   8494  H  HB2    . GLU B 2 157 ? 23.719  24.157  -22.251 1.00 133.13 ? 157  GLU B HB2    1 
ATOM   8495  H  HB3    . GLU B 2 157 ? 24.930  23.252  -22.735 1.00 133.13 ? 157  GLU B HB3    1 
ATOM   8496  H  HG2    . GLU B 2 157 ? 23.655  21.342  -22.391 1.00 119.86 ? 157  GLU B HG2    1 
ATOM   8497  H  HG3    . GLU B 2 157 ? 22.445  22.235  -21.876 1.00 119.86 ? 157  GLU B HG3    1 
ATOM   8498  N  N      . GLU B 2 158 ? 25.134  25.594  -20.286 1.00 106.62 ? 158  GLU B N      1 
ATOM   8499  C  CA     . GLU B 2 158 ? 25.933  26.790  -20.025 1.00 114.09 ? 158  GLU B CA     1 
ATOM   8500  C  C      . GLU B 2 158 ? 26.433  26.840  -18.580 1.00 103.87 ? 158  GLU B C      1 
ATOM   8501  O  O      . GLU B 2 158 ? 27.462  27.447  -18.287 1.00 110.41 ? 158  GLU B O      1 
ATOM   8502  C  CB     . GLU B 2 158 ? 25.116  28.041  -20.345 1.00 121.74 ? 158  GLU B CB     1 
ATOM   8503  C  CG     . GLU B 2 158 ? 24.871  28.237  -21.832 1.00 133.41 ? 158  GLU B CG     1 
ATOM   8504  C  CD     . GLU B 2 158 ? 23.981  29.427  -22.130 1.00 131.95 ? 158  GLU B CD     1 
ATOM   8505  O  OE1    . GLU B 2 158 ? 23.826  30.294  -21.244 1.00 125.74 ? 158  GLU B OE1    1 
ATOM   8506  O  OE2    . GLU B 2 158 ? 23.438  29.494  -23.253 1.00 125.48 ? 158  GLU B OE2    1 
ATOM   8507  H  H      . GLU B 2 158 ? 24.289  25.749  -20.334 1.00 127.95 ? 158  GLU B H      1 
ATOM   8508  H  HA     . GLU B 2 158 ? 26.708  26.782  -20.608 1.00 136.91 ? 158  GLU B HA     1 
ATOM   8509  H  HB2    . GLU B 2 158 ? 24.253  27.974  -19.907 1.00 146.08 ? 158  GLU B HB2    1 
ATOM   8510  H  HB3    . GLU B 2 158 ? 25.593  28.820  -20.017 1.00 146.08 ? 158  GLU B HB3    1 
ATOM   8511  H  HG2    . GLU B 2 158 ? 25.721  28.380  -22.276 1.00 160.10 ? 158  GLU B HG2    1 
ATOM   8512  H  HG3    . GLU B 2 158 ? 24.440  27.444  -22.188 1.00 160.10 ? 158  GLU B HG3    1 
ATOM   8513  N  N      . LYS B 2 159 ? 25.689  26.196  -17.687 1.00 101.54 ? 159  LYS B N      1 
ATOM   8514  C  CA     . LYS B 2 159 ? 26.045  26.107  -16.274 1.00 79.20  ? 159  LYS B CA     1 
ATOM   8515  C  C      . LYS B 2 159 ? 27.351  25.350  -16.053 1.00 83.39  ? 159  LYS B C      1 
ATOM   8516  O  O      . LYS B 2 159 ? 28.183  25.764  -15.250 1.00 87.49  ? 159  LYS B O      1 
ATOM   8517  C  CB     . LYS B 2 159 ? 24.920  25.430  -15.493 1.00 83.43  ? 159  LYS B CB     1 
ATOM   8518  C  CG     . LYS B 2 159 ? 25.180  25.296  -14.005 1.00 78.63  ? 159  LYS B CG     1 
ATOM   8519  C  CD     . LYS B 2 159 ? 23.939  24.808  -13.282 1.00 93.83  ? 159  LYS B CD     1 
ATOM   8520  C  CE     . LYS B 2 159 ? 24.160  24.721  -11.784 1.00 86.55  ? 159  LYS B CE     1 
ATOM   8521  N  NZ     . LYS B 2 159 ? 22.935  24.286  -11.061 1.00 101.22 ? 159  LYS B NZ     1 
ATOM   8522  H  H      . LYS B 2 159 ? 24.955  25.792  -17.880 1.00 121.84 ? 159  LYS B H      1 
ATOM   8523  H  HA     . LYS B 2 159 ? 26.156  27.004  -15.921 1.00 95.04  ? 159  LYS B HA     1 
ATOM   8524  H  HB2    . LYS B 2 159 ? 24.109  25.950  -15.604 1.00 100.11 ? 159  LYS B HB2    1 
ATOM   8525  H  HB3    . LYS B 2 159 ? 24.788  24.538  -15.850 1.00 100.11 ? 159  LYS B HB3    1 
ATOM   8526  H  HG2    . LYS B 2 159 ? 25.892  24.654  -13.859 1.00 94.36  ? 159  LYS B HG2    1 
ATOM   8527  H  HG3    . LYS B 2 159 ? 25.426  26.162  -13.641 1.00 94.36  ? 159  LYS B HG3    1 
ATOM   8528  H  HD2    . LYS B 2 159 ? 23.210  25.427  -13.446 1.00 112.59 ? 159  LYS B HD2    1 
ATOM   8529  H  HD3    . LYS B 2 159 ? 23.708  23.924  -13.607 1.00 112.59 ? 159  LYS B HD3    1 
ATOM   8530  H  HE2    . LYS B 2 159 ? 24.863  24.077  -11.603 1.00 103.86 ? 159  LYS B HE2    1 
ATOM   8531  H  HE3    . LYS B 2 159 ? 24.414  25.595  -11.449 1.00 103.86 ? 159  LYS B HE3    1 
ATOM   8532  H  HZ1    . LYS B 2 159 ? 22.683  23.482  -11.347 1.00 121.46 ? 159  LYS B HZ1    1 
ATOM   8533  H  HZ2    . LYS B 2 159 ? 23.096  24.245  -10.187 1.00 121.46 ? 159  LYS B HZ2    1 
ATOM   8534  H  HZ3    . LYS B 2 159 ? 22.274  24.865  -11.206 1.00 121.46 ? 159  LYS B HZ3    1 
ATOM   8535  N  N      . THR B 2 160 ? 27.533  24.249  -16.776 1.00 100.87 ? 160  THR B N      1 
ATOM   8536  C  CA     . THR B 2 160 ? 28.706  23.396  -16.600 1.00 102.32 ? 160  THR B CA     1 
ATOM   8537  C  C      . THR B 2 160 ? 29.923  23.980  -17.312 1.00 95.58  ? 160  THR B C      1 
ATOM   8538  O  O      . THR B 2 160 ? 31.044  23.510  -17.126 1.00 107.69 ? 160  THR B O      1 
ATOM   8539  C  CB     . THR B 2 160 ? 28.459  21.963  -17.117 1.00 102.94 ? 160  THR B CB     1 
ATOM   8540  O  OG1    . THR B 2 160 ? 28.061  22.006  -18.492 1.00 107.50 ? 160  THR B OG1    1 
ATOM   8541  C  CG2    . THR B 2 160 ? 27.380  21.270  -16.294 1.00 80.31  ? 160  THR B CG2    1 
ATOM   8542  H  H      . THR B 2 160 ? 26.988  23.972  -17.380 1.00 121.05 ? 160  THR B H      1 
ATOM   8543  H  HA     . THR B 2 160 ? 28.914  23.340  -15.654 1.00 122.78 ? 160  THR B HA     1 
ATOM   8544  H  HB     . THR B 2 160 ? 29.277  21.449  -17.037 1.00 123.53 ? 160  THR B HB     1 
ATOM   8545  H  HG1    . THR B 2 160 ? 27.925  21.227  -18.776 1.00 129.00 ? 160  THR B HG1    1 
ATOM   8546  H  HG21   . THR B 2 160 ? 26.549  21.767  -16.352 1.00 96.37  ? 160  THR B HG21   1 
ATOM   8547  H  HG22   . THR B 2 160 ? 27.234  20.371  -16.629 1.00 96.37  ? 160  THR B HG22   1 
ATOM   8548  H  HG23   . THR B 2 160 ? 27.653  21.220  -15.365 1.00 96.37  ? 160  THR B HG23   1 
ATOM   8549  N  N      . LEU B 2 161 ? 29.696  25.001  -18.130 1.00 91.38  ? 161  LEU B N      1 
ATOM   8550  C  CA     . LEU B 2 161 ? 30.777  25.668  -18.842 1.00 99.68  ? 161  LEU B CA     1 
ATOM   8551  C  C      . LEU B 2 161 ? 31.377  26.697  -17.892 1.00 101.28 ? 161  LEU B C      1 
ATOM   8552  O  O      . LEU B 2 161 ? 32.587  26.918  -17.881 1.00 111.85 ? 161  LEU B O      1 
ATOM   8553  C  CB     . LEU B 2 161 ? 30.284  26.335  -20.129 1.00 101.48 ? 161  LEU B CB     1 
ATOM   8554  C  CG     . LEU B 2 161 ? 29.923  25.428  -21.308 1.00 114.16 ? 161  LEU B CG     1 
ATOM   8555  C  CD1    . LEU B 2 161 ? 29.643  26.274  -22.539 1.00 116.02 ? 161  LEU B CD1    1 
ATOM   8556  C  CD2    . LEU B 2 161 ? 31.016  24.406  -21.606 1.00 131.08 ? 161  LEU B CD2    1 
ATOM   8557  H  H      . LEU B 2 161 ? 28.917  25.329  -18.290 1.00 109.65 ? 161  LEU B H      1 
ATOM   8558  H  HA     . LEU B 2 161 ? 31.463  25.022  -19.071 1.00 119.61 ? 161  LEU B HA     1 
ATOM   8559  H  HB2    . LEU B 2 161 ? 29.490  26.850  -19.914 1.00 121.78 ? 161  LEU B HB2    1 
ATOM   8560  H  HB3    . LEU B 2 161 ? 30.978  26.938  -20.438 1.00 121.78 ? 161  LEU B HB3    1 
ATOM   8561  H  HG     . LEU B 2 161 ? 29.112  24.941  -21.091 1.00 136.99 ? 161  LEU B HG     1 
ATOM   8562  H  HD11   . LEU B 2 161 ? 30.436  26.789  -22.755 1.00 139.23 ? 161  LEU B HD11   1 
ATOM   8563  H  HD12   . LEU B 2 161 ? 29.415  25.689  -23.279 1.00 139.23 ? 161  LEU B HD12   1 
ATOM   8564  H  HD13   . LEU B 2 161 ? 28.902  26.871  -22.349 1.00 139.23 ? 161  LEU B HD13   1 
ATOM   8565  H  HD21   . LEU B 2 161 ? 31.149  23.850  -20.822 1.00 157.30 ? 161  LEU B HD21   1 
ATOM   8566  H  HD22   . LEU B 2 161 ? 30.739  23.859  -22.357 1.00 157.30 ? 161  LEU B HD22   1 
ATOM   8567  H  HD23   . LEU B 2 161 ? 31.836  24.876  -21.822 1.00 157.30 ? 161  LEU B HD23   1 
ATOM   8568  N  N      . ARG B 2 162 ? 30.509  27.319  -17.099 1.00 93.81  ? 162  ARG B N      1 
ATOM   8569  C  CA     . ARG B 2 162 ? 30.911  28.339  -16.139 1.00 76.56  ? 162  ARG B CA     1 
ATOM   8570  C  C      . ARG B 2 162 ? 31.009  27.791  -14.718 1.00 80.68  ? 162  ARG B C      1 
ATOM   8571  O  O      . ARG B 2 162 ? 30.973  28.555  -13.760 1.00 87.27  ? 162  ARG B O      1 
ATOM   8572  C  CB     . ARG B 2 162 ? 29.907  29.494  -16.155 1.00 68.00  ? 162  ARG B CB     1 
ATOM   8573  C  CG     . ARG B 2 162 ? 29.822  30.239  -17.469 1.00 68.70  ? 162  ARG B CG     1 
ATOM   8574  C  CD     . ARG B 2 162 ? 28.829  31.387  -17.381 1.00 72.69  ? 162  ARG B CD     1 
ATOM   8575  N  NE     . ARG B 2 162 ? 28.836  32.197  -18.594 1.00 77.00  ? 162  ARG B NE     1 
ATOM   8576  C  CZ     . ARG B 2 162 ? 28.174  31.899  -19.708 1.00 89.34  ? 162  ARG B CZ     1 
ATOM   8577  N  NH1    . ARG B 2 162 ? 27.427  30.805  -19.778 1.00 102.95 ? 162  ARG B NH1    1 
ATOM   8578  N  NH2    . ARG B 2 162 ? 28.257  32.706  -20.757 1.00 85.65  ? 162  ARG B NH2    1 
ATOM   8579  H  H      . ARG B 2 162 ? 29.663  27.163  -17.100 1.00 112.57 ? 162  ARG B H      1 
ATOM   8580  H  HA     . ARG B 2 162 ? 31.780  28.688  -16.390 1.00 91.87  ? 162  ARG B HA     1 
ATOM   8581  H  HB2    . ARG B 2 162 ? 29.025  29.141  -15.961 1.00 81.60  ? 162  ARG B HB2    1 
ATOM   8582  H  HB3    . ARG B 2 162 ? 30.160  30.134  -15.471 1.00 81.60  ? 162  ARG B HB3    1 
ATOM   8583  H  HG2    . ARG B 2 162 ? 30.693  30.604  -17.688 1.00 82.44  ? 162  ARG B HG2    1 
ATOM   8584  H  HG3    . ARG B 2 162 ? 29.526  29.631  -18.164 1.00 82.44  ? 162  ARG B HG3    1 
ATOM   8585  H  HD2    . ARG B 2 162 ? 27.936  31.029  -17.260 1.00 87.23  ? 162  ARG B HD2    1 
ATOM   8586  H  HD3    . ARG B 2 162 ? 29.066  31.958  -16.633 1.00 87.23  ? 162  ARG B HD3    1 
ATOM   8587  H  HE     . ARG B 2 162 ? 29.302  32.920  -18.588 1.00 92.40  ? 162  ARG B HE     1 
ATOM   8588  H  HH11   . ARG B 2 162 ? 27.371  30.278  -19.101 1.00 123.54 ? 162  ARG B HH11   1 
ATOM   8589  H  HH12   . ARG B 2 162 ? 27.001  30.621  -20.502 1.00 123.54 ? 162  ARG B HH12   1 
ATOM   8590  H  HH21   . ARG B 2 162 ? 28.738  33.417  -20.716 1.00 102.78 ? 162  ARG B HH21   1 
ATOM   8591  H  HH22   . ARG B 2 162 ? 27.828  32.519  -21.478 1.00 102.78 ? 162  ARG B HH22   1 
ATOM   8592  N  N      . GLU B 2 163 ? 31.149  26.477  -14.570 1.00 94.36  ? 163  GLU B N      1 
ATOM   8593  C  CA     . GLU B 2 163 ? 31.183  25.874  -13.238 1.00 82.38  ? 163  GLU B CA     1 
ATOM   8594  C  C      . GLU B 2 163 ? 32.362  26.381  -12.408 1.00 77.19  ? 163  GLU B C      1 
ATOM   8595  O  O      . GLU B 2 163 ? 32.208  26.710  -11.232 1.00 81.92  ? 163  GLU B O      1 
ATOM   8596  C  CB     . GLU B 2 163 ? 31.254  24.351  -13.355 1.00 95.21  ? 163  GLU B CB     1 
ATOM   8597  C  CG     . GLU B 2 163 ? 31.053  23.613  -12.041 1.00 104.37 ? 163  GLU B CG     1 
ATOM   8598  C  CD     . GLU B 2 163 ? 30.872  22.121  -12.236 1.00 105.71 ? 163  GLU B CD     1 
ATOM   8599  O  OE1    . GLU B 2 163 ? 31.122  21.637  -13.359 1.00 108.51 ? 163  GLU B OE1    1 
ATOM   8600  O  OE2    . GLU B 2 163 ? 30.478  21.433  -11.272 1.00 99.04  ? 163  GLU B OE2    1 
ATOM   8601  H  H      . GLU B 2 163 ? 31.225  25.916  -15.218 1.00 113.24 ? 163  GLU B H      1 
ATOM   8602  H  HA     . GLU B 2 163 ? 30.366  26.101  -12.768 1.00 98.86  ? 163  GLU B HA     1 
ATOM   8603  H  HB2    . GLU B 2 163 ? 30.564  24.053  -13.969 1.00 114.25 ? 163  GLU B HB2    1 
ATOM   8604  H  HB3    . GLU B 2 163 ? 32.127  24.105  -13.700 1.00 114.25 ? 163  GLU B HB3    1 
ATOM   8605  H  HG2    . GLU B 2 163 ? 31.831  23.751  -11.479 1.00 125.25 ? 163  GLU B HG2    1 
ATOM   8606  H  HG3    . GLU B 2 163 ? 30.260  23.958  -11.602 1.00 125.25 ? 163  GLU B HG3    1 
ATOM   8607  N  N      . GLN B 2 164 ? 33.533  26.448  -13.031 1.00 73.21  ? 164  GLN B N      1 
ATOM   8608  C  CA     . GLN B 2 164 ? 34.751  26.898  -12.361 1.00 81.01  ? 164  GLN B CA     1 
ATOM   8609  C  C      . GLN B 2 164 ? 34.646  28.357  -11.936 1.00 78.26  ? 164  GLN B C      1 
ATOM   8610  O  O      . GLN B 2 164 ? 35.142  28.765  -10.886 1.00 82.12  ? 164  GLN B O      1 
ATOM   8611  C  CB     . GLN B 2 164 ? 35.967  26.736  -13.277 1.00 81.11  ? 164  GLN B CB     1 
ATOM   8612  C  CG     . GLN B 2 164 ? 36.093  25.391  -13.969 1.00 83.10  ? 164  GLN B CG     1 
ATOM   8613  C  CD     . GLN B 2 164 ? 36.786  24.360  -13.106 1.00 90.49  ? 164  GLN B CD     1 
ATOM   8614  O  OE1    . GLN B 2 164 ? 36.467  24.200  -11.927 1.00 92.62  ? 164  GLN B OE1    1 
ATOM   8615  N  NE2    . GLN B 2 164 ? 37.753  23.660  -13.688 1.00 102.07 ? 164  GLN B NE2    1 
ATOM   8616  H  H      . GLN B 2 164 ? 33.652  26.235  -13.856 1.00 87.86  ? 164  GLN B H      1 
ATOM   8617  H  HA     . GLN B 2 164 ? 34.895  26.360  -11.567 1.00 97.22  ? 164  GLN B HA     1 
ATOM   8618  H  HB2    . GLN B 2 164 ? 35.922  27.415  -13.969 1.00 97.33  ? 164  GLN B HB2    1 
ATOM   8619  H  HB3    . GLN B 2 164 ? 36.769  26.866  -12.748 1.00 97.33  ? 164  GLN B HB3    1 
ATOM   8620  H  HG2    . GLN B 2 164 ? 35.207  25.059  -14.181 1.00 99.72  ? 164  GLN B HG2    1 
ATOM   8621  H  HG3    . GLN B 2 164 ? 36.611  25.500  -14.782 1.00 99.72  ? 164  GLN B HG3    1 
ATOM   8622  H  HE21   . GLN B 2 164 ? 37.954  23.806  -14.511 1.00 122.48 ? 164  GLN B HE21   1 
ATOM   8623  H  HE22   . GLN B 2 164 ? 38.179  23.061  -13.241 1.00 122.48 ? 164  GLN B HE22   1 
ATOM   8624  N  N      . GLU B 2 165 ? 34.026  29.140  -12.806 1.00 86.42  ? 165  GLU B N      1 
ATOM   8625  C  CA     . GLU B 2 165 ? 33.863  30.566  -12.605 1.00 63.05  ? 165  GLU B CA     1 
ATOM   8626  C  C      . GLU B 2 165 ? 32.976  30.865  -11.402 1.00 58.60  ? 165  GLU B C      1 
ATOM   8627  O  O      . GLU B 2 165 ? 33.365  31.604  -10.503 1.00 68.97  ? 165  GLU B O      1 
ATOM   8628  C  CB     . GLU B 2 165 ? 33.289  31.205  -13.867 1.00 67.94  ? 165  GLU B CB     1 
ATOM   8629  C  CG     . GLU B 2 165 ? 33.905  30.671  -15.169 1.00 79.98  ? 165  GLU B CG     1 
ATOM   8630  C  CD     . GLU B 2 165 ? 35.356  31.062  -15.348 1.00 92.18  ? 165  GLU B CD     1 
ATOM   8631  O  OE1    . GLU B 2 165 ? 35.688  32.251  -15.172 1.00 90.28  ? 165  GLU B OE1    1 
ATOM   8632  O  OE2    . GLU B 2 165 ? 36.169  30.166  -15.665 1.00 93.20  ? 165  GLU B OE2    1 
ATOM   8633  H  H      . GLU B 2 165 ? 33.682  28.857  -13.542 1.00 103.70 ? 165  GLU B H      1 
ATOM   8634  H  HA     . GLU B 2 165 ? 34.734  30.962  -12.439 1.00 75.66  ? 165  GLU B HA     1 
ATOM   8635  H  HB2    . GLU B 2 165 ? 32.335  31.032  -13.898 1.00 81.52  ? 165  GLU B HB2    1 
ATOM   8636  H  HB3    . GLU B 2 165 ? 33.449  32.161  -13.834 1.00 81.52  ? 165  GLU B HB3    1 
ATOM   8637  H  HG2    . GLU B 2 165 ? 33.856  29.702  -15.166 1.00 95.98  ? 165  GLU B HG2    1 
ATOM   8638  H  HG3    . GLU B 2 165 ? 33.406  31.025  -15.922 1.00 95.98  ? 165  GLU B HG3    1 
ATOM   8639  N  N      . ILE B 2 166 ? 31.780  30.285  -11.397 1.00 64.97  ? 166  ILE B N      1 
ATOM   8640  C  CA     . ILE B 2 166 ? 30.775  30.585  -10.381 1.00 61.91  ? 166  ILE B CA     1 
ATOM   8641  C  C      . ILE B 2 166 ? 31.162  30.058  -9.014  1.00 69.44  ? 166  ILE B C      1 
ATOM   8642  O  O      . ILE B 2 166 ? 30.817  30.653  -7.991  1.00 75.57  ? 166  ILE B O      1 
ATOM   8643  C  CB     . ILE B 2 166 ? 29.396  29.996  -10.762 1.00 65.06  ? 166  ILE B CB     1 
ATOM   8644  C  CG1    . ILE B 2 166 ? 29.004  30.438  -12.176 1.00 51.14  ? 166  ILE B CG1    1 
ATOM   8645  C  CG2    . ILE B 2 166 ? 28.323  30.480  -9.790  1.00 62.54  ? 166  ILE B CG2    1 
ATOM   8646  C  CD1    . ILE B 2 166 ? 27.776  29.754  -12.735 1.00 53.11  ? 166  ILE B CD1    1 
ATOM   8647  H  H      . ILE B 2 166 ? 31.522  29.706  -11.979 1.00 77.97  ? 166  ILE B H      1 
ATOM   8648  H  HA     . ILE B 2 166 ? 30.678  31.548  -10.312 1.00 74.30  ? 166  ILE B HA     1 
ATOM   8649  H  HB     . ILE B 2 166 ? 29.442  29.027  -10.731 1.00 78.07  ? 166  ILE B HB     1 
ATOM   8650  H  HG12   . ILE B 2 166 ? 28.829  31.392  -12.164 1.00 61.37  ? 166  ILE B HG12   1 
ATOM   8651  H  HG13   . ILE B 2 166 ? 29.743  30.250  -12.775 1.00 61.37  ? 166  ILE B HG13   1 
ATOM   8652  H  HG21   . ILE B 2 166 ? 28.279  31.448  -9.827  1.00 75.05  ? 166  ILE B HG21   1 
ATOM   8653  H  HG22   . ILE B 2 166 ? 27.469  30.099  -10.047 1.00 75.05  ? 166  ILE B HG22   1 
ATOM   8654  H  HG23   . ILE B 2 166 ? 28.558  30.193  -8.893  1.00 75.05  ? 166  ILE B HG23   1 
ATOM   8655  H  HD11   . ILE B 2 166 ? 27.019  29.943  -12.157 1.00 63.73  ? 166  ILE B HD11   1 
ATOM   8656  H  HD12   . ILE B 2 166 ? 27.604  30.094  -13.627 1.00 63.73  ? 166  ILE B HD12   1 
ATOM   8657  H  HD13   . ILE B 2 166 ? 27.936  28.798  -12.769 1.00 63.73  ? 166  ILE B HD13   1 
ATOM   8658  N  N      . VAL B 2 167 ? 31.887  28.947  -8.990  1.00 71.25  ? 167  VAL B N      1 
ATOM   8659  C  CA     . VAL B 2 167 ? 32.299  28.377  -7.720  1.00 79.66  ? 167  VAL B CA     1 
ATOM   8660  C  C      . VAL B 2 167 ? 33.383  29.247  -7.096  1.00 69.54  ? 167  VAL B C      1 
ATOM   8661  O  O      . VAL B 2 167 ? 33.552  29.262  -5.877  1.00 88.36  ? 167  VAL B O      1 
ATOM   8662  C  CB     . VAL B 2 167 ? 32.810  26.929  -7.881  1.00 89.28  ? 167  VAL B CB     1 
ATOM   8663  C  CG1    . VAL B 2 167 ? 34.151  26.888  -8.599  1.00 81.13  ? 167  VAL B CG1    1 
ATOM   8664  C  CG2    . VAL B 2 167 ? 32.907  26.252  -6.532  1.00 112.90 ? 167  VAL B CG2    1 
ATOM   8665  H  H      . VAL B 2 167 ? 32.148  28.511  -9.684  1.00 85.50  ? 167  VAL B H      1 
ATOM   8666  H  HA     . VAL B 2 167 ? 31.540  28.362  -7.117  1.00 95.59  ? 167  VAL B HA     1 
ATOM   8667  H  HB     . VAL B 2 167 ? 32.172  26.432  -8.417  1.00 107.14 ? 167  VAL B HB     1 
ATOM   8668  H  HG11   . VAL B 2 167 ? 34.800  27.391  -8.083  1.00 97.36  ? 167  VAL B HG11   1 
ATOM   8669  H  HG12   . VAL B 2 167 ? 34.436  25.965  -8.681  1.00 97.36  ? 167  VAL B HG12   1 
ATOM   8670  H  HG13   . VAL B 2 167 ? 34.049  27.283  -9.479  1.00 97.36  ? 167  VAL B HG13   1 
ATOM   8671  H  HG21   . VAL B 2 167 ? 32.028  26.237  -6.123  1.00 135.48 ? 167  VAL B HG21   1 
ATOM   8672  H  HG22   . VAL B 2 167 ? 33.229  25.345  -6.657  1.00 135.48 ? 167  VAL B HG22   1 
ATOM   8673  H  HG23   . VAL B 2 167 ? 33.525  26.749  -5.974  1.00 135.48 ? 167  VAL B HG23   1 
ATOM   8674  N  N      . ALA B 2 168 ? 34.097  29.986  -7.939  1.00 62.34  ? 168  ALA B N      1 
ATOM   8675  C  CA     . ALA B 2 168 ? 35.189  30.832  -7.479  1.00 56.85  ? 168  ALA B CA     1 
ATOM   8676  C  C      . ALA B 2 168 ? 34.733  32.253  -7.168  1.00 57.28  ? 168  ALA B C      1 
ATOM   8677  O  O      . ALA B 2 168 ? 35.362  32.953  -6.374  1.00 76.86  ? 168  ALA B O      1 
ATOM   8678  C  CB     . ALA B 2 168 ? 36.290  30.866  -8.523  1.00 44.99  ? 168  ALA B CB     1 
ATOM   8679  H  H      . ALA B 2 168 ? 33.967  30.015  -8.789  1.00 74.81  ? 168  ALA B H      1 
ATOM   8680  H  HA     . ALA B 2 168 ? 35.559  30.453  -6.666  1.00 68.22  ? 168  ALA B HA     1 
ATOM   8681  H  HB1    . ALA B 2 168 ? 35.930  31.222  -9.350  1.00 53.99  ? 168  ALA B HB1    1 
ATOM   8682  H  HB2    . ALA B 2 168 ? 37.010  31.432  -8.204  1.00 53.99  ? 168  ALA B HB2    1 
ATOM   8683  H  HB3    . ALA B 2 168 ? 36.617  29.964  -8.666  1.00 53.99  ? 168  ALA B HB3    1 
ATOM   8684  N  N      . SER B 2 169 ? 33.638  32.676  -7.787  1.00 64.29  ? 169  SER B N      1 
ATOM   8685  C  CA     . SER B 2 169 ? 33.150  34.037  -7.608  1.00 59.60  ? 169  SER B CA     1 
ATOM   8686  C  C      . SER B 2 169 ? 32.251  34.175  -6.386  1.00 57.33  ? 169  SER B C      1 
ATOM   8687  O  O      . SER B 2 169 ? 32.213  35.239  -5.777  1.00 78.01  ? 169  SER B O      1 
ATOM   8688  C  CB     . SER B 2 169 ? 32.411  34.502  -8.864  1.00 63.92  ? 169  SER B CB     1 
ATOM   8689  O  OG     . SER B 2 169 ? 33.168  34.213  -10.028 1.00 59.71  ? 169  SER B OG     1 
ATOM   8690  H  H      . SER B 2 169 ? 33.160  32.196  -8.316  1.00 77.15  ? 169  SER B H      1 
ATOM   8691  H  HA     . SER B 2 169 ? 33.911  34.624  -7.480  1.00 71.52  ? 169  SER B HA     1 
ATOM   8692  H  HB2    . SER B 2 169 ? 31.559  34.042  -8.918  1.00 76.71  ? 169  SER B HB2    1 
ATOM   8693  H  HB3    . SER B 2 169 ? 32.268  35.460  -8.810  1.00 76.71  ? 169  SER B HB3    1 
ATOM   8694  H  HG     . SER B 2 169 ? 33.299  33.385  -10.086 1.00 71.66  ? 169  SER B HG     1 
ATOM   8695  N  N      . SER B 2 170 ? 31.515  33.121  -6.042  1.00 67.86  ? 170  SER B N      1 
ATOM   8696  C  CA     . SER B 2 170 ? 30.572  33.195  -4.926  1.00 90.48  ? 170  SER B CA     1 
ATOM   8697  C  C      . SER B 2 170 ? 31.140  32.446  -3.726  1.00 88.40  ? 170  SER B C      1 
ATOM   8698  O  O      . SER B 2 170 ? 31.194  31.216  -3.741  1.00 101.00 ? 170  SER B O      1 
ATOM   8699  C  CB     . SER B 2 170 ? 29.223  32.592  -5.327  1.00 98.29  ? 170  SER B CB     1 
ATOM   8700  O  OG     . SER B 2 170 ? 28.686  33.237  -6.471  1.00 84.93  ? 170  SER B OG     1 
ATOM   8701  H  H      . SER B 2 170 ? 31.541  32.357  -6.435  1.00 81.43  ? 170  SER B H      1 
ATOM   8702  H  HA     . SER B 2 170 ? 30.435  34.122  -4.676  1.00 108.57 ? 170  SER B HA     1 
ATOM   8703  H  HB2    . SER B 2 170 ? 29.347  31.651  -5.527  1.00 117.95 ? 170  SER B HB2    1 
ATOM   8704  H  HB3    . SER B 2 170 ? 28.601  32.693  -4.589  1.00 117.95 ? 170  SER B HB3    1 
ATOM   8705  H  HG     . SER B 2 170 ? 27.947  32.892  -6.675  1.00 101.91 ? 170  SER B HG     1 
ATOM   8706  N  N      . PRO B 2 171 ? 31.573  33.170  -2.679  1.00 80.27  ? 171  PRO B N      1 
ATOM   8707  C  CA     . PRO B 2 171 ? 32.052  32.363  -1.552  1.00 100.66 ? 171  PRO B CA     1 
ATOM   8708  C  C      . PRO B 2 171 ? 30.945  31.685  -0.735  1.00 108.50 ? 171  PRO B C      1 
ATOM   8709  O  O      . PRO B 2 171 ? 31.267  31.046  0.269   1.00 94.21  ? 171  PRO B O      1 
ATOM   8710  C  CB     . PRO B 2 171 ? 32.800  33.388  -0.688  1.00 101.18 ? 171  PRO B CB     1 
ATOM   8711  C  CG     . PRO B 2 171 ? 33.121  34.519  -1.614  1.00 81.89  ? 171  PRO B CG     1 
ATOM   8712  C  CD     . PRO B 2 171 ? 31.973  34.580  -2.561  1.00 76.56  ? 171  PRO B CD     1 
ATOM   8713  H  HA     . PRO B 2 171 ? 32.678  31.690  -1.863  1.00 120.80 ? 171  PRO B HA     1 
ATOM   8714  H  HB2    . PRO B 2 171 ? 32.226  33.688  0.034   1.00 121.41 ? 171  PRO B HB2    1 
ATOM   8715  H  HB3    . PRO B 2 171 ? 33.612  32.990  -0.338  1.00 121.41 ? 171  PRO B HB3    1 
ATOM   8716  H  HG2    . PRO B 2 171 ? 33.194  35.345  -1.110  1.00 98.27  ? 171  PRO B HG2    1 
ATOM   8717  H  HG3    . PRO B 2 171 ? 33.947  34.331  -2.087  1.00 98.27  ? 171  PRO B HG3    1 
ATOM   8718  H  HD2    . PRO B 2 171 ? 31.250  35.107  -2.186  1.00 91.87  ? 171  PRO B HD2    1 
ATOM   8719  H  HD3    . PRO B 2 171 ? 32.259  34.925  -3.421  1.00 91.87  ? 171  PRO B HD3    1 
ATOM   8720  N  N      . SER B 2 172 ? 29.683  31.809  -1.142  1.00 118.77 ? 172  SER B N      1 
ATOM   8721  C  CA     . SER B 2 172 ? 28.597  31.159  -0.409  1.00 123.50 ? 172  SER B CA     1 
ATOM   8722  C  C      . SER B 2 172 ? 28.356  29.765  -0.979  1.00 117.22 ? 172  SER B C      1 
ATOM   8723  O  O      . SER B 2 172 ? 27.427  29.064  -0.573  1.00 118.93 ? 172  SER B O      1 
ATOM   8724  C  CB     . SER B 2 172 ? 27.311  31.987  -0.472  1.00 123.26 ? 172  SER B CB     1 
ATOM   8725  O  OG     . SER B 2 172 ? 26.784  32.026  -1.787  1.00 107.65 ? 172  SER B OG     1 
ATOM   8726  H  H      . SER B 2 172 ? 29.430  32.258  -1.831  1.00 142.53 ? 172  SER B H      1 
ATOM   8727  H  HA     . SER B 2 172 ? 28.852  31.065  0.522   1.00 148.20 ? 172  SER B HA     1 
ATOM   8728  H  HB2    . SER B 2 172 ? 26.653  31.589  0.119   1.00 147.91 ? 172  SER B HB2    1 
ATOM   8729  H  HB3    . SER B 2 172 ? 27.507  32.892  -0.185  1.00 147.91 ? 172  SER B HB3    1 
ATOM   8730  H  HG     . SER B 2 172 ? 26.080  32.484  -1.800  1.00 129.18 ? 172  SER B HG     1 
ATOM   8731  N  N      . LEU B 2 173 ? 29.206  29.376  -1.923  1.00 111.11 ? 173  LEU B N      1 
ATOM   8732  C  CA     . LEU B 2 173 ? 29.179  28.044  -2.499  1.00 102.64 ? 173  LEU B CA     1 
ATOM   8733  C  C      . LEU B 2 173 ? 30.467  27.337  -2.124  1.00 116.66 ? 173  LEU B C      1 
ATOM   8734  O  O      . LEU B 2 173 ? 31.332  27.116  -2.972  1.00 122.05 ? 173  LEU B O      1 
ATOM   8735  C  CB     . LEU B 2 173 ? 29.018  28.119  -4.019  1.00 99.06  ? 173  LEU B CB     1 
ATOM   8736  C  CG     . LEU B 2 173 ? 27.756  28.837  -4.516  1.00 95.37  ? 173  LEU B CG     1 
ATOM   8737  C  CD1    . LEU B 2 173 ? 27.758  28.903  -6.034  1.00 67.96  ? 173  LEU B CD1    1 
ATOM   8738  C  CD2    . LEU B 2 173 ? 26.473  28.194  -4.003  1.00 98.56  ? 173  LEU B CD2    1 
ATOM   8739  H  H      . LEU B 2 173 ? 29.820  29.880  -2.252  1.00 133.33 ? 173  LEU B H      1 
ATOM   8740  H  HA     . LEU B 2 173 ? 28.433  27.545  -2.132  1.00 123.17 ? 173  LEU B HA     1 
ATOM   8741  H  HB2    . LEU B 2 173 ? 29.783  28.590  -4.385  1.00 118.87 ? 173  LEU B HB2    1 
ATOM   8742  H  HB3    . LEU B 2 173 ? 28.996  27.215  -4.370  1.00 118.87 ? 173  LEU B HB3    1 
ATOM   8743  H  HG     . LEU B 2 173 ? 27.774  29.749  -4.187  1.00 114.45 ? 173  LEU B HG     1 
ATOM   8744  H  HD11   . LEU B 2 173 ? 27.777  28.000  -6.389  1.00 81.56  ? 173  LEU B HD11   1 
ATOM   8745  H  HD12   . LEU B 2 173 ? 26.955  29.358  -6.331  1.00 81.56  ? 173  LEU B HD12   1 
ATOM   8746  H  HD13   . LEU B 2 173 ? 28.544  29.391  -6.327  1.00 81.56  ? 173  LEU B HD13   1 
ATOM   8747  H  HD21   . LEU B 2 173 ? 26.473  28.221  -3.034  1.00 118.27 ? 173  LEU B HD21   1 
ATOM   8748  H  HD22   . LEU B 2 173 ? 25.713  28.689  -4.349  1.00 118.27 ? 173  LEU B HD22   1 
ATOM   8749  H  HD23   . LEU B 2 173 ? 26.437  27.275  -4.309  1.00 118.27 ? 173  LEU B HD23   1 
ATOM   8750  N  N      . SER B 2 174 ? 30.602  27.004  -0.845  1.00 118.97 ? 174  SER B N      1 
ATOM   8751  C  CA     . SER B 2 174 ? 31.837  26.421  -0.341  1.00 122.16 ? 174  SER B CA     1 
ATOM   8752  C  C      . SER B 2 174 ? 32.090  25.067  -0.993  1.00 130.07 ? 174  SER B C      1 
ATOM   8753  O  O      . SER B 2 174 ? 33.239  24.678  -1.208  1.00 136.57 ? 174  SER B O      1 
ATOM   8754  C  CB     . SER B 2 174 ? 31.781  26.285  1.180   1.00 125.73 ? 174  SER B CB     1 
ATOM   8755  O  OG     . SER B 2 174 ? 33.072  26.054  1.715   1.00 135.63 ? 174  SER B OG     1 
ATOM   8756  H  H      . SER B 2 174 ? 29.991  27.107  -0.248  1.00 142.76 ? 174  SER B H      1 
ATOM   8757  H  HA     . SER B 2 174 ? 32.578  27.006  -0.564  1.00 146.60 ? 174  SER B HA     1 
ATOM   8758  H  HB2    . SER B 2 174 ? 31.425  27.105  1.557   1.00 150.88 ? 174  SER B HB2    1 
ATOM   8759  H  HB3    . SER B 2 174 ? 31.206  25.538  1.408   1.00 150.88 ? 174  SER B HB3    1 
ATOM   8760  H  HG     . SER B 2 174 ? 33.027  25.981  2.551   1.00 162.76 ? 174  SER B HG     1 
ATOM   8761  N  N      . GLY B 2 175 ? 31.012  24.358  -1.315  1.00 124.83 ? 175  GLY B N      1 
ATOM   8762  C  CA     . GLY B 2 175 ? 31.115  23.093  -2.020  1.00 120.90 ? 175  GLY B CA     1 
ATOM   8763  C  C      . GLY B 2 175 ? 31.241  23.308  -3.514  1.00 120.91 ? 175  GLY B C      1 
ATOM   8764  O  O      . GLY B 2 175 ? 30.591  24.184  -4.082  1.00 122.14 ? 175  GLY B O      1 
ATOM   8765  H  H      . GLY B 2 175 ? 30.205  24.592  -1.132  1.00 149.79 ? 175  GLY B H      1 
ATOM   8766  H  HA2    . GLY B 2 175 ? 31.894  22.607  -1.708  1.00 145.07 ? 175  GLY B HA2    1 
ATOM   8767  H  HA3    . GLY B 2 175 ? 30.324  22.558  -1.849  1.00 145.07 ? 175  GLY B HA3    1 
ATOM   8768  N  N      . LEU B 2 176 ? 32.077  22.497  -4.153  1.00 127.47 ? 176  LEU B N      1 
ATOM   8769  C  CA     . LEU B 2 176 ? 32.392  22.667  -5.569  1.00 131.17 ? 176  LEU B CA     1 
ATOM   8770  C  C      . LEU B 2 176 ? 31.360  22.023  -6.489  1.00 125.16 ? 176  LEU B C      1 
ATOM   8771  O  O      . LEU B 2 176 ? 31.587  21.907  -7.696  1.00 95.27  ? 176  LEU B O      1 
ATOM   8772  C  CB     . LEU B 2 176 ? 33.769  22.073  -5.873  1.00 123.00 ? 176  LEU B CB     1 
ATOM   8773  C  CG     . LEU B 2 176 ? 34.887  22.469  -4.908  1.00 123.03 ? 176  LEU B CG     1 
ATOM   8774  C  CD1    . LEU B 2 176 ? 36.101  21.573  -5.098  1.00 131.12 ? 176  LEU B CD1    1 
ATOM   8775  C  CD2    . LEU B 2 176 ? 35.258  23.930  -5.097  1.00 124.06 ? 176  LEU B CD2    1 
ATOM   8776  H  H      . LEU B 2 176 ? 32.480  21.832  -3.785  1.00 152.96 ? 176  LEU B H      1 
ATOM   8777  H  HA     . LEU B 2 176 ? 32.423  23.615  -5.773  1.00 157.40 ? 176  LEU B HA     1 
ATOM   8778  H  HB2    . LEU B 2 176 ? 33.696  21.106  -5.852  1.00 147.60 ? 176  LEU B HB2    1 
ATOM   8779  H  HB3    . LEU B 2 176 ? 34.036  22.359  -6.760  1.00 147.60 ? 176  LEU B HB3    1 
ATOM   8780  H  HG     . LEU B 2 176 ? 34.573  22.356  -3.998  1.00 147.64 ? 176  LEU B HG     1 
ATOM   8781  H  HD11   . LEU B 2 176 ? 36.420  21.664  -6.010  1.00 157.34 ? 176  LEU B HD11   1 
ATOM   8782  H  HD12   . LEU B 2 176 ? 36.794  21.845  -4.476  1.00 157.34 ? 176  LEU B HD12   1 
ATOM   8783  H  HD13   . LEU B 2 176 ? 35.844  20.654  -4.927  1.00 157.34 ? 176  LEU B HD13   1 
ATOM   8784  H  HD21   . LEU B 2 176 ? 34.477  24.478  -4.923  1.00 148.87 ? 176  LEU B HD21   1 
ATOM   8785  H  HD22   . LEU B 2 176 ? 35.968  24.158  -4.477  1.00 148.87 ? 176  LEU B HD22   1 
ATOM   8786  H  HD23   . LEU B 2 176 ? 35.560  24.063  -6.009  1.00 148.87 ? 176  LEU B HD23   1 
ATOM   8787  N  N      . LYS B 2 177 ? 30.228  21.608  -5.929  1.00 134.46 ? 177  LYS B N      1 
ATOM   8788  C  CA     . LYS B 2 177 ? 29.267  20.831  -6.701  1.00 121.03 ? 177  LYS B CA     1 
ATOM   8789  C  C      . LYS B 2 177 ? 28.639  21.721  -7.763  1.00 129.79 ? 177  LYS B C      1 
ATOM   8790  O  O      . LYS B 2 177 ? 28.972  21.601  -8.941  1.00 138.44 ? 177  LYS B O      1 
ATOM   8791  C  CB     . LYS B 2 177 ? 28.175  20.187  -5.822  1.00 116.74 ? 177  LYS B CB     1 
ATOM   8792  C  CG     . LYS B 2 177 ? 28.177  20.500  -4.326  1.00 116.88 ? 177  LYS B CG     1 
ATOM   8793  C  CD     . LYS B 2 177 ? 27.410  21.777  -4.015  1.00 112.19 ? 177  LYS B CD     1 
ATOM   8794  C  CE     . LYS B 2 177 ? 27.393  22.083  -2.524  1.00 109.07 ? 177  LYS B CE     1 
ATOM   8795  N  NZ     . LYS B 2 177 ? 27.061  20.893  -1.690  1.00 112.95 ? 177  LYS B NZ     1 
ATOM   8796  H  H      . LYS B 2 177 ? 29.996  21.761  -5.116  1.00 161.35 ? 177  LYS B H      1 
ATOM   8797  H  HA     . LYS B 2 177 ? 29.739  20.116  -7.156  1.00 145.23 ? 177  LYS B HA     1 
ATOM   8798  H  HB2    . LYS B 2 177 ? 27.313  20.467  -6.167  1.00 140.09 ? 177  LYS B HB2    1 
ATOM   8799  H  HB3    . LYS B 2 177 ? 28.253  19.224  -5.909  1.00 140.09 ? 177  LYS B HB3    1 
ATOM   8800  H  HG2    . LYS B 2 177 ? 27.756  19.769  -3.846  1.00 140.26 ? 177  LYS B HG2    1 
ATOM   8801  H  HG3    . LYS B 2 177 ? 29.092  20.615  -4.025  1.00 140.26 ? 177  LYS B HG3    1 
ATOM   8802  H  HD2    . LYS B 2 177 ? 27.833  22.522  -4.472  1.00 134.63 ? 177  LYS B HD2    1 
ATOM   8803  H  HD3    . LYS B 2 177 ? 26.493  21.679  -4.315  1.00 134.63 ? 177  LYS B HD3    1 
ATOM   8804  H  HE2    . LYS B 2 177 ? 28.270  22.400  -2.257  1.00 130.88 ? 177  LYS B HE2    1 
ATOM   8805  H  HE3    . LYS B 2 177 ? 26.727  22.766  -2.350  1.00 130.88 ? 177  LYS B HE3    1 
ATOM   8806  H  HZ1    . LYS B 2 177 ? 27.662  20.251  -1.823  1.00 135.54 ? 177  LYS B HZ1    1 
ATOM   8807  H  HZ2    . LYS B 2 177 ? 27.062  21.117  -0.828  1.00 135.54 ? 177  LYS B HZ2    1 
ATOM   8808  H  HZ3    . LYS B 2 177 ? 26.255  20.585  -1.908  1.00 135.54 ? 177  LYS B HZ3    1 
ATOM   8809  N  N      . LEU B 2 178 ? 27.756  22.622  -7.342  1.00 123.68 ? 178  LEU B N      1 
ATOM   8810  C  CA     . LEU B 2 178 ? 27.013  23.465  -8.273  1.00 120.91 ? 178  LEU B CA     1 
ATOM   8811  C  C      . LEU B 2 178 ? 26.349  22.604  -9.339  1.00 132.08 ? 178  LEU B C      1 
ATOM   8812  O  O      . LEU B 2 178 ? 26.837  22.503  -10.466 1.00 141.05 ? 178  LEU B O      1 
ATOM   8813  C  CB     . LEU B 2 178 ? 27.928  24.505  -8.927  1.00 114.85 ? 178  LEU B CB     1 
ATOM   8814  C  CG     . LEU B 2 178 ? 27.242  25.461  -9.911  1.00 106.80 ? 178  LEU B CG     1 
ATOM   8815  C  CD1    . LEU B 2 178 ? 26.292  26.394  -9.180  1.00 114.68 ? 178  LEU B CD1    1 
ATOM   8816  C  CD2    . LEU B 2 178 ? 28.265  26.248  -10.714 1.00 89.00  ? 178  LEU B CD2    1 
ATOM   8817  H  H      . LEU B 2 178 ? 27.568  22.766  -6.516  1.00 148.42 ? 178  LEU B H      1 
ATOM   8818  H  HA     . LEU B 2 178 ? 26.317  23.937  -7.789  1.00 145.09 ? 178  LEU B HA     1 
ATOM   8819  H  HB2    . LEU B 2 178 ? 28.328  25.046  -8.228  1.00 137.82 ? 178  LEU B HB2    1 
ATOM   8820  H  HB3    . LEU B 2 178 ? 28.625  24.038  -9.414  1.00 137.82 ? 178  LEU B HB3    1 
ATOM   8821  H  HG     . LEU B 2 178 ? 26.717  24.938  -10.537 1.00 128.16 ? 178  LEU B HG     1 
ATOM   8822  H  HD11   . LEU B 2 178 ? 26.795  26.912  -8.532  1.00 137.61 ? 178  LEU B HD11   1 
ATOM   8823  H  HD12   . LEU B 2 178 ? 25.873  26.987  -9.824  1.00 137.61 ? 178  LEU B HD12   1 
ATOM   8824  H  HD13   . LEU B 2 178 ? 25.616  25.865  -8.728  1.00 137.61 ? 178  LEU B HD13   1 
ATOM   8825  H  HD21   . LEU B 2 178 ? 28.818  25.627  -11.213 1.00 106.80 ? 178  LEU B HD21   1 
ATOM   8826  H  HD22   . LEU B 2 178 ? 27.798  26.840  -11.324 1.00 106.80 ? 178  LEU B HD22   1 
ATOM   8827  H  HD23   . LEU B 2 178 ? 28.814  26.765  -10.105 1.00 106.80 ? 178  LEU B HD23   1 
ATOM   8828  N  N      . GLY B 2 179 ? 25.248  21.966  -8.968  1.00 118.53 ? 179  GLY B N      1 
ATOM   8829  C  CA     . GLY B 2 179 ? 24.494  21.151  -9.901  1.00 124.60 ? 179  GLY B CA     1 
ATOM   8830  C  C      . GLY B 2 179 ? 23.036  21.008  -9.518  1.00 128.76 ? 179  GLY B C      1 
ATOM   8831  O  O      . GLY B 2 179 ? 22.230  20.523  -10.312 1.00 134.69 ? 179  GLY B O      1 
ATOM   8832  H  H      . GLY B 2 179 ? 24.916  21.990  -8.175  1.00 142.23 ? 179  GLY B H      1 
ATOM   8833  H  HA2    . GLY B 2 179 ? 24.540  21.548  -10.784 1.00 149.52 ? 179  GLY B HA2    1 
ATOM   8834  H  HA3    . GLY B 2 179 ? 24.887  20.265  -9.943  1.00 149.52 ? 179  GLY B HA3    1 
ATOM   8835  N  N      . PHE B 2 180 ? 22.696  21.435  -8.306  1.00 134.83 ? 180  PHE B N      1 
ATOM   8836  C  CA     . PHE B 2 180 ? 21.339  21.303  -7.797  1.00 153.70 ? 180  PHE B CA     1 
ATOM   8837  C  C      . PHE B 2 180 ? 20.594  22.633  -7.854  1.00 148.20 ? 180  PHE B C      1 
ATOM   8838  O  O      . PHE B 2 180 ? 19.589  22.742  -8.558  1.00 148.25 ? 180  PHE B O      1 
ATOM   8839  C  CB     . PHE B 2 180 ? 21.363  20.754  -6.373  1.00 161.42 ? 180  PHE B CB     1 
ATOM   8840  C  CG     . PHE B 2 180 ? 21.622  19.276  -6.306  1.00 162.44 ? 180  PHE B CG     1 
ATOM   8841  C  CD1    . PHE B 2 180 ? 20.629  18.372  -6.648  1.00 166.30 ? 180  PHE B CD1    1 
ATOM   8842  C  CD2    . PHE B 2 180 ? 22.854  18.788  -5.905  1.00 156.36 ? 180  PHE B CD2    1 
ATOM   8843  C  CE1    . PHE B 2 180 ? 20.859  17.011  -6.591  1.00 162.26 ? 180  PHE B CE1    1 
ATOM   8844  C  CE2    . PHE B 2 180 ? 23.089  17.427  -5.846  1.00 153.91 ? 180  PHE B CE2    1 
ATOM   8845  C  CZ     . PHE B 2 180 ? 22.090  16.538  -6.190  1.00 155.61 ? 180  PHE B CZ     1 
ATOM   8846  H  H      . PHE B 2 180 ? 23.240  21.809  -7.754  1.00 161.80 ? 180  PHE B H      1 
ATOM   8847  H  HA     . PHE B 2 180 ? 20.857  20.670  -8.351  1.00 184.44 ? 180  PHE B HA     1 
ATOM   8848  H  HB2    . PHE B 2 180 ? 22.065  21.203  -5.876  1.00 193.71 ? 180  PHE B HB2    1 
ATOM   8849  H  HB3    . PHE B 2 180 ? 20.504  20.925  -5.956  1.00 193.71 ? 180  PHE B HB3    1 
ATOM   8850  H  HD1    . PHE B 2 180 ? 19.797  18.685  -6.919  1.00 199.56 ? 180  PHE B HD1    1 
ATOM   8851  H  HD2    . PHE B 2 180 ? 23.531  19.382  -5.673  1.00 187.64 ? 180  PHE B HD2    1 
ATOM   8852  H  HE1    . PHE B 2 180 ? 20.184  16.414  -6.823  1.00 194.72 ? 180  PHE B HE1    1 
ATOM   8853  H  HE2    . PHE B 2 180 ? 23.921  17.110  -5.575  1.00 184.69 ? 180  PHE B HE2    1 
ATOM   8854  H  HZ     . PHE B 2 180 ? 22.247  15.622  -6.150  1.00 186.73 ? 180  PHE B HZ     1 
ATOM   8855  N  N      . GLU B 2 181 ? 21.067  23.645  -7.130  1.00 138.54 ? 181  GLU B N      1 
ATOM   8856  C  CA     . GLU B 2 181 ? 20.440  24.957  -7.243  1.00 137.85 ? 181  GLU B CA     1 
ATOM   8857  C  C      . GLU B 2 181 ? 20.645  25.507  -8.646  1.00 134.31 ? 181  GLU B C      1 
ATOM   8858  O  O      . GLU B 2 181 ? 21.538  25.077  -9.380  1.00 120.66 ? 181  GLU B O      1 
ATOM   8859  C  CB     . GLU B 2 181 ? 20.974  25.956  -6.212  1.00 121.88 ? 181  GLU B CB     1 
ATOM   8860  C  CG     . GLU B 2 181 ? 20.825  25.523  -4.767  1.00 139.20 ? 181  GLU B CG     1 
ATOM   8861  C  CD     . GLU B 2 181 ? 21.300  26.588  -3.793  1.00 148.23 ? 181  GLU B CD     1 
ATOM   8862  O  OE1    . GLU B 2 181 ? 21.934  27.567  -4.240  1.00 140.58 ? 181  GLU B OE1    1 
ATOM   8863  O  OE2    . GLU B 2 181 ? 21.026  26.454  -2.581  1.00 156.53 ? 181  GLU B OE2    1 
ATOM   8864  H  H      . GLU B 2 181 ? 21.729  23.601  -6.583  1.00 166.25 ? 181  GLU B H      1 
ATOM   8865  H  HA     . GLU B 2 181 ? 19.486  24.861  -7.098  1.00 165.42 ? 181  GLU B HA     1 
ATOM   8866  H  HB2    . GLU B 2 181 ? 21.919  26.097  -6.379  1.00 146.26 ? 181  GLU B HB2    1 
ATOM   8867  H  HB3    . GLU B 2 181 ? 20.496  26.794  -6.318  1.00 146.26 ? 181  GLU B HB3    1 
ATOM   8868  H  HG2    . GLU B 2 181 ? 19.889  25.344  -4.584  1.00 167.04 ? 181  GLU B HG2    1 
ATOM   8869  H  HG3    . GLU B 2 181 ? 21.352  24.723  -4.619  1.00 167.04 ? 181  GLU B HG3    1 
ATOM   8870  N  N      . SER B 2 182 ? 19.810  26.476  -8.994  1.00 119.32 ? 182  SER B N      1 
ATOM   8871  C  CA     . SER B 2 182 ? 19.828  27.098  -10.307 1.00 106.02 ? 182  SER B CA     1 
ATOM   8872  C  C      . SER B 2 182 ? 20.406  28.497  -10.207 1.00 107.05 ? 182  SER B C      1 
ATOM   8873  O  O      . SER B 2 182 ? 20.039  29.268  -9.320  1.00 108.47 ? 182  SER B O      1 
ATOM   8874  C  CB     . SER B 2 182 ? 18.421  27.144  -10.897 1.00 117.57 ? 182  SER B CB     1 
ATOM   8875  O  OG     . SER B 2 182 ? 17.542  27.866  -10.052 1.00 118.03 ? 182  SER B OG     1 
ATOM   8876  H  H      . SER B 2 182 ? 19.207  26.798  -8.472  1.00 143.18 ? 182  SER B H      1 
ATOM   8877  H  HA     . SER B 2 182 ? 20.391  26.577  -10.901 1.00 127.22 ? 182  SER B HA     1 
ATOM   8878  H  HB2    . SER B 2 182 ? 18.456  27.581  -11.763 1.00 141.08 ? 182  SER B HB2    1 
ATOM   8879  H  HB3    . SER B 2 182 ? 18.090  26.238  -10.997 1.00 141.08 ? 182  SER B HB3    1 
ATOM   8880  H  HG     . SER B 2 182 ? 17.817  28.654  -9.957  1.00 141.63 ? 182  SER B HG     1 
ATOM   8881  N  N      . ILE B 2 183 ? 21.312  28.816  -11.123 1.00 93.76  ? 183  ILE B N      1 
ATOM   8882  C  CA     . ILE B 2 183 ? 21.931  30.130  -11.163 1.00 86.80  ? 183  ILE B CA     1 
ATOM   8883  C  C      . ILE B 2 183 ? 21.247  30.961  -12.255 1.00 84.06  ? 183  ILE B C      1 
ATOM   8884  O  O      . ILE B 2 183 ? 21.174  30.558  -13.414 1.00 74.73  ? 183  ILE B O      1 
ATOM   8885  C  CB     . ILE B 2 183 ? 23.464  30.039  -11.377 1.00 86.99  ? 183  ILE B CB     1 
ATOM   8886  C  CG1    . ILE B 2 183 ? 23.824  29.480  -12.750 1.00 84.71  ? 183  ILE B CG1    1 
ATOM   8887  C  CG2    . ILE B 2 183 ? 24.103  29.179  -10.293 1.00 95.94  ? 183  ILE B CG2    1 
ATOM   8888  C  CD1    . ILE B 2 183 ? 24.395  30.532  -13.673 1.00 87.77  ? 183  ILE B CD1    1 
ATOM   8889  H  H      . ILE B 2 183 ? 21.587  28.281  -11.738 1.00 112.51 ? 183  ILE B H      1 
ATOM   8890  H  HA     . ILE B 2 183 ? 21.777  30.574  -10.314 1.00 104.16 ? 183  ILE B HA     1 
ATOM   8891  H  HB     . ILE B 2 183 ? 23.833  30.934  -11.309 1.00 104.39 ? 183  ILE B HB     1 
ATOM   8892  H  HG12   . ILE B 2 183 ? 24.488  28.781  -12.644 1.00 101.65 ? 183  ILE B HG12   1 
ATOM   8893  H  HG13   . ILE B 2 183 ? 23.024  29.120  -13.164 1.00 101.65 ? 183  ILE B HG13   1 
ATOM   8894  H  HG21   . ILE B 2 183 ? 23.722  28.288  -10.332 1.00 115.13 ? 183  ILE B HG21   1 
ATOM   8895  H  HG22   . ILE B 2 183 ? 25.060  29.136  -10.448 1.00 115.13 ? 183  ILE B HG22   1 
ATOM   8896  H  HG23   . ILE B 2 183 ? 23.925  29.578  -9.428  1.00 115.13 ? 183  ILE B HG23   1 
ATOM   8897  H  HD11   . ILE B 2 183 ? 25.201  30.897  -13.274 1.00 105.32 ? 183  ILE B HD11   1 
ATOM   8898  H  HD12   . ILE B 2 183 ? 24.604  30.123  -14.527 1.00 105.32 ? 183  ILE B HD12   1 
ATOM   8899  H  HD13   . ILE B 2 183 ? 23.738  31.236  -13.794 1.00 105.32 ? 183  ILE B HD13   1 
ATOM   8900  N  N      . TYR B 2 184 ? 20.726  32.118  -11.854 1.00 91.15  ? 184  TYR B N      1 
ATOM   8901  C  CA     . TYR B 2 184 ? 20.002  33.020  -12.750 1.00 75.38  ? 184  TYR B CA     1 
ATOM   8902  C  C      . TYR B 2 184 ? 20.877  34.136  -13.298 1.00 69.34  ? 184  TYR B C      1 
ATOM   8903  O  O      . TYR B 2 184 ? 21.689  34.723  -12.582 1.00 80.64  ? 184  TYR B O      1 
ATOM   8904  C  CB     . TYR B 2 184 ? 18.806  33.646  -12.032 1.00 78.41  ? 184  TYR B CB     1 
ATOM   8905  C  CG     . TYR B 2 184 ? 17.832  32.652  -11.455 1.00 86.84  ? 184  TYR B CG     1 
ATOM   8906  C  CD1    . TYR B 2 184 ? 16.858  32.062  -12.252 1.00 94.97  ? 184  TYR B CD1    1 
ATOM   8907  C  CD2    . TYR B 2 184 ? 17.883  32.305  -10.116 1.00 92.96  ? 184  TYR B CD2    1 
ATOM   8908  C  CE1    . TYR B 2 184 ? 15.961  31.153  -11.727 1.00 97.45  ? 184  TYR B CE1    1 
ATOM   8909  C  CE2    . TYR B 2 184 ? 16.994  31.399  -9.583  1.00 105.18 ? 184  TYR B CE2    1 
ATOM   8910  C  CZ     . TYR B 2 184 ? 16.034  30.825  -10.391 1.00 101.21 ? 184  TYR B CZ     1 
ATOM   8911  O  OH     . TYR B 2 184 ? 15.145  29.919  -9.859  1.00 111.14 ? 184  TYR B OH     1 
ATOM   8912  H  H      . TYR B 2 184 ? 20.781  32.411  -11.047 1.00 109.38 ? 184  TYR B H      1 
ATOM   8913  H  HA     . TYR B 2 184 ? 19.664  32.510  -13.502 1.00 90.46  ? 184  TYR B HA     1 
ATOM   8914  H  HB2    . TYR B 2 184 ? 19.135  34.193  -11.302 1.00 94.09  ? 184  TYR B HB2    1 
ATOM   8915  H  HB3    . TYR B 2 184 ? 18.322  34.200  -12.663 1.00 94.09  ? 184  TYR B HB3    1 
ATOM   8916  H  HD1    . TYR B 2 184 ? 16.808  32.284  -13.154 1.00 113.97 ? 184  TYR B HD1    1 
ATOM   8917  H  HD2    . TYR B 2 184 ? 18.527  32.690  -9.567  1.00 111.55 ? 184  TYR B HD2    1 
ATOM   8918  H  HE1    . TYR B 2 184 ? 15.314  30.765  -12.271 1.00 116.94 ? 184  TYR B HE1    1 
ATOM   8919  H  HE2    . TYR B 2 184 ? 17.040  31.176  -8.682  1.00 126.22 ? 184  TYR B HE2    1 
ATOM   8920  H  HH     . TYR B 2 184 ? 15.301  29.811  -9.041  1.00 133.37 ? 184  TYR B HH     1 
ATOM   8921  N  N      . LYS B 2 185 ? 20.692  34.416  -14.583 1.00 63.09  ? 185  LYS B N      1 
ATOM   8922  C  CA     . LYS B 2 185 ? 21.477  35.415  -15.290 1.00 60.78  ? 185  LYS B CA     1 
ATOM   8923  C  C      . LYS B 2 185 ? 20.773  36.777  -15.276 1.00 72.54  ? 185  LYS B C      1 
ATOM   8924  O  O      . LYS B 2 185 ? 19.814  37.014  -16.009 1.00 93.64  ? 185  LYS B O      1 
ATOM   8925  C  CB     . LYS B 2 185 ? 21.727  34.934  -16.721 1.00 50.61  ? 185  LYS B CB     1 
ATOM   8926  C  CG     . LYS B 2 185 ? 22.485  35.888  -17.618 1.00 73.49  ? 185  LYS B CG     1 
ATOM   8927  C  CD     . LYS B 2 185 ? 22.488  35.375  -19.051 1.00 72.60  ? 185  LYS B CD     1 
ATOM   8928  C  CE     . LYS B 2 185 ? 23.273  36.291  -19.972 1.00 86.49  ? 185  LYS B CE     1 
ATOM   8929  N  NZ     . LYS B 2 185 ? 23.285  35.807  -21.380 1.00 75.08  ? 185  LYS B NZ     1 
ATOM   8930  H  H      . LYS B 2 185 ? 20.104  34.030  -15.077 1.00 75.71  ? 185  LYS B H      1 
ATOM   8931  H  HA     . LYS B 2 185 ? 22.336  35.515  -14.851 1.00 72.94  ? 185  LYS B HA     1 
ATOM   8932  H  HB2    . LYS B 2 185 ? 22.234  34.109  -16.681 1.00 60.73  ? 185  LYS B HB2    1 
ATOM   8933  H  HB3    . LYS B 2 185 ? 20.868  34.765  -17.140 1.00 60.73  ? 185  LYS B HB3    1 
ATOM   8934  H  HG2    . LYS B 2 185 ? 22.056  36.757  -17.604 1.00 88.19  ? 185  LYS B HG2    1 
ATOM   8935  H  HG3    . LYS B 2 185 ? 23.404  35.957  -17.314 1.00 88.19  ? 185  LYS B HG3    1 
ATOM   8936  H  HD2    . LYS B 2 185 ? 22.898  34.496  -19.075 1.00 87.13  ? 185  LYS B HD2    1 
ATOM   8937  H  HD3    . LYS B 2 185 ? 21.575  35.328  -19.375 1.00 87.13  ? 185  LYS B HD3    1 
ATOM   8938  H  HE2    . LYS B 2 185 ? 22.870  37.173  -19.960 1.00 103.79 ? 185  LYS B HE2    1 
ATOM   8939  H  HE3    . LYS B 2 185 ? 24.191  36.341  -19.662 1.00 103.79 ? 185  LYS B HE3    1 
ATOM   8940  H  HZ1    . LYS B 2 185 ? 22.453  35.758  -21.692 1.00 90.10  ? 185  LYS B HZ1    1 
ATOM   8941  H  HZ2    . LYS B 2 185 ? 23.753  36.366  -21.890 1.00 90.10  ? 185  LYS B HZ2    1 
ATOM   8942  H  HZ3    . LYS B 2 185 ? 23.657  34.999  -21.421 1.00 90.10  ? 185  LYS B HZ3    1 
ATOM   8943  N  N      . ILE B 2 186 ? 21.289  37.657  -14.419 1.00 71.64  ? 186  ILE B N      1 
ATOM   8944  C  CA     . ILE B 2 186 ? 20.736  38.985  -14.138 1.00 66.18  ? 186  ILE B CA     1 
ATOM   8945  C  C      . ILE B 2 186 ? 21.685  40.089  -14.625 1.00 79.95  ? 186  ILE B C      1 
ATOM   8946  O  O      . ILE B 2 186 ? 22.902  39.926  -14.558 1.00 80.33  ? 186  ILE B O      1 
ATOM   8947  C  CB     . ILE B 2 186 ? 20.477  39.183  -12.624 1.00 68.36  ? 186  ILE B CB     1 
ATOM   8948  C  CG1    . ILE B 2 186 ? 19.826  37.932  -12.024 1.00 87.24  ? 186  ILE B CG1    1 
ATOM   8949  C  CG2    . ILE B 2 186 ? 19.588  40.402  -12.390 1.00 76.11  ? 186  ILE B CG2    1 
ATOM   8950  C  CD1    . ILE B 2 186 ? 19.543  38.022  -10.532 1.00 103.78 ? 186  ILE B CD1    1 
ATOM   8951  H  H      . ILE B 2 186 ? 22.000  37.496  -13.962 1.00 85.97  ? 186  ILE B H      1 
ATOM   8952  H  HA     . ILE B 2 186 ? 19.892  39.084  -14.605 1.00 79.41  ? 186  ILE B HA     1 
ATOM   8953  H  HB     . ILE B 2 186 ? 21.327  39.332  -12.182 1.00 82.03  ? 186  ILE B HB     1 
ATOM   8954  H  HG12   . ILE B 2 186 ? 18.982  37.775  -12.475 1.00 104.69 ? 186  ILE B HG12   1 
ATOM   8955  H  HG13   . ILE B 2 186 ? 20.418  37.177  -12.167 1.00 104.69 ? 186  ILE B HG13   1 
ATOM   8956  H  HG21   . ILE B 2 186 ? 18.741  40.267  -12.845 1.00 91.33  ? 186  ILE B HG21   1 
ATOM   8957  H  HG22   . ILE B 2 186 ? 19.439  40.505  -11.437 1.00 91.33  ? 186  ILE B HG22   1 
ATOM   8958  H  HG23   . ILE B 2 186 ? 20.032  41.188  -12.744 1.00 91.33  ? 186  ILE B HG23   1 
ATOM   8959  H  HD11   . ILE B 2 186 ? 18.941  38.764  -10.369 1.00 124.53 ? 186  ILE B HD11   1 
ATOM   8960  H  HD12   . ILE B 2 186 ? 19.135  37.193  -10.238 1.00 124.53 ? 186  ILE B HD12   1 
ATOM   8961  H  HD13   . ILE B 2 186 ? 20.379  38.165  -10.060 1.00 124.53 ? 186  ILE B HD13   1 
ATOM   8962  N  N      . PRO B 2 187 ? 21.136  41.211  -15.128 1.00 78.47  ? 187  PRO B N      1 
ATOM   8963  C  CA     . PRO B 2 187 ? 21.992  42.372  -15.414 1.00 78.04  ? 187  PRO B CA     1 
ATOM   8964  C  C      . PRO B 2 187 ? 22.795  42.809  -14.189 1.00 65.95  ? 187  PRO B C      1 
ATOM   8965  O  O      . PRO B 2 187 ? 22.232  42.847  -13.093 1.00 59.54  ? 187  PRO B O      1 
ATOM   8966  C  CB     . PRO B 2 187 ? 20.986  43.456  -15.800 1.00 67.90  ? 187  PRO B CB     1 
ATOM   8967  C  CG     . PRO B 2 187 ? 19.824  42.712  -16.340 1.00 67.19  ? 187  PRO B CG     1 
ATOM   8968  C  CD     . PRO B 2 187 ? 19.738  41.451  -15.532 1.00 54.72  ? 187  PRO B CD     1 
ATOM   8969  H  HA     . PRO B 2 187 ? 22.588  42.191  -16.158 1.00 93.65  ? 187  PRO B HA     1 
ATOM   8970  H  HB2    . PRO B 2 187 ? 20.735  43.966  -15.014 1.00 81.48  ? 187  PRO B HB2    1 
ATOM   8971  H  HB3    . PRO B 2 187 ? 21.370  44.034  -16.478 1.00 81.48  ? 187  PRO B HB3    1 
ATOM   8972  H  HG2    . PRO B 2 187 ? 19.019  43.242  -16.231 1.00 80.63  ? 187  PRO B HG2    1 
ATOM   8973  H  HG3    . PRO B 2 187 ? 19.975  42.507  -17.276 1.00 80.63  ? 187  PRO B HG3    1 
ATOM   8974  H  HD2    . PRO B 2 187 ? 19.179  41.587  -14.751 1.00 65.66  ? 187  PRO B HD2    1 
ATOM   8975  H  HD3    . PRO B 2 187 ? 19.414  40.719  -16.080 1.00 65.66  ? 187  PRO B HD3    1 
ATOM   8976  N  N      . PHE B 2 188 ? 24.080  43.119  -14.361 1.00 54.93  ? 188  PHE B N      1 
ATOM   8977  C  CA     . PHE B 2 188 ? 24.943  43.381  -13.212 1.00 51.82  ? 188  PHE B CA     1 
ATOM   8978  C  C      . PHE B 2 188 ? 24.446  44.539  -12.357 1.00 43.48  ? 188  PHE B C      1 
ATOM   8979  O  O      . PHE B 2 188 ? 24.629  44.533  -11.142 1.00 56.55  ? 188  PHE B O      1 
ATOM   8980  C  CB     . PHE B 2 188 ? 26.382  43.677  -13.650 1.00 45.87  ? 188  PHE B CB     1 
ATOM   8981  C  CG     . PHE B 2 188 ? 26.595  45.082  -14.160 1.00 41.91  ? 188  PHE B CG     1 
ATOM   8982  C  CD1    . PHE B 2 188 ? 26.374  45.402  -15.486 1.00 47.09  ? 188  PHE B CD1    1 
ATOM   8983  C  CD2    . PHE B 2 188 ? 26.989  46.090  -13.294 1.00 45.31  ? 188  PHE B CD2    1 
ATOM   8984  C  CE1    . PHE B 2 188 ? 26.574  46.694  -15.946 1.00 51.90  ? 188  PHE B CE1    1 
ATOM   8985  C  CE2    . PHE B 2 188 ? 27.181  47.381  -13.746 1.00 55.61  ? 188  PHE B CE2    1 
ATOM   8986  C  CZ     . PHE B 2 188 ? 26.972  47.683  -15.075 1.00 50.08  ? 188  PHE B CZ     1 
ATOM   8987  H  H      . PHE B 2 188 ? 24.472  43.182  -15.124 1.00 65.91  ? 188  PHE B H      1 
ATOM   8988  H  HA     . PHE B 2 188 ? 24.962  42.589  -12.652 1.00 62.18  ? 188  PHE B HA     1 
ATOM   8989  H  HB2    . PHE B 2 188 ? 26.972  43.545  -12.892 1.00 55.04  ? 188  PHE B HB2    1 
ATOM   8990  H  HB3    . PHE B 2 188 ? 26.623  43.065  -14.363 1.00 55.04  ? 188  PHE B HB3    1 
ATOM   8991  H  HD1    . PHE B 2 188 ? 27.136  45.893  -12.397 1.00 54.37  ? 188  PHE B HD1    1 
ATOM   8992  H  HD2    . PHE B 2 188 ? 26.109  44.738  -16.081 1.00 56.51  ? 188  PHE B HD2    1 
ATOM   8993  H  HE1    . PHE B 2 188 ? 27.452  48.046  -13.155 1.00 66.74  ? 188  PHE B HE1    1 
ATOM   8994  H  HE2    . PHE B 2 188 ? 26.427  46.895  -16.842 1.00 62.28  ? 188  PHE B HE2    1 
ATOM   8995  H  HZ     . PHE B 2 188 ? 27.099  48.552  -15.381 1.00 60.10  ? 188  PHE B HZ     1 
ATOM   8996  N  N      . ALA B 2 189 ? 23.822  45.527  -12.989 1.00 48.28  ? 189  ALA B N      1 
ATOM   8997  C  CA     . ALA B 2 189 ? 23.366  46.717  -12.278 1.00 47.27  ? 189  ALA B CA     1 
ATOM   8998  C  C      . ALA B 2 189 ? 22.356  46.359  -11.189 1.00 57.62  ? 189  ALA B C      1 
ATOM   8999  O  O      . ALA B 2 189 ? 22.230  47.071  -10.188 1.00 56.98  ? 189  ALA B O      1 
ATOM   9000  C  CB     . ALA B 2 189 ? 22.767  47.715  -13.253 1.00 73.19  ? 189  ALA B CB     1 
ATOM   9001  H  H      . ALA B 2 189 ? 23.651  45.533  -13.832 1.00 57.93  ? 189  ALA B H      1 
ATOM   9002  H  HA     . ALA B 2 189 ? 24.128  47.138  -11.850 1.00 56.73  ? 189  ALA B HA     1 
ATOM   9003  H  HB1    . ALA B 2 189 ? 22.014  47.302  -13.704 1.00 87.83  ? 189  ALA B HB1    1 
ATOM   9004  H  HB2    . ALA B 2 189 ? 22.470  48.497  -12.761 1.00 87.83  ? 189  ALA B HB2    1 
ATOM   9005  H  HB3    . ALA B 2 189 ? 23.443  47.968  -13.901 1.00 87.83  ? 189  ALA B HB3    1 
ATOM   9006  N  N      . ASP B 2 190 ? 21.639  45.255  -11.395 1.00 56.43  ? 190  ASP B N      1 
ATOM   9007  C  CA     . ASP B 2 190 ? 20.622  44.808  -10.450 1.00 67.00  ? 190  ASP B CA     1 
ATOM   9008  C  C      . ASP B 2 190 ? 21.215  43.880  -9.395  1.00 64.62  ? 190  ASP B C      1 
ATOM   9009  O  O      . ASP B 2 190 ? 20.498  43.362  -8.539  1.00 69.60  ? 190  ASP B O      1 
ATOM   9010  C  CB     . ASP B 2 190 ? 19.488  44.097  -11.189 1.00 73.56  ? 190  ASP B CB     1 
ATOM   9011  C  CG     . ASP B 2 190 ? 18.747  45.016  -12.142 1.00 94.75  ? 190  ASP B CG     1 
ATOM   9012  O  OD1    . ASP B 2 190 ? 18.396  46.146  -11.739 1.00 97.26  ? 190  ASP B OD1    1 
ATOM   9013  O  OD2    . ASP B 2 190 ? 18.516  44.606  -13.300 1.00 109.70 ? 190  ASP B OD2    1 
ATOM   9014  H  H      . ASP B 2 190 ? 21.726  44.744  -12.081 1.00 67.71  ? 190  ASP B H      1 
ATOM   9015  H  HA     . ASP B 2 190 ? 20.249  45.580  -9.996  1.00 80.40  ? 190  ASP B HA     1 
ATOM   9016  H  HB2    . ASP B 2 190 ? 19.858  43.364  -11.705 1.00 88.27  ? 190  ASP B HB2    1 
ATOM   9017  H  HB3    . ASP B 2 190 ? 18.851  43.759  -10.541 1.00 88.27  ? 190  ASP B HB3    1 
ATOM   9018  N  N      . ALA B 2 191 ? 22.529  43.685  -9.464  1.00 58.71  ? 191  ALA B N      1 
ATOM   9019  C  CA     . ALA B 2 191 ? 23.246  42.815  -8.539  1.00 53.83  ? 191  ALA B CA     1 
ATOM   9020  C  C      . ALA B 2 191 ? 24.304  43.635  -7.813  1.00 61.85  ? 191  ALA B C      1 
ATOM   9021  O  O      . ALA B 2 191 ? 25.321  43.102  -7.369  1.00 59.49  ? 191  ALA B O      1 
ATOM   9022  C  CB     . ALA B 2 191 ? 23.880  41.649  -9.281  1.00 40.54  ? 191  ALA B CB     1 
ATOM   9023  H  H      . ALA B 2 191 ? 23.037  44.054  -10.051 1.00 70.45  ? 191  ALA B H      1 
ATOM   9024  H  HA     . ALA B 2 191 ? 22.626  42.461  -7.881  1.00 64.60  ? 191  ALA B HA     1 
ATOM   9025  H  HB1    . ALA B 2 191 ? 24.502  41.996  -9.939  1.00 48.65  ? 191  ALA B HB1    1 
ATOM   9026  H  HB2    . ALA B 2 191 ? 24.349  41.088  -8.645  1.00 48.65  ? 191  ALA B HB2    1 
ATOM   9027  H  HB3    . ALA B 2 191 ? 23.182  41.139  -9.722  1.00 48.65  ? 191  ALA B HB3    1 
ATOM   9028  N  N      . LEU B 2 192 ? 24.054  44.940  -7.731  1.00 66.78  ? 192  LEU B N      1 
ATOM   9029  C  CA     . LEU B 2 192 ? 24.993  45.911  -7.172  1.00 56.03  ? 192  LEU B CA     1 
ATOM   9030  C  C      . LEU B 2 192 ? 25.732  45.430  -5.926  1.00 64.66  ? 192  LEU B C      1 
ATOM   9031  O  O      . LEU B 2 192 ? 26.962  45.449  -5.895  1.00 70.48  ? 192  LEU B O      1 
ATOM   9032  C  CB     . LEU B 2 192 ? 24.264  47.217  -6.862  1.00 63.92  ? 192  LEU B CB     1 
ATOM   9033  C  CG     . LEU B 2 192 ? 25.102  48.302  -6.181  1.00 52.41  ? 192  LEU B CG     1 
ATOM   9034  C  CD1    . LEU B 2 192 ? 26.176  48.807  -7.129  1.00 26.08  ? 192  LEU B CD1    1 
ATOM   9035  C  CD2    . LEU B 2 192 ? 24.215  49.445  -5.730  1.00 56.80  ? 192  LEU B CD2    1 
ATOM   9036  H  H      . LEU B 2 192 ? 23.321  45.299  -8.003  1.00 80.13  ? 192  LEU B H      1 
ATOM   9037  H  HA     . LEU B 2 192 ? 25.662  46.107  -7.846  1.00 67.24  ? 192  LEU B HA     1 
ATOM   9038  H  HB2    . LEU B 2 192 ? 23.933  47.588  -7.695  1.00 76.70  ? 192  LEU B HB2    1 
ATOM   9039  H  HB3    . LEU B 2 192 ? 23.516  47.019  -6.278  1.00 76.70  ? 192  LEU B HB3    1 
ATOM   9040  H  HG     . LEU B 2 192 ? 25.537  47.927  -5.399  1.00 62.89  ? 192  LEU B HG     1 
ATOM   9041  H  HD11   . LEU B 2 192 ? 25.751  49.177  -7.919  1.00 31.29  ? 192  LEU B HD11   1 
ATOM   9042  H  HD12   . LEU B 2 192 ? 26.696  49.492  -6.681  1.00 31.29  ? 192  LEU B HD12   1 
ATOM   9043  H  HD13   . LEU B 2 192 ? 26.750  48.066  -7.380  1.00 31.29  ? 192  LEU B HD13   1 
ATOM   9044  H  HD21   . LEU B 2 192 ? 23.557  49.105  -5.103  1.00 68.16  ? 192  LEU B HD21   1 
ATOM   9045  H  HD22   . LEU B 2 192 ? 24.763  50.120  -5.301  1.00 68.16  ? 192  LEU B HD22   1 
ATOM   9046  H  HD23   . LEU B 2 192 ? 23.769  49.823  -6.504  1.00 68.16  ? 192  LEU B HD23   1 
ATOM   9047  N  N      . ASP B 2 193 ? 24.996  44.993  -4.907  1.00 71.21  ? 193  ASP B N      1 
ATOM   9048  C  CA     . ASP B 2 193 ? 25.621  44.646  -3.629  1.00 79.85  ? 193  ASP B CA     1 
ATOM   9049  C  C      . ASP B 2 193 ? 26.515  43.422  -3.737  1.00 62.66  ? 193  ASP B C      1 
ATOM   9050  O  O      . ASP B 2 193 ? 27.444  43.255  -2.948  1.00 84.19  ? 193  ASP B O      1 
ATOM   9051  C  CB     . ASP B 2 193 ? 24.561  44.394  -2.552  1.00 78.67  ? 193  ASP B CB     1 
ATOM   9052  C  CG     . ASP B 2 193 ? 23.778  45.639  -2.200  1.00 92.58  ? 193  ASP B CG     1 
ATOM   9053  O  OD1    . ASP B 2 193 ? 24.411  46.682  -1.929  1.00 81.16  ? 193  ASP B OD1    1 
ATOM   9054  O  OD2    . ASP B 2 193 ? 22.531  45.570  -2.179  1.00 103.75 ? 193  ASP B OD2    1 
ATOM   9055  H  H      . ASP B 2 193 ? 24.143  44.889  -4.927  1.00 85.45  ? 193  ASP B H      1 
ATOM   9056  H  HA     . ASP B 2 193 ? 26.170  45.390  -3.337  1.00 95.82  ? 193  ASP B HA     1 
ATOM   9057  H  HB2    . ASP B 2 193 ? 23.934  43.727  -2.876  1.00 94.41  ? 193  ASP B HB2    1 
ATOM   9058  H  HB3    . ASP B 2 193 ? 24.998  44.076  -1.747  1.00 94.41  ? 193  ASP B HB3    1 
ATOM   9059  N  N      . LEU B 2 194 ? 26.243  42.571  -4.717  1.00 50.64  ? 194  LEU B N      1 
ATOM   9060  C  CA     . LEU B 2 194 ? 27.045  41.374  -4.916  1.00 52.24  ? 194  LEU B CA     1 
ATOM   9061  C  C      . LEU B 2 194 ? 28.342  41.685  -5.665  1.00 62.30  ? 194  LEU B C      1 
ATOM   9062  O  O      . LEU B 2 194 ? 29.433  41.464  -5.137  1.00 62.33  ? 194  LEU B O      1 
ATOM   9063  C  CB     . LEU B 2 194 ? 26.250  40.305  -5.666  1.00 64.68  ? 194  LEU B CB     1 
ATOM   9064  C  CG     . LEU B 2 194 ? 25.193  39.525  -4.877  1.00 54.20  ? 194  LEU B CG     1 
ATOM   9065  C  CD1    . LEU B 2 194 ? 24.742  38.316  -5.682  1.00 71.76  ? 194  LEU B CD1    1 
ATOM   9066  C  CD2    . LEU B 2 194 ? 25.674  39.088  -3.499  1.00 39.10  ? 194  LEU B CD2    1 
ATOM   9067  H  H      . LEU B 2 194 ? 25.599  42.663  -5.280  1.00 60.76  ? 194  LEU B H      1 
ATOM   9068  H  HA     . LEU B 2 194 ? 27.284  41.011  -4.048  1.00 62.69  ? 194  LEU B HA     1 
ATOM   9069  H  HB2    . LEU B 2 194 ? 25.793  40.735  -6.405  1.00 77.61  ? 194  LEU B HB2    1 
ATOM   9070  H  HB3    . LEU B 2 194 ? 26.879  39.655  -6.017  1.00 77.61  ? 194  LEU B HB3    1 
ATOM   9071  H  HG     . LEU B 2 194 ? 24.419  40.096  -4.749  1.00 65.04  ? 194  LEU B HG     1 
ATOM   9072  H  HD11   . LEU B 2 194 ? 25.509  37.746  -5.850  1.00 86.11  ? 194  LEU B HD11   1 
ATOM   9073  H  HD12   . LEU B 2 194 ? 24.074  37.830  -5.173  1.00 86.11  ? 194  LEU B HD12   1 
ATOM   9074  H  HD13   . LEU B 2 194 ? 24.364  38.619  -6.522  1.00 86.11  ? 194  LEU B HD13   1 
ATOM   9075  H  HD21   . LEU B 2 194 ? 25.909  39.875  -2.983  1.00 46.92  ? 194  LEU B HD21   1 
ATOM   9076  H  HD22   . LEU B 2 194 ? 24.960  38.603  -3.055  1.00 46.92  ? 194  LEU B HD22   1 
ATOM   9077  H  HD23   . LEU B 2 194 ? 26.449  38.516  -3.602  1.00 46.92  ? 194  LEU B HD23   1 
ATOM   9078  N  N      . PHE B 2 195 ? 28.234  42.192  -6.892  1.00 44.87  ? 195  PHE B N      1 
ATOM   9079  C  CA     . PHE B 2 195 ? 29.424  42.342  -7.723  1.00 47.87  ? 195  PHE B CA     1 
ATOM   9080  C  C      . PHE B 2 195 ? 30.355  43.435  -7.205  1.00 50.44  ? 195  PHE B C      1 
ATOM   9081  O  O      . PHE B 2 195 ? 31.529  43.474  -7.576  1.00 48.68  ? 195  PHE B O      1 
ATOM   9082  C  CB     . PHE B 2 195 ? 29.043  42.626  -9.184  1.00 45.08  ? 195  PHE B CB     1 
ATOM   9083  C  CG     . PHE B 2 195 ? 28.821  44.083  -9.500  1.00 47.97  ? 195  PHE B CG     1 
ATOM   9084  C  CD1    . PHE B 2 195 ? 29.889  44.896  -9.849  1.00 39.76  ? 195  PHE B CD1    1 
ATOM   9085  C  CD2    . PHE B 2 195 ? 27.550  44.633  -9.477  1.00 53.68  ? 195  PHE B CD2    1 
ATOM   9086  C  CE1    . PHE B 2 195 ? 29.698  46.228  -10.148 1.00 39.31  ? 195  PHE B CE1    1 
ATOM   9087  C  CE2    . PHE B 2 195 ? 27.354  45.969  -9.782  1.00 44.50  ? 195  PHE B CE2    1 
ATOM   9088  C  CZ     . PHE B 2 195 ? 28.427  46.765  -10.115 1.00 48.04  ? 195  PHE B CZ     1 
ATOM   9089  H  H      . PHE B 2 195 ? 27.501  42.450  -7.260  1.00 53.85  ? 195  PHE B H      1 
ATOM   9090  H  HA     . PHE B 2 195 ? 29.917  41.507  -7.707  1.00 57.45  ? 195  PHE B HA     1 
ATOM   9091  H  HB2    . PHE B 2 195 ? 29.756  42.306  -9.759  1.00 54.10  ? 195  PHE B HB2    1 
ATOM   9092  H  HB3    . PHE B 2 195 ? 28.222  42.152  -9.389  1.00 54.10  ? 195  PHE B HB3    1 
ATOM   9093  H  HD1    . PHE B 2 195 ? 30.748  44.540  -9.872  1.00 47.71  ? 195  PHE B HD1    1 
ATOM   9094  H  HD2    . PHE B 2 195 ? 26.822  44.100  -9.251  1.00 64.41  ? 195  PHE B HD2    1 
ATOM   9095  H  HE1    . PHE B 2 195 ? 30.423  46.763  -10.376 1.00 47.18  ? 195  PHE B HE1    1 
ATOM   9096  H  HE2    . PHE B 2 195 ? 26.497  46.331  -9.757  1.00 53.40  ? 195  PHE B HE2    1 
ATOM   9097  H  HZ     . PHE B 2 195 ? 28.296  47.663  -10.318 1.00 57.65  ? 195  PHE B HZ     1 
ATOM   9098  N  N      . ARG B 2 196 ? 29.855  44.320  -6.349  1.00 48.45  ? 196  ARG B N      1 
ATOM   9099  C  CA     . ARG B 2 196 ? 30.708  45.387  -5.833  1.00 44.05  ? 196  ARG B CA     1 
ATOM   9100  C  C      . ARG B 2 196 ? 31.609  44.850  -4.730  1.00 45.02  ? 196  ARG B C      1 
ATOM   9101  O  O      . ARG B 2 196 ? 32.433  45.580  -4.193  1.00 66.97  ? 196  ARG B O      1 
ATOM   9102  C  CB     . ARG B 2 196 ? 29.877  46.567  -5.321  1.00 51.86  ? 196  ARG B CB     1 
ATOM   9103  C  CG     . ARG B 2 196 ? 29.276  46.389  -3.940  1.00 49.01  ? 196  ARG B CG     1 
ATOM   9104  C  CD     . ARG B 2 196 ? 28.383  47.569  -3.598  1.00 54.67  ? 196  ARG B CD     1 
ATOM   9105  N  NE     . ARG B 2 196 ? 27.869  47.499  -2.236  1.00 71.78  ? 196  ARG B NE     1 
ATOM   9106  C  CZ     . ARG B 2 196 ? 28.474  48.015  -1.170  1.00 90.37  ? 196  ARG B CZ     1 
ATOM   9107  N  NH1    . ARG B 2 196 ? 29.644  48.628  -1.289  1.00 107.15 ? 196  ARG B NH1    1 
ATOM   9108  N  NH2    . ARG B 2 196 ? 27.914  47.897  0.027   1.00 78.88  ? 196  ARG B NH2    1 
ATOM   9109  H  H      . ARG B 2 196 ? 29.047  44.327  -6.056  1.00 58.14  ? 196  ARG B H      1 
ATOM   9110  H  HA     . ARG B 2 196 ? 31.275  45.711  -6.550  1.00 52.86  ? 196  ARG B HA     1 
ATOM   9111  H  HB2    . ARG B 2 196 ? 30.446  47.353  -5.292  1.00 62.23  ? 196  ARG B HB2    1 
ATOM   9112  H  HB3    . ARG B 2 196 ? 29.146  46.719  -5.940  1.00 62.23  ? 196  ARG B HB3    1 
ATOM   9113  H  HG2    . ARG B 2 196 ? 28.738  45.582  -3.923  1.00 58.81  ? 196  ARG B HG2    1 
ATOM   9114  H  HG3    . ARG B 2 196 ? 29.986  46.339  -3.281  1.00 58.81  ? 196  ARG B HG3    1 
ATOM   9115  H  HD2    . ARG B 2 196 ? 28.894  48.389  -3.685  1.00 65.61  ? 196  ARG B HD2    1 
ATOM   9116  H  HD3    . ARG B 2 196 ? 27.627  47.581  -4.205  1.00 65.61  ? 196  ARG B HD3    1 
ATOM   9117  H  HE     . ARG B 2 196 ? 27.120  47.094  -2.112  1.00 86.13  ? 196  ARG B HE     1 
ATOM   9118  H  HH11   . ARG B 2 196 ? 30.011  48.707  -2.062  1.00 128.58 ? 196  ARG B HH11   1 
ATOM   9119  H  HH12   . ARG B 2 196 ? 30.030  48.955  -0.594  1.00 128.58 ? 196  ARG B HH12   1 
ATOM   9120  H  HH21   . ARG B 2 196 ? 27.158  47.496  0.111   1.00 94.65  ? 196  ARG B HH21   1 
ATOM   9121  H  HH22   . ARG B 2 196 ? 28.306  48.224  0.720   1.00 94.65  ? 196  ARG B HH22   1 
ATOM   9122  N  N      . GLY B 2 197 ? 31.452  43.567  -4.416  1.00 47.69  ? 197  GLY B N      1 
ATOM   9123  C  CA     . GLY B 2 197 ? 32.294  42.878  -3.452  1.00 45.47  ? 197  GLY B CA     1 
ATOM   9124  C  C      . GLY B 2 197 ? 32.931  41.640  -4.058  1.00 47.37  ? 197  GLY B C      1 
ATOM   9125  O  O      . GLY B 2 197 ? 33.528  40.827  -3.351  1.00 62.35  ? 197  GLY B O      1 
ATOM   9126  H  H      . GLY B 2 197 ? 30.847  43.062  -4.760  1.00 57.23  ? 197  GLY B H      1 
ATOM   9127  H  HA2    . GLY B 2 197 ? 32.998  43.474  -3.149  1.00 54.57  ? 197  GLY B HA2    1 
ATOM   9128  H  HA3    . GLY B 2 197 ? 31.762  42.611  -2.686  1.00 54.57  ? 197  GLY B HA3    1 
ATOM   9129  N  N      . ARG B 2 198 ? 32.805  41.507  -5.373  1.00 37.95  ? 198  ARG B N      1 
ATOM   9130  C  CA     . ARG B 2 198 ? 33.286  40.340  -6.099  1.00 38.85  ? 198  ARG B CA     1 
ATOM   9131  C  C      . ARG B 2 198 ? 32.732  39.084  -5.429  1.00 57.95  ? 198  ARG B C      1 
ATOM   9132  O  O      . ARG B 2 198 ? 33.477  38.154  -5.119  1.00 61.15  ? 198  ARG B O      1 
ATOM   9133  C  CB     . ARG B 2 198 ? 34.814  40.270  -6.127  1.00 33.10  ? 198  ARG B CB     1 
ATOM   9134  C  CG     . ARG B 2 198 ? 35.507  41.264  -7.041  1.00 33.65  ? 198  ARG B CG     1 
ATOM   9135  C  CD     . ARG B 2 198 ? 37.016  41.016  -7.019  1.00 50.87  ? 198  ARG B CD     1 
ATOM   9136  N  NE     . ARG B 2 198 ? 37.706  41.555  -5.847  1.00 39.73  ? 198  ARG B NE     1 
ATOM   9137  C  CZ     . ARG B 2 198 ? 38.069  42.822  -5.689  1.00 33.91  ? 198  ARG B CZ     1 
ATOM   9138  N  NH1    . ARG B 2 198 ? 37.794  43.723  -6.618  1.00 54.24  ? 198  ARG B NH1    1 
ATOM   9139  N  NH2    . ARG B 2 198 ? 38.697  43.188  -4.586  1.00 49.14  ? 198  ARG B NH2    1 
ATOM   9140  H  H      . ARG B 2 198 ? 32.435  42.095  -5.879  1.00 45.54  ? 198  ARG B H      1 
ATOM   9141  H  HA     . ARG B 2 198 ? 32.962  40.371  -7.013  1.00 46.62  ? 198  ARG B HA     1 
ATOM   9142  H  HB2    . ARG B 2 198 ? 35.143  40.425  -5.228  1.00 39.72  ? 198  ARG B HB2    1 
ATOM   9143  H  HB3    . ARG B 2 198 ? 35.073  39.381  -6.416  1.00 39.72  ? 198  ARG B HB3    1 
ATOM   9144  H  HG2    . ARG B 2 198 ? 35.188  41.149  -7.950  1.00 40.38  ? 198  ARG B HG2    1 
ATOM   9145  H  HG3    . ARG B 2 198 ? 35.337  42.167  -6.731  1.00 40.38  ? 198  ARG B HG3    1 
ATOM   9146  H  HD2    . ARG B 2 198 ? 37.173  40.059  -7.038  1.00 61.04  ? 198  ARG B HD2    1 
ATOM   9147  H  HD3    . ARG B 2 198 ? 37.408  41.426  -7.805  1.00 61.04  ? 198  ARG B HD3    1 
ATOM   9148  H  HE     . ARG B 2 198 ? 37.891  41.008  -5.210  1.00 47.68  ? 198  ARG B HE     1 
ATOM   9149  H  HH11   . ARG B 2 198 ? 37.386  43.489  -7.338  1.00 65.08  ? 198  ARG B HH11   1 
ATOM   9150  H  HH12   . ARG B 2 198 ? 38.029  44.543  -6.504  1.00 65.08  ? 198  ARG B HH12   1 
ATOM   9151  H  HH21   . ARG B 2 198 ? 38.873  42.606  -3.978  1.00 58.97  ? 198  ARG B HH21   1 
ATOM   9152  H  HH22   . ARG B 2 198 ? 38.928  44.009  -4.475  1.00 58.97  ? 198  ARG B HH22   1 
ATOM   9153  N  N      . LYS B 2 199 ? 31.419  39.070  -5.219  1.00 64.46  ? 199  LYS B N      1 
ATOM   9154  C  CA     . LYS B 2 199 ? 30.726  37.937  -4.611  1.00 59.26  ? 199  LYS B CA     1 
ATOM   9155  C  C      . LYS B 2 199 ? 29.786  37.304  -5.630  1.00 68.08  ? 199  LYS B C      1 
ATOM   9156  O  O      . LYS B 2 199 ? 28.860  36.565  -5.285  1.00 74.07  ? 199  LYS B O      1 
ATOM   9157  C  CB     . LYS B 2 199 ? 29.948  38.384  -3.382  1.00 37.55  ? 199  LYS B CB     1 
ATOM   9158  C  CG     . LYS B 2 199 ? 30.807  38.970  -2.292  1.00 50.97  ? 199  LYS B CG     1 
ATOM   9159  C  CD     . LYS B 2 199 ? 29.928  39.558  -1.208  1.00 75.60  ? 199  LYS B CD     1 
ATOM   9160  C  CE     . LYS B 2 199 ? 30.739  40.212  -0.108  1.00 67.31  ? 199  LYS B CE     1 
ATOM   9161  N  NZ     . LYS B 2 199 ? 29.840  40.877  0.869   1.00 77.79  ? 199  LYS B NZ     1 
ATOM   9162  H  H      . LYS B 2 199 ? 30.895  39.720  -5.426  1.00 77.36  ? 199  LYS B H      1 
ATOM   9163  H  HA     . LYS B 2 199 ? 31.375  37.271  -4.337  1.00 71.11  ? 199  LYS B HA     1 
ATOM   9164  H  HB2    . LYS B 2 199 ? 29.306  39.061  -3.649  1.00 45.05  ? 199  LYS B HB2    1 
ATOM   9165  H  HB3    . LYS B 2 199 ? 29.483  37.618  -3.012  1.00 45.05  ? 199  LYS B HB3    1 
ATOM   9166  H  HG2    . LYS B 2 199 ? 31.356  38.273  -1.900  1.00 61.16  ? 199  LYS B HG2    1 
ATOM   9167  H  HG3    . LYS B 2 199 ? 31.361  39.677  -2.658  1.00 61.16  ? 199  LYS B HG3    1 
ATOM   9168  H  HD2    . LYS B 2 199 ? 29.350  40.232  -1.598  1.00 90.72  ? 199  LYS B HD2    1 
ATOM   9169  H  HD3    . LYS B 2 199 ? 29.396  38.851  -0.812  1.00 90.72  ? 199  LYS B HD3    1 
ATOM   9170  H  HE2    . LYS B 2 199 ? 31.255  39.536  0.360   1.00 80.77  ? 199  LYS B HE2    1 
ATOM   9171  H  HE3    . LYS B 2 199 ? 31.326  40.882  -0.492  1.00 80.77  ? 199  LYS B HE3    1 
ATOM   9172  H  HZ1    . LYS B 2 199 ? 29.292  40.279  1.234   1.00 93.35  ? 199  LYS B HZ1    1 
ATOM   9173  H  HZ2    . LYS B 2 199 ? 30.321  41.260  1.513   1.00 93.35  ? 199  LYS B HZ2    1 
ATOM   9174  H  HZ3    . LYS B 2 199 ? 29.356  41.502  0.460   1.00 93.35  ? 199  LYS B HZ3    1 
ATOM   9175  N  N      . VAL B 2 200 ? 30.044  37.603  -6.894  1.00 51.28  ? 200  VAL B N      1 
ATOM   9176  C  CA     . VAL B 2 200 ? 29.284  37.032  -7.983  1.00 50.31  ? 200  VAL B CA     1 
ATOM   9177  C  C      . VAL B 2 200 ? 30.151  37.101  -9.215  1.00 48.96  ? 200  VAL B C      1 
ATOM   9178  O  O      . VAL B 2 200 ? 31.111  37.867  -9.253  1.00 46.32  ? 200  VAL B O      1 
ATOM   9179  C  CB     . VAL B 2 200 ? 27.972  37.789  -8.223  1.00 50.55  ? 200  VAL B CB     1 
ATOM   9180  C  CG1    . VAL B 2 200 ? 28.226  39.109  -8.956  1.00 47.06  ? 200  VAL B CG1    1 
ATOM   9181  C  CG2    . VAL B 2 200 ? 27.003  36.935  -9.003  1.00 68.68  ? 200  VAL B CG2    1 
ATOM   9182  H  H      . VAL B 2 200 ? 30.664  38.143  -7.146  1.00 61.54  ? 200  VAL B H      1 
ATOM   9183  H  HA     . VAL B 2 200 ? 29.080  36.103  -7.793  1.00 60.37  ? 200  VAL B HA     1 
ATOM   9184  H  HB     . VAL B 2 200 ? 27.566  37.996  -7.366  1.00 60.66  ? 200  VAL B HB     1 
ATOM   9185  H  HG11   . VAL B 2 200 ? 28.641  38.919  -9.812  1.00 56.47  ? 200  VAL B HG11   1 
ATOM   9186  H  HG12   . VAL B 2 200 ? 27.379  39.562  -9.092  1.00 56.47  ? 200  VAL B HG12   1 
ATOM   9187  H  HG13   . VAL B 2 200 ? 28.814  39.660  -8.418  1.00 56.47  ? 200  VAL B HG13   1 
ATOM   9188  H  HG21   . VAL B 2 200 ? 26.818  36.127  -8.499  1.00 82.42  ? 200  VAL B HG21   1 
ATOM   9189  H  HG22   . VAL B 2 200 ? 26.183  37.434  -9.142  1.00 82.42  ? 200  VAL B HG22   1 
ATOM   9190  H  HG23   . VAL B 2 200 ? 27.401  36.708  -9.858  1.00 82.42  ? 200  VAL B HG23   1 
ATOM   9191  N  N      . TYR B 2 201 ? 29.819  36.296  -10.216 1.00 41.75  ? 201  TYR B N      1 
ATOM   9192  C  CA     . TYR B 2 201 ? 30.572  36.277  -11.459 1.00 43.26  ? 201  TYR B CA     1 
ATOM   9193  C  C      . TYR B 2 201 ? 29.938  37.187  -12.511 1.00 43.83  ? 201  TYR B C      1 
ATOM   9194  O  O      . TYR B 2 201 ? 28.717  37.247  -12.609 1.00 52.26  ? 201  TYR B O      1 
ATOM   9195  C  CB     . TYR B 2 201 ? 30.656  34.846  -11.966 1.00 40.90  ? 201  TYR B CB     1 
ATOM   9196  C  CG     . TYR B 2 201 ? 31.305  34.713  -13.310 1.00 45.77  ? 201  TYR B CG     1 
ATOM   9197  C  CD1    . TYR B 2 201 ? 32.677  34.813  -13.426 1.00 45.79  ? 201  TYR B CD1    1 
ATOM   9198  C  CD2    . TYR B 2 201 ? 30.566  34.426  -14.452 1.00 39.79  ? 201  TYR B CD2    1 
ATOM   9199  C  CE1    . TYR B 2 201 ? 33.302  34.679  -14.637 1.00 51.92  ? 201  TYR B CE1    1 
ATOM   9200  C  CE2    . TYR B 2 201 ? 31.187  34.283  -15.681 1.00 42.87  ? 201  TYR B CE2    1 
ATOM   9201  C  CZ     . TYR B 2 201 ? 32.561  34.410  -15.761 1.00 45.12  ? 201  TYR B CZ     1 
ATOM   9202  O  OH     . TYR B 2 201 ? 33.207  34.274  -16.966 1.00 66.41  ? 201  TYR B OH     1 
ATOM   9203  H  H      . TYR B 2 201 ? 29.157  35.747  -10.198 1.00 50.10  ? 201  TYR B H      1 
ATOM   9204  H  HA     . TYR B 2 201 ? 31.474  36.592  -11.291 1.00 51.91  ? 201  TYR B HA     1 
ATOM   9205  H  HB2    . TYR B 2 201 ? 31.172  34.321  -11.334 1.00 49.08  ? 201  TYR B HB2    1 
ATOM   9206  H  HB3    . TYR B 2 201 ? 29.757  34.486  -12.034 1.00 49.08  ? 201  TYR B HB3    1 
ATOM   9207  H  HD1    . TYR B 2 201 ? 33.185  34.997  -12.669 1.00 54.95  ? 201  TYR B HD1    1 
ATOM   9208  H  HD2    . TYR B 2 201 ? 29.641  34.344  -14.392 1.00 47.75  ? 201  TYR B HD2    1 
ATOM   9209  H  HE1    . TYR B 2 201 ? 34.227  34.761  -14.697 1.00 62.30  ? 201  TYR B HE1    1 
ATOM   9210  H  HE2    . TYR B 2 201 ? 30.686  34.103  -16.443 1.00 51.45  ? 201  TYR B HE2    1 
ATOM   9211  H  HH     . TYR B 2 201 ? 32.651  34.111  -17.574 1.00 79.69  ? 201  TYR B HH     1 
ATOM   9212  N  N      . LEU B 2 202 ? 30.754  37.887  -13.297 1.00 38.14  ? 202  LEU B N      1 
ATOM   9213  C  CA     . LEU B 2 202 ? 30.216  38.740  -14.362 1.00 49.08  ? 202  LEU B CA     1 
ATOM   9214  C  C      . LEU B 2 202 ? 30.796  38.416  -15.734 1.00 59.35  ? 202  LEU B C      1 
ATOM   9215  O  O      . LEU B 2 202 ? 32.011  38.300  -15.901 1.00 64.37  ? 202  LEU B O      1 
ATOM   9216  C  CB     . LEU B 2 202 ? 30.449  40.225  -14.083 1.00 34.27  ? 202  LEU B CB     1 
ATOM   9217  C  CG     . LEU B 2 202 ? 30.087  40.797  -12.723 1.00 37.86  ? 202  LEU B CG     1 
ATOM   9218  C  CD1    . LEU B 2 202 ? 30.546  42.248  -12.694 1.00 43.23  ? 202  LEU B CD1    1 
ATOM   9219  C  CD2    . LEU B 2 202 ? 28.605  40.662  -12.416 1.00 32.58  ? 202  LEU B CD2    1 
ATOM   9220  H  H      . LEU B 2 202 ? 31.612  37.889  -13.238 1.00 45.77  ? 202  LEU B H      1 
ATOM   9221  H  HA     . LEU B 2 202 ? 29.257  38.599  -14.411 1.00 58.90  ? 202  LEU B HA     1 
ATOM   9222  H  HB2    . LEU B 2 202 ? 31.393  40.403  -14.216 1.00 41.13  ? 202  LEU B HB2    1 
ATOM   9223  H  HB3    . LEU B 2 202 ? 29.941  40.729  -14.739 1.00 41.13  ? 202  LEU B HB3    1 
ATOM   9224  H  HG     . LEU B 2 202 ? 30.578  40.316  -12.039 1.00 45.44  ? 202  LEU B HG     1 
ATOM   9225  H  HD11   . LEU B 2 202 ? 30.094  42.736  -13.400 1.00 51.88  ? 202  LEU B HD11   1 
ATOM   9226  H  HD12   . LEU B 2 202 ? 30.323  42.631  -11.831 1.00 51.88  ? 202  LEU B HD12   1 
ATOM   9227  H  HD13   . LEU B 2 202 ? 31.506  42.278  -12.832 1.00 51.88  ? 202  LEU B HD13   1 
ATOM   9228  H  HD21   . LEU B 2 202 ? 28.366  39.722  -12.424 1.00 39.09  ? 202  LEU B HD21   1 
ATOM   9229  H  HD22   . LEU B 2 202 ? 28.429  41.041  -11.541 1.00 39.09  ? 202  LEU B HD22   1 
ATOM   9230  H  HD23   . LEU B 2 202 ? 28.098  41.139  -13.092 1.00 39.09  ? 202  LEU B HD23   1 
ATOM   9231  N  N      . GLU B 2 203 ? 29.905  38.279  -16.712 1.00 52.09  ? 203  GLU B N      1 
ATOM   9232  C  CA     . GLU B 2 203 ? 30.302  38.107  -18.101 1.00 53.26  ? 203  GLU B CA     1 
ATOM   9233  C  C      . GLU B 2 203 ? 29.411  38.976  -18.984 1.00 52.02  ? 203  GLU B C      1 
ATOM   9234  O  O      . GLU B 2 203 ? 28.186  38.870  -18.934 1.00 64.38  ? 203  GLU B O      1 
ATOM   9235  C  CB     . GLU B 2 203 ? 30.197  36.637  -18.509 1.00 58.15  ? 203  GLU B CB     1 
ATOM   9236  C  CG     . GLU B 2 203 ? 31.112  36.230  -19.649 1.00 64.89  ? 203  GLU B CG     1 
ATOM   9237  C  CD     . GLU B 2 203 ? 31.056  34.738  -19.933 1.00 85.06  ? 203  GLU B CD     1 
ATOM   9238  O  OE1    . GLU B 2 203 ? 31.310  33.947  -19.001 1.00 76.36  ? 203  GLU B OE1    1 
ATOM   9239  O  OE2    . GLU B 2 203 ? 30.750  34.356  -21.085 1.00 80.13  ? 203  GLU B OE2    1 
ATOM   9240  H  H      . GLU B 2 203 ? 29.053  38.283  -16.592 1.00 62.51  ? 203  GLU B H      1 
ATOM   9241  H  HA     . GLU B 2 203 ? 31.222  38.393  -18.213 1.00 63.91  ? 203  GLU B HA     1 
ATOM   9242  H  HB2    . GLU B 2 203 ? 30.419  36.086  -17.742 1.00 69.78  ? 203  GLU B HB2    1 
ATOM   9243  H  HB3    . GLU B 2 203 ? 29.284  36.458  -18.786 1.00 69.78  ? 203  GLU B HB3    1 
ATOM   9244  H  HG2    . GLU B 2 203 ? 30.843  36.700  -20.455 1.00 77.87  ? 203  GLU B HG2    1 
ATOM   9245  H  HG3    . GLU B 2 203 ? 32.026  36.459  -19.420 1.00 77.87  ? 203  GLU B HG3    1 
ATOM   9246  N  N      . ASP B 2 204 ? 30.044  39.830  -19.786 1.00 59.33  ? 204  ASP B N      1 
ATOM   9247  C  CA     . ASP B 2 204 ? 29.365  40.669  -20.778 1.00 53.32  ? 204  ASP B CA     1 
ATOM   9248  C  C      . ASP B 2 204 ? 28.167  41.432  -20.193 1.00 53.97  ? 204  ASP B C      1 
ATOM   9249  O  O      . ASP B 2 204 ? 27.123  41.541  -20.841 1.00 49.20  ? 204  ASP B O      1 
ATOM   9250  C  CB     . ASP B 2 204 ? 28.928  39.839  -21.987 1.00 48.33  ? 204  ASP B CB     1 
ATOM   9251  C  CG     . ASP B 2 204 ? 28.643  40.700  -23.210 1.00 68.94  ? 204  ASP B CG     1 
ATOM   9252  O  OD1    . ASP B 2 204 ? 29.615  41.156  -23.849 1.00 67.67  ? 204  ASP B OD1    1 
ATOM   9253  O  OD2    . ASP B 2 204 ? 27.457  40.921  -23.535 1.00 86.16  ? 204  ASP B OD2    1 
ATOM   9254  H  H      . ASP B 2 204 ? 30.896  39.945  -19.775 1.00 71.20  ? 204  ASP B H      1 
ATOM   9255  H  HA     . ASP B 2 204 ? 29.997  41.331  -21.098 1.00 63.99  ? 204  ASP B HA     1 
ATOM   9256  H  HB2    . ASP B 2 204 ? 29.634  39.216  -22.216 1.00 58.00  ? 204  ASP B HB2    1 
ATOM   9257  H  HB3    . ASP B 2 204 ? 28.117  39.356  -21.764 1.00 58.00  ? 204  ASP B HB3    1 
ATOM   9258  N  N      . GLY B 2 205 ? 28.309  41.917  -18.960 1.00 46.81  ? 205  GLY B N      1 
ATOM   9259  C  CA     . GLY B 2 205 ? 27.304  42.773  -18.350 1.00 36.06  ? 205  GLY B CA     1 
ATOM   9260  C  C      . GLY B 2 205 ? 26.256  42.061  -17.516 1.00 46.21  ? 205  GLY B C      1 
ATOM   9261  O  O      . GLY B 2 205 ? 25.378  42.698  -16.937 1.00 53.66  ? 205  GLY B O      1 
ATOM   9262  H  H      . GLY B 2 205 ? 28.987  41.761  -18.454 1.00 56.18  ? 205  GLY B H      1 
ATOM   9263  H  HA2    . GLY B 2 205 ? 27.749  43.419  -17.779 1.00 43.27  ? 205  GLY B HA2    1 
ATOM   9264  H  HA3    . GLY B 2 205 ? 26.844  43.262  -19.051 1.00 43.27  ? 205  GLY B HA3    1 
ATOM   9265  N  N      . PHE B 2 206 ? 26.323  40.736  -17.481 1.00 49.57  ? 206  PHE B N      1 
ATOM   9266  C  CA     . PHE B 2 206 ? 25.365  39.943  -16.718 1.00 60.24  ? 206  PHE B CA     1 
ATOM   9267  C  C      . PHE B 2 206 ? 26.007  39.221  -15.551 1.00 55.88  ? 206  PHE B C      1 
ATOM   9268  O  O      . PHE B 2 206 ? 27.094  38.657  -15.681 1.00 50.40  ? 206  PHE B O      1 
ATOM   9269  C  CB     . PHE B 2 206 ? 24.678  38.949  -17.653 1.00 65.49  ? 206  PHE B CB     1 
ATOM   9270  C  CG     . PHE B 2 206 ? 23.811  39.611  -18.674 1.00 67.79  ? 206  PHE B CG     1 
ATOM   9271  C  CD1    . PHE B 2 206 ? 22.505  39.958  -18.367 1.00 63.46  ? 206  PHE B CD1    1 
ATOM   9272  C  CD2    . PHE B 2 206 ? 24.321  39.955  -19.916 1.00 48.52  ? 206  PHE B CD2    1 
ATOM   9273  C  CE1    . PHE B 2 206 ? 21.711  40.594  -19.295 1.00 77.96  ? 206  PHE B CE1    1 
ATOM   9274  C  CE2    . PHE B 2 206 ? 23.532  40.594  -20.848 1.00 59.13  ? 206  PHE B CE2    1 
ATOM   9275  C  CZ     . PHE B 2 206 ? 22.225  40.916  -20.538 1.00 85.70  ? 206  PHE B CZ     1 
ATOM   9276  H  H      . PHE B 2 206 ? 26.916  40.269  -17.892 1.00 59.49  ? 206  PHE B H      1 
ATOM   9277  H  HA     . PHE B 2 206 ? 24.684  40.535  -16.362 1.00 72.29  ? 206  PHE B HA     1 
ATOM   9278  H  HB2    . PHE B 2 206 ? 25.355  38.437  -18.122 1.00 78.58  ? 206  PHE B HB2    1 
ATOM   9279  H  HB3    . PHE B 2 206 ? 24.120  38.355  -17.126 1.00 78.58  ? 206  PHE B HB3    1 
ATOM   9280  H  HD1    . PHE B 2 206 ? 22.155  39.742  -17.533 1.00 76.15  ? 206  PHE B HD1    1 
ATOM   9281  H  HD2    . PHE B 2 206 ? 25.200  39.739  -20.128 1.00 58.23  ? 206  PHE B HD2    1 
ATOM   9282  H  HE1    . PHE B 2 206 ? 20.832  40.810  -19.085 1.00 93.56  ? 206  PHE B HE1    1 
ATOM   9283  H  HE2    . PHE B 2 206 ? 23.880  40.807  -21.684 1.00 70.95  ? 206  PHE B HE2    1 
ATOM   9284  H  HZ     . PHE B 2 206 ? 21.690  41.344  -21.167 1.00 102.84 ? 206  PHE B HZ     1 
ATOM   9285  N  N      . ALA B 2 207 ? 25.320  39.238  -14.412 1.00 60.11  ? 207  ALA B N      1 
ATOM   9286  C  CA     . ALA B 2 207 ? 25.757  38.485  -13.247 1.00 46.12  ? 207  ALA B CA     1 
ATOM   9287  C  C      . ALA B 2 207 ? 25.216  37.072  -13.376 1.00 54.82  ? 207  ALA B C      1 
ATOM   9288  O  O      . ALA B 2 207 ? 24.283  36.836  -14.136 1.00 90.31  ? 207  ALA B O      1 
ATOM   9289  C  CB     . ALA B 2 207 ? 25.264  39.138  -11.963 1.00 43.26  ? 207  ALA B CB     1 
ATOM   9290  H  H      . ALA B 2 207 ? 24.594  39.683  -14.290 1.00 72.13  ? 207  ALA B H      1 
ATOM   9291  H  HA     . ALA B 2 207 ? 26.726  38.447  -13.226 1.00 55.35  ? 207  ALA B HA     1 
ATOM   9292  H  HB1    . ALA B 2 207 ? 24.294  39.166  -11.976 1.00 51.91  ? 207  ALA B HB1    1 
ATOM   9293  H  HB2    . ALA B 2 207 ? 25.570  38.614  -11.206 1.00 51.91  ? 207  ALA B HB2    1 
ATOM   9294  H  HB3    . ALA B 2 207 ? 25.620  40.038  -11.909 1.00 51.91  ? 207  ALA B HB3    1 
ATOM   9295  N  N      . TYR B 2 208 ? 25.799  36.134  -12.642 1.00 49.42  ? 208  TYR B N      1 
ATOM   9296  C  CA     . TYR B 2 208 ? 25.332  34.755  -12.659 1.00 41.92  ? 208  TYR B CA     1 
ATOM   9297  C  C      . TYR B 2 208 ? 25.120  34.368  -11.216 1.00 51.39  ? 208  TYR B C      1 
ATOM   9298  O  O      . TYR B 2 208 ? 26.036  33.890  -10.554 1.00 57.81  ? 208  TYR B O      1 
ATOM   9299  C  CB     . TYR B 2 208 ? 26.340  33.835  -13.340 1.00 42.00  ? 208  TYR B CB     1 
ATOM   9300  C  CG     . TYR B 2 208 ? 26.403  34.020  -14.837 1.00 57.12  ? 208  TYR B CG     1 
ATOM   9301  C  CD1    . TYR B 2 208 ? 27.106  35.080  -15.384 1.00 56.90  ? 208  TYR B CD1    1 
ATOM   9302  C  CD2    . TYR B 2 208 ? 25.754  33.149  -15.702 1.00 68.00  ? 208  TYR B CD2    1 
ATOM   9303  C  CE1    . TYR B 2 208 ? 27.171  35.267  -16.746 1.00 62.84  ? 208  TYR B CE1    1 
ATOM   9304  C  CE2    . TYR B 2 208 ? 25.814  33.328  -17.073 1.00 62.73  ? 208  TYR B CE2    1 
ATOM   9305  C  CZ     . TYR B 2 208 ? 26.524  34.391  -17.588 1.00 72.51  ? 208  TYR B CZ     1 
ATOM   9306  O  OH     . TYR B 2 208 ? 26.592  34.585  -18.949 1.00 82.01  ? 208  TYR B OH     1 
ATOM   9307  H  H      . TYR B 2 208 ? 26.470  36.271  -12.122 1.00 59.30  ? 208  TYR B H      1 
ATOM   9308  H  HA     . TYR B 2 208 ? 24.485  34.698  -13.129 1.00 50.31  ? 208  TYR B HA     1 
ATOM   9309  H  HB2    . TYR B 2 208 ? 27.222  34.014  -12.980 1.00 50.40  ? 208  TYR B HB2    1 
ATOM   9310  H  HB3    . TYR B 2 208 ? 26.092  32.913  -13.164 1.00 50.40  ? 208  TYR B HB3    1 
ATOM   9311  H  HD1    . TYR B 2 208 ? 25.275  32.432  -15.355 1.00 81.60  ? 208  TYR B HD1    1 
ATOM   9312  H  HD2    . TYR B 2 208 ? 27.545  35.675  -14.820 1.00 68.28  ? 208  TYR B HD2    1 
ATOM   9313  H  HE1    . TYR B 2 208 ? 25.376  32.737  -17.643 1.00 75.27  ? 208  TYR B HE1    1 
ATOM   9314  H  HE2    . TYR B 2 208 ? 27.650  35.983  -17.097 1.00 75.41  ? 208  TYR B HE2    1 
ATOM   9315  H  HH     . TYR B 2 208 ? 27.054  35.265  -19.119 1.00 98.41  ? 208  TYR B HH     1 
ATOM   9316  N  N      . VAL B 2 209 ? 23.901  34.562  -10.736 1.00 55.51  ? 209  VAL B N      1 
ATOM   9317  C  CA     . VAL B 2 209 ? 23.651  34.531  -9.306  1.00 54.23  ? 209  VAL B CA     1 
ATOM   9318  C  C      . VAL B 2 209 ? 22.968  33.231  -8.923  1.00 78.83  ? 209  VAL B C      1 
ATOM   9319  O  O      . VAL B 2 209 ? 22.008  32.829  -9.575  1.00 78.32  ? 209  VAL B O      1 
ATOM   9320  C  CB     . VAL B 2 209 ? 22.763  35.711  -8.869  1.00 65.42  ? 209  VAL B CB     1 
ATOM   9321  C  CG1    . VAL B 2 209 ? 22.738  35.824  -7.354  1.00 77.64  ? 209  VAL B CG1    1 
ATOM   9322  C  CG2    . VAL B 2 209 ? 23.254  37.012  -9.492  1.00 68.71  ? 209  VAL B CG2    1 
ATOM   9323  H  H      . VAL B 2 209 ? 23.203  34.713  -11.216 1.00 66.61  ? 209  VAL B H      1 
ATOM   9324  H  HA     . VAL B 2 209 ? 24.494  34.587  -8.830  1.00 65.07  ? 209  VAL B HA     1 
ATOM   9325  H  HB     . VAL B 2 209 ? 21.856  35.555  -9.174  1.00 78.51  ? 209  VAL B HB     1 
ATOM   9326  H  HG11   . VAL B 2 209 ? 23.642  35.968  -7.033  1.00 93.17  ? 209  VAL B HG11   1 
ATOM   9327  H  HG12   . VAL B 2 209 ? 22.175  36.573  -7.103  1.00 93.17  ? 209  VAL B HG12   1 
ATOM   9328  H  HG13   . VAL B 2 209 ? 22.382  35.002  -6.982  1.00 93.17  ? 209  VAL B HG13   1 
ATOM   9329  H  HG21   . VAL B 2 209 ? 23.222  36.930  -10.458 1.00 82.45  ? 209  VAL B HG21   1 
ATOM   9330  H  HG22   . VAL B 2 209 ? 22.679  37.737  -9.201  1.00 82.45  ? 209  VAL B HG22   1 
ATOM   9331  H  HG23   . VAL B 2 209 ? 24.166  37.175  -9.204  1.00 82.45  ? 209  VAL B HG23   1 
ATOM   9332  N  N      . PRO B 2 210 ? 23.448  32.573  -7.853  1.00 91.35  ? 210  PRO B N      1 
ATOM   9333  C  CA     . PRO B 2 210 ? 22.716  31.399  -7.370  1.00 91.63  ? 210  PRO B CA     1 
ATOM   9334  C  C      . PRO B 2 210 ? 21.341  31.769  -6.841  1.00 99.21  ? 210  PRO B C      1 
ATOM   9335  O  O      . PRO B 2 210 ? 20.956  32.937  -6.862  1.00 104.03 ? 210  PRO B O      1 
ATOM   9336  C  CB     . PRO B 2 210 ? 23.608  30.861  -6.244  1.00 87.18  ? 210  PRO B CB     1 
ATOM   9337  C  CG     . PRO B 2 210 ? 24.959  31.408  -6.526  1.00 82.80  ? 210  PRO B CG     1 
ATOM   9338  C  CD     . PRO B 2 210 ? 24.729  32.747  -7.145  1.00 80.92  ? 210  PRO B CD     1 
ATOM   9339  H  HA     . PRO B 2 210 ? 22.633  30.733  -8.071  1.00 109.96 ? 210  PRO B HA     1 
ATOM   9340  H  HB2    . PRO B 2 210 ? 23.281  31.179  -5.388  1.00 104.62 ? 210  PRO B HB2    1 
ATOM   9341  H  HB3    . PRO B 2 210 ? 23.617  29.891  -6.270  1.00 104.62 ? 210  PRO B HB3    1 
ATOM   9342  H  HG2    . PRO B 2 210 ? 25.455  31.495  -5.697  1.00 99.36  ? 210  PRO B HG2    1 
ATOM   9343  H  HG3    . PRO B 2 210 ? 25.425  30.822  -7.143  1.00 99.36  ? 210  PRO B HG3    1 
ATOM   9344  H  HD2    . PRO B 2 210 ? 24.647  33.428  -6.459  1.00 97.11  ? 210  PRO B HD2    1 
ATOM   9345  H  HD3    . PRO B 2 210 ? 25.437  32.957  -7.773  1.00 97.11  ? 210  PRO B HD3    1 
ATOM   9346  N  N      . LEU B 2 211 ? 20.614  30.776  -6.352  1.00 99.87  ? 211  LEU B N      1 
ATOM   9347  C  CA     . LEU B 2 211 ? 19.312  31.019  -5.761  1.00 98.27  ? 211  LEU B CA     1 
ATOM   9348  C  C      . LEU B 2 211 ? 19.561  31.443  -4.325  1.00 106.58 ? 211  LEU B C      1 
ATOM   9349  O  O      . LEU B 2 211 ? 18.795  32.209  -3.757  1.00 93.30  ? 211  LEU B O      1 
ATOM   9350  C  CB     . LEU B 2 211 ? 18.423  29.777  -5.832  1.00 102.33 ? 211  LEU B CB     1 
ATOM   9351  C  CG     . LEU B 2 211 ? 16.987  29.916  -5.315  1.00 105.09 ? 211  LEU B CG     1 
ATOM   9352  C  CD1    . LEU B 2 211 ? 16.189  30.933  -6.117  1.00 85.16  ? 211  LEU B CD1    1 
ATOM   9353  C  CD2    . LEU B 2 211 ? 16.294  28.564  -5.340  1.00 114.91 ? 211  LEU B CD2    1 
ATOM   9354  H  H      . LEU B 2 211 ? 20.855  29.950  -6.351  1.00 119.84 ? 211  LEU B H      1 
ATOM   9355  H  HA     . LEU B 2 211 ? 18.871  31.745  -6.229  1.00 117.93 ? 211  LEU B HA     1 
ATOM   9356  H  HB2    . LEU B 2 211 ? 18.367  29.500  -6.760  1.00 122.79 ? 211  LEU B HB2    1 
ATOM   9357  H  HB3    . LEU B 2 211 ? 18.846  29.074  -5.315  1.00 122.79 ? 211  LEU B HB3    1 
ATOM   9358  H  HG     . LEU B 2 211 ? 17.014  30.219  -4.394  1.00 126.10 ? 211  LEU B HG     1 
ATOM   9359  H  HD11   . LEU B 2 211 ? 16.155  30.648  -7.043  1.00 102.19 ? 211  LEU B HD11   1 
ATOM   9360  H  HD12   . LEU B 2 211 ? 15.291  30.987  -5.754  1.00 102.19 ? 211  LEU B HD12   1 
ATOM   9361  H  HD13   . LEU B 2 211 ? 16.624  31.798  -6.052  1.00 102.19 ? 211  LEU B HD13   1 
ATOM   9362  H  HD21   . LEU B 2 211 ? 16.784  27.948  -4.774  1.00 137.89 ? 211  LEU B HD21   1 
ATOM   9363  H  HD22   . LEU B 2 211 ? 15.388  28.668  -5.011  1.00 137.89 ? 211  LEU B HD22   1 
ATOM   9364  H  HD23   . LEU B 2 211 ? 16.279  28.235  -6.253  1.00 137.89 ? 211  LEU B HD23   1 
ATOM   9365  N  N      . LYS B 2 212 ? 20.639  30.931  -3.740  1.00 113.75 ? 212  LYS B N      1 
ATOM   9366  C  CA     . LYS B 2 212 ? 20.990  31.273  -2.370  1.00 109.18 ? 212  LYS B CA     1 
ATOM   9367  C  C      . LYS B 2 212 ? 21.286  32.771  -2.237  1.00 115.62 ? 212  LYS B C      1 
ATOM   9368  O  O      . LYS B 2 212 ? 21.032  33.358  -1.184  1.00 120.62 ? 212  LYS B O      1 
ATOM   9369  C  CB     . LYS B 2 212 ? 22.191  30.442  -1.906  1.00 107.72 ? 212  LYS B CB     1 
ATOM   9370  C  CG     . LYS B 2 212 ? 22.480  30.551  -0.416  1.00 129.37 ? 212  LYS B CG     1 
ATOM   9371  C  CD     . LYS B 2 212 ? 23.582  29.591  0.018   1.00 137.56 ? 212  LYS B CD     1 
ATOM   9372  C  CE     . LYS B 2 212 ? 23.848  29.695  1.514   1.00 111.26 ? 212  LYS B CE     1 
ATOM   9373  N  NZ     . LYS B 2 212 ? 24.964  28.815  1.961   1.00 79.55  ? 212  LYS B NZ     1 
ATOM   9374  H  H      . LYS B 2 212 ? 21.184  30.383  -4.117  1.00 136.50 ? 212  LYS B H      1 
ATOM   9375  H  HA     . LYS B 2 212 ? 20.240  31.063  -1.791  1.00 131.01 ? 212  LYS B HA     1 
ATOM   9376  H  HB2    . LYS B 2 212 ? 22.021  29.509  -2.108  1.00 129.27 ? 212  LYS B HB2    1 
ATOM   9377  H  HB3    . LYS B 2 212 ? 22.980  30.742  -2.384  1.00 129.27 ? 212  LYS B HB3    1 
ATOM   9378  H  HG2    . LYS B 2 212 ? 22.767  31.454  -0.212  1.00 155.24 ? 212  LYS B HG2    1 
ATOM   9379  H  HG3    . LYS B 2 212 ? 21.676  30.334  0.081   1.00 155.24 ? 212  LYS B HG3    1 
ATOM   9380  H  HD2    . LYS B 2 212 ? 23.311  28.681  -0.181  1.00 165.07 ? 212  LYS B HD2    1 
ATOM   9381  H  HD3    . LYS B 2 212 ? 24.401  29.809  -0.453  1.00 165.07 ? 212  LYS B HD3    1 
ATOM   9382  H  HE2    . LYS B 2 212 ? 24.083  30.611  1.730   1.00 133.51 ? 212  LYS B HE2    1 
ATOM   9383  H  HE3    . LYS B 2 212 ? 23.048  29.435  1.996   1.00 133.51 ? 212  LYS B HE3    1 
ATOM   9384  H  HZ1    . LYS B 2 212 ? 25.715  29.037  1.538   1.00 95.46  ? 212  LYS B HZ1    1 
ATOM   9385  H  HZ2    . LYS B 2 212 ? 25.088  28.904  2.838   1.00 95.46  ? 212  LYS B HZ2    1 
ATOM   9386  H  HZ3    . LYS B 2 212 ? 24.771  27.965  1.781   1.00 95.46  ? 212  LYS B HZ3    1 
ATOM   9387  N  N      . ASP B 2 213 ? 21.809  33.389  -3.298  1.00 110.06 ? 213  ASP B N      1 
ATOM   9388  C  CA     . ASP B 2 213 ? 22.214  34.799  -3.239  1.00 107.80 ? 213  ASP B CA     1 
ATOM   9389  C  C      . ASP B 2 213 ? 21.165  35.733  -3.830  1.00 106.05 ? 213  ASP B C      1 
ATOM   9390  O  O      . ASP B 2 213 ? 21.161  36.927  -3.530  1.00 107.95 ? 213  ASP B O      1 
ATOM   9391  C  CB     . ASP B 2 213 ? 23.543  35.038  -3.966  1.00 92.22  ? 213  ASP B CB     1 
ATOM   9392  C  CG     . ASP B 2 213 ? 24.700  34.280  -3.350  1.00 103.59 ? 213  ASP B CG     1 
ATOM   9393  O  OD1    . ASP B 2 213 ? 24.723  34.121  -2.111  1.00 111.91 ? 213  ASP B OD1    1 
ATOM   9394  O  OD2    . ASP B 2 213 ? 25.606  33.870  -4.105  1.00 91.35  ? 213  ASP B OD2    1 
ATOM   9395  H  H      . ASP B 2 213 ? 21.941  33.017  -4.062  1.00 132.08 ? 213  ASP B H      1 
ATOM   9396  H  HA     . ASP B 2 213 ? 22.338  35.046  -2.309  1.00 129.37 ? 213  ASP B HA     1 
ATOM   9397  H  HB2    . ASP B 2 213 ? 23.453  34.750  -4.888  1.00 110.66 ? 213  ASP B HB2    1 
ATOM   9398  H  HB3    . ASP B 2 213 ? 23.754  35.984  -3.934  1.00 110.66 ? 213  ASP B HB3    1 
ATOM   9399  N  N      . ILE B 2 214 ? 20.275  35.204  -4.665  1.00 107.79 ? 214  ILE B N      1 
ATOM   9400  C  CA     . ILE B 2 214 ? 19.225  36.035  -5.241  1.00 94.25  ? 214  ILE B CA     1 
ATOM   9401  C  C      . ILE B 2 214 ? 18.212  36.397  -4.165  1.00 101.57 ? 214  ILE B C      1 
ATOM   9402  O  O      . ILE B 2 214 ? 17.416  37.320  -4.333  1.00 96.41  ? 214  ILE B O      1 
ATOM   9403  C  CB     . ILE B 2 214 ? 18.521  35.334  -6.417  1.00 95.04  ? 214  ILE B CB     1 
ATOM   9404  C  CG1    . ILE B 2 214 ? 17.996  36.373  -7.408  1.00 100.60 ? 214  ILE B CG1    1 
ATOM   9405  C  CG2    . ILE B 2 214 ? 17.407  34.402  -5.917  1.00 115.72 ? 214  ILE B CG2    1 
ATOM   9406  C  CD1    . ILE B 2 214 ? 17.245  35.776  -8.569  1.00 113.32 ? 214  ILE B CD1    1 
ATOM   9407  H  H      . ILE B 2 214 ? 20.257  34.380  -4.911  1.00 129.35 ? 214  ILE B H      1 
ATOM   9408  H  HA     . ILE B 2 214 ? 19.619  36.858  -5.573  1.00 113.09 ? 214  ILE B HA     1 
ATOM   9409  H  HB     . ILE B 2 214 ? 19.179  34.790  -6.877  1.00 114.05 ? 214  ILE B HB     1 
ATOM   9410  H  HG12   . ILE B 2 214 ? 17.393  36.973  -6.942  1.00 120.72 ? 214  ILE B HG12   1 
ATOM   9411  H  HG13   . ILE B 2 214 ? 18.747  36.872  -7.765  1.00 120.72 ? 214  ILE B HG13   1 
ATOM   9412  H  HG21   . ILE B 2 214 ? 16.754  34.926  -5.426  1.00 138.86 ? 214  ILE B HG21   1 
ATOM   9413  H  HG22   . ILE B 2 214 ? 16.985  33.977  -6.680  1.00 138.86 ? 214  ILE B HG22   1 
ATOM   9414  H  HG23   . ILE B 2 214 ? 17.795  33.729  -5.336  1.00 138.86 ? 214  ILE B HG23   1 
ATOM   9415  H  HD11   . ILE B 2 214 ? 16.483  35.281  -8.231  1.00 135.99 ? 214  ILE B HD11   1 
ATOM   9416  H  HD12   . ILE B 2 214 ? 16.945  36.491  -9.152  1.00 135.99 ? 214  ILE B HD12   1 
ATOM   9417  H  HD13   . ILE B 2 214 ? 17.837  35.180  -9.055  1.00 135.99 ? 214  ILE B HD13   1 
ATOM   9418  N  N      . VAL B 2 215 ? 18.252  35.662  -3.059  1.00 112.71 ? 215  VAL B N      1 
ATOM   9419  C  CA     . VAL B 2 215 ? 17.423  35.967  -1.904  1.00 115.94 ? 215  VAL B CA     1 
ATOM   9420  C  C      . VAL B 2 215 ? 17.853  37.313  -1.354  1.00 112.88 ? 215  VAL B C      1 
ATOM   9421  O  O      . VAL B 2 215 ? 17.037  38.212  -1.160  1.00 118.16 ? 215  VAL B O      1 
ATOM   9422  C  CB     . VAL B 2 215 ? 17.534  34.899  -0.793  1.00 124.12 ? 215  VAL B CB     1 
ATOM   9423  C  CG1    . VAL B 2 215 ? 16.639  35.249  0.388   1.00 124.50 ? 215  VAL B CG1    1 
ATOM   9424  C  CG2    . VAL B 2 215 ? 17.187  33.529  -1.330  1.00 128.47 ? 215  VAL B CG2    1 
ATOM   9425  H  H      . VAL B 2 215 ? 18.757  34.974  -2.954  1.00 135.25 ? 215  VAL B H      1 
ATOM   9426  H  HA     . VAL B 2 215 ? 16.494  36.029  -2.178  1.00 139.12 ? 215  VAL B HA     1 
ATOM   9427  H  HB     . VAL B 2 215 ? 18.450  34.872  -0.475  1.00 148.95 ? 215  VAL B HB     1 
ATOM   9428  H  HG11   . VAL B 2 215 ? 15.719  35.294  0.084   1.00 149.40 ? 215  VAL B HG11   1 
ATOM   9429  H  HG12   . VAL B 2 215 ? 16.730  34.562  1.067   1.00 149.40 ? 215  VAL B HG12   1 
ATOM   9430  H  HG13   . VAL B 2 215 ? 16.912  36.108  0.747   1.00 149.40 ? 215  VAL B HG13   1 
ATOM   9431  H  HG21   . VAL B 2 215 ? 17.802  33.307  -2.047  1.00 154.16 ? 215  VAL B HG21   1 
ATOM   9432  H  HG22   . VAL B 2 215 ? 17.265  32.881  -0.613  1.00 154.16 ? 215  VAL B HG22   1 
ATOM   9433  H  HG23   . VAL B 2 215 ? 16.277  33.543  -1.666  1.00 154.16 ? 215  VAL B HG23   1 
ATOM   9434  N  N      . ALA B 2 216 ? 19.153  37.438  -1.112  1.00 109.78 ? 216  ALA B N      1 
ATOM   9435  C  CA     . ALA B 2 216 ? 19.711  38.632  -0.495  1.00 115.77 ? 216  ALA B CA     1 
ATOM   9436  C  C      . ALA B 2 216 ? 19.477  39.888  -1.331  1.00 114.22 ? 216  ALA B C      1 
ATOM   9437  O  O      . ALA B 2 216 ? 19.525  40.999  -0.804  1.00 125.31 ? 216  ALA B O      1 
ATOM   9438  C  CB     . ALA B 2 216 ? 21.199  38.443  -0.253  1.00 116.06 ? 216  ALA B CB     1 
ATOM   9439  H  H      . ALA B 2 216 ? 19.739  36.837  -1.298  1.00 131.73 ? 216  ALA B H      1 
ATOM   9440  H  HA     . ALA B 2 216 ? 19.285  38.767  0.366   1.00 138.93 ? 216  ALA B HA     1 
ATOM   9441  H  HB1    . ALA B 2 216 ? 21.639  38.281  -1.102  1.00 139.27 ? 216  ALA B HB1    1 
ATOM   9442  H  HB2    . ALA B 2 216 ? 21.556  39.246  0.158   1.00 139.27 ? 216  ALA B HB2    1 
ATOM   9443  H  HB3    . ALA B 2 216 ? 21.328  37.684  0.337   1.00 139.27 ? 216  ALA B HB3    1 
ATOM   9444  N  N      . ILE B 2 217 ? 19.225  39.721  -2.626  1.00 94.28  ? 217  ILE B N      1 
ATOM   9445  C  CA     . ILE B 2 217 ? 18.971  40.866  -3.494  1.00 94.10  ? 217  ILE B CA     1 
ATOM   9446  C  C      . ILE B 2 217 ? 17.673  41.558  -3.079  1.00 107.24 ? 217  ILE B C      1 
ATOM   9447  O  O      . ILE B 2 217 ? 17.677  42.732  -2.710  1.00 114.71 ? 217  ILE B O      1 
ATOM   9448  C  CB     . ILE B 2 217 ? 18.903  40.449  -4.980  1.00 101.50 ? 217  ILE B CB     1 
ATOM   9449  C  CG1    . ILE B 2 217 ? 20.290  39.989  -5.442  1.00 94.57  ? 217  ILE B CG1    1 
ATOM   9450  C  CG2    . ILE B 2 217 ? 18.394  41.607  -5.846  1.00 101.60 ? 217  ILE B CG2    1 
ATOM   9451  C  CD1    . ILE B 2 217 ? 20.393  39.625  -6.913  1.00 87.49  ? 217  ILE B CD1    1 
ATOM   9452  H  H      . ILE B 2 217 ? 19.196  38.959  -3.025  1.00 113.14 ? 217  ILE B H      1 
ATOM   9453  H  HA     . ILE B 2 217 ? 19.695  41.504  -3.395  1.00 112.92 ? 217  ILE B HA     1 
ATOM   9454  H  HB     . ILE B 2 217 ? 18.286  39.705  -5.064  1.00 121.79 ? 217  ILE B HB     1 
ATOM   9455  H  HG12   . ILE B 2 217 ? 20.924  40.703  -5.273  1.00 113.48 ? 217  ILE B HG12   1 
ATOM   9456  H  HG13   . ILE B 2 217 ? 20.541  39.205  -4.929  1.00 113.48 ? 217  ILE B HG13   1 
ATOM   9457  H  HG21   . ILE B 2 217 ? 18.999  42.359  -5.755  1.00 121.93 ? 217  ILE B HG21   1 
ATOM   9458  H  HG22   . ILE B 2 217 ? 18.361  41.318  -6.771  1.00 121.93 ? 217  ILE B HG22   1 
ATOM   9459  H  HG23   . ILE B 2 217 ? 17.506  41.858  -5.546  1.00 121.93 ? 217  ILE B HG23   1 
ATOM   9460  H  HD11   . ILE B 2 217 ? 20.162  40.401  -7.447  1.00 104.99 ? 217  ILE B HD11   1 
ATOM   9461  H  HD12   . ILE B 2 217 ? 21.302  39.348  -7.107  1.00 104.99 ? 217  ILE B HD12   1 
ATOM   9462  H  HD13   . ILE B 2 217 ? 19.778  38.899  -7.102  1.00 104.99 ? 217  ILE B HD13   1 
ATOM   9463  N  N      . ILE B 2 218 ? 16.568  40.822  -3.141  1.00 113.26 ? 218  ILE B N      1 
ATOM   9464  C  CA     . ILE B 2 218 ? 15.269  41.340  -2.716  1.00 112.33 ? 218  ILE B CA     1 
ATOM   9465  C  C      . ILE B 2 218 ? 15.259  41.609  -1.212  1.00 110.97 ? 218  ILE B C      1 
ATOM   9466  O  O      . ILE B 2 218 ? 14.556  42.498  -0.733  1.00 118.82 ? 218  ILE B O      1 
ATOM   9467  C  CB     . ILE B 2 218 ? 14.118  40.371  -3.071  1.00 107.27 ? 218  ILE B CB     1 
ATOM   9468  C  CG1    . ILE B 2 218 ? 14.409  38.964  -2.535  1.00 101.94 ? 218  ILE B CG1    1 
ATOM   9469  C  CG2    . ILE B 2 218 ? 13.895  40.356  -4.579  1.00 98.38  ? 218  ILE B CG2    1 
ATOM   9470  C  CD1    . ILE B 2 218 ? 13.282  37.970  -2.741  1.00 105.58 ? 218  ILE B CD1    1 
ATOM   9471  H  H      . ILE B 2 218 ? 16.543  40.012  -3.429  1.00 135.91 ? 218  ILE B H      1 
ATOM   9472  H  HA     . ILE B 2 218 ? 15.103  42.180  -3.170  1.00 134.80 ? 218  ILE B HA     1 
ATOM   9473  H  HB     . ILE B 2 218 ? 13.307  40.695  -2.648  1.00 128.73 ? 218  ILE B HB     1 
ATOM   9474  H  HG12   . ILE B 2 218 ? 15.194  38.616  -2.985  1.00 122.33 ? 218  ILE B HG12   1 
ATOM   9475  H  HG13   . ILE B 2 218 ? 14.578  39.023  -1.582  1.00 122.33 ? 218  ILE B HG13   1 
ATOM   9476  H  HG21   . ILE B 2 218 ? 14.710  40.063  -5.016  1.00 118.06 ? 218  ILE B HG21   1 
ATOM   9477  H  HG22   . ILE B 2 218 ? 13.171  39.745  -4.785  1.00 118.06 ? 218  ILE B HG22   1 
ATOM   9478  H  HG23   . ILE B 2 218 ? 13.666  41.252  -4.873  1.00 118.06 ? 218  ILE B HG23   1 
ATOM   9479  H  HD11   . ILE B 2 218 ? 13.106  37.885  -3.691  1.00 126.69 ? 218  ILE B HD11   1 
ATOM   9480  H  HD12   . ILE B 2 218 ? 13.548  37.112  -2.375  1.00 126.69 ? 218  ILE B HD12   1 
ATOM   9481  H  HD13   . ILE B 2 218 ? 12.489  38.293  -2.285  1.00 126.69 ? 218  ILE B HD13   1 
ATOM   9482  N  N      . LEU B 2 219 ? 16.045  40.831  -0.476  1.00 101.42 ? 219  LEU B N      1 
ATOM   9483  C  CA     . LEU B 2 219 ? 16.161  40.990  0.969   1.00 114.19 ? 219  LEU B CA     1 
ATOM   9484  C  C      . LEU B 2 219 ? 16.742  42.351  1.348   1.00 122.59 ? 219  LEU B C      1 
ATOM   9485  O  O      . LEU B 2 219 ? 16.431  42.893  2.409   1.00 127.19 ? 219  LEU B O      1 
ATOM   9486  C  CB     . LEU B 2 219 ? 17.039  39.875  1.542   1.00 113.43 ? 219  LEU B CB     1 
ATOM   9487  C  CG     . LEU B 2 219 ? 17.160  39.723  3.057   1.00 115.83 ? 219  LEU B CG     1 
ATOM   9488  C  CD1    . LEU B 2 219 ? 15.800  39.511  3.697   1.00 127.38 ? 219  LEU B CD1    1 
ATOM   9489  C  CD2    . LEU B 2 219 ? 18.094  38.566  3.383   1.00 112.31 ? 219  LEU B CD2    1 
ATOM   9490  H  H      . LEU B 2 219 ? 16.528  40.195  -0.795  1.00 121.71 ? 219  LEU B H      1 
ATOM   9491  H  HA     . LEU B 2 219 ? 15.280  40.916  1.369   1.00 137.02 ? 219  LEU B HA     1 
ATOM   9492  H  HB2    . LEU B 2 219 ? 16.698  39.031  1.205   1.00 136.12 ? 219  LEU B HB2    1 
ATOM   9493  H  HB3    . LEU B 2 219 ? 17.938  40.006  1.203   1.00 136.12 ? 219  LEU B HB3    1 
ATOM   9494  H  HG     . LEU B 2 219 ? 17.544  40.534  3.428   1.00 138.99 ? 219  LEU B HG     1 
ATOM   9495  H  HD11   . LEU B 2 219 ? 15.402  38.705  3.331   1.00 152.85 ? 219  LEU B HD11   1 
ATOM   9496  H  HD12   . LEU B 2 219 ? 15.913  39.419  4.656   1.00 152.85 ? 219  LEU B HD12   1 
ATOM   9497  H  HD13   . LEU B 2 219 ? 15.237  40.276  3.501   1.00 152.85 ? 219  LEU B HD13   1 
ATOM   9498  H  HD21   . LEU B 2 219 ? 18.968  38.749  3.003   1.00 134.77 ? 219  LEU B HD21   1 
ATOM   9499  H  HD22   . LEU B 2 219 ? 18.164  38.479  4.347   1.00 134.77 ? 219  LEU B HD22   1 
ATOM   9500  H  HD23   . LEU B 2 219 ? 17.732  37.751  3.003   1.00 134.77 ? 219  LEU B HD23   1 
ATOM   9501  N  N      . ASN B 2 220 ? 17.583  42.899  0.477   1.00 116.34 ? 220  ASN B N      1 
ATOM   9502  C  CA     . ASN B 2 220 ? 18.162  44.222  0.693   1.00 114.52 ? 220  ASN B CA     1 
ATOM   9503  C  C      . ASN B 2 220 ? 17.248  45.319  0.151   1.00 119.77 ? 220  ASN B C      1 
ATOM   9504  O  O      . ASN B 2 220 ? 17.142  46.395  0.739   1.00 124.31 ? 220  ASN B O      1 
ATOM   9505  C  CB     . ASN B 2 220 ? 19.547  44.317  0.049   1.00 117.79 ? 220  ASN B CB     1 
ATOM   9506  C  CG     . ASN B 2 220 ? 20.592  43.500  0.789   1.00 117.10 ? 220  ASN B CG     1 
ATOM   9507  O  OD1    . ASN B 2 220 ? 20.449  43.218  1.980   1.00 119.79 ? 220  ASN B OD1    1 
ATOM   9508  N  ND2    . ASN B 2 220 ? 21.654  43.121  0.086   1.00 108.14 ? 220  ASN B ND2    1 
ATOM   9509  H  H      . ASN B 2 220 ? 17.837  42.522  -0.253  1.00 139.61 ? 220  ASN B H      1 
ATOM   9510  H  HA     . ASN B 2 220 ? 18.267  44.366  1.646   1.00 137.42 ? 220  ASN B HA     1 
ATOM   9511  H  HB2    . ASN B 2 220 ? 19.497  43.987  -0.861  1.00 141.35 ? 220  ASN B HB2    1 
ATOM   9512  H  HB3    . ASN B 2 220 ? 19.834  45.244  0.051   1.00 141.35 ? 220  ASN B HB3    1 
ATOM   9513  H  HD21   . ASN B 2 220 ? 21.721  43.340  -0.743  1.00 129.76 ? 220  ASN B HD21   1 
ATOM   9514  H  HD22   . ASN B 2 220 ? 22.273  42.657  0.460   1.00 129.76 ? 220  ASN B HD22   1 
ATOM   9515  N  N      . GLU B 2 221 ? 16.598  45.046  -0.976  1.00 109.07 ? 221  GLU B N      1 
ATOM   9516  C  CA     . GLU B 2 221 ? 15.672  46.001  -1.570  1.00 109.25 ? 221  GLU B CA     1 
ATOM   9517  C  C      . GLU B 2 221 ? 14.501  46.232  -0.615  1.00 123.27 ? 221  GLU B C      1 
ATOM   9518  O  O      . GLU B 2 221 ? 13.980  47.340  -0.527  1.00 134.36 ? 221  GLU B O      1 
ATOM   9519  C  CB     . GLU B 2 221 ? 15.180  45.518  -2.938  1.00 124.22 ? 221  GLU B CB     1 
ATOM   9520  C  CG     . GLU B 2 221 ? 14.333  46.543  -3.693  1.00 137.82 ? 221  GLU B CG     1 
ATOM   9521  C  CD     . GLU B 2 221 ? 13.727  45.986  -4.971  1.00 146.21 ? 221  GLU B CD     1 
ATOM   9522  O  OE1    . GLU B 2 221 ? 13.975  44.803  -5.288  1.00 139.40 ? 221  GLU B OE1    1 
ATOM   9523  O  OE2    . GLU B 2 221 ? 13.005  46.735  -5.663  1.00 139.01 ? 221  GLU B OE2    1 
ATOM   9524  H  H      . GLU B 2 221 ? 16.677  44.312  -1.417  1.00 130.88 ? 221  GLU B H      1 
ATOM   9525  H  HA     . GLU B 2 221 ? 16.128  46.848  -1.696  1.00 131.10 ? 221  GLU B HA     1 
ATOM   9526  H  HB2    . GLU B 2 221 ? 15.950  45.307  -3.489  1.00 149.06 ? 221  GLU B HB2    1 
ATOM   9527  H  HB3    . GLU B 2 221 ? 14.639  44.723  -2.812  1.00 149.06 ? 221  GLU B HB3    1 
ATOM   9528  H  HG2    . GLU B 2 221 ? 13.607  46.835  -3.120  1.00 165.39 ? 221  GLU B HG2    1 
ATOM   9529  H  HG3    . GLU B 2 221 ? 14.892  47.299  -3.932  1.00 165.39 ? 221  GLU B HG3    1 
ATOM   9530  N  N      . PHE B 2 222 ? 14.098  45.189  0.108   1.00 117.55 ? 222  PHE B N      1 
ATOM   9531  C  CA     . PHE B 2 222 ? 13.050  45.326  1.117   1.00 125.73 ? 222  PHE B CA     1 
ATOM   9532  C  C      . PHE B 2 222 ? 13.572  46.208  2.249   1.00 134.16 ? 222  PHE B C      1 
ATOM   9533  O  O      . PHE B 2 222 ? 12.886  47.131  2.692   1.00 136.83 ? 222  PHE B O      1 
ATOM   9534  C  CB     . PHE B 2 222 ? 12.606  43.964  1.659   1.00 129.56 ? 222  PHE B CB     1 
ATOM   9535  C  CG     . PHE B 2 222 ? 11.684  44.056  2.848   1.00 149.17 ? 222  PHE B CG     1 
ATOM   9536  C  CD1    . PHE B 2 222 ? 10.353  44.409  2.685   1.00 144.62 ? 222  PHE B CD1    1 
ATOM   9537  C  CD2    . PHE B 2 222 ? 12.150  43.794  4.127   1.00 146.81 ? 222  PHE B CD2    1 
ATOM   9538  C  CE1    . PHE B 2 222 ? 9.505   44.495  3.777   1.00 144.57 ? 222  PHE B CE1    1 
ATOM   9539  C  CE2    . PHE B 2 222 ? 11.306  43.879  5.223   1.00 134.33 ? 222  PHE B CE2    1 
ATOM   9540  C  CZ     . PHE B 2 222 ? 9.983   44.230  5.047   1.00 135.27 ? 222  PHE B CZ     1 
ATOM   9541  H  H      . PHE B 2 222 ? 14.415  44.393  0.034   1.00 141.06 ? 222  PHE B H      1 
ATOM   9542  H  HA     . PHE B 2 222 ? 12.279  45.762  0.722   1.00 150.87 ? 222  PHE B HA     1 
ATOM   9543  H  HB2    . PHE B 2 222 ? 12.138  43.485  0.957   1.00 155.47 ? 222  PHE B HB2    1 
ATOM   9544  H  HB3    . PHE B 2 222 ? 13.392  43.464  1.931   1.00 155.47 ? 222  PHE B HB3    1 
ATOM   9545  H  HD1    . PHE B 2 222 ? 10.026  44.588  1.833   1.00 173.54 ? 222  PHE B HD1    1 
ATOM   9546  H  HD2    . PHE B 2 222 ? 13.041  43.557  4.251   1.00 176.17 ? 222  PHE B HD2    1 
ATOM   9547  H  HE1    . PHE B 2 222 ? 8.613   44.732  3.656   1.00 173.49 ? 222  PHE B HE1    1 
ATOM   9548  H  HE2    . PHE B 2 222 ? 11.631  43.700  6.076   1.00 161.19 ? 222  PHE B HE2    1 
ATOM   9549  H  HZ     . PHE B 2 222 ? 9.415   44.288  5.781   1.00 162.32 ? 222  PHE B HZ     1 
ATOM   9550  N  N      . ARG B 2 223 ? 14.779  45.908  2.723   1.00 129.69 ? 223  ARG B N      1 
ATOM   9551  C  CA     . ARG B 2 223 ? 15.416  46.689  3.782   1.00 119.95 ? 223  ARG B CA     1 
ATOM   9552  C  C      . ARG B 2 223 ? 15.444  48.164  3.405   1.00 121.87 ? 223  ARG B C      1 
ATOM   9553  O  O      . ARG B 2 223 ? 15.205  49.035  4.241   1.00 129.99 ? 223  ARG B O      1 
ATOM   9554  C  CB     . ARG B 2 223 ? 16.842  46.190  4.040   1.00 115.02 ? 223  ARG B CB     1 
ATOM   9555  C  CG     . ARG B 2 223 ? 17.748  47.190  4.761   1.00 92.23  ? 223  ARG B CG     1 
ATOM   9556  C  CD     . ARG B 2 223 ? 19.124  46.606  5.030   1.00 99.34  ? 223  ARG B CD     1 
ATOM   9557  N  NE     . ARG B 2 223 ? 19.090  45.588  6.073   1.00 115.07 ? 223  ARG B NE     1 
ATOM   9558  C  CZ     . ARG B 2 223 ? 20.167  45.017  6.603   1.00 118.14 ? 223  ARG B CZ     1 
ATOM   9559  N  NH1    . ARG B 2 223 ? 21.382  45.361  6.194   1.00 113.05 ? 223  ARG B NH1    1 
ATOM   9560  N  NH2    . ARG B 2 223 ? 20.028  44.099  7.550   1.00 125.60 ? 223  ARG B NH2    1 
ATOM   9561  H  H      . ARG B 2 223 ? 15.256  45.249  2.444   1.00 155.63 ? 223  ARG B H      1 
ATOM   9562  H  HA     . ARG B 2 223 ? 14.906  46.594  4.601   1.00 143.94 ? 223  ARG B HA     1 
ATOM   9563  H  HB2    . ARG B 2 223 ? 16.796  45.389  4.586   1.00 138.02 ? 223  ARG B HB2    1 
ATOM   9564  H  HB3    . ARG B 2 223 ? 17.256  45.980  3.188   1.00 138.02 ? 223  ARG B HB3    1 
ATOM   9565  H  HG2    . ARG B 2 223 ? 17.855  47.980  4.209   1.00 110.68 ? 223  ARG B HG2    1 
ATOM   9566  H  HG3    . ARG B 2 223 ? 17.348  47.428  5.613   1.00 110.68 ? 223  ARG B HG3    1 
ATOM   9567  H  HD2    . ARG B 2 223 ? 19.460  46.196  4.217   1.00 119.21 ? 223  ARG B HD2    1 
ATOM   9568  H  HD3    . ARG B 2 223 ? 19.720  47.315  5.318   1.00 119.21 ? 223  ARG B HD3    1 
ATOM   9569  H  HE     . ARG B 2 223 ? 18.320  45.340  6.366   1.00 138.09 ? 223  ARG B HE     1 
ATOM   9570  H  HH11   . ARG B 2 223 ? 21.477  45.956  5.580   1.00 135.66 ? 223  ARG B HH11   1 
ATOM   9571  H  HH12   . ARG B 2 223 ? 22.074  44.987  6.542   1.00 135.66 ? 223  ARG B HH12   1 
ATOM   9572  H  HH21   . ARG B 2 223 ? 19.243  43.874  7.819   1.00 150.72 ? 223  ARG B HH21   1 
ATOM   9573  H  HH22   . ARG B 2 223 ? 20.724  43.729  7.895   1.00 150.72 ? 223  ARG B HH22   1 
ATOM   9574  N  N      . ALA B 2 224 ? 15.735  48.433  2.138   1.00 117.76 ? 224  ALA B N      1 
ATOM   9575  C  CA     . ALA B 2 224 ? 15.835  49.798  1.645   1.00 124.58 ? 224  ALA B CA     1 
ATOM   9576  C  C      . ALA B 2 224 ? 14.464  50.464  1.657   1.00 130.00 ? 224  ALA B C      1 
ATOM   9577  O  O      . ALA B 2 224 ? 14.307  51.566  2.182   1.00 132.11 ? 224  ALA B O      1 
ATOM   9578  C  CB     . ALA B 2 224 ? 16.424  49.816  0.246   1.00 131.97 ? 224  ALA B CB     1 
ATOM   9579  H  H      . ALA B 2 224 ? 15.881  47.834  1.538   1.00 141.32 ? 224  ALA B H      1 
ATOM   9580  H  HA     . ALA B 2 224 ? 16.422  50.305  2.227   1.00 149.49 ? 224  ALA B HA     1 
ATOM   9581  H  HB1    . ALA B 2 224 ? 15.850  49.304  -0.345  1.00 158.36 ? 224  ALA B HB1    1 
ATOM   9582  H  HB2    . ALA B 2 224 ? 16.481  50.734  -0.061  1.00 158.36 ? 224  ALA B HB2    1 
ATOM   9583  H  HB3    . ALA B 2 224 ? 17.310  49.420  0.272   1.00 158.36 ? 224  ALA B HB3    1 
ATOM   9584  N  N      . LYS B 2 225 ? 13.475  49.792  1.077   1.00 129.49 ? 225  LYS B N      1 
ATOM   9585  C  CA     . LYS B 2 225 ? 12.124  50.334  1.019   1.00 126.00 ? 225  LYS B CA     1 
ATOM   9586  C  C      . LYS B 2 225 ? 11.572  50.510  2.433   1.00 125.05 ? 225  LYS B C      1 
ATOM   9587  O  O      . LYS B 2 225 ? 10.749  51.392  2.683   1.00 112.67 ? 225  LYS B O      1 
ATOM   9588  C  CB     . LYS B 2 225 ? 11.213  49.410  0.206   1.00 120.95 ? 225  LYS B CB     1 
ATOM   9589  C  CG     . LYS B 2 225 ? 11.523  49.372  -1.287  1.00 134.14 ? 225  LYS B CG     1 
ATOM   9590  C  CD     . LYS B 2 225 ? 10.412  48.697  -2.080  1.00 137.70 ? 225  LYS B CD     1 
ATOM   9591  C  CE     . LYS B 2 225 ? 10.663  48.792  -3.580  1.00 145.85 ? 225  LYS B CE     1 
ATOM   9592  N  NZ     . LYS B 2 225 ? 9.548   48.220  -4.387  1.00 141.43 ? 225  LYS B NZ     1 
ATOM   9593  H  H      . LYS B 2 225 ? 13.560  49.019  0.710   1.00 155.39 ? 225  LYS B H      1 
ATOM   9594  H  HA     . LYS B 2 225 ? 12.143  51.203  0.588   1.00 151.20 ? 225  LYS B HA     1 
ATOM   9595  H  HB2    . LYS B 2 225 ? 11.302  48.507  0.548   1.00 145.14 ? 225  LYS B HB2    1 
ATOM   9596  H  HB3    . LYS B 2 225 ? 10.296  49.709  0.308   1.00 145.14 ? 225  LYS B HB3    1 
ATOM   9597  H  HG2    . LYS B 2 225 ? 11.621  50.279  -1.615  1.00 160.97 ? 225  LYS B HG2    1 
ATOM   9598  H  HG3    . LYS B 2 225 ? 12.343  48.874  -1.429  1.00 160.97 ? 225  LYS B HG3    1 
ATOM   9599  H  HD2    . LYS B 2 225 ? 10.370  47.758  -1.838  1.00 165.23 ? 225  LYS B HD2    1 
ATOM   9600  H  HD3    . LYS B 2 225 ? 9.568   49.133  -1.885  1.00 165.23 ? 225  LYS B HD3    1 
ATOM   9601  H  HE2    . LYS B 2 225 ? 10.763  49.726  -3.825  1.00 175.02 ? 225  LYS B HE2    1 
ATOM   9602  H  HE3    . LYS B 2 225 ? 11.472  48.304  -3.797  1.00 175.02 ? 225  LYS B HE3    1 
ATOM   9603  H  HZ1    . LYS B 2 225 ? 8.792   48.656  -4.213  1.00 169.71 ? 225  LYS B HZ1    1 
ATOM   9604  H  HZ2    . LYS B 2 225 ? 9.731   48.295  -5.254  1.00 169.71 ? 225  LYS B HZ2    1 
ATOM   9605  H  HZ3    . LYS B 2 225 ? 9.438   47.360  -4.187  1.00 169.71 ? 225  LYS B HZ3    1 
ATOM   9606  N  N      . LEU B 2 226 ? 12.033  49.667  3.354   1.00 124.43 ? 226  LEU B N      1 
ATOM   9607  C  CA     . LEU B 2 226 ? 11.589  49.737  4.742   1.00 123.09 ? 226  LEU B CA     1 
ATOM   9608  C  C      . LEU B 2 226 ? 12.245  50.882  5.506   1.00 121.66 ? 226  LEU B C      1 
ATOM   9609  O  O      . LEU B 2 226 ? 11.566  51.644  6.193   1.00 119.83 ? 226  LEU B O      1 
ATOM   9610  C  CB     . LEU B 2 226 ? 11.882  48.415  5.461   1.00 125.39 ? 226  LEU B CB     1 
ATOM   9611  C  CG     . LEU B 2 226 ? 11.396  48.296  6.913   1.00 113.28 ? 226  LEU B CG     1 
ATOM   9612  C  CD1    . LEU B 2 226 ? 9.877   48.325  7.001   1.00 114.39 ? 226  LEU B CD1    1 
ATOM   9613  C  CD2    . LEU B 2 226 ? 11.942  47.030  7.558   1.00 101.09 ? 226  LEU B CD2    1 
ATOM   9614  H  H      . LEU B 2 226 ? 12.605  49.044  3.200   1.00 149.32 ? 226  LEU B H      1 
ATOM   9615  H  HA     . LEU B 2 226 ? 10.630  49.879  4.758   1.00 147.71 ? 226  LEU B HA     1 
ATOM   9616  H  HB2    . LEU B 2 226 ? 11.464  47.698  4.959   1.00 150.46 ? 226  LEU B HB2    1 
ATOM   9617  H  HB3    . LEU B 2 226 ? 12.843  48.281  5.469   1.00 150.46 ? 226  LEU B HB3    1 
ATOM   9618  H  HG     . LEU B 2 226 ? 11.734  49.053  7.416   1.00 135.93 ? 226  LEU B HG     1 
ATOM   9619  H  HD11   . LEU B 2 226 ? 9.517   47.582  6.491   1.00 137.27 ? 226  LEU B HD11   1 
ATOM   9620  H  HD12   . LEU B 2 226 ? 9.613   48.248  7.931   1.00 137.27 ? 226  LEU B HD12   1 
ATOM   9621  H  HD13   . LEU B 2 226 ? 9.556   49.164  6.634   1.00 137.27 ? 226  LEU B HD13   1 
ATOM   9622  H  HD21   . LEU B 2 226 ? 12.911  47.065  7.549   1.00 121.31 ? 226  LEU B HD21   1 
ATOM   9623  H  HD22   . LEU B 2 226 ? 11.621  46.979  8.472   1.00 121.31 ? 226  LEU B HD22   1 
ATOM   9624  H  HD23   . LEU B 2 226 ? 11.633  46.261  7.054   1.00 121.31 ? 226  LEU B HD23   1 
ATOM   9625  N  N      . SER B 2 227 ? 13.564  51.007  5.381   1.00 119.77 ? 227  SER B N      1 
ATOM   9626  C  CA     . SER B 2 227 ? 14.293  52.044  6.105   1.00 120.88 ? 227  SER B CA     1 
ATOM   9627  C  C      . SER B 2 227 ? 13.896  53.447  5.669   1.00 126.68 ? 227  SER B C      1 
ATOM   9628  O  O      . SER B 2 227 ? 14.001  54.395  6.448   1.00 122.12 ? 227  SER B O      1 
ATOM   9629  C  CB     . SER B 2 227 ? 15.802  51.866  5.922   1.00 123.30 ? 227  SER B CB     1 
ATOM   9630  O  OG     . SER B 2 227 ? 16.515  52.856  6.644   1.00 133.08 ? 227  SER B OG     1 
ATOM   9631  H  H      . SER B 2 227 ? 14.057  50.506  4.886   1.00 143.72 ? 227  SER B H      1 
ATOM   9632  H  HA     . SER B 2 227 ? 14.097  51.961  7.051   1.00 145.06 ? 227  SER B HA     1 
ATOM   9633  H  HB2    . SER B 2 227 ? 16.058  50.989  6.250   1.00 147.96 ? 227  SER B HB2    1 
ATOM   9634  H  HB3    . SER B 2 227 ? 16.017  51.944  4.980   1.00 147.96 ? 227  SER B HB3    1 
ATOM   9635  H  HG     . SER B 2 227 ? 17.342  52.750  6.538   1.00 159.70 ? 227  SER B HG     1 
ATOM   9636  N  N      . LYS B 2 228 ? 13.438  53.579  4.427   1.00 133.24 ? 228  LYS B N      1 
ATOM   9637  C  CA     . LYS B 2 228 ? 12.970  54.867  3.935   1.00 129.99 ? 228  LYS B CA     1 
ATOM   9638  C  C      . LYS B 2 228 ? 11.537  55.140  4.375   1.00 134.09 ? 228  LYS B C      1 
ATOM   9639  O  O      . LYS B 2 228 ? 11.178  56.283  4.657   1.00 143.60 ? 228  LYS B O      1 
ATOM   9640  C  CB     . LYS B 2 228 ? 13.085  54.935  2.413   1.00 116.07 ? 228  LYS B CB     1 
ATOM   9641  C  CG     . LYS B 2 228 ? 14.521  54.875  1.916   1.00 127.56 ? 228  LYS B CG     1 
ATOM   9642  C  CD     . LYS B 2 228 ? 14.617  55.200  0.438   1.00 144.75 ? 228  LYS B CD     1 
ATOM   9643  C  CE     . LYS B 2 228 ? 16.063  55.389  0.009   1.00 152.45 ? 228  LYS B CE     1 
ATOM   9644  N  NZ     . LYS B 2 228 ? 16.179  55.698  -1.441  1.00 163.77 ? 228  LYS B NZ     1 
ATOM   9645  H  H      . LYS B 2 228 ? 13.388  52.940  3.854   1.00 159.89 ? 228  LYS B H      1 
ATOM   9646  H  HA     . LYS B 2 228 ? 13.531  55.566  4.306   1.00 155.99 ? 228  LYS B HA     1 
ATOM   9647  H  HB2    . LYS B 2 228 ? 12.604  54.186  2.027   1.00 139.29 ? 228  LYS B HB2    1 
ATOM   9648  H  HB3    . LYS B 2 228 ? 12.698  55.770  2.105   1.00 139.29 ? 228  LYS B HB3    1 
ATOM   9649  H  HG2    . LYS B 2 228 ? 15.055  55.522  2.404   1.00 153.07 ? 228  LYS B HG2    1 
ATOM   9650  H  HG3    . LYS B 2 228 ? 14.869  53.981  2.053   1.00 153.07 ? 228  LYS B HG3    1 
ATOM   9651  H  HD2    . LYS B 2 228 ? 14.240  54.470  -0.077  1.00 173.70 ? 228  LYS B HD2    1 
ATOM   9652  H  HD3    . LYS B 2 228 ? 14.136  56.023  0.258   1.00 173.70 ? 228  LYS B HD3    1 
ATOM   9653  H  HE2    . LYS B 2 228 ? 16.449  56.126  0.508   1.00 182.94 ? 228  LYS B HE2    1 
ATOM   9654  H  HE3    . LYS B 2 228 ? 16.556  54.572  0.185   1.00 182.94 ? 228  LYS B HE3    1 
ATOM   9655  H  HZ1    . LYS B 2 228 ? 15.738  56.448  -1.628  1.00 196.52 ? 228  LYS B HZ1    1 
ATOM   9656  H  HZ2    . LYS B 2 228 ? 17.035  55.803  -1.662  1.00 196.52 ? 228  LYS B HZ2    1 
ATOM   9657  H  HZ3    . LYS B 2 228 ? 15.836  55.033  -1.922  1.00 196.52 ? 228  LYS B HZ3    1 
ATOM   9658  N  N      . ALA B 2 229 ? 10.719  54.094  4.434   1.00 130.33 ? 229  ALA B N      1 
ATOM   9659  C  CA     . ALA B 2 229 ? 9.339   54.254  4.873   1.00 131.63 ? 229  ALA B CA     1 
ATOM   9660  C  C      . ALA B 2 229 ? 9.275   54.536  6.376   1.00 135.18 ? 229  ALA B C      1 
ATOM   9661  O  O      . ALA B 2 229 ? 8.421   55.297  6.832   1.00 136.06 ? 229  ALA B O      1 
ATOM   9662  C  CB     . ALA B 2 229 ? 8.524   53.017  4.523   1.00 135.03 ? 229  ALA B CB     1 
ATOM   9663  H  H      . ALA B 2 229 ? 10.936  53.289  4.226   1.00 156.39 ? 229  ALA B H      1 
ATOM   9664  H  HA     . ALA B 2 229 ? 8.947   55.011  4.410   1.00 157.95 ? 229  ALA B HA     1 
ATOM   9665  H  HB1    . ALA B 2 229 ? 8.914   52.247  4.966   1.00 162.03 ? 229  ALA B HB1    1 
ATOM   9666  H  HB2    . ALA B 2 229 ? 7.611   53.145  4.824   1.00 162.03 ? 229  ALA B HB2    1 
ATOM   9667  H  HB3    . ALA B 2 229 ? 8.542   52.890  3.561   1.00 162.03 ? 229  ALA B HB3    1 
ATOM   9668  N  N      . LEU B 2 230 ? 10.178  53.924  7.140   1.00 128.34 ? 230  LEU B N      1 
ATOM   9669  C  CA     . LEU B 2 230 ? 10.252  54.170  8.579   1.00 127.94 ? 230  LEU B CA     1 
ATOM   9670  C  C      . LEU B 2 230 ? 10.728  55.584  8.874   1.00 128.60 ? 230  LEU B C      1 
ATOM   9671  O  O      . LEU B 2 230 ? 10.197  56.260  9.753   1.00 134.29 ? 230  LEU B O      1 
ATOM   9672  C  CB     . LEU B 2 230 ? 11.191  53.174  9.270   1.00 134.38 ? 230  LEU B CB     1 
ATOM   9673  C  CG     . LEU B 2 230 ? 10.780  51.704  9.368   1.00 137.80 ? 230  LEU B CG     1 
ATOM   9674  C  CD1    . LEU B 2 230 ? 11.906  50.873  9.971   1.00 103.50 ? 230  LEU B CD1    1 
ATOM   9675  C  CD2    . LEU B 2 230 ? 9.517   51.547  10.191  1.00 131.97 ? 230  LEU B CD2    1 
ATOM   9676  H  H      . LEU B 2 230 ? 10.760  53.361  6.849   1.00 154.01 ? 230  LEU B H      1 
ATOM   9677  H  HA     . LEU B 2 230 ? 9.368   54.065  8.964   1.00 153.53 ? 230  LEU B HA     1 
ATOM   9678  H  HB2    . LEU B 2 230 ? 12.039  53.194  8.798   1.00 161.26 ? 230  LEU B HB2    1 
ATOM   9679  H  HB3    . LEU B 2 230 ? 11.332  53.484  10.178  1.00 161.26 ? 230  LEU B HB3    1 
ATOM   9680  H  HG     . LEU B 2 230 ? 10.601  51.365  8.477   1.00 165.36 ? 230  LEU B HG     1 
ATOM   9681  H  HD11   . LEU B 2 230 ? 12.105  51.209  10.859  1.00 124.20 ? 230  LEU B HD11   1 
ATOM   9682  H  HD12   . LEU B 2 230 ? 11.622  49.947  10.023  1.00 124.20 ? 230  LEU B HD12   1 
ATOM   9683  H  HD13   . LEU B 2 230 ? 12.691  50.948  9.405   1.00 124.20 ? 230  LEU B HD13   1 
ATOM   9684  H  HD21   . LEU B 2 230 ? 8.802   52.047  9.768   1.00 158.37 ? 230  LEU B HD21   1 
ATOM   9685  H  HD22   . LEU B 2 230 ? 9.284   50.607  10.233  1.00 158.37 ? 230  LEU B HD22   1 
ATOM   9686  H  HD23   . LEU B 2 230 ? 9.679   51.889  11.084  1.00 158.37 ? 230  LEU B HD23   1 
ATOM   9687  N  N      . ALA B 2 231 ? 11.738  56.019  8.127   1.00 124.47 ? 231  ALA B N      1 
ATOM   9688  C  CA     . ALA B 2 231 ? 12.307  57.352  8.288   1.00 125.66 ? 231  ALA B CA     1 
ATOM   9689  C  C      . ALA B 2 231 ? 11.274  58.449  8.060   1.00 121.61 ? 231  ALA B C      1 
ATOM   9690  O  O      . ALA B 2 231 ? 11.272  59.462  8.757   1.00 120.97 ? 231  ALA B O      1 
ATOM   9691  C  CB     . ALA B 2 231 ? 13.485  57.534  7.340   1.00 118.95 ? 231  ALA B CB     1 
ATOM   9692  H  H      . ALA B 2 231 ? 12.117  55.554  7.511   1.00 149.36 ? 231  ALA B H      1 
ATOM   9693  H  HA     . ALA B 2 231 ? 12.640  57.441  9.195   1.00 150.79 ? 231  ALA B HA     1 
ATOM   9694  H  HB1    . ALA B 2 231 ? 13.175  57.423  6.428   1.00 142.74 ? 231  ALA B HB1    1 
ATOM   9695  H  HB2    . ALA B 2 231 ? 13.851  58.424  7.460   1.00 142.74 ? 231  ALA B HB2    1 
ATOM   9696  H  HB3    . ALA B 2 231 ? 14.160  56.867  7.544   1.00 142.74 ? 231  ALA B HB3    1 
ATOM   9697  N  N      . LEU B 2 232 ? 10.398  58.245  7.083   1.00 127.08 ? 232  LEU B N      1 
ATOM   9698  C  CA     . LEU B 2 232 ? 9.371   59.232  6.773   1.00 145.34 ? 232  LEU B CA     1 
ATOM   9699  C  C      . LEU B 2 232 ? 8.292   59.281  7.858   1.00 143.85 ? 232  LEU B C      1 
ATOM   9700  O  O      . LEU B 2 232 ? 7.831   60.359  8.233   1.00 146.64 ? 232  LEU B O      1 
ATOM   9701  C  CB     . LEU B 2 232 ? 8.745   58.923  5.406   1.00 146.50 ? 232  LEU B CB     1 
ATOM   9702  C  CG     . LEU B 2 232 ? 8.274   60.076  4.505   1.00 144.53 ? 232  LEU B CG     1 
ATOM   9703  C  CD1    . LEU B 2 232 ? 6.981   60.695  5.018   1.00 140.29 ? 232  LEU B CD1    1 
ATOM   9704  C  CD2    . LEU B 2 232 ? 9.352   61.147  4.314   1.00 132.90 ? 232  LEU B CD2    1 
ATOM   9705  H  H      . LEU B 2 232 ? 10.377  57.544  6.584   1.00 152.50 ? 232  LEU B H      1 
ATOM   9706  H  HA     . LEU B 2 232 ? 9.782   60.109  6.721   1.00 174.40 ? 232  LEU B HA     1 
ATOM   9707  H  HB2    . LEU B 2 232 ? 9.398   58.421  4.893   1.00 175.80 ? 232  LEU B HB2    1 
ATOM   9708  H  HB3    . LEU B 2 232 ? 7.971   58.359  5.560   1.00 175.80 ? 232  LEU B HB3    1 
ATOM   9709  H  HG     . LEU B 2 232 ? 8.083   59.709  3.628   1.00 173.43 ? 232  LEU B HG     1 
ATOM   9710  H  HD11   . LEU B 2 232 ? 7.129   61.040  5.912   1.00 168.35 ? 232  LEU B HD11   1 
ATOM   9711  H  HD12   . LEU B 2 232 ? 6.719   61.415  4.424   1.00 168.35 ? 232  LEU B HD12   1 
ATOM   9712  H  HD13   . LEU B 2 232 ? 6.291   60.013  5.036   1.00 168.35 ? 232  LEU B HD13   1 
ATOM   9713  H  HD21   . LEU B 2 232 ? 10.131  60.741  3.903   1.00 159.48 ? 232  LEU B HD21   1 
ATOM   9714  H  HD22   . LEU B 2 232 ? 9.003   61.847  3.740   1.00 159.48 ? 232  LEU B HD22   1 
ATOM   9715  H  HD23   . LEU B 2 232 ? 9.588   61.515  5.180   1.00 159.48 ? 232  LEU B HD23   1 
ATOM   9716  N  N      . THR B 2 233 ? 7.897   58.117  8.365   1.00 141.61 ? 233  THR B N      1 
ATOM   9717  C  CA     . THR B 2 233 ? 6.877   58.045  9.409   1.00 139.57 ? 233  THR B CA     1 
ATOM   9718  C  C      . THR B 2 233 ? 7.359   58.742  10.679  1.00 135.35 ? 233  THR B C      1 
ATOM   9719  O  O      . THR B 2 233 ? 6.568   59.304  11.435  1.00 139.66 ? 233  THR B O      1 
ATOM   9720  C  CB     . THR B 2 233 ? 6.504   56.582  9.748   1.00 131.00 ? 233  THR B CB     1 
ATOM   9721  O  OG1    . THR B 2 233 ? 6.173   55.874  8.548   1.00 145.85 ? 233  THR B OG1    1 
ATOM   9722  C  CG2    . THR B 2 233 ? 5.319   56.527  10.712  1.00 107.94 ? 233  THR B CG2    1 
ATOM   9723  H  H      . THR B 2 233 ? 8.203   57.351  8.121   1.00 169.93 ? 233  THR B H      1 
ATOM   9724  H  HA     . THR B 2 233 ? 6.076   58.497  9.102   1.00 167.49 ? 233  THR B HA     1 
ATOM   9725  H  HB     . THR B 2 233 ? 7.261   56.151  10.174  1.00 157.19 ? 233  THR B HB     1 
ATOM   9726  H  HG1    . THR B 2 233 ? 6.830   55.875  8.024   1.00 175.02 ? 233  THR B HG1    1 
ATOM   9727  H  HG21   . THR B 2 233 ? 4.546   56.956  10.312  1.00 129.52 ? 233  THR B HG21   1 
ATOM   9728  H  HG22   . THR B 2 233 ? 5.098   55.605  10.914  1.00 129.52 ? 233  THR B HG22   1 
ATOM   9729  H  HG23   . THR B 2 233 ? 5.541   56.986  11.537  1.00 129.52 ? 233  THR B HG23   1 
ATOM   9730  N  N      . ALA B 2 234 ? 8.670   58.700  10.895  1.00 134.15 ? 234  ALA B N      1 
ATOM   9731  C  CA     . ALA B 2 234 ? 9.296   59.285  12.078  1.00 142.01 ? 234  ALA B CA     1 
ATOM   9732  C  C      . ALA B 2 234 ? 9.274   60.809  12.139  1.00 149.58 ? 234  ALA B C      1 
ATOM   9733  O  O      . ALA B 2 234 ? 8.578   61.401  12.965  1.00 145.92 ? 234  ALA B O      1 
ATOM   9734  C  CB     . ALA B 2 234 ? 10.737  58.810  12.169  1.00 139.09 ? 234  ALA B CB     1 
ATOM   9735  H  H      . ALA B 2 234 ? 9.231   58.328  10.360  1.00 160.98 ? 234  ALA B H      1 
ATOM   9736  H  HA     . ALA B 2 234 ? 8.831   58.957  12.864  1.00 170.41 ? 234  ALA B HA     1 
ATOM   9737  H  HB1    . ALA B 2 234 ? 11.213  59.092  11.371  1.00 166.91 ? 234  ALA B HB1    1 
ATOM   9738  H  HB2    . ALA B 2 234 ? 11.149  59.201  12.955  1.00 166.91 ? 234  ALA B HB2    1 
ATOM   9739  H  HB3    . ALA B 2 234 ? 10.747  57.843  12.236  1.00 166.91 ? 234  ALA B HB3    1 
ATOM   9740  N  N      . ARG B 2 235 ? 10.042  61.432  11.253  1.00 155.30 ? 235  ARG B N      1 
ATOM   9741  C  CA     . ARG B 2 235 ? 10.184  62.883  11.236  1.00 152.85 ? 235  ARG B CA     1 
ATOM   9742  C  C      . ARG B 2 235 ? 8.947   63.657  10.772  1.00 155.58 ? 235  ARG B C      1 
ATOM   9743  O  O      . ARG B 2 235 ? 8.739   64.785  11.220  1.00 154.67 ? 235  ARG B O      1 
ATOM   9744  C  CB     . ARG B 2 235 ? 11.385  63.269  10.362  1.00 137.72 ? 235  ARG B CB     1 
ATOM   9745  C  CG     . ARG B 2 235 ? 12.691  62.536  10.705  1.00 126.77 ? 235  ARG B CG     1 
ATOM   9746  C  CD     . ARG B 2 235 ? 13.284  63.019  12.032  1.00 122.81 ? 235  ARG B CD     1 
ATOM   9747  N  NE     . ARG B 2 235 ? 14.593  62.428  12.324  1.00 124.48 ? 235  ARG B NE     1 
ATOM   9748  C  CZ     . ARG B 2 235 ? 14.813  61.424  13.176  1.00 127.56 ? 235  ARG B CZ     1 
ATOM   9749  N  NH1    . ARG B 2 235 ? 13.814  60.866  13.846  1.00 128.22 ? 235  ARG B NH1    1 
ATOM   9750  N  NH2    . ARG B 2 235 ? 16.049  60.974  13.361  1.00 97.84  ? 235  ARG B NH2    1 
ATOM   9751  H  H      . ARG B 2 235 ? 10.497  61.032  10.643  1.00 186.36 ? 235  ARG B H      1 
ATOM   9752  H  HA     . ARG B 2 235 ? 10.381  63.176  12.139  1.00 183.42 ? 235  ARG B HA     1 
ATOM   9753  H  HB2    . ARG B 2 235 ? 11.172  63.071  9.437   1.00 165.26 ? 235  ARG B HB2    1 
ATOM   9754  H  HB3    . ARG B 2 235 ? 11.548  64.220  10.462  1.00 165.26 ? 235  ARG B HB3    1 
ATOM   9755  H  HG2    . ARG B 2 235 ? 12.513  61.585  10.781  1.00 152.12 ? 235  ARG B HG2    1 
ATOM   9756  H  HG3    . ARG B 2 235 ? 13.343  62.699  10.005  1.00 152.12 ? 235  ARG B HG3    1 
ATOM   9757  H  HD2    . ARG B 2 235 ? 13.392  63.982  11.997  1.00 147.37 ? 235  ARG B HD2    1 
ATOM   9758  H  HD3    . ARG B 2 235 ? 12.680  62.779  12.752  1.00 147.37 ? 235  ARG B HD3    1 
ATOM   9759  H  HE     . ARG B 2 235 ? 15.275  62.754  11.914  1.00 149.37 ? 235  ARG B HE     1 
ATOM   9760  H  HH11   . ARG B 2 235 ? 13.009  61.150  13.735  1.00 153.86 ? 235  ARG B HH11   1 
ATOM   9761  H  HH12   . ARG B 2 235 ? 13.970  60.220  14.392  1.00 153.86 ? 235  ARG B HH12   1 
ATOM   9762  H  HH21   . ARG B 2 235 ? 16.704  61.328  12.932  1.00 117.41 ? 235  ARG B HH21   1 
ATOM   9763  H  HH22   . ARG B 2 235 ? 16.193  60.327  13.909  1.00 117.41 ? 235  ARG B HH22   1 
ATOM   9764  N  N      . SER B 2 236 ? 8.125   63.086  9.893   1.00 151.60 ? 236  SER B N      1 
ATOM   9765  C  CA     . SER B 2 236 ? 6.966   63.836  9.414   1.00 160.69 ? 236  SER B CA     1 
ATOM   9766  C  C      . SER B 2 236 ? 5.858   63.916  10.462  1.00 158.46 ? 236  SER B C      1 
ATOM   9767  O  O      . SER B 2 236 ? 5.298   64.989  10.690  1.00 158.40 ? 236  SER B O      1 
ATOM   9768  C  CB     . SER B 2 236 ? 6.414   63.198  8.136   1.00 165.09 ? 236  SER B CB     1 
ATOM   9769  O  OG     . SER B 2 236 ? 5.915   61.896  8.392   1.00 152.04 ? 236  SER B OG     1 
ATOM   9770  H  H      . SER B 2 236 ? 8.211   62.294  9.569   1.00 181.92 ? 236  SER B H      1 
ATOM   9771  H  HA     . SER B 2 236 ? 7.243   64.741  9.201   1.00 192.83 ? 236  SER B HA     1 
ATOM   9772  H  HB2    . SER B 2 236 ? 5.693   63.750  7.795   1.00 198.11 ? 236  SER B HB2    1 
ATOM   9773  H  HB3    . SER B 2 236 ? 7.125   63.140  7.480   1.00 198.11 ? 236  SER B HB3    1 
ATOM   9774  H  HG     . SER B 2 236 ? 6.529   61.406  8.688   1.00 182.45 ? 236  SER B HG     1 
ATOM   9775  N  N      . LEU B 2 237 ? 5.531   62.786  11.084  1.00 154.84 ? 237  LEU B N      1 
ATOM   9776  C  CA     . LEU B 2 237 ? 4.437   62.739  12.053  1.00 157.22 ? 237  LEU B CA     1 
ATOM   9777  C  C      . LEU B 2 237 ? 4.697   63.729  13.189  1.00 175.92 ? 237  LEU B C      1 
ATOM   9778  O  O      . LEU B 2 237 ? 5.853   63.993  13.525  1.00 174.01 ? 237  LEU B O      1 
ATOM   9779  C  CB     . LEU B 2 237 ? 4.239   61.322  12.599  1.00 149.18 ? 237  LEU B CB     1 
ATOM   9780  C  CG     . LEU B 2 237 ? 3.594   60.315  11.639  1.00 140.05 ? 237  LEU B CG     1 
ATOM   9781  C  CD1    . LEU B 2 237 ? 3.393   58.978  12.332  1.00 134.91 ? 237  LEU B CD1    1 
ATOM   9782  C  CD2    . LEU B 2 237 ? 2.263   60.821  11.084  1.00 139.26 ? 237  LEU B CD2    1 
ATOM   9783  H  H      . LEU B 2 237 ? 5.926   62.032  10.963  1.00 185.81 ? 237  LEU B H      1 
ATOM   9784  H  HA     . LEU B 2 237 ? 3.615   63.004  11.610  1.00 188.66 ? 237  LEU B HA     1 
ATOM   9785  H  HB2    . LEU B 2 237 ? 5.107   60.967  12.849  1.00 179.01 ? 237  LEU B HB2    1 
ATOM   9786  H  HB3    . LEU B 2 237 ? 3.674   61.374  13.385  1.00 179.01 ? 237  LEU B HB3    1 
ATOM   9787  H  HG     . LEU B 2 237 ? 4.192   60.173  10.888  1.00 168.07 ? 237  LEU B HG     1 
ATOM   9788  H  HD11   . LEU B 2 237 ? 2.814   59.104  13.100  1.00 161.89 ? 237  LEU B HD11   1 
ATOM   9789  H  HD12   . LEU B 2 237 ? 2.985   58.357  11.708  1.00 161.89 ? 237  LEU B HD12   1 
ATOM   9790  H  HD13   . LEU B 2 237 ? 4.255   58.639  12.620  1.00 161.89 ? 237  LEU B HD13   1 
ATOM   9791  H  HD21   . LEU B 2 237 ? 2.416   61.649  10.603  1.00 167.11 ? 237  LEU B HD21   1 
ATOM   9792  H  HD22   . LEU B 2 237 ? 1.896   60.152  10.485  1.00 167.11 ? 237  LEU B HD22   1 
ATOM   9793  H  HD23   . LEU B 2 237 ? 1.652   60.975  11.822  1.00 167.11 ? 237  LEU B HD23   1 
ATOM   9794  N  N      . PRO B 2 238 ? 3.631   64.276  13.796  1.00 180.32 ? 238  PRO B N      1 
ATOM   9795  C  CA     . PRO B 2 238 ? 3.876   65.227  14.884  1.00 168.03 ? 238  PRO B CA     1 
ATOM   9796  C  C      . PRO B 2 238 ? 4.274   64.504  16.176  1.00 153.30 ? 238  PRO B C      1 
ATOM   9797  O  O      . PRO B 2 238 ? 3.608   64.651  17.200  1.00 154.75 ? 238  PRO B O      1 
ATOM   9798  C  CB     . PRO B 2 238 ? 2.530   65.947  15.020  1.00 155.69 ? 238  PRO B CB     1 
ATOM   9799  C  CG     . PRO B 2 238 ? 1.530   64.932  14.593  1.00 153.75 ? 238  PRO B CG     1 
ATOM   9800  C  CD     . PRO B 2 238 ? 2.194   64.148  13.489  1.00 161.11 ? 238  PRO B CD     1 
ATOM   9801  H  HA     . PRO B 2 238 ? 4.565   65.864  14.637  1.00 201.64 ? 238  PRO B HA     1 
ATOM   9802  H  HB2    . PRO B 2 238 ? 2.387   66.207  15.943  1.00 186.83 ? 238  PRO B HB2    1 
ATOM   9803  H  HB3    . PRO B 2 238 ? 2.510   66.720  14.435  1.00 186.83 ? 238  PRO B HB3    1 
ATOM   9804  H  HG2    . PRO B 2 238 ? 1.314   64.353  15.341  1.00 184.50 ? 238  PRO B HG2    1 
ATOM   9805  H  HG3    . PRO B 2 238 ? 0.734   65.378  14.264  1.00 184.50 ? 238  PRO B HG3    1 
ATOM   9806  H  HD2    . PRO B 2 238 ? 1.923   63.217  13.525  1.00 193.33 ? 238  PRO B HD2    1 
ATOM   9807  H  HD3    . PRO B 2 238 ? 1.996   64.543  12.626  1.00 193.33 ? 238  PRO B HD3    1 
ATOM   9808  N  N      . ALA B 2 239 ? 5.361   63.735  16.110  1.00 147.04 ? 239  ALA B N      1 
ATOM   9809  C  CA     . ALA B 2 239 ? 5.906   63.029  17.267  1.00 153.51 ? 239  ALA B CA     1 
ATOM   9810  C  C      . ALA B 2 239 ? 4.879   62.067  17.862  1.00 159.93 ? 239  ALA B C      1 
ATOM   9811  O  O      . ALA B 2 239 ? 4.061   62.459  18.695  1.00 156.84 ? 239  ALA B O      1 
ATOM   9812  C  CB     . ALA B 2 239 ? 6.382   64.023  18.321  1.00 143.50 ? 239  ALA B CB     1 
ATOM   9813  H  H      . ALA B 2 239 ? 5.809   63.604  15.388  1.00 176.45 ? 239  ALA B H      1 
ATOM   9814  H  HA     . ALA B 2 239 ? 6.673   62.507  16.983  1.00 184.21 ? 239  ALA B HA     1 
ATOM   9815  H  HB1    . ALA B 2 239 ? 5.630   64.567  18.604  1.00 172.20 ? 239  ALA B HB1    1 
ATOM   9816  H  HB2    . ALA B 2 239 ? 6.740   63.533  19.078  1.00 172.20 ? 239  ALA B HB2    1 
ATOM   9817  H  HB3    . ALA B 2 239 ? 7.072   64.586  17.936  1.00 172.20 ? 239  ALA B HB3    1 
ATOM   9818  N  N      . VAL B 2 240 ? 4.942   60.801  17.456  1.00 158.83 ? 240  VAL B N      1 
ATOM   9819  C  CA     . VAL B 2 240 ? 4.026   59.799  17.993  1.00 150.12 ? 240  VAL B CA     1 
ATOM   9820  C  C      . VAL B 2 240 ? 4.507   59.294  19.347  1.00 150.94 ? 240  VAL B C      1 
ATOM   9821  O  O      . VAL B 2 240 ? 3.857   58.462  19.977  1.00 143.59 ? 240  VAL B O      1 
ATOM   9822  C  CB     . VAL B 2 240 ? 3.882   58.589  17.047  1.00 143.23 ? 240  VAL B CB     1 
ATOM   9823  C  CG1    . VAL B 2 240 ? 3.182   59.000  15.767  1.00 133.36 ? 240  VAL B CG1    1 
ATOM   9824  C  CG2    . VAL B 2 240 ? 5.242   57.980  16.727  1.00 136.01 ? 240  VAL B CG2    1 
ATOM   9825  H  H      . VAL B 2 240 ? 5.500   60.499  16.875  1.00 190.59 ? 240  VAL B H      1 
ATOM   9826  H  HA     . VAL B 2 240 ? 3.150   60.198  18.112  1.00 180.15 ? 240  VAL B HA     1 
ATOM   9827  H  HB     . VAL B 2 240 ? 3.342   57.910  17.481  1.00 171.88 ? 240  VAL B HB     1 
ATOM   9828  H  HG11   . VAL B 2 240 ? 3.707   59.689  15.329  1.00 160.04 ? 240  VAL B HG11   1 
ATOM   9829  H  HG12   . VAL B 2 240 ? 3.102   58.226  15.189  1.00 160.04 ? 240  VAL B HG12   1 
ATOM   9830  H  HG13   . VAL B 2 240 ? 2.302   59.343  15.985  1.00 160.04 ? 240  VAL B HG13   1 
ATOM   9831  H  HG21   . VAL B 2 240 ? 5.659   57.687  17.552  1.00 163.21 ? 240  VAL B HG21   1 
ATOM   9832  H  HG22   . VAL B 2 240 ? 5.117   57.224  16.132  1.00 163.21 ? 240  VAL B HG22   1 
ATOM   9833  H  HG23   . VAL B 2 240 ? 5.795   58.652  16.297  1.00 163.21 ? 240  VAL B HG23   1 
ATOM   9834  N  N      . GLN B 2 241 ? 5.648   59.809  19.792  1.00 156.07 ? 241  GLN B N      1 
ATOM   9835  C  CA     . GLN B 2 241 ? 6.223   59.421  21.071  1.00 153.06 ? 241  GLN B CA     1 
ATOM   9836  C  C      . GLN B 2 241 ? 5.291   59.909  22.170  1.00 154.34 ? 241  GLN B C      1 
ATOM   9837  O  O      . GLN B 2 241 ? 5.190   59.313  23.244  1.00 145.39 ? 241  GLN B O      1 
ATOM   9838  C  CB     . GLN B 2 241 ? 7.625   60.004  21.241  1.00 155.39 ? 241  GLN B CB     1 
ATOM   9839  C  CG     . GLN B 2 241 ? 8.349   59.538  22.495  1.00 165.57 ? 241  GLN B CG     1 
ATOM   9840  C  CD     . GLN B 2 241 ? 9.738   60.134  22.616  1.00 164.53 ? 241  GLN B CD     1 
ATOM   9841  O  OE1    . GLN B 2 241 ? 10.209  60.825  21.712  1.00 169.50 ? 241  GLN B OE1    1 
ATOM   9842  N  NE2    . GLN B 2 241 ? 10.400  59.872  23.737  1.00 152.77 ? 241  GLN B NE2    1 
ATOM   9843  H  H      . GLN B 2 241 ? 6.113   60.392  19.364  1.00 187.28 ? 241  GLN B H      1 
ATOM   9844  H  HA     . GLN B 2 241 ? 6.281   58.454  21.121  1.00 183.67 ? 241  GLN B HA     1 
ATOM   9845  H  HB2    . GLN B 2 241 ? 8.164   59.746  20.477  1.00 186.47 ? 241  GLN B HB2    1 
ATOM   9846  H  HB3    . GLN B 2 241 ? 7.557   60.971  21.283  1.00 186.47 ? 241  GLN B HB3    1 
ATOM   9847  H  HG2    . GLN B 2 241 ? 7.838   59.805  23.274  1.00 198.68 ? 241  GLN B HG2    1 
ATOM   9848  H  HG3    . GLN B 2 241 ? 8.438   58.572  22.469  1.00 198.68 ? 241  GLN B HG3    1 
ATOM   9849  H  HE21   . GLN B 2 241 ? 10.038  59.386  24.347  1.00 183.32 ? 241  GLN B HE21   1 
ATOM   9850  H  HE22   . GLN B 2 241 ? 11.192  60.189  23.852  1.00 183.32 ? 241  GLN B HE22   1 
ATOM   9851  N  N      . SER B 2 242 ? 4.604   61.006  21.868  1.00 151.76 ? 242  SER B N      1 
ATOM   9852  C  CA     . SER B 2 242 ? 3.791   61.721  22.836  1.00 151.39 ? 242  SER B CA     1 
ATOM   9853  C  C      . SER B 2 242 ? 2.405   61.115  23.037  1.00 142.29 ? 242  SER B C      1 
ATOM   9854  O  O      . SER B 2 242 ? 1.684   61.520  23.948  1.00 145.80 ? 242  SER B O      1 
ATOM   9855  C  CB     . SER B 2 242 ? 3.647   63.178  22.394  1.00 147.26 ? 242  SER B CB     1 
ATOM   9856  O  OG     . SER B 2 242 ? 4.914   63.793  22.243  1.00 159.60 ? 242  SER B OG     1 
ATOM   9857  H  H      . SER B 2 242 ? 4.596   61.363  21.086  1.00 182.12 ? 242  SER B H      1 
ATOM   9858  H  HA     . SER B 2 242 ? 4.245   61.713  23.693  1.00 181.67 ? 242  SER B HA     1 
ATOM   9859  H  HB2    . SER B 2 242 ? 3.180   63.205  21.544  1.00 176.72 ? 242  SER B HB2    1 
ATOM   9860  H  HB3    . SER B 2 242 ? 3.140   63.662  23.065  1.00 176.72 ? 242  SER B HB3    1 
ATOM   9861  H  HG     . SER B 2 242 ? 4.819   64.592  22.001  1.00 191.52 ? 242  SER B HG     1 
ATOM   9862  N  N      . ASP B 2 243 ? 2.031   60.142  22.211  1.00 139.34 ? 243  ASP B N      1 
ATOM   9863  C  CA     . ASP B 2 243 ? 0.710   59.542  22.349  1.00 130.12 ? 243  ASP B CA     1 
ATOM   9864  C  C      . ASP B 2 243 ? 0.676   58.755  23.648  1.00 122.85 ? 243  ASP B C      1 
ATOM   9865  O  O      . ASP B 2 243 ? 1.493   57.860  23.865  1.00 125.67 ? 243  ASP B O      1 
ATOM   9866  C  CB     . ASP B 2 243 ? 0.380   58.634  21.166  1.00 128.09 ? 243  ASP B CB     1 
ATOM   9867  C  CG     . ASP B 2 243 ? -1.113  58.445  20.981  1.00 115.26 ? 243  ASP B CG     1 
ATOM   9868  O  OD1    . ASP B 2 243 ? -1.778  59.401  20.531  1.00 97.31  ? 243  ASP B OD1    1 
ATOM   9869  O  OD2    . ASP B 2 243 ? -1.622  57.351  21.294  1.00 106.48 ? 243  ASP B OD2    1 
ATOM   9870  H  H      . ASP B 2 243 ? 2.512   59.817  21.577  1.00 167.21 ? 243  ASP B H      1 
ATOM   9871  H  HA     . ASP B 2 243 ? 0.041   60.242  22.395  1.00 156.14 ? 243  ASP B HA     1 
ATOM   9872  H  HB2    . ASP B 2 243 ? 0.736   59.028  20.354  1.00 153.71 ? 243  ASP B HB2    1 
ATOM   9873  H  HB3    . ASP B 2 243 ? 0.778   57.762  21.315  1.00 153.71 ? 243  ASP B HB3    1 
ATOM   9874  N  N      . GLU B 2 244 ? -0.273  59.100  24.509  1.00 119.24 ? 244  GLU B N      1 
ATOM   9875  C  CA     . GLU B 2 244 ? -0.365  58.500  25.832  1.00 135.72 ? 244  GLU B CA     1 
ATOM   9876  C  C      . GLU B 2 244 ? -0.636  56.989  25.720  1.00 130.50 ? 244  GLU B C      1 
ATOM   9877  O  O      . GLU B 2 244 ? -0.202  56.207  26.565  1.00 138.89 ? 244  GLU B O      1 
ATOM   9878  C  CB     . GLU B 2 244 ? -1.443  59.220  26.652  1.00 118.33 ? 244  GLU B CB     1 
ATOM   9879  C  CG     . GLU B 2 244 ? -1.483  58.842  28.128  1.00 115.70 ? 244  GLU B CG     1 
ATOM   9880  C  CD     . GLU B 2 244 ? -2.313  57.611  28.430  1.00 125.21 ? 244  GLU B CD     1 
ATOM   9881  O  OE1    . GLU B 2 244 ? -3.070  57.155  27.547  1.00 125.04 ? 244  GLU B OE1    1 
ATOM   9882  O  OE2    . GLU B 2 244 ? -2.213  57.103  29.569  1.00 99.07  ? 244  GLU B OE2    1 
ATOM   9883  H  H      . GLU B 2 244 ? -0.882  59.686  24.349  1.00 143.08 ? 244  GLU B H      1 
ATOM   9884  H  HA     . GLU B 2 244 ? 0.483   58.616  26.289  1.00 162.86 ? 244  GLU B HA     1 
ATOM   9885  H  HB2    . GLU B 2 244 ? -1.285  60.175  26.598  1.00 142.00 ? 244  GLU B HB2    1 
ATOM   9886  H  HB3    . GLU B 2 244 ? -2.311  59.011  26.272  1.00 142.00 ? 244  GLU B HB3    1 
ATOM   9887  H  HG2    . GLU B 2 244 ? -0.577  58.669  28.430  1.00 138.83 ? 244  GLU B HG2    1 
ATOM   9888  H  HG3    . GLU B 2 244 ? -1.859  59.582  28.629  1.00 138.83 ? 244  GLU B HG3    1 
ATOM   9889  N  N      . ARG B 2 245 ? -1.368  56.588  24.682  1.00 116.99 ? 245  ARG B N      1 
ATOM   9890  C  CA     . ARG B 2 245 ? -1.698  55.177  24.456  1.00 119.99 ? 245  ARG B CA     1 
ATOM   9891  C  C      . ARG B 2 245 ? -0.480  54.308  24.120  1.00 118.48 ? 245  ARG B C      1 
ATOM   9892  O  O      . ARG B 2 245 ? -0.541  53.085  24.240  1.00 114.83 ? 245  ARG B O      1 
ATOM   9893  C  CB     . ARG B 2 245 ? -2.738  55.028  23.340  1.00 127.67 ? 245  ARG B CB     1 
ATOM   9894  C  CG     . ARG B 2 245 ? -4.076  55.695  23.624  1.00 118.17 ? 245  ARG B CG     1 
ATOM   9895  C  CD     . ARG B 2 245 ? -4.948  55.748  22.380  1.00 107.51 ? 245  ARG B CD     1 
ATOM   9896  N  NE     . ARG B 2 245 ? -4.394  56.625  21.355  1.00 112.73 ? 245  ARG B NE     1 
ATOM   9897  C  CZ     . ARG B 2 245 ? -4.983  56.884  20.192  1.00 114.57 ? 245  ARG B CZ     1 
ATOM   9898  N  NH1    . ARG B 2 245 ? -6.144  56.319  19.886  1.00 105.98 ? 245  ARG B NH1    1 
ATOM   9899  N  NH2    . ARG B 2 245 ? -4.403  57.701  19.326  1.00 122.99 ? 245  ARG B NH2    1 
ATOM   9900  H  H      . ARG B 2 245 ? -1.690  57.119  24.087  1.00 140.39 ? 245  ARG B H      1 
ATOM   9901  H  HA     . ARG B 2 245 ? -2.091  54.822  25.268  1.00 143.99 ? 245  ARG B HA     1 
ATOM   9902  H  HB2    . ARG B 2 245 ? -2.381  55.421  22.529  1.00 153.20 ? 245  ARG B HB2    1 
ATOM   9903  H  HB3    . ARG B 2 245 ? -2.906  54.083  23.198  1.00 153.20 ? 245  ARG B HB3    1 
ATOM   9904  H  HG2    . ARG B 2 245 ? -4.547  55.190  24.305  1.00 141.80 ? 245  ARG B HG2    1 
ATOM   9905  H  HG3    . ARG B 2 245 ? -3.922  56.604  23.927  1.00 141.80 ? 245  ARG B HG3    1 
ATOM   9906  H  HD2    . ARG B 2 245 ? -5.023  54.856  22.006  1.00 129.01 ? 245  ARG B HD2    1 
ATOM   9907  H  HD3    . ARG B 2 245 ? -5.826  56.083  22.621  1.00 129.01 ? 245  ARG B HD3    1 
ATOM   9908  H  HE     . ARG B 2 245 ? -3.636  57.000  21.514  1.00 135.27 ? 245  ARG B HE     1 
ATOM   9909  H  HH11   . ARG B 2 245 ? -6.525  55.789  20.446  1.00 127.18 ? 245  ARG B HH11   1 
ATOM   9910  H  HH12   . ARG B 2 245 ? -6.519  56.488  19.131  1.00 127.18 ? 245  ARG B HH12   1 
ATOM   9911  H  HH21   . ARG B 2 245 ? -3.648  58.067  19.518  1.00 147.59 ? 245  ARG B HH21   1 
ATOM   9912  H  HH22   . ARG B 2 245 ? -4.780  57.865  18.570  1.00 147.59 ? 245  ARG B HH22   1 
ATOM   9913  N  N      . LEU B 2 246 ? 0.616   54.938  23.699  1.00 126.38 ? 246  LEU B N      1 
ATOM   9914  C  CA     . LEU B 2 246 ? 1.838   54.217  23.329  1.00 133.42 ? 246  LEU B CA     1 
ATOM   9915  C  C      . LEU B 2 246 ? 2.872   54.154  24.454  1.00 142.01 ? 246  LEU B C      1 
ATOM   9916  O  O      . LEU B 2 246 ? 3.955   53.599  24.276  1.00 145.04 ? 246  LEU B O      1 
ATOM   9917  C  CB     . LEU B 2 246 ? 2.481   54.870  22.099  1.00 128.31 ? 246  LEU B CB     1 
ATOM   9918  C  CG     . LEU B 2 246 ? 1.779   54.716  20.747  1.00 126.05 ? 246  LEU B CG     1 
ATOM   9919  C  CD1    . LEU B 2 246 ? 2.614   55.368  19.656  1.00 120.45 ? 246  LEU B CD1    1 
ATOM   9920  C  CD2    . LEU B 2 246 ? 1.508   53.262  20.404  1.00 122.07 ? 246  LEU B CD2    1 
ATOM   9921  H  H      . LEU B 2 246 ? 0.679   55.791  23.618  1.00 151.65 ? 246  LEU B H      1 
ATOM   9922  H  HA     . LEU B 2 246 ? 1.603   53.306  23.093  1.00 160.10 ? 246  LEU B HA     1 
ATOM   9923  H  HB2    . LEU B 2 246 ? 2.554   55.821  22.272  1.00 153.97 ? 246  LEU B HB2    1 
ATOM   9924  H  HB3    . LEU B 2 246 ? 3.371   54.498  21.998  1.00 153.97 ? 246  LEU B HB3    1 
ATOM   9925  H  HG     . LEU B 2 246 ? 0.926   55.177  20.784  1.00 151.26 ? 246  LEU B HG     1 
ATOM   9926  H  HD11   . LEU B 2 246 ? 3.482   54.936  19.622  1.00 144.54 ? 246  LEU B HD11   1 
ATOM   9927  H  HD12   . LEU B 2 246 ? 2.159   55.264  18.806  1.00 144.54 ? 246  LEU B HD12   1 
ATOM   9928  H  HD13   . LEU B 2 246 ? 2.722   56.310  19.861  1.00 144.54 ? 246  LEU B HD13   1 
ATOM   9929  H  HD21   . LEU B 2 246 ? 0.939   52.877  21.089  1.00 146.49 ? 246  LEU B HD21   1 
ATOM   9930  H  HD22   . LEU B 2 246 ? 1.064   53.218  19.543  1.00 146.49 ? 246  LEU B HD22   1 
ATOM   9931  H  HD23   . LEU B 2 246 ? 2.351   52.784  20.367  1.00 146.49 ? 246  LEU B HD23   1 
ATOM   9932  N  N      . GLN B 2 247 ? 2.529   54.695  25.617  1.00 141.01 ? 247  GLN B N      1 
ATOM   9933  C  CA     . GLN B 2 247 ? 3.445   54.712  26.755  1.00 131.14 ? 247  GLN B CA     1 
ATOM   9934  C  C      . GLN B 2 247 ? 3.851   53.318  27.255  1.00 134.74 ? 247  GLN B C      1 
ATOM   9935  O  O      . GLN B 2 247 ? 5.006   53.119  27.629  1.00 138.77 ? 247  GLN B O      1 
ATOM   9936  C  CB     . GLN B 2 247 ? 2.824   55.509  27.904  1.00 131.93 ? 247  GLN B CB     1 
ATOM   9937  C  CG     . GLN B 2 247 ? 2.654   56.989  27.593  1.00 127.06 ? 247  GLN B CG     1 
ATOM   9938  C  CD     . GLN B 2 247 ? 3.966   57.671  27.260  1.00 142.33 ? 247  GLN B CD     1 
ATOM   9939  O  OE1    . GLN B 2 247 ? 5.033   57.230  27.686  1.00 156.12 ? 247  GLN B OE1    1 
ATOM   9940  N  NE2    . GLN B 2 247 ? 3.893   58.749  26.487  1.00 131.61 ? 247  GLN B NE2    1 
ATOM   9941  H  H      . GLN B 2 247 ? 1.767   55.061  25.776  1.00 169.22 ? 247  GLN B H      1 
ATOM   9942  H  HA     . GLN B 2 247 ? 4.256   55.172  26.488  1.00 157.37 ? 247  GLN B HA     1 
ATOM   9943  H  HB2    . GLN B 2 247 ? 1.947   55.144  28.101  1.00 158.31 ? 247  GLN B HB2    1 
ATOM   9944  H  HB3    . GLN B 2 247 ? 3.396   55.432  28.683  1.00 158.31 ? 247  GLN B HB3    1 
ATOM   9945  H  HG2    . GLN B 2 247 ? 2.064   57.086  26.829  1.00 152.48 ? 247  GLN B HG2    1 
ATOM   9946  H  HG3    . GLN B 2 247 ? 2.273   57.433  28.366  1.00 152.48 ? 247  GLN B HG3    1 
ATOM   9947  H  HE21   . GLN B 2 247 ? 3.129   59.024  26.204  1.00 157.94 ? 247  GLN B HE21   1 
ATOM   9948  H  HE22   . GLN B 2 247 ? 4.609   59.172  26.270  1.00 157.94 ? 247  GLN B HE22   1 
ATOM   9949  N  N      . PRO B 2 248 ? 2.919   52.347  27.265  1.00 134.84 ? 248  PRO B N      1 
ATOM   9950  C  CA     . PRO B 2 248 ? 3.317   51.017  27.745  1.00 136.23 ? 248  PRO B CA     1 
ATOM   9951  C  C      . PRO B 2 248 ? 4.069   50.220  26.678  1.00 138.01 ? 248  PRO B C      1 
ATOM   9952  O  O      . PRO B 2 248 ? 4.619   49.159  26.974  1.00 138.01 ? 248  PRO B O      1 
ATOM   9953  C  CB     . PRO B 2 248 ? 1.986   50.353  28.098  1.00 130.78 ? 248  PRO B CB     1 
ATOM   9954  C  CG     . PRO B 2 248 ? 0.984   51.019  27.242  1.00 127.28 ? 248  PRO B CG     1 
ATOM   9955  C  CD     . PRO B 2 248 ? 1.478   52.409  26.954  1.00 132.13 ? 248  PRO B CD     1 
ATOM   9956  H  HA     . PRO B 2 248 ? 3.865   51.092  28.542  1.00 163.47 ? 248  PRO B HA     1 
ATOM   9957  H  HB2    . PRO B 2 248 ? 2.031   49.404  27.900  1.00 156.94 ? 248  PRO B HB2    1 
ATOM   9958  H  HB3    . PRO B 2 248 ? 1.786   50.499  29.036  1.00 156.94 ? 248  PRO B HB3    1 
ATOM   9959  H  HG2    . PRO B 2 248 ? 0.889   50.520  26.415  1.00 152.74 ? 248  PRO B HG2    1 
ATOM   9960  H  HG3    . PRO B 2 248 ? 0.136   51.055  27.711  1.00 152.74 ? 248  PRO B HG3    1 
ATOM   9961  H  HD2    . PRO B 2 248 ? 1.345   52.627  26.019  1.00 158.56 ? 248  PRO B HD2    1 
ATOM   9962  H  HD3    . PRO B 2 248 ? 1.036   53.050  27.534  1.00 158.56 ? 248  PRO B HD3    1 
ATOM   9963  N  N      . LEU B 2 249 ? 4.087   50.740  25.455  1.00 137.26 ? 249  LEU B N      1 
ATOM   9964  C  CA     . LEU B 2 249 ? 4.765   50.097  24.332  1.00 136.72 ? 249  LEU B CA     1 
ATOM   9965  C  C      . LEU B 2 249 ? 6.173   50.655  24.152  1.00 137.81 ? 249  LEU B C      1 
ATOM   9966  O  O      . LEU B 2 249 ? 7.070   49.954  23.685  1.00 142.60 ? 249  LEU B O      1 
ATOM   9967  C  CB     . LEU B 2 249 ? 3.966   50.268  23.038  1.00 146.19 ? 249  LEU B CB     1 
ATOM   9968  C  CG     . LEU B 2 249 ? 4.736   49.919  21.758  1.00 142.66 ? 249  LEU B CG     1 
ATOM   9969  C  CD1    . LEU B 2 249 ? 5.032   48.436  21.738  1.00 124.25 ? 249  LEU B CD1    1 
ATOM   9970  C  CD2    . LEU B 2 249 ? 3.953   50.324  20.528  1.00 124.40 ? 249  LEU B CD2    1 
ATOM   9971  H  H      . LEU B 2 249 ? 3.705   51.481  25.245  1.00 164.71 ? 249  LEU B H      1 
ATOM   9972  H  HA     . LEU B 2 249 ? 4.841   49.147  24.513  1.00 164.07 ? 249  LEU B HA     1 
ATOM   9973  H  HB2    . LEU B 2 249 ? 3.186   49.692  23.077  1.00 175.42 ? 249  LEU B HB2    1 
ATOM   9974  H  HB3    . LEU B 2 249 ? 3.684   51.193  22.968  1.00 175.42 ? 249  LEU B HB3    1 
ATOM   9975  H  HG     . LEU B 2 249 ? 5.580   50.397  21.752  1.00 171.19 ? 249  LEU B HG     1 
ATOM   9976  H  HD11   . LEU B 2 249 ? 4.194   47.947  21.760  1.00 149.10 ? 249  LEU B HD11   1 
ATOM   9977  H  HD12   . LEU B 2 249 ? 5.519   48.222  20.927  1.00 149.10 ? 249  LEU B HD12   1 
ATOM   9978  H  HD13   . LEU B 2 249 ? 5.567   48.211  22.515  1.00 149.10 ? 249  LEU B HD13   1 
ATOM   9979  H  HD21   . LEU B 2 249 ? 3.799   51.282  20.554  1.00 149.28 ? 249  LEU B HD21   1 
ATOM   9980  H  HD22   . LEU B 2 249 ? 4.465   50.092  19.738  1.00 149.28 ? 249  LEU B HD22   1 
ATOM   9981  H  HD23   . LEU B 2 249 ? 3.105   49.853  20.525  1.00 149.28 ? 249  LEU B HD23   1 
ATOM   9982  N  N      . LEU B 2 250 ? 6.367   51.910  24.537  1.00 130.24 ? 250  LEU B N      1 
ATOM   9983  C  CA     . LEU B 2 250 ? 7.635   52.598  24.320  1.00 134.68 ? 250  LEU B CA     1 
ATOM   9984  C  C      . LEU B 2 250 ? 8.624   52.256  25.429  1.00 139.85 ? 250  LEU B C      1 
ATOM   9985  O  O      . LEU B 2 250 ? 9.837   52.324  25.228  1.00 140.73 ? 250  LEU B O      1 
ATOM   9986  C  CB     . LEU B 2 250 ? 7.424   54.114  24.239  1.00 131.33 ? 250  LEU B CB     1 
ATOM   9987  C  CG     . LEU B 2 250 ? 6.713   54.654  22.993  1.00 131.06 ? 250  LEU B CG     1 
ATOM   9988  C  CD1    . LEU B 2 250 ? 6.612   56.170  23.055  1.00 134.13 ? 250  LEU B CD1    1 
ATOM   9989  C  CD2    . LEU B 2 250 ? 7.415   54.225  21.711  1.00 124.96 ? 250  LEU B CD2    1 
ATOM   9990  H  H      . LEU B 2 250 ? 5.773   52.392  24.931  1.00 156.29 ? 250  LEU B H      1 
ATOM   9991  H  HA     . LEU B 2 250 ? 8.014   52.303  23.477  1.00 161.62 ? 250  LEU B HA     1 
ATOM   9992  H  HB2    . LEU B 2 250 ? 6.899   54.387  25.008  1.00 157.60 ? 250  LEU B HB2    1 
ATOM   9993  H  HB3    . LEU B 2 250 ? 8.294   54.542  24.279  1.00 157.60 ? 250  LEU B HB3    1 
ATOM   9994  H  HG     . LEU B 2 250 ? 5.811   54.297  22.969  1.00 157.27 ? 250  LEU B HG     1 
ATOM   9995  H  HD11   . LEU B 2 250 ? 7.506   56.544  23.101  1.00 160.96 ? 250  LEU B HD11   1 
ATOM   9996  H  HD12   . LEU B 2 250 ? 6.159   56.489  22.259  1.00 160.96 ? 250  LEU B HD12   1 
ATOM   9997  H  HD13   . LEU B 2 250 ? 6.107   56.420  23.845  1.00 160.96 ? 250  LEU B HD13   1 
ATOM   9998  H  HD21   . LEU B 2 250 ? 7.425   53.257  21.666  1.00 149.95 ? 250  LEU B HD21   1 
ATOM   9999  H  HD22   . LEU B 2 250 ? 6.932   54.588  20.952  1.00 149.95 ? 250  LEU B HD22   1 
ATOM   10000 H  HD23   . LEU B 2 250 ? 8.323   54.566  21.720  1.00 149.95 ? 250  LEU B HD23   1 
ATOM   10001 N  N      . ASN B 2 251 ? 8.107   51.894  26.597  1.00 140.95 ? 251  ASN B N      1 
ATOM   10002 C  CA     . ASN B 2 251 ? 8.955   51.531  27.726  1.00 144.88 ? 251  ASN B CA     1 
ATOM   10003 C  C      . ASN B 2 251 ? 9.272   50.034  27.731  1.00 136.91 ? 251  ASN B C      1 
ATOM   10004 O  O      . ASN B 2 251 ? 10.356  49.625  28.146  1.00 137.28 ? 251  ASN B O      1 
ATOM   10005 C  CB     . ASN B 2 251 ? 8.283   51.930  29.041  1.00 151.09 ? 251  ASN B CB     1 
ATOM   10006 C  CG     . ASN B 2 251 ? 8.029   53.423  29.135  1.00 159.04 ? 251  ASN B CG     1 
ATOM   10007 O  OD1    . ASN B 2 251 ? 8.670   54.218  28.447  1.00 162.26 ? 251  ASN B OD1    1 
ATOM   10008 N  ND2    . ASN B 2 251 ? 7.094   53.813  29.994  1.00 159.40 ? 251  ASN B ND2    1 
ATOM   10009 H  H      . ASN B 2 251 ? 7.264   51.851  26.763  1.00 169.14 ? 251  ASN B H      1 
ATOM   10010 H  HA     . ASN B 2 251 ? 9.793   52.015  27.660  1.00 173.85 ? 251  ASN B HA     1 
ATOM   10011 H  HB2    . ASN B 2 251 ? 7.429   51.475  29.111  1.00 181.30 ? 251  ASN B HB2    1 
ATOM   10012 H  HB3    . ASN B 2 251 ? 8.857   51.676  29.780  1.00 181.30 ? 251  ASN B HB3    1 
ATOM   10013 H  HD21   . ASN B 2 251 ? 6.668   53.229  30.461  1.00 191.27 ? 251  ASN B HD21   1 
ATOM   10014 H  HD22   . ASN B 2 251 ? 6.914   54.649  30.083  1.00 191.27 ? 251  ASN B HD22   1 
ATOM   10015 N  N      . HIS B 2 252 ? 8.325   49.222  27.270  1.00 137.17 ? 252  HIS B N      1 
ATOM   10016 C  CA     . HIS B 2 252 ? 8.500   47.769  27.219  1.00 144.02 ? 252  HIS B CA     1 
ATOM   10017 C  C      . HIS B 2 252 ? 9.559   47.330  26.189  1.00 141.66 ? 252  HIS B C      1 
ATOM   10018 O  O      . HIS B 2 252 ? 9.881   46.145  26.090  1.00 141.09 ? 252  HIS B O      1 
ATOM   10019 C  CB     . HIS B 2 252 ? 7.150   47.102  26.914  1.00 135.94 ? 252  HIS B CB     1 
ATOM   10020 C  CG     . HIS B 2 252 ? 7.200   45.604  26.884  1.00 136.08 ? 252  HIS B CG     1 
ATOM   10021 N  ND1    . HIS B 2 252 ? 7.599   44.851  27.967  1.00 144.46 ? 252  HIS B ND1    1 
ATOM   10022 C  CD2    . HIS B 2 252 ? 6.895   44.721  25.904  1.00 138.14 ? 252  HIS B CD2    1 
ATOM   10023 C  CE1    . HIS B 2 252 ? 7.541   43.568  27.655  1.00 146.88 ? 252  HIS B CE1    1 
ATOM   10024 N  NE2    . HIS B 2 252 ? 7.116   43.462  26.409  1.00 140.17 ? 252  HIS B NE2    1 
ATOM   10025 H  H      . HIS B 2 252 ? 7.562   49.490  26.977  1.00 164.60 ? 252  HIS B H      1 
ATOM   10026 H  HA     . HIS B 2 252 ? 8.791   47.461  28.092  1.00 172.83 ? 252  HIS B HA     1 
ATOM   10027 H  HB2    . HIS B 2 252 ? 6.512   47.363  27.597  1.00 163.13 ? 252  HIS B HB2    1 
ATOM   10028 H  HB3    . HIS B 2 252 ? 6.843   47.404  26.045  1.00 163.13 ? 252  HIS B HB3    1 
ATOM   10029 H  HD1    . HIS B 2 252 ? 7.849   45.166  28.727  1.00 173.35 ? 252  HIS B HD1    1 
ATOM   10030 H  HD2    . HIS B 2 252 ? 6.593   44.927  25.049  1.00 165.77 ? 252  HIS B HD2    1 
ATOM   10031 H  HE1    . HIS B 2 252 ? 7.761   42.861  28.217  1.00 176.26 ? 252  HIS B HE1    1 
ATOM   10032 H  HE2    . HIS B 2 252 ? 6.998   42.725  25.983  1.00 168.21 ? 252  HIS B HE2    1 
ATOM   10033 N  N      . LEU B 2 253 ? 10.108  48.280  25.433  1.00 139.96 ? 253  LEU B N      1 
ATOM   10034 C  CA     . LEU B 2 253 ? 11.090  47.960  24.396  1.00 130.26 ? 253  LEU B CA     1 
ATOM   10035 C  C      . LEU B 2 253 ? 12.334  47.287  24.970  1.00 136.30 ? 253  LEU B C      1 
ATOM   10036 O  O      . LEU B 2 253 ? 13.059  46.597  24.252  1.00 134.27 ? 253  LEU B O      1 
ATOM   10037 C  CB     . LEU B 2 253 ? 11.505  49.223  23.636  1.00 126.24 ? 253  LEU B CB     1 
ATOM   10038 C  CG     . LEU B 2 253 ? 10.405  50.012  22.922  1.00 116.91 ? 253  LEU B CG     1 
ATOM   10039 C  CD1    . LEU B 2 253 ? 11.018  51.130  22.089  1.00 97.62  ? 253  LEU B CD1    1 
ATOM   10040 C  CD2    . LEU B 2 253 ? 9.554   49.106  22.053  1.00 117.58 ? 253  LEU B CD2    1 
ATOM   10041 O  OXT    . LEU B 2 253 ? 12.645  47.415  26.153  1.00 145.97 ? 253  LEU B OXT    1 
ATOM   10042 H  H      . LEU B 2 253 ? 9.928   49.118  25.500  1.00 167.96 ? 253  LEU B H      1 
ATOM   10043 H  HA     . LEU B 2 253 ? 10.687  47.348  23.761  1.00 156.31 ? 253  LEU B HA     1 
ATOM   10044 H  HB2    . LEU B 2 253 ? 11.924  49.829  24.266  1.00 151.49 ? 253  LEU B HB2    1 
ATOM   10045 H  HB3    . LEU B 2 253 ? 12.153  48.967  22.961  1.00 151.49 ? 253  LEU B HB3    1 
ATOM   10046 H  HG     . LEU B 2 253 ? 9.826   50.418  23.587  1.00 140.30 ? 253  LEU B HG     1 
ATOM   10047 H  HD11   . LEU B 2 253 ? 11.614  50.741  21.430  1.00 117.14 ? 253  LEU B HD11   1 
ATOM   10048 H  HD12   . LEU B 2 253 ? 10.307  51.618  21.645  1.00 117.14 ? 253  LEU B HD12   1 
ATOM   10049 H  HD13   . LEU B 2 253 ? 11.513  51.724  22.674  1.00 117.14 ? 253  LEU B HD13   1 
ATOM   10050 H  HD21   . LEU B 2 253 ? 9.141   48.430  22.613  1.00 141.10 ? 253  LEU B HD21   1 
ATOM   10051 H  HD22   . LEU B 2 253 ? 8.870   49.639  21.618  1.00 141.10 ? 253  LEU B HD22   1 
ATOM   10052 H  HD23   . LEU B 2 253 ? 10.120  48.686  21.387  1.00 141.10 ? 253  LEU B HD23   1 
ATOM   10053 N  N      . PHE C 1 7   ? -15.296 48.602  60.577  1.00 144.97 ? 4    PHE C N      1 
ATOM   10054 C  CA     . PHE C 1 7   ? -15.885 48.736  59.249  1.00 147.44 ? 4    PHE C CA     1 
ATOM   10055 C  C      . PHE C 1 7   ? -15.920 47.389  58.529  1.00 155.26 ? 4    PHE C C      1 
ATOM   10056 O  O      . PHE C 1 7   ? -14.957 46.624  58.582  1.00 156.23 ? 4    PHE C O      1 
ATOM   10057 C  CB     . PHE C 1 7   ? -15.110 49.757  58.414  1.00 147.87 ? 4    PHE C CB     1 
ATOM   10058 C  CG     . PHE C 1 7   ? -15.574 49.847  56.990  1.00 147.17 ? 4    PHE C CG     1 
ATOM   10059 C  CD1    . PHE C 1 7   ? -16.747 50.513  56.671  1.00 147.65 ? 4    PHE C CD1    1 
ATOM   10060 C  CD2    . PHE C 1 7   ? -14.844 49.260  55.970  1.00 143.37 ? 4    PHE C CD2    1 
ATOM   10061 C  CE1    . PHE C 1 7   ? -17.180 50.594  55.363  1.00 148.31 ? 4    PHE C CE1    1 
ATOM   10062 C  CE2    . PHE C 1 7   ? -15.272 49.338  54.659  1.00 138.08 ? 4    PHE C CE2    1 
ATOM   10063 C  CZ     . PHE C 1 7   ? -16.442 50.006  54.355  1.00 146.96 ? 4    PHE C CZ     1 
ATOM   10064 H  HA     . PHE C 1 7   ? -16.797 49.052  59.339  1.00 176.93 ? 4    PHE C HA     1 
ATOM   10065 H  HB2    . PHE C 1 7   ? -15.215 50.634  58.816  1.00 177.45 ? 4    PHE C HB2    1 
ATOM   10066 H  HB3    . PHE C 1 7   ? -14.173 49.509  58.406  1.00 177.45 ? 4    PHE C HB3    1 
ATOM   10067 H  HD1    . PHE C 1 7   ? -17.248 50.910  57.347  1.00 177.18 ? 4    PHE C HD1    1 
ATOM   10068 H  HD2    . PHE C 1 7   ? -14.055 48.809  56.170  1.00 172.05 ? 4    PHE C HD2    1 
ATOM   10069 H  HE1    . PHE C 1 7   ? -17.968 51.045  55.160  1.00 177.98 ? 4    PHE C HE1    1 
ATOM   10070 H  HE2    . PHE C 1 7   ? -14.772 48.942  53.982  1.00 165.70 ? 4    PHE C HE2    1 
ATOM   10071 H  HZ     . PHE C 1 7   ? -16.731 50.061  53.473  1.00 176.36 ? 4    PHE C HZ     1 
ATOM   10072 N  N      . ASP C 1 8   ? -17.036 47.112  57.858  1.00 165.08 ? 5    ASP C N      1 
ATOM   10073 C  CA     . ASP C 1 8   ? -17.245 45.844  57.159  1.00 167.22 ? 5    ASP C CA     1 
ATOM   10074 C  C      . ASP C 1 8   ? -17.270 46.048  55.640  1.00 166.49 ? 5    ASP C C      1 
ATOM   10075 O  O      . ASP C 1 8   ? -18.161 46.726  55.128  1.00 161.93 ? 5    ASP C O      1 
ATOM   10076 C  CB     . ASP C 1 8   ? -18.555 45.190  57.611  1.00 171.19 ? 5    ASP C CB     1 
ATOM   10077 C  CG     . ASP C 1 8   ? -18.496 44.674  59.041  1.00 181.11 ? 5    ASP C CG     1 
ATOM   10078 O  OD1    . ASP C 1 8   ? -17.381 44.444  59.554  1.00 177.92 ? 5    ASP C OD1    1 
ATOM   10079 O  OD2    . ASP C 1 8   ? -19.572 44.489  59.649  1.00 174.60 ? 5    ASP C OD2    1 
ATOM   10080 H  H      . ASP C 1 8   ? -17.701 47.654  57.791  1.00 198.10 ? 5    ASP C H      1 
ATOM   10081 H  HA     . ASP C 1 8   ? -16.516 45.240  57.371  1.00 200.66 ? 5    ASP C HA     1 
ATOM   10082 H  HB2    . ASP C 1 8   ? -19.269 45.844  57.558  1.00 205.43 ? 5    ASP C HB2    1 
ATOM   10083 H  HB3    . ASP C 1 8   ? -18.749 44.438  57.030  1.00 205.43 ? 5    ASP C HB3    1 
ATOM   10084 N  N      . PRO C 1 9   ? -16.296 45.465  54.910  1.00 170.57 ? 6    PRO C N      1 
ATOM   10085 C  CA     . PRO C 1 9   ? -16.237 45.659  53.452  1.00 171.82 ? 6    PRO C CA     1 
ATOM   10086 C  C      . PRO C 1 9   ? -17.366 44.970  52.682  1.00 167.56 ? 6    PRO C C      1 
ATOM   10087 O  O      . PRO C 1 9   ? -17.386 45.030  51.452  1.00 159.39 ? 6    PRO C O      1 
ATOM   10088 C  CB     . PRO C 1 9   ? -14.887 45.038  53.066  1.00 159.85 ? 6    PRO C CB     1 
ATOM   10089 C  CG     . PRO C 1 9   ? -14.107 44.979  54.324  1.00 156.83 ? 6    PRO C CG     1 
ATOM   10090 C  CD     . PRO C 1 9   ? -15.108 44.743  55.400  1.00 159.86 ? 6    PRO C CD     1 
ATOM   10091 H  HA     . PRO C 1 9   ? -16.230 46.605  53.237  1.00 206.18 ? 6    PRO C HA     1 
ATOM   10092 H  HB2    . PRO C 1 9   ? -15.027 44.147  52.709  1.00 191.82 ? 6    PRO C HB2    1 
ATOM   10093 H  HB3    . PRO C 1 9   ? -14.442 45.603  52.414  1.00 191.82 ? 6    PRO C HB3    1 
ATOM   10094 H  HG2    . PRO C 1 9   ? -13.473 44.246  54.280  1.00 188.20 ? 6    PRO C HG2    1 
ATOM   10095 H  HG3    . PRO C 1 9   ? -13.648 45.822  54.463  1.00 188.20 ? 6    PRO C HG3    1 
ATOM   10096 H  HD2    . PRO C 1 9   ? -15.298 43.796  55.486  1.00 191.84 ? 6    PRO C HD2    1 
ATOM   10097 H  HD3    . PRO C 1 9   ? -14.802 45.123  56.238  1.00 191.84 ? 6    PRO C HD3    1 
ATOM   10098 N  N      . THR C 1 10  ? -18.285 44.328  53.397  1.00 170.72 ? 7    THR C N      1 
ATOM   10099 C  CA     . THR C 1 10  ? -19.410 43.638  52.778  1.00 159.14 ? 7    THR C CA     1 
ATOM   10100 C  C      . THR C 1 10  ? -20.624 44.559  52.694  1.00 150.92 ? 7    THR C C      1 
ATOM   10101 O  O      . THR C 1 10  ? -21.523 44.338  51.885  1.00 146.48 ? 7    THR C O      1 
ATOM   10102 C  CB     . THR C 1 10  ? -19.786 42.369  53.556  1.00 168.18 ? 7    THR C CB     1 
ATOM   10103 O  OG1    . THR C 1 10  ? -19.828 42.661  54.959  1.00 166.94 ? 7    THR C OG1    1 
ATOM   10104 C  CG2    . THR C 1 10  ? -18.767 41.268  53.298  1.00 162.68 ? 7    THR C CG2    1 
ATOM   10105 H  H      . THR C 1 10  ? -18.278 44.278  54.256  1.00 204.87 ? 7    THR C H      1 
ATOM   10106 H  HA     . THR C 1 10  ? -19.166 43.378  51.876  1.00 190.97 ? 7    THR C HA     1 
ATOM   10107 H  HB     . THR C 1 10  ? -20.657 42.057  53.265  1.00 201.82 ? 7    THR C HB     1 
ATOM   10108 H  HG1    . THR C 1 10  ? -20.033 41.970  55.390  1.00 200.33 ? 7    THR C HG1    1 
ATOM   10109 H  HG21   . THR C 1 10  ? -17.886 41.558  53.581  1.00 195.22 ? 7    THR C HG21   1 
ATOM   10110 H  HG22   . THR C 1 10  ? -19.010 40.469  53.792  1.00 195.22 ? 7    THR C HG22   1 
ATOM   10111 H  HG23   . THR C 1 10  ? -18.740 41.057  52.351  1.00 195.22 ? 7    THR C HG23   1 
ATOM   10112 N  N      . GLU C 1 11  ? -20.652 45.580  53.546  1.00 160.43 ? 8    GLU C N      1 
ATOM   10113 C  CA     . GLU C 1 11  ? -21.684 46.611  53.475  1.00 162.95 ? 8    GLU C CA     1 
ATOM   10114 C  C      . GLU C 1 11  ? -21.415 47.579  52.327  1.00 157.46 ? 8    GLU C C      1 
ATOM   10115 O  O      . GLU C 1 11  ? -22.235 48.448  52.029  1.00 153.55 ? 8    GLU C O      1 
ATOM   10116 C  CB     . GLU C 1 11  ? -21.749 47.406  54.780  1.00 166.31 ? 8    GLU C CB     1 
ATOM   10117 C  CG     . GLU C 1 11  ? -22.095 46.605  56.018  1.00 160.68 ? 8    GLU C CG     1 
ATOM   10118 C  CD     . GLU C 1 11  ? -22.113 47.468  57.267  1.00 161.49 ? 8    GLU C CD     1 
ATOM   10119 O  OE1    . GLU C 1 11  ? -21.552 48.584  57.231  1.00 144.55 ? 8    GLU C OE1    1 
ATOM   10120 O  OE2    . GLU C 1 11  ? -22.691 47.033  58.284  1.00 167.31 ? 8    GLU C OE2    1 
ATOM   10121 H  H      . GLU C 1 11  ? -20.082 45.700  54.178  1.00 192.51 ? 8    GLU C H      1 
ATOM   10122 H  HA     . GLU C 1 11  ? -22.547 46.193  53.327  1.00 195.54 ? 8    GLU C HA     1 
ATOM   10123 H  HB2    . GLU C 1 11  ? -20.883 47.816  54.932  1.00 199.57 ? 8    GLU C HB2    1 
ATOM   10124 H  HB3    . GLU C 1 11  ? -22.421 48.098  54.684  1.00 199.57 ? 8    GLU C HB3    1 
ATOM   10125 H  HG2    . GLU C 1 11  ? -22.976 46.213  55.908  1.00 192.82 ? 8    GLU C HG2    1 
ATOM   10126 H  HG3    . GLU C 1 11  ? -21.432 45.907  56.142  1.00 192.82 ? 8    GLU C HG3    1 
ATOM   10127 N  N      . LEU C 1 12  ? -20.257 47.426  51.695  1.00 153.75 ? 9    LEU C N      1 
ATOM   10128 C  CA     . LEU C 1 12  ? -19.780 48.388  50.708  1.00 155.35 ? 9    LEU C CA     1 
ATOM   10129 C  C      . LEU C 1 12  ? -20.724 48.631  49.528  1.00 153.91 ? 9    LEU C C      1 
ATOM   10130 O  O      . LEU C 1 12  ? -21.027 49.781  49.215  1.00 150.17 ? 9    LEU C O      1 
ATOM   10131 C  CB     . LEU C 1 12  ? -18.415 47.936  50.180  1.00 159.64 ? 9    LEU C CB     1 
ATOM   10132 C  CG     . LEU C 1 12  ? -17.558 48.968  49.443  1.00 160.58 ? 9    LEU C CG     1 
ATOM   10133 C  CD1    . LEU C 1 12  ? -17.442 50.284  50.207  1.00 147.04 ? 9    LEU C CD1    1 
ATOM   10134 C  CD2    . LEU C 1 12  ? -16.180 48.382  49.183  1.00 159.36 ? 9    LEU C CD2    1 
ATOM   10135 H  H      . LEU C 1 12  ? -19.722 46.765  51.821  1.00 184.50 ? 9    LEU C H      1 
ATOM   10136 H  HA     . LEU C 1 12  ? -19.650 49.240  51.153  1.00 186.42 ? 9    LEU C HA     1 
ATOM   10137 H  HB2    . LEU C 1 12  ? -17.892 47.620  50.934  1.00 191.57 ? 9    LEU C HB2    1 
ATOM   10138 H  HB3    . LEU C 1 12  ? -18.561 47.199  49.566  1.00 191.57 ? 9    LEU C HB3    1 
ATOM   10139 H  HG     . LEU C 1 12  ? -17.966 49.158  48.585  1.00 192.70 ? 9    LEU C HG     1 
ATOM   10140 H  HD11   . LEU C 1 12  ? -17.034 50.113  51.070  1.00 176.45 ? 9    LEU C HD11   1 
ATOM   10141 H  HD12   . LEU C 1 12  ? -16.891 50.897  49.696  1.00 176.45 ? 9    LEU C HD12   1 
ATOM   10142 H  HD13   . LEU C 1 12  ? -18.329 50.657  50.328  1.00 176.45 ? 9    LEU C HD13   1 
ATOM   10143 H  HD21   . LEU C 1 12  ? -16.275 47.584  48.640  1.00 191.24 ? 9    LEU C HD21   1 
ATOM   10144 H  HD22   . LEU C 1 12  ? -15.641 49.039  48.717  1.00 191.24 ? 9    LEU C HD22   1 
ATOM   10145 H  HD23   . LEU C 1 12  ? -15.768 48.157  50.032  1.00 191.24 ? 9    LEU C HD23   1 
ATOM   10146 N  N      . PRO C 1 13  ? -21.209 47.560  48.875  1.00 156.49 ? 10   PRO C N      1 
ATOM   10147 C  CA     . PRO C 1 13  ? -22.047 47.803  47.694  1.00 150.46 ? 10   PRO C CA     1 
ATOM   10148 C  C      . PRO C 1 13  ? -23.364 48.515  47.997  1.00 159.66 ? 10   PRO C C      1 
ATOM   10149 O  O      . PRO C 1 13  ? -23.898 49.184  47.115  1.00 153.82 ? 10   PRO C O      1 
ATOM   10150 C  CB     . PRO C 1 13  ? -22.308 46.393  47.152  1.00 137.57 ? 10   PRO C CB     1 
ATOM   10151 C  CG     . PRO C 1 13  ? -22.097 45.488  48.307  1.00 148.15 ? 10   PRO C CG     1 
ATOM   10152 C  CD     . PRO C 1 13  ? -21.021 46.121  49.127  1.00 159.40 ? 10   PRO C CD     1 
ATOM   10153 H  HA     . PRO C 1 13  ? -21.554 48.313  47.032  1.00 180.55 ? 10   PRO C HA     1 
ATOM   10154 H  HB2    . PRO C 1 13  ? -23.221 46.330  46.830  1.00 165.09 ? 10   PRO C HB2    1 
ATOM   10155 H  HB3    . PRO C 1 13  ? -21.679 46.194  46.441  1.00 165.09 ? 10   PRO C HB3    1 
ATOM   10156 H  HG2    . PRO C 1 13  ? -22.918 45.416  48.818  1.00 177.78 ? 10   PRO C HG2    1 
ATOM   10157 H  HG3    . PRO C 1 13  ? -21.815 44.616  47.989  1.00 177.78 ? 10   PRO C HG3    1 
ATOM   10158 H  HD2    . PRO C 1 13  ? -21.151 45.922  50.068  1.00 191.28 ? 10   PRO C HD2    1 
ATOM   10159 H  HD3    . PRO C 1 13  ? -20.147 45.835  48.819  1.00 191.28 ? 10   PRO C HD3    1 
ATOM   10160 N  N      . GLU C 1 14  ? -23.877 48.380  49.216  1.00 163.20 ? 11   GLU C N      1 
ATOM   10161 C  CA     . GLU C 1 14  ? -25.110 49.062  49.597  1.00 165.07 ? 11   GLU C CA     1 
ATOM   10162 C  C      . GLU C 1 14  ? -24.847 50.512  49.984  1.00 167.02 ? 11   GLU C C      1 
ATOM   10163 O  O      . GLU C 1 14  ? -25.586 51.415  49.589  1.00 158.65 ? 11   GLU C O      1 
ATOM   10164 C  CB     . GLU C 1 14  ? -25.794 48.337  50.756  1.00 162.31 ? 11   GLU C CB     1 
ATOM   10165 C  CG     . GLU C 1 14  ? -26.151 46.892  50.460  1.00 168.78 ? 11   GLU C CG     1 
ATOM   10166 C  CD     . GLU C 1 14  ? -26.848 46.215  51.624  1.00 177.84 ? 11   GLU C CD     1 
ATOM   10167 O  OE1    . GLU C 1 14  ? -26.525 46.543  52.785  1.00 181.37 ? 11   GLU C OE1    1 
ATOM   10168 O  OE2    . GLU C 1 14  ? -27.722 45.358  51.378  1.00 175.34 ? 11   GLU C OE2    1 
ATOM   10169 H  H      . GLU C 1 14  ? -23.531 47.900  49.840  1.00 195.84 ? 11   GLU C H      1 
ATOM   10170 H  HA     . GLU C 1 14  ? -25.718 49.060  48.841  1.00 198.09 ? 11   GLU C HA     1 
ATOM   10171 H  HB2    . GLU C 1 14  ? -25.199 48.343  51.522  1.00 194.78 ? 11   GLU C HB2    1 
ATOM   10172 H  HB3    . GLU C 1 14  ? -26.615 48.805  50.975  1.00 194.78 ? 11   GLU C HB3    1 
ATOM   10173 H  HG2    . GLU C 1 14  ? -26.748 46.864  49.695  1.00 202.53 ? 11   GLU C HG2    1 
ATOM   10174 H  HG3    . GLU C 1 14  ? -25.339 46.399  50.267  1.00 202.53 ? 11   GLU C HG3    1 
ATOM   10175 N  N      . LEU C 1 15  ? -23.790 50.727  50.760  1.00 165.89 ? 12   LEU C N      1 
ATOM   10176 C  CA     . LEU C 1 15  ? -23.418 52.065  51.198  1.00 159.84 ? 12   LEU C CA     1 
ATOM   10177 C  C      . LEU C 1 15  ? -23.025 52.959  50.031  1.00 164.11 ? 12   LEU C C      1 
ATOM   10178 O  O      . LEU C 1 15  ? -23.331 54.152  50.021  1.00 160.92 ? 12   LEU C O      1 
ATOM   10179 C  CB     . LEU C 1 15  ? -22.265 51.984  52.197  1.00 149.30 ? 12   LEU C CB     1 
ATOM   10180 C  CG     . LEU C 1 15  ? -22.644 51.428  53.568  1.00 148.69 ? 12   LEU C CG     1 
ATOM   10181 C  CD1    . LEU C 1 15  ? -21.409 50.998  54.343  1.00 157.77 ? 12   LEU C CD1    1 
ATOM   10182 C  CD2    . LEU C 1 15  ?